3RTQD

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD02
1ZA3A 2UZXB 3MROB 4XCCH 5J57B 1OB1A 1IC4L 2KBGA 2EEDA 1B2WH 1IKNC 4JY6A 2UWEE 2VLKA 3SKMA 4MDIA 1U36A 4R26L 4UDUA 1KPUB 4P5MB 1CDYA 3P4LA 3C6SB 1RVFH 4AMKL 1CD9B 5E9DB 3MPCA 3VFPA 4HKBA 5EULV 2NTSP 2PO6D 3MUJA 3CPLA 4P23B 3ARGD 3RY6C 3ZKMD 2BXYA 1BQLL 4BFBD 4HJJL 1JI1A 5FKAA 3QDGA 2AABL 5F7EH 1NFIA 2GY7B 2CDFA 2VZSA 1LO5B 5D70H 4AEFA 3CDGB 1J1OL 4BFIB 4MNGA 3QUKB 1XF5A 4IIQB 1DBBH 4AK1A 3VFOA 4L3CA 3MV7E 4MA3B 4MD5A 3TBYB 4HLZG 4YDKL 1ZHLB 1A5FH 3LN9A 3G9VA 2WQRA 4RMVA 5GS1A 2BCKA 2FR4B 4YAQA 4YFLF 2JB5L 4I0PC 5SX4I 3QUZC 1QFUL 4JM2D 4JLRB 5EU5B 1XEDA 2QQNH 4L8BB 2VNCA 2C4FU 2N56A 4KMTL 2E7MA 1BWMA 4QGTA 3V5HA 2WIMA 3JBG7 1C7SA 1D7FA 3QIBA 2XXMB 3H7BB 3LVEA 3TA3D 5KJRH 3U6RA 4WWKD 3W5MA 1V8HA 2R23B 4KKCD 1B4RA 3M17A 5HHVH 4U1IB 3TBTA 1KJ2L 1TZHB 3GIZL 2P5EE 2HFTA 5HYJE 1DEDA 4ZS6D 5C3LD 1OAXH 4XHJC 1AO7B 4HHAB 2D0HA 2NY2C 2P8MB 1N59A 3NIGF 4IMKA 1EJOH 4WJ5B 4GRLD 4ZDHA 1BEYL 3SY0A 1I3VA 5JIIA 3OR7B 1NAML 2KDGA 1DVFA 3MV11 2OBGA 3WIHL 5AD0A 2QADD 3QCUH 3QG6A 4CVUA 4NQVA 1AC6A 5DHVB 3QXAA 3MRKA 3NAAL 2A6IA 2P5WA 3T1WA 3QUYA 5D6CA 4LF3A 1E4XH 1MWAB 2IAND 1TQBC 1RI8A 4F7MA 1BQHB 3P4OB 4HWEH 3DHJA 1KPVB 2EICA 3JWDH 1QBML 2WIIB 4HCRA 5GS1C 1LD9B 2KZWA 3BEWA 3AMKA 4OFPA 3BEVB 1N5AB 2ATKA 4MX7B 5HHNB 4YDJA 4KKAC 4U0RB 5CWSA 2BSSB 2F53A 4CMMA 1S7WA 5J6HA 5IW1B 4LSPH 1DBAL 2XTJB 3RTQD 5CMAA 2OX5A 3CMOL 4BSVB 1N6VA 2DLFH 4FG6C 3P77B 1AI1L 4ESKA 4OLYH 5DRZB 3QIBC 1BOGA 1T22B 2CMRH 2BVQA 4H88L 3IKCA 3X3GH 4E41A 1LNUB 3K1DA 4Y5VB 1YNLH 1P7QA 1C8PA 3WFBH 2V2TA 4OF0A 1TPXB 4A2LA 3DX7A 5GGQL 4DWHA 3GRWH 1H9VA 4JN1H 2VXUH 4KJPD 5JQ6L 2V7NB 5I8CB 1FL3B 2I9LA 5INCA 3NH7L 4ZUSA 1CXIA 2BRQA 3EYFA 5LGHH 5GRVL 3SKJH 4XC1H 4PJAB 4IMKC 2VLJE 4A2MA 1XT5A 5LXGH 2R0WL 1PSKL 1UKSA 4QRPD 1DQLL 3WS3A 1DVFC 2GI7A 4LNRA 3IS1X 2DI8A 3F62A 3GMMA 4EDWH 4H1LH 5ICYA 3HRZA 4ZFGH 4CU6A 5C0DB 3EHBC 4WGVB 4YJZL 1CLZL 4JRWA 5F7KC 5BOZG 4Q9QH 3GMRB 5FYJD 1IAIL 1V3LA 3QUYC 3BWUC 3QO0A 5DRNB 3OJVC 1EHAA 4RZCB 1EEQA 4GW5B 2ARJQ 3JTTA 3UDWA 15C8L 4F7PA 4JFFD 2CGRL 1JF1B 3G04B 3MRMA 1UB5B 3BKYH 5CCKH 4PJCA 4MNQA 4OZGF 4X7TB 3V0WL 3IDGB 3TNNB 2Q7YB 1U8QB 2OMNA 3RVVD 5DD3H 6CGTA 1YPZF 3ARDA 4G6AC 2IC2A 1WISA 1IJ9A 1U2HA 1JBJA 4LSTL 1KXQE 4G9FE 5CEZE 4UDTA 3O4LD 32C2B 4LSSH 5DJCB 3BH8A 4DEPB 2ZG3A 3U83A 1G0XA 5F70A 5IB5A 4JY4B 4G5ZL 5HHOA 4S10A 1J05A 3SGEH 3D9AH 4IOIB 2AEIT 5HDBF 1SYVA 4PV8A 4RFEB 4S1SL 1QBBA 1KG0A 3OGOE 3UJIL 3GSVB 1QR1B 1OTTD 3QIUB 5CBAB 4TSCH 2NY6C 3AM8A 1JYVA 4PB0L 3EOAB 3EZ8A 3EGSB 4I9WE 1OHQA 1OTSD 1U92B 1Q8MA 3F7VA 5SWSA 3QISA 2DYPB 4ZS7H 4GMSL 5F1SA 3S35L 5IIEA 1DQQB 3VWJD 2YA0A 5J3HC 5K9OA 4NJ9L 3QB7C 3MO1B 2HRPL 1HSBA 4ISVB 5J11C 2R1XB 2VKXA 4XXCA 3UDWC 1FJ1A 5CEYA 5IVNA 4PY8I 3QIWB 1AQKL 3UTSE 4O58H 2DQEL 5E6YA 4P9HL 1U8KA 2FX7L 3QXDB 1PZ5B 4Y4KB 3WMSA 3LV3B 1KJMA 4OF6A 3RA7L 2BX5A 5IR1B 2R0LL 2HKHH 5C0CB 2FIKB 3D85D 3IVKA 4ZFFA 3H6JA 3ARDC 3ZKSD 4A6YH 1F90H 2GJZB 4ODTH 2HMIC 4RGNB 3VWKB 1K4DB 1H15A 2MHAA 3BZFB 5F71A 4MLSA 3R06B 4ALAH 3PE9A 4RAVA 4S1QH 1TCRB 5JW4Q 3WYRA 2JJTA 3GSNB 2X1QA 5ADPL 2ZUXA 3ZE1F 5BO1H 1KTDB 4MJIE 2OTUA 5GHWH 3DGGA 4BKLA 4Z7UE 2VWEE 3IF1A 4X99B 4HEME 3DHMA 5DZNA 1U8OA 2NX5E 4HC1H 4XCFH 1CE1L 5F89B 4J4PA 1P2CA 5JPNB 4KWUA 1MFDL 1PGRB 3AM8C 2AXJA 1WK0A 1A6VL 4KTDL 2FSEA 3S37H 4EJ1C 1JK8A 1YNKL 1T03L 3TVMD 4KU1A 1ZLWK 4Z0XB 2PYED 3VI3E 1FH5L 3AS3A 4ODBD 1JYWA 5T5FL 4OGZA 3ARXA 3MRHB 1MCSA 1G9MH 4NRXA 5KN5A 4XAWL 1FFNB 4JFDE 4GKSA 4NIKB 5HGBA 2EDXA 2YOCA 2HWZH 5BQ7A 4MD0B 2ZG1A 4NHCH 1JRHL 4GKNA 1P84K 4OSUH 1HINH 4XXCC 3B9EA 3Q1SL 1R5VA 5F9WC 2JIXD 2I07A 4O2CA 4OTXH 1TCMA 4ZNEA 4XWGL 3LRHA 4YFLI 2GTWA 2FB4L 4HF5L 3PIQA 4RIRA 3LEXB 1YZZA 5HGHB 4GOSA 4YZFF 4LOUD 5KVGH 5L2KB 4UV4H 4QRQB 1PAMA 4NN7B 4W6WB 2PO6B 3ALXA 1HYSD 4PJXF 4LSQH 3ARGB 1WAAF 3TBSA 5FB8B 1TJHL 5EORH 5K93A 3NACL 4Y89A 3G5XA 1QYGL 2ICES 2JJTC 3BZEB 4AT6B 4HV8B 2UWEA 3EO9H 3JSSA 1IGCL 2WBJD 3CC5A 3UYOD 4PREA 3RKDD 4HT1L 4Y19E 3IFNH 3NMEA 4N8PA 3A67H 3BZ4B 4J4PC 4U1HA 5CZXD 4JFZL 5CILL 3KHOA 5HHQA 5F1NA 4Q9RH 4MA8H 1BAFL 2VYRE 5C1MB 3QG7L 3HFML 3U9PH 1IBGH 4Y88A 2MQ3A 3QPQD 3C60B 4J6RL 2DQUH 4JM2B 2IPUK 1IGML 1ZA6B 4M3JA 1T21A 1X5JA 3IDNA 4GW1A 3TF7C 3HZMB 2MOVA 2X4TA 1XZ0B 4Z9KB 3I9GL 5JIPA 3TA3B 2WW8A 3BIKB 3O81A 2CKBH 3R1GH 3BZDA 3MV7A 1UACL 4P4KD 2R2EB 4FQ1H 1MLCA 1HWGB 5DJZA 3ZMRA 1MEXL 4PGJA 3MRJB 3MOQA 1HHKA 2NXYD 2Y36H 5FYLH 4WUUD 3STZA 3P11L 4OFVA 1U91A 1JPSH 4LAQH 1LILA 2V5YA 1RZGA 2WQ8A 3MGOA 3LHPH 4GRLB 1IAOA 4D9LH 1LK3H 3HLAA 5E8OA 5JMOC 5E9DE 3E8UL 2EDEA 2VB5A 1TZGH 3FB5A 4EUPA 3TIDB 4Y16A 2BHUA 2VR9A 4PBVC 4U31A 3JTSA 3MOBL 5E0QA 2OJEA 3KVQA 4U1MA 5DD0H 3HNTL 4XBEH 1FNFA 2IANB 4MJ6B 2P5EA 3NTCH 5HYJA 4ZFZB 4X5WA 3UZEA 2NY5H 3QO1B 3SDDD 1C7TA 4M00A 1FCGA 3PP4H 2UVEA 4AMKH 4G8IA 4X9GA 4NC1C 3FT4A 3NCEB 5DD1L 2AK4D 5EOTB 1DDHB 3BKCL 3VXNA 4HJJH 3RTQB 2X42A 1QNZL 2LAGB 1T7XA 2H8PA 4K7FB 2ADFL 1B88A 3QFDB 1KIPB 4XNYH 3PHSA 2NYYC 3HI1B 4QOKA 2HLFD 4KUCD 4RFNC 5IB1B 1F6AB 4WHYH 3JWOC 1EXUA 4XNQA 4YBLB 3IU3A 2QL1A 3AAZB 3LRSB 4HS3A 1I7UA 3SEPA 5F1OB 3TT1L 1IFHH 5I1LA 2XIDA 2ED7A 3L95A 3IDIB 1X6NA 4ZYKA 5CEXB 5TDNA 3FOMB 4CW1A 1P5VA 1YDPA 1XFPA 1TQCB 4QRPB 1NGZB 2DQDL 4KMTH 3HMWH 4I4WB 4Y16C 4KDTA 3VXTB 4O00A 4S0SD 4N0UB 5IQ9A 2H2SC 2N1KA 2VXTL 4HS8H 2AV7B 2AXGA 3IFOB 4XAKE 4LLDA 4HUXA 1MCCA 1IEAB 1IM9D 4M7ZC 1BGXH 3GIZH 3HI5H 4JFFB 1E4JA 1CG9A 2FECL 3LPWA 3Q6FB 2VITA 4MJ5B 1MHCB 3REWA 3T3ME 2VLJA 4NKDB 4KZEH 3LS5L 4JPKL 3VFGL 3BGAA 4YBQD 4XZUA 3PWLB 2CXKA 1DUZA 4RWYH 3KJ6L 5IGXH 5MHSD 1OW0A 1MUJB 4WI9A 1OM3L 2R4SL 3O4LB 5I73C 2X4OA 2MQCA 1NC4B 3MRLB 4F8TA 1X5XA 5F21B 5GGRB 1A6ZA 1QHPA 1A21A 2X1WL 3OKOA 3ESVF 1M7DB 2EDDA 3UJTH 1JHLL 5I18H 3PQYD 4MCZA 2YUXA 3OXSB 2VR5A 5F7MC 3V6BR 2IQ9H 1NCWH 1W72B 4X4XA 3RWFB 5F7FA 2MMXA 2AI0L 1T4KB 3CVHA 4YNYA 2GK2A 1HQ4B 5TGBB 4HFWA 4G9FA 2EO9A 3AGVA 4IOFD 4PJAE 4XPHL 4G8EB 3CMOH 4OZIA 2G60H 4U1LB 4OCXH 5DD6A 4KXZH 1V7MH 5IB3B 4G42A 2GYSA 1U93A 4O2FA 1UXSA 1GGBH 1LO0H 3CLFH 2BOCB 1MJ7L 4JFED 4RMRA 3VFTA 1I8KB 3Q6GL 2ZOLA 3HS0B 5LCVL 5JOPE 2HH0L 1AGFB 4OZFG 3TZVD 4P2YA 2NY3C 4Q6YA 2MTPA 1S8DB 1AY1H 1CVRA 3O11A 3P0GB 1R24A 3U0PA 3BD5A 5FGCB 3MNVA 1WCBA 3D85B 5C0NC 4PGDB 3TNMB 5IESL 1QA9B 2BRRH 4DGYH 5CIPA 4CUCA 1YEGH 3SDAA 3F7YA 4FTVB 1OW0C 1S5IH 4JGUA 5DS8B 1KACB 3IFPA 3F8UB 1TJIL 1XF4B 2NY4C 1CLZH 1KB9K 2Z91B 1WGOA 3FONA 1L6ZA 2K7PA 2LU4A 2PW1A 5EBWB 5FF6A 4F7EB 3UTSA 2ITDB 3EYVA 3ET9F 1NCAH 3FFDB 4J7RA 5C0JA 2Q3AA 4YQXH 1QLRB 4G7VH 1KJ3L 4P49A 2NY0B 3V7MA 2Q8AL 1B6UA 4PJ7B 1SJHA 3LMJH 3TVMB 3MLUH 4LSTH 2PYEB 2YKLH 4DUXA 5K9KA 1Z9OA 1E4XI 3FHAA 3MUY1 3ARUA 3F12A 4J1UA 3PL6D 4UOW0 4I3RH 1J5OL 3A6CL 4MJIA 1I7ZA 2CR6A 2EKSB 4OIIL 4Z7UA 4ONHB 3FOLB 3MZTA 5HDOA 3QRGH 1YC8A 3O6MH 4JY5L 3VRJB 1DEEA 4RAHA 4KV5E 4FQXB 5F8RC 1UXWA 1ZLUH 4TRPH 4JAMA 3SKOA 4X7EC 5DSCB 1JZ8A 2D03L 5J1AA 4PRBA 3VGFA 4FS0A 1RZKC 3SDAC 4JFPB 5FYKE 5C0CE 2CLZA 3P73B 4JFDA 1MCEA 5FO8B 2D7MA 4QTHA 4HMCA 4ENEC 4X6CB 1XF3A 4RGNE 2XZCL 5GRJL 1BECA 4XCYB 4LGPB 1IT9H 1XH3A 2W60A 4BQ9A 3MUGB 3OKMA 3KLSA 4M3KB 3TV3H 1X7QA 4MB3A 3P0YL 5ENWA 4YWGH 1A6TB 2PETA 1I1FB 3NCJH 4PY7B 1T1WB 5T5NG 4XPAL 1CF8L 4GBXD 1MCOL 7CGTA 2W65B 43C9A 4BELD 5EO9B 3FL7A 3CGTA 4X8JB 5T3ZL 1Y18A 1FFOB 4YHLL 4OIAA 5DLMH 3H9HA 5D1ZD 5I2IA 2DQCL 4N0FB 4DGIL 4YXKL 1NCNA 5TQ0H 1UCBH 3T0EC 4HUWA 1I8IB 4GQ9H 5IFHL 4Y5YA 2VWEC 3MR9A 4HH8A 2HFFA 4Y19A 3NA9L 2FJFB 5I16B 1IRAY 4PRNA 3FO2B 2XFXB 4P4KB 1U3HA 4HIEB 4MAYA 2R0ZL 4X9HA 4OCMC 2NXYB 1A7PH 2X6MA 5KSBB 3U36A 4WUUB 2DQGH 2WUBH 4PRDB 1INQA 2IGFL 1Q9KA 2MNUA 1KULA 1Q9LA 4AJ0A 4QCIA 4TNVF 3FMGL 1PJ9A 1OL0A 5IB4B 2BOBA 1NCCH 3HAEG 1GL4B 5L2KE 4JRXD 1ZHNA 4XNZB 2YZ8A 3WFCH 4JVWA 4UBDD 2XQYK 4O4YH 3MROA 1TVBA 1TIUA 4OZFB 4XMPH 3O8XB 3PG2A 5D7IA 4HUVB 1BJMA 2DICA 4N0CD 1KYOK 1YY9D 3L1OL 3MLVL 5C2BH 3DVNA 1KPUA 1JYNA 1E4KA 5DWUL 4OM0L 3QPXH 4POZD 5BVPH 4U1NA 3C6SA 5SX5K 2KL6A 3G5YB 2AK4B 1S7TB 4ODVH 2CK2A 1TJHH 1K2DB 3JZ7A 3I6GB 3QDMB 4Y5YC 2XRAH 5A3IC 4Z7QF 2HKFL 3C5JB 1LO5A 4EOWL 4XT1C 1MHHB 3DETC 4QXWA 2OJZH 1U3HC 4BFIA 2BVOA 2EEAA 3QUKA 4MAYC 3ULSB 5FM4A 4PJGF 4NYLA 5GRUL 1FZMA 2C1PB 4UIKL 1EZVY 3CVIL 4QF1B 1CGWA 3HFMH 1JNJA 2FR4A 4M8QB 3ULVE 4FQLH 3GI8H 1AQDB 1IGMH 3UMTA 1I85A 1PD6A 1P6FA 2VLLB 5LGKA 1LE9B 5KSAB 4KKBC 4L8BA 5T1DH 3WD5H 3X12A 4MHHG 1MJUL 3KPSD 4YE4H 5TJWK 1REIA 1T20B 1GGCH 3Q3GA 1P4LB 2CPCA 5KOMC 1G7PB 4MQ7B 3QI9D 1M6OB 2R23A 4MJ2A 1YEEL 4XTRC 3UPCA 1IEHA 2ICWJ 3SHSA 3EAKA 2IANE 1E4KC 3B3IA 1HXYB 2OP4H 4HHAA 5GIRB 3S5LB 4HBCL 4I3SH 3DECA 4OCWH 2P8MA 5FUCE 2R56L 2UVFA 4G3YL 3X11B 1NGPH 1FVCA 3HE7A 4O02L 1BFTA 4W6XB 3OR7A 4X7CC 3GSRA 3B6SA 4NQUA 5L88L 1A9BB 2J6EA 5DMGD 1DP0A 3OJ2C 1FYTE 5DHVA 1MVFA 2IFGA 3U0WH 1XF1A 1MWAA 3ZHDA 3FT3B 2JK5A 1BQHA 3P4OA 3L3OB 5JQHC 4WHTB 1KPVA 3VFNB 5TF1L 3MGTB 1GYAA 3TO4C 3FQWA 4G6JH 3HA0A 3QQNA 1LD9A 1G7QA 1QOKA 1I85C 4JDZA 5IW1A 1FO0H 3GBNL 2FBJL 4Q74A 1SEQH 1A9EB 1A6PA 4PGBA 1CL7I 3WO4B 2DQHH 1VADB 3FZUC 4EI6B 1BFVH 2Z31C 5E8NB 4MQXD 3TJEH 3GKWL 1NDGB 3JVGA 1QSFD 4Y5VA 5CJQH 5GS2D 4N0UE 4LKCA 3ARED 3WLBB 1XGQB 3JXAA 3GI9H 4Z7NF 4XVTL 3TZVB 5I8CA 3LZFL 5F7WC 1O7VA 1FL3A 5B4MD 1A7BA 1LVEA 2CDEA 3V95A 2EDTA 1KTLB 3K1KC 3WFDL 4PJAA 1F2XK 4RRPA 2BZDA 3HAEB 1R5WA 1GCFA 4KVCL 5F9OH 3HE7C 3CSYB 4OF7A 4RBPK 3PGCB 1ZANH 3B5TA 1YEIL 4Z78B 2B5IC 5CJXA 5C0DA 2XNAA 2DRUA 3E6HB 3O4LE 1H3PH 3GMRA 5GJTH 5CJOL 3KR3H 4XP4L 4DFIA 1OTUC 4RZCA 3V0VB 5AZEH 2Q8BL 5KVDL 1S78C 4JFOA 2X1PA 25C8H 1ONQB 3X14B 3Q48A 1UB5A 4Y4FA 5BJTA 2BJMH 5I8EA 2A6KA 4X7TA 3T77B 4JO3H 3IDGA 3TNNA 3U82B 1D5BB 3PWVB 3C5ZD 1ZTXH 4L4TD 3FB8A 1Q0XH 2CRYA 1PLGH 4WIQA 3WLWD 5IMLB 1CDUA 1AHWB 3T09A 4XVSH 32C2A 4QRUB 4HCRL 4RGMB 1KB5L 3PL6B 4BYHA 1L9NA 2CLRB 4MB5A 1BZ7A 4ZO7A 4NQCB 1EEZA 4J3SA 2OTPA 1DANU 3WXWL 4MXWL 3T0WA 3JVGC 4Y5VC 2FZ3A 4LLMA 4IOIA 3WNNA 2WBKA 4UOW1 1A64A 5F3BB 1MOEA 5CHNB 5I1GH 5EOCJ 3IRPX 4PJDF 4JHAL 1CFVH 2ZCLH 2AI0H 1PVHA 4F3FA 3WN5C 3CFCH 1OAQH 3QYCA 4PLJD 4LIQE 1IGJB 4OQTA 4MA1B 1LEIA 1U92A 4X0KA 5LBSL 3EO0B 5FGCE 5J0BA 1NGWB 1M05B 5IBLC 1L0QA 1MRFL 4FTVE 3DYOA 4HKJB 4O5LH 5E56A 4N1CA 3VXRA 2YD8A 1FVEA 3MO1A 4W70A 5IVXF 2PCPA 1AH1A 4ZQKB 1ACYL 4PIRF 3Q6GH 5HHMD 1BBJB 3M1BB 2AXFA 2IH1A 3V6FB 3P30H 3QUMB 1T89A 3QIWA 4Y4FC 2BNQA 2YMXH 4FFZL 3RNQA 1PZ5A 3TEUA 1DLHA 3LV3A 3OKKB 5ANMA 5IR1A 2DM7A 1D5IL 4LCIH 2FIKA 5C0CA 1JNHA 1UT9A 2IADB 1H8OA 1KJ2B 1CTOA 2GJZA 1R3KB 5D1ZB 2HP4A 3BZFA 3V2AR 1TJGL 1I7RB 4PJ7E 3ZKNC 1Z6JT 3R06A 1BD2D 5T1KD 4G7YL 1EEUA 1WCQA 3E6FA 3MLXH 1BFOB 3GSNA 1FG2A 3QDHA 1GAFH 4YHNB 2X4QB 1NAMB 1KTDA 2W0PA 3FT2B 2RIKA 1BP3B 4AH2A 2AVGA 3U7YH 3PWPE 4B5EA 5JPNA 3BI9X 3MRIB 5BXFB 1CD1B 3GK8H 3P9MB 5C08B 3DTXB 3QJHB 5KSUB 1ETZB 4K8RC 3LKSB 1S7QB 4NZTL 3QXWA 4ZUTB 2NMSA 4DOHE 2OYPA 3MLSH 3SQOH 1J5OH 5CUSH 4LVHC 5DEGB 3A6CH 3CUPB 1FFNA 2V5TA 3SE8H 4X6CE 4QTIH 1I4FB 3LKRA 4P99A 3MBEB 5I74C 4M48L 4MLIA 1T89C 1CLCA 3QIWC 4DZBB 3RIAF 3FQTB 5FM5O 1S7VA 4JCMA 4WY7L 4PS4L 3DURB 4FABL 5TF0A 3BDYL 2I60L 4EBQH 4NQTA 1A7NH 5HGHA 4G8FA 3QWOA 5L2KA 4Q6IA 4KXZI 4LP5A 5FB8A 1X4YA 4CAGA 4QT5B 3BZEA 1KNOA 2VABB 4WDIA 3TH4T 5J6GA 5L8LB 5JOEA 2X44D 2ZUYA 4QHUB 3QEGH 5LJYH 4RA3A 4MMXC 3NN8B 2HT2C 4FQQA 3LOWA 3W81A 1EH9A 4JEGB 5JDSA 3V4VH 4XXDA 5H94B 4J3UA 2BERA 5F96H 3TLRA 1IAII 3C60A 4MB4A 4F9PA 1WVZA 3HHRB 4DGIH 3VDCA 5GGVL 1LP9E 4RWHA 3E1F1 5IFHH 3RWIB 4NQSB 3HZMA 4FFYL 2AJ3B 3IB4A 3KPSB 1XZ0A 2V7HA 5IFJA 1KCUL 2BK8A 3BIKA 4HK0B 1MFBL 2ZKHL 4P3CL 1NGQH 2I24N 4XPGH 5F7YC 4KROD 3FN9A 2R2EA 3I75B 5A16B 4I3GA 3P3YA 4XC3H 4GXUN 4HDIB 5DK3A 4U6XB 4ZODA 1Q9OB 5IBTL 4QNPF 4R7DB 4P2QD 3G6AB 4Z7OE 2J8OA 4Q6IC 2EYRA 3C6LD 4HAFA 4NBXB 3R8QA 1RUPL 4GRLA 4ZTPL 1U8JA 4TVPL 1QEWB 4XPBL 2AK4E 3UPAA 5FAAA 1MCKA 5I1EH 1LE5B 2ADJA 4WEBL 3QDME 3DRQB 3AVEA 3LKPB 1Z3GL 4MNHB 2IANA 4MJ6A 4R2GB 5IMOA 3L3HB 3EFDH 3VMPA 3IDMA 1NC2A 4XPFL 1KIRA 3CLEH 4PTTA 5CGTA 3WE6B 2AJSH 2HTLC 3CFBB 3QO1A 5AYUH 3QHZL 4K55A 2C3VB 2IQAB 4XVJL 4K94L 3ARBB 3ECBA 3C60C 4WW2F 4F9PC 3S3JA 1FIGH 1D5MA 5EOTA 5C0IB 2CIKB 1DDHA 4OKVA 2RAMA 2VXVH 1AE6L 1FYTA 3MA9L 2ARJB 2D3VA 3FJTA 1WC7A 2HKFH 1KIPA 2HTKD 3QEHB 2DLHA 2BDNL 1VFOA 2Y5TA 1B0GA 8FABB 4TOYH 1UH3A 1N4XL 1QSFB 4NO0A 5IB1A 1F6AA 3KLHC 1EFXA 3AREB 1MLBB 1GPOL 2WINB 1J0YA 2FCBA 2VISB 1FL5B 4NKIL 2OZ4L 2XWTA 3ULVC 4PJEF 1CGSL 3DX8B 4NNPH 3HZYB 4IRZH 1AFVH 3V6ZB 3T0BA 3JWOL 5DYOB 2E6QA 4JPVL 5I8KL 1QFWM 1UVQB 3GM8A 4DKFH 4DW2H 5KS9F 1ORSA 3KYNB 5I30L 2HT3C 3RHWK 4I4WA 3V6OE 4PJ8D 3TN0A 1XGYH 4L8CB 3U4AA 2YK1H 5D71L 3CMGA 3KS0H 3ZDYE 3N1QC 2AV7A 3IFOA 3NGBC 1IEAA 2W9LA 4QHKI 4YX2H 2VL4A 3A6BL 2NXZD 3ZDZF 1HIML 2LVCA 3D69A 5D93C 5D2LF 2HA1A 5FUCC 3Q6FA 4MJ5A 1DLFH 1MHCA 2BSTB 3ZSTA 1TTUA 3REVA 4LMQE 2R56H 5E2WH 3C5ZB 2BNRD 4YR6B 4L4TB 5IQ7L 4X6DB 4NBYB 1JRHI 1MIEL 3L3KB 5TH2B 5KG9A 1Z5LA 1E27B 3O4LA 5MEQB 3GSWB 1NC4A 3RVTC 1I7TB 3HUJA 4ODHH 5FDWA 1AGBA 2DI7A 4Z95L 1VACB 4L5FL 2UZIL 4OGAD 3CDCA 1NCBL 3MLTB 3D3VA 4YBLC 5DQ9B 4Z7VA 1VDGA 3OXSA 1JV5B 1U58A 3QHTC 4JKMA 3MOAL 3CXDL 4NWTL 1ZGLA 4OCNC 3F58H 4N0YL 5CJ8A 3RWFA 3L5IA 1F4YH 3T0VA 3VW3L 1N7MH 1ZVYA 3QQ4A 1T4KA 3MJGX 4X6EA 3EJYD 5TGBA 1Q94B 3RWGA 4X5XA 5B3JF 1HDMA 3SDCD 3QZWA 2MPAH 4GAGL 3GBNH 2FBJH 4G8EA 3GNMH 1VEOA 5T3ZD 3G5ZB 4PJFF 1PW3A 5IF0B 4ZAKB 5L6YH 3PV7A 3TN0C 1S7XA 5E8EB 3RVWC 1ZWIA 3RWHA 3K4DA 1F42A 3RI5K 5C6TL 1GOFA 5B39A 2J12B 5IB3A 2JELH 4NQDD 2BOCA 4OZ4A 3MRQA 5HHMB 4MQTB 2R29H 4XVTH 3GMOA 2YPLD 5IFAH 2ZUTA 3TCLB 4LSRH 3RDTA 3WNLA 1FORL 1WF5A 2EDLA 3O9WA 2MQ0A 1MCPL 2Q20A 2BC4B 2HJFA 3QQ3B 4M93C 4EXPX 3FQUB 2DTMH 3QP3A 3DX6B 3TNMA 5DJ2B 2N7BA 4HUUB 3GSXB 5IMKB 4FTVA 1UH2A 1VFAB 5DS8A 4H0GA 3EUUA 4ZOCA 4JREB 5T33L 1ZK9A 5EB9A 3TT3H 5T1KB 2C4FT 2ESVD 3OAZK 5ACLA 5D7KE 4OGXL 1II4E 3UTZB 1NAKL 3LEVL 4NQCE 4QHNB 2ITDA 3O3UN 5BS0D 4YUEH 2AJYH 2APVA 3PP3H 4UV7L 1CFSB 3L3GB 3LEYH 2UUDH 4MXVF 4FA8A 1I3RA 5E24E 1NLDH 2XN9D 4LKXA 4NJAH 3WCYA 5LAXB 3ARYA 4OD1L 1QR4A 4HS6A 4DKEH 4YHZL 4PJ7A 3DWTA 4HPOH 5HYSG 1SY6A 1PX3A 3KYAA 2UUDK 4HCRH 1CICD 3U7WH 3PF2A 1J88A 2GSGB 4JDTL 5DQDL 4PJBE 1LEKA 1JGVL 1JNLL 5DFTA 1H3XA 2NW3B 3CVHL 1RIUH 4EN3A 4XCEB 1E28B 3FOLA 4M8VA 5HDQL 5T3XE 3H9ZA 1K6QL 5C0AD 4JFHD 3PWPA 4M7KL 1A7RH 4FQXA 3RDTC 1MNUL 4AG4L 3O9WC 3DVIA 5CSBA 5H37H 3BAEL 4LEXH 1JGEA 2WV3A 1IC5H 4WTZA 3RUGE 4L3EB 4MAUH 2ZSWB 1UQSB 4PUBL 4WEUD 3MLRL 4JFPA 1FE8H 4N9OB 3P73A 2C3WA 4DGVH 2ZNXA 4P0DA 3DIFB 3VRLE 4Z7WF 1AR2A 4X6CA 2CJUH 5DC0A 4FNLL 1YEFL 2H1PL 3IYLW 3BSZL 1RZKL 4OLZH 4WI2A 5DUBB 3MRDB 4NRZA 1A6TA 1I1FA 2VDNL 1KJVB 4WFEE 1R3LB 1K4CA 4FFZH 1HCFX 5EO9A 1FFQA 2DQIL 2NY0C 4I0PD 3KLDA 1IGYB 3QUZD 1F5WA 5ICXB 4LHUD 3FQRA 2ZG2A 4L8DB 3M8OL 5EUOB 5C08E 4U1GB 3L3IA 2DBJA 4N0FA 2QSCL 2FATL 2CH8A 3ESUF 3DPBA 1I8IA 4RMTA 4ORGA 2FECI 4LARL 2VLKD 1EJ6A 3SDXF 4EN3C 4QXUH 2EZ0C 3NBNA 4WW1B 3LN4B 3HNVL 4MZ2A 2X1OA 3FO2A 5SV4A 3ARFA 4KROB 4FQXC 4XHJD 3NABL 3RU8L 2E7BA 2NY2D 3CK0L 3QBTB 1DN0B 1RJYB 1CXEA 4PRDA 4PJ9B 5CZVH 4NZUL 4C4KO 4OM1L 5HDLA 3FN0L 4P2QB 1RUQL 3BHBB 4R96A 1EVTC 3QDGD 1LP9A 3C6LB 4W68A 3GGWA 3DBXA 3Q2CA 4RDQG 5I66A 1TMCB 4P5KA 1I1CA 5ADOL 4XNXL 3ZTNH 4XP6H 4IDJL 4H0IA 1C5CH 3O8XA 1CXLA 1MAML 1DSFL 4M48H 3KNBA 1ZLVH 4JHWL 5BMFL 5IEKB 2FEDC 4G80B 4NHUB 1BZQK 4LVOC 5KS9B 1C5BL 3BDYH 1EAJA 4E0RB 2QEJA 4Y1AE 2XZAH 4FXKA 5GS3A 4MSWB 4KKAD 2C9AA 3OL2A 5D7SL 2Q76B 4JR9H 5D2NB 1K8IB 3FO1B 3GBML 4FG6D 2H32A 1NANI 1S7TA 2GAZB 3WEXA 1K2DA 2VDQH 3QIBD 4ZD3L 1UM4L 3W0WA 3I6GA 3DUSA 1I3GH 3QDMA 5E5UB 1U8HA 3QULA 5IB2B 5IHUL 3MTRA 1NGYA 3HC0B 5A2JH 3ARFC 1HILB 1QSEE 5DRXB 2AJZB 4LVNB 3SE4A 1G6RH 3MQIA 5EO0B 3ES6A 1T1ZA 3T1FA 4PJHB 4OD3H 2C1PA 3CJJA 5I1IH 5HYSB 1KEMH 4GSDL 3UJJH 1FBIH 1M1SA 3VD3A 1DVFD 3MJ8B 1AD0B 4D9QE 1OSPH 4N68A 2VLLA 3EHBD 5EU3A 1L6XA 2YPVL 1A3LL 2P5WD 2OS7A 4LLUA 1MAJA 3QUYD 5KSAA 4FFYH 4XNZC 4M6NL 4LFHD 4PJ8B 2QR0B 2X4SB 4L1HA 4UAOC 3TCXA 3TBVA 3O8XC 4YEEA 1P4LA 1T2QL 4WFHE 1RUMH 1G7PA 2VSCA 1M6OA 1MCJA 5H8DA 2NXZB 1YMMA 3IKKA 2CIIA 1ZGLM 3NCYP 1CQKA 3AY4A 2A74A 1G7LB 2GJ6B 1EBPA 5TQ2L 3SE9L 3WDHA 5FGSA 5GIRA 4G6AD 2PNDA 1KT2B 3S5LA 4DK3A 2BNRB 1F6LL 1MVUB 4ZTPH 3V6OA 3ZO0A 2X70B 4LHUG 4XPBH 1P5UA 4ONFL 4E41D 2GK0B 5MEOB 1QSVA 4OI8A 1A9BA 1PG7H 1P7QD 2JB6B 5C9KA 3VFMA 3O41A 5E08L 3LKQA 1FVDA 4R4NC 1RQ5A 1MRDH 4U49A 4U6HB 3SE4C 3N85H 3D18B 1XMWA 4XPFH 3FT3A 3WHXA 3L3JB 4P2OA 1QPPA 4Y2DB 2NY6D 3L3OA 2R2HB 1BM3H 5L9DL 2XACC 1N3NA 4GUPB 2Y5EA 3MGTA 3KXFE 2DWEB 3W2DL 2YD2A 1TVDA 5FIEA 5C0EB 5ESQA 3NIFE 1RURH 4HGWB 4LBEA 4F37F 5JO5B 5ICZA 2Z35A 5DUPH 1EUTA 5J3HD 1RHHB 2C5DC 5KSAC 3KPRE 4F15B 1U6AL 3FRUB 5DUMH 3VGAB 1A9EA 1JPGB 1LDPH 2UV3A 5I17B 1VADA 2KUTA 4D0DB 1VKXA 4EI6A 2A9ML 4JANB 4OLXL 1NDGA 4NQDB 2ICWA 1UKQA 4JO4H 4MNQD 3WLBA 4FXLA 1MY5A 3AY4C 2YPLB 1MIML 1BJ1H 4DQOH 4TPRH 2JCCA 3U30C 3PJSA 3ARDD 1UYWL 2HMID 1WEJL 2X4UA 5HHPB 1S9VA 3P4MB 2X9YA 3KYMA 5HI4C 3RWJA 3V6OC 4PRAB 3K0WA 1SYSB 2VDLL 4NC2B 1AGEB 5HHOD 3SBWA 3PGCA 4L4TE 5TE4H 1LO2L 5E2UH 4QRRB 3RJQB 2HLAB 4Z78A 2H2PC 1F8TH 4JJ5A 3DGCR 3E6HA 3WNOA 5JR1H 4ONOA 2F8XC 1ADQH 4YHIB 5GS0H 5F9JA 2YD9A 5MEPB 1IL1B 1VB9A 1CK0H 4P2OC 5BS0B 1L7TL 4YLQT 4EUPH 3BFOA 5FFLA 2J6EL 4HBQA 3B8SA 1BF2A 4H26A 3V4PL 2E6JA 2DDQL 1QRNB 3FHQA 1G7JA 2XN9B 3GO1L 5SWSD 3VJ6B 4PFEA 1FPTL 1D5BA 5GJSL 5IQ7H 2V5SA 4PJCF 4PB9H 3WDJA 2DIAA 1MIEH 2HVJA 3ULUL 3RL1B 5IMLA 4UILL 2IPUG 3PNWA 1CICB 3FB7B 2VZTA 2P48B 5JNYA 1P7KA 3I3DA 5BW7A 3WO4C 2AJXL 4NQCA 1VGEL 1VERA 2AJUL 2P46B 4BZ1L 4F7TB 4LFHG 1JPTH 2XQBL 4NNYB 5C0AB 5FA4A 4Y7MA 5CHNA 3TBWB 3MOAH 5BV7C 5HHME 5I1CL 4GS7B 3CXDH 4DN4H 3LIZH 5EU4B 1SM3L 4W6YB 4AL8L 1D5XB 4N0YH 2ZUUA 3BN9C 3BP4B 1E6OH 1TVHB 3TGXA 1YUHB 3SDXB 5EPMB 4JO2L 1DE4B 1IGJA 4GAGH 1Q38A 1F13A 3SBWC 5I1HL 1NGWA 2X7LB 4PJBA 5I0ZA 4HKJA 3BRDA 3RIFK 3DUHA 4JG0L 4N90E 3BT2H 4N1EA 1U3JA 4FXGA 1WWAX 3IETB 2OK0L 2OR7A 1DBML 4J4PD 2QKIA 2YBRB 3MBXL 3KPQB 2DIJA 3QDJB 1BREA 4OAWB 3QUMA 5CP3H 1XIWC 3OX8B 4WFFE 4GRWB 4BQCA 5JHDD 4GG6B 1JCKA 4NM4L 3RUGA 1ZLSL 4I0PB 5ITFB 4D3CH 3QUZB 3GJFK 4JRYB 1UWXK 4LHUB 4HWUA 1B0RB 2IADA 2YUWA 1R3KA 2P8PB 3DRTA 5EU6E 3KDMA 1HHGA 3C08H 1ZA3B 4RGMC 1OB1B 3S88H 1CFNA 2AK1L 4AY0A 3T2QA 2I25N 4JY6B 1CFQA 1VA9A 5DURB 1RJLB 1T5WB 4OGXH 4Z5RB 3MYJB 1F6FB 3DXAE 3SKMB 4MDIB 2AJVH 4YFEA 2QSTA 4YHNA 3O3AA 2X4QA 3K8MA 2EIBA 3WIHA 3FT2A 4WWID 4UV7H 1J0IA 3OV6A 1RUAL 1J11A 1QFWL 1CIUA 4JVUA 5DGRA 3VFPB 1CD1A 3MSPA 1BBDL 3DTXA 4OD1H 5KSUA 3C09C 4WNQA 5C08A 4YXHH 4MA1C 5IG7B 5F7UA 4H25A 5E8DL 4JFQA 1EGJA 3QDGB 1S7QA 5FK9A 3VXOB 3WO3B 4L3EE 3I84A 1O5DT 1SMOA 2EDYA 1WZ1H 3QHFH 5GGRY 5GGUB 5C6PB 3ZDXE 3CUPA 2P42B 1JNLH 3V5KB 3QSKB 3CVHH 5CEZH 4OQTL 4K8RL 3VFOB 4L3CB 1N64L 2DI9A 4MD5B 1EMTL 3MA7A 4M62L 5IVZA 3S34H 2ZNWA 3MBEA 3BKJL 4IS6A 2ZSVA 4M7KH 1NJ9B 3WXVL 5GS1B 3QJFA 2FHBA 3FQTA 1IAKA 4YAQB 3NIDE 3PUCA 3BAEH 3I02A 2G2RA 4KRNA 4NZJA 4OLVL 2EIDA 2J2ZA 4KPHL 3MLRH 2ADGB 4FP8L 1YQ2A 4FMKA 5C0GA 3C8HA 2QTEA 3V5HB 3N9GH 3SJVE 1YYML 2CK0H 2NYYD 5EUOE 4NO5A 4FNLH 4EIGB 1A7QL 3MV7D 4QT5A 2LQRA 5L2JB 1IGTA 2DJUA 3M17B 4BM7A 1KN4H 3TBTB 1EERB 2Z8WC 5I6XC 4OQ1A 2Z92B 4BSWB 3BYTA 4GFTB 3TIEA 2UWEF 3RGVA 1CYGA 4Y1AA 1N59B 3Q5OA 4U6YA 5HJ3A 2V2WB 4ZDHB 3SY0B 3M8OH 3WIIL 1VFUA 4XGZB 3O2WL 4MQSB 5AD0B 4KI5F 3QG6B 4Y16D 4QGYA 3RVXC 5HDBE 3MRKB 4YXLL 2P5WB 4KDVA 2H2SD 3RWIA 4NQSA 1P4IL 5EUKA 2P5ED 1C12A 5HYJD 1QSEA 5JOFA 4JKPH 4F7MB 3H9SE 3N50A 4POUB 3I50H 4Y5XA 1FSKC 1NEZB 4OJFH 5FHAH 1P1ZB 3MBEC 1KB5B 3VFRA 3W9DA 1BIIA 4P9ML 2AGJH 1RU9L 2QQKH 1AJ7H 1FN4A 4NZUH 3L5JA 4U6XA 5CWSB 3VG9C 1S3KL 5J6HB 1RUQH 4KK6C 3G6AA 5CMAB 4M4PA 5DMJB 1CI5A 4OFKA 2Q6WB 4QOKD 4X7SL 4S1DC 1FZOB 5ILTH 4WCYH 5K9JL 2V2TB 3DX7B 2HG5A 4Z18A 1WV7T 1GIGL 3AU1B 1DSFH 4G6KL 4E42A 2I9LB 5INCB 5K9QG 2NQCA 1CGTA 3RGVC 3UTTE 3S37X 2C1OA 2DKUA 1JGUL 1A47A 2FNBA 5AG9A 3WE6A 3BW9B 2WP3O 3EYUL 5C0FA 4D0CB 4PJHE 2C3VA 3RWCA 3OWEA 1ZOXA 2AAVA 2IQAA 2NY7L 3GBMH 3ARBA 4LNRB 1EV2E 3GMMB 1FHGA 5ICYB 2C3HA 2D7QA 3K80A 5C0IA 3QO0B 1JGLL 3OKDA 3U48A 5EOQL 3QEHA 5KZCB 4F7PB 4Y5XC 3INUH 4G6ML 3ZZ1A 3I2CL 2NY3D 1E6JL 1MLBA 4MNQB 2WINA 1NUDA 2VISA 3TPKA 1FL5A 2DM4A 2HJLB 3KXFA 2VLJD 5C0ND 3DX8A 2VDML 1DQML 4RISL 3ZYOA 3IDJA 1PEZA 3V6ZA 2GJ6E 4M6OL 4UDTB 1QVOA 4QRSB 2A0LC 1ZT4A 1WIPA 5CS7A 2BFVH 3BH8B 3KPRA 4HWBA 5DYOA 5HXMA 1UVQA 2NY4D 12E8H 4JE4B 4Z0BL 5IB5B 4HXBH 5HHOB 4TSBL 2VLRE 3EYQC 3ULVL 3KYNA 2XWBB 4C59B 1SYVB 4HKXB 4YO0B 3TYGL 3SO5A 2FX9L 3H3PL 1KG0B 4R2GC 5ID1A 1G7IA 1VFMA 4PRHA 1OCWH 4PTUA 4ETQB 4CJ0A 1OQXA 4UU9B 4G9FD 2QLVB 2BSTA 1WWWX 3ARBC 3FQXA 4WI3A 4F9LA 2QV2A 5IIEB 1SBSL 2OMBA 1Z0NA 4OZHB 4RFOL 2IBBA 5K9OB 3L3KA 5TH2A 1CCZA 3W11C 1E27A 5MEQA 1HSBB 4G8GE 4C4KT 2J4WL 5CEYB 1VACA 5C92A 5F9WB 3B9KA 3GMLB 1U8KB 4ZPTA 4M5ZH 1KJMB 4I9WD 2VH5L 4NP4L 4PP1C 5DQ9A 4NQDE 1JV5A 4MJ4A 3IVKB 5KTEL 3VXUE 4TTGA 2YPLE 3SDAD 5LQBH 3I6LD 4HXAL 2MHAB 1S7UA 5DMIH 1EPFA 4KTEL 1Q94A 4RMUA 4ENED 4U1JA 2IMNA 4RAVB 4TQEH 2IBZY 3B2VL 1KENH 4NCDA 1Z2KA 1A2YB 1EAPA 3G5ZA 4GKOA 5IF0A 5DQJB 4ZAKA 2ZUWA 3DGGB 3RWDB 3UTSD 4BKLB 1JPFA 3K7UA 4QRRE 1U8OB 3O2DA 3VE0A 1U8NB 2X1XR 5E03A 1KIQB 3OGCA 5EWIH 1TETH 3JV6B 2RJMA 1P9MA 5GGTH 3MRNB 4JFYB 5FO9B 5JHDB 2BY3A 3NFSL 4LCWB 1RZJH 2VDOL 1FZJB 4F9LC 3B5GA 1UM6H 1B0WA 1QRNE 3DX6A 4YHKL 2XN9E 2A77H 3MREA 2AV1B 3T0ED 4GKSB 5IJKA 5HGBB 4MJID 1VFAA 2XA8L 5DJDB 1HYRC 1VPOL 3NZHL 1MRCL 4GKNB 4JZJA 4HIXL 3NPZB 1YECL 1R5VB 1YC7A 3B9KC 3UTZA 2VC2L 3HTLX 4O2CB 1YYLL 1ULVA 5TDOB 3EOBA 4RIRB 3PXJA 2J6EH 3OAUH 1JZ2A 4JFHE 5DHVH 1NLBH 2FL5B 3HG1B 1TNNA 1MWAH 1JFQL 5GJSH 4JFDD 5HYFA 1KELH 2ED9A 4YGVA 1RHFA 5DO2C 5AAMA 3TBSB 1NGXB 5EU6A 4M7JH 1BVKB 2JTDA 1BX2A 1DQDH 3VD7A 3IDYB 3EDFA 4ZAKC 5I1DA 3DXAA 2GSGA 1H3TA 3CC5B 4XP1L 1CXFA 2NW3A 2AJUH 2CO6B 4XCEA 1E28A 5C8JA 1RZ7L 4AQOA 3F7PC 1P9MC 2XY2A 4Z7UF 1IAIM 3VGBA 5IOPA 3MODL 1G0YR 1HXMA 5I1CH 2FGWH 5B21A 1U8LB 5E2TH 3QDJE 1JJUA 2ZJSH 1OVZA 4U05A 3ZL4H 2Y4SA 1EX0A 4ZO6A 4LQ1A 4GRWE 4N8VA 4GG6E 4K2UH 4LEOB 3S3SA 4C58B 1J10A 1OAYH 4L3EA 1T21B 2ZSWA 4K23H 3WHE0 5GISL 3IDNB 3MJ9H 4GW1B 1EDQA 1L0YA 5IJKC 4JRYE 2XPGB 4XX1E 2WLYA 5ESAB 3VI3F 1I1AB 5A3ID 5FUOH 1CQYA 3FAWA 2H6PB 4Y19D 4KJWC 5ACMA 4JZJC 5JW4R 4S1RL 1OD9A 2GW5A 3BQUB 1FLRH 4QHKJ 1HEZA 3MV7B 2P1YA 3DETD 1U3HD 3DJ9A 4AEHH 4MAYD 4M7LH 3RP1A 2OR9H 3HR5A 4GAJH 5D5MB 1HHKB 1LMKA 4HUKB 1GGIL 1HOCA 3QCVL 4JZOA 5BRZE 4YHOL 1DFBH 1U91B 4HLJA 4J3WA 4NM4H 3S36H 2V9RA 2ZUQC 3C8DA 1YEDA 1RZGB 4P3DB 4M5YL 3MGOB 3ZLQC 2W59A 5GXBB 5E8OB 4LPUA 1OGAA 4WTXA 5CKGA 4L8DA 5IUSA 3FB5B 3SJVA 1QLFB 2W9DL 4KKBD 1OSZA 1T6VN 2OJEB 2AK1H 3P4NA 5I8OH 4YK4C 4KHXL 5C07B 4NM8H 3UXFA 2IPTL 5JXEA 4OZGA 3MLPA 1CDJA 4ZFOL 1EEYA 1CD8A 1UWEH 2VXQL 4XTRD 2R4RL 5I0DA 4WW1A 3HPLB 3CFDA 1SY6L 4CGTA 2F58L 5EBLB 2B2XL 1QFWH 2QHRH 1FC2D 1YEKL 2ZWLT 5FHBL 1OPGL 5JDJA 1DN0A 1RJYA 1FQ9C 4PJ9A 2O5XH 4HLZH 3VXNB 4QHLA 1IKFL 3BHBA 2H8PB 5I73B 2PUQT 1FP5A 2PW2A 4B41A 1Q1JL 2FD6L 4HKZA 3SO3B 5DGQA 5LWYL 4QOKB 1RUKL 3H9SA 4KQ3H 4LRIA 5GZOC 4NUGL 1EXUB 5JTWA 4XNQB 4CVWA 1DANT 3O6LH 1JHKH 1N64H 3IU3B 4HS3B 4M03A 3WXVH 4UNUA 5I1LB 4RQQB 1MY7A 4IJ3B 5IEKA 3TO4D 3WKML 1A1MA 4G80A 1HHIA 3OB0H 4NHUA 2YEZA 4ZYKB 4BZ2H 1J1XL 3THML 5DA0B 4N5EC 3HC4H 4CW1B 1YDPB 3EJJX 3ZHKA 3ARWA 2Q76A 1K8IA 4FP8H 3ZE0E 1JHTA 4F57H 3OZ9L 1UB6A 5J1SC 1N26A 1HN1A 3OB0K 2GAZA 4AZ8A 1NCTA 3FZUD 5E6IA 3VH8G 1A7QH 2Z31D 2AXGB 1XGTA 5JXEC 5FYKH 1U8IB 4UTBL 4GQPH 1DCLA 5HI3C 4D9RD 5EA0H 2F5AL 3D48R 3UTTA 2P47B 1CG9B 3MRGB 5DJXA 5KVFL 2VITB 4MD4B 3REWB 5A40E 2F15A 3TH2T 2Q3ZA 3BJ91 5CD3B 1XGUA 3GSNH 4BUHA 1R5IB 2A1WL 3IAGC 4PJ9C 1Z9LA 3DUUA 3HE7D 2YD6A 3O2WH 3T2NL 1AD0A 3C2SA 3NCCB 1IQWL 2NY4B 4XAKD 1FGNL 3EYSL 1A6ZB 4LRIC 2X10A 3HMXL 4XWOC 2W0FB 3OKOB 4MDJA 1OTUD 4K3HA 5F1IB 3ULUD 4C56E 1S78D 4LL9A 2VN4A 2V5MA 2FX8L 3B9DA 1HH9A 3Q5TA 1YN6A 4X4XB 1INDL 1A14L 4CADB 2O5YL 2LTQB 1KPRB 4G9FB 4UUJB 2GJ6A 3GSOA 1MI5E 3RQ3A 5JW4M 1ZSDA 5E2JA 3BD3A 3UYRL 1VHPA 4OZIB 2SEBB 2VLRA 1MVUA 4UINH 5DD6B 1V3KA 1OGTB 4BH8A 2IG2H 4X7SH 5E6IC 5FXCH 1SVCP 3TPUB 5I19H 1U93B 4JCLA 4R0LB 3KPOA 2ZOLB 3MYZA 35C8H 2AEPH 4ZXBA 1PFCA 2IFFH 3RAJL 2OTWB 1NFKA 5I75B 2WM0A 4U6HA 4K7PY 4LVNC 3ILQC 2VERN 4PJXA 3U0PB 1W0VA 3WFEH 1HKLL 4Y2DA 2R2HA 1WCBB 3O3BB 4OUUB 1Z9SA 3LS4H 4Q2ZA 1QPXA 4F2MA 4LDEB 5D96C 5CIPB 3T3MF 2OI9C 4N8CL 3SDAB 2NY7H 4ERSH 1LO3H 1OT1A 1NSNH 5JO5A 5IBLD 4KTYA 3OPZH 2J5LC 2QQLH 2Q87A 4G8GA 1NBVL 3F5WB 1Y6MR 5DDHB 4LASL 4UT9L 5JOPD 3OAYH 3FRUA 2PW1B 5FF6B 2G9HA 5DA4A 1RZFH 5HHOE 3EYVB 4P46B 3ZE2E 2F5BH 2YUVA 4D0DA 2YA2A 2VQTA 1UA6L 3UROR 4DVRH 2COQA 5C0JB 4Y4FD 4HPYH 4UQ3A 4MA7H 4UT6L 3VXUA 4J2XA 4TN9A 4LRNL 4JM4H 3DX9B 2Y6SC 2YPKB 1NMCC 1NL0H 4JGMA 3EDDA 4M6OH 5K9KB 3ILPB 1INEL 3F12B 2HVKA 3ZKND 4MVBC 1F11A 4O2EA 1N0XL 1S7RB 4PG9B 3T0EB 4ZMAT 1CZ8H 4PRAA 4PJAF 4MJIB 1SYSA 4Z7UB 1YEJH 3ULVH 4OZHE 4QRRA 1KLUB 1TZIA 1DBKL 4ZXBC 3TYGH 3GHBL 4R90L 1TFHA 5MENB 1DEEB 4YH6A 5HHXL 2ADIB 4H1LA 2X4PB 2DTSA 4JAMB 4Y2DC 3SKOB 3X3FH 5J1AB 1NMBL 5DFVC 4OCLC 4PRPE 2B1AL 5DJ6A 4GMTH 4CVXB 4K8RD 1QRNA 1DUYA 2FO1A 5KW9L 5E4EC 1WBZB 4OF8A 3V4UH 1AIFA 2CLVA 3BPCA 1ZHBA 4QTHB 3VH8B 3UAJC 1WZMA 2LU7A 3SOBH 2LU3A 3RL1A 3VXRD 4IRSA 1XH3B 5F93C 3D2UA 2W60B 3FB7A 3FQNA 1XF2B 1EO8L 1X7QB 4AEEA 1UWGH 4W81A 5ENWB 2J4WH 5IWLA 2D9QB 3V52L 3BKML 3QIWD 3MXWL 2A9NL 4F7TA 2D7TL 4KQ4H 2BNQD 4NNYA 1BQHG 5F8QC 2WANA 1I8LA 2YXMA 3TBWA 5C0CD 3VFWB 4TSAL 4JDVB 4FQIH 5JHDE 5I2IB 5DJYB 4LCWE 2DB8A 4XBPB 5EPMA 2B0SL 1R3HA 4HUWB 3MRBB 4R6UA 4KVNH 4Y5YB 4HIIB 4Z8FL 4FZEL 5F7NC 3DARA 3VGGA 3MRCB 3MR9B 4DUVA 5BV7L 1QLEL 3VXSD 2HFFB 3BVNB 4K3EL 3ARZA 3I3BA 3T08A 3U1SH 4PRNB 5E94B 4M1DH 3WDIA 4NFBA 5TE6H 3WHE1 4NPYB 1JVKA 3B83A 5E1AA 3BMWA 2ZCHH 4MAYB 1QTYT 4U33A 4OV6F 2HT2D 1NKRA 1A3RH 2YBRA 4XPTL 3QDJA 4OAWA 3VCLA 1INQB 4KV5F 4TVPE 3NFSH 5DRWA 1Q9KB 4CL7A 2OLDA 4YDIL 4GG6A 3CH8A 1Q9LB 5DT1H 5D7JB 1ITCA 4JRYA 4AEIL 2BOBB 2HFGH 4RRPG 4YHKH 1B0RA 3HG1E 1X5IA 1LEGA 1ZHNB 2EYTA 2P8PA 4IRSC 5A2IH 3OQ3B 2J88L 1TVBB 1A1OA 3NZHH 4TNWF 2YD5A 4DN3H 2AEQH 3BO8A 5D7IB 4OB5L 5IWLC 2ICEB 1ZAGA 5FO7A 1RJLA 2Y07H 1T5WA 4Z5RA 3MYJA 4LSUH 5EC1A 5BRZA 3DVNB 1MPAH 1I8LC 4U1NB 4GS7C 4LGSB 1WBXA 1QBLH 3QNZA 1R3IH 5L2KD 1ZMYA 3FFCD 2M1KA 3WJLA 4XVUC 4HC1A 3EDJA 5IG7A 3BE1H 4NC1E 2V17L 4PLKC 1T1XA 3VXOA 1W72H 5GGUA 3BPLC 3L5XH 3V5KA 1J0JA 2BVOB 5AWNH 4FQJL 4C55A 3PGFH 1MHPL 5DJ8A 5TDPB 4D8PB 4NYLB 1FZMB 3K2UL 2O61B 2V9QA 2KKQA 2HTLD 4HQQL 4NO3A 1NJ9A 1A4JA 3TO4B 4UTAH 5D5ME 5T3XL 3U46B 3MLZL 2NLJA 1MFAH 2XOTA 3C60D 5LKNA 2GCYA 5JW3H 1M7XA 5M95B 1OP5H 4PP2A 4ZSOB 2ADGA 1MFCH 3QUML 3X12B 3RRQA 4LIQH 3FO0H 4S1RH 5JLZB 3Q3GB 1YQVH 2Z31B 1BF8A 2E8YA 1RULH 5EZOL 3S8WA 5L2JA 3JV0A 3KLHD 3IRZA 1A6AB 1OP5K 5C07E 2LV4A 1HHHA 2Z92A 1A6WL 3C2AH 3QCVH 4BSWA 1T0MA 3B3IB 3D1MC 3ULVD 2LAAA 3D0LA 4KZDH 3WJLC 3F7RA 4FQHA 1FNHA 1G1YA 1JF5A 1KBGL 2V2WA 1FVCB 3HE7B 4OGYL 5EOCL 1DZBA 2R2CA 4ONGH 1MQKL 1KC5L 4XGZA 3GSRB 3B6SB 1F4XL 2B5IB 4XNUH 2HT3D 3FTGA 5DK2B 1C16A 1R0AL 1EHLL 1KLFA 4KHXH 4R97B 4AQ1B 2MCPL 2IPTH 4JM2F 1BQUA 3ELAT 1OAUH 4QOKE 2VXQH 2JK5B 1NC2D 2H3NA 1EGJL 3MZGB 5FECA 1CS6A 1NEZA 4JKLA 5DHYA 1G9MC 1P1ZA 4MCYB 5JUEH 1KB5A 1YEKH 2Y23A 3FQWB 2K1MA 1G7QB 1AXIB 2XKNA 1RIHL 4P3WA 1NCDL 3KLAB 2CKBA 1DL7L 4I5BA 4Q0XH 4JDZB 2Z8RA 4FQCH 2J1KA 4OCRH 3DV6A 1FYTD 3RZWA 3ULVF 4ZTOL 1GZQA 3UC0L 1YEHH 1CGVA 4P57A 3MNZB 3RVTD 4PGBB 1JPST 1F4WL 2Q6WA 4XBGA 4QRTB 4EI5B 4K7PL 3O3DA 3UO1L 4YHML 4PGCB 4XP9L 4C56A 1FZOA 4U1SA 4NO0D 4LKCB 1EFXD 4NUJA 4LHJB 1KCSL 3SGKA 3HNSL 4RCAA 4ODUB 3AU1A 3WKMH 1MFEL 2CDEB 1MI5A 5DR5L 3L9RB 1KCRL 3B4NA 3D0VA 3U4BH 3WN5B 5I76A 3F6LA 1R5WB 3BW9A 2A6DA 4D0CA 3STLB 3KS0J 3T0XA 3KG5A 2CDGA 2GIYA 3H0TA 1EK3A 2XNAB 3TN0D 1KCKA 5SWZE 3RVWD 2JJVA 4IMLB 5BOPA 4UTBH 1JWUB 4LDOB 4MS8C 4JFOB 3K4AA 3S96B 4NQEB 4Y4FB 5BJTB 5I8EB 2A6KB 1G9NC 2HJLA 3EBAA 3WFHB 5IW6A 2Q7NA 3O6KL 5C9JA 2DQTH 3FB8B 3HI6L 4YGAB 4BH7B 4GJTB 4JPWL 4PBXA 4QRSA 1NC4D 1S9XA 4Q7DA 1BZ7B 1KV3A 3OG4B 3VDAA 7FABL 1EEZB 4OZIE 2DBLL 4G6FD 2PR4H 3PGDA 2FZ3B 4LLMB 3RX8A 3IJYB 2XWBA 1QFWI 5GQBA 2VDKH 1Q0YH 4HKXA 2VDRH 4YO0A 4N9GA 3SGKC 3D3VD 4CDHA 3IJHB 3PWUA 1J8HE 1TDQA 3LRGA 3DMMC 3Q5YA 4TYUA 1B3JA 4ZUWA 1A14H 4F3FB 5IHBA 1H3GA 4ETQA 4UU9A 5IMMA 3G6DL 4OZFH 4X6BB 1LEIB 4X0KB 4TULL 4WI5A 2YRZA 1H8SA 1IGIL 2BHZA 5HSFA 2G5BB 1CR9L 5E6ZA 2NY5C 1BVZA 3DV4A 1UCTA 4OZHA 4LVHB 5IW3A 2VL5B 3I6LE 5D8JH 3VXRB 1FVEB 1EO7A 4L29A 2PCPB 1MREH 4LSVL 1I9RL 2FH8A 2DN7A 1CN4A 2AXFB 2IH1B 4WHDA 1HZHH 3RAJH 5I74B 3GJEB 4F8QA 3HZKA 2ZCKH 2EDWA 3RDTD 4XP5L 2BNQB 3GMLA 4HUNB 3O9WD 4PRPA 3RNQB 4JQVA 1HKLH 1DLHB 3GHEL 5ANMB 3W9EA 5EN2A 1T83A 1JNHB 1QSZA 3PV6B 1EO5A 2F19L 5IJVA 4FTVD 4I13B 5C70A 4DTGH 2DWDA 3V7AE 3MCG1 4YHPB 1NBVH 1FRGL 4JB9L 3BOVA 3IXAA 3E6FB 4PJGA 1IAMA 3VXSB 1FG2B 1MCHA 1A2YA 3T0EE 5DJAB 5DQJA 3RWDA 3G5VB 3HRPA 4AH2B 5FOJA 4FZ8L 5C0RL 1U8NA 4HWBL 5DMKA 1KIQA 5MENE 3JV6A 3MV9B 2LE9A 5F6HJ 2NY0D 2Y9RT 3MRNA 2E3VA 4DCQA 1HK6A 4JFYA 5FO9A 4ELMB 5JHDA 4LCWA 2AEWA 5CINH 1XGRA 1FZJA 2APFA 4OT1H 2MKWA 1CLOH 3LDBC 1L7IH 2R39A 3RNKB 5MP6L 1INEH 2WUCH 2Y06L 3D6GA 4ZOBA 5ALBL 4FQ2H 5E5MA 5KVEL 4OCSH 1AKJA 2AV1A 3IFLL 4WI7A 2W91A 1JNNL 2B4CH 4JO1H 4NN6B 2YWZA 1OY3B 5DJDA 4X4ME 4EN3D 4LU5H 4C57C 1BWWA 2EZ0D 1DBKH 5AAWA 2DLGA 3LKRB 3GHBH 5JMRA 3PWPD 4QWWC 1GHFL 4R8WL 5ALCL 5HHXH 1CIDA 4FQXD 3ME0A 5C09E 4W4NA 2APTA 5GGSA 1S7VB 3NFNA 4JQVC 3OTTA 4UIMA 5TDOA 1T83C 4WI8A 5E2VH 2ATPA 3JWNC 2D0GA 43CAA 4G8FB 3QWOB 2FL5A 5KW9H 4Q6IB 3HG1A 3GUTB 1X4ZA 3FFCB 5DXWA 1URLA 4NBZB 1NGXA 4PJ5E 1MF2H 4HFUL 3RFZC 1BVKA 2E6PA 3U2SA 1KNOB 4KY1H 5JXAH 4WDIB 4PJ7F 3DO7A 5J6GB 1CE6A 1CBVH 4S11A 2P4AB 4I48B 3H42H 3BKMH 3K3QA 3MGAA 1XR9B 5ISZB 4PJEE 1CLYH 1CL7H 2D7TH 2FEDD 4FQQB 3I85A 3L5WB 5I1KL 5JDSB 2R0KH 4XXDB 1BFSA 2K9UA 5I1AB 1FGVL 1F00I 1PDKA 2RCSL 2XZQH 1FYHB 1U8LA 4WEMB 4I77L 4KK9C 1Y6NR 3O2DL 5K33A 3R8BB 1KXTB 1OARH 2Z4QB 4LEOA 4QYOB 2G75A 3P0VH 3B5HA 5E70A 3VD5A 2E27H 3QZWG 2OZ4A 2XPGA 4CMHC 5AG8A 1FDLH 5ESAA 1WZLA 1I1AA 1JN6B 2V7HB 1FNLA 5IFJB 2H6PA 3FB6A 1A7OH 1C1EL 2EH8L 3P9LB 3ZDZE 3OHXB 4WO4A 1CU4H 3BQUA 4TUKL 3ARFD 3HAEH 5JZ7C 4FFWC 5EZIH 5D2LE 4KI1A 1VENA 1A22B 3BXNA 4X6CF 5D7IE 5B39G 4RGOL 5D5MA 2PTUA 4XPTH 3BP5B 5E00B 4FHBD 3QA3A 3VXQB 2YC1A 2EYRB 1QACA 4P3DA 1I1RA 4PGEA 2AP2A 3MACH 2YHGA 1U8JB 2P8LA 1MCQA 5FDYA 3BGMB 3PABB 1QLFA 4GG8B 4QKXB 5FV1L 3IDYC 4CBPA 2ADJB 1M71B 1RMFL 4PV9A 1IC4H 1OAZL 4K94C 3O8XD 4JKWA 5C07A 2XI9A 5IMOB 3NGBB 3CD4A 2A83A 3IDMB 5ELIA 1NC2B 1KIRB 4R26H 1Q72L 4PTTB 3QEQB 3HPLA 4UMGA 5D93B 3WNPA 3UCRA 4EZMA 5EBLA 1T80A 3EKCA 3D25A 3S7GA 3ECBB 3AROA 5GRYA 4PJFE 2E9WA 3IAQA 1D5MB 2P24A 1BQLH 4OKVB 3IXTB 2NR6C 5CLTA 1FYTB 3RVUC 3W0WD 5KSBF 2AABH 3QDMD 2VQ1A 1WC7B 2EXWC 1I1AC 2QJDA 3IT8D 4R4ND 4ZSOE 2Y5TB 4HZLA 1B0GB 1J1OH 4WO4C 3BQUC 3P9WB 4ZUVB 4NO0B 1F4HA 1EFXB 1TITA 2ZUSA 2I5YL 3MC0A 4NOBA 5ID0A 5FGRA 3MV8E 2XG5A 3K2UH 4YDKH 1RK1A 2XWTB 4D9RE 5DJ0A 1U9KA 3ZT5A 4RQQA 3RWEB 2JB5H 5LGJB 1W2KT 3KWWA 1QFUH 4WHCA 1GC1C 5E99L 4WTZG 5EIQA 4K3DL 2X4RB 3KPMA 1PEWA 4PD4J 1ORSB 5KSAD 5EC2B 2WBWB 3QUMH 2BMKB 2GUOA 4JG1L 3VXMB 2BP3A 4UT7L 3TN0B 4Y4HA 2R69L 5KAQG 4X83A 1G7MB 3ZHLA 1IARB 1H5BA 5GZNC 1U8IA 4OI7A 1JIBA 1YMMD 1KJ2H 4TNVK 1OAKL 1FIEA 3D69B 3MCKA 3MRGA 5IT2L 4MD4A 1RIVL 3ULUE 5JW5B 3REVB 1LK2B 3KPNB 2H45A 2ORBL 4KUCF 4M93B 2MWCA 1X5AA 4X80L 5AZ2L 5CD3A 2RB8A 2WNGA 2EO1A 3WNMA 1JZ5A 1R5IA 1BEYH 5HI4D 4OGYH 1NAMH 4WUKL 1Z5LB 3WIHH 5KG9B 5SWZA 4JQIL 1R0AH 2H2PD 3HUJB 3V9FA 5TFSL 3SO3C 5FDWB 1AGBB 1EHLH 3UEZA 3NAAH 4G6FB 3WSQL 3LSOB 3VRIA 2W0FA 1AD9A 3D3VB 4KK5C 4P2OD 5F1IA 5DMYA 4Z7VB 4WV1B 1QBMH 1U58B 3BPNB 4IJ3C 1ZGLB 1CFBA 3EJZC 1RIHH 1IC7L 3QQ4B 9CGTA 4X6EB 4CADA 3RWGB 1J1PL 1A0QL 3S3PA 1KPRA 4UUJA 4X5XB 2IH3A 2OCFD 4CKVX 2AXHA 3EO1B 2EE6A 1HDMB 3QZWB 3ROLA 5HTSA 1DBAH 3ALWA 4I8DA 2YA1A 1EVUA 1AI1H 3UC0H 5IVOA 1A3QA 2SEBA 5CJBA 4GKZA 4KUZL 5I9QC 2MSPA 1S7XB 4XCCL 4Y4HC 3SCMB 4H88H 1ZS8B 5EBGA 1BJ1J 1OGTA 1ZWIB 1PG7W 4K7PH 3RWHB 2VRAA 4YHMH 2D7NA 3TPUA 5B39B 1H5BC 1B2WL 1Q9WB 5EZLB 1J8HA 4OZ4B 3MRQB 4R0LA 5EO1B 1MCDA 5GGQH 5C7XL 3GMOB 5JQ6H 2OTWA 3RDTB 3NH7H 4XMKL 3O9WB 4IBLT 1B4JL 5T5NF 5DR5H 1KCRH 3ABZA 2HJFB 2NY1C 1RVFL 3BN9D 4BUGA 4NQEE 1UGNA 3O3BA 4JGJA 4OUUA 4X9BA 4R4BA 1WSST 4RSVA 5FUZL 4C83B 3CFKA 2R0WH 1WTGT 1PSKH 2OL3B 2VTFA 1DQLH 3IAPA 5F7EL 1S9YA 5T1MB 2ITCA 5GRVK 5D70L 4NGHL 4DVBA 3BPOB 3F5WA 1IAIH 5DDHA 3BMVA 4Y8DC 2GKIA 2VXSL 2VUOA 1WTLA 4LK4A 5L7XL 1R3JA 2Z9TA 1DBBL 4P46A 15C8H 4QXGL 1FO0A 4ZO9A 2CGRH 1W8OA 5EG6C 1XIWD 5EBMB 1I3RB 3V0WH 4LKXB 1CTNA 1RJZB 3O6KH 4KFZC 4ZFOB 1KCLA 1QQDB 2LTQC 4FFVC 4HS6B 3EFFB 3DX9A 4EKXA 2YPKA 4NQXA 5D7LB 2QQNL 3ILPA 4YIQB 1XCTA 4RX4A 5JIKA 2LABA 5D7KD 4HX1B 4PG9A 1S7RA 3T0EA 2BVPB 1EZVX 1LEKB 2DBLH 4G5ZH 4NQCD 4NO2B 4EN3B 3MFFA 5B38B 4R0LC 1KLUA 1X6LA 5HHVL 3VXRE 3QXUA 3PWPB 5MENA 5JA8B 4S1SH 4HIHB 3UJIH 5I75C 4J12A 4QEGA 1OAXL 4XMLL 3SPVB 2ADIA 2X4PA 2NCMA 1JGEB 3CSBA 5IKCB 4PB0H 2BNQE 1EJOL 4W4OA 4DOHB 2JKXA 4TULH 4CVXA 4XNMA 2RFXA 5ANME 1WBZA 1X44A 4RAUB 3S5LG 4GMSH 3S35H 1T7ZA 1HI6A 4X4MA 1ZLUK 3VH8A 3E0GA 4NJ9H 4LLVA 5T3XD 2HRPH 3JV4B 1XF2A 4LSVH 5HGDA 5C09A 4P46C 4HWEL 4NRZB 3VXSE 4D0BA 1GSMA 1AQKH 4K3JL 3VA2C 2DQEH 1K4CB 4P9HH 2FX7H 4OFYA 4LVOB 3RA7H 2WWMC 2ZPKL 3ARSA 3E3QC 2R0LH 3MV9E 3FQRB 3VFWA 2F54E 4JDVA 1RK0B 4KAQL 4PJ5A 4X6FA 4ELME 3L3IB 5DJYA 5GS2H 2C3GA 4XBPA 2DLFL 4X9FA 4JVPA 1PG7X 1FRGH 4OLYL 3MRBA 2R2BB 2CMRL 3X3GL 4ORGB 4LLYB 5CSZA 4HIIA 3MRCA 5ADPH 4OFDA 5I15L 3BVNA 1YNLL 2ERJC 4WFED 4NKMB 3WFBL 4PJEA 5E94A 1RZIA 1D9KB 1JUFB 4KGJA 3ARFB 4NPYA 3TM6A 4FZ8H 3GRWL 2DM2A 1NMAL 4IDLA 1VFBA 1WICA 3AB0C 1CE1H 4NCC1 2Y25A 1MFDH 5LGHL 3SKJL 4XC1L 5C08D 1NFDB 4KTDH 1A6VH 3SKUD 4W4OC 3GJFB 2UYLA 1YNKH 1WFOA 4R96B 1T03H 1T2JA 5LXGL 5D7JA 1LP9B 1FH5H 3GGWB 3DBXB 5T5FH 4EDWL 3RVXD 5I66B 4ZFGL 3C5SA 5K59E 3IFLH 3K74B 3FFCE 4LCYA 4XAWH 3EZJB 4P5KB 3OSKA 4UAOB 3OXRA 3SE3A 1JRHH 2A73B 5D2LA 3VRLF 3O6FA 2ICEA 2EE2A 3MBED 1PX4A 3Q1SH 4YDLB 3KNBB 3VD9A 3X13B 4WW2C 4OD2A 5HI5C 3BKYL 5CCKL 3DI3B 5IEHA 4XWGH 2FB4H 4HF5H 5ISZE 4JHBA 2R1YA 1T0NB 4FXKB 2EDHA 5DD3L 2MFNA 1IMHC 2A2QT 1U95B 4KK6D 2GFBB 4LPWA 2H32B 4PRIB 4J3OC 3WEXB 2CQVA 3NACH 3W0WB 3DUSB 2DLTA 1QYGH 4L8SA 4S1DD 1U8HB 3QULB 1NCUA 1IGCH 3OF6A 1NGYB 2Z8VC 3PWNB 4NSKB 1KLGB 4HT1H 1VESA 2CKNA 1GRWA 3ES6B 3RGVD 5FOBB 1T1ZB 2IALB 3T1FB 5I71C 3CX5J 4Y1AD 5TDPA 4D8PA 1PYWA 4JFZH 5CILH 4TSCL 2O61A 1H8NA 1BAFH 1LQSR 3QFJE 5ETUA 4L4VB 3TO4A 3H3BC 3QG7H 2EDBA 4PJFA 3U9UB 3U46A 1IILE 5D7JC 5IP4A 4J6RH 3O2DH 1ZVSB 1YN7B 4ZS7L 5EU3B 1W0WB 3STBA 4LLUB 4ZSOA 2YD3A 2ENYA 4BQ6A 3I9GH 1QSED 3SE3C 3HZVB 3TBVB 1KFAL 5JLZA 3O6FC 4TUJB 2Z31A 3HB3C 1UACH 5GGVY 3MV8A 4ZOEA 1MEXH 3K81A 4RGOH 1YMMB 2CIIB 2EYSB 1A6AA 4O58L 1EIBA 3T0DA 2DJ4A 5F9AC 2J7LA 2A74B 3T4YB 3H9YA 3P11H 2VZUA 3U30B 4D9QD 4LLWB 2EDQA 3IDXL 3QEQE 1U3ZA 1ODAA 1G1CA 5J12C 1TXKA 2A0LD 2AKRB 1PKQB 5F7LB 5J7CC 3BDBA 2HYMA 3E8UH 4ALAL 4L8SC 4S1QL 3EYQD 3RIAK 3VFMB 3O41B 5DK2A 3LKQB 1FVDB 4WFHD 3MOBH 5SWQB 3T2PA 3HNTH 5GHWL 4ODXB 5IHZA 4OI9A 4R2GD 3SGDH 4HC1L 1ES0A 3WHXB 2GY5A 1J87A 4P2OB 1KOAA 4XCFL 1Q72H 2EE9A 2QSQA 2YR3A 1N3NB 3OKYA 4MCYA 4CVZB 1JP5A 4PJIB 3FCTA 3S37L 1QO3B 4BK5A 1WFUA 5ESQB 3ARBD 4LBEB 3BGFC 4LMQI 1OP3H 5F7HA 3KLAA 5ICZB 2Z35B 5DD1H 3BKCH 2OQJB 1QNZH 1G9ML 3OB8A 2ADFH 3W11D 1VEMA 3MNZA 2HWZL 4NZRL 4QRTA 4F7CA 1VKXB 4NHCL 4EI5A 4I0CC 4EDXA 4OSUL 1HINL 1K8DA 4PGCA 3VXME 1HH6B 3BP7A 5GSVA 2ICWB 1SVZA 2DIBA 2XG4A 4YEFA 2CUIA 4CNIB 3KXFD 4U7SA 4OTXL 4ODUA 4PP1D 3MRRA 5BV7B 5FM8A 2E7HA 1YNTA 3TT1H 2JCCB 2ICWI 3PJSB 3QCTL 1ZV5A 2X4UB 3L9RA 5CZKA 4Z7WA 5KVGL 2EDKA 3WN5A 4UV4L 1S9VB 3KYMB 4NCC2 3KPRD 3RWJB 4LSQL 4K3DH 1HSAA 3WUWB 3STLA 5EORL 1TNMA 3MXVL 1JYXA 5HBBA 1ZT7A 2DQDH 4FRWA 4KJQC 4JJ5B 3EO9L 3ZT6A 2VXTH 4R97C 3DSFL 4IMLA 2D9CA 3HUJE 3O2VL 4P2RA 2OXHA 5F9JB 1JWUA 3IFNL 2APWA 1I9EA 3A67L 3ULUC 3UTQB 1MCWW 4PRHD 1AGCB 4CN4A 1XIWB 4H26B 3S96A 4NQEA 3D3VE 4Q9RL 4U1KB 1K5NA 4MA8L 5D9SA 1G7JB 4Z7VE 3LS5H 4JPKH 3U9PL 3WFHA 3VFGH 2CR3A 2E9IA 2DQUL 3IS0X 3W82A 2HVJB 3KJ6H 5C3TA 2YD4A 3MRFA 1OM3H 2R4SH 5HYEA 5FYJU 4BH7A 3PNWB 3NIFF 4KDWA 5JNYB 1P7KB 4G9DA 1QFOA 3LQZA 1G9NL 5T1LA 2CXGA 2VAAA 4EI5C 3WSQH 4RNRA 4P2CG 2CKBL 3B9KD 2PTVA 3IJYA 3VMOA 4FQ1L 1O0VA 2E9BA 5FA4B 2NNAB 1JHLH 3IJHA 5E1HB 1CGXA 2Y36L 3MNWB 4H0HB 4IRJA 5FYLL 4NFDA 2XTLA 1JPSL 3HC3L 3C09B 3NCYS 5DO2D 3LHPL 2YXFA 4X6BA 4D9LL 5D6DA 4XPHH 4H8WC 1JWMA 3QWQB 1WUNT 4PJBB 1TZGL 2G5BA 4ZAKD 2VL5A 1KTRL 4FXGB 4MHHI 5DD0L 4XBEL 1NANH 3NVQA 4TTDC 4X6DF 5HD8C 3T0AA 1MJ7H 3NTCL 4G43A 2QKIB 5LCVH 5C7XH 2HH0H 2PXYA 1JZ7A 3GJEA 2NY5L 4XMKH 3IJSB 1B4JH 3RUGB 3PP4L 4KI5E 2WZPD 5B3NA 1ZE3C 2BHYA 3QUXB 5CP7B 5IESH 5FUZH 3PV6A 2PKDA 3DRTB 3KDMB 1HHGB 3EOTL 4N90D 1TJIH 1CFNB 3EYOA 4KJWD 4O51A 4YHPA 4NGHH 5D7LE 3BUYB 2E5EA 2HFEB 4XNYL 1CFQB 2A6JA 4ZOAA 2VXSH 3VXSA 3O3AB 2BY2A 5I6XB 5L7XH 2B7DT 4ZO8A 1PQZB 4WFFD 4LPVA 4QXGH 5DJAA 3G5VA 1WZKA 1UADC 4IRJC 2W07A 1BQSA 1IFHL 1KJ3H 3MV9A 2F54A 3V79C 5EU7E 4WNQB 2Q8AH 2EC8A 2MKLC 4ELMA 5EU6D 3CFEA 1R6VA 3C87A 4H25B 5D6DC 1OWRM 4JFQB 3ZTJG 5FK9B 4P5TA 5DFWH 3RNKA 2VUYA 1H0DB 3HMWL 1T66C 3N1GC 1QP1A 3DXAD 1F4AA 4OIIH 5HY9B 4HS8L 3RY5A 2XKUA 1J86A 3V5DA 2VE6B 5H2BA 1FSKB 2ZP0T 3MA7B 2PXYC 1BGXL 4JY5H 5IVZB 4IS6B 2ZSVB 5INDB 4CRPA 3HI5L 3BRGC 3QJFB 4KK8C 1H3WM 2FJHA 4XMLH 1IAKB 5FEBA 5E95B 3I02B 2G2RB 4KZEL 2D03H 3BP6A 4PBWD 3VG9B 4L3ED 3PXHA 3D39E 4RWYL 1MJJA 5IGXL 3GUTA 5C0GB 3FFCA 2DKMA 1F97A 4K07A 4NO5B 5ERWA 2XZCH 1T2XA 5GRJH 1IGTB 5GZOD 1O7SA 4B53A 5IHLB 4HWZB 3G08A 3P0YH 5CLWA 2X09A 2J8UB 3UJTL 3TIEB 4I48A 4XPAH 5I18L 1BOYA 1CF8H 2R1WA 1XR9A 4K3JH 4KH2A 1MCOH 5ISZA 1A6UL 3RGVB 3CZFA 4Y1AB 1EBAA 4WI4A 2IQ9L 1NCWL 5J9PB 3L5WA 2ZPKH 4U6YB 5T3ZH 1HNGA 1I9IL 5HJ3B 3G6JB 4N5ED 5I1AA 4YHLH 1OGAD 2C4XA 4KAQH 4P5TC 3SJVD 1NFDE 1DTUA 2DQCH 1A4KB 1FNEA 2ZUVA 4YXKH 2Z4QA 4QYOA 2G60L 4OCXL 4JPIB 2N4IA 1F3DH 5JXED 1F45A 1I3UA 1V7ML 4NN6C 5EUKB 4AIZB 1C12B 1QSEB 5I15H 5JOFB 3NA9H 1JN6A 1VSCA 3LN5A 5HI3D 1GGBL 1LO0L 3CLFL 4Y5XB 3P9LA 3OHXA 3ZDXF 5CGYC 5FA3B 1NMAH 3MX0A 2R0ZH 3VFRB 3W9DB 1BIIB 1Y0LA 3LPGA 3QFJA 3GIVB 4XRCB 1AY1L 3NZ8B 3BP5A 5E00A 4K71C 3CSGA 1FN4B 5F88A 2IGFH 3UTOA 4PJ9D 3VXQA 4YHYC 1GXEA 3GSQB 2BRRL 4DGYL 4I2XB 1YEGL 3NIDF 3FMGH 4ACPA 1S5IL 4CN6A 1JI2A 2X89A 1IC1A 3LQMA 3PDDA 3WNKA 4P59L 3H9SD 3BGMA 4PRIE 4DJMA 3PABA 4GG8A 2Z0BA 1T3FA 4XWOD 1SJEA 3VFVA 3W0WE 2E7LA 4PY8J 2HG5B 1M71A 5EUOF 3SQBA 3CFIC 4E42B 3C8KA 5ESVB 1QUNA 1NCAL 4GRMB 2EDJA 2C1OB 3L1OH 3MLVH 4YQXL 4X4ZA 4G7VL 3QEQA 5C86A 1F3RB 1CGYA 2EIZA 5DWUH 2ARWA 4OM0H 3BH9B 5C0FB 1KXVC 4X4YA 3RWCB 3TO2B 1X4XA 3UPRB 3LMJL 2NW2A 3MLUL 2YKLL 3DROB 4L4VE 2LFGA 5KOVC 3IXTA 3UTPE 4I3RL 5E6ID 5IROA 3OKDB 1ED3B 1C08A 3VU2A 4EOWH 3QEUA 1SEBB 2VMFA 3QRGL 3UTTD 3O6ML 4ZUVA 3LKOA 3ILQD 5FKPA 3KXFB 5GRUH 3L7FA 4UIKH 4TRPL 3CVIH 3CSPA 1BZ9A 1YMME 2GT9A 2FGZA 3TYFA 1ITBB 3IDJB 3RWEA 2HRLA 5LGJA 1QVOB 1ZT4B 3WFZA 3KPRB 4N8VG 3H8NA 4KRPC 1GGYA 2X4RA 1PKOA 3T65A 1PKQE 2JJWA 5EC2A 2BMKA 1MJUH 1IT9L 4GRWH 2E7LC 3VXMA 1YJDC 1KFAH 3TV3L 4YWGL 4JKKA 1G7MA 4E5XB 1GC1L 3NCJL 1M7IA 1YEEH 4RMWA 5ID1B 1J12A 2DMKA 4APQB 4NNXA 1G7IB 4L9LA 2DQJL 4PRHB 4PTUB 1MELA 2GJ6D 2Y6SD 4L3AA 3ZKXC 3MMEB 5JW5A 3IDXH 1NDMB 3VI4E 2IF7A 4HBCH 1LK2A 3KPNA 5DLML 3FQXB 3OKNB 2VJXA 2CUMA 2E7CA 4G3YH 2D7PA 3LAFA 2VLRD 4PJIE 3MJ7B 1FNGB 1TTGA 4MVBD 4O02H 1WWCA 4PJHF 1G6RA 5TQ0L 5BCAA 1UCBL 5IROC 5L88H 5GRZA 4GQ9L 1N2RA 2NTFB 5TPWL 4ZXBD 5BZDA 2GITB 3B9KB 1ZLWH 3LSOA 4ZPTB 3BJLA 1JWSA 3S36X 4Y2DD 1UC6A 4WV1A 1A7PL 1F3JA 2RQ8A 5TF1H 1J8KA 2CO7B 2DQGL 5DFVD 2WUBL 1T6WA 4GLRH 1S7UB 2M2DA 2JCCE 3QNYB 1IEBA 4N1HB 3DOSA 2CD0A 3EO1A 4YBHA 4U1JB 4G8GD 1NCCL 3UAJD 1ORQB 5DHXB 3ZYIA 3GBLA 3T3PE 3UYPA 1CT8A 1EAPB 3WFCL 4CJ1A 4O4YL 3H7LA 4NZRH 1JPFB 3SCMA 1ZS8A 1MH5A 4XMPL 1RPQA 3VE0B 2VLME 3GKWH 4HW6A 1Q9WA 2EIEA 3OGCB 5EZLA 4U6TA 5HVHB 5EO1A 1D5ZA 4L9LC 1N6QL 4OLWL 3VXUD 5C2BL 3LZFH 1FG9C 3GSUA 4V2CB 3QPXL 5BVPL 3QCTH 2XT1B 1G0DA 3WFDH 3KPLA 4KVCH 3RL2B 3MREB 4ODVL 1AXTL 4C83A 3MXVH 1ZVHA 2OL3A 5F6IC 1AGDA 1SJVA 1XAUA 1YEIH 3EOYG 4QRRD 5T1MA 2XRAL 1S9WA 3GFUA 4JZJB 4Z6AT 5CGMA 2E8ZA 4Q9CA 1UH4A 3DSFH 3HPJA 4ZNCD 5CJOH 4XP4H 3O2VH 2OJZL 4WRLA 3FO9B 2Q8BH 5HPMA 5KVDH 3EOBB 4WV1C 2XY1A