3RTQD

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD02
4PGEA 3PWUB 1HZHH 4AT6B 4JM2B 4F7TA 1LVEA 3TO2A 1P4LA 5IJVA 2QSCH 1GCFA 4WY7L 5HHQA 2DD8L 2EYSA 4PJAB 3AY4C 4CKVX 5KANI 2ARWA 2EEAA 3AM8A 1BPVA 3SE8H 3GO1H 5EA0L 3OJVC 4X4ME 5T33L 2P4AB 1IGTA 2HFEA 2VWEE 1LO0H 1NCBH 3X3GH 3P9MB 5LAXB 3S34L 5BOZG 4LLVB 1C16B 4EVNB 1JHLL 3WSQL 5KVMC 4H8WC 3D39D 4J3UA 1EA9C 1Z5LA 4M03A 5IVXE 5T1MB 4KMTH 4JPVH 4OQTH 4U7MA 3K8MA 2V17L 2R2BA 3A0OA 3CC5B 3MA7A 1W72B 5GRJL 2O5XL 4I0PD 4KJWC 4OFYA 3STLB 5DEFA 1IM9D 4MA8L 3AU1A 4GKNA 5ADPH 3KPPA 4MCYA 3MR9A 1FYTB 3EHBD 1YJDC 2DLIA 3TESA 4UOW1 2YZ1A 5HI3D 4NSKA 4NQEB 3IXAB 3B4NA 2WQRA 4BSVB 2YEZA 4OZGB 1VPOL 3C5ZC 3CIQA 3MOAH 3EFFA 3OKYA 4K71B 5I8CB 3K4AA 4X0KB 4IDLA 4N0RA 3BQUD 3QQ9D 2J3SA 2AEQL 4YHKL 5HI3C 4ZD3H 4Y4FD 4I9WE 5JOPE 1S7WA 1Z3GH 1OHQA 4BZ2H 1INQB 2Q87A 3V8CA 2YRZA 3VXSB 1VERA 1JWMB 1MHHA 4G6FD 4Y4FC 3X3FH 2G2RA 3H6JA 2D0FA 3HZVB 4Y2DB 3BP7B 2Z31A 2I9LA 1NMBH 1ONQA 3S9DB 4LPCA 4APQB 4LSTH 5IV2B 2DKSA 5I76A 4NOFA 3WIHH 2WUCH 1JYWA 2Q6WA 1EAPA 3WNNA 4R97C 4M7LT 1BJ8A 2B7DT 2Z4QB 3W9EA 3Q2CA 2Y36H 4PJDA 1PG7H 3OZ9L 3G9VA 1TMCB 4C56D 3OMZA 2ZPKH 1YECH 4JO3H 3UYOD 4KFZC 4M4RA 1Z9OA 1FVEA 5F9OL 1N6QL 3LZFH 1FVDB 3BD3A 4Y5XB 3D2UB 1JWSA 3NH7L 1EERB 5IT2H 3RTQC 2APTA 5EU5B 5J9PA 1AC6A 1JV5B 3TBVB 3KXFE 4WCYH 4OUUA 5GS0L 4AEHH 4HUXB 4KK6C 3UTQA 2BHYA 3C6LA 4LBEB 1LDSA 4UT6H 1QYGL 1B4JL 5I0DA 4OZ4B 1AXSB 3GJFA 2MCPH 3SDXA 5DI8B 1MLBB 4C83B 2P44B 5IJKC 2OTUB 2VITA 3QWQB 1TZIB 4U33A 4F7EB 3TBYB 2AERT 3PJSA 1BBJB 3FRUA 4N8VB 5GRYA 4RDQG 5E2UL 2OZ4H 4KHXH 3DRTB 1WWBX 1TVHA 1GGIL 3FAWA 3HE6D 5TH2B 4HGKC 4W4NA 1RIVL 1U8KB 3DVNB 4K3EL 5DHVB 4Z7WA 3PP3K 3U9PH 2O93L 1JHTB 3MV8B 3BGMA 3HB3D 4NNPL 2C3HA 4HH9B 2QR0B 2NTSP 4G80A 5K9JH 1AQDA 5IBLD 3N9GL 1UKTA 3ZSSA 2HTKC 2X1QA 2FIKB 1OAZH 5EUOF 1NFDA 1UXSA 1ETZB 4LVHC 3RWIB 1NPUA 1BM3H 1CDCA 4PV8B 3L5HA 4GBXA 4JFQA 5CEYA 2RQ8A 3OGOE 4RFOH 4TULH 1ADQH 4WI7A 3DV4B 3BQUB 1XGRA 2FCBA 4Y4FB 3CFEA 4PP1D 4WI8A 4YIQB 2YPKA 5HI5C 1JK8B 3GMPB 1TTFA 1YN6A 5GQBA 3L3IB 5BXFB 5F72S 3IJSB 5FAAA 2VLKA 4MVBC 2B0SL 5KVEL 5GRVK 5C07A 2WIIB 3MUZ1 1J5OL 4O9HH 2QHRL 5JDJA 2HYMA 3JSSA 5MEQA 1HHIA 4DAGL 4EXKA 3DO3A 3QWOA 5IMLB 2G75B 1JGEB 5FM5M 4PY8I 5FGBC 2Q8BH 3ARWA 1RZ7L 2P43B 4ZNCD 1AO7D 1WLHA 1LEIB 4LAQL 3DX8B 4D0CA 2BSED 5EOQH 4KVCL 1Z2KA 1BX2B 4UIKH 3RY6C 4QHMB 3GI8L 1MCOL 3LKNB 4F2MA 2MQ0A 5TDNB 1K85A 4WW2B 4BSJA 1K5NB 2GK0A 1GH7A 3HI6H 4G8FA 1NAMH 3QIWA 3WDHA 3FTGB 2Y5EA 1KT2B 4MD5A 5JDSB 5K93A 2VAAA 4FQQA 2X1OA 1BAFH 4Z8FH 5M7QA 3IVKB 3K7UA 2YK1H 4LCIL 5DFTA 5L2KD 1FG9C 5BS0D 4WW1B 1YPZA 4PRBB 1S7XB 4FQLL 2FBJH 3GKWH 4XH2A 2ITCB 3DETC 4X5LA 1T2XA 1TCRB 1KJ2B 2Y1VA 4PJ8A 2OP4H 2O5ZL 5ICYA 1UM4L 2G9HB 2IWGA 4CW1B 3HPLA 1XIWA 1R5IA 5KANG 5TDOB 4GQ9H 1CVRA 3QDMA 3ESVF 4LVHB 4RZCA 3MRLA 2CKBL 1KENL 3NN8B 4KQ3H 3TVMA 4LSQH 3G6DL 1LK3L 3UC0H 1IC4L 3LH2L 4L8CB 4RDQF 3MOQA 2DQTH 3QH3A 1D6VL 3IJYB 3B43A 2HN7A 3DTXB 2GUOA 3LY6A 3SJVD 1G7HB 4HMCA 2QQNL 3IFLH 4TSAH 1XF1A 3EZ8A 4UT7H 5I0ZA 3EYUL 5D7KE 3QIUA 4M1CC 3VXRE 1TJHL 3KPQB 2BVEA 3EYSL 4XWGL 2V9RA 4UT9H 4Q58C 3HLAB 2W0KA 3REWA 2CMRH 3RQ3A 1PBYA 3BIBX 4KK8C 3PXHA 3TGXA 3MJ8A 4F7CA 1FFPA 2X70B 4ACPA 5F6HI 5GJSL 1YEGH 1QSFA 4JKKA 1L7TH 3QQ3B 1XZ0B 4MJ6B 5E8EB 3MNVB 1A7BA 1AO7B 1P2CB 2WUBL 4YUEL 2J8UA 4HBQA 4WI3A 4RWHA 4IDJH 2FD6H 2ZP0T 4X7FC 1MAMH 1S5IH 5CIPA 3L5WB 5BMFL 4PRAA 5CD3B 1RULL 2HWZH 2XFXB 3QQNA 2GJZA 1JTTA 1O0VA 4H25B 4JG0L 4LP4A 1UM6L 4PG9B 4KV5E 4HUWB 2B1AH 2YD4A 2CIIA 4RGNE 1HN1A 2VSCA 2EDOA 2PYEA 1DVFA 1JGVL 3BSZL 3ZKND 4EUPB 1VKXB 1JPTH 1NEUA 4G5ZL 1XR9B 3VG9C 4OLYH 3U4BH 1R24B 4FTVA 4BH8B 4ALAL 6CGTA 2E7BA 1YQVH 1S7VA 4ODXA 2QSTA 5FYJD 1N6VA 4PJAE 3N85H 4HAGA 2R0WL 2FYYA 2CJUL 5IR1A 4OLWL 3RBGA 3NZ8B 3PGFH 3CU1A 3U6RA 1NDMA 2RFXB 2ZCKL 1YUHB 1U8HB 4LLUA 5FYJU 1AD9B 1WZ1H 1ZS8A 4PJIA 1RZKH 4Z7VB 1BZ9A 3LN4A 5LGHL 1E27B 1LE9A 2OS7A 5F6IB 4FQXD 5C3TA 1SVZA 1WFNA 4JVPA 5B38A 3TN0A 3B2VH 1N8ZA 4TNWF 4M8VA 1XGTB 4XWOC 2P46B 2A83B 3W5MA 3FN3A 1EUUA 1XF4A 3PWVB 4OZFH 3SQOL 5ID0A 2GAZA 3ARED 4Y1AD 5E70A 2ICES 4D0BB 3U7WH 1BIIB 2A77H 1FYTE 4NN5B 2OJZH 4HUUB 1W8OA 3G6AB 2YPVH 4WWKA 4FQ2L 4UNTA 1IAII 1MCEA 3SJVB 4S1SH 4KHTL 4OLVL 4NM8L 2HJKB 1YEKL 2B4CH 1ZKAA 2BNQA 4OZGE 4PGDB 3Q3GB 2ARJB 3MOBH 1D5BA 3P0YL 4B7IA 2XZAL 4NUJB 5DT1H 4GG6B 3VXSE 3GNML 5EULV 3F7YA 1G9MC 5DO2D 4YNYA 4YPGA 5IROC 4W6YB 1A3LH 4O51B 4JHWH 5HHXH 1CFBA 3QJHB 4RSVA 1KCUL 3ROLA 1BWMA 3WFEL 3QFJA 4MNGB 4JPWH 4RAVA 2IGFL 3QPQD 3AXLB 3OKKA 3ULUC 5M95B 2X9WA 2L7UA 3GBNL 4L3EE 3WN5C 1CFQB 4W6WB 4RMQA 3QPQC 5B38G 5ECJE 3WNPA 1T04B 1VESA 3ELAT 3CVHL 2UYLB 3I02A 4KDTC 4ODSL 4W68A 5I2IA 3VG9B 1KLUA 2RIKA 5IBUG 1QQDB 4R6UA 2ADFL 1C08A 3CZFB 4XPHL 2JLLA 3RZCC 4WVRA 5L2JA 1F11A 1F2XK 4HK0A 3U48A 3EYVB 5BRZB 5IHUH 3HUJA 2NW2B 3T0WA 5DEZA 3QUXD 3UZQA 1RIUL 2EIZB 5E2VL 1UENA 5LQBL 1MFDH 1WBZB 1QLFA 3KPLA 2ERJB 3CH8A 3MNWA 2FNBA 2JB6A 1S7QB 4ZUVB 3O8XC 1PY4A 1SYVA 4Y19D 3QRFM 3D0VA 1U41A 1NCAH 4LEOB 1UWXH 2AJUH 4YXKL 5DD5H 4MNQE 4POUB 1ZVHA 3MC0A 1AR2A 2J4WH 5GS1C 3C5SA 5IEKB 5FCUH 5HYSA 3IDMB 4HC1L 4OF5A 4GXVL 1CGUA 1AIFB 1GHFH 5L7XL 2WIMA 5FK9A 3FFCA 2ZCHH 2WINA 3NPSC 2JB5L 4OCRL 3V8OA 3VMNA 3S35H 4FQXB 4R4FL 4K3DL 5SV3A 1KV3A 3V5HA 3NCYS 2LVCA 3MV8E 2F5BL 2VDPH 1KN4L 2JE8A 1B4RA 4IRSD 2ICCA 3QO1B 4EDXA 4Y1AB 3O6FA 3V4PL 2F53D 3RJQB 3F12B 4PJ5B 1I9RH 5ANME 1QFPA 2PF6A 2ZKHH 2AV7A 2CLRB 2C7UA 1YNLH 3EDKA 3V9FA 5KSBA 3HAEA 2NY6D 2W65A 3ARFA 5TE4L 4YGVA 5LGJA 4NQXA 1I9EA 1OF2B 4PYGA 4XAKE 1JRHH 5FYJL 5DTFB 5JHDD 2QKIB 5CFHA 3O2DA 2CRYA 1HXMB 4BH7B 4KTEL 4CVUA 4JFFB 4EQ2A 2V2WB 3QNZA 4J8RB 4QHNA 4NKDB 4C59B 1S7UA 3NFSH 5ADOL 2IH1B 2GYSA 5AZEL 1FDLH 3EW3B 3UJJH 3MRRB 3BYTA 4IMLB 1M7IB 4L8SA 3BD4A 5L8JB 3J8F7 4LLYB 3DUUB 2X4PB 4GRLC 2HMID 3SPVA 1UZ6E 1T0MB 3QULB 4UDUA 3EJYC 5JIPA 4N8CL 5HYSG 1AKJD 2QSVA 3O11B 4JZJA 1A7NL 4CU7A 3U36B 1WEJL 4MSWB 5BV7H 1IGYA 4MA1B 4TUKL 4UNUA 2GSGA 4M1GL 5E2WL 5CZXC 3RZCB 4HJ0D 4U1JB 3RUGB 4POYA 2DDQL 4QWWC 4EXPX 4KXZH 5FYKE 1Z6JT 3GSNB 4G9DA 5IESL 4HDIB 1S3KL 4CVWA 2VZVA 3ES6B 4PRNA 1A4KA 2XTLA 4HJGA 3UCRA 5GGUB 2HVJB 5IK3B 4NJ9H 5CZVH 5T5FL 3RL2B 3QUXB 5DJCA 4H5SA 4F37K 3HAEG 5MP6L 1VADA 3X13B 2BC4B 3H42H 3MLVH 3D48R 3VGBA 3B9EA 4M00A 1B3JA 1J05B 5D93C 3UJTL 3S88H 1KJVB 4OBSA 2ZUWA 3T0VA 5IMMA 1DBJL 5KSAC 4Y19B 1N64H 1CWVA 3SDCD 3BUYA 2IQAB 1OWRM 2NTFA 3NPSB 3MXVL 3RP1A 3KPTA 1RZ8B 3PNWB 4XCEB 4FQCH 4PLKC 1EHAA 3UTTE 3NIGE 2K3TA 4PY7B 5F8RC 3EOTH 1H15B 1UT9A 3JV4B 1OM3H 1HDMB 4KJYB 1DE4A 2D7MA 5F96L 1MHPL 2UZIH 4X6DF 5J4MA 4JFHE 1BQHA 1U3YA 5EBWA 4CMHC 4R0LA 1KB9K 4CBPA 3GSNL 3ARDA 4RGOH 4XVSL 1E4KC 4UQ3A 3EO1A 1RZGA 3S37X 2W59A 4OCSL 2F53B 4QHKJ 3SOBL 4ZTPH 5C0DA 3QI9A 5DURB 3R1GL 1KPRA 5GHWH 1LGVA 3KLSA 4RFNC 1IKNA 2NY6B 2R56L 5AD0A 1JPFB 2RCSH 3MRKA 3FCTA 5JHDB 3V4UH 3VRLE 1P1ZA 4PJGF 1DBKL 2ZOKB 3N1FC 1TIUA 2BOBA 2AXFA 4K9EH 5D1ZD 3FMGH 3ET9F 3D25A 4YAQB 4GRLB 3LS5L 1IILE 4PJXA 4HWEL 3MCKB 3Q6GH 4OTXH 1NCWH 4YDIL 3MUY1 1BFVL 4EJ1C 1UB6A 2X4OA 4U1HB 2HJFA 2BVYA 2PKDA 3QXTA 4L29A 1E6OH 1EJ6A 3W39A 5GRXG 1AKJB 5F1NB 2DOCA 3FOLB 4OLZL 3E1F1 3W11D 3VWKC 3H0TB 2HVKB 3KPSE 4NQCA 3QA3B 5CJQL 1GXEA 4CVZA 4PLNC 5E94B 4BFIB 1BQHG 1R0AH 2BRRH 5DC4B 2ENSA 1RUAL 3EOYG 4XP4L 1QACA 4TOYH 3WUWB 3PWUA 4UDTA 4X5XA 5I1AB 5INCB 4AT6A 4JM2A 1EXUB 4JO1L 5D93B 2C1OB 4Q2ZB 1NGQH 3SO3C 1FO0B 5FA4A 3CFDB 5KSAB 1I8KA 3D18B 4KK5C 3RI5K 2V5MA 2VL4A 4XNZB 4NPYB 3P0VL 3DGGB 2VR4A 2PNDA 4PIRF 1KC5H 5HHOD 3IRZA 3P11H 3ZHKA 1X6NA 1RAMA 4ORGB 5IVZB 4YZFE 2V5SA 1VHPA 4U1SB 1K6QH 1F3DH 3RGVD 3FO2B 3I84A 1FFOB 1ZOXA 1B0RA 1UH2A 3M8OH 1FGNH 4NWUH 4DVRH 4AEIL 5E2TH 2EZ0C 2J88H 4OKVB 5TE6L 4R7DB 5TE7L 4NGHL 1MLCB 3KJ4B 4U49A 1XF5B 4HFUL 1MJ8H 4OV6F 4LEXL 4ELMB 1M4KA 4XBGB 4QEGA 4Z7VE 5F44A 3F65A 1OSPL 4PJHA 2Q8AL 3MRIA 4EZMA 4RFNB 4DFHA 3BESR 4HQQL 1O7SA 5EZOH 1QPPA 5LXGH 4NQEA 5DRZA 4HWZA 5D7IB 1JN6B 4DVBB 1MREL 5JW4R 1FO0L 5C0NC 5I1JH 2UUDK 5F7KC 2FO1A 2LQRA 1GIGL 3L3GB 3CFKB 1X44A 2HT3C 2MPAL 4KZEH 1AGDB 2AXGA 1GAFL 5I19H 4YBQD 4LIQE 4YWGL 5IB2A 5DJZB 3VH8G 5IEHA 3O0RH 2XTJD 3LIZH 1HILA 4OCMC 4LRIC 1MI5D 5E8PB 5D1ZB 4KGLA 3B6SA 3QXDB 5DVNA 4Y2DA 5HHPB 4S1DD 4GXUM 1T1ZA 1L7IH 5TFSH 1AD0B 4NBYB 3GSWA 4PTUB 3MJ6A 3EO9L 2IANA 4FFWC 1ZTXH 1U91B 3QHZL 4M61A 4LVNC 2YMXL 3VWKB 1A7QH 3OAYH 1UKQA 3GJFH 3AUVA 4C4KO 3WBDA 5E8DL 4BELD 1UWEH 1KB5H 5T3XD 2E3VA 5ISZB 1AY1H 4XT1C 2BXYA 3R0NA 4AEFA 1TTGA 2Z4QA 5H2BB 3JWDL 4MNGE 5IFAL 2OI9B 2X1PA 3C5JA 5AAWA 3SGEI 2R1XA 5E4EB 1QR4A 3MCLH 3VFGH 3U4EA 3ZKQD 4K7PY 4F9LA 5DHXB 5CJOH 2BCKB 3OXRB 3ZDYF 4N5EC 1JI2A 3DSFH 3NGBC 2DQJH 1A7PH 1F45A 4U1IB 2E9IA 1FVDA 1T7XA 4DEPC 1XGUA 5FYLH 4K2UL 4MHHG 5ICXA 3EZJB 4I0CC 4PREA 1JV5A 5I1CH 5HHOB 2FHCA 4R8WL 4HUXA 5BW7A 5DMGD 5BRZE 2JCCB 5DRXA 4XPGL 1JF6A 1J11A 4P4KA 4P23C 3U30B 1DUYB 3RGVB 4C83A 1MLBA 2D0HA 5DD6A 4C4KT 1DBAL 2FBOJ 3HN3A 3D39A 5FB8B 1LEKA 2BDNL 2EIBA 3HS0B 1FSKC 3V5DB 2CDGA 1SMOA 4RIRA 5TH2A 1U8KA 4I0PA 3MGOA 2Y4SA 4LNVA 1FNSL 2YBRB 2EYTA 3LOWA 3NZHH 1JHTA 4JR9H 1IM9A 4JN2A 1Q9WA 3DX9B 2UWEB 5ESVB 3MBXH 3VGFA 4XAWH 2FL5A 3CMOH 1RK1A 3BRGC 1F4XH 1ZHBB 4D9QE 3LN5A 2E6PA 1TQBC 1CBVH 2G60H 3GSUA 1RSFA 2GI7A 1DBBL 3KJ6L 3TYGH 4PJ5E 2CR3A 4PGZA 3EJZD 3SE4C 2QADC 4YEFA 1L4IA 2XTJB 3UO1L 4H0IA 5EO0B 2XA3A 3L1OH 1BOGA 5SWZA 2F19H 4JPIB 4OCXH 5CINH 3GEWB 2EH8L 3TLRA 2WIIA 4JFFE 1CR9H 1I3RA 4WI2A 1T1YB 4TUOA 3O81A 1ZVYA 3ZYIA 3TA3D 4G7VH 5CGMA 4ONFH 1FJ1A 5IB1A 4JQXA 1HK6A 1JGEA 3TBWA 1IKFL 2EE3A 3KYKH 4G3YL 3ULUE 2WBKA 1LEIA 2XKSA 3DVGA 4QXUH 1UYWH 4JLRB 2AGJL 4C56A 4HS6B 4LSSL 4L1HA 1F6FB 1HOCA 4WW2A 1K5NA 3FFDA 2W9LA 2CKBA 5EOCH 3V6OA 1KYOK 4YE4L 4X98B 3RUGE 4O00A 4S2SB 5D71L 4NCC1 4U1GC 1DBML 1NMCC 5CP7A 1G0DA 2P5EB 4AY0A 2HFFB 3D69A 1VGKB 4ONGH 2C3VB 2HAZA 4TQEH 3GGWB 4Q6IA 4HMDA 3LKQB 3MROB 5TQ2H 1JGDA 3RWJA 5HGHA 1YY9D 2QQKH 4OGXH 4LLDB 5D70H 2FWOA 4PLJD 2I26N 3TBSA 4HT1L 1YEIH 3MODH 3T0DA 4O2EA 4HS3A 1QLEL 4RFEA 4LSPH 1AH1A 3F5WA 2V5YA 5T3XL 2G9HA 3HR5A 5EO1A 2OMNA 4MQSB 3FB6B 3HE6A 2XQBL 3S96A 4PUBH 4EOWL 4LDEB 2F8VA 3OWEA 4EN3D 3OGCB 5DJXB 3OBAA 5B3JF 3E8UL 3KYMB 5GJTH 5C7XH 1RZJL 1LO3H 3ME0A 4IRZL 3MLYL 5FO8B 2OCFD 4NO2A 4MZ2A 43C9B 5DMKA 4JKWA 4JCLA 2QADB 3N1PC 3GHEL 2NY3C 5CIPH 4TYUA 4X7TA 5LWYH 1BFOB 4EI5A 4PJEA 3TIDB 1MEXH 2XG4A 1G7HA 3QDAA 4GKSA 4EKXA 1A02N 4LCCB 3RAJH 5AG9A 1RJZB 3HG1A 4B7LA 3WFZA 4JFEA 5FDWB 2YSSA 3PQYE 4ZNEA 1QO3B 4Y7MA 1FE8L 5DEGA 2PTTB 5F7EL 2WLZA 1MRCL 1PLGH 2D3VA 4K3JH 3QQ3A 2QLVB 4F58L 5E8EA 4IRJD 5I73C 5E1AB 3HE7C 5C9JA 1U3JA 1AO7A 4HIEB 4ZO6A 5DJDB 4EBQL 2CXKA 3UPCA 5C0GB 4LQFH 4D0DB 5IOPB 5FUOH 3NCMA 3MV9E 4H0GA 4F37F 5BZWA 1SBBA 1VFAA 2XFXA 3DMMC 1I7ZA 3ARQA 4XRCB 4H25A 4JRXA 1TITA 3VXME 4PG9A 5C0CA 4LF3B 1W2KT 3RIFK 4RISL 1KN2L 2O61B 2CD0A 4JE4B 3TO4A 3PWNA 3EYQD 3VXTB 4EUPA 1ZT1B 1QFUL 1HI6A 3KG5A 4XCFH 5IQ7H 4QTIL 4GAJH 5CEXB 1QNZH 1CK0L 1R24A 2VC2L 3PL6C 4BH8A 1MJUH 4MCZA 3EYQC 3WFHB 4LCYA 2VDNL 3I50L 3ULVD 5L2KA 5BS0A 1EO7A 4MNHB 5FYKU 3EFDL 4U4BA 4TVSa 3T2NH 1L6XA 2A9NL 2DQEL 3A6BL 1Q1JH 4Z18A 1Q0YH 1ZANL 2NY2C 4JO2H 4U05A 4RAUB 1N26A 4YK4C 2RFXA 4S11A 1OTTD 4U1LB 3O6LH 3QDGB 1JTOA 2PXYD 1WCQA 3BEWB 3ZZ1A 3BIKA 5GGQH 3JUZA 4MD4B 3BO8A 3IU4H 4R4NC 3LD8C 2F5AL 3P9WB 3BKYL 1CZ8L 2OSLA 4EN3B 3K81A 1OT2A 2NNAA 2YHGA 4GAFB 3HRZB 2AP2A 1P4BL 4MDJA 1XMWA 4M9OA 3KPOA 3PWVA 4D0BA 3CVHA 4OCYH 3EDJA 4P2RB 4ZPTA 5E56A 2XV6B 1KYOJ 3FN9A 4YBHA 5EC2A 3L3KB 1H3GA 4FFZH 4MMZC 1B0GB 2HJLB 2G5RA 4LDLB 2OYPA 2DMKA 5B3NA 2QBWA 5BCAA 2BOCB 3S5LB 3WL9A 5TQ0H 1BGXL 4TTDD 3Q3GA 2QQLL 3IYLW 5IVOA 3TT3L 3W0WD 1I7TA 2W92A 5J13B 1ZLVK 1EHLL 2EXWC 4N5UA 1YMMB 3VA6A 4KUZL 4G42B 1OP5H 4HSQA 4JGUA 5DHYA 4P0DA 4DGVL 4GG6A 1H8NA 1KCSH 4X6BB 2R8SH 4Q97A 3B83A 4YHMH 4LSVL 1U6AL 4WNQB 4Z9KB 1D5MB 1M7XA 2P5WD 4XCYA 1RZFL 5DUPL 5I73B 4IIQC 3B2UD 1A1OA 3RVTC 4L8BA 5JW4N 3VXUD 1UWGL 5E5MB 4UU9B 3FO0L 2BVQB 2GFBB 2KZWA 1K8DB 4I5BA 4HC1A 4G6JL 2EC8A 1CQYA 3B5GA 3B2UC 3NCJH 5F1SA 3OJDB 5I18L 2MJWA 5ISZE 3RI5F 2AJSH 1UG9A 2YS4A 2UY6A 1NGWA 4JN1H 2FGWH 2XWTA 3ZE0E 1IGFH 4CGTA 1G0XA 2ZUTA 3SGDH 1IEBB 25C8H 1T04A 5GGSB 3LEXA 2UYLA 5I1HL 2WK2A 5A2JH 4K8RH 1WZKA 4PV9A 1U8QA 3L3OB 1QQDA 3E2HC 1SJVA 2IBZY 1MFBL 2FEDC 5ALCH 3ARYA 3EYVA 4E41A 1GOHA 2VLJE 2ZWLT 2EIZA 2AEPH 2NY1D 2AKRB 2CLZA 5DQJB 2NY2B 3O2VH 2IMNA 3NA9H 4OIBA 5JO5B 4NKMA 5ICZB 1SJXA 2IPUK 4Y4HD 3HAEH 3STZB 3DWTA 2ADJB 4MD0A 1I4FB 2JCCE 1U2HA 4LEOA 5C08E 3O3EA 3B9KA 3HPJB 4IMKA 3V5KB 1MHEA 3NACH 1XGPA 1K8IB 2IH3A 1OAXH 3O2DH 2C3WA 3E3QC 4KKBC 2PXYB 3UZEA 5CHNA 3O41B 3NIDF 1BQUA 4DTGH 4J6RH 2IQ9L 3QG6B 4X80L 4ZQKB 5F7DB 1ZSDA 2BNRD 3GM0A 1Q9LA 1G9NL 1LP9B 2HG5B 2YC1A 2Q86A 2F8OA 1OTSD 1OGAD 4IS6B 4DGYL 3FN0H 15C8L 4BYHA 2HP4A 3IFOB 1N2RB 3QO1A 3RGHA 3IU3A 2VXUH 3AREA 3G04A 1QRNE 1MJ7L 3QAZB 4IOFD 3G5ZA 2VRAA 4L5FL 2D03H 4XXCA 3KPNA 4M6MH 1U8NB 1ZWIB 1WC7B 3DUSA 4JGMA 3O4OC 4BFGA 3ZYJA 4Q9QH 5DTFA 1IAMA 5KOVC 3W0WB 3ULVL 3OR6B 1HKLL 1JGUL 4WV1A 3W9DA 1HXMA 3OJ2C 4IIQB 3WHXB 2V2WA 4X9IA 4J8RA 3T77B 2Y5TA 2DLTA 4KU1A 2XTJE 2MHAA 5F3BA 2XQYK 3MRDA 3MRRA 2P5WB 5DGQA 2JELL 1KJ3H 3PV6B 3MJGX 4NQVB 1GGCH 4PD4K 1V7ML 4J3WA 3FB5B 3VXUB 1EZVY 3LMJL 4LASL 4CMMB 1T0MA 2J8OA 1HKFA 4HK3N 4MXWH 3T04D 4D9RE 5T1DL 2CPCA 4Q6YA 5JXEA 1UXWB 4G6ML 3RKDD 3HC3L 4NM4L 1T20B 4NNYB 5EBMA 1AI1L 3BWAB 2YOCA 3GUTB 2H1PL 4JY5L 5C3LD 4U1JA 1NAMB 1KXTB 1XGYH 2XG5A 3PDDA 1Y6MR 1UKSA 3D85B 1TJGH 1CU4H 1VDGA 3GSNA 4IHOB 5GS3A 4RA0C 5GGUA 2HVJA 5JZ7C 1MWAL 3C60A 3HI5H 2KKQA 4NUGL 4OB5L 5IK3A 5CMAA 3GB7B 1G7IA 4PY8J 1I3GL 3PHQA 5HJ3A 3SE3C 2A73A 4HW6A 2AQ3A 1M71B 4FQIH 3MQIA 2YPLB 2P5EE 3WE6B 2R1YB 3PV7A 5A2LH 3WS3B 4QCIB 2R0ZL 4DN4L 3K8LA 1XH3B 3OF6D 4LL9A 4WY7H 5DYOA 1YEEL 2DD8H 4U6XB 2ADIA 1ZEAL 3L9RA 1DLHA 1ZHNB 2EEBA 2Z9TA 5CEZE 4E0RB 1D9KC 3N0PB 3P4LA 5E8OB 5EA0H 5T33H 2NX5D 5C0FB 1H15A 3S34H 2BNRB 4KJYA 1RZKC 2H9GB 4HKBB 1U93B 1JHLH 3WSQH 1D5IL 3WS6A 3G5YB 3LKSA 3NFPA 5EU4B 3O3DB 3DIFB 3VI4E 3DBXA 5J8OA 4GRMB 5E4IA 4IRSA 3ZTNL 2V17H 3O4OB 4Z77B 3GM8A 4MB4A 4JRYD 5GRJH 5INDA 1T0NB 3GBML 2F53A 2O5XH 4OZIF 1FFQA 4LCWE 3BH8B 4GAGL 3VRIB 5EU6E 5J3HC 3RVWC 5DVOA 4MA8H 3CLEL 2BVTA 5JHDA 5C6PB 2V2TB 4PGBB 2B4CC 2E7LC 1E28A 4EIGB 4U6HB 2DN7A 4N9OB 3MA9L 1VPOH 4P46D 3ZDXE 4ZO7A 3UXFA 3IDXL 3SDAD 3EOAB 4NDMA 1XEDA 1HXYA 2XN9D 2AEQH 4YHKH 5HVFB 5D7LD 4U1MB 3SBWA 3T65A 3HRPA 3FT2A 2X4TA 1JF1A 2FHFA 1XCTB 1I7UA 1Z0NA 3RVUC 1W0WB 4LLWA 2FR4B 3TNMA 3FOMB 4RCAA 1F5WA 1VEMA 1DEEB 3F58L 4HKXA 4Z0XA 5KS9A 1MIEL 5C09B 4XMLL 1RZIA 2VAJA 3ZE1F 4I3GA 2I25N 1T4KB 3DV6A 2HLFC 4WI6A 1NGPL 1JWUA 4JEGB 1FL5A 3EJJX 5HSFA 5IG7A 4K7PX 4LCUB 3I6GB 3DSNA 4KMLB 5INCA 5F6HJ 3MUJA 3ARGC 4KRPD 5K9QI 1U92A 1T22A 4L4VE 3OZ9H 4EDWL 5HGAA 3VFSB 1VACB 3GMOA 4FQPA 4Q0XL 5HDBE 1NC4A 1WBYB 2GITA 1FL6B 1I1CA 5JXAL 4GW4B 1L0XA 5E9DD 5IVZA 5F9OH 1N6QH 4HLZG 3UBXB 1CICD 2VQ1A 2DWEB 3NH7H 3FQTA 3VFPB 1MCFA 3SDCA 5DFVD 5IQ9A 2DI9A 1FNGB 2NY7L 4WGVB 3WKML 5BVPL 1A6UL 2HTLD 5GS0H 2PTVA 3GDBA 4PD4J 4AIZA 1QYGH 1B4JH 2HH0L 5MEND 5J6GA 4Y0GA 2X9XA 2BSSB 3RRQA 1WF5A 3QDGE 1QFWL 5J11C 1R3KA 1HH6B 4W70A 1SY6L 4AL8L 4GLRI 3JTSA 4OZFB 1JZ5A 2VH5L 4DCQA 1KTRL 3I6LD 1R3HA 1RJYB 4NHCL 5E2UH 1NJ9A 1BVKB 2XWJB 1YNTB 1GGIH 4HCRL 5D7IA 1R5VA 1JN6A 1RIVH 4DVBA 1C5CL 4CL7A 4K3EH 1MRDL 2A1WL 2A6DB 5IVNA 4NNPH 4NHUB 3WLBA 3UMTA 4P2RE 4F15C 4N90D 4J4PD 3N9GH 1Y6NR 5EU3A 4Z7UA 4G7YL 4F8TA 3QRGL 2GTWA 5ETUA 1DP0A 4YQXL 5DZNA 1YYLL 4U3HA 4YX2L 3GMQB 4P46B 4DGIL 2LTQC 4E5XB 4FNLL 3SDAB 3SKOB 3VGAC 3BZFA 4WUUA 1D5ZA 1OW0C 1IARB 2XN9B 1YMME 5D7LB 3AB0C 4XC3L 5FO9B 3UZVB 3EYFB 4QYOB 5JQ6L 5F1IB 2A74B 4M1DL 1U8OA 4NC2B 4DZBB 2BVOB 4MYWB 4XCNB 2H2SD 3RIFF 4MXVE 3HNVL 2B0SH 1YEDA 5KVEH 4RQQB 3S4SB 1RK0A 4KRLB 2NR6C 1MJJB 4OAWA 3SKJL 1J5OH 1U9KA 3KVQA 4KC3B 4S1RL 3CNKA 5A43C 2QHRH 2H2SC 5BVJB 4X5WB 1BZ7B 3RFZC 5BV7C 2ESVD 4DAGH 4JZOA 5D1QA 1YN7B 4QNPE 2H41A 4G8EB 2OLDA 1RZ7H 4QRQB 4U1IA 2WBWB 2Z0BA 5DQDL 5IB4A 4JQIL 1PQZB 4LAQH 5FXCH 4QRTA 1OGTB 4KVCH 4WI4A 3U0TA 4D8PB 1IGML 5HHNB 3DX6A 3GI8H 1MCOH 5HHOA 3RNKA 4NQSB 4MDIA 1S7SA 5E9DB 3G6JA 3CUPB 4ELKB 1NLBL 1CICB 3BPLC 2B20A 1DUYA 1A9EB 3GJEB 4FMKA 3BP4B 3FL7A 2XT1B 5EN2B 5GRZA 5J11B 4NQDE 2FJGB 2NLJA 4JDZA 3EBAA 1G84A 1CDUA 4D2NA 2HT2C 1PSKL 4LCIH 5MENB 4JVUA 4N9GB 3I75A 4YLQT 1QHOA 1T1XB 2XQYG 3DARA 2Z8VC 4ORZC 4PJFB 4UV4L 4PP2B 4Y16A 2VXQL 4JZNB 1CFSB 1NDGB 3IDJB 2Z91B 3L3DB 4FQLH 3VA2C 1H5BA 4QY8A 5KSUB 3TNNB 4OZHB 2IADA 3U7YL 4KKLD 3GSRA 2GJ6D 2D7TL 5T1LB 1UM5L 3HI1A 2UWEA 1FNEA 2O5ZH 5D6CA 1UM4H 1LP9E 2CUIA 2Z35A 2I5YL 3PWPD 4PLOB 4G6KL 5ITBL 3NABL 4X9GA 1FN4B 4D94A 4N68A 1KBGL 3BHBB 3S6CA 1YMHB 4HG4K 4PJCA 5EIIA 1U3HC 4WDIA 2LTQB 4G8GD 5DR5L 2H26B 3RA7L 3VGAB 1WWCA 2CKBH 1X5KA 1KENH 3O6ML 3G6DH 3L5XL 1LK3H 1IC4H 3S7GA 5EO0A 1MI5A 3LH2H 3TZVD 3VXRA 1D6VH 2KDGA 2VQTA 3T1WA 4K9EC 2N1KA 3CJJA 1S9XA 2QQNH 3MRHB 5EU7C 4JG1L 2ZUYA 5KG9B 5CWSA 5T5NG 5H94A 2WANA 3EYUH 3FB7B 1TJHH 5DJAB 3EYSH 4XWGH 5DQ9B 5DS8A 5CBAB 5BV7B 3JVGA 1KFAL 3F7PC 3BP6A 2Z93B 2C4FT 3X14A 1MCWW 4M02A 1QBAA 2UV3A 4HS6A 4FFVC 4OFYD 1FL3B 5GJSH 2ESVB 3F62A 4MA7L 4ZUWB 3EO0B 1BHGA 3VDCA 2DIJA 5D5ME 43CAA 3RDTD 3QEHB 5A2KH 5EUKA 2WUBH 4RNRB 4YUEH 4FFYL 2GT9B 3NA4A 1XT5A 1RVFL 5I8KL 3PHOB 2F58L 2EDHA 5BMFH 3QXUA 4D9LL 1RULH 2IPKB 3KLHD 1UVQA 5FA3A 5JLZB 2C3VA 4JG0H 2ZCLL 1UM6H 5D7JA 3GGWA 4V2CB 4ZPVB 1ED3A 1KIQB 3BPCB 4FQ1L 1DQTA 1X7QB 3DHJA 3QSKB 2Q7NA 5J1TC 2DM4A 2D31A 3KLHC 1JGVH 3BSZH 2YPLE 3BPOC 3SGEH 3E3QE 4UUJB 2DL2A 4G5ZH 2V7HA 1GC1L 1T80A 2IMMA 4AZ8A 2AV1A 1T66D 1JPSL 3MLRL 4ALAH 5K9KB 5IM7A 4MS8C 5DUBB 1XF2B 5D2LA 3UPRB 2MWCA 3FB6A 3RWGB 1T89A 2R0WH 3GIVB 3Q1SL 2CJUH 4OLXL 4PJBB 3BP5B 4OLWH 2Z31C 5DD1L 2GJ6B 5DJ2A 5C9KA 1EJOL 2ZCKH 2D4DA 5EBGA 1FV1B 1AR1D 3NCFB 3UAJD 3QEUB 5FO8A 5DXWA 3PWPB 5C8JB 1FVCB 5LGHH 5CJ5A 5J1AB 5GS2D 4XMPL 1FCGA 5F9WC 4JJ5B 4M6OL 2OK0L 3I6KA 1SYSB 3Q5YA 4PRID 4PGEB 5D8JL 3VMOA 3DYMA 3TO2B 2AEWA 3ZL4L 1P4LB 1U8JB 4LSRL 3VGHA 1FLTX 5IJVB 3SQOH 1CLCA 4H26A 5HHQB 8CGTA 4WJ5A 2EYSB 5HPOA 1QFHA 5CZKA 4EUPH 1NEZG 4KK9C 4XPTL 4FQ2H 4LFHG 3C6LD 3UDWC 4KHTH 4OLVH 4NM8H 1YEKH 4WFFE 1IGTB 2HFEB 5K9OA 1WCBA 4XXDA 1T5WB 3TA3A 1PZUB 3KYAA 3C6LC 4XX1G 5ILTL 3P0YH 1I9JL 1S78C 2XZAH 1O5DT 5DJDA 3GNMH 1UC6A 5BO1L 4HUMB 1Q94A 4KZDL 2R2BB 2VDKL 3FKUS 3MA7B 4ZXBA 1F8TL 1RPQA 4MGXA 3P0GB 2EXYC 1KCUH 4AIXA 5CSZA 5C09E 5DEFB 3WFEH 4Y5YC 3AU1B 1CLZL 4GKNB 4LF3A 3KPPB 5T5NF 2IGFH 4MCYB 3MR9B 4Q7DA 1C8PA 4NSKB 1E4WL 1KG0A 2R0KL 1OCWL 1TENA 4HG4J 3GBNH 2YEZB 2IBZX 1BD2D 3RPIA 4GBXD 2NY5L 3EFFB 1DUZA 3LKPA 3BPOB 3CVHH 5E7BA 2HA1A 5CKGA 4ODSH 1KLGB 1HYSC 4NC1C 3WUZA 3L5IA 1S7WB 4MNHA 2ADFH 4XPHH 5DRNA 5FCSH 1AXIB 3MBED 4B41A 4O4YL 2DLFL 1R5WA 1MHHB 2DM3A 4QT5A 2EDFA 3VI3E 1RIUH 2G2RB 1WGOA 3IT8D 2QSQA 5E2VH 3SKUD 4BJLA 4MNQA 5LQBH 2P1YA 2Z31B 1FP5A 2P8LB 3N1GC 1ONQB 1Q9KB 1J1OL 5CUSL 1UCTA 2DKMA 3HKFA 4WTZA 1UCBL 3MRFB 1TDQA 4CU8A 5FKPA 4YXKH 4NWTL 2R39A 3GSVA 3F7RA 1WFUA 4G6AC 4M93C 3V7AE 4EN3A 4MAYD 1K4DA 3W9EB 4HC1H 4OLUL 4PJDB 4GXVH 3UP1A 1OWWA 1JYVA 2EKJA 4JDVB 5L7XH 3QIBD 3QPXL 2JB5H 4OCRH 1N5YL 4I3SL 1QSED 2PO6D 4R4FH 1MNUL 2DKUA 4CDGC 4K3DH 3LQZA 1PD6A 5FGCB 1Q0XL 3T4AB 2AJVL 1FVEB 12E8L 4QRUA 3PWLA 3S5LA 2F5BH 1X5LA 1Y6KR 1JWSB 1KN4H 4J3VA 4PRPD 1G9EA 4Y4KD 2DWDA 2YD1A 3V4PH 4FG6D 1MCLA 3ECBA 3LN9A 4OUUB 4TRPL 2W9DL 3QIWC 2I07B 3UTQB 5JW3L 3BE1L 3C6LB 2ED9A 3VGEA 5TE4H 2XRAL 4WNQA 4RMTA 5HYQA 1JE6A 5FYJH 3EDDA 3SDXB 5JIHA 2VZSA 2VITB 5E5MA 4KV5F 4UU9A 4KTEH 1K8DA 1QKZL 5MERB 3S36X 4IRJA 3O45A 3PJSB 5HVHB 1EZVX 5ADOH 3VD3A 4NN6C 1AXTL 5AZEH 4NO3A 3OJDA 1ZLUH 2CR6A 4X9HA 3KLDA 4ODUA 1TVHB 1BREA 1XIWD 1RUKL 3ZDZF 1CXLA 4Z7WB 1QUNA 2CKNA 3QDMD 4PJ8C 4PJAF 5KAQG 4N8CH 4GMTL 1AQDB 3T09A 4K23L 5ACLA 1A7NH 3QUZD 5HDQL 2YD2A 3P40A 1MCWM 1V3MA 1WEJH 1R3LA 2O26U 1NFDB 3MX0A 4TUKH 3RTQA 1SEBB 3L95A 1BD2B 4M1GH 5E2WH 4GBXB 5CEYB 4BQ9A 3MXWL 1YEHL 5EZIL 2DDQH 5CJXA 1ZA3A 2GW5A 3TVMC 4XTRC 5IESH 1S3KH 1OD9A 1RURL 1QFWI 3MBEB 2ADJA 1K4CA 2YPKB 4OLEA 5IHBA 1MUJA 3QIUD 2AAVA 2VQUA 5T5FH 1K8IA 5DVKA 5MP6H 4O2FA 5A3ID 1J0IA 3JUYA 2PXYA 3E0GA 5L8LB 1CYGA 1H8SA 3UJTH 5C07B 1PKQB 3P9LA 4QXTA 4M93B 3FQUA 1DLFL 3QG6A 1DBJH 1T7WA 2YUZA 1QLRA 4ZQKA 3UTTA 3JWOC 2DMCA 4P9HL 4XNYL 5A3IC 5MENE 5MEQB 1HHIB 1P7QD 1OAQL 3ARTA 3VRJA 4OZGF 3MXVH 4PJFE 5IW6A 2FLRT 2X9YA 5D1XD 4MAYB 4OFIA 5F7WC 4DWHA 4OZHE 3MLTA 3EKCA 4D0CB 3UBXI 4MJ4A 4R3SA 1MH5B 1TVBA 5J7CC 1QSEB 2PO6B 4WO4D 4F2MB 5F96H 1MHPH 4NZUL 1XFPA 4MX7A 1KIUA 5E1HB 2GK0B 5JNYA 1WC7A 1J1PL 2EC9U 3O4LD 1MWAA 4G8FB 4WFGD 3QIWB 5BQ7A 4MD5B 5M94B 1DVFD 3GSNH 3W0WA 4XVSH 2VAAB 5MEOB 3UTPE 4FQQB 3WHXA 4OCSH 4LVOC 4MXQD 3SOBH 4QOKD 4BKLA 2PW1A 5DLML 3DVIA 5GSRA 3R1GH 2R56H 2NXYD 3LS4L 4OF6A 4XVUC 4PR5A 1YPZB 4MXQC 5SX5K 3VXUA 2R4SL 2EICA 2VWEC 4I8DA 4UB0L 1DBKH 4CMMA 1U8LB 3FT3A 1W0YT 3V7MA 4XPFL 4XH2B 3LS5H 2GSIA 4TN9A 3KDMA 1UXWA 4PJ8B 4HWEH 2VISA 5ICYB 3LQAL 3B5TA 4YDIH 3HPLB 2LV4A 1XIWB 1WAAA 1R5IB 1BFVH 1JGLL 3BWAA 3NIFE 2HFGL 2N56A 3CFCL 5I1IL 2COQA 3IFNL 4YXLL 2G5BA 3KPSA 3QDMB 4Z78A 5CCKL 3OKEB 4M7LL 4RZCB 2ESVE 3MRLB 4IHOA 4OLZH 4HWUA 1JZ2A 1NLDL 4ZFGL 2EO1A 2EDWA 3SDYL 4R26L 5E5RB 3TN0C 2M8XA 5CJQH 3QH3B 2HN7B 2A2QT 1PG7X 1RUAH 4XP4H 3WE6A 4Y4HA 4ZFOB 5BJTA 3WS3A 4JO1H 4QCIA 2CRMA 5KAQF 4GW1A 5D72L 4WWKC 3A6OA 3QIUB 4ODTL 4U6XA 3P0VH 4MJIE 3REWB 5GZNC 3VWJD 2NXZD 2WMPA 4F7CB 1FFPB 1V3LA 1CLYL 3FO9A 3QHTC 1U8PA 4M48L 5C0FA 1JL8A 2BNRA 4POZC 1A2YA 1VFBA 1GGYA 1QSFB 3CVIL 1A1NA 2ORBL 2V2XA 3OPZL 2LU7A 2NXZC 5I9QC 2Z8SA 5D1XB 1UJTA 4GKZA 5DD0L 1V8HA 4AEIH 3WYRA 1OGAA 2J7LA 1ND0A 3ZKXC 35C8L 2J8UB 5TE6H 3ARUA 5TE7H 4NGHH 5CIPB 4XI5C 4YXHL 4Z77A 3VFNA 4ONHB 4HFUH 4PRAB 3N1MC 4WFHD 5GISL 1OSZA 4LEXH 2EE9A 3BH8A 4P57A 4HZLA 4JFZL 2GJZB 4ESKA 3DUHA 5I1KL 3PWPE 4LVOB 3ZKMD 3RX7A 1OSPH 2Q8AH 4XNQB 2X4SB 1UZ6F 4YHLL 2PYEB 1CD8A 1DVFB 1QVOB 4HQQH 3VD4A 4PGCA 4ZFOL 3PGCA 1A8JH 3D0LA 2CUHA 1MREH 1A6AB 1FO0H 3QNYA 3LDBC 1TQCB 4FTVB 1GIGH 1VGEL 5IIEA 3QO0B 5EU7E 4OUOA 1S7VB 4RGMC 2NXYB 4DKFL 2MPAH 1GPOL 1GAFH 5FOJA 4YWGH 3RX5A 4JFOB 2FYYB 5IR1B 4KRMB 5F9JA 4QRSA 3KPRD 4M6NL 3U6RB 1NDMB 4JKPL 5D7SL 5DWUL 1JRHI 4LLUB 4KI5D 1ZS8B 4YDLC 1BZ9B 1N4XL 3LN4B 1P5UA 3G08A 3EO9H 5I71C 2APFA 5J0BA 3QHZH 1LE9B 1YNKL 2YMXH 3NCCB 4X6CA 5CSGA 4UILL 5B38B 2F15A 5E8DH 1N8ZB 5C6TL 3PF2A 4LCUA 5GGRA 1U8IA 1YC7A 4M7ZC 5A2FA 4HCRA 2XNAB 1I1YA 4K8RC 4QLRA 3JWDH 2VB5A 5IBUB 5IFAH 1XF4B 3DI3B 3ZT7A 2GAZB 4UMGA 3VFSA 1AHWB 2WWKT 3OX8A 5JUEL 4U1NA 4WWKB 4GW4A 3NIGF 2BNQB 1UACL 1BBDL 2PETA 4G43A 3O6FC 2V6HA 1BFSA 3GIZL 4K2UH 4X4YA 1D5BB 1WSST 3T1FA 3OF6A 3CCHA 3T4YA 3ARFC 4PJ7A 4KXZI 5IUSA 3QXAA 3TC9A 4R8WH 1CE6A 4KJPD 3F7YB 3VWJB 5D2NC 2NXZB 4XPGH 4YNYB 5EBLA 4YPGB 4PBWD 5I9QB 5LKNA 2XKNA 4P9ML 2NX5A 2BSSA 1CDHA 3ZKXB 4M62L 1RD6A 1OQXA 3TFKC 1WWWX 4GJTB 3ROLB 4S1QL 3QFJB 1DBAH 2VE6A 1B88A 4DZ8B 3VRLF 4RAVB 4L8SC 1RU9L 5EO9A 3AMKA 2JK5B 3MNZA 5IKCA 2BDNH 3VFMA 4KKAC 4O5LL 1HWGB 2XWJA 1MIML 2DF3A 4OIAA 5EOTB 4JRYA 2ZSWA 2HT4C 2ICEA 1FNSH 1IL1A 4UBDC 1OB1A 4JZJC 4NQUA 3BUTA 3I02B 4M7JL 4NHUA 4KJQD 5I2IB 3VDAA 3LDBB 1KLUB 5HYJD 1DQML 1C08B 3DVFA 4RGMB 3ZYZA 5MI0C 1F11B 2E7CA 1QP1A 3GMQA 3TYFA 4P46A 4E5XA 5MEPA 3SDAA 5DZOA 3KPLB 2XN9A 3RX8A 1DBBH 3KJ6H 3MNWB 3OG4B 2JB6B 4YHPA 5D7LA 1OLLA 1XCQA 3D0VB 4NQTA 1NCCL 4P5TD 1DN0A 4YDLB 3UO1H 1NCTA 2P48B 5E00B 3KPRB 4GS7C 4OQ1A 1RIHL 1HQ4A 5GRVL 3SDXE 5JHLL 3C5SB 5HYSB 1N0XL 2UZYB 4RQQA 2EH8H 1MJJA 2X10A 5FK9B 1A22B 2WINB 3BGAA 3K3QA 3WN5A 5C6WH 1BZ7A 4P3DA 4YZFF 1YN7A 4WEUD 3CDGA 2E9WA 3V5HB 4G8EA 5I8OL 4QRQA 4Z7WE 1IKFH 4JFDD 4G3YH 4A6YL 2WBJD 1PQZA 3ARDD 5FYLE 4EDXB 1CFVL 2RR3A 1JZ7A 1ZT7B 2AGJH 3O6FB 4LP5A 4D8PA 4LSSH 2BP3A 5SX4I 2AV7B 5JORB 3M07A 2C7UB 4NC1E 5KSBB 4NQSA 2A6JA 2CRIA 3HAEB 4P59L 2W65B 3ARFB 1FZJB 4FOMA 3FAXA 1A47A 3WFCL 5LGJB 1B2WL 4NQXB 2FECL 3O8XA 2KH2B 4YE4H 5K33A 3WNMA 3RIAK 5D71H 4Z7VF 1A9EA 3VFRA 3QI9C 3GJEA 4P99A 4AH2A 1DBMH 1I1AC 1IKNC 3QNZB 4QHNB 1S7UB 3K8KA 5GS1A 3SY0A 4OZIE 3ZLQC 4U7KA 4Z7QF 3K46A 4XVJL 1T1XA 2VLKE 4LPXA 1K2DA 2AXJA 1NDGA 5C07E 3SPVB 3VE0A 3TH4T 4HT1H 4UDUB 2VLRD 1V05A 1QLEH 1KGCD 2DTSA 2XWBA 4JZJB 5T3XH 1IGYB 1I1FB 2PR4L 2BJML 2XQBH 4JFXA 2NY0D 2GSGB 3LEYL 5I74C 1MVUA 4EOWH 1CD1A 3RVVC 4ZS6C 4GXUN 1F90L 2ZG3A 4GG6F 4G9DB 4J4PA 3CAFA 3E8UH 5E99L 1RZJH 3QCUL 1A4KB 2YWYA 4RBPH 4IRZH 3MLYH 1QTYT 4YEEA 4RGNC 4BQ6A 1LO4L 1EMTL 1WFOA 5A16B 1LK2A 1VB9A 4XP5L 5DJCB 4H5SB 3ZE1E 3O3AA 3GHEH 4JM2C 4GS7B 4KKCD 2AK4A 1T0PB 4N1HB 4ZSOA 1M05B 5IMMB 1T83A 4UV7L 5GRUL 3MV01 4PRDA 2DBJA 3BUYB 5DK2A 3OSKA 4U7SA 1FC2D 2W9EL 5HXMA 3WIFA 2NTFB 3A67L 1MOEA 4WEBL 1YPZE 4M9PA 3W5NA 5B39A 4OM0L 3MRMA 3TM6A 2HKFL 3HA0A 1FE8H 2JJTA 3PDGA 5LCVL 5JOFA 2R9HC 5F7EH 5I30L 1UEYA 4WUKL 4JANA 1MRCH 5KTEL 1BVLA 4KUCF 5HPMB 3BH9A 1M7DA 3TPKA 3SGKA 4F58H 1BQHB 5EBWB 1C7SA 2FX7L 2VZTA 4JFDB 3QEHA 3QDME 4R0LB 4EBQH 1S9YA 4PBXA 3PHOA 3ARDB 1V3JA 4UQ3B 3EO1B 1RZGB 4KVNL 3D87B 4F9PA 5C0DB 1TVDA 1KPRB 2ZUUA 5JLZA 1GOGA 3VXNB 1GSMA 4QTHB 5AD0B 1N0LA 3OXSA 1KIQA 2LAGB 3N1QC 4RISH 1KN2H 4Q9CA 1LNUA 5I75C 3TJHD 1X7QA 1UB5B 1P1ZB 1W0VA 5CP3A 2BOBB 2YKLL 1QFUH 2AXFB 5C71A 4YGAB 2H3NA 2FJHA 1QFWM 5LGKA 3D25B 4QTIH 1V7NL 1JUFA 1CK0H 2X09A 1VA9A 1G6RL 4PJXB 2VC2H 4R96A 5EUOA 3CH1A 2C3XA 1S9VB 3FHQA 3I50H 2VDNH 5FOBA 1EV2E 5GS0C 1R3JB 1HEZA 3EFDH 3RWGA 1UB6B 2X4OB 2HJFB 2EDLA 4Y2DC 1IGJB 2A9NH 2DQEH 3A6BH 4L29B 4N0CD 1ZANH 4WGWB 3V95A 3H9SD 3W39B 4EI6A 3ILQD 4APQC 5DJ8A 1QSFE 4M5YL 4XZUA 3ISWA 1BVZA 3MYJB 5D6DA 2NY0B 3IAGC 2F5AH 5DA4A 3BKYH 4CVZB 1CZ8H 1A7OL 3DRQA 3WLWC 1SYSA 4JY4B 3MRNA 3GMRB 4G8GA 2VOTA 4UDTB 4X5XB 3S35X 2VR9A 1P4BH 4GUPA 5AUMA 1U8JA 5FA4B 3VH8B 2JKXA 4L4TD 1I8KB 2CLVA 3TZVA 3ULUF 2PYEE 5JR1L 4Y5XC 1OP3H 4WU7A 2XY1A 5AAMA 2VZUA 4CAGA 1G6VK 5IHZA 2X4QA 4P4KD 1BGXH 4FTVE 2QQLH 1T5WA 1IM3A 4Z5RA 3NTCL 4KDVA 3TT3H 5AG8A 3THML 3TP4A 1EHLH 1J0YA 4ENED 1B0RB 3ZYOA 3O9WD 1NAKL 2OR7A 4OGAD 5HHMD 4KUZH 3RUGF 1P6FA 3VXQA 4NFBA 3JBG7 4RMSA 4DGVH 1DFBL 2H2PD 5FM8A 3ESUF 4LSVH 1U6AH 4ENEC 5DUPH 1RZFH 3V0VA 1G7JA 1S9KC 1BEYL 1U0QA 1UWGH 3C87A 4PJIE 3TIEA 3FO0H 1GGUA 4JHAL 4S0TD 2YUVA 3HC0B 4G6JH 1WIOA 3RDTA 4PJHB 3MRIB 4I0PC 5I18H 2VDLL 1F6LL 5DRZB 3ZTJH 4HWZB 5I75B 1NC2D 4I0KA 1J88A 5JA9A 1X4ZA 4TSCL 1JIBA 5EZLA 1DTUA 2VLJA 3EHBC 3OKMA 3AGVA 5I1HH 1WWAX 5FIEA 1KLGA 2FDBP 2AXGB 2C9AA 2D0GA 3MRCA 4ETQA 2VLME 4LPWA 1WJ3A 5IB2B 5IEHB 5K59E 1MFBH 2JIXD 5HD8D 3H7LA 5C0RL 2ATKA 2Q20A 2PYFA 1HILB 3JTTA 2BNQE 3BQUC 4K7FA 3QQ9C 4JGJA 5SWZD 3B8SA 4KAQL 4XBEL 5C08A 4P2OD 3B6SB 5DDHB 2KPNA 3BW9A 1T1ZB 5AWNL 2P8LA 1Q9KA 4UQ2A 1QEWA 2VDOL 3GSWB 3T0AA 2IANB 3ZSTA 3MGAA 4M61B 2NZ9D 1HH9A 2ZNWA 3MRFA 4R9HA 3MLXL 3DROB 4XC1L 4R2GD 2PCPA 1EFQA 1KTKE 1J1XL 5I1DA 5FGRA 4PPTA 3QFJE 4FABL 2IQ9H 3C5JB 1JYNA 4JDVA 3FRPA 4OFDA 4X80H 2R1XB 8FABA 4XHJD 4JQXC 4J7RA 3T8XA 3U4EB 3MSPA 3BISA 5AZ2L 1G9NH 1BJ1J 2IAMD 3T4AA 3PWJB 4PRIA 1HHHB 4DGYH 1H3PL 15C8H 2VXTL 4C57C 1XGUB 2WZPD 4GRWB 1LHZA 4TPRL 5ICXB 4L4TB 2ITDA 4WW2C 4PREB 5DA0B 1MJ7H 4LRIA 3V6OC 1TZHB 3HR6A 4L5FH 3R8BB 3SKNA 2I07A 2X4RA 3HUJE 4K3HA 5DRXB 3ZT5A 1J8HD 4P4KB 2BVPA 3WJJA 2Q76B 1FZMA 4QRPD 3OKNA 2OTWA 5EZJB 3ULVH 3HZKA 4ZYKA 1HKLH 4JDTL 5DD6B 1JGUH 2B8OT 4HBCL 4Q6IC 5HHMB 2IFFL 3CSYA 3PG2A 5MERA 1RFDL 3D39B 1EBAA 1LEKB 4M5ZL 2CDGB 4RIRB 2JELH 3MLZL 4AIOA 3L3JA 1V7MH 4I0PB 3MGOB 4NRYA 1RHHA 4KI5E 5BZDA 4C55A 2EYTB 3LMJH 3U2SA 5DGRA 4LASH 1IM9B 3FFCE 3V6BR 1DCLA 4JN2B 5T1DH 1FFNA 1Q9WB 3HE6C 5MHSE 2E6JA 4G6MH 2FL5B 3AC0A 3FRPG 2GTZA 3HC3H 1FHGA 1RK1B 4NM4H 3HB3C 4J1UA 4UZGA 1AI1H 3G9AB 3ZKSD 4I48A 1SEBA 1BD2A 3LN5B 2H1PH 4JY5H 3MV7D 5IBLC 3BKML 3GSUB 5HGDA 4EI5D 1OAYL 1JPGA 4NBXB 3MBEA 4P23A 4LOUD 3K80A 1AQKL 4DQOL 2DJUA 3HG1D 1F97A 1MWAH 1SJEB 2GIYA 4NUGH 4OB5H 4ELMF 5SWQA 4JFED 1BOGB 2KL6A 3L5JA 5SWZB 4G6FB 1I3GH 5D2NE 5CGYD 4PP1C 1KUMA 1PKQA 1I3RB 4HH8A 4TUOB 3NPZB 4OF3A 3GSXA 2R0ZH 2EC9T 4DN4H 1IGCL 4HFWA 5C0AD 1YEEH 1FJ1B 4W6XB 5IB1B 4R2GB 5IB3B 1ZEAH 2IPTL 4HIJB 5FHBL 4I2XE 4MAYA 3TBWB 2M26A 3ARBD 4NJAL 3DVGB 5F21B 3QIBA 5GZOD 1E4XL 4Q9RL 3LKRA 1MH5A 4C56B 3MFGB 3VJ6A 1QSEA 2PO6A 5FKAA 1ZT4B 3DXAD 1HOCB 4FS0A 1D5IH 4JRXD 2CO7B 5ACMA 2ZSVA 3FFDB 2CKBB 5C0CD 3IF1B 4I18B 5IW1A 3S3PA 2XICA 3TO4D 1U8MA 1INEL 4P5KA 4PRPA 5IP4A 3ZTNH 5MEOA 5CP7B 2XPGA 4Y4KA 2JJWA 1KXQE 3GBMH 3D69B 2YA1A 3MACL 4GAGH 2A38A 5DK3A 3VCLB 4Q6IB 4P2QE 4XP9L 3CLEH 3SGJC 1J8HB 1JGDB 2CQVA 2DB8A 4WHDA 3ZE0F 3RWJB 5HGHB 5E6ID 2VUOA 3V0AC 3TBSB 2FWOB 1X5GA 1U8LA 3CGTA 5ITFB 4LSDA 3MA9H 4O2EB 4HS3B 4RFEB 3IDXH 4LPUA 3IJHB 4WFEE 3F5WB 1TPXB 3HR5B 5EO1B 4JHZA 4GOSA 4LGPB 1A6VL 3HE6B 1I8LA 3FQWB 2F74B 5FF6A 3WIIL 4OCWL 3S96B 2AJXL 3V4VL 1NGXB 3OKEA 4KWUA 1DDHA 3UTSE 4OI7A 4C54A 2A0LD 1A6WL 4KMQA 3GSOA 2JCCF 1FBIL 3QUZA 1FPTL 4GAYA 1U95A 3F58H 3RIAF 1J7VR 3SN6N 3IETA 1MIEH 4NO2B 5F71A 5F6IC 4XMLH 5GXBB 5DMKB 1NSNL 3DYOA 4HMEA 1NGPH 1MVFA 4X7TB 3OAZH 4EI5B 4PJEB 3WXWL 4ZAKD 1ZLWH 3P4OB 4GKSB 4NP4L 4ZFOA 5ID1A 3VXOA 4NN5C 2F54D 3HG1B 1QSZA 3SGDI 3WO4B 4EDWH 4JFEB 3MUGA 2YSSB 4JPKL 1JF5A 4Q0XH 1T2QL 1TCMA 3CXDL 1J0ZA 3GMLB 4HWNA 1CL7L 5JXAH 4HUKB 5DEGB 3Q48A 3BN9D 3D3VD 3I3EA 4PJXE 4Y8AA 4Z95L 4G9FA 1P7QA 1FIGL 3BN9C 3C2AL 3QCVL 3CZJA 2BXZA 2NY7H 2D2OA 5D1XA 3UPAA 3WKMH 5BVPH 1A6UH 5C9JB 4YFDB 3I3BA 5GIRA 2HH0H 1NGYB 4NKOA 4ZUSA 2Z8WC 1S7TB 3MTRA 3P73B 1QFWH 4ONHA 3GSQB 5BZWB 1VFAB 4WO4A 3S3JA 1I7ZB 4JQVC 4YC2B 1SY6H 1ACYL 2AJ3A 3LEVL 4JRXB 3OL2A 4NQCE 5C0CB 4TVPD 4HKJA 4AL8H 3O4LA 2VH5H 3TO4B 3PWNB 4XNQA 2X4SA 4MLIA 5ALBL 5I1EL 4NHCH 3VFTB 3Q6FA 1QVOA 5IFHL 1WITA 2BSRA 1HI6B 4E41D 4HCRH 2FX8L 5EC1A 1HHJA 1C5CH 4QOKA 1A6AA 1MRDH 3ZDZE 1NCDL 2A1WH 5HVGB 3QO0A 4MCZB 4HWBL 3ZKNC 2WQ8A 4LCYB 1ULVA 2E8ZA 4HK3J 1FZKA 5L2KB 2OBGA 5BS0B 4PB0L 4ZUUA 1M1SA 5E6IB 4G7YH 3QRGH 5B4MD 4JFOA 2DQHL 4CN1A 4YQXH 3B9KD 2D7OA 1IGIL 5EB9A 1N3NA 1YYLH 5E7FA 2HRLA 4YX2H 2ERJC 4XB8A 4DGIH 1QZ1A 1CI5A 3HE7A 4FNLH 4QXWA 3BIKB 1IAOA 3BO8B 4BM7A 3B9KC 4IMKC 3SCMD 3R4DA 2Y06L 4XC3H 3ZHLA 5JMRA 5JQ6H 2B2XL 3DHMA 3DMMA 1WIUA 4M1DH 2OSLB 2RBLA 3ALXA 2NNAB 3HNVH 1PYWA 4E42A 4MDJB 2D9QB 2XNAA 3KPOB 2Y6SD 1OVZA 3SKJH 4FQXC 3KHOA 3WFBL 4S1RH 1YA5A 4GO6B 3CVHB 1AHWA 2IALA 4LLAA 4ZPTB 1CFTA 1YDPA 4GKOA 5EC2B 2WWMD 2EO9A 2DLHA 2MQ3A 4NQEE 3BI9X 3RU8L 4OJFL 4R90L 3AREC 3WL9B 1TJIL 5DQDH 2K7PA 1G7LA 4JQIH 3MLWL 1I8MB 4X6DA 2JJUA 2MTPA 5H37G 1I7TB 3IAPA 3S3SA 1F4HA 4WHYG 3VI4F 4U0RB 1IGMH 5DHYB 3KYNA 3EDFA 1A7RL 1AJ7L 2P8PB 4UTAL 4NQDA 3VWJA 2EDXA 4WV1C 4XCYB 4OD1L 1NLBH 2VN4A 4MQXD 5T3ZD 1A1OB 4L8BB 3JV0A 5GGVY 3ULSA 3U7AA 3RWEB 1NBZB 5DO2C 2IANE 4I5BB 4LNRB 2IBBA 4DZ8A 4P4RA 5JXED 3KGRA 2VXSL 4PJGA 4U1KA 3ARSA 5E95B 2Q1EA 3OJMB 1PSKH 2JK5A 3VFWA 2QTEA 2EIEA 4FQHB 3ZDXF 3ZT6A 4LPYA 5EOTA 3AAZA 4UV4H 1NGWB 2VXQH 2XWTB 1HHKB 2J5LC 5FUCC 1MQKL 4QXGL 3C09C 3LEXB 3U7YH 5DMIL 4A6YA 2X42A 3HNSL 2D7TH 4MA1C 3O2WL 4MMXC 1UM5H 4PV9B 1U8QB 1CE1L 3MZTA 1KPVA 2DTML 4BFEA 2ZUQC 2GHWB 2DQGL 2J1KA 2I5YH 3C60D 3K4ZA 1EEQA 4E41B 4G6KH 5ITBH 3NABH 2P42B 2I9TB 1P84K 1ZHKB 3BKJL 1SBSL 1NFKA 1KBGH 1KTLA 2CLZB 4FZEL 4NKMB 3C60C 2YRPA 5DR5H 1DSFL 3RA7H 5I15L 3QUXC 4BSWA 1B9ZA 4MD0B 2CIKB 3FQRB 3O6MH 3QXWA 4KH2A 3O3EB 3B9KB 3L5XH 5E00A 1QR1A 3KPRA 1MFEL 1MHEB 3QR2A 1XGPB 2IH3B 1I1RA 4GQPH 5CHNB 1T2JA 4Z0BL 5CD5D 5HHME 5HDBF 3SCMB 4JG1H 3D39E 2BSTA 1N59A 4HX1A 4X7DC 3I85A 1ZSDB 4QHKI 2BZDA 3VU2A 1Q9LB 1QFOA 2YC1B 4KROD 1JVKA 1KELL 1OTUD 2Q86B 2X1XR 3KLAA 1KFAH 2I24N 4PRHA 4TVPL 2F9BT 2VSDA 3IU3B 3AREB 3G04B 3WS6C 1ZT7A 3QG7L 1A6PA 1OTUC 3G5ZB 4MA7H 3MRPA 5JORA 1KTDA 2Z92A 1LMKA 1FZJA 3KPNB 4IRSC 4OM1L 4XP1L 3DUSB 4FP8L 1NBYA 4FQJL 1UGNA 4JCMA 4FFYH 4HAFA 2R29L 1RVFH 5I8KH 1UWXK 2X5PA 4I9WD 5JOPD 4WV1B 3W9DB 4K94L 3P77A 2F58H 2NY6C 1P6AB 2Y5TB 4D9LH 4NIKB 2MHAB 5F3BB 1CFNA 3MRDB 2ZCLH 1LEGA 1EBPA 2NW3A 5FFLA 5DJ6A 3KS0H 4FQ1H 2BY3A 1CG9B 1NUDA 4NN7C 4MHHI 2XZQL 3U82B 2JJSA 2VXVL 2J5LB 3C08L 1GC1H 1FH5L 3C09B 1JPSH 3MLRH 4JRWA 2HMIC 1JNLL 1I1FA 4XPBL 5EBMB 1NFIA 4UTBL 3EDEA 2ZUQB 3Q1SH 5TJWK 4OLXH 4P3CL 5DD1H 3CXHK 1EJOH 4C56E 5TF1L 1UADC 3HZMA 5HYJA 1EPFA 3KWWA 1WBXA 4HJ0C 3C60B 1PFCA 4QF1B 3TEUA 3V6OE 2W0LA 4MXVF 5CMAB 1G7IB 5A16A 1NC4D 3PHQB 4XMPH 3BEVA 5HJ3B 5L6YL 2A73B 4M6OH 3VXPA 4I77L 2OK0H 3KXFD 3MO1A 3AS3A 1M05A 5D8JH 2YD7A 4XNZC 1MAKA 1IAKA 4HPOL 4P5TA 3ZL4H 3OB0H 3QUML 1LO5A 2H8PA 4LSRH 4QNPF 4ZFFA 3QEGL 3ILPB 5DYOB 5T3ZL 1G6RA 3JWOL 2ADIB 5CP3H 3L9RB 1DLHB 1H0DA 4XPTH 3T3ME 3IDUA 1OPGL 3SDCC 5IWLA 2DAVA 4GT7A 3SDDD 4OIIL 3NBNA 1MCSA 2DQFB 3H3BC 5IVXB 3VG0L 3JWNC 5HPMA 2MOVA 2R69L 3TH3T 1NANH 5ILTH 1UQSB 1X4XA 3LKSB 1F42A 1I9JH 3NFPB 4KROB 4UINL 2IC2A 1MRFL 3DBXB 1ZA6A 4JFDA 1JJUA 3BN3B 3KJ4C 2WBJA 5BO1H 2DQUL 4IRSB 3LB6D 1II4E 4X4ZA 4KZDH 2VDKH 3UEZA 1F8TH 3MREB 5INDB 3JWDC 4D3CL 3VW3L 3U0WL 1IT9L 1CLZH 3VXNA 4QTHA 5F9AC 5ACZA 5DMYA 3AS0A 1P84J 1UB5A 4YHOL 2XA8L 2R2EA 3X11A 4ODHL 1H3TA 1E28B 1E4WH 2R0KH 1OCWH 2FATL 3CDFA 4NN7B 5FHAL 3CPLB 5DD3L 2NY4D 1LP9F 2NY5H 5DJYA 1D9KA 2VJXA 4NDMB 1CF8L 4WUUD 4JAMB 1HXYB 1S9VA 3V52L 4ZNEE 4NZRL 5DK0A 1E4XI 1R3JA 3T65B 5HYIA 5D1ZC 1J86A 4JY6B 4O4YH 3EAKA 1IGJA 3FT2B 2DLFH 1JF1B 2X4TB 4CADA 1JZ6A 1EDQA 2VLRA 1I7UB 4ERSL 4LLWB 4FN0A 4PJ9A 3TNMB 5SX4H 4IJ3C 4ZFZA 4HKXB 4Z0XB 3U46A 5KS9B 4LARL 2DBLL 5GGTL 1J1OH 1C12A 1RZIB 4OKDA 5CUSH 3MYJA 1AO7E 1ES0A 1UCBH 3DV6B 2C1PB 1JWUB 5D1QD 5HBBA 1FL5B 1BQLL 4NWTH 3W11C 1HQRA 3U9UA 2ICWJ 5F88A 5IG7B 2OI9C 4JY4A 3C8KA 3GMRA 5E4EC 1X5HA 4OLUH 1U92B 1T22B 3IFPB 4HUVA 5C0CE 3EIFA 5ERWA 5FM5O 3VH8A 2E7LA 5H8DA 1JI1A 5HGAB 3GMOB 3QPXH 3RPKA 1NC4B 1PKOA 1N5YH 2D7QA 2GITB 4I3SH 3OAUL 1MNUH 3F7VA 4PS4L 1Q0XH 3KXFB 2AJVH 3SO5A 1JHKL 2HKHL 12E8H 4XPAL 2YN5A 4CN6A 3WNOA 2VQ1B 2EDEA 3FQTB 3SDCB 1E6JL 5IQ9B 5D5MF 5L2KE 5BS0E 2R23A 1TXKA 1N5AA 4N1CA 1A5FL 1AFVL 5JW4Q 5L88L 1KIPA 4TRPH 1MHCB 2W9DH 4GW5A 5JW3H 1FGVL 3BE1H 3U30C 4HF5L 4AIZB 3RGVC 2CH8A 3ABZA 3BKCL 5ESQA 3SDDB 5J6GB 2XRAH 2W1NA 4Y16D 1R3KB 3T0XA 4U3XA 1QKZH 1I9IL 3HC0A 4P5MA 4HKZB 2ED7A 3JTSB 3RVXD 1ERNA 3V7AG 4DCQB 1AXTH 1R3HB 4FRWA 4DK3A 1NJ9B 3MJ9L 1RUKH 4YO0A 4Z7QE 3T0EA 1R5VB 4OZFG 3CXHJ 3KHQA 4LK4A 1KPUB 4U6VL 2XZCL 1CL7I 3MRQB 4PFEA 5GS2H 3WLBB 2IBGA 4GMTH 5SV4A 4K23H 2V7NB 3KPMA 5HDQH 1M6OA 2AEIT 5EU3B 4Z7UB 1HINL 3SJVE 3LV3A 2GTWB 5ETUB 1MF2L 4F8QA 3V6FB 1F2QA 2ED8A 2NY4B 1CIUA 5DDHA 3B3IB 3MXWH 5D7KD 3VXRD 1YEHH 5EZIH 1FAIL 3BZFB 4YBQC 4WUUB 1D5ZB 1P4IL 2ZNXA 3JV6A 1QBLL 3L6FA 2L7JA 4JM4L 2XTJC 4IJ3B 1MPAL 4OSUL 1RURH 2CDFB 4GG6E 3VFUA 2BY1A 3MRJA 4S1DC 3S37L 1FYHB 2VERN 3TT1L 3BVNA 1U8OB 3DROA 2IF7A 1EEZA 3H9SA 4HULB 3U0PA 3O6KL 1YEDB 3UTOA 1RK0B 4OAWB 1DLFH 1CGSL 4LHUA 3QWRD 1EFXD 2H45A 4YFLF 3UTZA 4XNYH 4P9HH 3JVGC 1OAQH 4JZOB 5D1QB 2R4RL 1KB9J 3NVQA 2A6KA 1LO2L 3PWJA 1J87A 1HHHA 1S9WA 2BY0A 5IB4B 5DJ0A 4QRTB 4OFVA 1AGCA 4L4TA 3V0WL 2EDTA 3U0TB 4AJ0A 1RZJC 4OCLC 1TZHA 3DX6B 4ETYA 5JQHC 1FC1A 2J6EL 2R2HB 3RNKB 4NZUH 4MDIB 1S7SB 1OW0A 3GMNB 4X6FA 5D7JD 5FECA 2CGRL 3G6JB 3H2WA 4AMKL 3P2TA 2YUWA 4LFHD 1NKOA 2QQQA 1J1PH 2W0FA 4OI9A 2Q76A 4U2YA 2MMXA 3ARPA 3W81A 5EZJA 5FYJE 3OAYK 1KCKA 3GJFK 5DMGC 3O9WA 2QHLA 4S0SD 4JO4L 5DLMH 2NLJB 4JDZB 2APXA 3K74B 5J89A 3LS4H 5CILL 3I75B 1AGEB 1F00I 4Y16B 2R4SH 1H5BB 4QY8B 4UB0H 3LKOB 3I9GL 4PTTA 5GRWA 2IADB 4W4OC 1A64A 3GSRB 4XPFH 3HI1B 4QRRA 1NUFA 4HIHA 1DN2A 1FNEB 5D6CB 3EUUA 1T89C 2ZUXA 3LQAH 4LHUG 2Z35B 1MSPA 1HSAA 3VI3F 1JGLH 1NC2A 1RJLA 2HFGH 3CFCH 4X8JB 5I1IH 3IFNH 4YXLH 5CCKH 3HFML 4PJCB 1FYTD 4NO0A 4M7LH 4Y1AE 5EIIB 4WDIB 1IFHL 3ALWA 4GSDL 1IC7L 1FNAA 2JIXA 4OGZA 1NLDH 3WO3B 4ZFGH 3QEQA 5KVFL 1HWHB 3SDYH 1SJEA 4R26H 2X4UA 1TLKA 3REVA 1MI5B 4P2OA 1MFAL 4BFBD 3VXRB 4DN3L 3EJZC 1CGWA 2ZUVA 4MJIA 4LCCC 1X5IA 1SEQL 1S9XB 5CWSB 5H94B 4ZOAA 4HIIB 4LGRB 5D72H 4ODTH 2CSPA 5IW3A 1G7MB 1IAIL 1QD0A 5IB3A 5DS8B 5HTSA 3QUYD 4HIJA 4HZAA 4NBZB 2B5IB 1KSRA 3TA3C 3BP6B 4NRZA 4ISVA 5I8EB 1CT8A 5F7UA 4X7SL 5FUCE 1CLYH 4ZXBD 3X14B 4M48H 1T03L 3BZEB 3OR7B 3CVIH 1ZT4A 2EE6A 4L3ED 2IAMA 2ORBH 3OPZH 4RWYL 43CAB 1I3UA 5DD0H 3IF1A 4I18A 4YJZL 5EUKB 35C8H 1INDL 1LD9B 1GZQA 7CGTA 4JFPA 4YXHH 5GISH 3VFOA 1UVQB 5FA3B 4JFZH 5I1KH 1F3DJ 1NEZB 2C4FU 3D2UD 5D7JB 4YR6A 3VCLA 1ED3B 2P7TA 1J8HA 1OAKL 1T7YA 4QRPA 5L9DL 4YHLH 2D31B 3QYCA 4V1DA 1A6ZA 5T1KD 5ITFA 4R4BA 4OFKA 4Y19E 4YH6A 4DW2L 3P4NA 2V7HB 3CD4A 4MNQD 1WIPA 2AV1B 1YY9C 3IJHA 1VGEH 4XMKL 3GRWL 5IM7B 4DKFH 4MA3A 3OKLA 4PLJC 1GPOH 5D2LB 3FT4A 3H9ZA 1DQLL 3FQWA 5HGBA 2F74A 4KJWD 2HFTA 1NGXA 1T3FB 5DZLA 4PG2C 4M6NH 5DJ2B 2APBA 3BAEL 5DSCA 3NMEA 4JKPH 5D7SH 5DWUH 2X44D 3P30L 3QJFA 3C8HA 3B9VA 4N0UA 2XYCA 3MV8D 1N4XH 2MQCA 4LQ1A 4NO5A 4EN3C 4HPYL 4HV8A 3HTLX 1YNKH 3MV7A 3WDIA 1C5DA 3C5ZD 2R2CA 4UILH 1G1CA 1FIEA 3I6KB 2A6IA 5C6TH 2F53E 3P4OA 4K07A 4B0MM 4LSUL 5C86A 4PJFF 4XAKD 4H26B 4RX4D 2YXMA 4FXLA 1IQDA 4WJ5B 4F33A 3HZYA 5JHDE 4HWBA 1I85A 4OZHF 5JUEH 5SWSA 3GMLA 4JFYA 5H37H 4DUXA 4WHYH 4HS8L 5HY9A 5J13C 1FNLA 5K9OB 1UACH 1BBDH 1WCBB 3BPNC 4XXDB 4OF0A 3GIZH 3TA3B 4WEMB 2PN5A 4KY1L 5C0AA 1FORL 3EYOA 2FEEL 5IMOA 3QUYB 4CNIA 5L0QB 3WXVL 2HRPL 3ARBA 3T3PE 1NGYA 1Q94B 2XXCB 2W60B 1S7TA 1W72L 4P9MH 3P73A 4ZXBB 4IRJC 4M62H 4U6TA 5HVWA 3GSQA 1IJ9A 5KS9E 5CSZB 5GSVA 1NUGA 4L3EB 4S1QH 3DXAA 2C3GA 1T5XB 1EEYA 1WTGT 1RU9H 4U6YA 1G9NC 1ACZA 5FYKD 5JMOC 4O5LH 5AEAA 3VFTA 3PP3H 1MIMH 1KG0B 3GMMA 3RTQD 3GBLA 1GGTA 3RPIB 3BT2L 1DUZB 3LKPB 2DQDL 2RB8A 4KK6D 4M7JH 3UDWA 1GZPA 4M43L 3NIFF 1KJMA 5H35A 1DQMH 5DRNB 1D6EA 4YHIA 5C2BL 5CSBA 5E6IA 4MB3A 2H32A 3ARVA 1R5WB 5CJXC 5T1KB 1K9TA 1EX0A 4QT5B 3O3BA 1MY7A 5IFJB 4HGWA 3ULVC 4MNQB 3RY5A 1KB5A 1BLNA 3QZWA 1NCCH 3UTTD 1CVSC 5DF0A 1OTTC 5FKPB 1CCZA 5D9SA 2PXYC 1AGBA 1JNJA 1RIHH 4RMRA 4Y5YA 5C0BA 3BMWA 3GSVB 4U0QB 4ELME 5JHLH 2C5DC 4MQTB 1K4DB 4JFHD 1N0XH 4DKDC 2ZJSL 3VFVA 2HTKD 5IBTL 3C5ZB 5E03A 3LQZB 5ANMB 4ZAKA 3K4DA 5D7IE 3QUKB 4HJJL 3OQ3B 2XY2A 4QRUB 3RNQA 5I8OH 1WZLA 3PWLB 5I66A 5EH1A 4A6YH 1I8MA 3QAZC 2F54A 5KVGL 1JCKA 4HXBL 5HI5D 1CFVH 1JFQL 2DWDB 3BPNB 4PJBF 4Z7NE 3ECBB 4Z7UE 3L3HA 3IS1X 5B22A 4TTDC 4P59H 2P8PA 4MVBD 3U1SL 4URTB 4H8WL 3WFCH 3D3VA 3M1BB 1B2WH 5HYQB 4OZIA 3INUL 1H9VA 3CK0L 4WUUE 4XCCL 3RWHA 3UROR 1Y18A 4ZO8A 1FQ9C 3RWFA 3RWEA 1NBZA 1L9NA 4IRJB 4LNRA 3O45B 4QO1A 4R97B 4F57L 2OR9L 3OHXA 1CXIA 4NO3B 1LE5A 3QZWG 1CGYA 4XVJH 4ODUB 1U42A 4FQHA 1DQJA 4ONOA 1YJDL 2XOTA 5EOCJ 5DUML 5EFIB 3MLSL 4YDKL 1HHKA 1DQDL 3KPSD 3A6CL 3JV5A 1NMAL 2DLGA 4XBPA 5EIVA 4CJ1A 5J6HA 1Q72L 2OL3B 1R3LB 3QDJA 2PR4H 3QNXA 2BERA 3C8DA 3RTQB 2BJMH 2I9TA 1OP5K 3L95B 3LEYH 1ZHKA 2YD6A 1ODAA 1XR8A 4OF8A 1ZA3B 1WVZA 5GGVL 1F90H 2ZG1A 4TUJA 5HHOE 5E99H 3QCUH 1K4CB 2CIKA 3FQRA 2NY1C 3G6JE 1T7VA 3MRBA 1MUJB 1LO4H 1EMTH 5JTWA 4XP5H 3DX7B 4O2FB 3DETD 4Y4HC 1ZHLA 3BYYA 3HMXL 4XVTL 3P9LB 2DICA 4QXTB 3FQUB 3SCMA 1QLRB 4UV7H 5GRUH 3BXNA 1ZK9A 3UTTB 4AG4L 3TV3L 2OJEA 4H20L 1PW3A 2W9EH 3MJ7B 4RRPA 3ORJA 3VRJB 3A67H 4WEBH 2W91A 3BX7C 4LKCA 2AI0L 5IW6B 4YHNA 4OM0H 1XF3B 2HKFH 3T08A 2K7QA 5JA8B 1Z9SA 3MLTB 5LCVH 2X7LA 5I30H 7FABL 4WUKH 4NT6A 2OL3L 4R3SB 5FYKL 5KTEH 1GGBL 2UWEE 1TVBB 1OY3B 4M7KL 1OTSC 2P49B 3OKOB 2BMKA 4MX7B 1PAMA 5JNYB 1A1MA 2FX7H 5BQ7B 1MWAB 4O2CA 4KQ4L 2FJFA 2CXGA 4IOFC 4PJCE 3U79A 4XNUL 3BZ4B 1I8IA 4M1CD 4KVNH 4BKLB 2PW1B 3PGDA 5GSRB 1T6VN 5TPWL 4KK8D 1MI5E 4X99A 3QUMA 1C1EL 5F89A 1CG9A 4PR5B 3R0MA 4PJDF 3AVEA 3F6IA 4UIMB 3C9NB 3IDIA 2YKLH 3FT3B 1HHGA 4LLMA 3FB8B 4LPTA 1KJ2L 5F97E 1PX4A 1V7NH 2GSIB 3KDMB 1G6RH 1QRKA 2VISB 3MMEA 2EDDA 5T3XE 2VNCA 5I1GL 4RRPG 2CDEA 2G5BB 3KPSB 3GKZA 4Z78B 4JHBA 3RKDC 4Z76A 1TTUA 4M5YH 5JW5B 4MB5A 4J3SA 2ZG2A 4QF1A 2ADGA 3SDXF 3L7FB 5C0JA 5F1KC 4K55A 5DVMA 2NY1B 32C2B 3TBTA 3MZGB 1A7OH 3MLPA 3K1KC 1IE5A 4FZ8L 5FUZL 1JMXA 4Z7OE 1RUQL 4Y4HB 5BRZD 1A9BA 5BJTB 4KUCD 1JZ8A 1SHMA 4X4MA 2J2ZA 4GW1B 3U83A 3ILPA 4Z7WF 1VENA 3QCTL 1X5XA 2FO4A 1JNHA 4YHZL 5JR1H 2AJZA 3GHBL 3X12A 5TDPA 2VZ1A 2DQFA 4XX1E 5IVXA 3FO9B 3PP4L 1U8PB 1NFDF 5CBEA 3NTCH 1A2YB 3THMH 1VFBB 5D2LE 1NAKH 2BNUB 4NZTL 1A1NB 1UQSA 2AVGA 2V2XB 1RMFL 4GKZB 1IRAY 5GGTA 1OGAB 1DFBH 1ND0B 4XWOD 4ODVL 3QHFL 5IGXL 4ZUTB 3MREA 4K3GA 3VFNB 1BEYH 1OSZB 2A9ML 2VIRA 4MWFA 4HZLB 4P57B 4F7MA 1A6TB 3AS1A 4LLQA 4JHAH 3IDNA 3DURA 4D9QD 2VDLH 1O7VA 4PJ5D 4PGCB 3PGCB 2R15A 3D0LB 3H7BB 3CPLA 4TSCH 3QNYB 1WUNT 4XNMA 3RY4A 5IIEB 2P8MA 2PTUA 4JAMA 1EGJL 3HNTL 2WAHA 1DL7L