3RTQD

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD02
1B2WL 1UWGL 3GSVB 3LQZB 4S2SA 4OD3H 5IG7A 4J8RB 4FFWD 1KPUB 4J2XA 5MERA 1RJLA 2AQ3A 5HGAB 5DVNA 2A77H 1HOCA 1PQZA 2I07A 5DLMH 5HYSG 1E4XL 4PRHA 4OIIH 4GW4A 4JY5H 3UPRA 4UNTA 4XVSH 3C5ZD 1LEIB 5FCUH 1VACA 3GSNH 3VXSB 4X7EC 2AK1H 3PL6D 3GHBL 2ENSA 4XP6L 5FGRA 5LGHL 1T03L 4MD4B 1LD9A 4X6CB 2CKBB 5LXGL 4L8DA 1AGDA 1FBIH 5F9DC 1I8LC 4OLZH 2P5WD 5C0RH 4R7DB 1TVBA 1M7DB 3QO1B 4HWBA 1Z5LA 1H0DB 1LP9B 4WUUE 4JCMA 1S9VB 2NYYD 4KJYB 3DYOA 4OM0L 5JXED 4G7VH 1MFAL 2XPGA 3WIHL 4NUJB 1SBBA 5DO2C 4N5EC 3OV6A 2CK0H 3R1GH 2MSPA 3RUGF 4HC1H 3ARSA 3NCYS 3S97C 1JWSB 3BISA 4YAQA 1T89A 5GJTH 3IB4A 3NTCL 3H9HA 3KPQB 2HFEA 4HJGB 2OX5A 4UDTB 3VFTB 4P2OD 2E6QA 4UUJB 1VFUA 4XI5D 3EUUA 2VLJD 4TQEL 1QO3A 4JPVL 4P59L 4NQDE 3HE7C 4G3YH 5IMLA 3PWPB 5T1DL 4I1NB 1HEZB 2V5YA 3KLDA 4OB5L 4DEPB 1AQKL 3BH8A 2J6EH 3UTQA 3LCYA 5L2KA 4PRBB 4WTZA 2QV2A 4AENA 3QDJD 2DQHH 4Y4KD 1MCBA 5JO5A 1UVQB 1GAFH 2HFFA 3HC3H 2X09A 3CLFL 1P69B 2D31A 2XKUA 2XRAH 3JWOL 5D72L 4HIJB 5DHVA 4EI5D 4L5FL 4GKOA 4P3WA 1S7TB 2NQCA 1YDPA 1LE9A 3LKRB 2J5LB 3BT2H 4ZSOE 4L3ED 4JFPB 3VD3A 2H32B 5F9WB 2WINA 3LIZH 1F13A 4QHNB 4OZIB 3W11C 4E9LA 3L7EB 3HS0B 2M2DA 3SKNA 5E56A 4N8VB 4O4YL 1KENL 2JJUA 2V5SA 3PQYB 4XBEH 1LO3H 3KGRA 3BWAA 4K3DL 4YXLL 5HGDA 4ZD3H 5K9OA 1TFHA 4NQCA 4EBQH 4TSAL 4U7KA 3QFJE 4CDGC 5TPWH 1UEYA 1NDMB 1A7PL 2FEEI 3MLYL 3RWGA 1UACH 2VXSH 1QSEE 5CINH 1FVDB 4DKFH 5F96L 2FGZA 1KJ2A 1CGXA 4LHUD 1OQXA 3P9MA 3EIFA 2EDOA 4PB9H 5ACLA 5BZDB 1MCCA 4MJ6A 3C87A 4L4JA 2D2OA 4OFIA 2VDRL 3CVHH 4FTVB 1MAML 5C2UB 3PABB 4WCYL 1GGUA 1T7XA 3CH1A 5ITFB 2MPAH 1FLTX 1YMMB 3QUXD 4Z7UE 4JKMA 5ICXB 1NFIA 3IDMB 4UBDC 1PZ5B 4XPAH 4J1UB 1I3RA 1MI5B 4OZ4A 4U0QB 5CILH 4HGMA 2PW1B 4LIQE 4RWHA 4Y5VA 5IEKB 4XZUB 3VU2A 3QJHA 1U8QA 4ALAH 4MA1B 4RMQA 4XP9H 1RZIA 3I50H 3EYOA 3WUZA 4JRXB 3O3BB 3WXVH 4WHTA 1RVFH 3MRLB 4QHKJ 1IC7H 2DBJA 3NA9H 2VDMH 2JCCF 4I5BA 1UWXK 2FEDC 3GMNA 1KTKE 3P2TA 5IB3A 5DUPH 2AQ1A 4GUPA 4AQOA 1XF4A 5JHDE 1MHCA 1N0XL 2R1YB 3TN0D 1OSZA 4PJHE 2V6HA 2ADGA 3FRPA 5CZKA 1AO7D 3DI3B 1QR4A 3IXAA 1LK3L 5TDOB 5B38G 1IGIL 1KFAH 1R5IA 5FHBH 4Q97A 3HE6A 3S3PA 5FYKH 1MJ7L 1RJYB 4NKOB 3IFNH 3GSNA 3SOBL 3HI6H 2EH8H 5FUOH 1JMZA 1CL7H 5CSZA 2VQ1A 3TWCH 1JRHI 3BMWA 4F2MB 2NNAB 1SBSL 4IHOB 5D2LB 4Y5XB 4OQTH 4NQEA 3WHE1 3ETBF 1AH1A 4IRJA 5I76B 1QOKA 1YEIH 4RAVA 1DANT 2WWKO 1A7OL 2HLAA 2HJLB 2R0KH 1FCGA 1HKLL 3QEHA 1CT8A 1GC1L 1XGRB 2OTWA 1Q9LB 4KPHL 5I66A 2N7BA 3MLUL 4JO2H 1N6QH 1EO8H 1ZLSH 3QEGL 4E41E 4QXTB 4E5XA 4HGKC 5JW5A 4YHPB 1TVHB 1NCAL 5K59E 1HYSD 1J8HB 5IHUH 1WBXA 5CAYB 1JHLL 4PJ7E 4LSSH 5J3HD 4KK5D 5AZEL 2AJUL 4OCRH 1R0AL 5EB9A 1HXYB 3SDCC 1ZS8A 1VFBA 5T5FH 3RZCB 3UYRL 4G42B 4HQQL 2NTSP 3TT3L 2WLZA 4YGAB 1OLLA 4NZTL 2OBGA 1WWWX 1N59B 2C7UB 3SKJL 4N9OB 4JN2A 5DMGD 1K8DA 4P9HC 3HUJF 3L5JA 1FNLA 4AEIH 1QEWB 3QUKA 3MXWL 4N0UA 4H25B 1RUML 3AREC 4NQXA 1KLUB 1FNAA 2VUOA 4X83A 5D6CB 4CMMB 3LQAL 2J6EA 5FF6B 4OI8A 1QBLL 4PGBA 5INDA 1RIVL 3OHXA 3RWEB 4DUWA 5EO0A 1P7QB 3MUJA 1AD9A 3SDYL 5MI0C 4PJEB 5J1AB 1MCLA 1HK6A 1AR1C 1F8TL 3VFSA 3G6DH 1X3DA 5IMKB 1CLOL 2VAAA 4JO3L 4M61B 2AK4E 5D7JB 3QA3B 1KCVL 3HR5B 5HD8D 5EIIB 3WEXB 3ISWA 2PUQT 4FNLL 5T3ZD 2YD3A 1BQHA 4JANA 1YEKH 5D1ZC 2R0ZL 15C8H 1P53A 5I16B 4NPYB 4MB4A 5FM5M 5F7UA 4OZGF 4OUOA 1PDKA 2ARJA 1NGZA 5I8OL 4YR6A 1RMFL 4EXPX 4LASL 1U3JA 1IT9H 2DL2A 2O5XH 3MLTB 4QTIH 4OCNC 1U6AL 2AI0H 4HPYL 5GZND 4RFNC 3ZTJG 2EIZA 1XGQB 3SEPA 4PUBL 4WHYG 4Z76A 2DBLL 4EDWH 4IJ3B 2IFGA 4P2QD 3S96A 2XA8L 1U3HD 4UILH 2FX8H 4J12A 2HVKB 1T80A 4N90D 1YJDH 3CFCH 4Z95L 2JKXA 3Q48A 4LKCA 1I7ZB 2WQRA 2J8HA 3U0WL 2EDJA 2OXGA 43C9A 4HWBL 1A7NL 2FATL 1INDH 2BC4A 5C09E 5J6GB 3QDMD 5CSBA 4JDZB 3DXAB 1Q72H 2BRRL 2ITCB 1RZ7H 3KWWA 2NY1B 2PETA 1MEXH 4M00A 5ID0A 4WENB 1G0DA 4FOMA 5SWZD 1FL3B 4R7NB 3I02A 5J9PB 4Z0XA 3H2WA 1I1FA 5FGBA 2CIKA 4DOHB 5E94B 3DRTA 2EYSA 3ES6B 1G7IA 1P7KA 3HZMB 2UVFA 5I1DA 3B6SA 1RURH 3MO1B 1H3WM 1CR9H 5K9JL 5I75B 4P5MA 3K2UL 1QLRB 4G7YL 1NJ9B 1TJHL 2YXFA 4Y19A 5CBAA 3OR7A 2UWEF 3WS6C 1X5AA 2IH3B 5DHYA 4YWGH 3ZYJA 2OMNA 5DMYA 4YX2L 4LSDA 4BH7B 4N0RA 2AABH 2JB6A 5EC2A 3LS5H 1D6EB 1PG7W 5CMAB 3BJLA 4MJIE 4POYA 3FN9A 4EUPH 3MRJB 5GJSL 3O4OB 5JQHC 4DK3A 1U95B 4KROD 2DI9A 3PHOB 3IDNA 4FQLL 3WN5C 3MUY1 4KFZC 1CE6A 1WIPA 3A6BH 1UCBH 3DUUA 1CGUA 4YZFE 1KT2A 4MLIA 5ITBH 2P49B 3T0EE 3G6JF 4U6YB 1M7IB 5IK3B 7FABH 4AT6B 5IFHL 4UT7L 1F42A 1SM3L 2R2CA 2B2XL 5C07B 2EH7L 2A6IA 4OI9A 5GS2D 1QRKA 5E2UL 4F7EB 1R3JA 4ZNCD 3SKOB 5IKCB 2R69L 4OF5A 3FT3A 3KXFB 4OQTA 5IF0B 3ZT5A 5BV7B 2AXGB 5C0BD 4OZFG 2DYPA 2ESVA 3MYZA 5J57B 2CRIA 2OJZL 4PJ9B 5DJ2B 2NTFA 4PV9A 4E42A 3CSYA 3MRRB 3VWKA 3ZE2F 4OUUB 4P5TB 3H7BB 3TH2T 4D8PB 1Z9MA 4RSVA 2DI8A 5IJKA 5CZXD 4G6AD 4HXAH 3AB0B 5GHWH 5CIPA 1VDGA 4GMSL 2VLKD 1AGCA 5T5NF 1KJ2L 2CLVB 4KTDH 3HE6D 1S9XB 1SQ2N 5F1NA 5I1EH 4U31A 1QFHA 3I6KA 4NRXB 1AP2A 4JHWH 5IB2B 2W65B 5SWQA 1H3GA 4Z6AT 3FO0H 1NBQA 3VG9C 3V0WH 5I1CH 1AY1H 2LE9A 3PXHA 5E0QA 1P4BH 5GXBB 4JZOA 2AP2A 5HHXL 1I7TA 1CICC 2X4TB 5KZCB 4UT6L 4RQQA 1XR9B 3MLSL 4JLRA 4JPKL 3M8OH 4Z77A 4M8QB 4I77H 3IJYB 5D1QB 2JK5A 3JWDC 3MRBB 4M4PA 5D7IB 2AS5M 1N5YL 1OARH 1RIHH 3ULVE 3H9SE 3GBMH 1OGAE 1OVZA 1AE6H 3I6LE 3MRFB 3T77A 1HI6B 1FNSL 4Y4FB 5ALBH 1L6ZA 1ZHKB 4JFOA 4QLRA 4OGXH 3SO5A 4CN6A 2OQJA 1C12B 3SPVB 3V5HA 2GCYB 4GW5A 4PJ8B 1A7QH 4FQJH 5DA0B 4AH2A 4X6DF 1T7VA 3TGXA 2NLJA 2QEJA 3WD5H 4N0YH 1MNUL 2WIIB 1J1XL 3VRJA 2DLGA 3F7YB 3VRLF 2FHBA 3MV8D 5E2TL 2V9TA 5EUOB 2X1QA 1DVFA 2OXHA 4WWID 4PP2B 2HJFA 3D39A 2Q7YA 2A77L 3AU1A 4M5YH 1WCBB 2VYRE 5DUML 2FGWH 5DLML 3TNNA 5JOEA 4OIIL 4JY5L 5IR1B 2NR6C 4XVSL 1QA9B 2UZYB 5FCUL 3GSNL 4TUKH 1FFOB 1FL6A 2ICWJ 1PKQA 2IPUK 2YD4A 4JJ5B 5B4MC 3LN5B 4PFEA 4JM2C 3HKFA 1EXUA 2C26A 2VWEC 2E7LC 1HH9B 4L29A 4LP5A 1AFVH 1FBIL 3D0LB 2PO6D 1PAMA 1NUGA 2EE6A 5C0CD 4LVHB 5C0RL 4RGOH 3ILQD 4WW2F 3RWCB 4PGZA 3U48A 4H26B 4NC1E 1C5BH 4S11A 2DQTH 3ZDYF 2LU3A 2WWMC 3FQRA 4G7VL 1AGBB 5I0ZA 3S8WA 2GY5A 4KJWD 3X12A 1QFWI 5BOZG 3ARFA 1I8IA 1HCFX 1U8NB 5FYJD 3LPWA 3O6FA 4XP4H 4KKAC 4X4XA 5KG9B 1JGLL 5GGVY 4YHKH 1I9RH 5CKGA 4XPBH 2XKNA 4MB5A 1U8LB 5HDBF 1SMOA 2J8UA 3RUGB 4ZFOB 1AXIB 1LO2H 3AY4C 4R4BA 4ENED 3VXMB 3BHBA 4S0SD 4JFXB 3BVNB 5I19H 3SJVB 2A9MH 4HBQA 1A6AA 3U36B 2OYPA 3HNSH 3DMMA 2VITB 5GGRB 3V0VB 5EULV 1VSCA 4G3YL 4HWNA 3QWRA 3B9KD 2YWYA 1EUUA 4P23A 4ODSH 1HINH 5M7QA 2J6EL 4R0LB 1SJEA 5ISZE 2Q76B 4IRSB 1JPST 1TJIH 3K8LA 1Z9OA 1SJHB 2DQHL 4WFHD 1JV5B 1GAFL 3HC3L 3H42L 1EGJH 4LAQH 4TYUA 3W0WB 3UBXG 4JFFA 1MUJB 4DTGH 3D9AH 3BQUD 2NZ9C 4QYOA 3AAZB 2BNRB 2VZUA 3MACH 3LZFH 1UM6H 1CE1H 1BP3B 2DQDH 2VLMD 1S7UA 3BPLC 4L8SB 4KQ3H 5F9WC 3REWA 5CD3B 5JW3L 4LVNB 5IFJB 4I0CC 3QQ9C 4U6HB 2Y06L 3S98A 4UIMA 5TQ2L 4PGDB 1FNGA 1KTRL 5FV1L 3W81A 4XBEL 5DJXB 1LO3L 5I17B 3PIQA 3QIWD 4HFWA 4I48A 4ZD3L 4BKLA 4EBQL 4I2XA 5TPWL 3NA4A 1S7VB 4U4BA 4WU5B 3G5YA 4YJZL 3REVB 5L2JA 4JQXC 2VXSL 1OAKH 2H45A 2AV1B 2X1OA 5CINL 1YN7B 4PRPB 4DKFL 2X89D 4MZ3A 1FNHA 3VGEA 5E00B 3IJSB 4X6BA 2CMRL 5KSVA 4U05A 2H9GB 4PJXA 4OCMC 5CBEB 3QDGB 4O51B 1KB5H 4PB9L 4L4TD 1BZ7A 4JG0L 4XTRD 1KXQE 2QSVA 3O3AA 4LMQI 4D9RD 4M7LL 4IDLA 3NFNB 3DSFH 2YBRA 4QTHB 5HI4C 4MA8L 2GY7B 2BHYA 4HFUH 5D1XA 3QI9B 4MLSA 3O11A 2Z92A 5FDWB 1S7RB 3NPSB 4RX4D 1A9EA 1QRNA 4WWKA 2GUOA 2EDHA 4LEOB 5I1AA 4Q9RL 5CILL 2CXGA 4WU7A 1OCWH 4MA1C 5DJ6A 4ALAL 1FE8H 1PX3A 4KGLA 4XP9L 5I1IH 1ZANH 3GKWH 4ZO6A 3I50L 1A8JH 1CQKA 1CG9A 3WXVL 4V2BA 3BUYB 5EZIL 1RVFL 3TA3B 1IC7L 2QHRH 4D0BA 3K81A 1NGYA 1BVZA 3TT1H 2ICWB 1I3VA 2Y25A 3TP4A 3THMH 3MROB 2PYEB 1GH7A 3L5XH 1NC4A 2O5YH 1CDUA 3MA7A 3PWPE 4GKNB 5DUPL 1E6OH 3GSUB 1MCPH 2XNAA 1KEMH 1B0WA 1C08B 3DECA 3SE4C 4L9LA 4KJPD 1YNKH 3T2NL 4XMLH 3DHJA 3L3IA 5GRJL 3VCLA 2BNUB 1R3LB 1SY6H 3RPIA 2P5EB 1OP9A 4YHIB 4X4MA 5FYKL 1J0HA 3ZKQD 4LF3B 2YD8A 3PDDA 3EOTH 1RHFA 1S7XB 3MXVH 3HI6L 2EH8L 3IS1X 5FUOL 5KSBE 3OJDA 1I3UA 1P1ZB 2OI9B 4LMQE 4Q58C 1CS6A 2KZWA 2F9BT 5BZWA 1CK0H 3WBDA 3X17A 4Y5XC 1IAOA 1V8HA 3L5IA 4OQTL 3FFCD 4HHAA 2G9HB 2WANA 2QADC 1AJ7H 3DI2B 3PQYE 4DZ8A 1CLCA 2MMXA 2BSRA 4YDKH 2R0KL 2AVGA 5EU6A 3ARUA 2A38A 3FQXB 1A3RH 1VPOH 3ZHDA 3ESVF 2VIRB 2DQGL 3FQUA 4JO2L 1AHWA 1HSBA 1N6QL 1EO8L 1U3YA 4HX1B 1ZLSL 3HAEH 1RPQA 2E6PA 2J1KA 1G7QA 5KAQG 2AJ3A 5IHUL 2A9NH 5AWNL 1XGPB 4LSSL 5ETUB 3R0NA 4LQFH 5LGJA 1OSPH 1ZT1A 3MCLH 4OCRL 2X4UA 4Y16A 3FQNA 3RZCC 5T5FL 4MXWH 3BE1L 4WW1A 3UP1A 2R2BB 1BD2A 4PJBA 1MOEA 3EHBD 3JV0A 5A16B 3NCCB 1F6AA 3KYAA 4PJIA 3U4AA 3MUGA 1EAPA 4G8GB 4XVTH 4W6XB 4MX7B 4DAGH 4HSQA 4N9GA 1MI5E 4AEIL 4OF3A 3U30B 4U1LB 2C3VB 4V1DE 2BVYA 5CEZH 2QR0B 1KULA 3HUJB 4FFVC 5ALCH 4F58L 2IG2H 2RAMA 5BXFB 5HYFA 3HPLA 3U0TB 2FJGA 3V0AC 3PWLA 1S7WA 3ARBD 4UZGA 1KLGB 4MAYD 5T3ZH 3GJFK 1EO5A 3A6CH 1EGJA 2NCMA 3BWUC 5F8QC 4B0MM 5DGQA 3IVKB 2GFBA 3G6DL 5DTFB 2F58H 5D7JC 1KTLB 4Y7MA 4F7PB 2V5MA 5DMJB 3V5KA 3LKSB 4B41A 1QSFE 3ARGC 4U1KB 3C60A 5B39A 5TFSH 3ULSA 1YEKL 4NO0D 4ZFZB 4YO0B 2V2WA 4CVXB 5H2BA 3U2SB 1EFXD 2R29H 5CSGA 5BO1H 1YZZA 2LU7A 4CNIA 1RZKL 2PW2A 1IT9L 2O5XL 2L0DA 4P4RA 1F4XH 1MIEL 4U0RB 4YXKH 3OKDA 4QTIL 2Q8BH 3BN9D 4GG6A 3MLXH 3JBG7 2ADFH 4ONHA 5MEOB 3TYFA 4X4YA 3RWJB 3SDAB 1ZGLA 2VZVA 3STZA 32C2B 2EICA 4HWZB 4PJ5E 4WEMB 4EDWL 2KH2B 3ECBB 5KS9E 4P2RD 4MS8C 3N06B 4UILL 2FX8L 2EIBA 5EFIB 2E7CA 3QSKB 4XCFH 3NFSH 5JHLL 5ECJE 1YJDL 1FZOA 4GAYB 1EDQA 5K9QI 5J12B 1KB5A 5C1MB 1YYMH 3OAYH 3P9LB 3I6GA 4N0FA 5E5RB 4AMKH 1INDL 3RU8H 1T66C 4JG1H 1Q72L 3UTPD 3NCYP 1MEXL 1Z3GH 2OTUA 3QCVH 3CDGB 2K9UA 3BP6B 3FB8B 5E8NA 3QUZB 1I8LA 4M7JH 4M5ZH 2FYYB 1A6UH 3E2HC 3N9GH 5DQDL 2VKXA 3MV9D 4POZD 1NMBL 3MPCA 1ADQL 4YBQD 1QLFA 5GS1A 4O2CA 3QNXB 5ADOH 1CR9L 1LO5B 3V5DB 1SHMA 2P46B 3WIFA 1QHPA 5IV2A 1NUNB 2RCSH 3GJEB 4OCYH 4YWGL 2BCKB 4JPWH 1JK8B 3BO8B 1URLA 3NABH 4PRIE 5C8JB 2UWEB 3TVMD 5ILTL 3IT8D 3UTSD 1NBZB 4CADB 1QPPA 3LS5L 1MJ8H 3VXOB 3VFWB 4LLWB 2YSSA 4FFZH 3D3VB 3O4OC 1AI1H 1D5XB 4KJQD 1VFMA 4FG6C 2DLHA 1JMXA 4NIKB 3WE6B 4HJJH 3L3GB 2O26U 3AXLA 2NX5A 4ONFH 3ARPA 1SY6A 5T1LD 4BM7A 1HQRA 1NCWL 1QRND 3A6BL 3K8MA 3I9GH 3HE7A 1U92A 1UCBL 1ZHNA 1JF1A 1YY8B 1RHHB 5DD6A 5FYKU 7FABL 4MNGA 3GSRB 3VFPB 4JAMA 4BH8B 2VLRB 4LCWA 1WWAX 1PSKH 3G6JB 3VFOB 2AJVL 4F7CA 2VZ1A 5H94B 3LKQA 1IM9D 2AEPL 2VABB 5DI8A 1OWWA 4EN3C 5BV7C 1GYAA 5AD0A 1IGTB 3WNNA 4PRNB 4ZO7A 3KYOB 3RGVA 5LAXA 5F1OB 3T2PA 5ADPH 1FVEB 4YIQB 4CBPA 2EEBA 3MJ9H 4UAOB 2JF1A 3EOAA 3OKOB 1S7QA 4ZUUA 4PP1C 2AEQH 2ZG1A 3HAEA 1EHLH 4R8WH 4Q9QH 3AB0C 4QRTB 3RKPA 1N3NA 4HXAL 4CN4A 4CW1B 5HPOA 4R9HA 2GK0A 3O8XC 4QOKB 2IANB 3QUYB 4JRYE 2WBJA 3MRIA 3U9UA 2DMBA 3HLAB 4R2GB 5I1EL 3SE3C 1OOAA 1Q9KA 3PHQB 4ETQA 3UROR 1TNNA 3ARYA 3FO0L 3V0WL 3O6KH 5I1CL 1AY1L 1ITCA 1MCIA 1P4BL 4M93B 5FYLE 3EO9L 4TNVK 5F3HB 3KJ6H 1HH6A 3W82A 3BZDA 1WT5C 1ZWIB 3M8OL 4EI6B 4I77L 1NFDA 2J4WH 4DOHE 1NLBL 3SGKA 2WP3O 1RIHL 1CFQA 3GBML 1AE6L 1T21B 4LFHG 1JL8A 1VCAA 3LKNA 4P46C 4QNPF 4M4RA 2VDOH 4HV8A 5IIEB 3FQWA 4OGXL 2VXVL 2IGFH 1D6VH 2WBKA 1NGXA 1WLHA 4FQIH 4BUGA 2DKMA 4FQJL 1GL4B 1BFTA 4ZAKA 3GSQB 3WD5L 1HHGA 3QQ4B 2VTFA 4X5LA 3UDWC 4WUUD 4PV8B 4X6DB 4F33A 1SJVA 1LWRA 2IALB 2YUVA 1J05B 1UQSA 3CH8A 4JY6B 5FECA 3V79C 2X1PA 1L7IH 2KBGA 1MHHA 2DS4A 5A2JH 5JTWA 1WBYB 1U91B 4PJGB 5EZLB 1KIUA 4J3WA 5CP3H 4M5YL 4WI5A 2FGWL 3I3BA 4KK9D 4JFYB 1MIMH 1N26A 3KPRB 4UOW1 3MV01 5FO7A 1OP3K 1G9MC 4S2SB 4TUKL 3H3BC 3LH2H 2VB5A 1DL7H 1V7NL 4HIXH 3Q3GA 5MERB 1RJLB 2QQKH 2VE6A 1HOCB 3FO9A 2I07B 4FA8A 3BUTA 4PRHB 3UPRB 4GW4B 1SYSA 1NBYA 1P7HL 5HDOA 3RBSA 3BJ91 1AFVL 3ALWA 3NZ8A 2GJ6E 1VACB 4LVHC 5C0EA 4PD4J 2YC1A 4PJFA 3IU3A 2H3NA 1J1OH 4RRPA 5BOPA 1LD9B 4C56A 3D0VB 5BS0A 5E6ZA 4KKLD 5KVFL 1NCNA 1U3ZA 1BF2A 4FQQA 3UTTA 4LKXA 4MDIA 1TVBB 5BMFH 4LK4A 1Q0YH 4S1QL 4YHKL 1I9RL 1Z5LB 5EZJA 2EDRA 4UNVA 1Q9OA 2VR9A 4RDQF 1TZGH 5F9AC 1OY3B 3HC4L 2XPGB 1LO2L 2FX7L 4Y2DD 4P3DA 3MNWA 1A9BA 3BI9X 5I19L 2DQFA 1FFPB 3SQOH 4JRWA 2J8UF 3EDDA 3BP7A 3HNSL 4M3KB 4YAQB 3T65A 1NGPH 2DIAA 2X10A 3H9HB 1VENA 5D7IE 1E0OB 4ODSL 3SDCA 3QFJD 1RQ5A 4JFDA 3U1SL 4IRSC 2JELH 5KVGL 3SY0A 1C5CH 1CU4L 4XPGL 4XBGA 1QSED 1OP3H 8CGTA 2WBWB 1EGJL 1QO3B 5I1HL 1Y0LA 4YDVA 3LPGA 3EJYC 5IMLB 4DTGL 2QSQA 3D9AL 2E7MA 2Y36H 4YDJA 2YMXL 3UTQB 3JWDH 5L2KB 3MACL 2DD8L 3LZFL 4KRNA 4AENB 1UM6L 1H8SA 1CE1L 2DQDL 5I8CB 1PVHA 1X5JA 4TNWK 3UTZA 2X4QA 4KQ3L 3WNKA 5JO5B 2HFFB 4HUWA 3BGMA 2W0PA 3QIBD 4MZ2A 5AZ2L 3PP4H 3I3EA 2CH8A 4R3SA 2D31B 4JVUA 2V7NA 1CIUA 2AKRA 1S9YA 1LE5A 5DHVB 5MENE 3MRKA 4FS0A 2FO1A 1YDPB 1LE9B 4FQXD 1OAQH 1JPSH 2WINB 1IAIH 3IF1A 4NQSA 3LB6D 3MJ9A 2MFNA 2OP4H 4Y4HC 3SKNB 4WNQA 4OFYA 1YEHH 1OAKL 4N8PA 4WHCA 4OGAD 3ZKMC 1QNZL 2MHAA 3QIUC 5K9OB 5B8CC 4NQCB 1KB5L 3L7FA 2VLLA 2BNQA 5JHDD 3CIQA 3OB0K 2YKLH 5IM7A 3RWGB 1V3LA 4I13B 4XNZB 2MKWA 4GQPH 3RTQC 4PJXF 3MYJA 5IW3A 1PKOA 4QRPD 4MCYA 2V2XA 1F3DH 1BWMA 3QI9C 1KJ2B 4HFUL 3P9MB 3NPSC 3GEWB 5FKPA 1ZAGA 4MJ6B 2I26N 4XCYB 1GPOH 3LMJH 3LS4H 1YEGL 3CH1B 1VFAA 1FE8L 1GOGA 2F19H 3BZFB 3TCLB 1QG3A 1NFIB 3CNKA 4F80A 3LN9A 3TA3C 3PDGA 2QHRL 4M43H 3W11D 1I3RB 5K93A 3TT1L 1JWUA 4KRPD 3FOLA 5HYSA 3HZYB 4Y5VB 3VWJC 5EBWA 2W92A 3QJHB 3L5XL 4GBXC 4J3SA 3EYOB 3VXRE 1E6OL 2DQIH 4N8VG 4WHTB 1KV3A 1MCPL 1KEML 3JTTA 5HHPA 1T0NA 5T1MA 1YNKL 4I5BB 3IFPA 4YUEH 4RGNB 1HDMA 1Z9SA 3GMNB 4NFBA 5CP3A 1SY6L 1PLGH 5FB8A 5IB3B 3QEQB 4GUPB 3IDUA 4KI5C 5IB5A 2NY4B 1XF4B 4OF6A 1MHCB 4EDXA 3MNZA 1OSZB 4NJAL 1T1ZA 2ADGB 3H7LA 3MC0A 1G1YA 5ESQA 3T0EC 3FFDA 4ZOCA 1F4HA 3OB0H 4CN1A 1CK0L 3HNVL 4R4FH 3RDTD 1BBJA 1NMCB 5DD3H 1G7HA 4FMFA 2AJZA 2DIBA 4TUJA 5H37H 3GSNB 1AD0A 3MTRA 1AJ7L 1JE6A 5IW6A 3DIFA 4YDKL 4UT9H 3DUSB 3ZKXB 5CSZB 4JHZA 1A3RL 2EDKA 2VQ1B 4JREB 4WFFE 4OTXL 4C58B 1FRGL 5CGTA 2L4OA 2X70A 4CU6A 1MCRA 1EV2E 2B20A 4NQEB 4IRJB 2LTQB 4RAVB 5B3JF 3OWEA 1I7UA 2A9NL 2HLAB 5DVMA 3D2UD 3QEHB 1CT8B 2FEDD 3STLB 4LQFL 3U7WH 3MRHA 5IW1B 1OSPL 2OTWB 3CU1A 5DGRA 1GGYA 3CFJA 4LRNH 3QXDA 2QJDA 4HIEA 1JN6A 4MXWL 4E5XB 3LHPL 4D94A 1SJXA 5E08H 3G5ZA 1VA9A 1E4XI 5I1JL 1EX0A 4FZEL 4U2ZA 4IOSD 1WBXB 5D4QA 2HMIC 5E9DE 3B2VH 4QWWC 2IBBA 3WLWD 1CFNA 1DUZA 4J3OC 2GJZA 4XVTL 2OSLB 2FNBA 5JIHA 4DAGL 3DYMA 4PJBF 4JFEA 5DHXB 5CEZL 3J8F7 1ZS8B 1VFBB 4PJIF 2FL5A 3OZ9L 4JO4H 5ALCL 2IG2L 3CFIC 5C0AA 4JGMA 5IBTH 3HG1A 5HPMA 4ZTPH 1D3CA 3L3KA 5IESH 4JN2B 3ULVC 2GITA 1K8DB 1T1YA 5IMOA 1R3IL 3CDYA 3QUKB 1RU9H 4N0UB 5DSCA 1YY9C 3QHZL 4J23A 4IMKC 4NQXB 2PYEE 2F58L 5E7FA 2EKJA 2UYLA 1Q38A 1WQVT 5L8KB 3ZTJH 5INDB 3OHXB 1BIIA 3NIFE 3K4AA 2JCCE 5EO0B 2DL9A 2VJXA 1AD9B 2XXMB 3WFDH 5TFSL 5C09D 3CDCA 4Z7WA 2OS7A 3VFSB 5I8KH 2VAAB 2CQVA 4YHOH 5BO1L 4HBCH 3MLRL 1F4XL 3SGEH 2P5EE 1XF3A 5C0FB 1BQHB 4JANB 3L9RA 1T83C 3MLXL 4NM8H 2ADFL 43CAA 4J4PA 4X9IA 3MLWH 1AIFB 5F7MC 5HVFB 1DJSA 2BVPA 4KDWA 4YFLF 3TO4D 5IP4A 4GG6F 1NGZB 2P8LB 1NCBH 5T1KD 5EN2A 3NGBB 3HMXA 5HGAA 2ADJA 4PJDA 4XCFL 3TZVA 4LQ1A 1YECH 3O0RH 2EIZB 1YEEL 5J12C 4P4KC 5DA4A 5DK0A 4X6FA 3ARED 1YYML 4IMLA 3CCHA 3DJ9A 1ED3B 3QB7C 1W0VA 3Q5TA 3RL2B 4B7LA 3QQ3A 4RGMB 2DM3A 3S96B 4AMKL 3RU8L 3BDYH 1KCSH 2FBOJ 2Z8SA 1S78C 4MJ5A 5CFHA 4NC0B 4JG1L 3G5XA 4X6CA 5I18H 2VL5A 1G9EA 3O81A 4JM2A 4PY8I 2JIXD 4NNPH 2E7LA 4LKCB 3QCVL 3QUZC 4Y1AA 4YBLC 2YA2A 4YHZH 5EG6C 43C9B 4F7MA 4HJ0C 4R7DA 1I9EA 4HMDA 3S5LG 3VMNA 1M7DA 4DFHA 1A6UL 2BC4B 1LP9A 1CD9B 3O2VH 4OCSL 1J87A 5ADOL 2C1OA 3KYKH 4KTYA 1CIDA 5D1ZD 5K9QG 5ID0B 3DTXA 3I02B 4OCYL 4QRRE 3UPCA 5B38A 4Z0XB 1S7SB 2FZ3A 4JPWL 5E8PB 1I1FB 2CIKB 4EIGB 3DRTB 3SKMA 4M7ZC 1G7IB 1P7KB 5B21A 1MJ8L 4H20H 5I1DB 3B6SB 2F54A 5DF0A 4M1CD 4P5MB 5DMKA 4C4KT 5CBAB 3AY4A 3OR7B 1AI1L 4AJ0A 3L3HA 5DHYB 4HJJL 3ARQA 1WICA 3F5WA 5F21B 3KYNA 2JB6B 1MFCL 5IHBA 4ONFL 4P9HL 5EC2B 5F1IA 1UJTA 4OZFH 3C2AL 3I9GL 3S3JA 4ZNEA 4OGZA 1NAKH 1HEZA 3LOWA 4URTB 2J88H 2NY0D 2V5RA 5F6HJ 5TE7H 5C0NC 2VDQL 1B0GA 5FUZH 2H6PA 4LOUC 3IDNB 1PSKL 1OTTC 1CE6B 4TVPH 3DUUB 2P5WE 3MRGB 1KT2B 2EE9A 5D7LD 3TF7C 1A3LL 1P6FA 1YN6A 5SV4A 4KZDH 1F58H 4OZGE 4LAJH 2YUWA 3K74B 3LKRA 4XGZB 2NXZC 5ADPL 1OGAD 4UAOC 4Z7NF 4JFPA 2D9QB 2NY6B 2A6IB 3MJ9L 3I6LD 3SHSA 5SX5K 1R3JB 4OZIA 1QQDB 2AEQL 1MCOL 4XVUC 4K3EH 3FT3B 1TCRA 2FD6H 3TEUA 1EHLL 1WBZA 4K7FB 4R8WL 4PJCE 2BP3A 1ORSA 1MH5A 1OAUH 2DYPB 2ESVB 1UM4H 4ODUA 5J11B 2NTFB 1EBAA 4PV9B 1H3PH 3O4LA 3CSYB 4E42B 3KPLA 3VWKB 5IEHA 1OAYH 3DPBA 1KIRA 2EDYA 4K8RC 3OKMA 1NDMA 2IPKA 4JQXA 3D85D 3O6KL 1AGCB 4MNQA 2VLJE 2X6MA 3DNKA 1IC4L 3AS3A 1RJCA 2PXYC 1HSAA 3KJ6L 3BGAA 4H88H 4LFHD 5ANMA 5F1NB 5GGUA 3D48R 1AP2B 3FN3A 1OM3L 2J4WL 5SWQB 3PABA 2AXJA 1J0IA 3RRQA 1FL5A 1F4YH 1YMMA 3DARA 4G6KH 2JJWA 4JZOB 1I7TB 1NFDF 2VDOL 4RQQB 1PZ5A 3VXUB 1WF5A 4JLRB 3KHOA 4B50A 4R90H 2IGFL 4ZUSA 1D6VL 4Z77B 4GAJH 4FQIL 2JK5B 3BMVA 2UWEE 1WFNA 4XZUA 4KY1H 1D5IL 2R0WH 5TDNA 3T77B 4CMHC 1QR1A 3O3BA 2YD9A 4JFOB 5F9OH 4JFZH 4Z0BH 4PRDA 1J1PH 3U4BH 1L7IL 4P57A 1CVSC 2X05A 3RQ3A 2OJEA 4GW5B 1ZTXL 1HWHB 2QQQA 4AH2B 1CFVH 5SX5H 1K85A 2NLJB 2OZ4A 3LRSA 4AM0A 5ABDE 3VRJB 5DZNA 3KNBA 3T3MF 4DGYH 2EXYC 4U1SA 2B4CC 1DVFB 3JWNC 3SE4A 3LH2L 3WNMA 1DL7L 2HJFB 3P4MA 4HIXL 1EH9A 4MXQC 3D39B 2OM5A 1N6VA 1X5GA 2W91A 3BEVA 2ZSWB 3AU1B 3TNNB 2BVTA 4MDJA 1CICD 1KB9K 3BEWA 2HWZH 5IQ7L 4JKKA 5FFLA 1DFBH 4IRZH 1ZKAA 1FL6B 5HHMB 2ED7A 3ARVA 1JJUA 1J1OL 5FM8A 2CDEA 4YK4B 1IE5A 4HWEH 1A6VH 1NAMA 1EXUB 5DDHA 4J3XA 5GZOC 4L29B 1T0MA 4PJFF 5DWUH 3ZE2E 2ILLA 1XT5A 1GOHA 2VZ3A 3QCTH 2F5AL 1C5DA 3ULUC 3E6FA 2IANE 3ILPA 1G9NC 1UYWH 1XGRA 3FQRB 1ZOXA 3X12B 1N4XH 3ARFB 1I8IB 3LEXA 2DLTA 2HG5A 2E9IA 4YHPA 3O6FB 3NAAH 1Z6JT 4X4XB 5E6YA 3ZKSD 4FQCL 3MLZH 1T89C 4PLJD 3V4PH 1NGPL 2J8UB 4OF0A 1ZLWH 4R4BB 5E8EB 4HWUA 5D2NE 3BHBB 3VXSD 1AO7E 2JELL 1A6AB 1C5CL 3NCFB 3ESUF 5FO8A 1N59A 4UQ3A 3N1GC 3F58H 1AKJD 1FNEA 4EUPB 4P23B 2Y36L 3F12A 3KDMB 3KPSA 3JWDL 1SJEB 2Z8VC 4Z7VA 5FF6A 2Q87A 4PTTA 2BOCA 4BFIB 3S34H 2YN3A 1U58A 1S5IL 4JFFB 2WWMD 2CK2A 2Y4SA 1I1AC 4P2CG 3MOBH 3VRLE 3IJHA 3MV11 3QAZC 1OD7A 3JV6A 3OR6A 2AW2A 5HHVL 5D7JA 3SN6N 2O93L 4KKAD 3RVUD 3FZUD 3PWVB 2VXUH 1S7UB 1S8DA 1XGUA 2BHUA 2XT1B 3WV0A 1OAQL 1JPSL 5E99H 3ARGA 4PLKD 3O9WC 2ENYA 1FYTA 2OP4L 5KVMC 5C70A 1RFDH 5DURB 5E2WH 3BPNC 3C09B 1YEHL 4UIMB 1FV1A 5I15H 1FNGB 3HMXL 3PHSA 1NCDH 4LDLB 4KVCH 2GTWA 3NOIA 1DLHA 3V6OC 4AEHL 5IHLB 3PIQB 4HFWB 4I48B 3CSBA 3WO4C 4BKLB 4N1EA 3V7MA 3PWPD 5HHNA 4I2XB 1D9KA 1HWGB 4ONGL 1CWVA 5A2KH 2YKLL 3C9NA 3Q5YA 3G5YB 2DLIA 2YRPA 3BPOC 3VDAA 5L2JB 3JUYA 4NBXB 4M1DH 2D7OA 1AXTH 3MCG1 3WIIL 4U49A 4BQCA 2W9LA 4XB8A 4XNXH 3CFEB 2MWCA 4X6BB 4PJXB 1XR8A 2P43B 3TJHC 4GRWF 1BZ7B 1ZLVK 3LS4L 5EORH 3VD4A 1V7MH 4MSWA 1JNNH 5A1AA 2F19L 3N1QC 1I4FA 3GI8H 2FO4A 2EYTA 5D1XB 3SCMA 4JDZA 3DXAA 2Z92B 4ODTH 4M43L 5HDBE 1BJ8A 1A9EB 4XPHL 4WWKB 2GUOB 5I1AB 2ORBH 4XMPH 3QQ9D 4WU7B 4G5ZH 4Y5VC 2G5BA 3PQYD 5DJ6B 1NEZA 5GS0D 1FC1A 4BQ8A 4UOJA 1J0ZA 4XVJH 4LSTH 1CG9B 4GFTB 2DQIL 4NFDA 4Q2ZA 1XF2A 3T0BA 1XFPA 3AC0A 4QY8A 4D0BB 5A2IH 5JPNA 1NGYB 3WDHA 3RI5F 1NJ9A 3BW9B 5L8JB 1H9VA 1WVZA 1R3KA 1X5XA 3EFDL 4YUEL 3HFML 3AUVA 3IYLW 5SX4I 1YC7A 1RK1A 1NC4B 5EUKA 2OK0L 1JHKH 1U36A 3MA7B 5FGCB 1PLGL 1YEFH 2NY4C 1L0YA 3V52H 3F8UB 2XNAB 5DS8B 3ROOA 5IVZA 4P5KA 1U8MA 3NN8A 4FTVD 4D3CH 4NQDA 4P2QE 2AAVA 5CWSA 2WSKA 4XHQA 3L3IB 2CSPA 4DVRL 3TM6A 4X99A 4S0TD 1S3KL 2P47B 4ZYKA 1DQDH 5DD3L 5GRZA 1IQWL 1MRDH 1CZ8H 1MI5D 2KDGA 4W4OC 3X3GH 1D5BB 2QTEA 5H35A 1LDSA 1R3HA 5I6XB 1KBGH 4AT6A 3GK8H 2APTA 3A0OA 3OJDB 3QDME 1W72H 4NJ9L 2D7TH 4MGXA 4JRXD 4JQVC 3RNKA 1ZLVH 3DO3A 5BZWB 4UU9A 4RAHA 4RAUA 1IAOB 1NMAL 4OSUH 1BF8A 2LTQC 1NGWA 2LFGA 4EN3A 4BJLA 1MHEA 3KXFA 2EIEA 3K1DA 2DQUH 4QT5B 4DZ8B 2BSRB 5EU6B 4MMXC 4PYHA 3BIKA 2BERA 4TPRH 1AHWB 3B3IB 1HSBB 1X5IA 1JYNA 4O5LL 4OUUA 5BVJA 3H7BA 3ZTNH 4J3VA 1XIWA 1U41A 1G7QB 2BY1A 3H0TA 3ZKND 3INUL 4G9FA 4ODHH 3B2VL 5JZ7D 3C8DA 4LSRH 1N8ZB 5LGJB 1JWMA 3CAFA 3QUMH 4Q0XH 2ADIA 1ZT1B 3EYQC 3O8XA 1T0PB 4Y16B 4ZFGL 4ZXBC 1DBMH 1MELA 3FQNB 4KKBD 4AIXA 3OF6A 4WW1B 3WFHA 4NRXA 5F97E 4JO4L 4R6UA 3SE3A 1BD2B 5KSUA 2B1HL 2EO9A 4LP4A 5D7SH 4ZTPL 3CK0H 5IESL 1F6AB 4PJIB 3MUGB 1EAPB 5TQ0H 4N9GB 4Y4KB 1RU9L 3DX7A 5JW4R 1IZJA 4JY4A 4LSVL 3VI4E 1PZUB 4X7SH 2JJSA 2FWOB 3FAWA 3HPLB 2FJGB 3PWLB 3SBWC 3WHXA 1FIGH 3WFDL 5BRZA 4UB0H 4P46A 1JGVH 4X4ZA 5E1AA 4RMSA 1QBBA 2GFBB 1NANH 4YHOL 3SPVA 4RGNE 4GS7B 1J8HD 4HBCL 3T2OA 4BK5A 4Z7WF 3V5KB 2OZ4L 4HK0A 4ZO9A 2ARWA 2YA1A 1V05A 3C60B 2XTJC 5B39B 4NM8L 3ULSB 4HLZG 3CGTA 3UDWA 2V2WB 1UWEH 4XBPA 5EUOA 5H2BB 1RSFA 3DSNA 3RZCD 4PB0L 2MQ3A 4AK1A 4CNIB 1NCBL 4NT6A 2PW2B 1OTUD 1UJ3A 1L7TL 2D0FA 1L9MA 2BRQA 4RBPK 4GG6B 4YNYA 1M05A 5L0QC 4ONHB 1YECL 3O0RL 3TYFB 4X4YB 2CUMA 5IVXA 1J0KA 3P77A 1ZGLB 3STZB 4FFVD 1HQ4A 1T7YA 4PJDF 3K2MC 2IQAA 4FQ1H 1BWWA 2AEIT 1P7QD 1KCSL 1NAML 4PTUA 5T3XL 3G04B 1FZOB 4CU8A 2Z31A 1EMTH 5CP7A 4NNPL 5C08A 1KB5B 4OLUL 4W6YB 4EZMA 3E3QE 1UH2A 2IADA 4YHZL 4X6CF 4XPFH 5CUSL 2HH0H 4PGJA 3I6GB 4JM2F 4N0FB 2XTLA 3O2VL 2MOVA 1FLRL 2F53A 1WAAE 1WZKA 5DEZA 1GOFA 2WUBH 2OTUB 2EXWC 1IQDA 1LP9F 2CO7B 4I3SH 4UTBH 3BRDA 4Q7DA 1G0YR 4IS6A 4E41A 5KG9A 2P8PB 2XXCB 1Y6NR 5MEPA 5LCVL 3EZ8A 4QHMA 1QLFB 5GS1B 4O2CB 4M6OH 3EYSH 2XG4A 5HGBA 4NQUA 4OBSA 1EJOH 3WIFB 1L9NA 1ZMYA 3MMEA 1YQVH 5IV2B 2DMCA 2IAMC 1JTOA 4KH2A 2Q3AA 3E8UH 3MREA 4YEFA 4K7PL 2YSSB 3ZT6A 3DX6B 4RBPH 2CGRH 5TE7L 1F02I 3IXTA 2Q76A 4OKDA 1G7JA 3RVTD 1X6NA 5F1KC 3AXLB 2NX5B 3C6LA 5JUEH 3ULVH 1QACA 3VG0H 5FYLD 2NY1D 1BQLL 1HQRB 3ZL4H 1EAJA 4TVPL 4YHLH 1P2CB 1U92B 1ZHNB 2ZUXA 1JF1B 5C0CE 5DD6B 2C4FU 2BNRA 5EO1A 5AUMA 4OCXH 5DR5L 2X44D 3ARZA 4NCC1 4KZDL 1F58L 1PD6A 3QJFA 4MNGB 4JAMB 5TF0A 1WEJH 2AK4A 4LCWB 4F7CB 3WHE0 4WI9A 5FOBA 5GISH 4P9MH 3LKQB 5DI8B 2FD6L 2HN7B 2HT4C 1P9MC 3RGVB 4AEFA 5D70H 4OZIF 2GI7A 4GKZA 1UM4L 1W2KT 3RVXD 1UB6A 2AJXL 2HRPH 3VWKC 4ZUUB 1OAYL 2RFXB 3VFMA 4Y4HA 3HAEB 3FQTA 4ZDHA 3ARDC 2CD0A 4GKSA 3B8SA 1N3NB 2IPTH 3LN4A 4HUVA 3QUMA 4LNVA 4H88L 2WBJB 5CBEA 3QIUA 4JDTH 3MRIB 3QDGA 5B8CA 3U9UB 4YE4H 3ZLQC 3OPZL 3GSXA 4Y89A 4XCCL 1F4YL 5C07D 4U1NA 3NFNA 3RTQA 3VRIA 2YUZA 4G6KL 1YEDA 1NKOA 3STBA 1NGQH 3VH8G 1DBBH 2A6KA 1HH6B 4LEOA 4GAJL 4A6YH 4RCAA 3EFFA 1NFDB 3HC0A 4WEBH 1CFQB 2XWBB 1XCQA 3FN0L 4LLDB 3DVIA 3LKNB 4PJ9D 5FUCC 4HV8B 4Y19E 5F9OL 3I85A 4P5TD 3TA3A 4JFZL 1J1PL 3U4BL 3QO0B 1IC1A 3F7PC 2VL4A 1K9TA 4ZAKB 5BJTB 3WKMH 1CFVL 2Y7QA 4X9HA 3VWJA 4F9PC 5C86A 2NY7H 1HHGB 3PV7A 2VMFA 4GT7A 4GLRI 4GBXA 2HVJA 1NBVH 5J7CC 4DGYL 2Q86B 4JKPH 4F33B 3O2WH 1UQSB 2MCPH 1DVFC 5FECB 1C08A 2DLEA 1MHHB 4MJIA 4NZRH 4KKCD 4I4WA 1MWAA 4M3JA 1VEMA 5T5NG 5KZCD 1K4DA 5GGTH 1E4KC 2FLRT 5FYKE 4ZTOL 5FO7B 1DQMH 3MBXL 3PXJA 4UV4H 4YC2C 4WGWB 5D1QD 1DFBL 4FN0A 4IRZL 4D9RE 1JZ5A 1IGML 2X7LA 2DWEA 4S1RH 3Q3GB 2VE6B 3FO9B 3R06A 5C6WH 1P1ZA 3T0EA 5E8DH 4Y4FD 3EJZD 1A6VL 1SYSB 1NBYB 1YJDC 3W39B 1MF2H 3NZ8B 5DWUL 5C0EB 3KLSA 4GW1A 5BV7L 1JIBA 4PJ8D 5HBBA 2VN4A 2ESVE 2YC1B 5L7XH 3QCTL 1X4XA 3IU3B 2D0HA 2H3NB 1JHTB 4LLAA 1UYWL 4C56B 4Q6IA 5BS0B 4CU7A 4ZOBA 3ARFC 4MVBD 1N4XL 2ZUQC 3RX7A 4N8CH 3EYUH 4ETYA 2Z8RA 4FQQB 4MB3A 1WZ1H 3UTTB 5IB4A 3VFVB 3NAAL 4LKXB 4MDIB 5GRWA 5C0GA 5EZJB 4U1HA 1Q9OB 1BIHA 3V6FA 3WNOA 2BJML 4NZDA 3V4PL 3E6HA 1KN4H 4Z7OF 1NUDA 2W59A 1C8PA 4X7DC 4M62L 3RAJH 4P3DB 2EKSA 1A9BB 4K8RH 3UZVB 1SMAA 2DQFB 2ED9A 4L1HA 2FH8A 3G9AB 4L8CA 3BP7B 2YRZA 4MX7A 4X8XA 3T65B 2HKHH 4J3TA 2P45B 4XWOC 3TV3H 2QBWA 2HTLC 1MREH 4QNPE 3EOBA 3SDCB 2X5PA 2PR4H 4JFDB 1Y6KR 3SY0B 1JZ7A 4XBGB 3OKEA 2VDKL 3EDJA 4BFEA 1Y0LB 4Z7VF 3H9SA 1XZ0A 3MOBL 1H3TA 1H3XA 35C8L 2DQJH 4YDJB 3DUHA 2NY3B 1QLEL 4PJEF 2FIRT 2VXUL 4N0CD 3UTZB 2X4QB 1EVTC 3B9EA 5E99L 4HUWB 3SDDC 3WS3B 4BSWA 4R3SB 3VXMD 2V7NB 2AKRB 4KTEH 1S9YB 5E2WL 3SJVD 1LE5B 3OKNB 5IBLC 5I15L 2NXYC 5CJOH 1NCDL 3KHQA 4L4VA 3HI5H 2VISA 3GFUA 1KJVA 4I0KA 2GAZA 3P4OA 4Y5YA 2FEEL 3IF1B 4LNRA 4NQSB 1T83A 3RWJA 5GGQH 3JVGC 1AC6A 4NHCH 3ROLA 5HHME 4JB9H 2B4CH 3NCEB 1PKQE 1ZV5A 4WNQB 4F37F 4IRSD 3UAJD 4M1DL 3RP1A 1G7LA 3QDHA 3GRWH 1CGSH 2DM7A 2YPKB 4XNXL 3W0WD 2MHAB 4FP8L 3GSOB 1P4IL 3L7FB 2VLLB 5KSAC 2BNQB 4P4KA 2B5IB 1HCVA 5EORL 5IM7B 4YHMH 1V7ML 1XGTB 1I1RA 3IRPX 1JNNL 3MYJB 2B1AH 3WUWA 5GS0H 4MCYB 2V2XB 3GI8L 5ID1A 3HR6A 2CRYA 1GXEA 4ODTL 4WTZG 4LCUA 4WWKC 5FKPB 4NQVA 5IFAH 5ICZB 5HGHA 2ORBL 3BP6A 4ELMA 3QUZA 1MVUA 1VFAB 3CXDH 4LDEB 3OJMB 4I0PA 2F74A 4XVJL 3MGOB 4KAQH 5HHOA 5CJQL 4LSTL 2J8UE 3AS1A 1KPVA 2F8XC 5EBGA 5EU7E 4DW2L 1LO5A 1B90A 3LEVH 1KELH 1JWUB 4KVNH 2DWDA 3FOLB 5HYSB 2IH1A 4TVSa 4BA8A 3AGVA 4FFWC 1AGFB 4PRPD 2BCKA 3TCXA 5EOCH 3NH7H 3UO1H 1JHKL 5LWYH 3HMWL 5C8JA 2W1NA 2E27H 3ZKMD 1ONQA 3ALPA 1NL0H 4CADA 4XC3L 1IC5H 1YEFL 4LLWA 5IT2H 5EIVA 2F5BH 3OX8A 3JTTB 3AM8C 5HHPB 4D3CL 1T0NB 1JGDA 5JDJA 1N7MH 4P2RE 3PL6C 2X4RA 3IFPB 4WO4A 3T4AA 1KCUH 3OAUH 2PTUA 1HDMB 2ZPKH 4XNUH 5ISZA 3DVFA 5I1KL 3QI9D 4RMRA 5GGTA 1DQDL 1JYXA 3FOMA 4KRLB 5E1HB 5IB5B 1MRDL 1T2JA 4EDXB 1CZ8L 5C6TH 3X3GL 3HCVA 3RVWD 3MNZB 3LDBB 1T1ZB 4HCRH 4NNXA 2V17H 1BPVA 3GK8L 5ESQB 4M6ML 1FORH 2D7TL 3FFDB 2VLRA 2YD7A 3T8XA 2NYYC 3VFOA 1CDGA 4PIRF 5B22A 1BBJB 1G7HB 4WDIA 5JXEC 2AJZB 4LSUH 5H94A 4TUJB 1EJ6A 2DQCH 1UKSA 1AD0B 2Z35A 5IW6B 2PYED 3DIFB 1A3QA 2BOBB 3MV9E 3NBNA 4YIQA 4I2XE 2X70B 4GXVH 1OF2A 4TPRL 5IVOA 4ZS7H 3WFCH 5E7BA 3ZTNL 3TPUA 4X6EA 1I7UB 4QRTA 5JLZA 4P2OC 4ODHL 3UTSE 3WFZA 2GEEA 3MRHB 1KEGL 3QUML 4XI5C 3BESR 3ARWA 3SE9H 2P5ED 3CFJB 1CFSB 3QXDB 1DBML 2CLZA 3RHWF 2ATKA 3G5ZB 4LL9A 3CK0L 1CFNB 1DUZB 2GJZB 3ZYZA 4Y4KC 5TQ0L 4M02A 1QRNE 3WSQH 3FRPG 2PXYA 4JFEB 4QXWA 4XP1H 3KR3H 1GRWA 1T7ZA 1ZWIA 5FV2A 2FL5B 3TBWA 4X7SL 5C0AB 2RGSA 3RIAK 1C7TA 3HG1B 4EI5C 5HPMB 3L3KB 4H0GA 5D96B 3VG9B 1PBYA 2GITB 1T1YB 5CJBA 5IMOB 1JGVL 2FB4L 5DSCB 3G5VA 4O2FA 4AG4H 5D5ME 2UYLB 2N7AA 4AL8H 3UTOA 5L9DH 1BIIB 1BGXH 5DFTA 4QHLB 3IS0X 4Z7WB 2IC2A 1UWEL 3B8YA 3ZYOA 4JJHA 5F88A 2FBJH 1WFUA 5CJ5A 4M48H 4LGRB 2AGJH 4NN7B 1MWAL 1RZ8A 4OJFH 4GXUM 4JZJC 5EUOF 4QWWD 4G8GD 1XF3B 2YD5A 3L9RB 5E2VH 3OJ2C 3BKCL 3C5SA 3WCYA 43CAB 3Q6GL 3CX5K 4RFOH 5D7KE 5C9JA 2BVPB 1CXFA 3IFLL 8FABA 1UKTA 4FXGA 4OD2A 2W0LA 4DN3L 5IVXF 5EN2B 5LKNA 3GRWA 3QUXC 2ADJB 4PJDB 3TZVB 2CUIA 2N56A 5KSBA 2WQ8A 1EMTL 5SWSA 5DK0B 1F97A 4X6FB 4IMLB 2K3TA 3E0GA 3CCHB 2YD1A 3P0YH 3VDBA 3B5GA 1W0VB 1W0WA 4XPFL 1CF8H 3QQ3B 2HH0L 5DC4B 3FO1A 3Q2CA 5EZOH 2BSSA 4MJ5B 1IL1A 3G5XB 3D0VA 2VL5B 4Y8AA 4JM2B 4JN1H 2WUBL 4M6AA 4YFLI 2ZZUT 4MQ7A 5GGSA 4Y1AB 4F7MB 2G2RA 1X4YA 3OKKA 1ACZA 2CXKA 4AEEA 1C7SA 5GS1C 2R1WA 3SDAD 2C1OB 4M6OL 2O61A 3EYSL 4PJBE 3DTXB 4RISH 1YQVL 1KGCD 4Z8FH 3TN0C 1ZK9A 4DVBA 5B38B 1FFPA 4PJIE 5DD5H 2FZ3B 1KPRA 4UNUA 3U7YH 4I18A 1QD0A 3E8UL 2X4PB 3WLBA 2VDLH 3SKMB 3UBXI 1W8OA 2F54B 3CVIH 2DN7A 5DMKB 2KUTA 2NY5H 4I3RH 3JV4A 3L3HB 2CGRL 4V1DA 2XZQH 4LRIC 4HPOH 2EECA 5F7KC 3F5WB 4FQHB 3KYNB 1IGFH 1S78D 3ULVL 4KXZI 1RV6X 2M8XA 1C1EH 3MBED 5F1IB 3ZL4L 4GJTB 3QG6A 2DLFH 4OCXL 1AQDA 5F72S 4HCRA 2XACC 4XXDA 3QNYA 1B0GB 4O02L 5I8CA 2RHEA 2H6PB 1WEJL 3NCJH 4HUUA 4NHUA 5IJVA 4LEXL 1TIUA 3DHMA 2R4RH 1QSFA 2OTPA 5GISL 3B2UD 2XV6B 1I1AA 3VFGH 4HW6A 4ZUVA 1CDJA 1J0YA 3RGVC 1JP5A 5HDLA 2MNUA 1WC7B 1YN6B 2X1XR 5D70L 4GG6E 3AMLA 3U9PH 5JPMA 4XAKE 3PDOA 4NKMA 5J3HC 1MQKL 4KK5C 3BPLB 4X98A 3AS0A 4MAUH 3L3JA 3D3VD 3LV3A 4HS3A 4LDOB 4WUKL 3O9WA 2EDQA 1ULVA 4JZNA 1TCRB 3O3DA 1G6RH 1N5AA 1WBZB 5EBLA 1I8MA 1ORSB 2BFVH 4ODWA 1MH5B 3BX7C 1FAKT 4PJ5A 4ODUB 5KS9A 1T5WB 3FKUS 3V6OA 2WBJC 3O4LB 2BHZA 3KPLB 3QEUA 5IEHB 4JDTL 1LEKA 1WFOA 1KIRB 2APWA 1VEOA 3OKMB 3AMKA 2IPKB 5C0ND 4X80H 3V8CA 4K2UH 4WHDA 1YMHA 4W4NA 5J8OA 4MNQB 1TPXC 2DKUA 4LOUD 1QBML 1HSAB 2BVEA 3ARBB 3WL9A 1DBBL 3G6AA 3AFLA 1CLZH 2H2SC 1Z0MA 4KC3B 5ANMB 5GGUB 1I9JH 4X7CC 4M1GH 4XCYA 3SGKC 4KRMB 2HT3D 4HKJA 1FL5B 4WEBL 5ICYB 1MCDA 3BZFA 1MCKA 3TCLA 2BDNH 4NO0B 4ZUSB 4XVUD 4ZAKC 1FZJA 3Q6FA 3HZYA 3WKML 2NY7L 5TDNB 3DOSA 4QOKD 2IAND 1NBVL 1QR1B 4GO6B 3QUYD 1JNHA 5GZNC 2DJUA 4PRIA 4JKPL 1OLZA 4XXCA 4R2GD 3VXTB 4PRDB 4P57B 2OJEB 2NW2A 4WFGD 4K7PY 4NZRL 5ACZA 5DT1H 3GKZA 4KZEH 3U82B 4PGCA 2HKFH 3LRSB 4AM0B 1U3HC 1WUNT 5GGTL 2FECI 1MCFA 3KNBB 4EJ1C 3QEQA 1RUQL 4U1SB 4UV4L 1QKZL 1ZT7A 4YEEA 4JVWA 4S1RL 3P4MB 4QRPE 3BEVB 3K1KC 4KI5F 1UXSA 1FSKC 4MDJB 3FL7A 3PWNA 3MODH 3BEWB 1MCJA 2NY2D 2CDGB 1MF2L 4GRLA 4WTWA 4PG9A 2V2TB 4W4OA 4APQA 3T0WA 3S88H 2DIJA 5L7XL 3BDXA 3DUSA 4FHBD 5BW7C 1Z9LA 2HFGH 2CDEB 3OL2A 1NAMB 4JQVA 5DDHB 1FFRA 1T0MB 3BD5A 4IDJH 3EYUL 4PPTA 1WZ1L 2HA1A 2QADB 4OIAA 5EPMB 1C5DB 3STLA 3E6FB 3HB3D 3ILPB 4PJAB 5IW1A 4LSPH 4XX1G 3KPRD 1KN4L 4HMEA 3FCTA 3IDGA 4KWUA 3QXVA 5F7NC 3SE8H 3LEXB 4JQIL 1OAXH 2HG5B 4K8RL 1IFHH 2ZJSL 4JRYA 1U93A 5I9QB 1RJZA 4TTDC 4U33A 4MXQD 3SDXA 4K3JH 1KJ3H 4PRHD 4GSDH 1BBDH 2OSLA 4HC1A 2IQ9H 3C2SA 1CYGA 5F3BA 1KC5H 4AQ1B 1NFDE 1MREL 3BKML 1UWXH 4LLYA 4ZXBA 1FGNH 1BJ1H 1X6LA 5LQBH 1GGIH 5FO8B 4UQ3B 5C2BH 3KYMA 4EVNA 1KCRH 1FNEB 4OZFB 3RX5A 1OAZL 2DQJL 2H41A 3F12B 3EZJB 3KPSB 2NY3C 4U2YA 4Z7VB 1P5UA 1CLYL 4EQ2A 3ULVF 2BMKA 1D5ZA 4PTTB 2BOCB 2XZAH 4X9GA 1OGTA 3SBWA 2EDNA 1U58B 3X14B 4LARL 5JW4Q 3T3ME 3NIDF 2COQA 3IJHB 3QZWA 4KTEL 3JV6B 3OR6B 1YPZB 4X5XB 3CMOH 3VGBA 1BZ9A 4G6AC 1S8DB 1XGUB 3HI5L 3X3FH 4RDQG 1DR9A 5C0FA 25C8H 5CLTA 4AIOA 3ARGB 1HNFA 5GGQL 1FYTB 4WFED 1AIFA 4W6WB 2Y07H 3RY5A 5D8JL 2B4CL 3GNMH 1G6RA 3GIVA 2P8LA 1FV1B 2R56H 1SYVA 3BP4B 1ZVYA 5FKAA 1KB9J 3GRWL 2BVQA 2GTWB 4ZS6D 1DLHB 2VC2H 4Y2OA 3R8BB 1NUFA 1XAUA 5HHNB 2GK2A 2W9DH 3X11A 2YPLA 1D9KB 2B5IC 5LBSH 4PJFE 3C9NB 1ED3A 5L2KD 4YHML 5JNYA 3L3DA 5IQ9B 2I27N 2GJ6A 3RL2A 2FIKA 1XH3A 4HAGA 2B1AL 2HFTA 3NACL 3RGHA 2H26A 3MGTA 3GDBA 4WGVB 3OB8A 4YLQT 1XR8B 5IFAL 3S36H 4WV1B 3UTTE 1X5FA 4G8FB 5CS7A 4LGSB 2XWTA 2KZ1B 3CVHA 4MSWB 3CXDL 2B0SH 3ULUL 3QXAA 4KAQL 1I4FB 1G9NL 2EYTB 2FO4B 5FHAH 4ELMF 4NP4H 4JM4H 3SCMB 4I9WE 2QQNL 2DTML 4WUUB 3LEVL 5GGVH 4KVNL 2G5BB 5EU3A 1S7SA 1NEZB 3NH7L 5E8PA 3V4UL 3OGCA 1CCZA 3E2HB 1NL0L 2VXTL 1OP5K 1IC5L 1U8HA 4Q2ZB 4NQCD 1XF2B 5HY9A 5IT2L 1LGVA 4QY8B 2ZCHH 2F5BL 5JPNB 3FB5A 5GQBA 4S10A 1TNMA 3QRGL 4PBWD 4RNRA 4EOWH 1N7ML 1R3KB 1R24A 1KCUL 2IAMA 1RK1B 4NUGH 5EUKB 1XF1A 2ZPKL 4XNUL 1BFVH 5KTEH 4LLQA 1UM5H 3FT4A 1NLDH 2Q3ZA 1CN4A 2JJTC 3LDBC 3ROOB 1QYGL 4P5KB 5IVZB 1U8MB 3NN8B 3RKDC 1RY7B 1PYWA 2PO6C 4NQDB 4HCRL 1T20A 5CGMA 1RK0A 3IU4L 5CWSB 2PCPA 4NYLA 1FORL 1LO4H 2Q8AH 3ILQC 3LY6A 4X99B 4NOFA 4ZYKB 3JXAA 5CHNA 3CLEH 4XP5H 4KJWC 2DQCL 5H35B 3MRGA 3LEYH 2H1PH 4JKWA 1R3HB 2MTPA 3PGDA 2EZ0C 4BQ6A 1B6UA 4WRLA 3Q0HA 4XNQA 2P42B 3L95A 4D0CA 4XGZA 4UIKL 3QNZA 3RNKB 5MENA 4TOYL 2Q6WA 4UU9B 4RAUB 4ZSOB 1R6VA 4ZS7L 1QQDA 1CXIA 1NGWB 1PEWA 4EN3B 1MHEB 5I1GH 1O0VA 3VGFA 4K7FA 2GKIA 4RGND 5HYJA 1P9MA 4HGWA 3BIKB 4X5WA 3KLHD 4MYWB 3RWFA 3SE9L 2FHCA 5L8LB 2NY4D 1E4XH 2PKDA 4RA3A 5J13B 2BVOA 3GM0A 5BVJB 3BRGC 4CJ0A 2A6JB 3B9KC 5DJ0A 1XIWB 2ZUVA 4NZUH 2E9JA 3MRQA 4GRWE 3ARDA 3H0TB 1OP5H 3VXQB 4G9FB 3O45A 1JWMB 3VMPA 2ADIB 5JOPE 3WSQL 2CPCA 1FFNA 1V5JA 3O8XB 4Z7QF 4XP1L 1OQOA 3KR3L 1G84A 3WFHB 4IEFB 5KSUB 1KOAA 5D96C 1JFQL 3EDKA 3M45A 2ZCLH 3QG7L 1JTPA 3MV7A 3RZWA 4F15B 1YQ2A 3DX7B 3MFFA 5ENWA 2YN5A 4Z7UB 2XZCH 3CFKA 4NQED 1DQLH 3VXUA 4IRJD 4YDIH 4JY4B 1MFAH 5D7LE 3WIHH 5F7LB 2D0GA 4Z78A 4YGVA 3MZTA 4FFYH 1DLFL 4DJMA 4ORGA 3WHXB 3HZKA 5BRZB 4OLEA 4P46B 4LPXA 1IGCH 5E1AB 1NC2A 3FB7A 1A22B 4D0DA 3IAQA 3VXRA 2W07A 5GGRY 2UZXB 4KUCF 4OV6F 4M48L 1MFNA 4NN7C 2AGJL 2AEWA 4HK0B 4OJFL 1I9IL 3W5NA 2HRLA 3QBTB 4F9PA 2KPNA 5DJ8A 5DK3A 5E2VL 4J4PC 5IMMB 3U4EB 4HF5H 4P59H 4XBPB 4PJGF 1TENA 2V7HA 5T1DH 4OD3L 1H3UA 1UA6H 3QULA 2A73A 2DQEH 1U0QA 4G6MH 1JCKA 4NT6B 4N1HB 2XQYG 4M9PA 1UJ3B 1F4AA 1YYLH 3TZVC 5J89A 2ZSWA 4YNYB 1M05B 1PFCA 5IVXB 1E4KA 3P77B 4O2EA 5KJRH 4U3CA 2P7TB 3CLFH 2XFXA 3FO2B 2AK1L 3T3PF 3JWOH 3P0YL 1HQ4B 5D72H 5C9KA 2IQAB 2XN9A 1CF8L 3R0MA 3ZYIA 5EZOL 4L5FH 4OV5A 4PTUB 2L7JA 2F8VA 2Z31B 5FAAA 5CP7B 4K07A 5CZVH 3DYPA 5C08B 1ZE3C 4DUVA 1FZMA 1IILE 4KV5F 4OLZL 1U2CA 2IADB 1ZVSA 1X5KA 4M7LT 3TBSA 4KRPB 3HTLX 4O4YH 4U3HA 1LNUA 1FVCA 3UC0H 5IHZB 1NKRA 2F53B 5EOTA 1YA5A 4YXLH 4K3DH 6FABH 1IQDB 3ULUF 4Z8FL 5B39G 2IWGA 2CK0L 5DD5L 4KJPC 4IS6B 4E41B 3U7YL 3R1GL 1CGWA 5MEPB 4HC1L 3SGDI 2VDLL 4JFEE 1U8JA 1HHIA 4JR9H 2VOTA 4S1DD 4QHMB 1MFDH 2R2EA 5E9DA 5JORA 3CVIL 5GJTL 1JNLH 5JIPA 2ICES 2ZCKH 5HGBB 5E8EA 5C0AE 2NY5L 3MMEB 3HG1E 2CLRA 4L1DA 2M1KA 5FGSA 4HPOL 3VFUA 1IGFL 1EHNA 3BOVA 3MREB 1AGEA 2YS4A 4NBZB 1DBKH 1C1EL 2D7MA 5A3ID 1F3RB 4IBLT 2D9CA 2XWJA 4EUPA 5JW4N 2DLFL 4AZ8A 3KDMA 1SVCP 1F2QA 3IXTB 1G7JB 2C5DC 4BFIA 3NCJL 3C6LB 3CSGA 5DC0A 2C3HA 3U83A 3GUTA 2JCCA 2R4RL 2ZNWA 3ALXA 2XRAL 3P11H 4WY7H 4NN6B 4HMCA 3VFGL 3NZHH 5EO1B 5AUMB 1BLNB 3MGAA 4EQ3A 3O41A 2WLYA 1T1XA 1V3KA 3PWVA 3QJFB 4QRSA 3CZFB 3BT2L 2AK4B 1W72B 2DRUA 2XA3A 5GRVK 5DK2B 4HZLA 4QRUA 4DN4H 1DP0A 3LIZL 3SDDA 4MAUL 5FOBB 4Y19D 2K7PA 3GMPB 1B0RA 1N0XH 1G6RL 3QXUA 5J56B 3TBYB 3WDIA 5E6IA 2BFVL 3WJJC 4GKZB 2AQ2A 3EHBC 3BGFB 5IBUB 3G08A 1UB6B 4JCLA 4HIIA 2YXMA 3EO0A 1LK3H 3VXSE 1QFPA 4XHJC 3VFMB 3JVGA 2Z93B 4Y4HB 4ZDHB 3FQTB 5KS9F 4GKSB 5E4EC 4HKBA 1UACL 3VFNA 4X80L 4K2UL 3ZO0A 5EA0H 3LN4B 1JUFA 2X41A 4X6CE 4HUVB 3TIDA 3ARBC 3QUMB 2VWEE 1DTUA 3CFEA 4YPJA 4MAYC 2Y6SC 3KPTA 2P4AB 4Y1AE 2OR8A 2EDTA 3QIUB 1SBSH 3T04D 4ELKA 3TYGH 1IEBB 1I9JL 2EDLA 4FXLA 1EEYA 5B8CB 5FYKD 3RWDA 3VFRA 4O58H 2EC8A 5KSAA 3CVHL 3GSXB 4FQ2H 1LP9E 5I30H 1KCKA 2MPAL 3MRNA 4U1NB 3RTQB 5DRNB 3VRIB 1HKLH 4C57C 1FIEA 1YEDB 2NY6D 1ITBB 5SV3A 2EDBA 2A6KB 2BDNL 4XPAL 2GSGA 5FDYA 1VKXA 3EFFB 3WIHA 4PBVC 3HC0B 1P84K 1MFEH 1NCAH 2DYPD 3ZDZF 1RIUH 3UYOD 2ESVD 4QEGA 1XCQB 3C8HA 2MQ0A 2G60H 3DWTA 4QRRA 3BN9C 4KK6D 5AZEH 1PX4A 4V2CB 3VWKD 2F8OA 4YXHH 3BW9A 3NA9L 2VDML 1A4KA 3ZHLA 5CD5D 5LJYH 4HQQH 4MWFA 1M6OB 1DSFH 5J06A 4KZEL 1CTOA 2Y7QB 2APXA 3VWJB 4MQXC 4NZTH 1PY9A 4H1LH 3SKJH 3HAEG 2HT2D 4GBXB 2HVJB 2ZOKA 4ZNEE 3QXWA 3MLPA 3S36X 5DS8A 4BZYA 4KQ4H 4B53A 3C5ZA 3AM8A 4MJIB 2EEAA 1BX2A 3LQAH 3PL6A 4I4WB 1MWAB 1SEBA 2HLFC 1K4DB 1IGJA 3MA9H 3VE0A 1KFAL 1Y18A 4KMTH 4RZCA 5FHBL 1D5BA 5E8OA 3TPKA 3IFNL 1DZBA 1UXWB 1DQJA 4NGHH 1F8TH 1LQSR 2DWEB 2X7LB 3GHEH 1CLOH 4JO3H 4B7IA 2FJHA 4A2LA 2P5WA 1CL7L 2HFGL 5AYQA 3R06B 3T0EB 3TWCL 1T2QH 3L5WA 4FNLH 4OZIE 1ORQA 4DCQA 4G8EA 4POZC 2OCFD 4YBQC 4FZ8H 2C9AA 1WTLA 5JXEA 1HZHH 3LAFA 3GB7A 4GW1B 4LPTA 1YEIL 4QT5A 5I8OH 3TIEB 1E27A 1TZHA 4NBYB 1FZKA 4ODXA 1BOGA 4PJCA 4GOSA 4LSPL 3TVMC 4Q6IB 5DQJA 3Q1SH 3B3IA 5GSVA 1UT9A 4J3UA 2VKWA 3SE8L 1DVFD 4PUBH 4C54A 5I9QC 1IFHL 2XICA 4KJQC 5IB4B 3D39D 5C0GB 3IKKA 1D5MA 4K3JL 4P2OA 4U1HB 1KJ3L 4HH8A 1N8ZA 3V6FB 4GSDL 2XA8H 2IQ9L 3E6HB 2Q20A 5A2LH 3RIFK 3WYRA 2VLJA 4NQTA 4FTVE 3SDXF 3H8NA 3UZEA 2EKSB 2ZUTA 1FGNL 4PS4H 1MHPH 5HHMD 1DQTA 1YMME 2ICEA 4UQ2A 1EHXA 5LQBL 1T6WA 4L8CB 4HWBH 3VGGA 5C2BL 2KQNA 2EC9T 5J6HA 1KCRL 3QDJA 3S4SG 4Y4KA 3IDYC 5D93B 3TO2A 3EOBB 3MRDA 3QPXH 2FWOA 1BQUA 4JRXE 3CD4A 2XZAL 3UJIH 1PEZA 4EI5A 3OKEB 1O7VA 2EO1A 3W2DH 3H9SB 1XZ0B 3C08H 4L3EA 2A0LD 3ARFD 4F9LC 3TNMA 4RRPG 5K9JH 1GGCH 3O6FD 5JA8B 3CMOL 3RVVD 4JDVA 1RZGA 4K9EC 5C0DA 1BEYH 1OT1A 4BSWB 3I2CH 4CVUA 3O3EA 15C8L 3P73A 3PP3K 4Q6YA 1BVKA 1G7MA 2YR3A 1HXMA 3GNML 5GJSH 1H3VA 4R97B 4L4VB 4JGUA 1OB1A 3DMMD 2VISB 1GZQB 1KJVB 4JZJA 2GAZB 2AI0L 3P4OB 4Y5YB 4BUHA 4LNRB 3QWRD 1D9KC 2LVEA 4LHUA 2HTLD 3ROLB 3DRQB 4P23D 5LBSL 2P44B 3B5HA 3VW3H 5KW9H 4WI8A 1G7LB 3RY6C 4OF7A 5GIRA 4DGVH 4PD4K 3GZKA 5D2LE 5T3XE 1UZ8B 2EH7H 3QUXA 4JFFD 3CFCL 3G04A 4WV1C 4QXUH 5E2UH 3KS0H 3TFKC 3MR9A 4P4KB 4PR5A 3M17A 2ZG3A 2R69H 2UY6A 2B0SL 3GMLA 3DVGA 3WUWB 3VJ6A 5ID1B 3SCMC 5FHAL 4NP4L 1RZ7L 4KKNA 1A7BA 4LCUB 4NQVB 4Z7OE 1V3JA 4MA7H 1KJMB 5ERWA 5HGHB 5DURD 1J8HE 4ELMB 3U6RA 5F89A 1KF9B 4YBLB 1MVUB 3GJFH 3LKOA 4I0PB 4XCNA 2F74B 2P8PA 5J0BA 2Z4QA 5HHOB 5DJCA 5EDXA 2K7QA 3HNTH 3W9EA 5C0IA 1KPVB 4BZ2H 4KK9C 4LHJB 5FOJA 1RURL 2ZCHL 1M1SA 5SX4H 4EOWL 2FCBA 5TE6H 2DWDB 2IH1B 4QHKI 3TN0A 4W81A 4NUGL 4HUNB 2AABL 3PP3H 1AO7A 1ONQB 4H1LA 5M94B 5KTEL 4HG4K 1UM5L 4ODVH 1HIMH 4LLMA 1NLDL 4M7ZB 2DAVA 3NPZB 3OX8B 3DX6A 1JGDB 4JPKH 1CDYA 2X4RB 4WO4B 3UJJH 3T4AB 1RUPH 1LO4L 4LRIA 2Q8AL 4PJEE 5ISZB 2EEDA 5D1XD 4HLJA 3FOMB 1RZJC 5BQ7A 3CLEL 4MXVF 4PLNC 5GS2H 4WWKD 4KKLC 1P2CA 2N1KA 3HCVB 3LEYL 2H1PL 5ITBL 2IBZX 3LSOA 2RQ8A 2R2HA 4NNXB 1TCMA 3LPFA 4ISVA 2E7HA 3QWOA 5EOCJ 3T8XB 4WVRA 2E8ZA 4WDIB 1J1XH 4HULB 2D4FA 4XAWH 3CDFA 2WUCH 4Y2DC 5E2TH 4J6RH 2Z35B 3T0DA 2HN7A 3FB6B 1NC4D 3MRMA 1IKFH 4MD0B 2NXZB 5DUMH 2YHGA 1D7FA 1OF2B 1UZ6F 5J13C 2DMKA 4UI2A 1XIWC 2RFXA 3TPUB 2WIMA 4X6EB 4NZUL 1X5HA 1TQCB 5JLZB 1MCWM 2VDPH 5GHWL 1U9KA 2I60H 5DFVD 3W5MA 3OXRA 3RY4A 1ZGLM 5HXMA 4KTDL 4GXUN 2CLZB 4BSJA 4WW2A 2CJUH 1AKJB 5D7KD 3NFPA 4JHWL 4XRCA 2ATKB 1NSNH 4M6NH 3D69A 4WJ5A 5GGSY 3WFEH 4CVZA 3DXAE 2ZCLL 4F15C 4OF8A 1OW0A 4ZPVA 2VH5H 2PXYB 3QIBC 2XZCL 4XWGH 3VMOA 1DQLL 5J1SC 1CXKA 4YDIL 1N2RB 4AIZA 5I74C 5DJDB 2JJSC 4MHHI 3TBWB 1XF5A 5EU6D 3K0WA 4FFYL 1OARL 3OG4B 2XWBA 4LLDA 3EYFA 1JGLH 1MY5A 2FX9H 4FQXC 5ALBL 3P9WB 3IFOA 4EKXA 1J5OH 1IGCL 2B7DT 3G5VB 3LB6C 4O2FB 4C59B 2AXHA 3QO0A 2R9HC 1QSVA 4R4ND 3MRCA 1A7QL 5BJTA 1U8PA 3JTSB 1T3FA 4Y0GA 4OGAC 4N0YL 5KN5A 2EDDA 2CO6B 3OKYA 1A2YA 2LABA 2Q86A 4CMHB 4Y16D 1DN0A 4HF5L 4BSVA 2HTKD 4N5UA 3ZE1F 5F88B 1BD2D 1UA6L 4R26H 2DQEL 4G6ML 1UJ3C 1F3JA 1RZ8B 1YYLL 5DRZA 4P2QA 2VXQH 1T22A 3C5SB 1U3HA 3H42H 5F70A 5KJRL 1ZEAH 5C9JB 5C0JB 4MA3A 8FABB 4FXGB 4OD2B 5C07E 1A1OA 1C16A 1HHKA 1QZ1A 4KHTH 2H8PA 2Z31C 3OKLA 5KSBB 3QDMA 4PG2C 3KXFE 1MAJA 5CZVL 5JW3H 5SWSB 3W39A 1I3GH 2BY0A 4GAGH 5TJWK 1W0WB 4KRPC 5SWZA 2D7PA 4RGOL 2Y06H 3FO1B 5FYJH 2BSSB 5TQ2H 5EO9A 5BW7A 3UC0L 3C60D 1RUKH 1JHTA 1IL1B 5JMOC 1C5BL 2DQTL 2WV3A 3BH9A 4EEEA 6FABL 1W8NA 4MQ7B 5GGSB 4G9FE 3VFVA 3CC5A 4XP4L 2G2RB 3GJFA 4YHNA 2RIKA 1K3ZA 3OKKB 4XPBL 2APFA 4XAKD 4OZHA 4JR9L 4ZPTA 1MFDL 2R1WB 5J1TC 2O61B 1JNLL 3F7VA 2ZCKL 2CMRH 4LCYA 1FO0H 5TE4H 5HDQH 3P30H 2W0FA 4DVBB 4LBEA 2A9ML 3JZ7A 3FRUA 3OG6B 4JG0H 1UKQA 1KPRB 4I18B 3I84A 4M7LH 3WLBB 4HS8H 1DBKL 4MA8H 1ZT4A 1DE4A 3RDTC 5LVEA 1LEGA 2ZUUA 1CI5A 1HINL 4Q9RH 3JV4B 4V1DB 4M8VA 4QCIA 1HE7A 5BRZE 1TJIL 3C6LC 3IDIA 1A6PA 4LAQL 2Y9RT 1LVEA 1NDGA 5EZIH 4L3CA 4NN6C 4WY7L 3P11L 2ARJQ 2DM2A 2X2YA 3BPCA 3NZHL 3QG6B 1AQDB 1X9QA 4XXDB 3NIFF 3QNYB 3RWHA 2O5ZH 2D7NA 5C0BA 4HUUB 4NHUB 5IJVB 5EUOE 4DN4L 4IIQC 3WS3A 1QSFB 2ZUYA 1UFUA 2BSED 3TLRA 1QSZA 4X9FA 5DO2D 4MD5A 1N64H 3DBXA 1I1AB 3UPAA 2YRLA 4N5ED 3U46A 3QAZB 4ZUVB 3OKNA 3JV5A 3AVEA 4DGIH 4F7TA 2L7UA 5JPMB 3PDOB 3BGFC 4NKMB 2AJYH 1JPFA 3DVNA 2RBLA 5DVLA 5IVXE 3T2NH 3WLWC 3CX5J 4X98B 5GRJH 2VLKA 4XH2A 1VB9A 3L3JB 4HS3B 3LV3B 1VESA 3O9WB 4JZNB 3SKUD 4JKLA 3O3DB 1N5AB 4NNYA 1OWRM 2CUHA 4OD1H 5EBLB 3BPNB 3CPLA 1I8MB 4ODWB 5EA0L 2DKSA 3O2DH 4PJ5B 4LLUA 2NX5D 2YPKA 5AG9A 5KS9B 5C08E 3HE7D 3QEUB 1CFTA 3WO4B 5I1GL 3GSOA 1LEKB 3TYGL 3BD3A 1IEAA 1JPGA 5DXWA 4O58L 5TH2B 4F8TA 4FQ2L 3BPOB 3WKNA 3ZZ1A 5I30L 1XGTA 3VA2C 1YMHB 1WITA 2F53E 3DSFL 4LCWD 3LD8B 1LHZA 3WL9B 3L1OH 3G6AB 4HIHA 2DQGH 4A2MA 5AYUH 1WIOA 5ICZA 1WAAA 1R5VA 5GRUH 1MFEL 3LRHA 1OCWL 3RGVD 4HKJB 4HUXB 1RIUL 2UZIH 5CIPH 2A2QT 5AWNH 5I1IL 1CDBA 5ESVA 1ZANL 3GKWL 3MGOA 2G60L 5D6DC 2GW5A 3RUGE 5I8EA 5H37G 3VXME 2PYFA 2AXFA 3S9DB 3MRPA 4YXHL 1X7QA 5KVEH 3SJVE 2AJSH 4OAWA 3MV8A 3TO4C 4JFHE 5GRVL 3BE1H 1FZJB 3Q6FB 4GLRH 3THML 1DSFL 1AGFA 1L0QA 2O5YL 3D5OF 2DTSA 1VGKA 3WXWH 3P4LA 4HT1H 4TSCH 1U8IA 1JNHB 3B83A 2WBJD 3NIGF 4PRIB 5C3TA 2QLVB 3VD9A 3DX9B 4KQ4L 5D9SB 5F6IC 2NW2B 5ACZB 5E03A 1TLKA 4F58H 2X1WL 4XMLL 3W0WE 4PGCB 4K55A 3MA9L 5HGGS 3DROB 1B6DA 4MQTB 4KMTL 5E2JA 2H2SD 2XY1A 2BNRE 4XPTH 3S5LB 2PNDA 5CEZD 2JJTA 2E6JA 3OMZA 1ZT7B 3EOTL 4NGHL 2PO6A 3GHEL 3MXVL 3PUCA 5C0CA 4HS6A 5IB1A 1UB5A 1T2QL 1NANI 1UXSB 1CD8A 3PWNB 1WK0A 2ICWI 5I1LA 3O6MH 4RMUA 4UBDD 3ZSTA 4FZ8L 2YEZA 2ID5A 4GRLB 1HZHL 4PG9B 4OFKA 4APQB 4U7MA 1UH4A 5E4IA 5J4MA 3C5JA 4ZAKD 1EUTA 5AAMA 2DJSA 2BOBA 1RZKH 1VPOL 3OSKA 1WFTA 2GHWB 1MIEH 2GJJA 4Q6IC 2VZSA 5KANI 2GYSA 3Q1SL 4ZUWA 5E5MA 1UG9A 3UYPA 4M1CC 4QGYA 4PJCF 3BFOA 4BZ1H 4KK8C 4X0KA 4PRPE 2AV7B 1E28A 2VERN 4G80B 4HEME 3MCLL 3QDGE 4G43A 1CFSA 3FCTB 3IDGB 3ZHKA 5JHLH 1HNGA 2A74A 1FO0A 3IKCB 4BFBD 4PS4L 1FAIH 1MHPL 2BXZA 1M71A 3B9KA 4JRYB 2NY0C 4NN5C 1U93B 1FJ1A 4PGEB 1RJZB 2VSCA 2BY2A 1ZA3A 3SDXB 2EE2A 2YUXA 5C7XH 5D93C 5F3BB 2B39A 4F57H 4LLYB 4ZXBB 1J18A 1FPTH 3MNVA 3RJDA 5F71A 3BQUA 1I1YA 3QPXL 2OR9H 2EDFA 3P4NA 5DFWH 3N1FC 5DQ9A 3UJIL 5I2IA 2E3VA 1CDIA 4C56D 5DQDH 3KYMB 3W2DL 1KNOA 1DQQA 3QR2A 5T3ZL 4EVNB 3A6CL 5BS0D 1NMBH 3C08L 1ADQH 1VGEH 2J8OA 1GGCL 4JHAH 3UTTD 1U2HA 2Y23A