3RTQD

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD02
4RNRB 3H7BA 4NQDA 1IAMA 3P4MB 3SE9L 4GUPA 5I1KL 1V3JA 4PJBE 1M7XA 3CFEB 4CDHA 4AG4L 3VWJB 4XGZA 2W9DH 4LHJB 1KF9B 4MQSB 3H6JA 3VXPB 5A40E 1YQVL 4X5LA 5F96L 4P5KA 4R2GB 3EYFB 4PJHF 4LVHB 1F4WH 1X6NA 4Z8FL 1N6UA 2EICA 3PIQB 3FO0H 1DBBH 2HJFB 3D69B 3P77B 1JFQL 1XF4B 4NKMA 3ZYOA 4UOW0 3FFCB 3MOAL 4FXKB 2PO6D 1QRKA 1INDL 1AR2A 4QHUA 2APTA 3D39E 5KW9L 4F7EB 1MFEH 5I71B 1IGJA 4LLQB 2DIJA 3O45A 1JWMB 4TTDD 4MZ3A 2B4CL 2DL9A 1EVTC 3BDBA 4EI5B 3O2DA 3MFFB 1IAII 2Z31B 3K80A 3HC3L 1P9MA 1Z9LA 5FA3B 4XH2B 3MLVH 3WO4C 3HFMH 3X13B 4NKDA 5IMMB 2BCKA 3MX0A 2VDML 2FGWL 3RZCA 2R1XB 1NJ9A 2G75B 4Y1AD 3C5JA 3G5XA 1I1RA 1ZHKB 2VXTL 1JZ2A 3PHQB 1HIML 3QUYA 4M5ZH 4YE4H 3T77A 3MLXL 3D1MC 4NKQB 4I18C 2F54A 2Y06H 4YQXL 5E6ID 3HZMB 3REWB 4HGMA 3L5HA 3QDAA 4OAWB 1C12B 2W65B 3T8XB 3I6LE 3ZLQC 4MXQC 1J87A 2BSED 3G5YA 2Y36H 2UV3A 3RWJB 3GBNL 4WHDA 4K94L 2AV1A 1VADB 5D1XA 2YK1L 3ESUF 3RL1B 2VQ1A 2RCSH 4PBWD 4TUJB 1ED3B 1XR9B 3MXVL 2OJZL 3OAZK 1MOEA 1G7LA 3OJDB 1WEJH 3DMMD 5JA9A 1B88A 4PY7A 3A6CL 5IKCB 3A67L 5A2LH 1W0WA 1ZTXH 3MV9E 4JJ5B 4POUB 2FX8H 4RMUA 1MFEL 1FFQA 4MVBD 4RX4A 3QUYD 4HWEL 4G80A 4FQCH 4XVSL 1NMCC 5EN2B 5I6XC 4WO4D 3QUML 4P23A 3B3IB 3A6CH 2DM2A 1DBBL 4LKCB 4MJIA 2OJEB 2EIBA 4KRLB 1P1ZB 2YN5A 4OZGA 1L9NA 3CZFB 4M6NH 4Z7VB 5C1MB 1DQML 2AS5M 3QXWA 3QQNA 4BFIA 32C2B 4ZFZB 4WU7A 1QBAA 4P59H 2PW1A 4JDZB 3VXUB 2XACC 4QYOA 3RPIA 1BOGA 5F8RC 4JO2H 2A6IB 3E6FA 4PJGF 2EDLA 4N9GA 1Z3GL 2EC8A 4R7DA 1WBZB 4QCIB 3T4YA 5DC0A 4M7JH 2I9TB 3HE7C 4G42B 2PR4L 3P9LB 4OGZA 1EVUA 5E2UL 1AP2B 3QPQC 1QLEL 2YZ8A 4UDUB 4I1NB 1TQBB 2MCG1 1ZMYA 2KZWA 4OCMC 1N6VA 1RJZB 3F5WB 4AG4H 5GSRA 1X5YA 4K94H 3GIZL 3V0WH 4JFFE 5BO1L 4AMKH 5C2BH 3TO2A 3SJVA 4Y16A 5KBNC 1RVFH 4JCMA 4PLOB 4M62L 4EIZC 3MLVL 4X4YA 5C0DB 1HHJB 4UB0H 1V3LA 3W9EA 1N6QH 2AJUL 1CF8L 5DA0B 3GMPB 1EXUB 2A6DA 5DMIL 4LSVL 4BZYA 4R97B 3BP6A 3GSVA 3C8KB 1OAQL 1U3YA 3C60D 2W38A 1U8MB 4UTBL 4HXBH 3KLAA 4GBXB 1A1MA 5FUOH 5IP4A 4ZFGL 2IWGA 1C16A 2X4PB 1BD2B 1I85C 1P84J 4NHUA 3QG7H 4R26L 1JGLL 4N90E 1MPAL 1XF5B 4QHLA 4XAWL 2N7BA 5ESQA 3CMOH 4PD4K 5D7LE 2Q6WB 3SKNB 5JA8B 4P9ML 3RNKB 1AHWA 4NUGL 4JN2B 4IEFB 4RSVA 1SYSA 3QFJD 1OQOA 5L8JB 1FAIH 1KXQE 2VDPL 4WUKL 1T04A 4MHHG 1T2QH 1QOKA 4FMKA 2OL3H 2QEJA 2FEEL 5H2BB 3QRGH 3RY6C 4M7ZC 3PHSA 3DUSB 5EOTA 2YD3A 1OTTD 3CFKA 1UWEH 1EJ6A 1RZIB 4CMHC 3DHJA 4YNYB 1C5BH 1VACA 2Q86A 5FAAA 4HLJA 3AS0A 4LPUA 4J23A 1ZVHA 2YD2A 2YXMA 3CUPB 4PJIE 4RFEA 3ZDXF 1VEPA 1DTUA 4LQ1A 4H8WH 4KTEH 4RMTA 2CUHA 3IJHB 1TITA 1I8KB 3VDAA 4QHKJ 2JTDA 2ZCKL 4PRPA 3RU8L 5DJZB 5T1KB 5D93B 3VRIA 1E4KC 2QADC 1LE9B 2DQFA 3W11C 5J57B 2Y4SA 1LO2H 1HSBA 1J88A 1J8KA 3MBEB 3FT3B 5HYSG 3PWUA 5C0AE 4CAGA 3QXDA 4JHZA 5C86A 5EDXA 1R0AH 1V3MA 1RZKH 4H0IA 4M1DH 3LKRA 5JIPA 3MYJB 2PYEA 5TGBB 2BERA 4LSDA 4NNYA 3VFMB 2F5AH 3GJFB 5BVPL 1GPOH 5CHNB 2NY6B 1UEYA 5CCKH 5C09E 1K4CB 1IGTB 5DT1L 2QSTA 1S7XA 5EC2B 1EERB 4M4PA 3UPRB 1XIWD 1C5CH 1S9XA 2X4QA 2VABB 4Z7WF 4HCRA 4F7CA 4LLYB 2CK0H 2OX5A 3QIWC 1I1FA 1DVFA 4DW2L 3VFRB 3MRPA 2UUDK 3P73A 1PY9A 4I5BB 3RBGA 1JGDB 4ODUA 2QADD 4DGYH 1NAMH 4MAUL 1K3ZA 2WWKO 12E8H 3EFDL 3KLHC 1OHQA 4TSAL 3IFLH 3FOLA 4R4BB 4OFKA 2MHAB 5C7XL 4PJHE 3SDAB 5AAWA 5IHZB 1CGTA 1OAUH 5IFHL 4GXUM 2CIIB 4XCFH 2ZSVA 1RJYB 5I1EH 4DGVL 3MXWH 4LGPB 4G7VH 2X1XR 4EUPB 4YR6A 2N7AA 2C1PB 2MNUA 3VXOB 1UB6B 4R90H 4D0BB 4MA7H 1WIOA 2OSLA 1CGWA 2K3TA 1SJXA 3OX8A 5LBSH 4DGVH 1VSCA 3WJJA 4BSVB 2R0ZL 2HKHH 2ORBH 4ZOAA 2J8UE 4CJ1A 1NQBA 1G0XA 4P2QB 4YHKL 5E2VH 3ZE2F 1DDHA 4Z7WE 3QBTB 2DQUL 3IKCB 4U1SB 1CQKA 2VSCA 2FYYA 5DVNA 4PYHA 1NC4A 4M48L 1B6UA 4YFLI 1EO8L 2FBOJ 4PJEA 4QRRD 1DZBA 4Y19A 5C9JB 4Z95H 4XNZC 5D8JH 3IXTB 4MX7B 1TZGL 4I9WD 3V5KB 1IC5L 4PJDA 4CL7A 3U46B 3F65A 5E5RB 2R8SL 1I1AA 4GLRH 1AD0A 3MCKA 4RAUB 4BFBD 5D7LD 1U3ZA 3WDHA 1IGCH 3KPOB 5FYLH 4XB8A 2NW3B 1LO0L 1BGXH 2H1PL 2PO6B 1R5WB 5F7NC 5IM7A 3O9WA 4K9EH 3SN6N 4GG6A 5E8NB 4QHKI 3HUJA 1X7QA 3IVKB 2VTFA 5D1QB 3QHTC 4NHCH 5GSVB 4RIRB 1YPZB 1UB5A 5GGRA 1JWSB 1WAAE 2AJSL 3Q3GA 1PX4A 1FORH 1NCDH 1I8IA 1AC6A 4V1DB 1KCUH 2B4CC 4G6KH 2C7UB 4H1LG 5I1EL 3QULA 2NLJA 4JRWA 3QUZA 2NR6D 4X8JA 2F5AL 3RAJH 3OKMA 4QRRB 1XIWB 2VWEC 1BLNA 4CNIA 4Z5RA 4WJ5B 2VZ3A 1A6WL 3HE7B 5EPMA 4X6DF 1JMZA 3RU8H 5EZLB 4XTRD 4G8EA 4H25B 3HZVB 3VFWA 1OTUC 4KKLD 1NDGA 4PR5A 3P9MB 4D0CA 3MRKB 2VL4A 3HE6A 3OXSB 4RZCB 5ERWA 3RQ3A 3VXRD 3OPZL 2CDFB 3O8XB 1KV3A 3QXUA 2AKRA 2BVUA 4LPYA 2GCYA 5ADOL 1NUNB 4YHML 1FYHB 3QFDA 3FQNB 4KY1L 4LNRA 4XVUC 5HHOB 4PJ5E 2DQHL 5I6XB 4OLUH 3ARSA 1NMCB 2VZVA 3MGOA 4FXLA 3KJ4C 2OQJB 5EOCL 1MELA 4X4MA 2VR9A 5MEOB 4ESKA 1NGQL 3ARFC 3NZHH 1MWAA 4OZFH 4PGDA 5FYKE 3U4AA 5HDQH 3MRGB 3S5LG 2BRRL 5JORB 1S78D 4R9HA 3W0WA 4X0KB 1C1EL 5D96B 1QBLL 1D5XB 2B0SH 3RVXD 4WV1C 3U4EB 2VZTA 4QNPF 3O0RH 4HSQA 3ARDB 3KWWB 2HKFL 3QZWG 5J3HD 5B39B 1NGZA 1SVZA 4N8VA 4YGAB 4O02L 3QEUA 5MEPB 1K85A 2IJ0C 2VB5A 4U05A 4MA3B 2J12B 1ZLVH 4P9HC 3BH9B 2BNRD 5DMGC 4HF5H 1N8ZB 4M3KB 3QEHA 4Y5XA 2HMIC 2FJGA 5MP6H 2Q3ZA 1CF8H 3BT2L 1XAUA 3MGTA 3MXVH 4S1RH 2NY4D 1IAKA 2ZKHH 4X5WA 2DOCA 2VIRA 4WFGE 5DR5L 1YDPA 4LL9A 4KU1A 2C4FU 5B38A 2R2CA 3LEVH 2WLZA 2BVOA 4NNXA 3HHRB 4JO4L 4HIEB 5DJ0A 1EBAA 2HG5B 1IFHH 2BVQA 3PWVA 3MJ7A 4ZNEA 3WL9B 5FYKL 3PP3H 4IRJB 2EXYC 3GJFH 5C07D 4D9QD 2IG2H 4HKZB 2VRAA 4NO0A 4M6OL 5GS1C 2VDKH 2EDDA 5E6YA 3L5XL 5CP3A 3OJ2C 4HC1L 4NO5A 2QQLH 4YDVB 5JIKA 1CFVL 1AY1H 1E4WH 1A7PL 1UM6H 4Q7DA 2B7DT 4NC1C 3NCCB 1INEL 4NQEA 4LVOB 5FHBL 4MQXD 4XNUL 4XMKL 1UEMA 2AJUH 4U1LB 1R3LB 4LVHC 1JGUL 4TQEH 3DJ9A 2R2BA 5F9AC 3VU2A 4OUUB 25C8L 2DQDH 5D96C 3G6JB 1G9EA 4ODXB 4G9DA 3UTZA 4Y5VB 2W0FB 4Y4HB 3WXWL 4HW6A 4KDWA 3IU4L 4NQXA 1K8DB 4PJBB 3CU7A 1CXEA 4WEBH 5DMJB 4H1LH 2E6PA 1ODAA 1P6FA 5ALBH 3L3KA 2ZJSL 5DLML 4QRQB 1XCTB 5CMAB 2D7TL 3G9VA 5B3JF 3S7GA 1EHLH 5CD3B 2JB5L 3TIEA 5I1CH 3MZGB 1NMAL 3RX7A 5F1KC 3DGGA 8CGTA 4RA0C 1IGFL 1KLUA 3RA7H 1ZANH 1TZIA 4I2XA 4X6FB 2JLLA 4XC3L 2VDLL 1VGEH 4WCYH 3QEQE 4KJQC 1GOFA 1TJGH 4XCNA 4JKKA 1S7VA 1MFAL 4NM4H 1SY6H 1HDMA 3EOTL 4AQ1B 4JFDD 1D9KD 3NCYS 4FFVC 4RDQG 4YDKH 2QHLA 4TULL 2DBJA 4Q0XL 3DX9A 3TA3C 1WC7B 3V79C 1T1XA 2EYTB 2NQCA 4W6XB 4XGZB 1IFHL 1I7ZB 1DVFD 3QCTH 1RY7B 4ONOA 3DO3A 1WEJL 4OCSH 4HX1B 3RWIA 2FX7L 1CFSB 3PIQA 4LOUD 4OM1L 1N64L 3D69A 1P2CA 1K6QH 5I75B 3KYOB 5HTSA 1QLFB 3WXWH 3V0VA 4HWEH 3FFCA 1Q94A 5DRWB 3LD8B 3EO9L 3O6FC 4F7EA 2RAMA 3W9DA 2AJZB 2IADB 4MCYB 2B1HL 2R23B 1X4XA 4NN6C 3CLEL 3KGRA 4E5XA 2VDKL 3MFFA 3MUZ1 1J86A 4L3ED 5D5MA 3UTPD 3S9DB 2A1WH 1HH6A 1YMHA 1JFQH 4B0MM 1Q9OB 5L88H 4RGMC 4PTTA 3ULUE 3QWQB 4R6UA 4BUHA 1MJ8H 1NJ9B 2FD6H 3C09B 5L0QB 2XKUA 1V7MH 3QQ3A 3RGVA 3KPSD 4M9PA 4YHIB 4PBVC 2IALB 3PGFL 3VGAC 5IW6A 1GCFA 1FN4B 1FSKC 3T77B 1GZQB 3QA3A 1UCBL 5DA4A 4X6EA 2YR3A 3H42H 1U3HD 2XWBB 2JJSA 1AGDB 1OAYH 4XZUA 5I17A 4N1CA 4PJ8B 3IRZA 1JI1A 3S37L 1MCHA 1CIUA 4OLVH 5HDLA 4NM8H 3IGAA 3SKMB 5IV2A 3RJDA 2P5WB 3U36B 5TF0A 1D5ZA 2AV1B 3MRNA 5HDBF 1NGYB 3RL1A 5K93A 1NMBL 2QSVA 2NX5D 1YEGL 1CGSH 3U7YL 3IF1B 1CDGA 3QIWB 3BWAA 2Y07L 2E5EA 3OJDA 1XFPA 2JJWA 2SEBB 3AMLA 4KVCH 3BD4A 3KDMA 4K8RD 4PY7B 4RBPH 1UJ3A 2ZCHH 3MNVB 5D4QA 4AY0A 4UIKL 1MLBB 2JCCB 4KVNL 3RGHA 4OTXL 5T33H 1A9EB 4HZLA 2VJXA 2R56H 4L8DA 4U1JA 4ZD3L 3DI2B 1RZ7L 3GSWB 2IAMD 4NDMB 2CKBA 2F9BT 1CLOH 4JFZL 1Q0XH 2ESVB 2JK5A 2CLVA 1BVLA 3GBMH 1FVEB 3OKEA 5JW4Q 1YEHH 4HGWB 1LO3H 2BNQD 2OJEA 1TQCB 1YJDL 2NY5L 4ZAKC 7FABL 2EEBA 3HB3D 4Z7VA 4MJ2A 5FUCC 5KSBF 2B20A 1LO0H 1UJTA 4XP1L 4O2CB 1MRFH 3MLWH 3BJ91 4QHNA 5IVXE 2X10A 3S5LA 5I19H 1Y0LB 2VXSL 5D93C 2VITA 4JHAH 4N9GB 1JNNL 3ZTJH 5EOCH 2D7OA 4OLXH 4LCWB 5J12B 1IKNC 5C6TL 3DYPA 4G42A 3P9LA 1A5FH 3KLSA 5JHDA 1LEGB 1NDMB 4CGTA 3HRZB 3HI5L 3UYPA 4RGNB 5HGBB 3WFBL 1MCLA 4X7SH 1AO7A 3NCJH 4FABL 4GRWE 4UTAL 2HN7A 5I0DA 3WLWD 2GK0B 4MWFB 3F5WA 4CMHB 2HVKA 3T0DA 3IKKA 2ZNXA 4LFHD 5HY9B 3VE0B 5DJ8A 1AGFB 2CGRH 3WO3B 3U0PB 2DQEL 1A5FL 2NXZC 2QBWA 4ZYKA 2Z93B 3FQTA 4OQ1A 4M00A 5MEND 3PWLA 4WI7A 3OGCA 2H32H 3L9RA 4O00A 3W9EB 4NGHH 5EBMA 5I8KL 1JP5A 4PV9A 2VAAB 4JM4H 3C8KA 1KYOJ 4W81A 2JELH 5DRNA 1X5ZA 5DD6A 1U8MA 2KPNA 3HI6H 4OCWH 12E8L 1MH5A 5E99H 1QFWI 5E9DA 5HD8C 2DQHH 1BD2A 4TSCH 5J0BA 5JHDD 2H9GA 4PJ9B 3GHBH 3HG1B 5B8CA 1VENA 2WAHA 4KDVA 1A4KB 3Q5YA 4R97C 3HNTH 4OFIA 2NX5B 5ISZA 1WAAF 2W9EH 4DK6A 3HMWH 2HT2C 1Q9KA 4K7FB 5JNYA 4PJAF 3AU1B 3IDGA 3MLTA 2W0LA 2E7BA 5H2BA 2LAGB 1KEMH 2IGFL 3LZFH 1O7SA 2NTFA 2P7TB 5FCUH 4KI5D 1P4LB 1RZIA 3KJ6L 3VGEA 5SX4H 1VACB 5IHUL 5T1LD 3A6OA 3BN9C 4G7VL 3V95A 4GKSA 5JW5A 4QXTA 1G9MH 4MJ6A 2ADFL 3BW9A 3PQYD 1IKNA 5DHXB 5J6HA 5FCUL 4QY8A 4LHUB 4ZUWA 4KKNA 1LE9A 3P0YL 4OIIH 5DEFB 1F3JA 3QG6A 3PUCA 3KPPA 3M1BB 3WNLA 8FABA 5I1HH 1MVUB 3UTTD 1N59A 3ULUC 3C8DA 5IG7B 4DQOL 4ZAKA 4H8WL 2APXA 1KNOB 5JHLL 5JOFA 4KTDL 4L29B 3QDMD 3QRFM 3FB5A 3MYJA 3ARGC 4NNYB 3VFMA 5J11C 1W8OA 1IGIL 1TIUA 3G08A 4JFDE 3ABZA 2PTTB 4OB5L 1YEHL 3DXAA 4WTXA 3GSUA 2EDOA 2Z92B 4KHXH 2BSRA 3T2NH 5C09A 3RWGA 1SJEA 1MLCB 4M7KL 3NCJL 4FABH 1BF2A 5J06A 4XC3H 2XZQL 1CWVA 1IBGH 2GJ6E 4NNPL 4PJCB 4LSRL 3GSNA 1MFBH 4UU9B 2OL3A 4JFXA 4KJPD 4OKVB 5FKPB 4XTRC 5C8JB 2XA3A 5TQ0L 3O4OB 1NLBL 5DQ9A 3ULVE 3RIFF 4OD1H 4QF1A 3VXRB 2UWEE 3OAYH 5CZVL 4TVPD 2VH5H 5D6CA 1QVOB 4LCYA 4JPKL 3HR5A 3WFHA 5IHZA 3RDTD 2VLRD 4M8QB 4F7TA 4JRYE 1N2RA 4RMQA 2VXQL 2ZUSA 2JJSC 3CFJA 1AIFA 5IB5B 4IS6B 1BBDL 3TWCL 4F57H 3D6GA 3VH8B 4M3JA 4LSVH 4LPWA 1UB6A 2I26N 4TQEL 3ZE2E 4P49A 5HGGS 3BQUB 5E2WL 2E8ZA 3UJTH 4PP1D 1WJ3A 1BFOB 1JL8A 2DL2A 4UILL 1J8HD 1JHKH 1MNUL 3ARZA 4BK5A 2GJJA 3FQWA 1NCWL 3WO4B 1YNTA 1KCVL 1MJ7L 2XOTA 4KFZC 2FO1A 1C5BL 1UWGH 1PEWA 2APFA 3GMRA 4EI6B 3ZYZA 1H5BB 1NUDA 1B6DA 4M7LH 3VXSD 5E24E 2I60H 1HQRA 1MIMH 3MRJA 4JVWA 3ROOA 4YBQC 5I71C 4YEEA 1JE6A 3O6FA 5FUOL 3V5KA 3UX9B 1I4FA 4AENA 1ND0B 3WIFA 1CG9B 5T3XL 2XTJB 3ULUL 1I3GH 1I1AB 4YC2C 4BELD 1AD0B 3MCKB 4OM0L 1EK3A 1A7OH 5B22A 1KPRA 4N0RA 3EO1B 2NW3A 3ARBA 5SWSD 3BJLA 3CMOL 1CXHA 4KK6D 2CH8A 4PRID 4YXLL 3L3HB 3SO5A 5E8NA 3CXHK 5IJVB 1E27A 4YK4C 1RI8A 5HHNB 4U1NA 3O81A 4QRUA 1JWUA 5JW4M 2BHYA 1MRCH 3TO4D 1ACZA 1JWSA 2Q7YB 3FCTB 4XBEH 3CFDB 5TE7H 1GZPA 2CXKA 1EEUA 3LN5B 5DMKA 3DX7B 3MACH 1E6OH 3MRBB 3QH3B 2VE6A 4FQJL 5HGHB 5C07B 3JWDL 1DN0B 2NLJB 3QUZB 1ZTXL 1N3NB 1DP0A 5DYOA 4XB7A 3BXNA 1IZKA 2DLTA 4O5LH 2UY6A 1FE8L 4PJHA 1BD2E 1ZLUK 3D39A 4ZFFA 3VWKA 1NL0H 5KSVB 5EZLA 1MJUL 4G8EB 1LP9A 1X6LA 3VFWB 1T1YB 5HHQA 3IDMB 2QKIA 3EYQC 5BRZD 4QRPD 3IDYC 2AJYL 1MRDH 5TE6H 1KIPA 3IAQA 5FF6A 5ANMB 4K3JL 3W11D 3IRPX 1YNLH 5F88B 3QIUA 3MO1A 1P53A 4S10A 1U8HB 1YEDB 4PLJD 2G60H 2VZUA 4X7FC 4PJ7F 5CSGA 3FQNA 5TH2A 4S1QH 2X44D 1B90A 1BWMA 4NKOA 4UV4H 4ETQB 5IUSA 4M61B 5SWZB 1HIMH 5HVFB 1N7ML 3TLRA 3MRGA 5JORA 3U6RB 1S9VA 5LG1A 1IM9D 5GXBB 2IC2A 5IR1B 2XWJA 5LGHH 5I73C 2FBJH 4P5KB 2KZ1B 4H5SA 4LKXB 4ZSOB 2H41A 5FGSA 4L8SA 4FTVA 1KIRB 3LKPA 25C8H 2CMRH 3C5SB 3IFPB 5AUMB 5AZEL 1XF4A 1UM6L 3D0VB 5D2LA 1ZANL 5SWSA 3TBSA 1XF1A 4D9LH 4GKNB 3EOBA 4B7IA 4JVUA 2X7LA 4LLUB 1C1EH 3R1GL 5CIPB 3EHBD 5DC9B 4OM0H 2XY2A 2ESVD 1KTDB 1JWMA 1UA6H 4HC1A 2IPTL 1RHHB 3CU1A 4RX4D 1ZEAL 5JDJA 5GS1A 4LSSL 4ONHB 2XPGB 5JZ7C 4G5ZH 4X7EC 4KZDL 2I07B 2YA1A 2J2ZA 1BJ1H 3BO8A 3TA3D 3IU4H 2BCKB 5IF0A 2VKXA 3X12A 1FL3A 4OD2B 4XBEL 4JPVH 3G6JE 4UILH 2YPVL 5IK3B 3PHQA 1HSAB 5BMFL 1BM3H 3EO0A 5DLMH 5FOBB 4KDTA 2BVQB 3M8OL 3TBTA 3WL9A 1NCAH 3UTTA 3TH3T 4X4XA 3KPRA 4JR9H 3Q6GL 4P5TA 5E8DH 3MSPA 1C12A 3VA2C 4GLRI 2PYEE 3D18A 3RDTC 4CVXA 4Y5XC 2YN3A 1OGAE 4XXCC 5CUSL 5IESH 5TDOA 1W72H 4HBCL 1QUNA 3FN9A 1I3GL 5BV7C 3RWJA 1KPVB 1JHLH 1OP3K 1IAIM 2I25N 1RAMA 5KVDL 3QR2A 1GC1H 1NANI 1U6AL 1FYTB 2BC4B 3TZVC 1ONQB 1QFUL 3B2VH 2EXWD 4HK3N 1S7TA 4PJGE 1G7LB 5F6IC 3FO9A 2UZIH 4WV1A 4DKDC 1IM9A 1A47A 1G1CA 4Z8FH 3PV6B 4OUUA 1P69B 1WLHA 5F70A 5KVEH 3S96A 4Y4KB 3CIQA 3U4BH 5MEQB 3D2UB 1JIBA 3CMGA 1GL4B 3INUL 3NN8A 2ICES 1G6RH 1ORQA 3SDXE 4GH7B 4G9FA 5A43C 1F5WA 5FYKU 3HAEH 1BFTA 4HV8B 1T03L 5CJOL 1TTUA 5T5NG 4WWKA 3CD4A 4BUGA 1QSZA 2DICA 1XCTA 5CMAA 2A9MH 4OCYL 4ZFZA 3EUUA 1IKFL 2F53E 4WU7B 1GH7A 5D1ZC 2R0WH 3VXUA 1JPSH 2B1AH 4QYOB 3HE6C 3F7VB 3RPIB 3V4VH 1MCWM 3C6SB 5D7LA 3U79A 5IVZA 3O3EB 1SEQL 2FIKA 3TZVD 4NN5B 3W2DH 5D70H 4QCIA 5A2JH 5I1LA 5EOQL 4PJXB 3RUGF 3P2TA 4LLDA 4X80L 5JMRA 1LEKB 4HMDA 4AEIH 4L4TA 4OZIF 2DAVA 2XTJD 4OZGE 4NQDD 3D0LA 4HJJH 5K59E 4OV5A 4WUUB 1OGTB 1MFBL 5C09D 1U41A 3TCXA 4KGJA 1YQ2A 3HE7D 3LDBB 3SJVB 2HJLB 4GSDL 4U7MA 2VISB 1YMME 3GB7A 3GM8A 4MD0A 4PJ5B 4U6HA 4DTGH 2Q76A 3STBA 4RBPK 1YY9C 3O3AB 4ZPTB 4S1SL 4AL8L 5DD3H 1UCTA 3VXQA 2IGFH 3NCFB 3EGSB 1R3KA 1KT2A 1X4YA 4W70A 4N8CL 4I2XE 3LIZH 3QDJE 4KZEH 3SDCB 1NBVH 3MMEA 3NIFE 5C0BD 4L4VB 4APQD 1QLFA 3MODH 2PF6A 5M95B 3N06B 1OP3H 2V2WB 5E9DE 2XA8L 5ITFB 1XF3A 2E3VA 4EDXB 4LBEB 1JGVL 3CK0L 4QHLB 5KAQF 4LSPH 2DQUH 3FB8B 2Q6WA 1MCRA 1HH6B 3JWNC 3RKDC 4APQA 3ULVF 1MFCH 4BH7A 5DI8A 4YPGA 5I1HL 5EUOF 4XI5C 1VKXB 1PEZA 2Q7NA 4IMLB 4ZODA 5I0ZA 4FZ8L 1MHPL 1MCCA 1GJIA 4GQPH 2R29H 3G5ZB 2IBGA 3QQ3B 3TNNA 3NH7L 4ONFH 2XG5A 4L3CB 4JPIA 4HKJA 2ZWLT 3C08H 3O6LH 4XCEA 4KK8C 2I24N 2YD9A 1QO3A 5KS9E 4NRZB 4QOKA 3P0GB 5FM4A 3I9GL 4X6EB 5GGSA 3L5IA 3F12A 3PJSB 3O6KL 1RZJH 4JRYA 4L8BA 2R0WL 5HD8D 4X6DA 5SV3A 1RZGA 4PUBL 5K9OB 4TSCL 4JFPB 4P2CG 5A2FA 2DJSA 5CP3H 1NANH 3BIKB 2D9CA 2P5WD 3N9GH 4PRPB 4Z7UF 4E0RA 4LVNB 1XF2A 3RX5A 2ADIA 1WFUA 2ATPA 4NO3B 4D0DB 4X6BA 1FLRL 5F1NA 2CJUL 4OCXH 1CLCA 3BWAB 1U3HB 2MPAH 4FFZL 4QTIL 3MV11 2E9IA 3MNVA 4OF6A 4J3UA 1MLBA 1QFWM 2CR6A 2JCCA 3F7RA 4N1EA 4LEOA 1OQXA 3TYGH 4MA7L 5CILL 5DF0A 4DTGL 2BHZA 5CHNA 3EYVB 3SDCD 3OKYA 1MHCA 1KTKE 4EN3C 4LNVA 3DETD 3UPRA 1JNJA 2DKSA 2X4QB 4JY5H 4HHAB 3WXVH 1C5DA 3NACL 2BOBA 4XPBL 1I1FB 4Q9RH 1N5YH 5I1IH 2ED7A 1IE5A 3ALPA 4X7TA 4ZOBA 4HK0A 4CADB 3BGFB 4ZTOH 1S9YA 4NOBA 4HD9A 5DFWH 4M6NL 2VLRB 5FFLA 2ZSWB 3RIAF 4HWZA 3WFEH 4FQ2L 2FNBA 4R4BA 4WFFD 4GJTB 4Q97A 1F58L 1A7BA 4ONGH 3ROLB 3MV7E 4GW4A 3HRZA 3ARGD 1OY3B 3VXNB 1CFBA 2OZ4H 1IC7H 4UV7H 1QA9B 1P7QB 2ESVE 3LQZA 4EUPA 1TVBB 5JO5A 2GTZA 1SY6L 4DN4L 1IT9L 2YPKA 4OLWL 3FAXA 4LCUA 3VE0A 4Z7NF 43CAA 4D8PB 2OSLB 3OGCB 3S34H 3ILPA 2XWTA 3GSNH 5T3ZD 4FOMA 1JRHI 4JKPL 4FQIH 2P24B 4MNGA 2DQCH 5C0AB 3V4UL 4PV9B 4BZ1H 1AHWC 3MRQB 5DJDA 3N85L 4E41A 3L3JB 3CVHL 2FBJL 4TNVK 1GGIH 1BQHA 4NO0D 4EQ2A 1FCCA 1I85A 5JHDE 3UC0L 1DLHB 4NM8L 4S1DC 1MCKA 3C6LA 5CGYC 1G7IB 3I6GA 1MCDA 1NFDA 3KPOA 1KTLA 4F7MB 4PV8B 3WFDH 4FZEH 3PL6D 4PRBA 3REVB 4JR9L 2ZUQC 5ISZB 1Q9KB 3HUJB 1BX2B 3H42L 1S9WB 4NUJA 4OM1H 2IPUG 3LH2H 4RIRA 4GAJL 2EKSA 1UB5B 4KTEL 5MENE 3QO0B 5I66A 4Y16C 2WIIA 1MJ8L 3MNZA 4WUKH 1EV2E 5K9QG 5BO1H 5I15L 2C7UA 1T66C 3OZ9L 5KOMC 2ZCLH 5D2NA 2YMXL 5TPWL 1BFVL 4M43H 4L8CB 1LGVA 4QXTB 4MJ6B 2D7MA 3OKMB 4QRRA 3BGMB 3OKNB 3OL2A 1FZMB 5F3BB 2GTWA 5CKGA 2XN9D 4QY8B 4U1IB 3V6FA 3SQOH 2A6JB 1OB1B 1I9EA 2NY2C 5LAXB 3OZ9H 3BFOA 3P9MA 3MLXH 5FM8A 3MRKA 4U2ZA 2OMBA 3EDKA 5DD1H 3KPPB 3M1BA 8FABB 1QYGL 4JHBA 4YDIH 4XPFL 3FB6B 3IFNH 2FGWH 2O26U 2GCYB 4YDLB 5GRVK 4OT1H 5DR5H 1X5FA 4LNRB 4P23C 5GRJH 2VDRH 4LARH 5AZ2L 1H8SA 4Y8DC 4Z7OF 1WBYB 1PG7X 2WUCL 2FL5A 3ZTJG 1GXEA 1YZZA 3SGEI 3V6ZA 2F58L 4UT6H 1FDLH 5FO8B 2Y5EA 4OZIA 1JYWA 2Z35A 4G8FB 5HYSA 3L3DA 3RIFK 4NQEE 5FKPA 3WLBA 2DM4A 3QI9C 4ORGB 4HS3A 1IGMH 3CVIL 4JVPA 2P5EE 4JHWL 3PWJB 2PW2B 4R4NC 1NAMA 3GI8L 5INDA 5C0GB 2FH6A 3DV4A 3FQUA 1J0YA 4TVPL 5D1XC 4QF1B 3V0AC 3ESVF 3VXRA 1CGVA 1Q72L 5D6CB 2C3HA 4MA3A 3WFHB 3QQ4A 4M6OH 5F72S 2DTSA 2X1PA 5C6PB 5IVXF 5JPMA 2AXFA 5IBUG 3P11L 1UACH 3MGTB 4XBPB 3SPVB 4FQPA 4Y4FC 1AXIB 1RK0B 4JZJC 4C56B 2D0GA 5F9JA 1YDPB 5K59F 2P46B 3TFKC 5ADPL 1RIUL 2ATKB 5FKAA 5I8CB 3QUYC 3QYCA 2J6EA 4CRPA 1FFPB 2R1WB 4G3YH 5DJ0B 3KPSE 1UM4L 2WV3A 4EOWH 3RZCC 1K5NB 5HI4D 2NXZD 3FJTA 5L8LB 1FH5H 1ZVSA 1INQA 1AGEA 3K3QA 2XKNA 2PXYC 1EAPB 1F2XK 2ARJB 4A6YA 1OF2A 5JIIA 2NW2A 1CDJA 4PP1C 3TYFA 4KQ3L 4G3YL 1UYWL 3MRJB 3HMXH 1AY1L 1E4WL 1QFPA 4LCCA 4NO5B 4XNYL 5DTFA 1SJHA 4OI7A 1NFIA 1ACYH 2QV2A 2B2XH 2BOCB 1TENA 3QJHB 1AGCA 5E1HB 5EO9B 4F9PA 3DX6A 2EE6A 1KPRB 3MRHA 3SCMC 1I9IH 3AREB 5J7CC 2FZ3B 3A6BL 1KFAH 3BUYB 4GKZB 2BDNL 3FTGA 4QXUH 4LIQH 4DKFH 4U1LA 3GJEA 5IFJB 3L3HA 3VI4E 3W0WE 1AQKL 3JXAA 2WP3T 3RPKA 3E8UH 2VOTA 4O4YH 2D7QA 5HHNA 4MD5B 3KS0H 2EDXA 4MCZB 2XQBL 3FCTA 3L6FA 4KK5C 2VDMH 3LMJL 1GZPB 2UUDH 3LN5A 1FG9C 5KSBE 1EIBA 4PRAB 4P4KA 4KK8D 1N3NA 1DCLA 4HJGB 5DYOB 1Z5LB 4NQTA 4ZTPL 5I1GH 1LNUA 4MSWA 1FVCB 1CDBA 4CN4A 3CPLB 4OZHE 5MP6L 1UH3A 4JLRA 3MRFA 5C0BA 1F02I 4KROC 5DUBB 4X6CF 1J05A 5DK0A 3WKMH 5HHQB 2IFFH 3HAEA 3LEVL 4HIXL 5GGSY 1F11A 2W0KA 1AI1L 3STZB 4Y0GA 4LCIL 3BYYA 5AG9A 1H8OA 3QIUB 3QWRA 3MO1B 4P4RA 4K7PH 4U1MB 2NNAA 3T2PA 5TJWK 3GSXA 4E41E 5IROA 1IBGL 3OJVC 1JPTH 4ZFOB 1B2WL 3U48A 5CD5D 1JF5A 4FHBD 4MA8H 4I8DA 2EYTA 2OR7A 1FJ1A 4FQXA 4Q6IC 1HXMA 5EO0B 5H35B 4WFED 1CT8B 1A6ZB 4U3XA 5IR1A 2XWJB 4NBYB 1E0OB 1H15B 4HX1A 3TH2T 5GRUL 4H5SB 4LKXA 5EIVA 5KSAB 1EEQA 4Y1AE 5CBAB 4X5XB 3GMQB 2ZPKH 4PGBA 4WEMB 1RUPL 3VD5A 5AUMA 3VD7A 1U8KB 3CAFA 1MAKA 3QUXD 4NQUA 1L0XA 4PJDE 3EJJX 1KCRL 1LDPH 1XZ0B 3S36L 1DANU 1T80A 1Q94B 1I7TA 1HYRC 4P2OC 4LLUA 4NPYA 4S11A 3ZKQD 5C0EA 2F53D 4HJ0D 4O58L 4JY6A 3V4PH 2C26A 5BVJB 4YXHL 2F53A 3EW3B 2EE2A 3EYOA 2NY3D 1A2YB 3AY4C 1EGJL 4RFOL 1ZA6A 4LEXH 1W0YT 3IJYB 4L9LC 4PTUB 4GRMA 1JPFB 3TN0D 5CGMA 2P44B 5I1DB 5ID1B 5JLZA 4NQVB 4TSAH 1HSAA 3CNKA 4PB9H 4MLIA 1RUQH 1FN4A 2EDYA 1LE5A 3ARFD 4ERSL 1GZQA 4TVPE 3QA3B 3HPJB 4NYLA 5IIEA 2J6EH 5IJKA 1OD9A 4PJ8A 1RJCA 3SKOB 2Y6SD 4UBDC 1MRFL 3MRCA 5DO2D 3QIBA 4PRPD 4MXWH 3I75B 3G04B 2BHUA 5KVFH 3NPSB 3IFLL 3OAUH 4JQIL 2AK4D 5IFAH 2WBJC 5C7XH 4JRXE 1KGCE 4YBLC 3AS1A 1NGYA 3BPLB 5HHVL 2NY7H 4H0HB 1T0NA 5C2UB 2J8UB 3BRGC 4LSQH 3LY6A 4W4OA 4XI5D 2HVJA 3KDMB 2Z8VC 5E08H 3U30C 3PV6A 5EH1A 5IJKC 3QDME 4H20H 5GS0L 3SDXA 1GAFH 3S96B 2L4OA 3OKKB 3D2UA 3WN5C 3E0GA 1BAFH 2CKBB 3LN4A 2EKJA 5KS9A 2GIYA 2LTQB 4YUEL 4G9FB 3KXFB 5F7FA 2F5BL 5IQ9B 4FQ1H 4L9LA 4JDTL 4S2SB 5GGQL 5E08L 3O2DH 4HGWA 5J13B 1MIEH 3CH1B 3AY4A 1EGJH 4RFOH 2E7HA 4H88L 5GGTH 4NZRH 1ETZB 4NZTL 4FFWC 3MR9A 4O2CA 1W72B 1KBGH 3S5LB 2FSEB 4ELMF 2VZ1A 1IJ9A 3O41B 4P2OA 1CL7L 4WTWA 2RFXB 4KI5E 4LLDB 4EQ3A 4ZDHA 4QTIH 1CK0H 4FXGB 2ADGB 4PS4L 3TEUA 4JO3L 2DLGA 4OV5B 1IAIL 5HYEA 4WUUA 2VZOA 4XCCH 4WHTB 3UTQB 2GK0A 1TZGH 1PQZA 1KLFA 3N9GL 1QBML 1DE4B 2A1WL 4XNQB 1KCSL 2OYPA 5D71L 3UZVB 3NAAH 4PJAA 4FQXC 2Z93A 4KGLA 4F15C 1MUJB 2DLFH 1RZJL 3VXQB 4LRNH 1NBYB 1GOHA 4HS6B 1M71A 3KYMB 5IROC 1KT2B 1OAKH 3LV3A 6CGTA 1DJSA 1E6JL 2IAND 1F90H 2A83B 2GUOB 4MAYB 5DMIH 4OFYA 4ZPVA 4QXUL 4GXVL 1LDSA 2DBLH 2VLKB 4OFPA 4PJEF 3O2WL 5C6WH 3WDJA 4NUGH 1EFQA 3ES6B 3KYNA 3RWHB 4K3DH 4PJGB 4M93C 3FMGL 2YPLE 4GQ9H 3F7PC 5LXGH 5BS0A 4C58B 2NY4B 3QWOA 4PJIB 4AMKL 4LSQL 3JZ7A 4EOWL 5B8CB 3WD5H 3ILQC 1BD2D 4LSUL 4Z7WA 2GY5A 3L7FA 5IQ7H 3LS5L 2BNRB 4PJFB 2AK4E 5E8PB 5EZIL 1VKXA 4IMLA 3IDUA 3EJYD 4P4KC 3TBYB 1YPZF 3Q6GH 3AU1A 5GJTL 4U6XA 3LSOA 4RWYH 3F7QA 2M8XA 1IAOB 1HOCB 4ELKB 4L3CA 4Y89A 4JGMA 3S8WA 4HPYH 3QWRD 3RVXC 2JB6B 4WW1A 2HLAB 4LAQL 3SDYH 2DWDB 4WVRA 1L0YA 3F12B 1C5CL 1MCFA 4L8BB 4YO0A 2AJ3A 3RVTC 3EDEA 4EUPH 2MJWA 4MQ7A 1ITCA 1K9TA 3LRSB 3SCMA 4F9PC 1P6AB 5I76A 3BIKA 3FHAA 3OAYK 1BREA 3PF2A 4UAOC 5E4EB 5BS0E 2DN7A 5IMKB 3HMXL 3MBED 4JM2B 4IRSC 4LCCC 1F4HA 5I2IA 4XC1H 1OWWA 1U3HA 2C9AA 1CD9B 2WQ8A 4C57C 5JOFB 1HWGB 1NGWB 2PXYA 3FB5B 2F8VA 3HKFA 2VZSA 1QG3A 3ZO0A 4IIQA 5E8DL 3VFTA 4XNMB 3H9SB 3WNOA 1OVZA 4PB0H 1ZLWK 1RZFL 2LFGA 4X6CA 1G9NC 3S4SG 1FV1B 3DXAB 1Z9MA 3WKML 5CP7B 2BSRB 1MHCB 2YD7A 4KJWC 3B9KC 4P57A 5KG9B 1KENH 4GO6B 4TSBH 2P49B 5D7SL 4Y4KD 4JZJA 1VFAA 4PJCA 1T03H 2QTEA 4Y4FA 3WNPA 2MCPL 4K8RL 2I60L 1U95A 2GSIB 3K8MA 3GMOA 2R0KL 3NGBC 4TTDC 3T1FA 4HMEA 5DQ9B 4YE4L 1CE6A 4NZUL 4XWGL 2YK1H 1FG2B 3DRQA 2V17H 1A21A 4LAQH 1T21B 1XGQB 2VDNL 5E8EA 5HGAB 5J3HC 2VSDA 5GZOC 2D0FA 4DN3L 5FCSH 3GO1H 5DRXB 4M8QA 4F7TB 3GK8L 4U0RC 2A0LC 3U9UA 4QLRA 4HKBB 2EYRB 1QR4A 4HIXH 3B9DA 3ECBA 3QI9A 4MD4A 4GAJH 3RX8A 3ZT6A 2Z8SA 1QA9A 2EDBA 1DQQA 2GJ6D 5IB5A 1DFBL 4KKCC 2VXUH 1RMFL 4JZNB 1HCFX 2IH3A 3JWOH 4KRPD 1M6OA 5E8OB 3MV9B 4FQCL 3KPLB 1WFNA 1SBSL 2FEEI 1V05A 4HF5L 1JI2A 1RZJC 3LQAC 1IGYA 1PZ5A 2FJFB 3BZEB 4P2RB 4EXKA 4TNVF 4EDWH 1JGUH 1J1OL 3GM0A 3SGDI 2VO5A 1TPXB 3NIGF 3BX7C 4RMSA 3V7AE 4LDOB 5GRJL 2AI0L 1RK1A 3CFBA 3UXFA 4WW2B 1CDYA 2YPVH 3B9VA 4ELME 3EFFB 2BSSA 4N90D 3S34L 1ND0A 3WIFB 3E3QE 4YHZL 3K2UL 2H32A 3C6LB 3O4LB 3I6GB 4JY4A 1S3KH 3K7UA 4FFWD 3HC0A 1KTLB 4XNXH 1CD1B 2AXHA 1F3DJ 4W6YB 2G60L 2ITCA 4LASH 3S35L 5HPOA 3ALWA 4R4FH 1G9NL 1ZGLB 5D2NC 3VXSB 4NUJB 1J9CT 3QDJA 5CEYB 4MXVE 4DQOH 4FTVD 2AV7B 1KB9J 3L3OA 1D5MA 1T7XA 1B4RA 4TPRL 3MJ6A 2Q7YA 2OI9C 1J8HB 2P8LA 5DMKB 2VE6B 1JNHA 2NPLX 1IGML 4RGND 1T83C 6FABL 2FCBA 2MCPH 1MHHB 1JV5B 2B4CH 2G9HB 4Y19D 3D39B 5L6YL 1KELH 4BA8A 3VWKB 1QSFA 2VXQH 4PP2A 3SDXF 4OLZL 5CJBA 1D9KA 5MHSE 1H3WM 1TLKA 3C6LC 3TH4T 3SKUD 1LO4H 3ARUA 1BVKA 2DI8A 5ILTL 1KJ3H 3RUGA 1YEFH 2WBJD 4PGZA 1QFHA 4ZO8A 3SO3B 4WEUD 5ANMA 3U0TB 4OD1L 5BRZA 1ADQL 4NN7C 4WI3A 4WW2C 2X05A 3UCRA 1YQVH 3PWPD 2HFEA 1P7KB 1TJIL 5BQ7B 2PKDA 4HUUB 1TPXC 1X5JA 4HUXB 2FX9L 4L3EB 2FL5B 5DEGB 3G6AA 1X5XA 2O5ZH 3RJQB 4YHYC 5HYIA 3QHZH 4L9DA 1ZLSL 5J9PA 1D7FA 2HTLC 5CWSA 4OSUH 4PLJC 5DQJA 1IILE 1S9VB 3DSFH 4YAQA 1T7VA 4ODHL 4Y5YB 3ZDXE 3FN0L 3MRDB 2Z8WC 2Z91A 4OZIB 3S88H 2YWYA 4L8SB 1A0QH 1DEEA 4I77L 3LKOB 3LKPB 5BS0D 3MLZH 3VXME 2H3NB 4LSUH 9CGTA 3W5MA 1KPUB 5JOEA 4U0RB 3ZE1E 3PWJA 4X9IA 5INDB 5EZJA 4Z0XA 4LGSB 3DV4B 3FQUB 2EC9T 3W81A 3GEWB 1A3LL 1FBIH 2ZKHL 5B3NA 5TQ0H 4I48A 3QQ4B 5SX5H 5CJXA 1I3UA 1QQDA 3AXLB 1CU4L 2XPGA 3ARRA 4NT6B 4OZHA 4JFQA 2Q8BL 2V7NB 2LV4A 2IF7A 3G5VB 3P40A 4FZEL 2ZUVA 3P4OB 5DFTA 2E6QA 3IJSA 1F8TH 2QQKH 3RWCB 4OD2A 4WY7H 3B9KB 2PTUA 4EN3A 3SDDB 3TBWA 3DX8A 2H26A 1EUUA 1YEIL 4F8QA 2NY3B 5KOVC 1K5NA 3NABH 3TBTB 3UTTB 4LLMB 2FEDD 4X4XB 4RWHA 1T1ZB 1AGEB 4NQDE 4O2EA 1LK3L 3GMNA 4NP4L 4PG2C 1FFNB 2VXSH 2F19L 2X4UA 4KMTL 1EMTL 2Z8RA 4Q58C 4ZMAT 1IEAB 3IS0X 1FL5A 2NX5E 3L1OL 1W0VA 3FN3A 4D9RD 5HI3D 1SJHB 3C87A 4KC3B 4JRXA 1RURL 3AMKA 4DN4H 1FNEA 1VFBB 2PTVA 5AG8A 1KC5H 1FYTA 2A77L 2BC4A 4Z7QE 1JNLH 5ESVA 3DX6B 1NEZG 3MRHB 3AREA 4OZGF 2FZ3A 3VFNB 4XHQA 5IW3A 3FTGB 3GSQB 1U8QB 3NMEA 1UZ6F 3BPOC 5IBTH 2XZZA 3BZ4B 4DGIL 3FO2A 3VFOA 2R2EB 3MBXL 5GJSL 4PB9L 1CFNA 5DJAA 4AEIL 3HPLA 1KB5B 3NN8B 3O2WH 2DQTL 2R39A 4S1SH 5CBEB 3MLYL 43C9B 5FGCB 3ZL4L 3OJMB 5TDNB 4UI2A 3ULUD 1VFOA 5CINL 3STLB 3T2OA 5K9KB 3TT1L 4HKXA 3T2QA 3JSSA 1OAZL 1P5UA 2A74A 1LNUB 4L3EE 4APQC 2UYLA 3TPUA 3CPLA 2D3VA 1A3RH 2FDBP 4M1GH 3I50L 4MDJB 3VWKD 3E3QC 3MRFB 5C0BB 2X9WA 4N0UB 1K8IB 3L7EA 1BJ8A 1S7WA 4ODHH 4XHJC 3O3EA 3GSRB 3T4AB 3QXTA 4Y4FD 4Z18A 5F89A 4AYFA 3LS4L 1F11B 3P30H 1LEKA 2F19H 4L4TB 5HBBA 3SGEH 3BH8A 3D0LB 1EMTH 2GW5A 2CRMA 4M5YH 4JB9H 3GSXB 4PIRF 4ZTOL 1B9ZA 2V5SA 4KVCL 4QTHB 5FHAH 1IC5H 2AVGA 1JK8B 3P3YA 5LGJA 3NH7H 1MAMH 5GGRY 3B4NA 4XPAL 1FJ1B 4U6HB 5EO0A 5H35A 2V9QA 2HMID 5FDWB 4ZPTA 4PJBF 5E2VL 3HI5H 4R0LB 5KSAA 4X7SL 2NY1C 4KV5F 4P99A 5J56B 3DVNB 2MSPA 1CFQB 3BKYH 1Z9SA 5FO7B 1CI5A 3QEQD 4YPJA 1YY9D 4PGEA 3B9AA 1TNMA 1P4BH 2JJVA 4JFFD 5JDSA 4RA3A 3VW3L 3MLWL 3WHE0 5ITFA 1ZXQA 5CZXC 2HFFA 2VLJA 4QRPA 2XZAH 3DIFA 3O4LE 3DO7A 4PRIB 2DWEB 5D1ZA 1REIA 3RWEB 1I1YA 5KTEL 2P5WE 4QHMB 3WS3B 5C0CD 4I4WA 4BH7B 1A2YA 1OGAB 4CMMB 1DBMH 5EIQA 2BY3A 5J13C 3DROA 4WWKC 3PWPB 2KL6A 5IB4B 3BKCH 5I8EB 4Z7UB 3G5ZA 4C4KT 3PGCA 2OMNA 2LTQC 3HCVA 4J3WA 5DS8A 1TZHA 4LFHG 5KVEL 4I0KA 1UVQA 1ZVYA 1QO3B 1AC0A 3LEYL 3H9ZA 1ZA3A 3BPOB 4NFBA 3B2VL 2BMKB 3ZE1F 4C83B 3QNZA 3QEQA 4BK4A 4X6DB 2D4FA 2FHCA 5K9OA 2Y07H 3TZVA 1HHGB 3F58H 4P5MB 2AI0H 5ESAA 4XXDA 1WVZA 2KUTA 3LVEA 1G7MB 1BP3B 1W72L 4ACPA 1ACYL 1EFXA 4ZFGH 4MDIA 4X6BB 5F1NB 3NPSC 1HEZB 4XXCA 4DFIA 3BIBX 5E70A 4MMZC 1YEKH 3RDTA 3BRFA 2HVJB 2R9HD 4RDQF 3PDGA 4IM8A 5EO1A 1FZJA 1G0YR 1C8PA 4NRXA 3VMOA 4P5TC 1FVDB 5C08E 4WUUD 4K23H 2X4TA 4MNGE 4LQFH 2Z9TA 4KDTC 5SWQA 5E1AB 1ERNA 4PRNB 4BZ2H 3V4VL 7CGTA 1QRNE 3WE6A 2D7PA 4ISVB 4NKIH 5HVHB 1K4DA 4HUKB 3KXFA 3QB7C 5E4IA 5EU6D 1LD9B 4S2SA 3D85B 4WFGD 4U1HB 3DWTA 4TPRH 4UINH 5DK2A 3TBVA 5C08D 5HVWA 1U42A 3SGKC 3EYUL 5HJ3A 15C8L 3VJ6A 4NQCD 3MR9B 4IJ3B 4JFEE 1CGUA 1BIHA 3DETC 4KPHL 3ZTNL 3BP4B 3N1MC 4DVRL 4A6YH 4DZBB 2VLRA 3K1KC 1CN4A 4ODBD 2ZSWA 3PL6B 4RAHA 4FN0A 5J1SC 1NCTA 3CCHA 2M26A 1NCCH 4MJ5B 4KWUA 1ORSA 5GS3A 1KLGB 3BEWA 1AI1H 3TC9A 3EDJA 3SE8H 4HWNA 1BBJA 3W2DL 4GXUN 1DSFH 1U58B 4QOKE 1EEYB 5GISL 4TUOB 3CX5J 2YD6A 3IU3A 4WHTA 4L8SC 4WU5A 3QFJE 2X1WL 1ADQH 3RWFB 2E7CA 4LCUB 4XVSH 1MREL 3D3VB 3MJ9H 1J10A 2DMCA 1INEH 2DYPA 5DHVB 3W0WD 1FYTD 2CLRB 1LO4L 2ADJA 2CXGA 1MFAH 1S9KC 1HZHH 1BEYH 2XI9A 3KYAA 1ES0A 4JFOA 1KXVC 4QWWC 1KEGH 2HT4D 2M1KA 3A67H 3HS0A 1R5IB 5DJDB 4MAYA 5IVNA 3VXTA 1Q9LA 2J1KA 2QHRH 3NFPB 6FABH 3QIUC 3VDBA 2VLKA 3BZDA 3FFDB 4PJFE 5TE6L 4BKLB 3RI5K 3RWHA 5C71A 1RVFL 3FOMB 4QT5B 5EZOH 4B50A 1UM5L 1JHKL 1MNUH 4HAFA 1NFKA 1TFHA 5E5MB 2ZJSH 3VWKC 1FE8H 3HRPA 5I1CL 2RJMA 4K8RH 4NM4L 1I3RB 2P8MB 4P23D 2YD1A 4M7LL 3LQAH 1T5XB 1U8OB 2Q1EA 2VLKE 4WHYG 2NR6C 4XNYH 2YA2A 3GSOA 4XCYB 1G7QB 1HHHB 1A1NB 4U6XB 5C9KA 4XAKE 4OQTL 3QSKB 2Z31D 5I66B 2OI9B 2WIIB 4GUPB 5I15H 4O9HL 3AB0B 2H2SD 1CFTA 4I0PC 1CICB 3C8HA 4FQ2H 1KIQB 1NBZB 3QDHA 4G8IA 3QCUH 3VXPA 5I9QC 4M7LT 1BIIB 2F15A 4L8CA 4Z7NE 1JTTA 1S7SA 1WCBA 4KXZI 1E4XH 3ARBC 4XX1G 4PGJA 4MQ7B 4NNPH 1EPFA 2Y6SC 3P77A 2CQVA 3V2AR 1QHOA 1OB1A 5IB3A 1AJ7H 4WI8A 4CU8A 2ITDB 4GOSA 2WMPA 2E9WA 1DUZA 4MXQD 2IBZY 4JM2A 5J6GB 2R2HA 4HPOH 1A7RL 2X5PA 4BQBA 4Z6AT 4LLQA 1RJLB 2UWEB 3P11H 1RMFH 4OB5H 5L2KB 1I7UA 1FQ9C 3MUY1 1H8NA 2B0SL 5FA3A 5DD0H 2OJZH 2DQCL 3V4UH 5IVXA 1HE7A 2J88L 3ZDZF 4WGWB 4I13B 3S37X 5F96H 1UM5H 5IMMA 1U8IB 1F00I 2EDRA 4X6CB 3QCVL 3AAZA 4OJFH 1FV1A 2CDEB 2XRAH 3MOBL 3UYOD 2OCFD 5SV4A 4XP6L 3U7WL 1CZ8L 4KI5F 3S98A 3HZMA 3REWA 1JUFA 1MWAL 2R4RL 1YUHA 1F4XL 1RD6A 4ORGA 2W1NA 3MA7B 2W65A 5LKNA 5F1SA 1Y6KR 4H88H 5GGTL 1PKOA 3VD3A 2VWEE 3O6KH 3HUJF 1EHNA 1QFWL 3H9YA 4MNQD 1NLBH 1V5JA 2BJML 2FLRT 5T5FH 1NGPH 1UQSA 4GXVH 2X9YA 3CVHH 1DBJH 2Y5TB 4IHOA 1MCEA 1YYLL 3NGBB 1ZOXA 2DJ4A 5GISH 4TUJA 3G6DH 5ENWA 5EORL 1MRDL 1GHFL 5IEHB 2V6HA 3H3PH 2AXFB 2XICA 5D72H 5JPMB 4HDIB 3M17B 4BZ1L 1E28A 2ENSA 1JYXA 4KK9D 4FFZH 3E1F1 1Q38A 5L9DL 4M1CD 4Z0BH 2G5BA 3T0EC 4CDGC 1ITBB 3FB7B 3EOYG 3KPLA 5L2KD 1S7QA 3SKJH 3DOSA 4RAVA 1IGYB 4OLWH 5D7IB 2FJFA 3BZEA 2J5LB 3U7AA 5LCVH 4Z78A 2ZNWA 1INQB 4OLEA 3ARGA 3SDDD 4YDLC 1EAJA 3RZCD 3CFBB 1YC7A 4PJ7A 2O5YL 2K9UA 5F3HB 3U0WH 4JKPH 2WM0A 1PZUB 2PW1B 3CSBA 4JDZA 1Z6JT 4JG0L 3C5ZD 4YH6A 2GT9B 4YXLH 5SWSE 2C4XA 4BH8A 3KXFD 5BZWA 1L7TL 5IB1B 1NCBL 4OZFG 4P46C 1AD9B 5T3ZE 2BNQE 4QXGL 3TVMB 1XGYH 4HUVB 5F1OB 2C1OB 5K33A 4UTAH 3I02A 3OR7A 4K2UL 3W5NA 4L4VE 2R1YA 3MV8A 1FO0A 4NCC1 1G7HA 1S8DA 3QDJB 4LMQI 5CEYA 5I30L 2AV7A 3L3OB 2R0LL 2V5MA 5LBSL 4GW1A 4UQ2A 3MOQA 3MV8E 3L6FB 3QDMA 1JBJA 3OB0H 3CK0H 2DBLL 4Y16B 5FM5M 3TCLA 4U6TA 1PYWA 1NLDH 3C2AL 3DVFA 4HPYL 4KK5D 4DJMA 1Z5LA 1IMHC 4AM0B 2ZUQB 5EBGA 3GMPA 4F33A 5I30H 5HYJB 3LEYH 2HH0H 1QSFB 3L95B 2DLEA 1FC2D 4LF3B 3R4DA 5B8CC 3N50A 4IOSD 4PJXF 5C6TH 3RUGB 1HINH 5BJTB 5FECB 1S5IL 1U36A 3U0TA 1A02N 4DCQB 3HNSL 4YLQT 3CH8A 4YHPB 1CVSC 4DWHA 2LU4A 4UT7L 5IEKA 1NBVL 2YBRA 2VN7A 1F8TL 4Y19E 3EYSH 4M8VA 4R8WH 2HFEB 1P7KA 3GUTA 3WSQL 4B5EA 1SYSB 4HT1L 4JKMA 4ONFL 1D3CA 5E2JA 4U1GC 2WP3O 3D48R 3G6AB 3LKQA 3MRIA 1IQWH 1KEML 3TVMD 5J9PB 1WTGT 4X80H 4F15B 1WWCA 3ISWA 5D7JA 5C3TA 5L2JA 1BPVA 3ARYA 3EDDA 5BVPH 5TF1H 3BKJH 1IEBB 3RNQA 3WXVL 1A6ZA 3DPBA 4W6WB 4J12A 1T6VN 3ARVA 1D5BB 4GW5B 1KG0A 2L7JA 5JXAL 3LOWA 3B9EA 3FT2A 1I9RH 3ZZ1A 5EWIH 3UJJH 3U9PH 5JZ7D 1EA9C 1KCSH 1IQDA 1U8KA 1CCZA 4OIAA 4LHUG 5DGQA 5EFIB 1KTRL 3DSFL 5JQ6L 4NPYB 3FRUA 2IH1A 3VRIB 2XQBH 3BGFC 1P5VA 5IHLB 1QQDB 1T2QL 3AXLA 4M5YL 2AERT 4Y2OA 3ALXA 1J7VR 3GBML 4MNQE 4GG8B 3IXAA 3G5VA 5JPNA 1YJDH 2NY5H 3IJSB 1KFAL 1LK2A 5EULV 2NY7L 5HHPB 3GJFA 5JLZB 3IB4A 1S5IH 2BXYA 5I1DA 4NQVA 3NIGE 1CBVL 4HS8L 1GGBL 4YFEA 5LQBH 1D6EB 3WN5B 1SYVB 2IPKB 1F6LL 4ZD3H 4LLMA 2Q8BH 4G6FD 3HPJA 3R1GH 2VABA 5IIEB 2FR4A 2K7QA 3U30B 1KB5L 1BZ7A 2CKBH 1UJ3C 4KRNA 4HFWA 3B83A 3CSGA 3OKOA 4P9MH 3UTOA 3VFRA 3MRPB 4UUJB 1ZE3C 3IAGC 1KCLA 1JGDA 4ODUB 3C5ZB 5KJRH 5MI0B 3FO1A 1TMCB 3O6MH 1JPSL 2B1AL 2L7UA 2COQA 2NZ9C 2CIKA 4GAYB 3DNKA 3BMVA 5JMOC 1T0NB 2HFGL 3FOLB 3I6LD 4K2UH 1CXKA 1ZWIA 1J5OH 2H8PA 5AD0A 3GSQA 1EO5A 2CIIA 4PY8I 1U91A 1RJYA 2XXCB 2WK2A 2R4RH 1O5DT 4BQ6A 5JR1H 4DVBB 1DBKH 1UC6A 4AIZB 5DJAB 4FQXD 3HPLB 5CEZL 1WZ1L 1QSEE 4DW2H 2NTSP 4K3EL 3RGVC 2XIDA 4AJ0A 5ICZA 2HLFC 4LHQB 4MA1C 1JTPA 1T0MB 3JV4A 3STLA 3HZYB 2CDGA 2FB4L 2W91A 4MJID 2A74B 3I2CH 1JVKA 5INCA 4JFFB 5ETUB 2XN9B 1BZ9B 2LVCA 3K8LA 5F7EH 3OXRB 4HJ0C 4LPCA 4N0UA 3PWNA 4QKXB 2DD8H 1K8IA 1S7WB 2AEPH 2VLKD 3VGHA 5CJ8A 5JIHA 1Z3GH 3RL2B 2OS7A 1VGEL 3O41A 4MX7A 1M05A 1SM3H 4PJDB 2YUWA 3JUZA 1YEFL 4JN1H 5E00B 4BSWB 1PBYA 5FIEA 4U6VH 2ADGA 3WJLC 3ZKND 2XNAA 1PG7W 1WBXA 3FHQA 4ZUUA 1CGSL 4PRHD 4OQTA 1KCKA 5BV7L 4QTHA 1GGTA 3UBXG 4E41D 3TPKA 5C2BL 1DE4A 5FYJL 5DSCB 3RGVD 5EA0L 1YPZA 3QCTL 2EXYD 4Q6IB 1DQJA 2AGJL 3ZHLA 4WO4B 3TA3A 2FO4A 1EGJA 3Q3GB 3IAPA 3Q5TA 1EEZA 3DBXA 2YKLL 4PJFF 3DVNA 2QR0B 4MNHB 3GRWL 1CFQA 5HHXH 1B4JL 1MIML 5CEXA 4KJYB 4J6RL 2AK4A 1JZ3A 1BLNB 1WWAX 1NGXB 4P48A 5JDSB 3MACL 2PYED 3BAEH 5AWNL 3QWOB 1NDGB 4PR5B 2K7PA 2I5YH 4G6ML 2DWEA 4KROB 3HE6B 3JBG7 4RZCA 4IOIB 5ERWB 2NXYB 1U8NA 3SY0A 2DTML 4ZQKA 5T3XE 4WNQA 2BNRA 5FYJD 4JFHD 1Y6NR 5HXMA 3DRTB 3PWPA 2P47B 1D5IH 3NPZB 5IB4A 5EUKA 2WNGA 1Y6MR 4K07A 1NC2A 3MGOB 1HOCA 4J4PA 1MWAB 2GAZA 5E6IB 1NAKL 4H1LA 1L7IH 4UIMB 4HULB 1F4YL 3THMH 5TDPB 3GMMA 1JYNA 4Y4KC 5EU6E 3KNBA 4NCDA 2ZG2A 1DSFL 1BQHG 4LU5H 4DEPC 1HI6A 1M7IB 1D5XA 1MCBA 3DVIA 5F7EL 1A7NL 5F6IB 4NJAL 3AVEA 1BHGA 3TESA 1WT5C 4F2MB 1MCNA 3BPCA 1UXSA 1MJJA 2AJYH 3OHXA 2V17L 3UTPE 4FXKA 3D25B 1KJ2B 2PCPB 5EU4A 2IQ9L 1NEZA 3MV01 1ZEAH 5DFVC 4K9EC 3UBXB 1HYSD 1B0RB 1R3HA 1AKJB 1NC4D 4JFEB 4NRYB 3X3FL 1FZJB 2AXGA 5CIPH 5ID0B 4XH2A 5I1JH 2QQNL 1DEDA 1IAKB 4C4KO 4XNMA 2VIRB 1H0DB 2H2SC 4DN3H 4NWUL 5E1AA 3ET9F 3RZCB 2R1XA 1Z0NA 3LCYA 3GI9H 4ZO9A 3HFML 5FUZH 4ISVA 5GRXG 3VFPA 3J7HA 4JFHE 3KPMA 5KG9A 4E9LA 3KR3L 3T3PF 3FMGH 1J1OH 2EZ0D 4YIQA 2BVYA 2JIXB 4RQQB 2NY0B 3TBVB 4TOYH 2YS4A 2H2PD 5J4MA 2MKLC 5HJ3B 1B0GA 3QZWA 4QRPE 1FRGL 4HKZA 4QRTA 4F3FB 4OQTH 3BP4A 2F58H 2X2YA 4GRLB 4LPVA 5C0CE 4U1KB 4TRPL 2C3VB 2M2DA 3DRQB 4YDVA 4QEGA 4K3HA 3OTTA 4MJ4A 1ZKAA 1YN7B 1B4JH 2X9XA 5T1LB 3U9UB 2OTUA 3X17A 4PRPE 3TM6A 4ZXBB 1BWWA 3ECBB 3QI9B 1YN6B 3TNMA 5I18H 1G6RA 2CUIA 2RR3A 4PLKC 4WU5B 2OK0L 3OWEA 4FQIL 5I73B 3RWFA 1QSEB 3DXAE 4V2CB 1TVHA 1DQLH 3SEPA 5A3IC 5E8OA 2R8SH 4ODXA 1G84A 3I84A 4H0GA 1U8LB 3ARFA 4PRHE 2UVFA 5C92A 1DL7H 5GJTH 3SE9H 1F45A 3DGCR 4MMXC 4N5EC 4Z7UE 4YXKL 3B3IA 3QQ9D 4LKCA 4MJIB 3JVGC 5F8QC 3IDXL 1GSMA 3HA0A 1WK0A 3CZJA 3T0VA 4MNQB 3TIEB 1A6VH 2BSSB 1BOGB 3QNXB 3WUZA 4OI8A 2H32B 1I1AD 4ZS6C 2E8YA 5GPRA 1R5VA 5I8KH 3U83A 3LH2L 4X6FA 3TP4A 3QI9D 1MFDL 3HC0B 2PYFA 5CZXD 3FT4A 4POZC 1U93A 4XT1C 5GZNC 4Q2ZB 3L5JA 2P8MA 3EOAB 4J3TA 4UT7H 3IT8D 1HDMB 3QUZC 3OR6A 3VXSA 3T0ED 3KS0J 1A1NA 4GMSH 1NEUA 2VUYA 1L0QA 4P2QE 2ID5A 1F3DH 3ZT7A 4JFYB 1FORL 4H8WC 1T2XA 1WC7A 1U8JB 3VD9A 2MKWA 3O6ML 4N5ED 1OPGH 1YC8A 3UTSA 5ISZE 3NAAL 3EBAA 1HHJA 1NBZA 1WGOA 1BIIA 4LRIC 4OCWL 3HNTL 3O9WC 3RWIB 3SJVE 2GI7A 3OQ3B 2R4SL 4BQ9A 1BJ1J 1FP5A 2ICWJ 5HSFA 3DURA 3E6HB 3I6KB 2W60A 3VD4A 2WBWB 3KPQA 4I0PD 3VDCA 3MJ8B 1I1AC 4ZS6D 2XTJC 4HBQA 4KI5C 4JZOB 3QIWD 3BKCL 1PSKL 4JG1H 4FA8A 3RHWK 4LCWE 5EBWA 1AO7D 4DKEH 1XF5A 4KMLB 1M7DB 3V6OA 4S1DD 5A16A 2KQNA 1JGEB 3QNYA 3MODL 3NCYP 3SKNA 3HI6L 1AHWB 5T1KD 4JN2A 3WD5L 5IVXB 5FB8B 4O02H 2QQKL 1T4KB 4HUXA 5KSUA 1F97A 4PTTB 2VN4A 3WFEL 3WJJC 3Q48A 5EIIB 4K7PY 1UENA 4YUEH 1L7TH 3RY5A 4WDIB 2VR5A 5DD3L 2YEZB 5IOPA 3NABL 5ITBL 5DQJB 3OKDA 4WFFE 5IW6B 1MFCL 4Y5YA 5TFSL 2O61A 1FLTX 5C0FB 3C9NB 1OL0A 2Q86B 4BQCA 1JUFB 1Y18B 3UPAA 4H20L 4N0CD 4XZUB 5I17B 1RU9H 2QSCL 1IGIH 2X4SA 3MCLL 1HINL 3WIHA 3BPNB 1NCBH 4LLWB 3IJHA 1WIUA 3AS2A 1UQSB 5BXFB 4I48B 3VXMA 3MRNB 4OUOA 4JO3H 2X4NB 3LN9A 1BGXL 1HSBB 2P48B 3DMMB 2VLJD 3ZKXC 3PWUB 1DVFC 3MYZA 3QIWA 2NY6D 2SEBA 2V7NA 1XCQA 1HHKB 2PXYD 5GS0D 2PYEB 3QPXL 1S7RA 1RUML 4NQDB 4LMQE 2G5BB 4M6AA 3P4MA 4U1JB 5HHVH 3KVQA 3MLYH 3SDDA 3CFEA 4D94A 3GSWA 3H3BC 3U2SA 5DD5L 3VWJA 1R24B 2BRQA 5JOPD 4Z78B 1J0IA 3RRQA 1T1ZA 3EYSL 4R8WL 5IBTL 3UJJL 4CVUA 4K71B 3VFUB 2P4AB 2DKUA 4S0TD 3BHBA 5IFHH 2J3SA 3FQRA 1OAYL 1DQTA 1FL5B 1IQWL 4NKMB 1OW0A 2RIKA 3LAFA 4FFYL 4JRXB 1QTYT 1E4KA 2FJHB 4BFEA 3HI1B 1UKSA 2XZCH 5IB1A 1ZK9A 5K9JL 1V7ML 3GI9L 3WSQH 2O5YH 3IDJB 2C1OA 2C3GA 5CJOH 1AXSB 2ICEA 3I02B 3OR7B 5C0RH 1JZ8A 3GMLB 2WWMC 2ZSVB 5F7WC 4HMCA 3UAJC 4IOFC 3S88L 5KANG 1IM3B 3ARQA 3VFOB 1LO3L 1EDQA 2ZUYA 3BYTA 2FECL 3ORJA 4OZIE 1OPGL 4UQ2B 3T1WA 3RY6A 1N6QL 1ZHKA 2AQ3A 3MRRA 1W2KT 1NUGA 2AEQH 4RGOL 4U2YA 3FQTB 4MQXC 1U8PB 4CVZA 3PWLB 5K9KA 4MA8L 1BECA 4GT7A 4XPGL 4AM0A 1PX3A 4F33B 3QT2A 4J1UA 1J12A 3LPGA 1R6VA 4LIQL 2FYYB 4DKFL 4PJ9C 2NZ9D 4R26H 3V6OE 5E9DB 1JZ7A 5DRZA 1M1SA 4P0DA 3X11B 4HBCH 3CLFL 3PHOA 3CVHA 4XVUD 3HG1A 2P8PA 1OSZA 5CJQL 5FXCH 2B8OT 3SBWA 4XWOD 1V8HA 1LO2L 3HG1D 2O5XH 1A0QL 1HXYB 1CZ8H 2DQDL 2P1YA 4Z7VE 4PJ7E 1JK8A 1P4IL 3G9AB 2AEIT 1X5AA 5GGRB 5EU6B 2NXZB 4YDIL 3LKSB 5CS7A 1MEXH 1OOAA 1IEBA 1WFTA 3RNQB 4FNLH 3U4BL 4GG6E 3MNWA 4NWUH 2GFBA 1UWXK 1DLFH 3KYKL 2VAJA 1SMAA 2HAZA 5L7XH 4AH2A 4N0FB 4YDKL 3FT2B 1TXKA 5ADPH 4X8JB 4AEHH 4S1QL 4RGNC 1YYLH 4ODSL 1PKQA 1VFUA 4LP5A 3BW9B 3HE7A 4HWUA 5J12C 4HUWA 4K3JH 4NN5C 1Z9OA 4D3CH 1C7SA 4LIQE 1WBZA 3JWDH 5F44A 3DO7B 1UFUA 4FG6D 1IVLA 4PRIA 3CJJA 1DFBH 4G8GE 2CDFA 2QHRL 1JZ5A 5EOQH 3NA4A 2J8UF 4GG8A 5FYLE 3RVWC 5EORH 1BOYA 3KLDA 2CMRL 4CVWA 1KNOA 2C3WA 4L29A 4P3DB 4K23L 5DJCB 5DVOA 4KI1A 3VFGH 3EDFA 1BM3L 3MROB 2DM3A 4P2RE 3G08B 4TSBL 5D9SA 2GY7B 3GSUB 5CJQH 1SYVA 3BIAX 3W0WB 2BVPB 1AE6L 4WWKD 4LDEB 2VDRL 1ULVA 1EXUA 2P43B 1EZVY 3D3VD 3BP6B 3GSVB 4C83A 1VA9A 3QNZB 1DL7L 2HJKA 4HXAL 3PGDA 1I9JL 1TETH 1OAXH 1OGAD 3OKOB 1L6XA 1U2CA 3WIHH 3KWWA 1IGFH 3RA7L 1A1MB 4X9FA 3TZVB 3F7YB 3D87B 4P5MA 4W68A 4UINL 5BMFH 1C16B 2VDLH 4XXDB 4JQVA 1JPST 1OD7A 3DVGB 5ALCL 1F42A 2BRRH 3FKUS 2IPUK 5DUPH 3BVNA 1PLGL 3RDTB 4J3SA 1N2RB 5DHYB 3GI8H 2V2XB 4J6RH 5TQ2L 1U91B 3UO1H 4NSKB 3OV6A 1FVDA 3AROA 3BSZH 4YJZL 5J1TC 4Q9QH 4I18A 3QJFA 5SWQB 5B38B 4KRPB 1N5AB 4FNLL 2BVOB 4NNXB 3EKCA 1K4DB 2H6PB 3DUSA 5EOTB 1BFOA 3CFKB 1LD9A 5F7YC 4CU7A 3NVQA 3MQIA 3UO1L 4PJ8D 5DK2B 5INCB 1B3JA 3H3KA 4RGMB 1HH9B 4RFEB 1P9MC 3SDYL 2ERJB 4Y16D 4JPWH 4UOJA 1S5HB 5EUOA 4NN6B 1SBSH 5CEZD 4Y2DA 5DVKA 5BOZG 3BRDA 1M05B 1CXLA 4NO2B 3O6FB 5DJZA 5T1KA 1I4FB 4AENB 3CCHB 4MJ5A 1CG9A 3RVVC 2X41A 3IFOA 5I1AA 5CZVH 1FZKA 2X1OA 1T3FB 4NQEB 1HWHB 4HXAH 1UACL 4ZAKD 1A22B 3MA9H 2YPLD 3HNVH 1U58A 4XBGA 2V2TB 4NHCL 2YMXH 1FGVH 2ARWA 5EZOL 1FHGA 5E6ZA 4QRSA 4Z76B 1F4WL 3B8SA 1ZAGA 1LO5A 2EE3A 5DSCA 5F7UA 4U1NB 4HLZH 4QRUB 3OKLA 1K4CA 2V5RA 3QXAB 5DVLA 3TA3B 2W0FA 1RZFH 2BNUB 3BI9X 4NQXB 3ZE0F 3DV6B 1S9XB 1K8DA 1EEZB 1ES0B 5EOCJ 3MLRL 1DN0A 1DBAL 5BV7H 1KSRA 1R5IA 4HGKC 1E6JH 5CEXB 4QRQA 4PG9A 2AK4B 4J8RB 1DVFB 3ZKXB 5EWIL 2ZCLL 1JF6A 5I8OH 4ZFFB 1T6WA 3P73B 4I5BA 4D3CL 5KSVA 5TE4L 4U6YA 3FOMA 4WI5A 2BY1A 2R15A 3OPZH 4XRCB 2X89A 5DJ6A 1MCPL 4NQCE 1XGRA 5KJRL 3HR6A 4GQ9L 3BPNC 3SDAA 1KIPB 2RCSL 4JM2F 3BKJL 3DECA 3QDJD 1A7OL 1A9BB 4PREB 4J3XA 2W9EL 4XC1L 4JANA 1JCKA 1YEKL 1F90L 2EE9A 1RUKH 5E5UB 5ICYA 1G7JB 4Y4HC 5SWZA 2GAZB 5E6IA 5JR1L 1IT9H 2UY7A 1R3IL 5DGRA 1I7ZA 1YY8B 1CICA 3KNBB 5LQBL 4S0SD 4YK4B 1G7PA 2BNRE 1S7UA 1HI6B 1E4XI 3LQMA 1M7IA 4M48H 4P2QA 1YECH 1DDHB 1WTLA 1WCBB 1KIRA 2FB4H 1CXIA 4FTVB 4P9HH 1MCSA 1JTOA 2IQAA 4CJ0A 2XTJE 1Q1JL 3ELAT 3BPCB 1T89A 4LVOC 1MJJB 1EHAA 3KYOA 5C9JA 3OHXB 4YC2B 2W9DL 3IXTA 4GKNA 2KKQA 4I3RL 2F8XC 3K8KA 1KACB 4GBXD 3U46A 2E9BA 1CL7I 1FNSH 3R0MA 5T3ZL 4AT6A 3W9DB 2IADA 4ZS7H 2YA0A 4MCYA 3UBXA 1OT1A 2R23A 1H5BC 5L2KA 1I7UB 5GS1B 3WUWG 3KLHD 4JN1L 1FNGB 1R5WA 2EDEA 5D5MB 4DGIH 4LCWD 1QSFE 2ZP0T 3PP4H 1Q9OA 2F8OA 1JPGA 4LK4A 3K4AA 3IVKA 1CD8A 4L5FH 1ZHLA 5GSVA 2HT4C 3LRHA 1FL3B 1JZ6A 3N1PC 4R4ND 4LSPL 1Q9WB 3ZHKA 1SY6A 3BQUC 3VFPB 4YHIA 4ERSH 4NC2B 2YUXA 4ZUSA 1RFDH 5HYFA 4CW1A 4H26A 2H1PH 2MQ3A 4LSRH 4HT1H 3HLAB 2D9QB 2GJZA 2APVA 2XWBA 3O4LD 4KJQD 1MHPH 3OB8A 4KV5E 3U0WL 5I1KH 5HHOD 3DUHA 1KCRH 1LDPL 3ZKSD 4CNIB 4PPTA 4Q74A 4Z5RB 4CVXB 5B38G 2UZXB 3T09A 3ULSB 1NGQH 3NZHL 2X4OA 4FQHA 1T20B 4GRLA 3LS4H 3P30L 5IV2B 2A73B 2P5WA 4AIXA 4OKDA 3U36A 1KPVA 3OG6B 3RKDD 4P46D 2Y5TA 1ZGLP 3OXSA 3HE6D 2AXJA 5ADOH 4Y1AA 3MLUL 5DWUH 3MRLA 4YX2H 2D2OA 5DJ2B 4KTYA 2BSTB 1AGBB 2OL3L 2DYPD 4PJCE 4KJPC 4ZXBA 5FHAL 4PBXA 1S7TB 4KTDH 4PUBH 2A38A 3I50H 2CRIA 2WUBH 3QFDB 4WV1B 3WUWA 5E7FA 4MJIE 4RNRA 1MHEB 7FABH 4XMPH 1QSEA 5E95B 3H7BB 2OQJA 1RUQL 4PGDB 3UTTE 3TT1H 1CR9H 1S7QB 1GPOL 1NLDL 1ORQB 3RVUC 3NACH 3KJ4B 4LP4A 2OXHA 3S4SB 4HV8A 5CD5C 3U4EA 3QUKA 4OLYL 5FK9B 2HJFA 2ORBL 3LHPL 4NQCA 3O8XC 4MNQA 4HFUL 3F7VA 4I3RH 4FQ1L 3WCYA 3TGXA 5D7LB 4QHUB 5IVZB 2VITB 4KQ4L 2XY1A 1R5VB 2BK8A 3H9HB 1CLYL 5I19L 4PJXA 3ZSSA 3MOBH 4P9HL 2W0PA 3TVMA 4ETYA 1LEGA 2PNDA 1XIWC 2ERJC 2Z31A 3EOAA 3L1OH 2DQIL 4HCRL 1AO7B 3SGDH 1G7HB 1S8DB 3SE4A 3MPCA 2G75A 3C5JB 3GFUA 3G5XB 1KC5L 4OD3H 5HY9A 1AGFA 4OTXH 4HIEA 5T33L 3U0PA 3T0BA 1BQUA 3NA9L 4KRPC 1QFWH 3TCLB 3H2WA 4OCLC 1PYWB 3VFVB 3O3AA 3PWVB 5D1QC 5JXAH 3WMSA 1A7RH 2F54B 1HILA 4MHHI 5GGVL 2IQ9H 3GDBA 4OZHF 3I9GH 2PO6C 3V5DA 3ULVC 4NO0B 3SDCA 5DRNB 5IBLC 1CR9L 3DURB 3E6HA 3I6KA 3G5YB 2E7LC 4JGUA 3RHWF 3X3GH 2DLHA 3MJ8A 3IS1X 1Z0MA 3VXUD 3MXWL 2DQJL 5BJTA 3D9AH 4PJDF 2CGRL 4ZOCA 4XNZB 2HTLD 4ZO6A 5EBWB 1UZ8B 1ED3A 1M7DA 5DO2C 3FB8A 3QNYB 3CSPA 1JNLL 1QEWB 5KSAD 4RISL 1OAUL 4UTBH 5K9QI 4Q0XH 2VQTA 1MWAH 4OZFA 5IKCA 3I3EA 1W0WB 4DEPB 1PGRB 3UEZA 3LKQB 1PSKH 5CAYB 4G9DB 3UTZB 4MXWL 1KULA 3TNNB 5L2JB 5IOPB 1XT5A 3F8UB 3NFNA 3OKDB 2NTFB 4PJBA 4XCEB 5C0AD 5EBLA 4NRZA 5DK3A 3DARA 2EZ0C 5GGSB 1J0JA 1P1ZA 3G6DL 4OZGB 3CZFA 5JW5B 4WENB 2Y36L 3TIDA 32C2A 3QCUL 2NXYC 3EO9H 5EFIA 1HCVA 1YNKH 2R69H 2GITA 4JFPA 2YD4A 4ENED 4LHUA 2HTKD 4ZUWB 2ICWB 4AQOA 5BXFA 4FQQB 1IEHA 2D0HA 4TRPH 3WIIL 3WBDA 2IANB 2ADIB 2O5ZL 1AP2A 2RQ8A 4D0DA 3RVVD 5AZEH 4F9LC 4UIKH 5C0NC 4HXBL 1QLRA 2XV6B 3IXAB 4MVBC 1K6QL 1XCQB 3CVIH 4O51A 1TQCC 3H7LA 1PLGH 5JPNB 4K7PL 1J8HE 5GSRB 2ZCKH 5FO9B 2EH8L 1MPAH 5CGTA 5LJYH 1HK6A 1U6AH 5EU5A 3TO2B 3W39A 3WEXB 5C3LD 2X70B 1T1XB 2H45A 3EYVA 1HNGA 1D6EA 3MV8D 1GGCH 2N4IA 2Z92A 1UXWA 3CDGB 4DZ8A 4Z77A 1OTUD 4R4FL 1MLCA 1YEEH 3L3IA 3VFUA 1G9NH 3PABB 4KKBC 1CFSA 1D5IL 1BZ7B 3RIAK 3ZTNH 1C5DB 2BOBB 2VXVH 4GAGL 3UDWA 3TFKD 3FQRB 2OL3B 4OKVA 3L3GB 2I9LB 4JRYD 1FIGL 2XFXB 1YA5A 4LHUD 3CDYA 4XP4L 5MHSD 3V0VB 3ARDD 1I8LC 4CADA 1T7ZA 3C5ZA 5DRWA 3FO1B 5HHME 3PGFH 1S9YB 2OBGA 2VDNH 1PKQE 1YEEL 2X4PA 2EDQA 1DR9A 3HR5B 3SQBA 4E5XB 5D7KD 1N64H 3BEVA 1FIGH 5J8OA 3BMWA 2P5EB 2EH7L 4JHWH 4KKAC 5AYUH 1XGUB 2XN9E 3CFJB 1G1YA 3BN9D 1IM3A 4J3OC 4Q9CA 5JO5B 5A2IH 4DVBA 4S1RL 2XYCA 3P4LA 3TJHC 4TUKL 1SEBA 2YPKB 3B5HA 1NCCL 2D4DA 3WIIH 4TYUA 1UH2A 5FOJA 3MRRB 4X9GA 1AE6H 2C5DC 3FZUC 1XGPB 2D03L 4CVZB 1T0MA 3C09C 3JV4B 5L0QC 3JTSA 1CDUA 3ILPB 2CDGB 4YNYA 4X99A 3ARTA 1RIHL 4UMGA 3VRLE 4TUKH 3PWNB 5A2KH 5F7MC 3BN3B 1HQRB 4O9HH 3ROOB 1D5ZB 4HH9A 4MS8C 5DRZB 2VDQH 3LD8C 3C5ZC 3BOVA 2MWCA 4YFLF 5ICXA 3CVHB 3VMPA 3MFGB 3LKNB 2P8PB 1OSZB 1N0LA 2DQGH 1WBXB 1LQSR 4ZUUB 3UDWC 4FQJH 1UJ3B 4XP4H 2FWOB 3REVA 4ALAH 1ZHNB 1BQLH 4KROD 4K71C 2OZ4L 3PDDA 5IQ7L 2AGJH 4X9HA 5JHLH 4NDMA 2BZDA 4ODVL 1FL6A 3TO4A 2FATH 3MLSH 3EAKA 1JN6A 1URLA 2JE8A 3C60A 3H9SE 5C08A 4WHCA 1ROWA 4M03A 2WUCH 4BZ2L 5LXGL 3MNWB 2GFBB 2X4RA 3DBXB 4AEEA 5HGHA 3HAEG 3VW3H 2O5XL 2Y7QA 3UTSD 1CLYH 1CGYA 2QR0A 4MNHA 4JQXA 1MQKH 1EJOH 4WEBL 3TJEL 2VC2H 1LILA 3LS5H 4F9LA 4M1CC 2ENYA 5T1MB 3DMMC 1PKQB 4QHNB 3UYRH 1FZMA 5F3BA 2GTWB 1Y0LA 4U1IA 2E27H 5E94A 5H94A 1IRAY 2FX8L 1VFMA 4KPHH 4UNUA 3B43A 3IDMA 3IETA 3T04D 4PY8J 1DN2A 3UC0H 2VMFA 2F74A 3CX5K 5JHDB 4Y88A 4AEHL 1NDMA 4XPTH 3U1SH 1D6VH 3C2SA 5FHBH 4K9EL 1TJHH 5IHBA 1YEDA 1GIGH 5KTEH 2HN7B 4NCC2 1P7QD 3QDGE 4MWFA 4N0YH 1TCMA 4YR6B 2E7MA 4C55A 3VXOA 2YXFA 4D0BA 5D9SB 1MSPA 2D7TH 4Y5VC 1KJVB 3CDFA 3TWCH