3RTQD

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 63
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqD02
4TTDD 3TV3L 2IMMA 3FKUS 5DJAB 3ARBD 5FUOL 5ADPH 2DAVA 4ZAKB 1U91B 2BC4B 2ZUWA 5T3ZE 1LK3H 1HCFX 5ID0B 3GEWB 1EFXA 1CGUA 1NCAL 3FQWB 1ZT7B 4QF1B 4BQCA 4C83B 2C4FT 1EAPA 4HBQA 3MJ9H 5KS9A 5B4MC 1YJDH 3SDDB 4X8XA 4LCWD 4OQ1A 5E8EB 4PTTB 3AUVA 4R7DB 3TFKC 3AU1A 2UZYB 3CH1B 1IEAA 3OSKA 4NQVA 2JTDA 2X4TA 4X7FC 2CDFA 2M1KA 1QYGL 3OR7B 4ZS6C 4FQXC 3T65B 1W0YT 5ADOH 4PJBA 1S9YA 1K4DA 1LNUA 1MUJA 3IJHA 3TIDA 3W0WB 1C1EL 5KBNC 1H3PH 1DVFC 4ZFZA 4WEUD 1G7PB 3MRFB 1FIGH 1TITA 1PKQA 1WCBA 4F37F 4NNYB 1A6VH 1K8DB 4JDVB 5F7EL 5EDXA 3ULVC 4EDXB 1I3UA 3RUGF 3GMOA 2QR0B 4P5TA 3TO2B 5T1MA 4X4XA 5HYIA 4LU5L 2E6PA 4MD5A 3VFWA 3AM8C 4GRLB 4F58L 3IAPA 3DV6A 4LDEB 3REVA 3TVMA 3RVTD 5HHOB 4I18C 3EYFA 4KK8C 3NH7H 1UG9A 1HHJB 4W6YB 4WTXA 4M1GH 5FM4A 3QEUB 1YEKH 4QXUL 1FVEB 5B38G 2JJSC 5IG7A 4TVPE 3D0VB 4GMTL 1NCDH 2N7AA 4PP1D 3X11B 3QXAB 1KGCD 4TUOB 1Q72L 3GRWA 3V7AG 3T0XA 1ZGLA 1IVLA 4NKOA 2D7TL 4LSVL 4O51A 1EHAA 3WKMH 3QEGL 3VW3L 3C8HA 4RQQB 4YHLL 5BMFL 1DDHB 1YMMB 2IPUK 3VWKB 4RGNB 3VFUA 3OF6A 4LLYA 1Z0NA 5ITBL 5EZJB 3D1MC 2VZ1A 3GBNL 3GSXB 5T5NG 1FSKB 3G5VA 3HPLB 2Q3AA 4YDKH 2GY7B 4P2OA 4U33A 3OZ9L 5DGQA 4LOUD 5CSGA 4BFIB 2A83B 3EO9L 1GOHA 4L4TD 4R4ND 3HE6B 4L4VB 1ZEAL 1RUQL 4PRNA 1MIEH 4NKOB 4HDIA 4NSKA 1HE7A 5HPOA 1KLGA 5D2LA 4OBSA 2WBJC 2RIKA 2R8SL 4KJQC 2D0HA 3RGVA 4MA3A 4O2CB 5DD6A 2VLMD 4QY8A 1IKFL 3PGCA 4Q6IC 2GT9B 3JUYA 1WEJH 2Y25A 1JFQL 5MEOA 4N0FB 3MV9D 8FABA 3HCVB 1EAPB 4D9RE 2DJ4A 5E7FA 1BVZA 2V2TA 1GIGH 3BGMA 3GMRA 4PJBF 5ECJE 4ZPVA 4P57B 3FCTA 4YFDB 3QXDA 1LDPL 5C0NC 4ZPTA 5GRUL 4Y4KC 5AG9A 3FQNA 4WO4B 1RUAH 1BFOB 1U6AH 4GRMA 4LF3B 2E6QA 1S9YB 3EW3B 3HE6D 3KYKL 4JFEA 5ISZB 1ES0B 2DQIH 4PBXA 4TVPD 1T0PB 3P11L 4OZIE 3NTCL 2BSTB 3KYKH 1E28A 4RGOH 5SWZE 4XPTH 3QDGE 1CL7I 4PJ7A 3EUUA 3MV9E 1A6ZA 4FOMA 4MCYA 5EU3A 4NO3A 3X3GL 3V4VL 5EO9A 4CVXB 1E4WH 4WFGE 1LDPH 4HS3B 4OZIA 2E7LA 4C4KT 4U05A 2J8HA 4KQ4H 4HWNA 5KOMC 3ZDZF 5DLML 3ARSA 4XNXL 1KJ2A 1CGYA 4OLZH 1JE6A 5HDBF 1NL0L 4JPVL 3JV6A 2H2SD 3BZFA 4MAYC 5ISZD 1FFRA 2A2QT 4YR6B 3CDYA 4YHML 5J12C 4BZYA 3UO1L 3C5JB 5IEKB 5JUEL 1X5XA 2W59A 5I66A 1X6LA 5GRVK 4HIJB 3U36A 3BH8A 3DMMC 1EUUA 4JAMA 4P2QA 2ZSVB 3V4UL 2BY1A 3LQAL 5INDB 3OL2A 3K2UH 1C7TA 4JFHD 3T0BA 4PUBH 2DD8H 3HFMH 4GRWH 4KKCD 1U3HD 4PJGB 5D1ZB 2HH0L 3GKWH 2KDGA 4ZPVB 1LEGA 3QNZA 2D31B 3TCXA 3W0WD 2R23A 4P4KC 3AMKA 1I85C 3GHBH 4OFPA 4BM7A 3TYFA 5L8LB 1FNGB 5JQ6H 4Y8AA 2OJZH 1QRND 5IK3B 5F3HA 5EOTA 2Z9TA 3Q2CA 5DYOB 1UJ3A 1MLBA 2NY7H 5I2IB 2PYEA 4ODWA 3CFKB 1U3YA 4LBEA 4MHHI 5LWYL 1FZOB 3UAJC 1ZS8A 1XH3B 2VO5A 3BP5B 3OB0K 1G9ML 3P2TA 4PBWD 1YEIL 4L8BA 3QR2A 1QLRB 3C2AH 4H1LB 2PTVA 3MODH 2XN9D 3NZ8B 5C0EB 3L9RB 3P73A 4M43L 1KCKA 2G75A 5E2UL 2YKLL 3T2NL 3IU3A 3MACH 1RSFA 3ET9F 1YEGH 2Y06H 4OGXL 3HA0A 4ZPTB 5DHXB 4N8CL 5DK2B 1U8LA 4PBVC 4QOKD 3NAAH 2PO6D 4H26B 2YN5A 1OSZA 2XWTA 1XGYL 3VXTB 1NFDA 1MJ8H 4WFGD 2IFFH 3UTTD 4HULB 4MXQC 3NCEB 4NFDA 3H9HA 3HAEA 1U92B 3EYOA 4X7TA 2R4SH 3RIAF 2IAMB 2WNGA 1QQDB 4XPBH 1RZJL 1WJ3A 3TF7C 1JHLH 4IDJL 4K8RH 1JPGB 2MKWA 5FA4B 1VFBB 4O5LH 3TA3D 1JRHI 5DHVB 5DK0A 2R56L 4OZIF 4LIQL 6FABL 2Y07H 1ZSDA 3TWCH 5B8CB 4UV4H 4Q2ZA 1P6FA 1ZHBB 2E8ZA 3ECBA 2XYCA 4R6UA 1ZXQA 5F88A 2I9TB 2HRPH 5I1CH 5CD5C 4YLQT 2WIIA 2WINA 3MXVL 4U49A 3GI8H 4PR5B 4FQXB 3KHQA 1NGXA 4WU5A 1Z0MA 3TH4T 4I0KA 5D1QB 4G8FB 3E8UL 7FABL 1UA6L 2X09A 3L3IB 3SE8L 1QLRA 3NFSH 3QI9C 2AI0L 2E7HA 4IMKC 4LRIA 3VFVA 1T1ZB 2K7QA 4OIIL 5D72L 3RVXD 3QDGD 1UA6H 2D03L 1DL7H 2MMXA 4OBRA 4GAYA 5EO0A 4EN3A 4R90H 3V5HB 4HFWA 1XGPA 2H1PL 2YRZA 4OT1H 4H88H 5C0DA 4OM0H 4ZYKA 2XWTB 1T7XA 1ZT4A 4NO0D 4D0CB 3P3YA 2PYFA 3OG6B 1ADQH 1MJJB 4OF3A 5HDQL 4K94L 3HPLA 4PREA 1AI1H 3VFPB 3OKMA 1CGSL 2ICWJ 3P73B 2H6PA 5TE6L 5DJCB 2JJTC 3B43A 5IR1B 3X11A 2H8PA 3L3HB 5ETUB 1L7TH 3BISA 5DHVA 3H7BB 5DK0B 1FAIL 5I8CA 1FO0B 1XGRB 4KMTL 3ESUF 4YO0A 4NOFA 1I9IH 5AD0B 1JL8A 3ORJA 1FNLA 3L7FB 4DUVA 4KJQD 5DFWH 2HWZL 3H3BC 2IJ0C 2O5ZL 3WDHA 4JR9L 1DN2A 1XAUA 4QYOA 4XNYH 3TBSB 3IDUA 4OT1L 1A4JB 3BGFB 2BVPB 3MLVH 5HHNA 5LQBH 1U8MB 3U7YL 3GB7B 5T33H 3E0GA 2C7UA 4NO2B 4JGMA 4I3RH 5C0RL 4FZEL 3WIFA 1RZKC 3I9GH 3K1KC 4MX7B 4QHUB 1I1CA 2DD8L 4N8VB 1CK0L 2AAVA 2JJWA 5AEAA 3STLA 5MEND 1WK0A 5GRWA 4YFLI 4XTRC 3P4MA 4RWYH 5EU7C 1RZFL 2P7TB 4HKJB 3ILPB 3MOBH 1S9WA 4HGWB 5DJZA 4X5XA 3DVNA 2OK0L 1M6OB 4KJPD 3EDDA 3UXFA 5IQ7H 4HWEL 3UEZA 5CMAA 1VGKA 1T4KB 1NBVL 4NQDB 4DN4L 1F4HA 5FOBB 3O81A 4WO4C 3DARA 5I8KL 5CEXA 5IV2A 4P23A 3FO2A 1J0ZA 1KEGL 1DN0B 1HILB 4LVOC 3DMMA 3WIHH 1I9RL 4DEPB 2DQEH 1NBYA 2R69H 3LKRA 3ZO0A 1SBSL 3QEQA 3ZDYE 3GIVA 2AP2A 4PLKD 2LVEA 4PY8I 1QFUL 4JFOB 1IAKA 1T2QL 3WXVH 2FX7H 1H0DB 4FFZH 1IGFL 4XBGB 3LVEA 3O41A 3WFBL 4PRIE 1J0IA 4U6YA 1XGTB 3KYOB 4D9QE 4HWEH 1MCSA 1XF3B 3P9MA 4JO4H 4MDJB 1A1MB 3A6CL 5GGQH 1V7NH 3UJIH 2R4RL 2WAHA 3V6FA 3GNMH 3WKML 4WI2A 2HAZA 4FFVD 2BRRL 4WCYH 3H8NA 4AIXA 1S7XB 3EFDL 1Y6MR 3LS4H 4LCWB 5HGDA 2WUCH 1RIHH 3D3VA 5HGBB 4KKCC 3WFZA 5FB8B 4PJ5E 5DVNA 1IGML 5J12B 2BVQB 2HTLC 4YXKL 3QIBC 3G08A 4QXUH 5ESQA 1OAQL 1NBQA 3WKNA 4CW1B 1CE1L 4JM2C 2YRPA 2DLGA 4GAGL 2HTLD 2JJTA 5DJXB 3ZKXB 4FP8L 1YYMH 1FYHB 3GHEH 5EULV 5TPWL 4MJ6B 2Y36L 5EOCH 3GSOB 1RIVH 4MXQD 1NANI 4KVNL 5D1ZC 4JFED 3GHEL 4LAJH 4FXKB 1VGEH 3LN9A 1A3LL 1GGBL 3V6OE 5I19L 4HK3J 5JXAL 2AEWA 1N26A 4R8WL 4EUPA 4MXVE 2FJGA 4I1NB 5MENB 4HPYH 3RWDA 1XZ0B 5JHLH 3SKJH 1I4FB 4ZXBD 3NN8A 1RJCA 3RIAK 3VGBA 2OZ4A 1B3JA 3EFDH 4OIAA 2ATKB 2AKRB 2WUCL 1EUTA 5EIIB 3I75B 2HG5B 4LEOA 2Y5EA 1YEEH 2HKHH 5DRZB 1P1ZA 3FRUB 4G8GD 3OB0H 4XGZB 4O4YL 1INEH 2VDQH 3RVVC 4JHZA 4OM0L 5T3XH 1R3KB 4X4ME 4X80H 3OXSA 1HSBA 4IS6B 3KWWA 4OCRL 1S7UB 3D85B 4MNHA 2EDFA 4R26L 4IRJD 3I50H 4FFVC 3C6LD 2NLJB 4P46B 3DTXA 1CLZL 3RI5K 4ZNCD 2I5YH 2CDEB 5A2KH 1IMHC 3TJEH 2XFXB 4HUVB 1IQDB 4IDLA 4FG6C 4Z7NF 3MV8A 5DQJA 4ELKA 4ZO7A 4KAQL 4K71B 4Q2ZB 4Z77B 4JRWA 2R1XB 1QSEE 2VLKA 3RWCA 3GM8A 1IM3B 4CGTA 4EBQH 4LLUB 4CJ1A 2C3GA 5I17A 2EEDA 5EBMA 3SDYH 3SDXF 1U8HB 1TZIA 1DBJH 1BFSA 1WZ1L 1RFDH 3LKNB 4J6RH 3QIUA 5E2WL 1L7IH 1NL0H 2X4UA 2IAMA 4DK3A 4QHLA 5I1AA 2EH7H 3U9UA 2DJUA 4YX2L 1FRGL 4MHHG 1X6NA 2BRQA 3FOMB 3VWJA 3CZJA 1GZQA 5E8OB 1T89A 4RFEA 5J6HA 1KC5H 1LEIA 4K3DL 1UC6A 1UM6H 3HZYA 1GGIL 3LKPB 2X7LA 1AGDA 4RFNC 5HHVL 3VRLE 4IOIB 2RGSA 4CW1A 3LKSA 3RL1A 2QKIB 1BF8A 4PRPE 1J18A 3QPQC 3CJJA 1J11A 4M4RA 3NIFE 2BNUA 4OLEA 2ZUVA 5FO8B 1RIUH 3VXOA 4L4VE 4QNPF 1NC4B 5CEZE 1IL1B 1CFVH 5EOQH 5BXFB 1I9IL 1FN4B 1RY7B 4EOWL 4NKMB 2BXYA 4MS8D 4BH7A 2CK0L 4OUOA 3KS0H 4PRPA 1IM9D 5DZNA 1N5YH 4TULH 1QLFB 3QQ4B 2J3SA 3MV8E 5C07D 4JDTH 1KTLA 4YX2H 2D3VA 5IEKA 3GJFB 3QXVA 5DQDL 4P59H 5D1XB 4OZFB 3GI9L 2P8PA 5MEQB 2FECL 2NY5H 3T0EC 1BHGA 5DMKA 3CH8A 4MDIB 1DUZA 3N1GC 1K6QL 5JR1H 3IRZA 4U1JA 3FHQA 5HHPA 3JV5A 3B5GA 1C08A 4U1HA 1CS6A 2VC2H 4PJFE 1R3HA 3EO1B 4PYHA 5E2VH 4G80A 4HHAB 1G6RH 1YPZA 1IEBB 2FHCA 4PRBB 3RUGE 3MLSL 2OMNA 3DETD 5AYUL 5BV7L 4FS0A 3NGBC 4ODTH 2K7PA 5EG6C 1HI6B 1S7QA 4KGJA 4CVXA 1LEGB 3QNZB 4X6CA 3X13A 4W70A 1X5GA 1R5IB 3SDDD 2I07B 5C0AE 1YPZF 2N56A 3BKYL 5C09D 4TSAL 3HMXA 3L3HA 3BRGC 1MFEH 3RJQB 5KVGH 2YUXA 4YEFA 2NY4C 4HUMB 5KVDH 1C16A 5JW4Q 5A16A 2ZWLT 2Y36H 4F9PA 3BPOC 1WTLA 1JUFB 2XACC 2HTKD 2AERT 1I7UA 2VQ1A 4Z0XB 3QIUB 3GMPA 1S8DB 4FQLH 5C08B 2Y9RT 3J7HA 3R8BB 5GSRA 3F7VA 4NNXB 4WTWA 5LVEA 2DBJA 5EBMB 4YBQC 1AO7D 4EI6A 3QDGB 3BE1H 2CR3A 2QSCH 1FN4A 2IANA 2OM5A 5DWUH 4E5XB 4F7CB 2D31A 3G5YA 3VGHA 5FGCE 1UCBL 1RZJH 4N8PA 3CAFA 3EFFA 2D9CA 2IH1B 5C09E 2DTML 5IHUL 1BD2D 1LEIB 4HUNB 1QFWI 3MLUL 2VE6A 3SOBL 4L3AA 4YDVB 4XVJL 4PB9L 2B4CL 4MDIA 2MTPA 1S9WB 3I6GA 2EZ0D 3C5JA 3RVWC 3QRGH 3THMH 3PGDB 3B9KB 1FAKT 3P77B 2P5EB 1Q9LB 1GGIH 1CD0A 3CNKA 1FG2B 4OGXH 4LRIC 5HYJA 1KEGH 4JFDB 3DIFA 1A7QH 1IC1A 3DRQA 5T3ZH 3FB5A 3INUH 3LEYL 1F11B 2W9EL 1MI5A 1E4JA 3ULUD 1U2HA 4JQVC 4OAWA 3MV7B 1HH6A 3QA3A 3MBED 4UU9A 5C6PB 4LLYB 3G5XA 4S1RL 4R2GD 4N1EA 2X44D 4KMQA 4ZFGH 1K8IB 5C6TH 1D5ZA 4NWTL 4UQ2B 4RX4D 5E9DA 4U0QB 4PG9B 1S78C 1C12A 1I3GL 1DBKL 1GGUA 1Q8MA 3DSFL 5E99L 1UVQA 4WWID 1F58L 4GKOA 3QIBB 1DQQA 3VRIA 4LLDA 5FK9B 1TTFA 4PRNB 2DLHA 2IANB 4M1DL 4Q6YA 3QEUA 4YBLC 4YK4B 3SO3B 1KXQE 4HUWA 2VLKB 3RWCB 1DBBH 2HG5A 4F7MB 1X44A 1KCSH 2OXGA 1GH7A 4PB0L 4U6HB 4X7SL 1P1ZB 3ARBB 4OLWL 2BFVH 4XPTL 5L2JA 2Q8AH 1LP9E 2GFBA 4M48H 3NA9H 1XR8B 1JVKA 4K3JL 4LCCA 5EU5A 4JRXD 5E6ZA 3ULSA 3H9SB 4JVPA 5I71B 2CDFB 4GO6B 3BN9D 4PGZA 3MOBL 2E7BA 3ZTNL 3OPZH 1BD2E 3FTGA 5I76B 2EDKA 3PIQB 1ZLUH 5F7WC 3DTXB 5FHAH 1KYOK 1T21A 4NKDA 4H8WL 1Q9KB 3MRKB 4WVRA 3S4SG 5IVOA 2F5BL 4EIZC 3UPRB 4QNPE 2QR0A 4FFWC 4KC3B 4RMSA 5E2WH 4LHUD 4OD3L 4ESKA 2HJLB 3B5TA 1AGCA 5IFHL 1ZT7A 4QF1A 1T2JA 4G8EB 4JQXC 2W9LA 4GMSL 2EIZA 2FJFA 1D9KA 3RRQA 3VFTB 2Q7YB 2AV7B 3RWGA 1YC7A 2CO6B 4KMLB 5CINH 2ZSVA 3RWIB 3SO5A 3OGCB 1FZMB 2VZOA 3IDJA 3V7MA 3CH1A 1KIQA 3QWQB 4JKLA 3EDFA 4NDMA 1FLTX 1W72A 1GOGA 5ANMA 1A6UH 3IJSB 1K3IA 3OR7A 3MYZA 1JWSA 1ZHKA 4LVNC 2ICEA 1K5NA 1B0RA 3STLB 4YDIL 3SGEI 3FQWA 1R0AL 2HJLA 4ODWB 3U1SH 1ZVSA 3W2DH 1A3RH 1CZ8L 5HVHB 1UT9A 3BSZL 3KPSE 3LKSB 3F6IA 2R2HA 4Q0XL 3LAFA 5CMAB 4MD5B 5ALCL 5J9PA 4ENED 3LN5A 5F8RC 5FO8A 5GPRA 3CZFB 4QRQB 3KPNA 3DUSA 3O2DA 2MPAH 5D93C 3MRBA 3QDHA 4UIKL 4CU8A 1ZK9A 3MUGA 1AFVL 3IU3B 2FJHB 3BPLB 4FQCH 3O2DH 5ESVA 5IUSA 3QIWA 2NY2D 4WI8A 1NC2A 5C0EA 1RUQH 1I8KA 1AQDA 1BGXH 2BVEA 2MKLC 3MMEB 2YXMA 5DHYB 2CIIB 5CLTA 4FHBD 4M62H 5INCA 4OZHF 1LP9B 4GAFB 4GUPB 4YQXH 1KENH 2VH5H 2EDJA 4K3EH 1A21A 4KHXL 4E0RB 5BS0B 3ILPA 1OW0C 2EE9A 2PO6C 2XPGA 2VDPL 1VB9A 3AY4C 5JPNA 3CFEA 3CVHL 3GK8H 4PLNC 1ZHLA 4FQJH 3V0WL 2OTWB 1DANU 2V2TB 3BXNA 4HS8H 2VLKD 3MRHB 3R0MA 1G0YR 3MGAA 4P99A 2AXGB 2I9LB 3HE7C 4HPOH 5K93A 1A7PL 1F2QA 1MCOL 2P43B 1RJYA 4L5FH 2A1WH 3T0EB 4PY7A 1FLRL 4JDTL 2YSSB 3BX7C 3MNWA 2ID5A 4JY5L 1S3KH 5EU6B 5DUBA 1T3FB 2BNQE 5JORA 4PLJD 5LWYH 1AD9B 3O2WL 1WT5C 5I1LB 1K6QH 4U2ZA 1D9KB 3VFTA 4M8VA 5KVFH 1TVHA 1T1WB 3UTSA 4P5KB 3DVNB 3VA2C 3ZDXF 4FFZL 3ROOB 2YRLA 2GAZB 2A6IB 4NO5B 1B90A 5SWZA 3QP3A 1KB5A 1U41A 1RZGA 3UPAA 4GAYB 5JOFA 3RGVC 5D9SA 3I75A 2NX5A 5LBSH 4UNUA 3S9DB 3IVKB 4HIXH 2EIBA 1F13A 4YDKL 2V5SA 1ERNA 2AGJH 35C8L 5IKCB 4QY8B 4HEME 1KNOB 1FQ9C 1YJDL 3TNNB 4YIQB 1OM3L 1CICA 2BHYA 4U31A 1QFWL 5DVMA 1EGJA 5FHBL 1BLNA 4OB5L 2WWMC 4GW5A 1GGYA 3O2WH 1B2WL 4LSQL 3SDCC 2NZ9C 1EGJH 1Q94A 5KW9L 5DQ9A 2B8OT 3JWOL 4D3CH 1JNHB 1RZIA 3U7AA 5ID1A 3UYPA 1X3DA 3VXRE 3WO3B 1F00I 2EXWC 2Y07L 2G5BB 4LKCB 4CNIB 1VERA 4M93C 2MQ3A 4K55A 4WTZA 1OB1B 4NNYA 5HY9B 3EOTH 5F7FA 3H3PH 4JM2D 3OJDA 3ZZ1A 1HH9A 5I0DA 2X89A 1U8IB 4WGVB 3Q6GL 3AREA 4G6JH 2J4WL 5J11C 2VDML 3HR5A 2DB8A 4F37K 2WP3T 4EDWH 3QPXH 4IHOA 4XPFL 4DK6A 2C4FU 2J12B 4NJ9L 1ZA6A 1RI8A 4U1NB 2F15A 2VAAB 1VHPA 5L2KE 2AXJA 4PB0H 4ZAKD 3UZVB 5DMJB 3D0VA 2SEBA 4Y5XA 2VXVL 4P5TC 4IJ3C 1P7QB 4U1LB 5DEZA 4JFYA 4P46A 5MI0C 1SYSA 1YY9D 3T2NH 4WI7A 3NCBB 4ZDHB 1ZLVH 4H26A 2PNDA 2AJXL 1HH6B 2ATKA 4EDXA 1J10A 2KBGA 1EEYA 4KRMB 4KROC 4QXGL 3BUTA 1DBJL 4DJMA 1IAMA 4L8SC 5EH1A 3V5KB 3ES6B 3FAWA 5GGTH 1QFOA 3HC0B 1G7LB 3N06B 3IT8D 3WEXA 1AD9A 3QUYA 5HI4D 1UGNA 1G1CA 5JW5A 2AABH 3JV4B 4MQXD 5I66B 1PEZA 4PRPB 4NQUA 3JWNC 4MQXC 5I6XB 5CBAA 4U7SA 5FM5O 2FEDC 3VG9B 2IBZX 4R7DA 1IARB 4XHJD 5HYSG 4MSWA 1H5BC 3EOBA 4AQ1B 4P3CH 1UM5L 2QHRL 4X6BB 1W0WB 4GXUM 3C5SA 3NFPA 5A2FA 3JUZA 3VXSA 4KRNA 3K2UL 3AXLA 3QDJA 4NRZA 1MOEA 5J1AB 4ZXBB 1SMAA 3I3DA 1FZKA 4ZUSB 4LLWB 4LASH 5DC0A 5LQBL 3TO4C 2FL5B 5E8DL 3BUYB 2HT2C 4WUKL 1LE9B 4POZD 1WZKA 3S4SA 2FO4B 2Y1VA 3KPQB 5E1HB 4OZHE 4TUKL 1D5IL 2P8LB 4L9LB 1YDPB 3QNYA 2P24A 3DXAD 4LP5A 5C2BL 3EYSH 3QB7C 2IQAB 2NW2A 1VPOH 4PJFB 3S5LA 1XH3A 5DHYA 3S36H 4H1LH 4HUXB 5FECA 5F9WB 5GIRA 1I7ZA 1V7MH 4L3EB 2P8MA 4HW6A 3EYSL 4YWGL 1UM5H 2QHRH 3V95A 1JRHL 4AMKL 1NCCH 1JGLL 1G9EA 4PJXE 4JN1H 3F12A 5KW9H 4ZG1A 3VJ6A 1NLDH 1QVOA 4GQPH 5IM7B 3NTCH 4DN3H 1HXMB 1D5MB 3HPJA 5I16A 4YUEL 4LSDA 3S4SB 1BBJB 1A3LH 2OLDA 4G43A 4NQXA 3U0TA 3RL2A 4OIBA 1EHXA 3WJJA 3OKNA 2BHUA 5MERB 3MRRA 5F9JB 4MAYA 3H0TB 3ZHLA 3MUGB 4PRBA 1JYXA 5DRNB 4HCRH 1LEKA 4NQDA 5F72S 3CXHJ 1MF2L 1UH2A 1EFQA 3DX9B 4WUUA 4GRWB 4U0RB 1OAKL 1F4XL 4XMKL 3FN3A 5D96C 4YHOH 1GVIA 5JOPE 5ANMB 4HJ0D 1HHHA 3BVNB 4AK1A 4MSWB 3AGVA 3KPRD 4G8GA 4HDIB 3LV3B 4B53A 5JXED 4K9EH 1F02I 1O7VA 3LCYA 4K7PH 3L5XH 4PJ8A 3VXRD 4MNQA 3S97C 3B9KD 3ARZA 1A2YA 4NSKB 1OSPL 1OAYL 1FO0H 4NNPL 3RTQA 5HGGS 5CEYB 5FXCH 2BZDA 3V8CA 1DCLA 5L0QB 2BJML 1ITBB 3HC0A 1JZ7A 3MRPB 5T5FH 3W81A 1AXTL 3BPLC 5DR5H 5JDSA 4G8GE 4Z7NE 5CD3B 4G3YL 4OLVH 4FQQA 1LO3L 5KVDL 1K2DA 4LU5H 3ZMRA 4MCYB 2KZWA 3C60D 4HJJH 1DVFB 3SCMD 1D9KD 5DD0H 3O4LB 1ND0B 1MHEA 2MCPH 2X9WA 4YPGA 3L1OH 3IXTA 3T2PA 5CZVH 4WFEE 1FZJA 3SDXE 4OZFG 3BH9B 3BFOA 2PO6B 3O6FB 3WFDL 4GRWE 1J8HA 1QSFE 1YMHB 4IMLB 3ARUA 1NGYA 3O9WB 4GRLC 2F5AL 1KIUA 3HMWL 1CICB 5J8OA 2DWEA 5JW4N 3GBNH 2VABA 3LKOB 4O9HH 4I18B 4KI5C 4G6JL 1HHKB 4Z78A 3RKPA 1RUMH 4WFFD 3T0ED 1BWMA 3K81A 5T5FL 5DS8B 1G84A 3B9EA 3EO0A 5E00A 4XXCA 1KFAL 1ZA3B 3HE7D 1Z9LA 4S10A 5FGCB 3QDMB 3OQ3B 3RHWF 4JB9H 3PQYD 2BY3A 1AGFB 1RJZA 3CSYB 1T0MB 4K3DH 4UAOC 2HJFB 2AJZA 2H8PB 3B5HA 4AY0A 5D7KD 1WZLA 1M71A 1C7SA 5FGBC 4UUJB 5HGAA 5KN5A 5GRYA 4HX1A 1EMTH 5DJCA 1MAML 1I4FA 4JANA 5F9DC 3VWKC 1QTYT 1GGCH 4U6HA 4CUCA 3K1DA 4U6YB 4Z7VB 1N8ZA 1TIUA 3B2UD 1BAFH 2XXCB 1FSKC 4GG6B 2CXKA 2A74B 4X4ZA 4Y8DC 1TJHH 3QWOA 5T1KB 2Z8VC 4G7YH 5MEPB 2QLVB 4MMXC 4PV9B 3U4BH 4GT7A 1HHIA 5GJTL 3AC0A 4PRPD 3R06B 4KGLA 4P2CG 1KB5B 4Y5VB 2WM0A 1J8KA 2A0LC 4WRLA 5CEXB 4I77H 4DVRH 5D1ZA 2QQLL 5DGRA 4YNYA 1HQRA 2FX9L 3CX2A 1MUJB 3TIDB 4RA0C 4G6FD 3VXUA 4PJCE 3QUZC 1HDMA 1RZGB 2C1PA 1KT2A 3GDBA 4ODUA 3UZEA 2FIKB 1A2YB 1AQKL 2B1AL 4X0KA 4CVZA 4WY7L 5C0IA 4JKWA 1H9VA 1U91A 2YWZA 5A1AA 3TT1H 4RGMB 4KZDL 5EPMA 5EZJA 5CD3A 3QUKA 3L6FA 4Z0BH 4WUKH 3RX7A 1ZWIB 5HI5C 4ZFFB 2A9NH 4LSTH 5I1GH 4PJHA 3LH2H 2NR6D 4UV4L 1T5WB 4S1SL 1A14H 4Y4KB 4M1CD 2NXZD 3PXHA 5E8EA 4XBEL 2FEDD 1IC4L 2HJKB 2CKBH 2ITCB 2F54E 4RMQA 5EBWB 4ONGL 3ULVH 4LPTA 2NNAA 3C8KA 4NBXB 3NCCB 2ZSWA 1XIWC 4UZGA 5FYJE 3GSVB 2H2SC 4MAYD 2VUOA 1DN0A 4U1KB 1P84J 3LKOA 2V2WA 2X05A 1XIWD 4G9FA 5I9QB 1RHHB 4HT1H 5D2NE 3IKKA 5CEZD 5JW4M 1IAIL 4NP4H 2PUQT 2AQ1A 1R5VA 1XF3A 4POZC 1T7WA 3HG1B 4P5TB 1FCGA 5HI5D 4J3WA 4YAQB 4IJ3B 3BAEH 2ZNWA 3AS3A 2NY6B 3BD3A 5F6HI 5K9QI 2D7QA 3HE7A 3IXAA 4MNQD 1AGFA 1AR1D 5IROC 4P4KA 3H9SE 4KTDH 3KJ6L 1ZA3A 4YDIH 5ICXB 3QAZB 4PJCA 1RU9L 2VNCA 5HDOA 1AY1H 1QSVA 2GK2A 5FM5M 5D7IA 4AG4H 1UYWH 1YZZA 4J4PD 4CMHC 4OGZA 4KVCL 5C0DB 2Y6SD 3U6RA 1CXHA 2GKIA 4DCQB 3LSOB 1PGRB 4IM8A 5ESAB 5IMLB 1U8MA 2IH3A 1FG9C 4F80A 1CBVH 4H20L 5MEOB 4NPYA 3NOIA 1JGDA 1H15B 4GBXA 1T83C 1MCPH 2W9DL 3KDMB 2F54A 5K9KB 4NKIH 2Q87A 4ZXBC 4BFGA 3VXQB 1CD1A 4KK5C 3L1OL 4R7NB 4P3CL 1I9RH 2ATPB 3BQUA 4KKLD 3O6LH 1KCRL 3D2UA 1DUYB 1QVOB 3G6DH 3MLSH 4IOSD 1JV5B 2P48B 3PWVA 4FZ8L 5I1JH 3S5LG 1YQVH 4ONFL 1HYSC 4U4BA 5FYKH 3IS1X 4P2QB 5LXGH 3FRPA 5LGHH 2IPUG 2QTEA 3C6LB 5IB3A 3QDAA 4HIJA 2NY7L 1A4JA 2YK1H 5F44A 3DBXB 4NM4L 4FZ8H 5I1JL 4TVPH 2K1MA 4CMMA 4NKMA 3GB7A 4XNXH 1AQKH 2B1AH 4OD1H 1NDGA 4P9MH 3QQ9D 2ADJB 5EFIA 2NW3B 3WIHA 3MCG1 5JXEC 2ADFH 3E6FB 4RDQG 2XZCL 3D3VE 4D8PB 5ADPL 3SGDH 4HS3A 3U9UB 4XP1H 1J8HB 5D7IE 2VLRA 4Z7QE 1DFBH 1DSFL 5K9QG 1IC7L 2R1WB 1MRCL 1VSCA 1TVBA 2IADA 4Y19E 2V2XB 4YO0B 2APWA 4N9GB 3G9AB 3A67H 3U9PL 5DD3L 3HZKB 1QBMH 4RIRB 3ZE0F 1MH5A 2F74A 5BS0A 1A1OA 3PV6A 3WHXA 2UZIH 1HHJA 1S9XA 2J8OA 1L4IA 4OCXH 3H3PL 4YGVA 2EE6A 5ISZA 3D9AL 3GSRB 3MO1B 5D96B 5LGHL 3N50A 1NGPL 5C08D 1MCRA 4JZOB 1RZIB 3HG1A 3K7UA 4U6TA 2O5XL 1N0LA 1JHTB 1ZHNA 3QJHB 1RZ8B 4YXKH 2EDWA 5EU6D 3ROLB 1OARH 1CDUA 5GRUH 2V5MA 4MGXA 3ARFC 3OKYA 5FYLL 2CDGB 5C07E 2EEBA 5ERWB 2QQLH 1YMME 3PP4L 2DQHH 1MLCA 1U8NB 2VSDA 2LQRA 5KSUA 3GSOA 4YXLH 4UI2A 3QJFA 4X7DC 4BQ6A 2E9IA 4F58H 35C8H 3VFOA 1BLNB 1RUPL 2C1OB 3OKLA 1N4XH 1G7MB 5IHZB 2CGRL 4UV7H 5ILTL 5AG8A 3P30H 3FO9B 3I84A 4XXCC 3V8OA 5IB2B 3BGAA 1P7KA 4NFCA 4LCWA 2IFGA 2EDQA 1NFIA 4ONGH 1S7SB 5BOPA 1CICC 3ULVL 2XWBA 1V3JA 4WV1A 2LVCA 2V5TA 3TBVB 4C56B 4P9HC 5DJ8A 2EO9A 4PJIB 4WTZG 4ZSOA 3MRMB 3CX5K 3FRUA 3D2UD 3ULVF 4NZUL 3R1GL 3N1FC 3D2UB 2XTJD 4OCMC 4IRSB 2HP4A 1FNEA 3O3AB 3RWJB 3DHMA 1TJGL 4OKVA 3VGEA 4Z7WE 3W11C 3PV6B 4KY1L 2P1YA 5ITFA 4UAOB 3RTQD 4XXDB 5D6DC 3D85A 5FGSA 2O61B 5TH2B 3QFJE 1ZT1B 1K85A 3GMMA 4R96A 1KTKE 1J1OL 1J87A 3VD4A 5TDOB 3AAZA 4F2MB 1FRGH 5HGDB 5SWSB 4U3HA 5CIPA 4ZXBA 3MR9B 4NQCA 5E70A 3TZVB 4QO1A 5ID0A 4M3JA 3R0NA 4X6FB 5L88L 4I3RL 4P2YA 1T03L 1WFTA 5H2BB 4GBXD 4UTAL 1F6FB 3EYQC 4DW2H 2BSRA 1OP9A 2HFGH 4JRYA 5JO5B 2WBJD 2NTSP 4JPWL 3CUPA 3U4AA 3QT2A 4OFIA 3OTTA 3BD5A 4X6DA 1A6TB 1I8IB 5JW5B 5E8NB 3DX6A 3MREA 1YUHB 1I9JL 1BX2B 1ONQB 2Q7YA 3RWGB 1ZTXH 1OAYH 4JG0H 2Y5TB 2NY5C 1M7DA 4WDIA 3GSQA 4PG2A 4NN5C 3G6JF 5FKAB 4HQQL 4HH9A 4XNUL 5HBBA 3AY4A 2VJXA 2ZOKB 4XNZB 4FQHA 4EI5C 1TLKA 4N90E 5IB1B 1I1FA 3TBSA 4WWKA 5IMMA 3KLDA 4ZOBA 4MA3B 4JFDD 3NA9L 2ZG2A 4LVHB 2HFGL 3O8XB 3TEUA 1IGFH 4Y19D 2EDOA 1NEZB 2XG5A 2Y5TA 3F7PC 4S0TD 3SGKC 4WWKC 1JF1A 4X7CC 1T6VN 4QXTA 4TULL 3PQYB 4YZFF 2OCFD 5SWZB 4LHJB 2ZUQB 2XWJB 4QHNA 4WHYG 4Z5RA 3TIEB 4G6KH 4JN2B 1KENL 2VH5L 3MLYL 3TA3B 2P5EA 5C71A 2COQA 4J3OC 3LDBB 5LGJA 1WVZA 3HFML 2YEZA 3OJ2C 2WUBH 3KPLB 4ELMF 1YEIH 3QIBD 2GW5A 5INCB 1X7QB 4U7KA 4U1IB 3LOWA 4OUUA 5JUEH 4HJGB 5GS0D 2ICCA 1JNHA 2HRPL 1QFWM 4Q74A 1S7TB 1Z6JT 5DUML 1YMMD 4FP8H 1ES0A 3O45B 1FGVL 3WFHA 1EAJA 5F9JA 5EO1B 1JTOA 4HG4J 3HAEH 3MCKB 2H26A 3QCVL 1PG7W 1FHGA 3G6DL 4PFEA 3WUWG 4F7PA 4I9WD 1UZ6F 4Z6AT 3JBG7 5C0AB 1N59B 1R3IH 4FTVE 4KUCF 4XRCB 4YHIB 1FVCA 2BOBA 4DTGL 3TV3H 1PJ9A 2VLLA 4GSDL 4HPYL 2FR4A 2X4SB 5A16B 2D7OA 3RVUD 2Z91A 5D2NC 1FO0A 4HUWB 2IG2L 1LO3H 1NBZB 3QRGL 1K8DA 4JDVA 4LCCB 4U6XA 1P7HL 4JFHE 1YN6A 1D6VH 5LGKA 3AS2A 1T0MA 3BWAB 5J13C 2FEEL 3KGRA 1AJ7L 5DJ0B 2P5WD 4HZLA 4P3WA 2VDRL 3MRLA 1HI6A 1S7QB 5BRZB 4NKDB 3I6KB 5GS1B 5J1TC 3EGSA 4OI7A 2I24N 1Z5LA 1Z2KA 1R3IL 3WS6C 1YQ2A 4AM0A 4P4KD 2MOVA 4Z7UE 2L7UA 4DOHB 3JVGA 1XGUB 2HVJB 4NC2B 3O3EB 3WUWA 5D7JD 1G6VK 3OPZL 3UPRA 3VFOB 4S1RH 2AK4A 2ZCLL 3KPOB 4OZFA 2XN9B 4UT7H 2HKHL 3LEXA 1KJ3L 3BW9A 3O4LE 1ED3B 1OCWH 2XZQL 1NUFA 5EA0L 2DTSA 1WIPA 3G6JE 3EIFA 4DZBA 5GSRB 2OI9B 3FB6A 2YZ1A 5MENA 2AS5M 4P46C 5BZDB 1N5AB 2IEPA 3NIDE 2FSEB 1CCZA 2WIMA 2DMBA 3G9VA 4PRAA 2FIKA 1P53A 1BOYA 4RMTA 5SWSD 3KPSA 4QTHB 5IB4B 2I5YL 2OYPA 4LKCA 1IC4H 5I1DA 1UH4A 5CP3A 2BVOB 4M6NH 5EO0B 4F7EB 2IADB 1R24A 3BYTA 2V9RA 1CT8A 4XVTL 1MH5B 1DBKH 5E99H 4L8CB 1JPFB 4PTTA 1SY6L 3VU2A 4YHLH 3RTQC 4PV9A 5D2NA 5IW1A 1NEUA 1RK0B 1U3HA 3LN4A 4BYHA 4H8WC 4NP4L 2HFTA 2YPKB 1FYTE 2WUBL 4PRAB 1OPGL 1L0XA 4KI5F 3VD7A 4HK0A 3B3IA 3V5DA 5HI3C 3X17A 4ISVB 4F7CA 4U1SB 4RFNB 3QQ3A 4ZSOB 4DGVL 3OKDB 2NY1B 3VMNA 1RMFL 4P48A 2VN4A 1T1XA 4NBYB 2ZPKL 2ZOLA 4APQB 4PJ5A 1KULA 2QSTA 2AABL 1J0JA 4ETYA 5IBUB 4S1SH 1ORSB 5C0CD 3V6ZA 2FX7L 2FH6A 5I1LA 5I15L 4IRJB 4DKEH 2Z31C 2AVGA 2XN9A 3DX9A 1K9TA 3DVFA 4LLQB 4WUUB 5EB9A 3QHFL 3GJFK 2CLRA 4MJ5A 1WAAF 2B1HH 2NW2B 3HNVH 2MFNA 3H0TA 3QIBA 4J3VA 1SYVB 3HAEG 3CFDA 3SQOH 4Z7UB 1FIGL 5FKAA 3REWB 4G9DA 1AHWC 4M7ZB 1MWAB 5EU3B 4JPKL 1L7TL 4Q9BA 5CCKL 3MODL 5EU6A 1M6OA 5IMMB 4PS4H 3WXWH 1T22B 1RZKH 4GBXC 4NRZB 4KKBD 1IQWL 5C9JB 3OAUH 3QCUH 4ERSH 2CRIA 3HLAA 3OKNB 2VXTL 3QSKB 1NAKH 1MEXH 4YR6A 2A6IA 4BH7B 4L4TE 3ZL4L 1SY6A 3WLBB 2HN7B 1IAIH 2PF6A 1TZIB 4OGAC 1ZS8B 1TVHB 5HVWA 3HNSH 4JFPA 5D1QD 3U2SB 4Y2DA 1HINH 5L2KA 1KTLB 3DX7A 4FZEH 3F7YB 3SCMC 5I74C 4NQEA 4WW2F 5SWSA 3BRFA 3FQUB 3KVQA 5DI8A 1T22A 4XPBL 3AAZB 2NY4B 1GHFL 4JFFD 1PEWA 4UMGA 3U48A 5I8KH 4CADB 3VFSA 1RIUL 4OZGB 4KK9C 1CLOH 2APVA 2VOTA 3MJ9A 4XC1H 2A9ML 3WFHB 2CRMA 2RFXA 4HIIB 1B4JL 3BD4A 4G7VL 1WIUA 4KK9D 5FGRA 3LEVH 4X8JA 5T5NF 2NY0B 1ZVYA 1DEEA 5B38B 3WCYA 2ITDB 3PP4H 4PJEF 4LLQA 4P59L 5HGBA 1QPXA 2X42A 1NSNL 4HGMA 1EMTL 1IAOA 2NY5L 4QHNB 1QRNE 3C5SB 1BX2A 3PGFL 1CFSB 2P42B 1JNLH 2J8UB 1JN6B 2QSCL 5BO1L 1CXLA 3EJYC 3CFBB 2GK0B 5KAQF 1MCBA 4PP1C 3QIUD 3VXSE 5DMIL 1MREH 4PPTA 4LK4A 5IVZB 5C07A 2ZP0T 4DAGL 3OKDA 2PKDA 5I1KH 4WWKB 3MV9A 1BMGA 3TLRA 3RU8H 4IOIA 3OAZK 3BESR 3DHJA 4LSPL 4YQXL 4YXLL 3UAJD 4AEEA 4Y4HC 4TPRL 1A6VL 3C8DA 2UVFA 2EEAA 5CSZB 2IQ9L 1FO0L 4G9DB 2LV4A 1A47A 1J7VR 1U6AL 5KSBB 4XI5C 5J06A 1U8PA 4JQIL 4L4VA 1NCDL 1FNHA 3P30L 1WTGT 1UADC 5T3XL 4LCWE 2X4OB 1OY3B 5I75C 4Q97A 4Y4FB 3G04A 4ZO6A 1S5HA 1GPOL 4XVTH 1CFQB 5AAMA 3TO4D 4GS7B 5FEBA 5JNYA 2DN7A 3R1GH 1AD0A 3RNQA 1MJ8L 2GJ6A 5C0BD 3MYJA 1S7SA 1CFTB 3JVGC 4JO3H 4M5ZL 3WIFB 2FEEI 3EZJB 4BQ8A 4O9HL 5KG9B 5FCUH 3ARFA 2E7CA 1EIBA 4LDLB 3PDOA 3QFJA 1EJOL 1SEQL 3X14B 3SKJL 3PL6A 1N59A 2V7NA 3U30B 3BP7A 3ARBC 5IF0B 3M1BB 3KYMB 1CFSA 2DQDL 4D9LL 1HQ4A 4F8TA 2YUWA 4Y4KD 1MLBB 5FO9B 3DXAB 2NYYC 1FORH 3Q0HA 4R26H 4L8CA 2YD8A 5KSUB 2R1WA 2R1YB 5CINL 3L7FA 1PQZB 2Q8AL 4LLMA 5D6CA 1KPRB 1NUNB 3WJLA 3MYJB 1DBAH 4C58B 3SDAC 4PJHB 5F7MC 1EX0A 1RZ7H 1UWGH 2H3NA 2OK0H 3M8OH 1X5IA 1XF1A 3FN0H 1KN2H 2UWEF 2FSEA 3P0VH 1JTTA 2DLFL 4ZFZB 4PJDF 1P7KB 3GBLA 3FHAA 5GS1A 3DIFB 1KN2L 1H3XA 3MRLB 5T1LD 3TBVA 5DFVC 5F1NB 1FNSL 1WAAE 2XQYK 1X5ZA 3T3PF 3ZYZA 1F2XK 5C6TL 1JN6A 4PJ8B 4S1DC 1EXUA 4JCLA 2WZPD 3VFNB 3VCLB 1CD8A 4MD0B 4MQTB 4MDJA 4OF5A 4NQED 5D7KE 1WFNA 3O3EA 3CFCL 4DKDC 2OTUA 3SGEH 4Y2DC 3L95B 5JPMB 1BWWA 4GAJL 3SPVB 1G6RA 1BQLH 1BBDH 4R3SB 4IS6A 3OB8A 2AJ3B 3C5ZA 4S2SB 1A22B 5DJYA 2EDTA 3P4LA 1MCEA 3EOAA 3O2DL 5HVHC 1CGXA 4OD2A 2GUOB 3VCLA 5IB3B 5K9JH 1G9NC 3E6HA 5DZLA 2P49B 2VXVH 4Y5YB 1H8SA 4M61A 4RDQF 1EEQA 4Q58C 2MWCA 2E9WA 2CD0A 3CUPB 4H5SB 3QDME 4K94C 4JFPB 3U2SA 2OR9L 43CAA 5T3XD 3N0PB 4PV8B 4NDMB 4G6AC 5DQDH 3A6BL 4HIEB 1T0NA 5GRJL 4D8PA 5IESL 4QRPB 3IETB 5F6IB 4FTVB 4KTEH 1DFBL 1DSFH 1A02N 5JDJA 4HLZH 3EOAB 5E7BA 1NCWH 3ULUF 4XAWL 5E95B 4TRPH 4FXGA 5T33L 1A7QL 3UROR 4J2XA 4MJIA 2AV1A 2VQTA 3V6OC 4FQLL 3CIQA 2UY6A 3PGCB 1ORQB 4GXUN 4HKBA 3F62A 3GIVB 1YNKH 4U1HB 3QH3A 2GTZA 5HYQB 4Z8FH 43CAB 1LO2L 5DMIH 4OQTA 3K2MC 1MPAH 5SV4A 1T0NB 4BSWB 4IRJA 4TSAH 2D0GA 4WU5B 3HN3A 4KKAD 1KN4L 3ULUH 1N7ML 4K8RD 5IHUH 5C6WH 4QLRA 4XHQA 3MREB 2PN5A 2FWOB 1N6VA 3V6FB 4PY8J 1A4KB 1HYRC 4MVBD 4W6XB 3W5MA 4JQIH 2E27H 3NCYS 4WCYL 3KPRB 2Z31A 1CXKA 3VH8B 2E6JA 1KFAH 3DROB 4PGEA 1PDKA 3C08L 5ICYB 4G9FE 4NGHH 4PJDE 1Q38A 1NUDA 4D0CA 4ZTPL 1EEYB 3CMGA 4FXKA 4YE4L 4PJ5D 1PW3A 4XP5L 3HS0B 3MLUH 2HMIC 4I3SL 4M7JH 4PRHA 5F1SA 3QUZA 2YC1A 4FQPA 4L8DA 5D71L 2BVUA 4Z7WF 3TP4A 5FYJU 1UXSA 2CDGA 2DM2A 1U95A 4MA7L 4Q6IA 4AM0B 3OKKB 5FCUL 2E27L 1UACH 2ESVD 4O2FB 4WGWB 5GJTH 2EH7L 2J7LA 4P5MB 2W60A 1U42A 3DJ9A 1BVLA 1KCVH 4ZUWA 3QA3B 3OKOA 5ACZB 1E27A 4YJZL 4TTGA 1GL4B 5IIEB 1IL1A 3B6SA 5GHWL 3AREC 2IBGA 2PR4H 3S37L 2N1KA 2H2PC 3D69A 1MQKL 4XP4L 3QXWA 5DD1L 3GMMB 4JFQB 4B7IA 4F3FA 2VUYA 1B4RA 4GKSB 1PX4A 1F3JA 2OSLA 1R5WA 5IJKA 2CKBA 3TNNA 4PLKC 3B8YA 4RFEB 5J6HB 4XWOD 5FUZH 3HNVL 5DTFA 4Y16B 1IQDA 1F3RB 1K4CA 4IRSA 4KV5F 4Y4HB 4PJBE 4TOYH 1XGRA 1TJHL 2IFFL 1CG9B 2OQJB 1BZQK 4ZTOH 3L3DB 2YZ8A 3RWEA 1JMXA 1G1YA 1J05B 1SJVA 4YDLB 4B41A 5EORH 2HJFA 1DQLL 2X4TB 5HI4C 3ARTA 1F4YL 3SDCA 3HZMA 3GMLA 4IIQA 4X4MA 3MA9L 5GXBB 3KXFB 1QSED 4GW4A 5IT2H 5FA3B 1TQCB 3GGWA 4UILH 4QHMB 3VXNA 5T3XE 1FGNL 4R7NA 4Z95L 4CN1A 2V2XA 4UOW1 2FX8H 4JKPL 4KROB 4N8VA 3OKKA 4YXHL 4XCFL 1U8PB 3HNTH 5CJ5A 5CP3H 4NZDA 1CDJA 4RBPK 3MCLH 1OTUC 4KY1H 1KN4H 3ULUL 3TVMC 4JO4L 4NC0B 4Y19A 4TUKH 1MI5D 3BO8B 3CVHH 1RHFA 3WNPA 3VD3A 5B39G 2OL3L 1FL5B 2IAND 5I6XC 4EI6B 3GK8L 1A6WH 3B6SB 2NY3B 3UCRA 1NFDF 4PRHD 4NQSB 1SYVA 4MYWB 1H8NA 1RJZB 2JK5B 3OG4B 1I3RA 4RMUA 5E9DD 3NA4A 1EZVX 1EJOH 1F4WH 3P9WB 2VDOL 4YH6A 3UTSD 1OHQA 5EIIA 4QGYA 1KTRL 5HY9A 3ALPA 3TO4B 3ECBB 1JGVH 5HHXH 4JE4B 4Q6IB 1SJHA 1PYWA 3WDJA 3BQUB 4FG6D 5K9OA 3MRNB 1YMMA 4HBCH 2VC2L 3UO1H 5EUKB 3ULUE 1I8MB 3HZKA 5F96H 3MLRH 5EZIL 1DBAL 3RAJL 3GMRB 4GXVL 5DS8A 3O41B 3W2DL 4YGAB 3BMVA 4XPGL 5C3LD 5DEGA 2X1QA 5FCSH 4HEPG 2VXSH 4PTUB 2Z92A 3QULB 1A3RL 4JKKA 1JHKH 2X2YA 3ARDA 3T77A 2W91A 1C5BL 4S2SA 2PCPA 1A6UL 1Q0YL 1Z9OA 5C2BH 2VDOH 1J9CT 3VFSB 5BS0E 1UKQA 3ARFD 4FMKA 4GFTB 3GSNH 3QIWC 5F89A 1NGQH 2FGWH 4BUGA 4WEMB 1ZVSB 1Q0YH 3BKCL 3MV01 4HH9B 5D7JC 4HXBL 4LPVA 4LSUL 4U1IA 4XZUB 2VZ3A 3HG1E 3V4UH 5TGBB 5IVXF 3OKEA 5D8JH 4ZS7L 2O61A 1B6UA 1T83A 3BO8A 1E6JH 3ARGB 4KDTA 3RAJH 5C0GA 1PBYA 1TJIH 5GIRB 3DURA 3HZMB 3BIBX 3Q6FB 4PJFA 1VACB 3CC5B 4OLXL 3MACL 4BSJA 1UCBH 1ZLSL 2YR3A 3LS4L 3GGWB 4RZCA 5F9OL 3C60C 4WO4A 5TE7L 1GJIA 1JPSL 3ETBF 4TN9A 5JHDA 3V4VH 3OHXB 2JLLA 4CJ0A 1MRDL 2AK4B 3QWRA 5GJSH 3MQIA 3FB7A 4X0KB 3JTTB 2CJUH 3T1FB 3U0TB 4IIQC 2O5XH 2X4RB 4PGBA 1I8LC 5JZ7C 4NUGH 2Y4SA 1UQSA 4MWFB 4EQ3A 5IQ7L 3UC0L 4MAUL 1WC7A 1G7MA 1RIVL 2NXYD 5DA4A 5IBUG 1JIBA 2HMID 4HIXL 2YD6A 4PJGA 5JIKA 4TNWF 5E4EB 2X4PA 1QR4A 1A7NL 4P4KB 1NLBL 4UIMB 3VWJD 4JM2F 3BZ4A 2KQMA 3O6FC 5D70H 4N0UA 3BHBB 1R3KA 4XNMA 4D0BA 1A7OH 3WO4B 4TRPL 3VWJB 3P4MB 4D9QD 4P57A 3TC9A 4PJIA 2DS4A 4O2EB 3OKOB 1PZUB 2A77H 2FD6H 3K74B 2AXFB 2VERN 2X40A 4XMPH 4QRRE 4BELD 1PG7L 3MLZL 5DDHB 3LRSA 1RHHA 2NY3D 1QACA 3E3QE 1L6ZA 5C0FB 2DJSA 1IEAB 3BUYA 2VLJD 3K4DA 4BKLA 2FATL 3PXJA 4F3FB 2F54D 4QRTA 3WFCH 3FTGB 3MJ6A 1KEML 2YXFA 3VRIB 3GRWH 4J7RA 4M6OL 4RA3A 4X6CF 4BH8A 5IFJA 1NGYB 3O9WA 1VADB 4H0HB 4N90D 3ARGD 5CIPH 1WWAX 4ZUUA 2DLIA 1QP1A 4I0CC 4DKEL 4EI5D 5KJRL 4OZ4B 1HEZB 3MZGB 4CL7A 3LH2L 5KTEH 4GLRI 4LSRH 4EBQL 1RUPH 4Y5VC 4P5TD 4X4XB 2EDBA 3DVGA 3GSWA 3MROB 2V5YA 3QUZB 1EA9C 5A2IH 4PJ9C 3IFPA 2SEBB 3LRGA 1I9EA 1VKXB 4L9DA 4PJAB 4WO4D 1TFHA 1LP9F 1CDIA 1AFVH 3VXME 1UACL 5FYKD 1NJ9B 2AEPH 3W9EB 2XRAH 1VFOA 3VXQA 4RGMC 5FGBA 5IESH 1L7IL 2EDLA 1UQSB 2QBWA 3AREB 1ZLWH 3UZQA 3SKMA 4JPIB 3MLVL 4O02L 5BS0D 3RA7H 5D1QA 1KXTB 1QHOA 4G42B 4HJGA 4H25A 5DJ0A 3UDWA 2R9HC 2V7HB 4HXAL 5DVLA 3SE4A 3TBWB 2H2PD 3HI5H 2YA2A 3HG1D 2A83A 4V2BA 4DWHA 1HSAB 2BNRE 3QDMA 3MBEA 1K2DB 1A0QH 3CSYA 2AEIT 4K7PY 4LMQI 2AKRA 2IC2A 4ZUVB 1U93A 3O4OC 4OCWL 3TN0B 5L2KB 1CN4A 3Q3GA 3RWFA 5I1EL 5E08H 1NC2B 2XTJE 4CRPA 3IU4L 3ME0A 1W72L 1XR9B 1XCQA 4KTEL 3NFSL 1ODAA 3KPLA 4CU7A 2XT1B 2EYTB 3I02A 2CRYA 3ZKND 2GIYA 1J1XL 2DMCA 5DT1H 4LQFH 4LCYB 2JCCF 2WP3O 2G2RA 4F33B 3LS5L 1TVBB 4ODSH 4LVEA 4OZGA 3TBWA 2WSKA 5GGTL 1QA9B 3BP6A 2V9TA 4FABH 1KJMB 4X8JB 1AE6H 1S78D 3MBEB 2VLJA 1TQCC 4IEFB 2GT9A 4X6DF 2KZ1B 3U82B 2PCPB 4J3XA 3E2HB 1WLHA 4I8DA 1WIOA 2B5IC 1M7IB 3O6LL 3R8QA 1W0WA 2ZCKL 2ZSWB 2PTTA 5L9DL 5LCVH 3F7QA 3D3VB 4DGYL 3GKWL 4Y2OA 3RZWA 5BVJA 1EFXB 2EDEA 2R29L 1U8OA 1KJ2H 4DKFH 1MVUA 3D5OF 4RGOL 1J5OH 4FFWD 5B4MD 3W39B 4C57C 4E41E 2GY5A 4JCMA 2A6DA 1NEZG 4AL8H 1A6TA 1I8IA 2QEJA 4OKVB 3PE9A 3U4EB 2X1PA 2CR6A 4XWGL 4M3KB 4DN3L 5CWSB 4G42A 3MLXH 1JCKA 3MSPA 1GC1H 1HHHB 3IGAB 5DRNA 1WV7T 4AT6A 1DQTA 6FABH 1H3TA 5KANG 2HH0H 3RKDC 2HRLA 1XEDA 1A7NH 2YUZA 4P9ML 1IILE 5E2UH 4YWGH 1MVFA 2XA3A 4PGBB 3CLFH 3V4PL 3C6LC 1OAKH 1WBXA 3OAYK 2DQJH 1HN1A 3ARXA 3PHQB 1MPAL 1E4KC 1L9NA 4JRXA 4L1DA 2R2CA 3W5NA 5IJVB 2AJSL 5EUKA 5LXGL 3MRJA 5FOBA 2CLRB 2YUVA 2NXYC 1FYTB 3GO1L 5HHOA 3L5XL 5HD8D 1DQJB 1EZVY 5T1DL 3VG0L 4LVOB 3BH8B 4H8WH 1FYTD 3F8UB 1AKJD 1D5BA 1DL7L 4JJ5B 4L9LA 4M8QB 4F15B 1LILA 5BJTB 4KK6C 5D7JB 5TFSH 4JFXA 5J3HD 4GRLD 3TZVA 3C2SA 4LLDB 4X6EA 5FK9A 4ZUWB 1YECH 2UWEE 4J3TA 4PJBB 3Q3GB 3GMNA 2R0WL 5AZEH 3RWFB 3W0WA 2R2HB 2A6KA 1MCDA 4KVNH 4RNRB 5IHBA 1JTPA 4ZFGL 2UYLB 3RPIA 2BMKA 2J6EH 4FFYL 5BMFH 4HHAA 4E42A 4YIQA 4RRPG 3T3PE 3TT1L 4KZDH 5ID1B 1H3GA 3HNTL 4LSVH 3FMGL 1KIRA 3MFGB 4P49A 2FD6L 5D5MF 4GKSA 3MCLL 3ARFB 1X4YA 3T1WA 1HZHH 1CGWA 2OSLB 4ZOAA 5DJ6A 3X14A 1BF2A 1P4LA 2WWKT 4JHWH 5FKPA 4JO1H 2WBWB 3QDJD 2KUTA 3AS1A 1K5NB 5KSBA 1F4YH 2I60H 5GGVH 4UUJA 5HGAB 2RHEA 5SWSE 5KN5B 1I1AA 5E6IB 3Q48A 1DQDH 4ISVA 4C55A 1PY4A 3FB7B 3T1FA 3S98A 1FJ1B 3BRDA 3D0LB 5EIQA 1CXIA 3WS6A 2ZG3A 1Y0LA 4JO3L 1BFVL 1MJJA 4MAUH 4LSSL 2PW1A 3S6CA 2I9TA 1YYML 3NFNA 1OT2A 3HCVA 4CVUA 4J3SA 4EUPB 1AGCB 1HHIB 1QQDA 1KCSL 4HD9A 2NMSA 4GLRH 4WW1B 5L88H 4OKDA 1IGTB 4I0PB 1FFNA 3GIZL 4QTIL 2LAAA 2J8UA 4JFQA 3A0OA 2ARWA 2YSSA 1CDBA 4QCIA 3KLHD 1CFBA 2AJYH 2Y23A 4L8DB 5HHMD 1Q1JH 3PABB 3ZDXE 2BSSA 3NIFF 1JPGA 4HWBH 5D2LB 2W07A 3O6FA 1NMCB 3LD8C 3P9LA 3VFMA 4AENA 3WFEL 3IF1B 3UBXG 5HDLA 4YHNB 3S88L 4XAKE 5ITBH 2PTUA 2BDNH 4DGIL 4XGZA 3SJVD 3EYQD 4KUZH 1LO5B 1WEJL 1U8KB 4FABL 1CQKA 4C56D 4NRXB 4TOYL 4GG6E 4PV8A 3WNKA 3HUJA 1FYTA 1FORL 1MIEL 3FL7A 5HVFB 4ETQA 3RIFF 5JXEA 2HN7A 1FC2D 2VXQH 2FX9H 4K71C 2ICWB 3Q5YA 1S7XA 1ZTXL 4HV8B 1OD9A 4MB5A 1JWUB 4FQ2H 5F3HB 4YEEA 3ABZA 3VDAA 2C3XA 4GUPA 1PYWB 1KPUA 1HHGB 5C8JA 1F3DJ 3CDGA 4JZJC 4LBEB 4F9PC 4GJTB 2HT3C 1J5OL 3NZHL 4DW2L 2QHLA 4X5WB 2PXYB 1U0QA 4U6VL 1CQYA 1A6AA 2FL5A 1YPZE 3PWPA 4R4NC 2CJUL 4OF8A 3L95A 5JPMA 1FAIH 2ESVE 1P2CA 4WU7A 1JI1A 3MNVB 4PJ7B 3DI3B 2VIRB 2QV2A 4EI5B 3CSBA 1X5YA 4CN4A 4JG0L 3DRQB 5C0CE 3MRFA 3D25B 4BJLA 4BSVA 4E41D 4YHPB 2X9XA 4R2GC 1CDCA 1HKLH 2QQNL 5C0IB 5EUOA 4OCNC 4BK5A 3WIIH 1I1YA 1T3FA 3HMWH 3O2VL 3U36B 2DI9A 4L4TA 2ZUQC 4K3GA 2VLJB 1WBZB 3OX8B 5F21B 2P46B 1CU4H 1D6EB 1C1EH 2VIRA 3H9YA 1ZGLM 4UQ3B 3D85D 4P23B 3B3IB 5D1XC 3IETA 3TJHD 2GCYB 1C5DB 3NABL 2X89D 3SGJC 1DUZB 3D18B 1HQ4B 1AXTH 2EIDA 4PJ5B 3SQOL 3MBEC 2YA1A 2A9MH 1BOGA 3WLBA 4HKJA 3HB3D 3IB4A 2WK2A 5ALCH 1IM3A 1PLGH 1YQVL 3O6KH 1IEHA 1R5VB 5L6YH 1TNNA 4HWBL 1ZANH 2CK2A 3P9MB 1RURH 4JY5H 2H45A 4S1QL 3F58H 4HAGA 2HYMA 2EH8H 2FNBA 2WWMD 3IDJB 4P46D 3UTPE 4BFIA 4QOKB 5F7EH 3A67L 1MCQA 1R3JB 1INDL 1J12A 1HDMB 3IJSA 3M17A 3RDTC 1D5XB 1T20B 3HUJB 2AJZB 5J1AA 3QDMD 1WCQA 1F90L 2R4SL 1BVLB 5H37G 5IOPA 5IF0A 3LIZL 3VFGL 2CO7B 5TF1L 1G7HA 3QUYD 4OFVA 5EA0H 4D0DB 3T4YB 3QIUC 4BQBA 4JGUA 3RX8A 1QO3B 3VXPB 2F8XC 5A2LH 3HHRB 2DLEA 4L8SA 4YHZL 3CX5J 4U1MB 3MRQB 3NPSC 5E9DE 1JZ3A 5GS1C 1OAQH 5ALBH 4GW4B 4G8FA 5EU5B 1LMKA 3S7GA 2DWDB 4ZS6D 5A3ID 3HS0A 3MJGX 4KPHL 4N5UA 3TFKD 1KC5L 5FO7A 3I50L 1ZE3C 1IFHH 3L5IA 1I1AB 2CRZA 3RWDB 4LEXH 4KK6D 4QOKE 2MQ0A 1KB9J 3TJHC 1NFDE 4BH8B 3EOYG 3M8OL 1OGTA 3FQRA 4O2EA 4M7JL 4N9OB 4Y5XC 2FYYB 1VGEL 1IKNC 2VDLH 3B9KC 1QBLL 4U1GB 5E03A 4OCXL 4S1DD 3ZT7A 1YEDB 1ZHBA 2DQCL 4HWUA 2XG4A 2A74A 4ZO8A 1QBLH 32C2A 5EZOH 1TETL 3EGSB 1H3WM 1I7TB 5FO7B 1DQDL 3B9KA 2OX5A 3MRIA 4NQCE 3X12A 4MNHB 4W4OC 3L3JB 2BY0A 3AB0C 1CLZH 3QG6A 4UINL 5C0AA 5ERWA 3IDGB 5DSCA 4FXGB 4UB0L 2G60H 1QKZH 3MLTA 5IM7A 2P47B 2C3VB 3MX0A 2Z91B 5E2VL 1BOGB 1NCNA 4QXGH 1UWGL 2DQFB 1AJ7H 1NBZA 3FB6B 3G5XB 3BDBA 3FT2B 4PP2A 1C8PA 2CLZA 2I27N 2ITDA 2UUDK 4WHCA 1RZFH 4YBLB 4Z0XA 1KJVA 4IBLT 1UVQB 3CPLA 3ZKSD 5KZCB 5DSCB 4NT6A 1F97A 4LOUC 1N5YL 3N1PC 3OMZA 1XF5B 1IAOB 5CJQH 3T65A 3UTZB 4QRTB 3AM8A 4XZUA 3FO1A 3IVKA 3U7YH 5GRJH 1AXSA 1IZKA 1WT5A 2HT4D 2XZQH 3TH2T 4WHTA 3ZYJA 3MV9B 2HT4C 3VFRA 1BVKB 5TDNB 5KS9B 4U2YA 4LPYA 3PHOA 5EC2A 4DCQA 3B2UC 3RL2B 3VA6A 3CVIH 4AIZA 4PTUA 3P0GB 5CD5D 3O3BB 4MB4A 4UTAH 5K33A 1PVHA 5JHDD 3TPKA 3I6LE 1A7BA 5EBLA 1UYWL 5ICXA 4JDZB 1NMCC 2X70A 4ODTL 2DYPB 5ELIA 1BEYL 5A2JH 1JF6A 2BSRB 2R0KH 2P7TA 3T2QA 4MXVF 2RJMA 1I1AD 1QSZA 1K3ZA 5IFAH 3KNBB 4Z9KB 4KI5D 1T5XA 3V0WH 5KVGL 3IF1A 3EYOB 3O3UN 1FH5H 1R3HB 3RY4A 43C9B 5B3NA 5HHOE 5LCVL 1HNGA 5C0RH 4ZAKC 3GSQB 5IMKB 2NZ9D 2YEZB 3WIHL 2GSIB 2W65A 2DQGH 5IWLA 3LKQB 1FGNH 4Z95H 2V7NB 3E8UH 1BIIA 7FABH 4HQQH 4O58H 3GJFA 5DK3A 3SE8H 1NGZA 4M5YH 3FO1B 3RU8L 1EEUA 3U46B 3GJFH 4Y1AA 2NY0C 2HTKC 2W0PA 1A1NB 2V5RA 5HHPB 1JZ8A 2DM7A 2QADD 2JB5L 2R0LL 4LARL 5D93B 2L0DA 3KLAA 2XY2A 3UTSE 2YBRB 1AIFB 3QUXD 4EZMA 3BSZH 3SE9L 3LN5B 4RGNE 1EO7A 1KPRA 3WLWD 2LU4A 1RULH 4PJ9A 1RZKL 2W38A 5HHQB 2MSPA 3QO1B 5DQ9B 3GKZA 4C56A 4Z7UA 4V1DA 4YNYB 1V3LA 2BY2A 2HLFC 3QXDB 4GOSA 4OLYL 1FDLL 1FNAA 2G5BA 4WV1C 5LBSL 1BQHA 2CSPA 4PRIA 2P5WB 2NY2B 5J57B 3NH7L 5AUMB 5C7XH 1XGPB 5EN2B 3D39A 4HJJL 1MLCB 4CDHA 1L6XA 3ALWA 1I7RA 4NWUH 4P9HH 2GTWB 1RVFH 2ZOLB 3DVGB 3GSWB 3MROA 4K23H 4TNWK 5J89A 4FQIL 4YE4H 1SVCP 3HE7B 1N8ZB 5CFHA 5EUOB 5DEFA 4BZ2H 1JYWA 2EIZB 2FJFB 4KAQH 4PRHE 2HFEA 1X5HA 3DGGB 3FO9A 4TSCH 4K07A 1F4AA 2PYED 5C09B 1OPGH 2HVJA 4JG1H 3WUWB 4QGTA 5I73C 2QSVA 2WBJA 3GSVA 4KJYA 1NUGA 1ZMYA 1B6DA 2AJUH 4Z77A 4GS7C 1JZ5A 1RUKH 4FFYH 2D9QB 3M45A 3U83A 1RZ7L 4OV5A 2HT2D 5FV1L 1V05A 2BJMH 1IKNA 4TSBH 1JZ4A 5ILTH 1HWHB 2BNQB 4M48L 3U0WL 4RAHA 4N0CC 1QBML 3DV4A 4I5BA 2VE6B 2EC9U 3VGDA 2EC9T 3STZA 1J0KA 5JW3H 5JQHC 4WW1A 3CCHA 4MA1B 2H6PB 1HNFA 2Q6WB 2VISB 2WBJB 4KJYB 1CI5A 1HXYA 3ZE1E 2ADIA 5F3BB 1MI5B 1J0YA 1L0YA 2W60B 1TCMA 5FYJL 2M8XA 1SJEA 4OCSH 3FQNB 4NUJB 1UENA 5E6YA 2VL4A 4L3CA 5HTSA 4DUXA 2HLAA 3WDIA 3GMNB 4OQTL 1EDQA 4OD3H 2ZCLH 3MRPA 3MV7E 1Q94B 5GS0H 1LO5A 5T1MB 2N4IA 5IBLD 3BN9C 1C5CH 2VLRD 4JQVA 2ZNXA 4PG9A 1AD0B 5GS2D 3P4OA 2F58H 3TH3T 4OJFH 1FE8H 3MLWL 3GI9H 1MCJA 4DZ8B 5CSZA 3CFIC 1CK0H 2I07A 4HZLB 2RR3A 4R4FL 3BPCB 4PJ8C 2IMNA 2DLFH 2P5WA 2EE3A 1H0DA 5HI3D 4XCEB 3RNKB 1YNLH 4DFHA 4PJ8D 3VXRA 3QHZL 5HYEA 2Q8BL 5EOTB 4K3JH 4A6YA 4ZSOE 3UMTA 5EOCJ 3DECA 5FUCC 5J9PB 5E8DH 1OTUD 1ADQA 3WYRA 2ZKHH 3MZTA 1Z9MA 3GJEB 3V6ZB 4R9HA 2HWZH 4EN3D 2ORBH 2AK1H 5KVMC 1RMFH 3BKCH 4PS4L 3Q1SH 1KPVA 3NZ8A 4TUJB 2DQDH 1VEPA 4DZBB 3OGCA 4KI1A 1BQSA 2F5BH 4WU7B 2DM4A 4YXHH 5DHVH 5J56B 4YHPA 1I85A 4FQCL 1T1XB 2OP4L 4QEGA 4RAVA 3PV7A 4LPWA 3W39A 5DJXA 1JBJA 3VRJA 4U6VH 4XCYB 4V2CB 3QNXA 3MLRL 3RBGA 4LLMB 5D6CB 2ERJB 3NPZB 4LCYA 1A64A 3P11H 1QR1A 4JRYE 3L5WB 1KBGH 3PWLB 4PJDB 1N6QL 1YNKL 4MCZA 1VEOA 1T6WA 2VDKL 4U1JB 5IMKA 1ZV5A 2Q86A 3DUSB 1MFEL 5F7NC 1I1RA 4X6BA 4WUUE 4JN2A 3QUMH 4WW2A 5BVPH 4X6EB 1YECL 1UFUA 4L8BB 3NVQA 2ICEB 4M43H 3TO4A 3FO2B 3D6GA 5D7JA 5CJQL 4Q9RL 4ZFOB 4EVNB 3UTZA 2RQ8A 2DYPA 2ICWI 3MMEA 3QUML 4XBPB 1I3VA 5BVPL 3ULVD 3THML 3EBAA 5LJYH 3N85L 4KDVA 4Z7WA 3DRTA 2DI8A 3VXMA 2BVYA 2AQ3A 3HNSL 2B0SL 3ZT5A 2FR4B 1LE9A 1B0RB 4KPHH 4ZFFA 5F8QC 4JFOA 4KKNA 3V5KA 3RX5A 4JFZL 4NZTH 3DO3A 2DTMH 1X5KA 4NM4H 1ZT4B 4PJ7E 3RJDA 5E56A 2K3TA 3PG2A 4LPXA 4E9LA 2CUMA 4GRWF 3O6ML 5F1IA 4AIOA 4F2MA 2Q20A 3MNZA 5TQ0H 5IBTH 4K7PX 4MJIB 4MVBC 5DQJB 4ELKB 1G9NL 1MELA 4QRSA 3GUTB 3VJ6B 2BRRH 4LIQE 2DMKA 4J12A 3VXSB 1FNFA 1MFAH 5A40E 1J8HE 1QSFA 1TETH 3BPCA 5DC9B 1CLCA 2IPTL 1GSMA 5F6HJ 3UYOD 1V5JA 3C6SB 4PRDB 3BZFB 3LS5H 3O3AA 3QCTH 1OM3H 4M9OA 4YAQA 5F88B 4YUEH 3BW9B 1U3HC 4PJGE 4TNVF 1Y18A 3NFNB 4XI5D 1DBBL 4OCYL 4QT5A 1Q9LA 3GJEA 4W4OA 1P4LB 2O5YH 2VLJE 3OWEA 5CJBA 1LD9A 5IB2A 1S3KL 1REIA 2IAMC 1NFIB 2F53E 1OGTB 4JFDA 4NJAH 5B8CC 2ZCKH 3HZYB 1JNLL 2AJ3A 1FG2A 4JRYD 1TNMA 1XZ0A 1LHZA 3TNMB 5L0QC 4F7MA 2NY4D 2XQYG 2AK1L 2DBLL 3ARPA 2E3VA 5HPMA 4J4PC 4ORZC 3HR5B 5D5MA 1CDGA 1R24B 3HC4H 2EKJA 2FBJH 3BDXA 3MLZH 3CMOH 3D3VD 1I7TA 5HYSA 1V3KA 1T66D 1U8HA 3LMJH 5H37H 2DKSA 4Z7UF 1C12B 3HE6A 5DMGD 2AGJL 1OWRM 1GAFH 5FDYA 3VFPA 5D9SB 5E5MB 3MGTB 1FFOB 5IW6B 1JMZA 5LGJB 3O9WC 3TT3H 1CE6A 1FDLH 4YPGB 4B0MM 1MJUL 3QI9B 4NN7C 4XCNB 4UV7L 5JIHA 3VXMD 3VI4E 3WHE1 2QQKL 2Y6SC 4I3SH 2DM3A 3MRJB 1DDHA 5CHNA 3L3KB 3NIDF 1PKQB 1WCBB 4LSRL 4RMVA 2O5ZH 4TVSa 1FJ1A 4I18A 2NCMA 1BJMA 5IKCA 5HXMA 2ADJA 3Q5OA 3KYOA 3TYGL 1QO3A 1SHMA 5L2KD 3QCUL 3NCMA 3H9HB 1H15A 4HAFA 3HR6A 3O4LA 2H1PH 1T1ZA 2Z0BA 3ESVF 3F7RA 3IGAA 3P0YH 3EYVA 3OBAA 4WNQB 5F1IB 3REWA 5D7SH 4XB7A 4M02A 4JLRA 1M71B 3KPPB 2FATH 2CIKA 3G5ZB 2ZUTA 3K4AA 1OTSC 3IFNL 1CFVL 4FQHB 5EOQL 1NDMB 1NKOA 5IBLC 1S9XB 2BK8A 2UWEA 4WI3A 4R97C 1LVEA 1S7VA 3L7EA 3C6LA 5ICYA 1U8OB 4JM2A 5DMYA 4X5LA 3BOVA 1OSZB 1U8JA 1S5IH 2GHWB 3O8XA 1R3LB 1MAJA 3EJJX 4NO0B 3MV8D 4KH2A 4M62L 3IDIA 3VFUB 4LGSB 1TTGA 4FXLA 3TCLA 2Q8BH 3OXRB 4K3EL 4KHXH 1F8TL 4NOBA 4F7PB 1DQMH 5J1SC 4MQSB 1OW0A 4QRRD 1FFQA 4WENB 2JIXD 3S96A 1D5BB 2WW8A 3D18A 5GGRA 3KJ4B 3EDEA 1FBIL 3EFFB 2MPAL 4J23A 1U8NA 5KANI 1M05A 2YPLA 4P3DA 3IDYB 1NAKL 3QNXB 4R0LB 5E24E 3LZFH 1HIMH 3FFDA 1LO0H 2XPGB 3S36X 4PJXB 2DDQL 4JFZH 2L4OA 5HHNB 5DDHA 3S35H 3KPSD 4NO5A 2XNAB 1WBZA 3FRPG 1R3JA 4XX1G 5C92A 1OP5K 1MHPL 5C7XL 1T2QH 2XN9E 4HUUB 3MGOA 3GHBL 4X99A 4JFXB 3QIWB 2LTQB 4XBPA 1F4XH 4XMKH 2W65B 5F9AC 2OR8A 3T2OA 4NYLB 4Y1AB 4AMKH 5CBAB 3X13B 2J88H 4ZOCA 1VFMA 5DYOA 4DUWA 4JVWA 1KLFA 5K59E 1FV1A 4B7LA 5E6IA 5C9KA 5I2IA 4NBZB 1OAXL 4JPIA 4XVUD 4YPJA 5GGUA 2PYFB 1WBYB 4Y4FD 5E1AB 3RFZC 5DR5L 5ABDE 2IPKB 4M7LT 1BVKA 4Z7QF 5TDNA 3MRHA 4PLOB 3T77B 2B2XH 4HKXB 3DO7B 5EU7E 4GAGH 3QAZC 1LO4L 4PJCB 3CU1A 1NCCL 5BZWA 1UEMA 1AO7B 1OL0A 2NNAB 3C8KB 3VD9A 4NYLA 3BDYH 3VXUE 1MWAH 4QXWA 5EWIL 5CUSH 3GMLB 4GMTH 4IIQB 3S96B 3WN5C 4ZNEE 4JDZA 4GKNB 3I2CL 1FV1B 5D7LE 5GGQL 3UJIL 1UM4L 3W9EA 5JW4R 2BVOA 1JYNA 2EICA 1SJHB 1MCWM 5JZ7D 4JRXE 3VGGA 2AJVL 3JSSA 4PJHF 1QSEA 1IGJB 2GFBB 2VLKE 4F57H 1TENA 3QG7L 3ZKXC 4TQEL 1SEBA 3GO1H 5DUPL 3BEVB 5ENWA 2NTFB 1KCRH 2VITB 5K9KA 5CILH 3QXTA 4N68A 3GSNL 2LABA 1KJ2L 4DKFL 3VWJC 3DI2B 2YD7A 1SYSB 4R4BB 3ZE2E 5BQ7A 3CDCA 1BQUA 2W9DH 2ZCHL 1A5FL 1G7IB 5E4IA 3BP7B 5J3HC 1O7SA 1IGYB 4O51B 5EWIH 1ZLWK 3S37H 5SWQA 1GOFA 2VAJA 4AENB 4GG6A 1AC6A 3HKFA 2EDHA 1XCQB 1BQHG 2J6EL 2NY0D 5TDPB 4MJID 4HWBA 4DKAA 4F33A 4P4RA 5ACZA 3BT2H 3GM0A 4NZTL 1FZMA 4MXWH 1KJVB 3RBSA 3T3MF 2OR7A 4XH2A 5DRWB 5IJKC 3QO0B 1CFQA 5E00B 1BJ8A 4KTYA 2CLZB 3WE6B 1ACYH 1N3NA 5JIIA 4D9LH 1KIPB 5F7UA 3V0AC 1DTUA 3CXHK 1MSPA 4UT9L 4K7FB 4IMLA 3EHBD 2VLRB 4DVRL 4PLJC 3X3FL 1ZSDB 2ORBL 5B8CA 2X5PA 3HI1B 1XF4B 1MHPH 2VLME 1G7PA 5DD1H 1H3VA 2FCBA 3VMPA 3IDNA 1VENA 2RB8A 5DD5H 4YC2C 4L29B 1QSFB 3C6SA 4PRDA 2VDMH 3VWKA 5HYJD 3VE0A 4IHOB 4D9RD 3GFUA 4XBGA 4FQXA 3BZEA 5FYLE 4XCFH 2D7TH 5E5UB 2F8VA 2GITB 1BFTA 5T1LB 1AO7A 3RUGA 3EYFB 1KF9B 3T0EE 4PRHB 2GJ6E 3L3GA 2CKBL 2R8SH 1B9ZA 4N0YH 1UWXH 3I85A 1FVEA 1MFCL 4QRUB 4RMRA 1LD9B 3I6LD 5H94B 5JTWA 3NN8B 4M9PA 1YEFL 5E94A 1MCOH 1E4WL 5HDQH 2VLLB 1EBPA 1OTSD 4HF5L 1XF2A 2OJEB 3KNBA 4KJPC 4G7VH 4CVZB 1C5CL 1I8LA 4EOWH 1IGJA 4POUB 1X5LA 1UWEH 2Q7NA 2VWEE 1ZHLB 4EIGB 1WFUA 2ED9A 1YN6B 4LQFL 5H35A 2DWDA 1YN7A 1OAZL 3UJTL 3WUZA 5FYLD 3HUJE 1R0AH 2GSIA 2NQCA 5E6ID 5EBLB 3HC3H 4PY7B 1FC1A 3FQTB 1X5AA 4E5XA 3BVNA 1OGAA 4J3UA 1DQJA 4RAUB 4UIMA 12E8L 4OM1L 1D5XA 3FJTA 1M05B 1MFCH 2BERA 3KJ6H 2BC4A 3QDJB 3N1QC 4ODHL 5IWLC 2ENSA 3NFPB 1RAMA 3GI8L 1ORQA 3QUXA 1FL3B 1IQWH 3MRNA 1AXSB 1N64H 2VXTH 3NZHH 1SY6H 2EIEA 4OF7A 1WZMA 2Z92B 3QULA 4ODHH 4GH7B 3C08H 4OTXH 3KLAB 3TYGH 5HHMB 3UP1A 3BPNC 3NGBB 4ODSL 1MCNA 3PJSB 4LFHG 4KDWA 3WJJC 3WXWL 5DJDB 1K4DB 3IJHB 2J5LB 1MFNA 1MNUH 4JFFE 5L7XH 4FQ2L 4HUXA 5FECB 2DOCA 4UINH 3GMQA 3GZKA 2A6JB 2Z35B 4MB3A 1U8QA 4R97B 1IAKB 5L7XL 1I9JH 3KPPA 5I1HH 3HI5L 4X9BA 2DQFA 5AYUH 1VA9A 2CLVA 4HKZB 3RVTC 1N6QH 5KSAA 1XGYH 1FH5L 5IVNA 3SJVA 1GC1C 3J8F7 1IT9H 4PB9H 5HD8C 1YPZB 5IROA 1OWWA 4QYOB 5IMOA 2AJVH 4ONHA 3DXAE 5A43C 3WFDH 1LE5B 3BPOB 3PIQA 2XI9A 5IEHB 3K80A 3LQZB 4PJIE 2ARJQ 4FNLL 3MRKA 2A6JA 2Z35A 4M5YL 3UTPD 5F7HA 3IXAB 4M6AA 3PL6B 2EXYC 5D7LD 2XZCH 3QRFM 3OXRA 4LRNL 2OMBA 4HV8A 1MY5A 4QHUA 2N7BA 4UT6L 5CCKH 1HYSD 4FNLH 3UDWC 2EXYD 1QLFA 3MBXL 3QQ4A 4OLXH 4Z7VA 3BIAX 4Z7WB 1OP3H 1MVUB 1II4E 2VZUA 4LVHC 2D2OA 5E94B 3G6JB 3KYAA 4XP5H 3DYMA 5I19H 3STBA 4EXPX 2CUHA 4X6DB 1IT9L 2W0KA 2X7LB 2Y7QB 3CVIL 3VXOB 4KK8D 2R2EA 3TA3C 3WNOA 3UC0H 1WF5A 3SHSA 5I76A 5F3BA 3MJ7A 3O8XD 5TQ2L 1IM9A 4MZ2A 2RCSL 4BFBD 2EDRA 3BH9A 5SWQB 3TNMA 2HLAB 2YD5A 2JIXA 4PGCA 3KPSB 4QTHA 1QBBA 2X4RA 1EHLH 1UB6B 3T0VA 4JY6B 3BQUD 1NBVH 3DPBA 3SJVE 5GHWH 3O6KL 4OFKA 5C0BE 2CMRH 4OGAD 5GISH 2AV7A 5HJ3A 4ELMB 4EN3C 1URLA 5D4QA 3MGTA 2A77L 4XMPL 5IW6A 3WN5B 3TWCL 3M17B 2DQJL 2R56H 2BFVL 2V17H 3BP5A 3BGMB 1JZ6A 4KRLB 3BDYL 2GYSA 3P4NA 1QPPA 4LFHD 3TN0D 4HFWB 1UB6A 2A38A 4UNVA 4NCC2 1KT2B 3IS0X 4HS6A 5ICZB 1ACZA 1T21B 4G6ML 1ULVA 4N9GA 4TUOA 4LCCC 4I48A 2FO1A 2J1KA 5SWZD 3SO3C 1ZGLB 3D9AH 4PGJA 4ODXB 1DEEB 2P45B 1TCRB 3PP3K 2WANA 1BREA 2DQCH 5IFHH 4Y19B 4Y16A 3MRQA 1E6OL 2BMKB 2ZJSL 4XMLL 1LE5A 3KYNA 4MD0A 4LLAA 4AJ0A 2Z31D 1QSEB 2XA8L 4MQ7B 5TE4L 1M1SA 3QWOB 5T1KA 1Z5LB 1IGMH 3HAEB 3BEWA 2NTFA 2VITA 4Y2DD 4JKPH 5C08A 3T0WA 1FFOA 4UB0H 2W0LA 3JWOC 1B0GA 3LD8B 4XRCA 3GIZH 2ZUUA 2X4QA 1P5VA 3IJYA 3T0AA 5AYQA 2B7DT 3HZVA 3LPFA 3W11D 5IVZA 5C07B 1BD2A 3QUZD 3X3GH 1QOKA 2HT3D 4HGKC 3MRCA 4G8IB 2VB5A 2XKNA 1IE5A 1BZ7B 4GG8B 5D5MB 5F7KC 5GGSY 4HK3N 4YHKH 2XTLA 1E6OH 2ZJSH 3MRRB 4PYGA 4XMLH 4BFEA 4RGND 4NHUA 1A7RL 1V3MA 1NFKA 3L5WA 5JOPD 1YDPA 1M7XA 3QNYB 3CZFA 1UXSB 3RHWK 4OCLC 1JGLH 4FTVA 1YYLH 1P4BL 4WI4A 4Y1AE 5GRZA 3QHZH 3OHXA 2VYRE 1W2KT 4V1DB 1RUAL 2ZUYA 4YC2B 5MENE 1CF8H 2HJKA 2ITCA 3QBTB 5EZOL 2AV1B 3P0YL 3C9NB 5IT2L 2MHAB