4QI3A

Cytochrome domain of myriococcum thermophilum cellobiose dehydrogenase, mtcyt
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
ENNVPNTFTDPDSGITFNTWGLDEDSPQTQGGFTFGVALPSDALTTDASEFIGYLKCARNDESGWCGISLGGPMTNSLLITAWPHEDTVYTSLRFATGYAMPDVYEGDAEITQVSSSVNSTHFSLIFRCKNCLQWSHGGSSGGASTSGGVLVLGWVQAFDDPGNPTCPEQITLQQHDNGMGIWGAQLNTDAASPSYTDWAAQATKTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
pubmed doi rcsb
source organism Myriococcum thermophilum
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
total genus 45
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qi3A00
4QI3A 1D7DA 1D7CA 1D7BA 1PL3A
chains in the Genus database with same CATH superfamily
3REWB 4FFWD 5DJDA 5B7FA 5T5FL 1HL9A 1C8PA 1F11B 3VJ6B 3CVBA 2PCXA 1ZLVH 2CO3A 3M46A 3D18B 2VOTA 3O3DB 1R19A 2GW5A 1QI3A 4OZFG 5DZAA 4Y4HD 3WN5A 2YR3A 1VFBA 3ERXA 4G11A 4LKXB 1NOFA 1JIBA 2DEWX 2A9NH 3QCVH 1BYNA 4LRNL 2OYLA 3FB5A 3L5HA 1BLNA 3VRIA 1UB6B 3HUJF 5K9OA 1ML0A 3T3PF 3TBYA 2F0CA 5FOJA 4P5TD 3V4UH 1R33A 5GGTH 3VXUD 5D2NC 3ZE1F 5DZPA 5BCAA 3LXBA 4S1RH 2X70B 4AMXA 3O4LE 3UZEC 2JCCE 1B3IA 3SDYL 5LWYH 1NTDA 2VMJA 1RUKH 4UV4H 5MENE 1J5OL 4OCWL 5ECJE 3MCYA 1BAWA 3INUL 4J1UA 1IGTB 4MDRA 4LVNC 3VFVB 5DJ0A 1X5IA 1F90L 2FEJA 2X2JA 1BX2B 5F6IB 5G5DA 3WN6A 1MCBA 1TLMA 2XV0A 4AJ0A 4R5TA 2EEBA 4GAJH 4ZQKB 4F3FB 1J12A 3ZL1A 4FD0A 1S9WB 3ARFA 4NBZB 1NDMB 3UBXA 2CIIA 3MV8A 5JO5A 2P5EE 4LF3A 5FK9A 4JPVH 3MRIA 4YDMA 3NFPB 3LKRB 2EIKB 3HZKB 3C5ZC 2WUCL 1JYNA 2K1MA 3FUMA 1JGDB 1EXUA 1T7WA 2WXHA 5EU4A 4TVPH 1I1RA 4ZXBC 5T1KB 3K71A 3V8OA 1BQSA 2ED9A 5CCKL 1N0LA 1PDKB 5ICXA 3KPRE 1X9UA 1U8NB 3CC5A 4O9HL 1XIWA 4KKAC 1R24B 4BFBD 1P1VA 4YZFE 5IFAH 3EOAA 5DRXA 3FQRB 4GSDH 5ICYB 3DOSB 5IB2A 3W2DL 4XX1E 1ITCA 5ANME 3WNNA 3W9DA 1DJZA 4A6YA 2Y25A 1U36A 3D05A 1AI1H 3Q8AA 1SN2A 5IG7B 1UM4H 1ZVHA 1I9RH 4XCFL 2L0DA 5C0EB 2NX5A 3IS1X 1RFDL 2OX5B 3B6SB 5CN3A 5K59F 3BKCH 2KL6A 3NESA 1X5MA 4LCWB 4PB0H 5J6HB 4KNQA 3C5SB 5J3HD 3CZJA 5DA0B 3B1UA 4NQDE 4UDTA 3RI5K 4IGBD 3DVIA 3FQNB 2V17H 3V52L 1MY7A 2XBZA 3K81A 2L7JA 2IDQA 5DJ2A 2H7WA 5KS9B 3HLKA 5BXFA 4L5FL 4FZ8L 4MNQD 4JVPA 2FAUA 1VEOA 1CXIA 1F3JB 1I9RL 3JV6A 5GGRY 5ISZE 5JMRA 1XCWA 2FR4A 3UG5A 4I3SH 5ALBL 1UD2A 3J8F7 4BZ1L 3SO3C 3RFRA 4AQAB 1HEHC 3I6LE 3HHSB 3RFZB 3V0WL 1CC3A 3GGWB 3AM8C 2IXQA 2LABA 3L3DA 4N90D 3H9SB 4XI5D 4NP4L 3S3BB 5BV7L 1GZQB 3FT3A 1MCWM 4TQIA 3VI4F 1PX4A 4HG4K 4YHNB 2XN9D 3B8SA 1N19A 2NY7H 1MZYA 1HILB 2X5PA 5HHME 1AXSB 2NZ9D 4H88L 5SWQA 2L3BA 5I8KH 3QUXD 2HA1A 5AW5B 5JNYA 4H2AA 5KVDL 1IM3A 2APTA 5H35A 4AC2A 3NSFA 5D6DC 3FSWA 3IJEB 5AUMB 1JDCA 2XWBA 3TWCH 4Y5YC 3FN0L 2KDGA 5DEFA 3TN0D 1A6ZB 2IDTA 3SE6A 3LTVA 5SWSA 3DYMA 4LQFH 4F2FA 1VF5C 4LRIA 3CFJA 1SYSA 2XZQH 4MMYB 4P5MB 1DHKA 2QTVA 1YAIA 2EXSA 4KPHH 3V0JA 4GRWB 4X83A 2DQUH 1S7TA 3HZVA 5B3SB 4OZGF 4X7CC 1U30A 4QHUA 3OPZH 5IMOA 2ZUQC 2VWEE 2EEAA 3OJVC 1G9ML 4DFHA 5DD5H 4MMXA 4P49A 4TRPL 1ECYA 5DFWH 1IILE 2OBGA 1MLBB 1NDMA 5F3FA 2YJQA 1PPIA 4UZUA 3QGVA 3BUIA 3EO1A 3NIDE 3MODH 4XI5C 3OZ9L 3LXCA 5D2LB 1AKJA 3PAYA 3S4SG 3TU6A 3DIDA 1HL8A 3MRJA 4NOBA 3ZTDC 2BC4B 5DT1L 4AGPA 4ZX5A 2EXWC 1HCZA 2JK5A 4YSPA 2ATPB 4YSQA 3HI5L 4GRWH 1I4FA 1DBML 3DO3A 4AK1A 3ZMNA 1L9QA 3RWEB 3L2LA 3A47A 1H3XA 3CXDL 4HHGA 2DEXX 1CTNA 2WXKA 1H15B 2XWTA 1N7MH 3ZRCC 4JZNB 3LPPA 1AZUA 4G6KL 5K9OB 2HG5A 1KCUL 3O8XA 4IS6B 5SWZE 2OJZH 3P4OA 5AALA 5ISZD 4XMPH 1EPFA 1XMEB 5F1KC 5C0JA 4P4KC 5ID1B 3PV6B 1KY6A 1GGCH 3QG7H 4GMTL 4KVNL 4FCAA 5G4MA 3WNJA 4JDTL 2AK4B 4HJUA 1ID5I 5EBGA 3T9WA 4XN1A 2F8XC 5ECGA 2CK2A 3EJYD 3RWGB 1K72A 4D0DB 2QSCH 5A6MA 1A7BA 3B5HA 5FECB 3KBPA 1L7IL 1RUMH 2BSED 5B22A 1AE6L 1PCSA 4PGEA 1A6VL 4RGNB 3WJMA 3I74A 1CMOA 4PRPA 3EH5B 3EJRA 4LOEA 1Q1JH 2Z8VC 2VJ0A 3BHBA 3EOAB 3QO1B 4Z7QF 5DRXB 1DL7L 4RCAA 1K4DA 1LK3H 1VFAA 2QQLL 1KTLA 4Y4FB 4FQ2H 3KLDA 1KY7A 1TVBB 1B4RA 1MRCH 2EE2A 5E70A 3MRPA 4DN3H 2CD0A 4HKBB 2H2SD 5ETUB 1XCQB 4YVUA 1JUFA 2B9AA 5K1JA 3OKNB 3KLQA 4JFFB 4M62H 4OFPA 1WFJA 3ZDYE 5I73B 3ZR5A 1JXJA 1QLEB 4Z3JA 3I3DA 2R0LH 2ZUVA 5JO5B 2NMSA 1YY9C 2X4TB 4RSYA 3X13B 5EIIB 1BAFL 1Z3GL 3L4VA 3MX0A 1GAFL 4N5EC 4EZKA 1QR1B 4JDVB 3OKOB 4MWFB 1S9XA 4JE0A 2QZQA 1DZ0A 1X6NA 2YD2A 2ZAIA 3NQIA 2ZKMX 1KJ3L 4PJBE 5FYJH 1T4WA 4GPVA 3L9BA 4OFDA 5IQNA 2GJZB 4OM0L 5ICUA 3ZE2B 3I02A 4GQRA 3S97C 2VAJA 4XWOD 1MNUH 4DVRL 1FYHB 2TRYA 3BKJH 1ETB1 3ZDZB 3SOTA 3HBQA 2RAMA 1YRKA 1R3JB 1FDLL 1W8EA 4YDKH 4CVZB 5EIIG 1BXVA 4Q0XH 5C08D 1IV8A 2CALA 4PSRA 1RZ7L 1S7QA 3CDGA 3MRNB 1R3KA 4LDEB 5KBLA 2ZXGA 4J6IA 1GRWA 1EIBA 4FTVD 3HUJB 2PPCA 3VGAC 3BGFB 3UTPD 3NPZB 5D7SH 5JOPE 1RJLB 3O0LA 4NZTL 1NC2A 4AMWA 4XPTH 3VO0A 4P2QA 1V7NH 1MREL 1JPEA 2HFGH 2JJTA 3T0VA 1Q0YL 2F08A 4AYEC 1NKRA 1IKFL 1AR2A 1YPZA 1YEIL 1DUYA 1M6UA 3HAEG 2CH8A 4ONGL 5A6LA 5JDJA 4KUZH 5LN8A 2K6YA 4MNHA 2XPZA 1Q90A 4TM9A 4L18A 4ZTEA 2BVQA 4RESB 3GNML 1KBGH 4FQXB 1ND0B 3BUDA 3O6ML 5KW9H 2X05A 1ZVSA 5IEKB 3IU4L 3HB3B 1H3PL 4LEEA 4PRID 2QT6A 1KGXA 4NBXB 3LRMA 4YSAA 5IM7A 2CRMA 4XXDB 3AROA 2IH3A 4JL2A 3W0WE 2E7CA 2D3NA 2EE9A 4W4NA 3VE0A 2BNRB 4JG1L 4J4PD 3TO4D 4A1RA 2W65A 3RG1C 2J4WL 4GSXA 1MPAL 5I15H 1T1ZB 4Y8DC 4HMEA 5E4EC 3MJWA 5MEQA 5GGSB 4W70A 3FL7A 1WZ1L 3LH2H 3FO9B 3L54A 1S4IA 1DBBH 1VENA 5A16A 3EO0B 3FCTB 3CN4A 1THCA 4YHZH 4QRRA 5C0CA 2HUEA 5I6KA 1YAZA 5DDHB 5AZUA 5KVGH 1G43A 4MDJB 2PWHA 1J9QA 3TX4A 3U0WL 1DEDA 2APXA 3NSDA 2P8MB 3JWOC 3NUKA 1YECH 4DEWA 1OAYL 1WCBA 3SOBH 4Z7OF 3IAPA 3D85D 3SO5A 4XC3H 2BCMA 3HBPA 3PU7A 3T6QC 2FCBA 2B9BA 4L1TA 5EH1A 5IROA 5HYJB 1YQVL 3O3BA 3BSZA 4PRNB 3KGRA 2B4CC 4P05A 5TK2A 2IWEA 3TP4A 1VLXA 2O5YH 1MFDH 1JTPA 1MI5A 1HT6A 3LKNA 2DI7A 4UU9A 3L95A 5DRZB 2CNZA 2OR7A 3M1BA 2XZAH 1R5WA 4XB8A 5GZOC 3NABL 5I8EA 4XO4A 3KXFE 5CFHA 4XVTL 3UJJH 3LNEA 1C7SA 2ITCB 3MXVH 3G6JB 4HK3N 3O9WB 2NW3A 1GH7A 2AABH 4WO4B 4XNMA 4KQ4L 1I7RB 3FHEA 4BKLB 1C5DA 3OL2A 4HJGA 4QYAA 4TSBH 4J2XA 3LD8B 4I2XA 5DUMH 5FDWA 3BUBA 1SVCP 3MRDB 1UZGA 2WUCH 3P40A 1ICTA 2COVD 4G1EB 1RUAH 1TPXC 5ERWA 5I2IB 1U21A 3GMPA 4DKAA 4D9LL 5D2NA 1AJ7L 2BSDA 4HT1L 5HHOD 4FADA 3D69B 4V1DE 2BVPB 4JAMA 2NSQA 4PRBB 4OZIB 1IC7L 3K2UL 3FBKA 4K73A 1IC1A 1XH3B 2QADC 1UXWA 1DQQA 1RP9A 2VSCA 4H0IA 1A66A 4Y4KD 3FFDB 3NZ8A 3BPNC 2R4RL 3EJQA 3QIUD 4AGQA 1G7LA 2D73A 2OTPA 5KYWA 1R5IA 2A77L 4M7KL 2EE3A 3TPUB 3N1QC 3ULVL 5FYKH 1NCBL 2CPUA 3PV7A 4G8GD 5IB4B 5IT2H 4Z7NF 4HC1H 4HUXB 4PGDB 1S5IH 3NYKA 1CGSH 4XGZA 4OT1L 3TBWB 2JKXA 5HHOB 4O2CA 1A1OA 5A3IC 2Y22A 3MBWA 4FNRA 2WAQA 2RGSA 1NAKL 4WI0A 1V54B 2NR6C 1B6UA 3CFDA 4GXVH 4O4YH 1SLXA 3U4AA 1H3WM 2C9QA 2QQNL 3B2VH 2B1HL 2JB5H 2BOBA 2LU7A 4Y5XB 4HOXA 4HKBA 5H8DA 4YN3A 2WTOA 2EDEA 2ICEA 1RZGB 3Q5TA 2AJYH 5GRWA 4Z7OE 1UD3A 1MWAA 5I17A 2HKFH 1VRSA 1DO5A 1S9VB 3EYSH 5JPNB 1YMMA 3FQXA 2HFEB 1G4MA 3L4TA 2F61A 1PSKH 4HJ1A 4HBQA 4I9WE 4MCZB 4TTGA 1BF5A 3IPBA 1JZ8A 5E8DH 1ZHKB 4UT9A 1KT2A 2PCFA 2AMUA 2MHAA 3KYNB 4TTDC 5T5FH 2FECL 3SKOA 1E5AA 4XVUD 4EIZC 1GC1L 4TS6A 3U0TA 3FQTA 4DPAX 4KOBA 2IBBA 1KXQE 1I3RA 1L0YA 1EHAA 1X4ZA 3BP7A 1EK3A 5I8KL 4HU2A 4U3CA 2RA1A 3FUHA 4Z5RB 3ZMEA 4Z7VA 3U6XS 5F9WC 3GUTB 1BVLB 2E7HA 1I8MA 1L6PA 3ULSA 1DBJH 1Z5LB 1OOWA 2HVKB 2OR9H 2O6FA 2BIMA 3NZSA 1JHKL 5F7EL 4CADB 3WDJA 4D2NA 1EO7A 1MCFA 4HKXB 5E8DL 1NC2B 1UXSA 4PG9B 3CBJB 3NIGB 4JFPA 3SDAB 5FM5O 4PRHA 3EJZC 2NX5D 3ZRSA 5HHNB 4HH9A 1CFBA 1GYCA 4ICWA 4N0CD 4WWKD 2BC4A 4PYGA 4GUCA 5EF0A 1U58B 3BESR 3P02A 4LPXA 4MKTA 5A6IA 4NQXB 1BFOB 1NGQH 4JHVA 4BJLA 1L7TL 4BH7A 1WO2A 4LVOC 4QY8A 2YO3A 2Q5BA 5C86A 3NAAL 1YNLL 3U4EA 2A4ZA 2FO1A 1JK9B 1UT1A 3LZNA 1HHJA 3L3OB 1ZHBA 4KV5E 1B2WH 2R2HB 4CBPA 3A6CH 5FHBL 4TXVB 3TWYA 1OT4A 2WAHA 2P8PB 3ABZA 1UZ8B 2EDOA 1J5DA 3CHOA 4ZRGA 3QAZB 5E1AB 2WKLA 3UCQA 3IKCA 1I1FB 1PGRB 4ZODA 5DI8A 1E6OH 2D7TL 4KKRA 3C60D 1D9KD 2X28A 2OPCA 3RB7A 3SIKA 1BD2D 4OM1H 4P46D 4CKQA 2DQTH 5D71H 5HHVH 2CJTA 1KCKA 2JI3A 3QJUB 3GBLA 4YPGB 3B3BA 3UAAA 1RZKH 4HS3B 3WOVA 5ENWA 2Z6FA 2EO1A 3L7EB 4A7GF 3LXAA 3S3DB 3WKQA 4L8CA 5EBMB 4DO5A 1XF3B 2YD1A 5FDWB 4GAJL 1UEYA 4NO2A 3QHTC 4YR6A 1XGPB 5HYQA 4FQIH 3TCLA 1KPUB 3OKYA 2XA3A 3FFCE 2ITCA 5F88A 3WLBA 5KG9A 3AS0A 1P4BH 2PCPA 3V95A 4OQTL 1N6QH 2K78A 1NCNA 3CC1A 1Y1UA 2I85A 4LLAA 2W80C 2HRLA 3MJ9A 5D4HA 4ACTA 4ZX3A 2A6KA 1ACZA 4IM8A 1XV8A 4OZGE 1U8JB 3VGDA 3GEWB 5CWSA 2OI9C 4MJ5A 3OR7A 1OY3B 5C3TA 2PWDA 2F1EA 3RFZA 4OJAA 2RH0A 2MTPA 3QI9C 4ZMNA 5KVEL 1FRGH 4KHTH 5F70A 1SHMA 3RVUD 1SEBA 3MNVA 4BXSV 4KTDL 1A7QH 4BH8B 2BK8A 2ICES 4G8EA 1J0YA 4YSDA 1OF2A 1SUHA 2BP8B 3T8VA 2I5YH 4HGMA 5IBTL 2BP8A 2ZUYA 4RGNE 4Z95H 3VGFA 1AAJA 3H9SA 4TVPL 4B60A 1AXIB 3DVNA 3GMOB 2ZYSA 5EU6E 4K3JL 1SBSL 2PXYB 5JHBA 1A8ZA 1NCOA 3GSWB 4I0PD 2PR4H 4UM8B 4N4YB 1SDYA 1KCSH 1OZTG 4Y19D 4FMFA 4UTAL 5C0EA 4B7IA 1LO0L 2DWEB 2N7BA 4RIRB 5CZRA 4OW6A 3ARBC 3NFNA 1LEKB 2XFXB 4QHLB 3MREA 1JPTH 3QNZA 5E8PB 4FQXA 1G1KA 1J9TA 1KXVC 2QDWA 3BGAA 1VHPA 5F9DC 3X3FL 2VR5A 4F9LC 4WI7A 1HH9B 2XVBA 4MMXB 4NZFA 3SE3A 1MCKA 3B8YA 1QI4A 5E2JA 3EGSB 1CN4A 2IIJA 5F2FA 4ELMB 4HOMA 1I8IA 1L3NA 1ZHLA 3D25A 2X4QA 3LKRA 3R7RA 2X9ZA 1XL4A 1FZJB 3L5WA 4RAVB 1CGXA 4EEEA 5D5MF 5BVJB 3MUJA 3ZN6A 4V1DD 3CHXA 2A9NL 5BVJA 2ZSVB 1P69B 3BLBA 5TQ0L 5EBLB 2EVGA 3VFUA 2ZPKL 2HX7A 5IVXE 1K5NB 4FQJH 3JQOB 2D31B 4TOYL 1XFPA 3CQFA 3RUGB 3WKMH 3P69A 2VJXA 3IKCB 3FDWA 3V5HA 3JT0A 1NBQA 3ZTEA 3VFVA 3LQZA 4JREB 3HG2A 4BQ9A 2R2HA 1DJHA 4BRJA 1WDAA 4AH2A 5ACZB 4TSCL 2XC8A 3RTQB 3KLHC 4X80H 3S5LB 4MAZA 1HDMB 4QCIB 3MA9L 3RWCB 4QI3A 3HS0C 5GRUH 5EB9A 4E9WA 5HGGS 4A7UA 2DLFL 2OULB 4XZUA 3I9AA 4HJIA 1IBZA 2E9IA 1Q9KA 1LEGB 3U2SB 1MEXH 1KB5H 4HF5L 4FXGB 2J1XA 2CKBL 4Y4FC 1A1MB 3KYNA 3OZ9H 1HHIB 1OAUH 4NIKB 2QBWA 1K6QL 2FB4L 4F27A 4ODSH 1AZCA 3BGMB 3QFJA 4NUGH 5FEBA 3IK2A 4G42A 4ZD3L 2WBKA 5I1EH 3L5JA 4AENA 1XCQA 3FSAA 5DR5L 1CGWA 5ICZA 1UACH 3QHFH 5DWUL 4G7YL 4JFYB 5DRWA 4LCWE 4ONFL 5L0QC 2VM4A 1N5AA 3UYOD 2XX1A 2VDRL 1GSKA 3U0WH 4XVSH 3SN6N 3Q44A 5EORL 5IREA 2MQ0A 3PPEA 4U6XB 1YN6A 1F6AB 4PJ7F 2N0MA 4OD2B 5I6XC 3KDMB 4MJIE 1DQJB 1E2ZA 3RVWD 4OU3A 4BD4A 5GZNA 4OLVL 3AG3B 4F92B 4XXCA 4H8VA 3ZE1B 1WD8A 5D5ME 1SF3A 4XWOC 2F1AA 1JG9A 1FNEA 1N0LB 1SLUA 3RGVC 3COOA 1NGWB 1Q9WB 1G7LB 1W6WA 2BRQA 2EJ1A 2XZAL 2DH3A 3B3IB 3MBEA 5CBEA 1J1OH 4XP6L 1TYRA 3CZSA 3OG4B 1QAWA 4IKLA 4JR9H 4TYUA 3RWFB 1LE5A 2H4EA 3VFSA 2E5EA 4G42B 1XGPA 5HYQB 1BEYL 2WGXA 1BG9A 3MXVL 2ROXA 4YH6A 1LO3H 3QVAA 3VFOA 1KPRB 3WUWB 2ZCKL 1WHPA 4A68A 1SEBB 3MNVB 3BVNB 3LJ3A 4G8IB 1XD0A 2X53A 5DUML 4DETA 4JM4L 4G6JH 2VJ8A 2X87A 4UQIM 5DLML 3EYUH 3OAWA 4M62L 4J3WA 4E42A 1T20B 1A2YA 2CDGA 4O2EA 3CLFL 1X7SA 5T1JA 2FBJL 2D03L 4PI0A 2I60L 3LX9A 4PG2A 5F1NB 3RJOA 4C47A 3L4WA 4GXUM 4JZJB 2QSCL 4UQAA 2WXLA 3WLWD 3MLTA 1O7SA 1FL6B 4UQDA 4WSKA 4N0RA 5HVWA 3O41A 1SFDA 1RUQH 1OCZB 4G80A 4AEIL 5DQDL 5JUEL 1KV3A 1GS7A 4WCYH 3PQYE 4Y1SA 3W11D 2EH7L 2AJSL 4XRCA 2ADIB 3MHZA 4JMNA 1PF3A 4NPYB 3VXSE 4JJ5B 1FHNA 3S98A 1JTTA 1BBJB 2RQEA 4H8WH 2VL4A 4QJ3B 1CLYL 1QBLH 2QVMA 4YSEA 3LEXB 1CFNB 2FZ3B 4MXVF 2OL3B 4PJEF 3N04A 2VXVH 4PRHB 2XA8H 1VFOA 3AADB 4XO3A 1F13A 2QR0A 3S8WA 1MAMH 2I9TA 3TFBA 1FL5B 4X0KA 2FNBA 2X3BA 2XT1B 2QGEA 2F7OA 4D0CA 3UTZB 2XIBA 1YEKL 3UBFA 1WA0X 4M7ZC 4PJ7E 1JYWA 1BVNT 2WXFA 5ANMA 5GGSA 3IFOB 1XBRA 2YA2A 5F97E 2IDFA 1KUMA 3WY3A 2WZAA 3KJ4C 2V9RA 4L3CA 4XPTL 2LT9A 3C2AL 5MEPB 5J11C 4M8VA 3OGCB 3OGOE 1OTUC 1WUNT 4RAHA 1PY4A 3IDIA 5EC1A 4UBDD 3KH3A 5D4IA 5C0AD 3MR9A 1QBMH 1ZCRA 3NFNB 4WWKB 2BY0A 1NFDE 4HFUL 1OCRB 4X6FA 5C0BE 1YEIH 2X4SA 2IAAC 2NY7L 4PP2A 1MY5A 1DN0B 2LLGA 5CCGE 2V6HA 1BVZA 3A4DA 2FQGA 1NCAH 3FQUB 4TSAH 4NZUH 4X4XB 4HIIB 4RAUB 3PNWA 3ESOA 5IKCA 3UDWC 5ID0B 2YPLD 2VN7A 3WDIA 2JH2A 2PW2B 3KW8A 1I8LC 3HAEB 3QRGL 3SJVD 2C3XA 3PUCA 1JZ3A 2GHWB 2DN7A 3VVVA 5E5MB 4JRYD 3QJHB 3GMQA 5FWQA 4LOUD 4JM2F 5I66B 1WBYA 1QTYT 2UWEA 4JFHD 3T09A 3QUGA 4D8OA 1CXLA 4DP8X 5IEKA 4G3YL 2BIPA 1E3ZA 2H2PC 1S78C 2P24A 2V3FA 2XRAH 3N42B 4ZMWA 4ZAKD 3EDDA 4LKCB 2C9VA 3V10A 5IGXH 2VLRB 2N3JA 2ZX9A 4KNTA 3UX9B 2FWUA 3PHAA 3QUZD 4PJAA 1GZPB 3R8QA 3FRUA 1CD1A 5TH2A 4XCYB 2MTAA 4HIQA 1E7VA 2OTUA 4N3UA 4EKXA 2JXMB 2PWFA 3ZE0F 1DTUA 4MJID 3ZL4H 1KFAL 4ZPVB 4JRYE 2WXNA 3BSGA 3ARFC 2ARJB 5I1HL 1W72H 5IV2B 2JKNA 1CXHA 5CJ8A 1QSFB 2H6OA 5GGQH 3UYRL 3N55A 1FH2A 4NNPH 1WGOA 4WGWB 1MFDL 3HN8A 4TLKA 4EPSA 3QDME 3HHRB 3ZE2E 4Y2DB 1KCRH 3TURA 2XN1A 4ZNCD 3L4ZA 3MSPA 4MWFA 5BRPA 4U7KA 4H7VA 1BXAA 2AKRB 2K0RA 3NJLA 5GS1B 2ITDA 4RSVA 4DH2A 4MD4B 1KYOK 3MA7B 3PG2A 4N1EA 5GS1A 4X8JB 2APBA 4BIKA 4CVWA 3ZL4L 5E23A 4G6KH 1GHFH 1NKGA 3MOAH 1LXMA 2FWSA 3WV0A 3GO1H 5ESQB 1MNUL 2HZHA 5I76A 3B56A 4A2DA 2ZJSH 3ETSA 5E6YA 4FOMA 1XR8B 3O6FD 3C5JB 4NNPL 2MOGA 4ELMF 4ZAKC 2ESVE 1FQ9C 1DSWA 1HXYB 1QNZL 2AJUL 3KZ8A 2BZCA 1DVUA 2UX6A 4BFFA 5HVFB 2DYRB 3QDJA 4PRHE 4QXVA 3K6SB 3KVPA 5IF0B 1Y6KR 4QIRA 3L45A 4OSUL 1S8DA 3G5YB 3V5DB 1L7IH 1RUML 1UYWL 4OKVB 3HRZC 4YO0B 2WVSA 1A47A 1UASA 4MDJA 2C4FT 5KVEH 1GZPA 5G55A 2XV3A 5JIHA 2XN0A 1H3UA 2E74C 3L1GA 5C09B 3C12A 1YN6B 5DU7A 2WD0A 3JUYA 3Q8EA 4IRSD 4PJHF 3NJHA 4DGIH 4EI0A 4PTUB 1X5AA 3ATDA 2DYPD 2BNQD 1VB9A 4Z7UB 4DN3L 3ETBF 2PYEB 3LZPA 1KXHA 3MBEB 4RETB 3WKNA 3UP6A 3RDTB 2HH0H 3PV6A 3SJVE 1YCSA 5CP3H 3BXNB 1Z5LA 3WXVL 4O4YL 5HHPB 2ZD0A 2GIYA 5HDQH 2YGNA 3MJ8B 3BEWB 3GC3A 3HB3C 1AKPA 4RGOL 3EJYC 5I71B 3PWNB 5KOMC 4N20A 3D85B 1UXLA 1NCDL 1MIML 1NCCL 2QFPA 2WVTA 3ARXA 4K15A 3FSOA 4LPCA 2EVFA 1P84K 2VDKB 5LCVH 3V6BR 3ARPA 5TPWH 5D5MA 4JPQA 2QTEA 3QDGA 2LU4A 2YEQA 1LHZA 3TO4A 5D7IE 5DDHA 2VQ1B 5B4MD 5HDQL 3VRLE 1ZRUA 2XQBH 4IU2B 2H1XA 4OY9A 1A22B 3ZE2F 3HNSL 1PLCA 3ZHKA 4BQBA 2AQ3A 2CA3A 4NUJA 3TC9A 2M26A 5C1MB 1USQA 4YDLC 5I1GL 2G2RB 4UM9D 3VACA 2PW2A 1AFVL 5E03A 2DAVA 3RDTA 1RZ7H 3S8FB 2WNKA 1IC5H 3VG9C 2B1OA 2G2NA 3KPRA 4AKPA 1BDYA 4JO3L 1P7QB 5DEZA 2AEOA 5LBSL 1ZS8B 3HE7A 4L4VD 3CMOH 3O6LL 3HB3D 2VR3A 3ZHFA 4YHOH 3K2MC 1MQKH 3FRPA 5CEZL 1E30A 4V1DA 2WP3T 3HKZA 4Y9GA 1BOGA 2AXGA 3D48R 3HRPA 4NSKA 3PDOA 4KY1L 4OD1L 1ZSDA 2EIDA 4IRZH 3VTAA 2IO5A 4LIQL 1PG7W 3OGCA 4Y5VB 1MLBA 2OFQA 1TKWB 2I24N 1BZ7A 2WLLB 5E7FA 3BZFB 3WO4B 2XX0A 6TAAA 4N2GA 4R3SB 5KYWB 4L4JA 5KTEH 1FVCA 4Z3IA 3L9RB 4NC2B 2VM3A 4ZUWB 3DJTA 5F7FA 5KANG 4XCEA 5IOKA 4EI5C 2WLZA 3MMEA 2K6WA 4PJHE 3VNZA 2AEIT 2ZOKA 4MA7L 2ZYRA 15C8H 1YYLH 4L4VE 4NCC1 3BRGC 4FFYH 3MA7A 3CVHA 1ZVYA 3T4YB 1EXGA 4IKKA 5DVOA 2BXZA 4TSBL 4ZS6C 3AVEA 1PLGH 5HXMA 4WV1C 3X17A 3D2UD 4NZRH 1F5WA 3C6SA 3TEYA 2N0KA 5L2KE 2J3SA 2Z8SA 4KK6C 5GGUB 3VRJA 5MI0B 4NNYA 3SGEH 4XVJL 1LE5B 2EYSA 5C0RH 2Y9RT 2X4UB 5GXBB 5KYYA 3QFJD 1YEJH 4YXHL 1OTSD 3OHMB 4Q6IB 5EZJB 1RHFA 2L7UA 1XZWA 3CSYB 1D7FA 3IVKB 3W37A 1PBYA 3BAJA 1SMDA 4HSQA 3D0LA 4MYWB 5KBPA 2OQJA 2A0LD 2WWMD 3BIKA 5ALCH 2GVYA 1NLDL 3S4SA 3U0PB 4X99B 1CB4A 1UT2A 4YHLL 3OB0K 3ZDXB 1UA6H 3NSYA 3ULUD 4ZPTA 5E0FA 2VLLB 5E5UB 3RNKB 3DDFA 1HE7A 3HS9A 2PPDA 3B6SA 3MUZ1 2VLLA 2FTAA 3X13A 1P1ZB 1Q94A 3QR2A 1WZKA 5E8OA 1NAMH 2ZX8A 1GGUA 1T0OA 3MOBL 2VXQL 1E67A 4U6XA 1GVIA 5L8LB 4G8GE 1VPOL 3E6HA 3LKSB 4N24A 1SN5A 2DV6A 1JV2B 5FR3A 3EZ8A 2C1OB 3S35X 5E6UB 3BCDA 4DEPB 5FW7A 1BEYH 1N9PA 3RQ3A 5KAQF 5IESL 1KENL 2H41A 4M7LH 4Q6IA 1ZSHA 2LW3A 4FXKA 4YC2C 3PE9A 4OLUL 5I0WA 3GDBA 3OZKA 2BHFA 2HLFD 4R7XA 2K6ZA 5CJOH 1NICA 4H1LG 1NIEA 2DTSA 3D39E 3MRBA 5TD4A 3N2JA 3Q01A 3RZCC 3H9HA 1VGKB 4KKAD 1FNSL 1BZ9A 4ODBD 4X99A 2WPGA 3S8GB 4QRBA 4YDIL 3EHBD 2J2ZB 4W4OA 1IAKB 1D5IH 3IDIB 3UJIH 3IDNA 4XPFL 4MQSB 2YD6A 2KERA 3NA4A 3BFQG 4GUQA 4JO5A 3VW3H 3CBKB 3WIIH 5JXEC 4L05A 3MGAA 2AQ2A 4QOKD 2J72A 3I6GA 3QYCA 4JRFA 3D2TA 3IGFA 5E1GA 4IDLA 3QEHB 3TH3T 3V5HB 3GI8H 4PB9H 2HG5B 1JGDA 3O8XB 4Z7VF 1IAIM 2GK2A 3CV5A 4NQCD 4RBPK 1LGVA 3REVB 3RTQA 1PFCA 1QSED 4HV8B 3GXDA 3VH8B 3KPSD 4A04A 1JNLL 3MN8A 4PJIE 2P5PA 5FA4B 1U92A 2OMBA 4F37K 2BVEA 1CFVH 5PAZA 3VXMA 2TRHA 4WKXA 4A2FA 1PZSA 2E7MA 5DD0L 3QDJE 1M2VA 3KYOA 3D2UB 3QUKA 4FXGA 4XNQA 5GZND 3RZCB 3SDDD 1A3ZA 1FV1B 3FRPB 3BC9A 2PR4L 4XZUB 1KWGA 2N1TE 4ANVA 1RMFL 3RL1A 1NGQL 4OJEH 4EN3D 2PO6C 1JF6A 4MCMA 3LQAL 4PB9L 5DC4B 1FYTE 3T0EC 2BCKA 3MXWL 3S5LA 4NYLA 4XRCB 4LOFA 2WQVA 4BSVA 1J0JA 3INOA 3GM8A 3UZVA 2OSLA 4JFEA 4OJCA 4K7PY 3EHBC 1KB3A 2XXMB 1WAPA 4K71C 5LN4A 2YKLH 1S5HA 4WUUB 2XQYA 3PDOB 1HOEA 3DI2B 1SZNA 5ACLA 3DMMA 5E56A 2VLKB 3K6IA 3PXHA 1JWMB 2WBJA 2V9QA 2DWEA 1GGIL 3FQ2A 2AZUA 3Q6GH 4AYMC 4BYHA 5I1IH 5KZCB 2PXYC 3Q43A 5C0ND 1WWCA 4PGBA 1MRDL 2AXFA 1OTTC 4P06A 3BLKA 1PKQA 3ROLA 4DTGL 4G6ML 5EZIL 5KBKA 4AIXA 1LEKA 1XZ0B 2YD5A 4J12A 1INDL 3GMNA 1SJHB 2IAMA 3EYVB 3ZKSD 4IW4C 2Y7QB 4Y2OB 2SODB 3KS0H 3VH8A 4HOWA 4HIJA 4ESKA 3NJVA 1ETJA 3S3JA 1JSYA 4H4NA 3EGSA 4KU1A 5D7IA 4JG0H 4LIQE 1LO4L 5TE4L 3CD4A 4F1SA 3T0DA 3U6XA 1EUTA 5HTSA 3RGVA 1I3RB 5FUOL 2HUHA 4WK2B 1D2PA 3R4RA 3RFZC 2ARJQ 1K4DB 1KV7A 3VDBA 4L29A 1EEUA 2Y0SA 2R69L 4MQ7A 4FNLH 4H1LA 3D1MC 1IEAA 3L1EA 3QNYB 2YK1H 2FJGA 3NOIA 3P2TA 1N2RB 1JGLL 3O8XC 3RHWF 3UYPB 1DJIA 5KVGE 4QNPE 1DVYA 3DOHA 4M5SA 2CRZA 4ORZC 5DWUH 1VEPA 3FHAA 1L9SA 2YPVA 2CLVB 5KSBA 2VERA 4KI1A 2YGVA 3GRWH 4KVPA 3C60A 2HWZH 5CZVH 2CKBH 4QOKE 3S37H 4XVSL 3GHEL 1NANI 1BD2A 2HB0A 4MS8D 4JPIA 5BVPL 2WQAA 4JDZB 4NB7A 1H6FA 2W07A 4AENB 1KEML 4OCRL 4R7DB 4JG9A 4PTUA 4LLDB 1JNHB 4DP7X 4FRWA 4XC1L 5IBUG 2ZX6A 3SPIA 2A6KB 4JAMB 3O6KL 2WGNB 3NH7H 1PNDA 1TEYA 3GZKA 4WTZG 2EC8A 4DOHE 3T0AA 5C0AA 4MB3A 4TULL 2YOAA 5ERWB 5I8OL 1ZXQA 4G8FB 2B7DT 3GF8A 1GXEA 4NQEA 1VA9A 4XNUL 4FKEA 3B7SA 1Q9KB 3U2SA 2JJWA 3W39A 3N1GC 4XWGH 4Y16A 5E2UH 3O2DL 4OCSL 4JCMA 3IJ9A 1BQRA 5CNHA 3V6ZB 3L4YA 4L8CB 3KPPA 1U8KB 5GHWL 3PWJB 1HI6A 1LYQA 5EZLB 4LLYA 3QARA 5HY9B 1U91A 3EF4A 1KJVA 1ZA3B 2W38A 2Z8RA 5HI3C 2PABA 1W8NA 3VXMB 5EZJA 3BW9A 3ULVD 4LSQH 3DBXA 5DS8A 3L3IA 1QATA 5JR1H 3QZPA 3FSZA 3HE6A 4G43A 2VLJB 5KSAD 1CZ8H 3ZDZF 1NBCA 5TDOB 1KBPA 4JFZL 1MFAH 1BFVH 2NW3B 4WNQA 1UM5L 2DKMA 1GY1A 3BSZL 4YDLB 1FCCA 1BM3H 3UBXB 5SWSB 3FMGL 2XKUA 1CLYH 4PVLA 3HFMH 4BH7B 1NMCC 1LDSA 5DTFA 5C0DA 5CMAA 3U1QA 3NIDB 2J73A 2BOCA 1N26A 1RPQA 2WXGA 3CN1A 4PJDE 3TCTA 3FOLB 5I8CB 3P11L 5AZ2L 1KCBA 3DSFL 2EUVA 2MQ3A 2VABA 2P8PA 3C5ZA 5IHLB 2APSA 2WXOA 4NN5C 2ZIDA 3HG1D 5ABDE 1MFAL 1AY1L 3U30B 2BHYA 2Z1KA 4BKSC 1P5VA 4AW7A 4WHTB 1TQBC 4PHZA 4J3OG 1F4HA 3NDZE 4NSKB 3V4VA 4J3TA 4N2NA 4PJHA 1CDBA 2YUZA 1XGUA 3RWIB 5F0LB 4E68A 4RFNC 3MV7D 1VGKA 1BMWA 1ZE3H 4EI5B 3RWIA 5CN1A 3KEDA 3VU1A 4WWID 4M8QB 3TVMD 3N44F 1CFQA 3VXUB 4FXKC 4F9PA 1ZA6A 5IFJB 1A7NH 4JFPB 2VXSH 4OH2A 4CL7A 2Z4TA 4JDEA 3DVNB 1FNFA 3OBAA 1A5FH 5I1JL 1GSMA 4X6CF 1TZGH 2W65B 3BT2H 5I1DA 1H9VA 1RVFL 3Q2LA 5GS0L 3QQXA 1KTBA 4ZNEA 4RQQB 3W5MA 2GTZA 1TVDA 2GFBA 2XWXA 2JJSC 2WNGA 2H3XC 4NJ9L 4NZTH 4UIMA 3UL4A 1XGYH 3KM2A 3VI3E 4K94H 2GSMB 4ADIA 4YE4L 4RRPG 4K7FB 5D5MB 4XHQA 1IQDB 3T1WA 1L0XA 4WW2F 4NN7C 1FDLH 3WFZA 3T6WA 3V0HA 1PZUB 1SRDA 5D7LD 4PRIB 4ONGH 5T3ZH 5DZNA 7FABL 3GZQA 3T1FB 3MFFA 3H7LA 3W9DB 1FG9C 4LCVA 3JTSA 2HFEA 3V4VH 2GKIA 3SGKA 2IPUG 1F6LL 1HHKA 2D0GA 2G5UA 2XI9A 4NHUA 5EUOF 5T1KD 1HTYA 5AKRA 4HS6A 2D4FA 4NO5B 2HVBA 4AL8H 3U9PL 4JFDA 1RZGA 2Q8BL 2FSDA 3NCYS 3P0YL 1H0DA 4Z7OB 2BO0A 1QYGH 2IADA 4M6OL 3MNWA 4HD5A 4H40A 4S10A 5FLVA 5I1CL 2EDWA 1X5JA 5AFAA 5D7IF 4ILDA 4A6YL 3UTSB 3H6AA 3ATBA 2CBTA 2X4OA 2IWGA 4I2XB 1NZRA 3L4XA 5CLXA 1FSKB 3UERA 1G7HB 4OR1A 4WEBH 1WWAX 1SHSA 4K3DL 1BZ7B 2A6JB 5I2IA 5IR1A 3LHPH 4NPYA 1X7QA 4MQTB 1W72L 3QUZB 3GRBA 3FT1A 1E3XA 3QIBD 4FNPA 3LZQA 1YN7B 1TETL 5KYUB 3WNOA 4M03A 4YXHH 3T77B 4XVTH 4YL4A 5DGQA 4I89A 4UM9A 4HQQH 1FJ1B 4FABH 1BMGA 1QFPA 4N0UE 1GGTA 4QHNB 5IROC 3CH1B 2ICWA 5CILH 2E7DA 4G8AC 4MA1B 4MGXA 4PQXA 4ZXBB 3MOAL 3SYQA 2WHVA 2YPVL 1XF4B 4P2OB 2Q2EB 4WI4A 3V0FA 4UDUA 1GA2A 3MX0B 2CG9X 5BV7B 2BRRL 3HMXH 3CNKA 3HJ0A 4MA3A 2DQ6A 4XMKH 3VD0A 2YPLB 1IFHH 1GKOA 3IMSA 4OQ1A 2QQKL 2DM7A 3LAFA 2H0PA 3SZ6A 1FNAA 3LNHA 3UZQB 3DTXB 3TN0C 3L08A 4ETQB 4NKMB 3TO4C 3GSOB 2JCCB 3MNWB 1MKFA 1J0HA 1F00I 2KC0A 2QQLH 3ESMA 3OLGA 4JANB 4QTFA 5B39G 5LUMA 1FLRH 3DJZA 3PHQA 2V9TA 3PS6A 2GHZA 2VMDA 4GW1A 5IB1A 3WTUA 3P4OB 2IQ9L 3POHA 3AS1A 4KNSA 4N0CC 4K55A 1Q0XH 4QDGA 4WWKC 2AGJH 1MI5B 2ATKA 4DZBB 5AW2B 2VRAA 4TNEA 4TUKH 4JO2H 2V2XA 4N9GB 1MCPL 1Y6MR 1F6AA 3ES6B 5CIPA 5F8QC 3WS3B 1KELH 2DDQL 4NPJA 3N41B 2P3YA 1OANA 3X1NA 5A2KH 1FO0L 1KIPA 3H9SE 2WCGA 4KKCD 4MXWL 1SXCA 5CCHE 4KH2A 3D51A 1JWUB 4P9MH 4PS8A 4PJ5B 3WIIL 3HI6L 4H20H 4S1SL 1OP5H 1P2CA 2BFVH 3SGDH 4P5KB 2WLNA 1DJXA 2GFBB 2Q3ZA 1FORL 1D5ZB 2DW5A 4UILL 2BNUB 3RRQA 5LCVL 4QOKA 5CLTA 1E42A 1DLHA 3H9ZA 1PMYA 4Z0BL 1I9EA 8FABA 3WNIA 5IJDC 1UT9A 2HN7B 3CFKB 4BEIA 2G9KA 1TQSA 5I0ZA 1V3LA 3AQZA 2X4OB 3GSNA 1ZTXH 1RZ8A 3FOLA 3RUGA 5BOPA 3ET9F 4S1SH 4RVBA 5B38A 1BVOA 2LTQB 1CXFA 4XN7A 1BXUA 3JWDC 4OLEA 3FTUA 2YWYA 4LSRL 2D2CC 4GKSB 7PAZA 3QORC 4OD3H 1PZDA 2YMTA 5B3JE 5IHZB 4WHTA 3L3HA 4J8RB 5IF0A 1CFNA 5EOTA 4RNRB 2GBUA 2HMIC 3EZJB 3NJGA 4M29A 4ODUA 3REVA 2VABB 4DW2L 3T4AC 1CGSL 3I02B 5INDB 2ALWA 4NKDA 2J1KA 35C8L 4N5ED 1NGXA 4DNLA 5D72L 3EXLA 5CLWA 3I6GB 1J5IA 1W0YT 4EZMA 2E7LA 1A3RH 1VGEL 5F9OL 4UZSA 3G08A 1QUNB 2IQAA 1NEZG 3O3EB 2UY6B 4YHYC 5DJ8B 1BOYA 4J6RL 1W8OA 1F4WH 2AKRA 1HHKB 4NHUB 2W88A 4RAVA 32C2B 1NIAA 1GZQA 2VO8A 2HJKA 4L9LB 4M7ZB 4U33A 3RDJA 1DBKH 5E8NB 1G9NC 2XG5B 2HT3D 2ICEC 4IRSB 4AXWA 3QDMD 3PJSA 4XAWH 5BMFL 2NY2B 5DC2A 1H8OA 2X4TA 3MACL 3Q3GA 4MA8L 1WIOA 3DUSA 4LMQE 4Y7OC 2WIMA 3NQKA 4GEIA 1IBDA 1HQ4A 1GZHA 3BD5A 3FUFA 2A74A 3HPLB 2YLKA 2AJXH 1A3QA 2EDXA 4MZRA 1PYWA 3AABA 3VI4B 4HWUA 2YC1B 3WUZA 3MRFA 3KH4A 4LSDA 4JUTA 5FHBH 5TGBA 5DHYB 3X1BA 3RWGA 5KN5A 4P4KB 4QEGA 5EU6A 1OW0A 2FUQA 1Z0MA 3QP3A 3P73B 4UMSA 4PCTA 4B9FA 2BVTA 1HQRB 3PGFL 5FA3A 1URIA 3VX1A 1FBIL 2X3AA 2DY2A 1DSYA 1YHPA 4WY7H 3KPQA 2JJSA 4CN1A 1P2CB 2Q8AL 1AACA 2DWXA 5GISL 1IKNC 5HGBA 2O6CA 5EDXA 2IAMC 2MCMA 3DOSA 4JGNA 1F6FB 3WE6A 3F12B 3SE3C 4MMZA 5I1HH 3WSQH 5EF2A 4PB0L 4XP9H 1F4AA 5ETUA 3DBSA 3CXFA 4UOQA 3FSVA 4KI5E 2H6UA 4FFZH 2Y6SD 2IEPA 3MJ9H 1QMUA 3UCRA 2JK5B 1S78D 1JMXA 2Z0BA 3DUUA 2N56A 4JVWA 4KJYA 4LLUB 5E99H 1OSEA 4MHHG 1T89C 1CDYA 5F7LB 3PWPE 4AUYA 4LVOB 3G5VB 4OCMC 4UOJA 4ZQTA 3H2PA 2FX9L 1FZMA 1JNNH 3GXTA 1JZFA 4YDJB 4HS3A 5CP7B 2VDOB 2A9CA 1IM9A 3ABGA 2YPKA 4XB7A 5ICZB 4X6CB 4OZHF 4L3FA 2BDNH 1J8HA 5I6OA 5DD0H 3QEGL 3SPHA 1ZLEA 4PAZA 5E1AA 1PY0A 5T1DL 3WFBL 1AR1D 2W59A 3HIZA 3S88L 3C09C 1G6RB 4HEPG 4WENB 4TUJA 4UT9H 5FGBA 5C2UB 5H4YA 4GIOA 3DXAE 2EEXA 3AXIA 3X11A 4BK4A 1NUNB 3AZUA 4BUGA 3GINA 5LDSA 4PRPD 5BQDA 4APQB 2CK0H 4B27A 4UQ9A 2BY3A 3E1ZA 4XTRC 2LTQC 4QLWA 3V0WH 5KOVC 2NUPA 4GW4B 4Y5XC 2KPNA 3KWWA 1CR9L 3W39B 1U8CA 4MFHA 3TM6A 3K1DA 2FLMA 3MNDA 4R96B 2VSDA 4OGQC 4PBXA 5GRVK 4IRZA 1UXSB 1KGIA 4JQIH 1AGEA 1N8ZA 2FJHB 4XP5H 5DEFB 1F11A 3L17A 1HC1A 1MUJB 1YA5A 4RFEB 4UNVA 5EC2A 4L5FH 3REWA 1JPTL 3PPSA 1XGQB 4GAAA 5L2KA 1FZOA 1UD8A 1NGYA 1NCWL 1O5DT 3DX7A 4IBYA 3FB7A 3HTLX 3QXDA 4L8BA 3FQYA 1KJ2L 2ZAGA 4N2EA 2Z4QB 4PW9A 3S2AA 4Z7QB 1TJGL 1KB9K 3OXRB 5SX4I 3QQNA 4M1DH 4ABVA 3D2UA 2OTWA 1LO2L 4JO1L 1BQ5A 1XGTB 1BQHA 3K1KC 3BVVA 2A83B 1IAII 3Q5YA 4U1IA 3VCLA 3JYBA 1RZPA 1SYVB 4IIQA 4WF7A 4ZMPA 5E5RB 3MV9E 4KWUA 4MS8C 2X4NB 2CPCA 3ULUL 4PPTA 1NC4D 3OM3B 3RVUC 3ZDZE 2BVOA 1AD0B 4HUKB 2Y1VA 4H1LB 5EIVA 2OSWA 1IL1A 1CJYA 1TJGH 5C09D 1BEXA 2Y7NA 3EYQD 2XETA 2JV6A 1HINH 1FGNL 5HYJD 3II2A 3VWKA 4M4RA 3MBED 4QHLA 3WJJA 2LV4A 2PMZA 2MKLC 4C56E 3WAJA 5I82A 2XXFA 1NC2D 4PR5A 2HTKC 1HQ4B 4B41A 5CBAB 1PG7H 2XN9E 4L9DA 1DO6A 1RK1B 3QRLA 5AVVB 3PAVA 4WI3A 4I48B 3FULA 2H0EA 3VCLB 3EH1A 2J5LB 1M56B 3AITA 2OMVB 4O58L 1DVQA 5FYJD 2FR4B 1Q9LA 1TCMA 4M8QA 4AGLA 4U4IA 1AE6H 4KZEH 4YSUA 1WZLA 5GS2H 5T1KA 3BGFC 1U8JA 1UXWB 2YGQA 4PJFA 3T2NL 1SOSA 5CR8A 2ALAA 1KNOB 3C6LC 3F7VA 3ZOAA 3LZLA 5BVPH 2IQAB 2AW2A 5GGRA 5CEYA 5I1KL 4U1LA 1A3LH 5T5NG 5KEZA 2WB1A 4GT7A 3N5AA 5FS5A 4MJJA 1SOXA 5B8CA 3K71B 4X6CE 4ENED 3IFNH 4LSSH 1HL5A 4BHUA 4U6HA 2NUPB 4DHLA 1P9MA 2VQTA 3DETD 2YFOA 1QTPA 1RY7B 3FB6A 3VI3F 1T2QH 3H3PL 5D8JL 5IW6A 5C0DB 4HW6A 1S9KC 1JGLH 5IB2B 3LS4H 2FEDC 5HVHB 4AH2B 5JOEA 5JQHC 4P8QA 5GSVA 4I1PA 2X09A 1HHHA 3U79A 5TDOA 4OM0H 3A21A 4PFEA 3TIDA 2CJUL 3B2PA 4XCNB 2VXQA 4TUJB 3MRGA 3I75B 3RWJB 4NWUL 3F58H 5K39B 1NJ9A 5I1EL 3VFWB 4GS7C 1HHJB 5D7LA 5EBMA 3BI9X 4P23B 3F6IA 3N1FC 5AKSA 1BMZA 3O2WH 4DP9X 2H32B 1AO7A 3BWAB 5KVMC 3L3OC 4LHUG 2GCYA 1LO3L 1ODAA 1OCOB 1WT5C 4FJYA 3C8KB 3CX5J 4HH8A 4XT1C 4PJ5D 3LVTA 4P5KA 2JELL 1H8SA 2XKSA 1H5BC 4ZFQA 3SEPA 1JNJA 4QXWA 4HAGA 4JFZH 1NFKA 3TH2T 4KAQL 1NAMB 3FMGH 4ZMOA 3I84A 2CGYA 3ESNA 2W0PA 2FEDD 4ODHL 8FABB 1UZ6E 4HHWA 4TUKL 3I6KA 1HNFA 1AQMA 4FULA 2G2RA 4DGVH 3U4EB 4K9EH 2FIKB 3KYMB 3BZ4B 1LQSR 3CDYA 4Z18A 4QRRE 2YXVA 3A23A 2EDTA 3N0AA 4L4TE 1M71A 2ATKB 4DZBA 4IU2A 1R5VB 3QT2A 2JELH 4FFVD 1B2YA 3J07A 4HAKA 2G0LA 4IRJA 1L9TA 2KLRA 5C07D 2Y5QA 1IL1B 3TJHD 3R4DA 3E6FA 3C6LD 3WL9B 3CN2A 4EUPA 1LD9B 4G6JL 5LNEA 1XAUA 2FUTA 4X9YA 3TN0A 1U8QA 3AT8A 3NCYP 3UYPA 2YD3A 1KULA 4NQTA 2BNRA 2R7EA 1AS7A 2D03H 4E5XG 4J3OC 3NGBB 4ZUVB 4KJWD 5TF1L 5DJ8A 4UDTB 4Q56A 1IKFH 4LCIL 3RU8L 3IMBA 2ICEB 4IRSC 1AO7E 3RL2A 4LEBA 2VDKH 4AG4H 4P23C 3Q8FA 4XN8A 3U1PA 1AY1H 1F41A 4PJGA 1E9OB 3I85A 6CGTA 1OGPA 3OKDB 1AD0A 3UPAA 5EOCJ 3QH3A 2GJ6E 3JZYA 1E40A 5I1CH 2FO4B 2GJRA 4YWGL 1TEGA 3I6LD 4GI8A 4FS0A 2IPKA 1ASOA 4J3OF 4MAYA 4P3DA 5CZVL 1QQDA 1D5MA 3LMJL 1SXZA 2YLHA 5DA4A 1BQHB 3QISA 5EEYA 1LE9B 1TNMA 2YXWA 2DTML 5E6SB 5H37G 4W4OC 1QFWH 3VXPA 4OAWB 5CM1A 5C08E 4ZXBA 2DBJA 2C9RA 2GK0A 3BQUB 4K5MA 5B38B 4KTEH 3FU0A 2BSTB 3BDBA 3DROB 4JM2C 4LCCB 5LAXA 4NKDB 4WV1A 4N3TA 3U9PH 2NNXA 1H6UA 3MUY1 5ESVA 4F8PA 4WUUA 4XX1G 5I8OH 4Q9QH 3H54A 3QCUH 1NCHA 4XGZB 2P7TA 5DMJB 1GTFA 1O6TA 3AB0B 1KB5L 4GT0A 1VERA 4QLRA 1N59B 2D2OA 4QO1A 4QRTB 2QLYA 2OCCB 3RGVD 5IVZA 1K6QH 4GP5B 1C1EL 1FIEA 2VLRD 4TUOA 1K5WA 2G9HB 1HNGA 2IOMA 1I1AD 3CJJA 1E43A 4OLXH 5D1XC 4NKIL 4OGXH 4HFUH 4FXGC 3HE7B 2Y24A 1N3NA 1IM9B 1SEQH 3ESPA 5GRZA 5EG6C 2A9DA 2GY5A 2KH2B 3VFMA 3ATEA 4RMUA 3OLIA 4FFVC 4M5TA 1ACYL 1G5GA 5MP6L 3QO1A 4C54A 5ADPL 2ZUTA 2Z9TA 4CMHB 3MJ8A 2BOLA 3FTZA 3OWEA 4OCXH 3GRWA 2IQ9H 4HIEA 2D7OA 1JWUA 4P46C 2KZKA 3LIZL 1IAOA 2WXQA 2OZ4H 2YPKB 1OB0A 3TVMB 1FFRA 4UTBH 4BZ2L 1QNIA 3IDNB 5IUSA 5BNXD 4MQXC 3U7YL 4AW4A 4QRRB 4R90H 3X3GH 4C83B 3DSFH 4NQSA 2PPFA 2DM3A 4XCYA 1CFMA 2R56L 1AGFB 1JGVH 4AVJA 3V4LA 1TG8A 1AZBA 1F8TH 1GW6A 3FONB 4EOWH 5EU6B 1HVXA 4GKNA 1BGXL 4H0HB 3Q1EA 1ZJBA 4K3HA 5TDNA 4F2MB 1MIEH 3UMNA 4EZLA 4UTBL 1QO3A 2G30A 1UOVA 3ARGC 4WTXA 1DANU 4Y5XA 3SE4A 1CFQB 4JO2L 5J89A 2BWQA 4E9SA 2AAAA 2WBXA 3LY6A 3NRPA 5GHWH 5DMIL 4MJHA 1R46A 1CE1L 5ESQA 2OA9A 2UZXA 3VA6A 4OT1H 3P4MB 4NQDA 2ICWI 5FA3B 2Y7MA 4LDCA 4ECNA 3O4OB 4P5TB 1F8TL 4FFWC 3PWLA 3WFCL 5MEPA 1CIDA 3ZL2A 1S3KH 4X7FC 1UURA 1I8KB 1BIIA 1TJIH 2VH5H 5ID0A 3IRZA 3P4NB 5ABZA 2X3CA 3BP5B 4MMXC 5J6GB 3I75A 2OR9L 4N25A 2D3VA 3BZEA 3V0VA 4C57C 1RURL 4PGDA 1F1GA 2XBTA 3HFML 3WKPA 1ZVSB 4U1MB 3HI1B 2PPAA 4QRTA 2XXCB 1UOKA 2FYVA 3CFEA 1E27A 4XMVA 4GUPB 3UO1H 4DERA 5K1VA 1FZJA 1ETZA 2OMWB 3CVIL 4N22A 4LGSB 3H42H 4N2KA 1OZUA 4PVMA 1LNUA 2B1HH 2QJDA 4ZMZA 3A67L 4WO4A 3T3PB 5AAPA 4Z1PA 4QHUB 4ANXA 2XZZA 4JFQB 4MD0B 3DPBB 1MHPH 1DQIA 3W56A 2F7PA 4TNVF 4R6UA 3PFUA 4A6YH 4G1EA 2P26A 2VW7A 3PP3H 4JKWA 3SE9H 4DKFL 1MFEH 1KIUA 5I1AB 2ORBL 1NFAA 1K3IA 2FZ3A 43C9A 2A73A 4OM1L 2E56A 2DOCA 2NCEA 3UP1A 5AW4B 4QHPA 1XT5A 4H8PA 5E2VL 3VXRE 3CTTA 5AVTB 4JX0A 2CUHA 2OMVA 1QKZL 4ZUUB 2BNUA 1HS6A 4QRRD 3CFNA 1BQLH 1FNLA 1HEZA 2EIMB 3E2HB 4Y1AE 2N7SA 3F00A 4ZZKA 1X9LA 4YX2H 4ATWA 3G3LA 4OD1H 4IKIA 3A6CL 3AWGA 5CHNB 5CGTA 1ANUA 4UTCA 4LSPL 3RNQB 3CHPA 2F2HA 4GB9A 3GJFA 3DX3A 5D93B 5FGRA 3FPXA 3FT3B 2IDSA 2XJLA 4IMKC 1T1XA 2IOIA 3WJLA 3HG5A 1WC7A 1J5OH 2AK4E 1UOWA 2FH6A 4M6MH 4Y19E 2AJXL 3MUGB 3QI9B 4X6BA 4OUUB 2EYTB 3ASWA 4NBYB 3UAEA 1YQVH 4OLZL 2Q6WA 1ZA6B 4A63A 3BHBB 4D0BB 1QLFA 2V9UA 3QUHA 4FNSA 1EO8H 2O5YL 4U3HA 5TFSL 4MJ5B 1RK0B 4MA7H 2VN4A 3ECVA 3D4GA 3VAEA 1DN0A 1FYTB 3CX5K 4CBZA 1JZHA 1TFHA 2HKHL 1D7BA 3ELQA 4FFYL 4GAGL 3L1FA 4W68A 5DHVH 2WBWB 2BJML 2W1NA 3FN3A 3BWAA 3CAFA 3US9A 2XN9B 3KLKA 3FO0H 3QEQA 4OLYL 4GRMA 1EHKB 3E0GA 4DCQB 4GOSA 1C08B 4MNHB 1SY6H 5ICXB 1QFWI 1O9WA 2AGJL 2NX5E 3GIVA 4WHYG 3RGVB 2UXFA 1X44A 4PMEA 4XPBL 2Q7NA 3RUGF 4AT6B 2WBJC 2IFFH 3CVCA 3BEWA 3PHOB 5EEUA 2LVEA 4XTRD 4JCLA 4YHML 2BJMH 1KXVA 4ANUA 3H3PH 1E6JL 1N5AB 3BN3B 3N50A 1R24A 4NC0B 4BFEA 4ETQA 5LVEA 3E9TA 4IOFC 4F3FA 1NAMA 1U8CB 2W94A 1GJWA 5D1XE 3MLTB 3GLEA 2APWA 5H94B 3GBDA 1TZIB 3NZUA 3E1F1 5E9AA 2EICA 3T4AB 1S3RA 2GITA 2H5UA 1PJ9A 1UWEH 4NZRL 4FX5A 1ES0B 5BRQA 3D52A 5M94B 1UADC 4P2QB 4NM4L 4WTZA 2VCOA 1ZANL 7CGTA 1LP9E 3FTXA 1U92B 1VPOH 3EYFA 1JXGA 1J1XL 1FVDB 2ZSWA 5SV4A 1J5CA 1XGRA 1G9MC 4AEFA 2GTWB 1PAZA 4H8WC 4QRUA 1B3JA 3V6OA 2VERN 5E9NA 3V6OE 1D6VH 4MASA 4R4FL 2JB5L 3FFCD 4YHIA 4PS4L 4R26H 5D93C 2WBJD 1R75A 3UO8B 1T21B 3MJ6A 5JW4N 5T8IA 2R2BB 1UUNA 1T6VN 3QJSB 4U6VH 5HBBA 1P7QD 4UOZA 3U25A 4HPYH 5L88H 3U83A 4NQVA 1HOCA 1E4XH 2WZPA 3GBML 2GY7B 1V05A 5IJBC 1DJWA 2PN5A 1MCCA 2R4SH 1UVQA 1QSEB 4HKZA 4PG2C 4KY2A 4PJGB 5I19L 3WFHA 5GZOA 3FOMB 3GMMA 3NJFA 4OAWA 4NAQA 5C6PB 3ULUC 1IT9H 1SYSB 1FUNA 3N41F 3CSFA 3MV01 5EO0B 5LBSA 4DIXA 5IB3A 2AQSA 3MRKB 2JWYA 4Y1AB 4LAQH 2X2UA 1I9IL 1RK1A 2DBLH 4R0LC 3WD5L 1T4KA 4M1CC 3I50L 2NNCA 1IGFL 2XWBB 5DJDB 5AOIA 1SJHA 3EYVA 3FH5A 4HVBA 5BO1H 3MU3A 1FFOA 4RLDA 5DEGA 1KZQA 3MACH 2PLTA 4FTDA 4UT6H 5FO2A 3T0XA 1GGIH 3Q6GL 5I1IL 2ADFL 2V5MA 4Q14A 3GXUB 1QACA 3MUGA 1U3HA 4H88H 1M7UA 4PR5B 1HILA 1BW8A 3QXDB 4L8BB 3TYFB 4N2HA 3V6OC 3GJFB 2J20A 3V4VB 5IBUB 4KH9A 2FX7L 3D0LB 2CAKA 4G8EB 1IGFH 2FIKA 3QFJB 2ZYIA 1YMMD 2JE8A 3NDYE 2HJLB 1F86A 2DWDA 1WH0A 3RWEA 4IHOA 2Z31A 4NYLB 4R96A 2AEQH 1I4FB 2B3IA 1HSBA 5AOZA 5EORH 5FUOH 2EYRB 3RNKA 4LGPB 5IFJA 4HIHB 3M45A 2HXAA 2V7NA 3SKUD 2AK4D 5IG7A 5DO2C 3RL1B 3MRJB 3I6SA 5DJ2B 3IETA 3DMMB 5D71L 5E00B 5HHVL 3VGEA 2WYZA 3CQPA 1NCTA 2KZBA 5ACZA 1RH8A 4FQLL 5EU7E 1WE5A 2AJ3A 2AI0L 3KWXA 4P9HC 4UTAA 1YG9A 3NCCB 3TVMC 2CSPA 4B95C 1TF4A 2CLZB 3G6JE 25C8L 3CX2A 5TQ2L 3AWFA 4JFUA 1G6RA 4GW5A 3ARBB 1BZDA 4LSVH 2VDMH 3OR7B 5DUBA 4NN6C 1F58H 5JOPD 3FTGA 3QQ3A 2WKGA 1IZKA 4PY8I 2ODHA 4S0TD 1C5DB 2XOTA 4XCCH 2YEZA 4FXLA 4X6CA 4D0CB 4OF0A 3V5KB 3S5LG 3OKEB 1KJVB 1ZA3A 2GUYA 3CSBA 4LB8A 4JN1L 5DD3L 3TNMA 3OKEA 3HI5H 4B5ZA 4HMDA 4L48A 4HG4J 4LNVA 1JHTA 1NCJA 2NY6B 4LRIC 4EVNB 5GZNC 4TL4A 2XQYG 3VFWA 1HJBC 3TXAA 3NVQA 1E65A 1TTFA 3EOBA 3B9KC 1PD1A 3DUHA 4TNGA 2KQMA 5FUCC 5EO9B 4UM8A 3QRFM 1FFNB 2OJZL 4BFKA 4JPVL 1CURA 2ADIA 1JPGA 2B1AH 2B2XL 2G3MA 3BZFA 4OFIA 1K8DB 1XF2A 4WFHE 3BQUD 1NBYA 3HG1A 5GRXG 2Q10A 2MOVA 1T0NB 3AREC 4LAJH 2VUYA 5DT1H 4H0GA 4ZW5A 3IETB 2CA4A 4V33A 1NSNH 4F1ZA 1E7UA 1WRFA 1DFBL 2PUQT 1WFTA 4PY8J 1IUZA 4H13C 5A16B 1W80A 3DWTA 3MLZL 4AI7A 2FGZA 1D2OA 2R1YA 5CKGA 5FUZH 3GUFA 1EERB 3N9GH 5KWYC 2NY6D 1Y1DA 4XE5B 3KGSA 4LNRB 4W6WB 4Y88A 3U2JA 4F58H 3D33A 4XN5A 3F7VB 2ERJB 3HZ3A 4I2XE 4YHKL 3SSGA 3ZK0A 2V5RA 1JGIA 2OW6A 3MCKA 4JJOA 3BO8B 1LVEA 3EH2A 1Z5YD 5HHPA 4YDKL 3SDCD 1VIWA 3ESVF 5C0CD 5FX3A 1BD2B 4CJ1A 4K23L 3DX9B 4LSTL 2R0LL 2PCPB 3H1ZA 4PJCE 5FUZL 2BDNL 1SXNA 2MHAB 3QIUC 4NKMA 3GHPA 4H25B 3LV3B 4ISVA 2BVOB 2XG5A 3EDEA 1CICC 2NZ9C 1Z3GH 1XMWA 1QP1A 1MHCA 4AIOA 2EQDA 3GS4A 4QKXB 3GMNB 4I3SL 2Y07L 2F58H 2Q0ZX 5I75B 4AOFA 6PCYA 3N44B 2A9MH 5JMOC 5FYJL 2AJSH 5JZ7C 4OKVA 1MI5D 1FNHA 4NP4H 3BKJL 4GO8A 4I9WD 5D70L 3FZUD 4NGHH 3CH8A 3T6VA 4K8RC 4XOCA 2X44D 2YWZA 3OXRA 1ZIAA 1NBVL 3FBQA 2OYPA 1JE6A 3VXTA 5JYMA 5L2JB 3GPEA 3EUDA 1GJIA 3D0VA 5C09E 5IQ7L 2R15A 4NNXB 4XO9A 4PGJA 4IMLA 2D3LA 2VDNL 3II1A 1E8ZA 2B5IB 3QJQB 2Z92B 3RIFF 4XP5L 1WAAF 1XCXA 2BS9A 4CRPA 4WGKA 5IB3B 3D50A 1AXTL 4QF1A 3G08B 4AXWB 5IR1B 4KZEL 1XHHA 4DZ8A 4NS0A 4BGLA 2FLBT 2I07B 3F05A 4FP8H 1CQKA 3U6RB 1RJCA 4YJZL 5K9KB 3VB9A 4LP8A 3IDJB 1XR9B 2OMTA 3LKQB 1MEXL 4M1DL 1OAKH 5EUOB 3NCBB 2XZQL 3CFKA 4PIRF 4YPJA 4KXDA 2F5AL 3TT1L 3P3SA 3V4VL 3QIUA 3DRTA 1Z9LA 5ADOH 1YYML 4R97B 1KEGH 5IHZA 1A6WL 1N68A 1CFTB 2F68X 1NBZA 4I18C 3T3MB 3IU4H 3X1FA 5I0DA 5D1QA 3PABA 4AEEA 4ODUB 3QCTL 1PZ5A 3SQBA 2EVHA 3OKKA 5EOTB 4X5QA 2R2CA 4Z7WE 3RGBA 1SDDA 3KPRB 1L3WA 3LXUX 3QRGH 4IKJA 4WHCA 1R0AH 1JVKA 1R34A 1PX3A 1BREA 1REIA 1VFAB 4EN2A 4MAYC 1A4BA 1A7NL 4CADA 3SPCA 1E4KC 1NEZA 2OXGB 3BT2L 3D5OF 2AQQA 2AQ1A 5EFIB 4I1RA 4JY5L 1DBMH 3NSXA 4FI6A 5E6RB 4BCZA 3W0WD 2VDOL 3W9EA 3K7UA 2ADYA 3TO4B 3DRQB 3D7PA 2R23A 4FI8A 3V9EA 1CICA 4JFWA 3H9YA 1BM7A 1M7IB 2D7MA 1FGVH 1QRNB 1C8QA 4KRPD 1GJUA 4MRCA 4DK3A 1BGXH 1NL0H 4BE5A 5A7EA 4JHAH 4PEEA 2EDLA 1IC4L 4PJBA 1CBJA 1ACXA 5E1QA 1EMTL 1P1ZA 1Q94B 2MCPL 5JPNA 1P53A 3NZHH 3QWOB 2VDOH 2O61A 4LL9A 2AJUH 3ECWA 2BMKA 3IMRA 5TGBB 1C08A 4AV4A 5IJKC 4MZ2A 5F7HA 1JI2A 1JF1A 2G2PA 3GJFK 2UZIH 5I30L 5IJCC 2C1OA 3SKNA 3CN0A 4HUVB 4NFCA 1DQVA 1P7KA 3RIAF 3CFDB 1HZHH 5I8CA 1Y6NR 2PWEA 3RDTD 4O2CB 3GLDA 4KK9D 4LOVA 3EGXA 3JUZA 4WCYL 2YN5A 3ECBB 1KJMB 1GHFL 5KYYB 1MCPH 4PU2A 1MWOA 3LNGA 1IFHL 3HN3A 1HH6A 2O26U 5KN5B 3CXHK 1TO5A 4B9IA 4F7PB 1FO0H 5D1XB 3UC0L 5ANMB 2EDFA 3SCMC 1UQSB 1BZ8A 3B7TA 1ZK5A 3O81A 1ZLSH 2IBGA 4Y89A 4OCYH 5JLZA 3MLYH 4Y8AA 1P7BA 4JKLA 1QSFA 3WHXB 4NO0D 2CKBA 1DEEB 4X6DA 1YN7A 1MG2C 4ZW3A 3UPCA 1Z2KA 1L9OA 4MB4A 3F2LA 2D3JA 2JI2A 1BM3L 1TZ8A 1WD9A 3FU8A 3LS5L 4JKPL 4MAYB 4XO8A 5E08L 4JEGB 3KPPB 4X8CA 4UM9B 3B83A 3IJEA 5AUMA 3GMRA 4A7VA 3LIUA 4RWYL 2OK0H 3FTWA 4I7ZC 3MLXL 4X9GA 1KN2H 1P4LB 4JLRA 3MV8D 1JV5B 1WCBB 2B0SH 3QQDA 2ZXCA 4GKOA 5IVOA 2DQCL 4NOFA 4NQEB 2X7LA 2P5WD 5DHDA 4E9VA 4J3VA 4HLZH 4WFFE 2NY0C 2IH9A 4YQXL 4O5LL 1M6OB 4R0LB 3T3ME 4WDIA 3WNMA 5DGRA 1ET5A 4DAGL 2CBMA 4U7SA 1G5AA 5GZOD 2APFA 1CFSA 4IBSA 3JTBA 3ARDB 1EJ8A 2EIBA 4YX2L 2AK1H 2DM4A 5L4IA 3D39A 1ZLVK 2DEYX 2WO4A 2VLRA 1J9SA 2FEEL 2MPAL 3KDPB 4HC1L 4LSPH 5E6IC 3L3JA 5AQ0A 4GUPA 3C60B 1ZDSA 3T2OA 4RX4D 2P8MA 4NJAL 5C0GB 2YZ1A 1O75A 1YVLA 5KYXB 2DZEA 4WWPA 5LHDA 3ZQWA 3UFIA 4M02A 3HS0A 3EO0A 5C0CB 2ZXDA 3HI6H 4H20L 5K93A 3GSNB 3T8MA 5B1AB 5CBEB 1JVLA 3FQWA 4FLHA 1U95B 4NP9A 4UILH 4B6ZA 3B9AA 1U3HB 1UXMA 1KYDA 3VXOA 2HVKA 4KKBC 3PWLB 2BIQA 5J1AB 1BZOA 2VM9A 5T3XD 2EINB 3IGUA 1FFOB 4Y5YA 4QHKJ 3OMAB 1UB5B 3SGJA 5EU5A 4AYID 4W93A 3RPIA 5GGTL 2AXWA 4ZXBD 2NQ3A 3F7PC 3LRLA 3CFUA 3STZB 5HVGB 4WNJA 2AJZB 12E8H 3OXSB 3KBHE 4KROB 2AK4A 1XIWB 2WO3B 4GG8B 4Q2ZA 4JGJA 3DTXA 3VD2A 4H0LC 4AYBA 4FYSA 3ZGHA 2PPEA 4Y4FA 2Y36L 2KLSA 2VMFA 4U1HB 3GSUB 3KPOA 3QIBB 4EI5A 2AZAA 5JIPA 1YPZB 2HT2D 2VLKA 5AVQB 5DD1H 3BJLA 1E90A 5GSRA 4CA4A 1NWOA 3ZTJG 3SBPA 3NFPA 5D6CA 1CK0H 4TTDD 2NOYA 3FCGA 4EUPH 1P4IL 3L3GA 4NZ8A 3M1CA 3KXFA 4HZ1A 4JANA 4W81A 1KGUA 3O3AA 1RIVL 3F7KA 3IXTB 1OWWA 2X88A 4GQ9L 4PHXA 3V6ZA 3SQBB 2Y1AA 1IU1A 5HI5C 4XVJH 3LKOA 3D6GA 2ESVA 4P57B 3QZLA 1DBBL 2AV1A 3TBVA 5E9DA 1QX1A 2EZ0C 2QKIB 1T1YB 2P5WB 4U1JA 5DJ6A 1HYRC 5DD1L 3WEXA 1MAJA 1CF8H 4GAGH 3V4UL 4W9EC 5EIIA 3L3IB 1I8LA 4G8IA 3KHQA 4U1LB 1R3JA 3GQFA 5HYFA 4NT6A 1JZEA 2BINA 3OB0H 1RIVH 3VFMB 4JQXA 5HY9A 4MJIA 3BAWA 2FK9A 2YQGA 3GDCA 4LZKA 3U1SH 4P2RB 4GRLD 3QJRB 4PJ8B 2RR3A 1QFWM 3FHQA 3LVEA 4LLQB 1EZSA 4MZ3A 4RRPM 4WRLA 2CO1A 4GP8B 5KYUA 2EUXA 3N40P 2OTUB 2COQA 4R90L 3HZYB 1QHOA 5GGTA 4PBVC 4Z0XA 1XEDA 3IB4A 3MGTB 4FQCH 4QTIL 4RFNB 4ABUA 2HSIA 3HVNA 1SLWA 2HKFL 1ZHLB 3OAYK 3WELA 4H8QA 4OJYA 1E9QA 4QRPB 3APDA 2Y2TA 3VWJD 4MQ7B 1MIEL 3MRRA 4HLEA 4Z95L 3VXQA 3NIFF 2MH4A 5I8EB 5CJOL 1B4LA 2ZUXA 1A8JH 2Z91B 4MMYA 4OV5B 3FPYA 4WTWA 2VDNB 4ERSH 1AYOA 2HFFB 4QD2E 2WQXA 3G5WA 1HCFX 3L95B 1KCSL 4AMKL 4U0QB 5JYLA 1XVSA 2F8OA 2R7EB 4PGEB 4ZK8A 2ZCLH 4YE0A 2BW4A 3IDUA 2WM0A 4JDZA 2ZWNA 4JDEB 1KJ2B 2EYRA 4D0BA 1LP9A 4R26L 2I32A 2GG1A 3MZTA 5M95B 1A4KB 3GSNH 2W9DL 2HFTA 2BSEA 4ZS6D 4F7MB 1KOAA 2FHCA 3GFUA 4PP1D 3T2QA 4XXWC 2QHRL 2YKLL 3BH9A 1DDHA 1OSPH 4QCIA 3RWCA 1A4CA 5C97A 2HJFA 4FG0A 3LQAC 4W9HC 2VN5A 2BW5A 3EOYG 1NKOA 2JLLA 3QQ4A 1MRFL 2FE0A 4HPOL 4YIQB 4QPEA 5CXPA 4XPGH 5EOCL 2AV7A 4JHZA 2CBOA 5AG8A 3U48A 1J48A 2YK1L 1MRDH 3M6DA 3KPMB 3ZSSA 5F96L 2ATPA 3TJEL 3VFPA 3VGHA 5GGUA 3VRJB 1AXTH 5CWSB 5DRNB 5EPMA 2AAVA 3T8XA 1MHPL 3MRHA 3N43F 5DFAA 3EDJA 4UMGA 3QDGD 3VFUB 1XQ4A 1JHTB 1M1SA 3IXAA 1BPLB 2HTKD 3EBIA 3KPSE 4Y4KB 2E7BA 3RWHA 2XVLA 5AOLA 4JG0L 4URKA 5EDSA 4PJCF 4XE0A 5DK0A 1NIDA 2IFFL 3J7HA 1MWAH 3PGDB 3Q5OA 3ARED 3Q06A 1OGTB 1U2CA 1QPKA 1UATA 5MEOB 3HCVB 3KPRD 2D31A 4BDVA 4DTGH 1M1XB 1VFMA 1OGAA 2BWDA 4UNTA 5D4QA 3D4YA 5CMAB 1UM6H 2ZUWA 5FK9B 5HDLA 5FV1L 1PZ2A 5F7EH 3C6EA 2X38A 1A0QH 1MFCH 2Y06L 3UZEA 4XBEH 4YDJA 4XNZC 2GT9A 3QORA 3TYGH 1EANA 2W81C 3BH9B 3U4KA 4D8PA 3PL6C 4QMEA 1R9FA 4ZAKB 5F21B 1N0XL 1WBZA 2ZWZA 4ZFOA 4XP1L 5K39A 3VI3B 1GMEA 1FV1A 2EDRA 4XZ4A 2VW4A 5HHMB 1W2KT 3TBTB 1O5PA 5DD5L 5CO1A 1AP2A 6PAZA 5DS8B 1WAAE 1TQWA 4NT6B 5CZKA 3TA3C 1EDQA 2HJLA 4JY4B 1E9PA 1WIPA 2EE6A 3X12A 4CAGA 3IBOA 3K74B 3N6YA 2DIEA 3U4BL 3QEQD 4LLYB 4J23A 4BA8A 4MAUH 1WYJA 2OSYA 2VZVA 2HLEB 4L3ED 4Q58C 4UAOC 2UXGA 4RIRA 5AAWA 4UZGA 3ULUE 4WU7B 5EU7C 3QS3A 4JDVA 1O7DE 1HJCA 1IC4H 3GRGA 2H0JA 5J8OA 3SDXF 3VJ6A 3QJVB 3SDAD 1WGVA 4UQBA 1E8XA 1N2RA 3O2WL 3QXTA 2V8LA 1RUPL 5FCSH 2VL5A 4TULH 2BP5M 2ED6A 3V0GA 3JZ7A 4F58L 1BAGA 1I7TA 4EXPX 1JZ4A 4DEUA 4XMWA 3P3TA 5GGVH 1MJJB 3WHE1 2YBRB 1IARB 3RTQD 4LEXL 5ILTL 3N1PC 1LM8V 3SCMB 2IPUK 1A65A 2ZXEB 1JRHH 4PLKC 3L8QA 3IGKA 4PJXB 4RFOL 4L8DA 3PP4L 4HGKC 5T1DH 3WFBH 2NRDA 3GXIA 2E4TA 2LR4A 3QS2A 1J9CT 1AH1A 1T6WA 5I17B 5JORA 3P73A 4IGBA 3QQ9D 3CPUA 4JFYA 5DRWB 1AHWC 2GB2A 4ZPTB 2WJ7A 4HCGA 4KDTA 1EH9A 4QT5B 1KFGA 3FOMA 3GMMB 4U1SA 3VSQA 2FQEA 1CYWA 1T1XB 4I3RH 3PY9A 2YSSB 3ARFD 5DJYB 3DX8B 2DH2A 4G9FA 3LN4B 5IWLA 3GTTA 2MQCA 1FA4A 4PRAA 5LB1A 4M6NH 1KLFA 3MRIB 2IAMB 3IDXL 1NBVH 4L8SC 2J57A 4X7EC 1JK9A 4U0RC 1ORQB 4I77L 4LCIH 3RU8H 4R4BB 3N42F 5D1QC 3APNA 5BS0A 4JFOB 3TBYB 4D9RE 4YQXH 1PZBA 3HPJB 3VYOA 2VDPL 5I5MA 1JFQL 4OFVA 1OAZH 3Q7JA 1DQQB 2WTRB 2X6AA 4X5XA 4JGUA 4P2OD 3BCFA 5DHVA 4AX3A 1EAOA 2BSTA 3DROA 5T3ZE 2Y07H 2VLMD 2VLJD 3ZE0B 1UUSA 1NUFA 1TTGA 1V55B 4NENB 5EZOL 1T80A 4KROC 4QRQB 1K3ZA 4XX5A 5F9AC 4K3GA 2JIXD 4GRWF 3CDZB 3CVHL 4KHXL 5IEHB 3US1A 1N6UA 1UB5A 2J7LA 3HCVA 2X6BA 4Q9BA 1T0PB 2NYZA 3SKJH 2NY3C 4GBXA 5DSCB 4GW4A 4OLWL 4ZUWA 1B0IA 3JXAA 2NYYC 4G3YH 2ZXAA 3FCSB 4U31A 3HG1E 1UFGA 3AMKA 2C5DC 3ROOA 1AZVA 1U3HC 3V9FA 3O9WD 3T0BA 3QXAB 3D18A 3RAJL 1SM3L 1MF2L 5L7XL 4AYFB 2B39A 5CIPB 3E80A 1RAMA 3O2VH 1RD6A 2HFGL 4G5ZL 3T8XB 4KJYB 4M9PA 1I8IB 5IWLC 2VWEC 3I9GL 4G7VL 2R29H 1AQKL 5F7NC 4B9KC 1B9ZA 4AT6A 4XNYH 3SGEI 4TLTA 3R1GL 2AV7B 2NY1B 2ZT9C 1OT1A 4JRWA 3FQTB 3QUMH 2BH0A 3TN0B 2V0AA 1GC1C 3GZPA 3NIGF 3DV6A 5IFHH 3E6FB 4U0RB 4JW3A 4FTVE 3SDAC 1JV2A 4LXFA 3KJ6L 1KJMA 5IHUH 3SDDB 5HGBB 3OJMB 4P0DA 2WMPB 1IEBB 1MVUA 3NGBC 4BH8A 2NTFA 3QUXC 3IAQA 1XGUB 3BJ91 1I53A 1AQKH 1HQRA 3N9GL 3FTSA 3BAKA 1WA1X 4KX9A 4MNGA 2HYMA 5TDNB 2FL5B 4HFWA 2HAZA 2VYRE 1U41A 3GMOA 4HCRH 4LSVL 2GJPA 1CLVA 4PS7A 4OFQA 1DQDL 2NCMA 5IQLA 3V0DA 2V2XB 4N9GA 4PJXE 1XR8A 3BVUA 4GKZA 4HEMA 2YQ2A 1WQVT 4ABWA 1XSKA 4LCWD 4MKMA 4DGYH 1TYEB 1RUAL 3BYYA 1I1CA 5HVHC 5DMYA 4E9TA 2ZOUA 2JCWA 2D7NA 3THMH 1PTZA 1N7ML 1OLLA 2BNQB 2PO6D 4BFGA 1FIGH 3BPOB 3UTSD 4H8HA 1NGZB 4KKLC 3BWUC 4LBEB 2A6IA 4B5EA 4AM0B 2J71A 5EOQH 1R5IB 5FV2A 1JXFA 4KKCC 1E9QB 2FATL 4KQ3H 2CJUH 1AZNA 1UJ3A 2I9LA 1ADQH 4WSGA 3G6DH 1WJ3A 3L9YA 2NXYC 2OSXA 4JPSA 3B4NA 7PCYA 5I16B 4LP4A 2ZJSL 5ENWB 4LCYA 1MFMA 5JPMC 4GQZA 3HI1A 4IBUA 2IPTL 3QZWA 4P3CL 5FHAL 1A6VH 5E8EA 4OCYL 4FYTA 5JIIA 2DDQH 3MGOA 1ZLUK 5DO2D 3RKDD 1FFQA 3CH1A 4HIPA 1KGJA 5EN2B 5I76B 1LDPH 1NM9A 1FVCB 1WUZA 3R0MA 3CN3A 4ORGB 5B39A 1V3JA 1O6SB 2FL5A 2LHAA 1HWHB 1TSRA 2CUIA 3EHBB 3V4PH 3QWOA 4JM0A 2A6JA 1UWYA 3C08L 3ORJA 2UXVA 4P3CH 5FHAH 4K94C 4UNIA 3QPXH 3JWNE 5E1IA 4WQOA 2FBJH 1E8YA 4ZOCA 1FE8L 1KLUB 1ZS8A 1RERA 3M86A 5JHDA 4BFIB 4IYKA 1BAFH 1A3RL 2LGNA 3CDCA 3TF4A 4ZO9A 1SJEB 1LDPL 4KVCH 3ARDC 1BA9A 3OKOA 2ARJA 2PF6A 3NACL 1YNTA 3Q2CA 2JTYA 4NZUL 1TKWA 2WLLA 2GSIB 3A6BH 1OAQH 2VZTA 4S1QL 4P5TA 5C0AE 4Z5RA 3C08H 1BFOA 1IEHA 3JTSB 3HUJE 1ZE3C 4APXB 4K94L 3E8VA 4LESA 4TQHA 1M3JA 2D7PA 4BKTC 1U3ZA 3IDYB 4NGHL 1E4WH 2F53D 4NHCL 2AXHA 4OF3A 1QFOA 1KIPB 4TF4A 5JA8B 5MEQB 5I1GH 3X3FH 9PCYA 4OVVA 4EAEA 2CNYA 3B7UX 1QKZH 3OAUL 4YUEL 1MFBH 1TJHH 3ARGD 3E38A 3D3VE 1I1YB 2P5ED 4BQ8A 2GIXA 3WFEH 3DV4B 2HRPL 3QJXA 4XODA 3CMGA 4CW1A 3ZZQA 2A6DA 4XNAA 4Y2OA 4OBSA 3NBNA 1D5XB 3HEIB 3K2KA 3F65A 1V7NL 4G7SB 1U4EA 5DZ9A 1YNTB 2A5UA 1QYGL 2QSTA 4M6OH 3HC3H 3IKKA 4U1IB 2D9CA 2NUTA 2O6DA 4IRJC 3AQDA 3ZZLA 4JHAL 4KQ0A 5AL8A 4X5XB 3WDHA 4JRXD 3ECUA 5JXED 2H26B 1BP3B 3OSVA 3JWNH 1X7TA 1AKJB 1QWNA 2NXYD 4KXBA 2VC2L 3V8CA 4X9BA 1F02I 1G9HA 4DPCX 1CI5A 4UI2A 3JTTB 1I3UA 4FQXC 4HCFA 1YJDH 3AUVA 2VT0A 5EZLA 4AV0A 1D7CA 3ZGIA 4NUPA 4DQOL 2W0KA 4HC1A 5EMYA 5L8JB 4FA6A 1XF5B 3O45A 4Y16B 5K9KA 5C09A 5A1AA 1OK8A 5DVKA 4ELKA 1HSAB 3IPFA 2JNZA 1ZY9A 1R47A 1P6FA 4IJTA 5BJTA 3NCEB 1S7UA 5L4FA 5EA0H 1IKNA 1CL7I 2BFGA 5IHWA 5FA4A 1KPRA 1H3GA 1SN0A 1UYWH 3E8UL 2XTJD 3L5IA 1MCRA 3BQUC 4LCCA 5LAXB 1FC2D 4LK4A 1FL6A 1BBJA 4PW4A 3SQOH 4XPHL 5LXGL 3ARYA 5IP4A 2ZP8A 3SE4C 3PL6D