4QI3A

Cytochrome domain of myriococcum thermophilum cellobiose dehydrogenase, mtcyt
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
ENNVPNTFTDPDSGITFNTWGLDEDSPQTQGGFTFGVALPSDALTTDASEFIGYLKCARNDESGWCGISLGGPMTNSLLITAWPHEDTVYTSLRFATGYAMPDVYEGDAEITQVSSSVNSTHFSLIFRCKNCLQWSHGGSSGGASTSGGVLVLGWVQAFDDPGNPTCPEQITLQQHDNGMGIWGAQLNTDAASPSYTDWAAQATKTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
publication title Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
pubmed doi rcsb
source organism Myriococcum thermophilum
total genus 45
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qi3A00
1PL3A 1D7BA 1D7DA 1D7CA 4QI3A
chains in the Genus database with same CATH superfamily
3PGCB 4LLQA 4OZGB 2OCCB 1R3IH 3RUGB 3AMKA 4FFWC 1DE4A 3WLBB 4L8CB 2B3RA 4NLHA 4PRNA 1F0LA 3ZZSA 3BZEA 3KBPA 2H0FA 1E65A 1MIEH 4OF5A 3HUJA 3GUFA 3GTNA 5EF1A 4ODVH 4G11A 2VT0A 5HI5C 1H3TA 4ZTPL 2D0FA 4E0RB 3QFJD 4OIIH 5F1IB 2OTWB 3ARBD 5EEXA 4PS3A 3O9WB 4NI6A 4LIQH 4FQCL 1IC7L 5T1DL 5IF0A 1NCAH 2XQYA 5HGHA 3DX6A 3H54A 5TE6L 1U6AL 1X5FA 2GFBB 5E7BA 1YN6A 1LDPL 4JPQA 1W8OA 3MUJA 2CGYA 3IFNH 4FOMA 3LNFA 3DYPA 1T1ZA 1HQRB 4YOKA 1MWOA 4KKLC 4LK4A 1MKFA 4WW2F 2WKLA 3QEGH 3A5VA 5E6ZA 4R4NC 3L1OL 3V9EA 1EANA 3APDA 5I1IH 3O6FB 2DEYX 3FFCA 3MNZA 2FATL 3VVVA 2YHGA 4KH9A 2GBTA 2IF7A 3U30C 5I8KL 4YHNB 3O3BA 5JPMA 4H25B 5D4IA 4F15C 2WVVA 2NTFA 4FG2A 2IAMA 2NYKA 2WUBL 4UM9D 2J88L 1FFOB 2H45A 2P48B 1NCCH 3BGAA 3VFRA 1JWSA 4KO7A 4U4IA 4PQXA 5DMKB 5IWLC 5E5RB 3OC5A 8CGTA 5J9PA 2EXSA 3C6LB 3EH5B 1BX2A 1M9WA 1NIAA 2H6PB 3PREA 4FYSA 4NIYE 3FB7B 3TVMC 4HBQA 4H8WH 1A7RL 4OJFL 1K5NB 3HBQA 1SLWA 3A21A 3MQIA 1Z9SB 2QGDA 4ELMB 2FQDA 2JQZA 3CHOA 3CHQA 4JGMA 1T7XA 1NWPA 2F0CA 3LKRA 4HS8H 3MOQA 3V0AC 4Z23A 4PS4H 5T1MA 3CD4A 3TYGH 2TAAA 4AGQA 2OP4L 1ACYL 3DROB 4LCWA 4JM0A 1HZKA 4PRPB 4JPVL 5DK0A 3UL4A 3S36L 4AZ8B 2BVOA 2R7EA 4M3HA 5JW4Q 1HEZB 3GBMH 1NIBA 2EH8L 1SXNA 2WLKA 5FGCB 4HUCA 1QFOA 3ATEA 1G9HA 3NZ8A 4LBAA 1K5WA 3FQ4A 1YEHH 1RFDH 1VGEH 2AJXH 2G9HA 3ARXA 3U0WL 3CZEA 1HVXA 3L6FB 4OGZA 2P24B 5KOVC 4DGUA 4S1RL 3LEXA 2F1EA 2R69L 1TG8A 3UX9B 1I7TB 4HEPG 1KPVB 2C7UA 3ECBB 3FT4A 3OG4B 4BK5C 1CDUA 3QNYB 2XPZA 1HXMA 3H9YA 4I0PD 4M6OH 5LVEA 5DFVD 4Z7OB 1S3KH 3HG1E 4DPBX 4LPTA 3GMPA 3MKKA 5E1AA 3U7YH 3EO1A 5EOCL 1OOAA 4HZLA 2Z92B 3V8CA 4HAKA 3DVGA 1Q9WA 1Q4NX 2ZWYA 3NGBC 3LZNA 4X6CA 3U7AA 3TONA 1LE9B 4Q14A 4X5WA 2GJPA 3CFCH 3EOTL 4XRCB 2VRKA 5IFHL 2AVGA 3UZQB 2X1XR 2E6QA 2UWEA 4Z0XB 4A04A 1NEZG 2IDUA 4PR5B 1F58H 1M7IB 4JO3L 4P23B 2CKNA 2GTZB 5EUOF 4WFED 2OMVA 1IKNA 2Z4QA 1GH7A 1B6UA 4ENEC 3K1DA 1OGAD 3MRKA 1RZGA 3MJ9L 1L4IA 2OBGA 3MFFB 5BVPH 1UD2A 1LO0H 3L5WA 1BFVL 2NUPB 3IB4A 5D1QB 4X7CC 5K9OB 2IXQA 3GM8A 1OAXH 1SN5A 1WA1X 2YK1H 3B6SA 1DN0B 4U6XA 4ANUA 2FQEA 4IBUA 1EUUA 1GAFL 2R0WH 3HKZA 5E8OA 3RDTA 4BEIA 5GGUB 1IM3B 3GRWL 3QUYD 3ARGB 2DQTL 3B2UC 5DJXB 1OEZW 1GPOH 1BJ1J 2ENPA 4EOWH 2WLLA 2HPOA 2OMZA 4QKXB 1YHPA 3MLZL 4ZXBA 5C0EB 2Y72A 2G3ZA 3AQDA 4GMTL 4WV1C 1X5KA 4GRWF 1LO5A 1TPXB 4PJEE 5E6UB 3O4LD 1YPZB 2AQ2A 3HR5A 1IARB 3KH4A 1BPLB 4AW7A 1D3CA 4GAFB 3VXUD 3ARFC 4TV3A 3MRQB 4JFOA 5L8LB 1BD2D 3B9DA 1T7YA 3C5ZA 1CGXA 3VRIA 3VD5A 3L3HB 3MA7A 3RZCD 1RZ7L 3IU4H 4PAZA 1MEXL 3WDIA 5HHPA 5CFAA 3MN8A 1IM9B 3C60A 1I9RH 1YDPA 3NJHA 3EIFA 5B1KA 3NIGF 3DI2B 1RURL 4Y5XC 2YPKA 4BK8A 5HDWA 4AITA 1CDYA 1DEEA 5JLZA 2JJSC 5FDWB 3LKSA 5I1LA 4IBTA 1DBML 2YD2A 5IBTL 3WDHA 1V7NL 2K3TA 1JHLL 3HI6H 3ATDA 4R3SA 5DD1H 1Z5LA 3ZN6A 1F1DA 3TN0C 2B59B 3TNNA 4AEIH 4DOHB 5JHMA 4D3CL 3ZE2B 5F6HI 1R24A 5E99H 3DBXA 5GSRB 4C56A 4N0RA 4CADA 4J3UA 3NFPA 1ZCRA 2AI0H 4JHVA 3MRMA 4IYKA 2YPVL 2D3NA 3ERXA 4JM2B 2YGQA 1E5YA 1MUJA 3MYJB 4NQDA 4C47A 4QHNA 3NZHL 1M9SA 2W9EH 4DP6X 2X42A 5T33L 3MRBA 5C09A 4DO6A 4LBEA 4AG4L 1EGJH 4L3EA 4QT5B 1GGYA 1YC8A 3NRQA 1I9EA 3BIKB 5ANMA 4OCSH 3UYRL 2XZQL 4NNXA 3UC0L 4ZFGL 4TQIA 2PUQT 5IQ7H 1R0AH 2C9PA 3ARQA 5I30H 1L9MA 3QJTB 3W9EB 3NCJL 5EU6D 4LU5L 4Z6AT 2APSA 3DX8B 3NEOA 4WY7L 5BV7C 5KZCB 2V5SA 1T89C 3G5ZA 5E9NA 1JHKL 3KPSE 2OLDA 1P6WA 4ZD3H 4NB7A 2R39A 1CL7L 3G5XA 5D9SB 3D0VB 3FQWB 2IWKA 5CXPA 1S7SB 4R0LA 3WS3A 2C8NA 2W38A 3QDJD 4N8VB 2XA3A 5DGRA 1TEGA 1V3MA 2PPCA 4Z3JA 5A6LA 4MQXC 5DFAA 4A1RA 3U6XS 3FTGA 5J6GA 3FO1A 3L7FA 1CR9H 1D5BA 4GRLA 5DJZB 1ZV5A 3DMMC 5E6IC 3GSUA 3P73A 3THMH 5ISZB 4KJPC 2Z7ZA 2J20A 4NP4H 4YUEL 4DETA 5BO1H 1F11B 1YECL 4N0YH 4O51A 1A3LL 4U1GC 2DF3A 3NACL 3EHBB 4LHJB 4MJIE 1FORH 1O6SA 3BAWA 3FNKA 1AQHA 3WL9A 3WXWH 2UYLB 3CVCA 2BNUA 2E7DA 2GEQA 1UXSA 5GISL 2WXKA 3MAWA 2YFNA 1C08A 3H9SA 1IGCH 2AS5M 3OR7A 4Z78A 4P2RA 4U3CA 5T3ZH 3CC5B 5KVFE 2HJLB 4G6AC 5DF0A 3C8KB 3E8UH 3EGSA 3IJHA 1N6QH 2R1XB 1YZZA 5FM5O 3CFJB 1A9BB 1MCQA 2K78A 1CF1A 5D93C 4I0KA 3W3BA 1PD1A 1KIPA 1MAMH 1DBJL 1QKZH 2WHVA 4HG4K 3B9KA 5CKGA 3PHAA 4PVLA 1TJGL 4U1MA 3WJJC 1EO7A 4AMWA 4JKPH 3WDJA 4UNUA 2IBZX 1D5XA 2D31B 3ZGHA 4B9ZA 1FNAA 2Y07L 3GKWL 4Y8AA 4XP9L 5C0BE 4E9QA 1LNUB 1E4WL 4X80L 2AEOA 3T5WA 2GI7A 2V3DA 3IJYA 4L3CA 4DEPC 1CFTB 1SZNA 3F62A 4NQEE 2A73B 5IW1A 1LO4L 3N1FC 4P3CH 3JWDH 4WUKL 1NTDA 1JZIA 3VDBA 3L1GA 1TTAA 2GB2A 2B14A 2IDCA 1OTUC 4N90E 3PABA 1KEML 1YYLL 4GB9A 4ZRGA 3REVB 4MHHI 1JPFB 4ZNCD 1HL4A 4NQCA 1VAHA 1LQSR 1QABA 3RJQB 3NJKA 3OQ3B 3HKFA 2OW6A 1JS4A 2GW5A 1AC6A 3OZ9L 4FFZL 3FSZA 1OAZH 2Z93A 3M17A 2ZYSA 3X12B 2BZ7A 1XGUB 3L3GA 3WKML 3DIFB 5F7NC 3WKQA 1FFRA 1IGFL 1KN4L 2FWOB 1A6AA 2DEWX 4WDIB 4YZWA 4YK4C 3KYMA 3OHXA 4AJ0A 4C59B 3TURA 3PJSB 5GJTH 2V17L 3DVFA 5E51A 2FT7A 4MBOA 3NDYE 1EO5A 5DK2B 2NQ3A 5F2FA 5SX4H 15C8H 4LCUB 5DEGB 4PJHB 4ELDA 3LSOA 1M1XB 2OULB 3HMXL 3QIBB 3IWUA 2PO6C 3FFCD 4WNQB 1U8CB 3JYBA 5CBEA 4CBPA 2EEXA 4LVNC 1A1NB 1S9YA 1JPTH 4H1LA 4QHUA 3T0EE 3MLSH 1I1AA 4JQVA 3JV4A 1S7QB 3EYFA 2YXVA 5CLWA 4FFYH 3W9DB 2IAMD 2ZG3A 2AQPA 1GYUA 3PPEA 4I7ZC 3RBSA 2JB6B 4WI7A 3VRJB 4FQIL 4P0DA 2VLJA 3N6YA 3Q8FA 5HPMA 1CB4A 2WK2A 1GS7A 2QV2A 2XV6B 5E9AA 3FC8A 1S7RB 2HH0L 3RKDC 4AMXA 4DP5X 4YSAA 4Y16B 4P2OA 1AXSA 1S5HB 3KGRA 3EZJB 4HFWB 4QXUH 2F7IA 3QW9A 2YAMA 5AZ2L 5MEQB 4NC0B 1SY6A 4JFPA 3R4DA 2H8PB 1UB6B 1MRDH 2V5TA 5EZJB 4XTRD 8PAZA 2BIQA 2VC2H 3GTVA 4OV6F 1KOAA 3I9GH 5JO5A 3Q5OA 1BM7A 5IJCC 2HN7A 3O6MH 2XSKA 3QIWA 3PL6B 4UIMB 1FFTB 4YDZA 1FC1A 1FE8L 3S6CA 4LCWD 2X12A 2MKLC 2ILLA 2IWGA 4MSWB 5JHDA 5DJ0A 3RKPA 2B15A 3QUZC 5KTEL 3UJIH 3RWCA 1BP3B 1TTBA 3VW3L 4G8EB 4P57A 4X6DB 5AYQA 2F61A 1MDAA 4JK0D 2R23A 43C9B 4GFXA 5DD3H 1DSFH 1S3RA 4KKRA 5T3XD 1IV8A 1UC6A 1XR8B 2VM9A 4NPJA 5F93C 4HIPA 2O5ZH 4WK0B 5KSBB 2CLZA 4P46C 2QT6A 2EUXA 1MCDA 4M1CC 2JVUA 1EHLH 1L7TH 4RA0C 2X1WL 3FO0H 4KKPA 4TSAH 4WHYG 4UDTA 4PLJD 1HSBA 3A24A 4QF1B 3L3IB 1PLGH 1BYOA 2PPAA 3PE9A 2DQHH 4GIOA 4JG0L 3AU1A 3C2AL 3SDXA 4EI6B 5I9QC 3RIKA 1NDGA 2NLJA 3BZFB 5IW3A 3EJSA 3N55A 5B22A 3F7KA 2F6AA 1UUNA 5I73C 4JFZH 4OUUB 5CEYA 1NBYA 2K6ZA 4G8FA 2CK2A 3MJ8A 1ZEAL 3RNKA 5LBSH 4CVZA 1A6TB 1IKFL 1B2WH 1SLXA 5IV2A 3F7YB 2HLEB 2ZYIA 4YPJA 5DVKA 5EA0H 2QJDA 3ZL4L 3RWDB 3V52H 3HI5L 4AVIA 2EYTA 2R2EA 4FG6C 1L5GB 4H2AA 4Q97A 2AV1A 2AANA 1E3XA 3QQ4A 4WI2A 4Y4FB 4A2LA 2DWXA 5CZKA 1ET5A 1OY3B 4NENA 4GSUA 4WFHE 4NOBA 4XMPH 3ME0B 2XT1B 4ZYKA 4JN2B 3T3MB 1B3JA 3U36A 3KLQA 4M9OA 4ONOA 3RDTD 4ZUSA 2HVKB 5FCUH 1UYWL 4PIRF 2P8LA 4G6KH 2WUCL 4K8RD 1KJMA 2CNYA 2J6EL 4ZXBD 1QMUA 2EADA 1F4XH 3L95A 3HNTH 2YIHA 2Y1YA 1Q1PA 3RAJL 3U1PA 4DKAA 4MS6A 5DO2D 4ZFQA 3VQLA 3N85H 3RPIA 3PP3H 4ZFOB 2HLAA 3Q7JA 4U31A 4L4TB 4FXLA 5CJOL 1FC2D 1Q0YL 1TLMA 3C5ZD 4PCYA 1OCOB 3C08H 1IC5H 4XI5D 1WEJH 3MVSA 1MCEA 1LK3H 4G3YL 1A25A 4G80A 4IKLA 5KOMC 1DQQB 3C60D 3LZLA 3LNIA 1FNGA 3IN0A 5IJVA 4BH8B 3WAJA 1P5UC 3DX4A 5F3BB 3FQYA 3MTXA 5DZAA 4V33A 3HB3D 4XMUA 5CMAA 2NPLX 2VOTA 4M7LL 2HJKA 4NQSA 4ZX5A 2VABA 3MACL 2J4WH 2F2HA 2IANE 3REWA 3NFNA 1JV2B 1Z0NA 4NCC1 3ARBC 2JCCA 3B8SA 3TBCA 4KUZH 2H3NA 4LQFL 5H37H 3VO0A 4C56D 1EZVY 5F6HJ 3BUIA 3DO7A 3WTTA 3WNKA 4NPKA 4ZX4A 1JVLA 1UWEH 1BGXL 4TXVB 4NQDD 2QVTA 3N1PC 3BPNB 1RZ8B 5LAPA 1OSPH 1PMYA 2EXTA 2XACC 3VXTA 4K3EH 5C09D 3HFMH 1PX4A 2MSPA 3P4MB 4D0CA 1URIA 4L3ED 5ILTL 1YG9A 1UJ3A 5C0ND 3X13A 5AVYB 2VR8A 2EDWA 3HZ3A 3A6CH 4MFHA 1JFQH 2R8SH 1IL1B 1KEGH 4A2DA 4Y5VB 4N0UE 2YPLE 1J9QA 4F7MB 5HYSA 3TTSA 1MPAH 3PY9A 3ZYOA 3QI9A 5I5JA 1I8KB 3CU1A 1BM3L 1CMOA 3ARFB 4J8RA 4YIQA 2VE6B 4ZFFB 2GIMA 4L9DA 2VH5H 4F7TA 3NK3A 4HBCL 4LLMB 2DBJA 4YSUA 4HCRA 3II1A 2AQTA 3PUCA 1RIHL 4X6FB 4UAHA 1QBLH 1E5AA 3MBEA 3MUUA 4L3AA 4APXA 2EDHA 1LEGA 4GRLD 5FK9A 4PJXF 3BT2L 5FWRA 1IFHH 4NXKA 4OLZL 4G7QB 4UTBL 5AW3B 1D2PA 1RJLA 3UBXG 1DVQA 1ZTMA 3QEQA 3QZWG 3F00A 4MYPA 5FYLH 3M46A 1JUFA 4B0MM 2JQAA 1HHIA 3GMLA 3FSWA 1J10A 5JW3L 1PIFA 3H9SD 2PNDA 4XGZB 3KXFA 4ICWA 5LCVL 2W60A 3SGDH 2WZPA 4P2RD 2HLFD 3DKHA 4HCFA 4N28A 3VB9A 2YD0A 3P54A 3VSUA 5A2FA 2DD8L 4NI3A 4LP5A 3IE4A 4KI5F 3CSGA 4NDMB 4Y4KB 5GHWH 2XQBL 1AO7B 4KOCA 2BCMA 1MNUL 1TCRB 4OKVB 1NEUA 3S2AA 2BY3A 3Q1EA 4X9BA 3O11B 4NQXB 2VERA 5KVGH 3B9KD 3RG1C 2QZQA 1FO0A 2N01B 5HY9A 5L2KB 5E8PA 2XNAA 4G1MB 4ELKA 4TUJA 1V7MH 1W0WA 4YX2L 1EFXB 4I0PC 4GXVH 3US0A 3ZKSD 3GK8H 4ZPVA 3U9UA 5DFVC 3ZBMA 4UTAL 3GSNH 4LOVA 3DV4A 2G75A 1MJ8H 2CDGA 3CSBA 3BLBA 1EDHA 1HN1A 5CR8A 3BAIA 5I1HL 3COOA 1FZJB 4BCZA 2QGCA 4B9YA 3WTSA 4S0SD 3LXCA 4O02A 1A0QH 3ROOB 5L8JB 4AQ1A 4JAMA 1HHJA 1QO3B 2DMBA 3AITA 4EXPX 3OKDA 3MU3A 1YQVL 1INDH 4KUCF 1AQKL 5EF2A 3QBTB 3MNVA 4NQCD 4APQB 4RGNE 2A83B 1UZGA 2B2XL 2FLBT 3SKOB 3LH2L 4IBLT 4Y5YC 3N91A 2FJSA 2IOOA 2AQ1A 4GAYA 2R1YB 5JUEL 1FRGL 4OZIA 1G6RL 2YBRB 2GSIB 3MV9A 4K3DL 3H0TA 4JKKA 5MEOA 2FO4A 1P53A 4C57C 4D8PB 4RMUA 3FCTB 1Q9KA 2F8VA 2HKFL 5E4OA 5IESL 2Z8WC 4GG8B 3U9WA 2HKHL 3FB8B 1HX0A 3KYOB 1YY9C 1ZA3A 5DEZA 2JSFA 2ZXBA 3ROLA 5IEKB 1AANA 4Z1PA 4UV7L 5DVNA 1BXXA 5D93B 5EHFA 4IMKC 4HD5A 4CNIA 1UEMA 1I1AD 4LLUA 3SGDI 4QGYA 5E7FA 4DAGL 1UEYA 3OJDA 4GSDH 1JVOA 1OHZA 4ESKA 5GS1A 2VLJD 4FLRA 5FHAH 2Z8RA 5BVJA 3OZKA 1Q94A 1ODUA 2F8OA 5CLTA 1FUNA 3QRBA 4ORGA 4XPBH 2WN2A 3F04A 4GI8A 3RZCC 5IB4A 5J11C 3EJYD 2YMTA 1OANA 4L9LB 4P2OD 5D7KD 3VQ1C 2MPAH 4YSEA 4LCIL 5D2LE 1JGLH 2X2YA 1UHVA 2GK0A 4CN4A 5JTWA 3K2UL 4P5MA 2IBBA 3ZE0E 4KPHL 2WQUA 1KGCD 1XGRB 4NGHL 3RTQA 3FU8A 2YS4A 1M1SA 3LS5H 2UX7A 3WE6A 3O41A 3WSQH 4AE0A 4F9PC 1FVEA 2Y0SA 3L4UA 4KAQL 1D5MB 3PS6A 5JYLA 1TZHA 4IKJA 3UG5A 3QIWD 2EE2A 1MJJA 5E1QA 4OCRL 4KY1H 3FTSA 2CO1A 2FJFB 2R1WA 3CVHH 3IU3A 1S78D 3ZTDC 4CDGC 3M1BB 5JHDD 3DRTB 2X5PA 2IDTA 2VDKL 3WMQA 2BXZA 3T09A 5GS2D 4EBQL 2CJ3A 3FUNA 5CEZE 2CZNA 4DIXA 1FG9C 2QFPA 4L8SC 3GKZA 1NBCA 3ZQXA 2VN3A 4OQ1A 3IMTA 1NFIB 1DQML 1JK9B 5KVEE 1JHTB 1B0RA 5IR1A 3QEHA 4BFKA 4UDUA 3V8OA 5H94A 1FNSL 2DAVA 1K4CA 3QR1A 2HMID 1I4FB 3MRJA 3ULVD 2V9UA 4N3UA 2KERA 3LOWA 3F58L 2R29H 4HETA 1NGYA 4D94A 4KVNH 4WU7A 1KB9J 1T21B 1E9QA 3BZDA 4XNQA 5IFAL 3LYRA 2XTJC 4JFDB 3P0VH 2VDMH 2D9CA 4OB5L 1OAUL 2PYFB 2YMXL 1IAKB 2HRLA 5ITFB 4KKNA 5K9JH 2ZKHH 5ID1B 1J1PL 7TAAA 2XIBA 4XMKH 3KCWA 1AE6H 3WU1A 4RDBA 2V6HA 1AR1C 2ESVE 2H2PD 3RVUC 4K23L 4RNRB 4TSCL 3UTSB 4M5YL 1TJIL 2Q7YA 1O6VA 3BDYL 4B53A 2WNGA 3HHRB 3T6WA 1GIGH 4LNRA 2VITB 5E94A 4GW4B 1BZ7A 3D85A 4KVCH 1EEZB 1ZLVK 3NCCB 3TBSB 1JPST 3BMVA 3LTVA 5GRJH 3R06B 4XPFH 4HSCX 2PW1B 3QORA 3BH9A 3H4FA 4OCXL 1CFSB 4ACPA 4XH2A 4K5MA 5AVXB 3PU7A 3VI4B 2F19L 3GSNB 1MLCB 3F65A 2ZUUA 3FQRA 1JI2A 4NIKB 5JA9A 4X8GA 4Z7NB 1D6EA 1CJYA 2C9AA 3WLWD 1KJ3H 4RZKA 3LD8B 4V1DE 2VXVL 4M6MH 2XWRA 43CAA 3MCG1 3JWNG 1YC7A 3MCLH 4D9LL 3MGOA 3KGTA 3VFNB 2LT9A 3P3RA 2X6BA 2K0RA 1YNTA 3CV5A 3W5MA 1P7HL 4YR6A 2X88A 2EXWD 3ILQD 2DQ6A 4LHUG 1HAWA 1EERB 1WBYB 2GY5A 2JTDA 3EO9H 3BSZA 4MCNA 5DSCA 4LKCB 3SDYL 3I02A 4KVPA 2WCGA 1HCYA 1CDGA 4YHOH 1Q9LA 1ZLEA 5KVDE 1TQCC 3L9BA 2GYSA 3OGCB 2FBJH 3QDGA 2XPGA 4ZPTB 4NPYB 3S5ZA 5GS1B 3ESOA 3P77B 3RY5A 1T5WB 3LDBC 4JX0A 4X0NA 5KN5A 5F6IB 3T65B 4WJ5A 2HRGA 2BOBB 5AFAA 1PZAA 3IJ9A 3IDNB 3PDDA 1IEBA 1CGYA 2ZWKA 1NFDF 5AW0B 2O6CA 3PV6B 4RMRA 3Q48A 4GUCA 4HJEA 2WYHA 1OTSD 3GEWB 1KXQE 3OKLA 4LEXL 1I7UA 2EDDA 1J0KA 2VXQA 5HJ3A 3OB0H 3HG1A 1HOEA 4ONGL 4R97C 4A68A 1CFNB 3OZLA 1JPSH 3AWEA 1SMDA 1OQOA 2PXYB 2OTUB 2BY2A 3AG2B 3QQ3A 4JHWL 4CMMA 3ZDYE 1MXDA 3WV0A 3KPOA 4NHCL 5H35B 2J12B 4YHYC 1SFDA 2I60L 2V8LA 3FHEA 4P5TA 4YWGL 3MREB 4KROD 4FQCH 2ADIB 5TD4A 4XPTL 2G3XA 1J8KA 1XSJA 5TE6H 1U6AH 2DYPB 4NZRL 1N0LB 1J18A 3WE1A 3WUWA 3V4UL 2XI9A 4FQJH 5DHYA 4K4KA 4GG6B 1QZNA 4QPEA 3TTYA 4AV5A 2HUHA 1L7IH 4UT9H 5JPMC 1BF8A 4BRJA 1DVSA 3TWYA 2IAMC 3KVQA 4WHTB 3QI9D 4BV1A 1CVRA 2EDRA 3BUYB 4BKLB 3CCHB 5I8KH 5GRYA 3ARVA 4WSKA 3IDMB 3CVHB 4QTIH 1AKJA 3H7BB 1Q0XH 1LGVA 2J88H 3RUGE 5J5EA 4BHUA 2WO4A 2WO3B 4PJEA 1WZKA 4JPWL 4HJJH 1WPCA 4IKIA 5EEYA 4GY4A 2VJ8A 5T1LA 3MBED 4J3TA 4XB7A 1M57B 3P11L 1UFUA 1SF5A 2OCJA 5I1CL 4WTXA 2WQWA 3EFOB 1QSZA 4JB9H 1U3NA 3UTTB 3DDFA 1WIOA 4JG5A 3QEQD 1HL5A 3QHFL 1A7PL 5ADOL 4NUJA 4OJDH 2UUDK 1BAWA 4AWJC 3W39A 4UQAA 3VG0H 4EDXA 1JDCA 5JIPA 1MLBA 1NJ9B 1FFNB 1P2CB 3Q6FA 1J1OL 1QW9A 1J48A 3FOLB 3FUEA 3GSXB 1PZUB 2AQ3A 3KXFD 1CICC 2VDMB 2X4RA 3WELA 2WZPD 4XCEB 1WA2X 4E42B 4WWPA 2AEPH 1O7SA 1IRAY 4ZT1A 4EPSA 2DLIA 3MXWL 3CVIH 1CGSL 4K3HA 2J2ZA 5GGRA 5JHLL 3IJSB 4JPVH 4UQ3B 4U1NA 2X41A 2D3JA 3S36H 4XN4A 4UOW0 4UT6H 5F7DA 3VI3F 4YEEA 3WAKA 1EX0A 2PWFA 4KHXH 1J8HB 1BV8A 2AKRA 2VXSH 3U0WH 1TKWB 4S1RH 2VXTL 1CT8B 2UXVA 5EOQH 3WIHH 4LSVL 2PYEB 1QR1B 3ZMEA 2E7CA 2IH8A 3TGXA 1MVUB 1M05B 2GAZB 4QMEA 2DY2A 1F3JA 2VUYA 3IFLL 3NN8B 4UZUA 4W9EC 4PJ9B 5EOCH 2WN3A 3IXAB 3IVKB 2NR6A 2LU5A 4RZCB 2GBAA 1NLBL 1UH4A 4ERSL 3TBVB 2XQ0A 4PLKC 2X09A 5E5LA 5FGBA 3HNSL 4JREC 4YC2C 5EU7E 1ICTA 5IHUH 5IFHH 2LV4A 3H3BC 4N9OB 4AQOA 5CSBA 3Q3GA 3AACA 4TUOB 3CXHJ 4FQ1L 3L17A 3ATFA 3MV9D 4ZW6A 4A2MA 1D7CA 3S88L 1KPUB 4EVNB 3MJ9H 4PRPE 4B9PA 1B88A 3WEXA 2DQDL 1BFVH 4M62H 3L3OA 1FGVL 1U8NA 4FJ6A 3KPPA 4PRAB 1I3GH 2QADD 3GSWB 1LP9F 4HK0A 2BFVL 1JWUB 3V6ZA 4N2GA 4K8RC 4MJIA 4HXAL 5GZNA 1GAFH 4HGKC 3PP4L 3BZ4B 1NCHA 1AACA 4AYGA 5KBDA 1ZLDA 1NGXA 3WFDH 1B90A 2VW6A 4CVUA 3H3PL 5F1NB 1XD0A 3I75B 2ZG1A 4KTDL 1C5DA 1X7QB 1FIGL 4XWGL 4ZS7H 3S4SA 3BIBX 3J07A 3OKOA 3RDJA 4FADA 4QRUA 4XMTA 3S96B 3QJZA 4Z7OE 2WB7A 4ZO7A 5J8OA 3FT3A 2RFXA 1GGIL 4QY8B 3G5WA 4YSOA 2VERN 1M7DB 3C60C 3UCQA 1M7XA 1VHPA 2N4IA 5C9JB 3RLSA 1SBBA 1I1FA 2CR0A 1RZ7H 1MREL 1N8OE 2WB1A 2JQMA 2OW7A 2XVKA 3QJOA 4PRBA 4UTCA 3RTQD 5E00A 1A6PA 1E9OB 3BLPX 3QUMH 5FM8A 2AXFA 3W5NA 4IHBA 4GAGH 4N4YB 4KJYA 4YLCA 3PWUA 3OTTA 1N10A 1LHZA 4PD4J 3S37L 3KVPA 1A8JH 4HJIA 4JDEB 2OL3A 4N9GB 3SE4A 2P47B 4P8QA 5ACZA 1MQ8A 3L3JA 4HQQH 1BVZA 1JHLH 1MFCL 5D1QE 2E27H 4ODUA 5A2CA 2DQGL 3CSYA 4RMSA 1AKPA 3B5HA 3BW9B 3PWLB 5FKAB 4R8WH 5EZOL 5GRUL 2NY7L 3VXPA 3I84A 2YPVH 2F53B 3VJ6B 1VGKA 2KPNA 4JFQA 4O58L 4NNYA 1EBAA 3BP7A 2Z3FA 4CC0A 2F7PA 4BSWA 4Y1SA 3O3EA 4JHAL 5AAWC 4F80A 1KJ2A 3KLDA 5I76A 2HT3D 3EJZD 4JFYA 5J3HD 4LSUH 1AG0A 4J3SA 3IFPB 4PJFB 1YNKH 2GUOB 2FIKA 1OTTD 1F00I 4LHQB 1YPZE 2ITDB 3T2QA 1MCPH 4NO2A 4OGAD 3II3A 4ZFGH 4I4WA 4LIQE 5I8OH 2CDFA 1UACL 2G9KA 2W88A 3VWKA 3FQTA 3US9A 4HCGA 4CU6A 3NCJH 4Z95H 2ZOOA 4E5XB 4Q9RH 3C5SB 3VWJB 1CLZL 1N5AA 1LO2L 1WYJA 3BQUB 3T0EA 1TETL 3ECVA 2YA2A 4JFUA 2XJLA 1ONQA 5FYJU 3Q1SH 2EIZB 1OALA 1QLFA 4FNPA 2BFGA 4LDCA 4YE4H 4MB1A 2XN9B 4GRLC 3INUH 1DSWA 4MDIA 3U2SB 4DK6A 1KTKE 1OGSA 2CJUL 3D85D 4MX7B 2GJZB 5FECB 3CFEA 4GS7B 2OXGA 3HAEG 4HH8A 4YNYB 4NZTH 4DOHE 4K71C 3GTTA 3QORD 3ZE2E 1OHQA 3BMWA 3UBHA 5E56A 2EIBA 5TFSL 4WEBL 3NPSC 3ZO0A 4F1SA 5BZDA 5D6CA 3HUJF 4GSQA 4PGCA 2BS8A 2CLRA 4ONFH 2F7RA 3ZYJA 2R27A 3HC0A 5GISH 5IVXB 4N0FB 1F6FB 3K3QA 4NJAH 3PCYA 5IJKC 2OZ4L 1BVOA 1J0JA 1SPDA 2E9IA 4YLBA 5DHVH 2PLTA 3DOHA 1SOQA 1NOAA 3B9KC 3EDEA 3F01A 4FHBD 1KCRH 5HDOA 3WY2A 2Q7AA 2UZXA 4HLZG 4K73A 1ZLUK 2CO3A 4TRPH 3SPHA 3T6XA 2EIMB 2AGJH 4H8QA 1IU1A 4YVUA 4W68A 1BBJB 3F85A 2XTJB 3L16A 3QDGD 3RA7L 4P48A 4D9QE 2Y07H 4O2FA 4KO5A 4XP9H 4Q2ZB 3HHMA 3ZR5A 2YD8A 2IV8A 3UYPA 1BQUA 3CN3A 3IFOB 2YFOA 1PZCA 4YPGB 5IMKA 4JHUA 5AW2B 3N41F 5IMLA 1C5CL 3CX5K 5DUBA 1RK0A 5AENA 4G7VL 3I6SA 4UOJA 2YD5A 3RL1B 2QELA 4M8QB 3VA6A 2YC1B 3HG1D 4PGEB 2SEBB 4FQ2L 4MD5A 5D55A 3ZIMA 2P52A 5ISZE 5D7LB 4LLVA 4X7FC 2GT9B 1OLZA 1EXUB 1HFUA 2G30A 3CC1A 1FH2A 1YMHB 4WZ9A 3P2BA 3I2CL 1U92A 2QKIA 3KL0A 4K7PL 4P5TD 1AZZC 2FJUB 1L6PA 5E2TL 3WGUB 1JWMB 1NFAA 1THAA 3G04A 3OHXC 4IIQA 4JE4B 5TDNA 5ACMA 2NX5E 1WAAE 5F8QC 4I2XB 1ETA1 5ERWB 1YUHB 1NA8A 4PSRA 1IGFH 1MWAL 1GGCH 4X6BB 3A4FA 4B9CA 1OT4A 4RFNB 3MBWB 1MIML 2V17H 2HRHA 5DUJA 5L4FA 4MAUL 4JQVC 3LVEA 3UTZB 3QUMB 3HMXH 5IB5A 4G9FA 1AGEB 2VDPL 2BVQA 2Z4TA 1MHEB 2ZCHH 1ZRUA 4IBZA 4LVEA 3SKJL 2UV3A 2C9UA 4G70B 1T6VN 3UZVB 2YLKA 1RD6A 4J39A 1PZBA 4W9HC 1UXWA 4XC3L 2D0HA 2X4PA 4YE0A 1AKJD 1L0QA 4FQIH 3EJYC 1FYTA 3QAQA 3LDBB 5EU3A 5CJ5A 2CBMA 4FMFA 5DJ2A 5B38A 1DN2A 3JWOC 3V6FA 4NZUL 1MCOL 2XWBB 3CFTA 3GZQA 1U8IB 3QA3A 1MFAH 1S7XB 3P3TA 4U1LB 3D7PA 4ZW8A 2RCSL 3BVXA 4IW4C 1U8KA 3U48A 3ZT5A 4DKFH 5CN1A 1H3GA 4YL4A 3LN4A 1KIRA 4YVNA 2R4RL 1NBQA 2RGSA 1E7VA 4Q4IA 4GQ9H 4MAYA 4XWOD 5AZ2H 4RQQB 1RIVH 1J0IA 4YHML 2J1KA 4R97B 1S9XB 4X6CF 3QIWC 2CCLA 1NH6A 1S78C 3GSRB 4BZ2A 3FH5A 2X6MA 2R2HB 2UWEF 4FTVB 4J1UA 3R1GL 4BKTC 4YHYB 1XGYH 4XAWH 4NXSA 4U1KA 1FE8H 5G4OA 1EVUA 3X1GA 1XGTB 4KRNA 2IANA 1D2OA 1ND0A 5AW6B 3MV8B 3UGUA 5IOPB 1AFVH 4J3OD 1R3KB 1TVBB 3DXAB 5DJYB 3MR9A 1HH6B 3QJFA 4PJHE 4DW2H 2BSRA 1HINL 1IGYA 3BHBA 4RAHA 2ZKYA 2TRYA 2IIJA 1EZVX 3B2VL 3S97C 3UTPD 1FPTH 4N8PA 5FA3A 5A16B 4AW4A 4G1EA 2ADJB 4QOKA 5F9DC 1MW3A 1U21A 4FRWA 3I6GB 5ALBH 4ODTL 2ZUTA 1TENA 5C2UB 5CZVL 5JNYB 2IQAA 4MD4A 1XF4B 5JPNB 1PY9A 3QG6B 1GS8A 2XRAH 5JXEA 4UOZA 5CFHA 1E40A 5SWQA 4LSRL 1BQHB 5JXAH 5GS0H 1X6LA 1XFPA 2ATKB 4FULA 4I1NB 4G5ZL 2WWKT 4U1HA 3U0PB 2QVFB 2NR6D 2F54B 3FN0L 1HSAB 3E7JA 4GKZA 2LABA 4M1DL 4N0UA 4TUKH 4GIPD 3UO1L 4PW3A 2DWDB 3QEUB 4G6JL 4X7TB 5EFIA 5FYKU 2QTEA 5DHVB 1I8AA 2O5YL 3C5JA 3OKNB 2X2IA 4ZMZA 2QSQA 4QRBA 2DIBA 5A6MA 4G7YL 5FUZH 1K2DB 1FLRH 4WFFE 5IFJA 1BEYH 3O3AB 1KACB 3QDHA 1XGPA 4PWGA 1J8RA 4U3SA 1P4IH 2I32A 1B3IA 4JCWA 4X6DE 1R5WA 1CICB 1SYVA 2D03H 2ZOUA 3LQMA 5JW4N 4ZW5A 3GI8L 3QCVL 3WNOA 1OIOA 2QR0A 2Z31C 4FXGB 3WLWC 1XL4A 3JUYA 5D1XB 3NJXA 3GI9H 1FVCA 3G6JB 5MERA 4MJID 5GZND 5KSBE 2WWKO 3WIIH 3SB3A 2AQRA 1TYRA 1KNOB 2ZZUT 4FXKB 2Q2EB 3GPEA 1UWYA 2DQJL 4PBXA 1IGML 4NKMA 4G7RB 2EXWC 1NCBH 2I25N 1IVTA 5DDHA 5KSAB 1REIA 2I26N 5EOTA 2QPSA 4DP8X 2ERJC 5LGKA 2PETA 3FU7A 5C0IB 1USZA 4ORZC 3VXSA 1XIWA 2X4OB 35C8H 5L2JA 1EAJA 4IDJL 4OFQA 1UENA 2F8XC 4GSXA 1W72A 5J06A 3C9NB 4XR8C 1JTTA 3EXJA 3K5SA 5T3ZE 1OTSC 1ZIAA 2CXKA 1KTJA 5E1GA 1RV6X 2HSIA 5HGDA 1AZUA 1DDHB 1A7BA 3APFA 4ZUVB 5BZWA 1UQSA 2Z34A 2ENJA 1KXHA 1SN2A 5C6TL 4JREB 3U4BH 3L48A 3ZE1B 2FGWL 4GIAA 4YO0A 5IUCA 1XCTA 2G0KA 1WBZA 2I24N 4E41B 3DTXA 4N90D 1RULL 1R19A 1K4DB 4KROC 4LQFH 1X5GA 5EUOB 5F9WC 4YXLH 4LL9A 1YCSA 4HF5L 4DGIH 1DTUA 3U46A 4POYA 1BFOB 3T3ME 2CMRH 1WGOA 4ANKA 4KITB 2NY1D 1ACXA 3ZGIA 2BS71 3BAEL 1CLOL 4OJYA 3FYEB 3VFTB 4JMXA 2GC4C 5E24E 3AXLA 3ALXA 4HIJB 2FECL 4J3XA 4OCWH 1D9KA 4OZHB 3MRLA 5INDA 2RBLA 4GKSB 2R0LL 3SDDA 5HXMA 3NA9L 3DV6B 5ILTH 2H1LM 2HPTA 5H4ZA 1G4RA 1AD0B 1PNDA 3RWEA 4Z77B 4ABUA 2ZXQA 1SMAA 3BXNA 1HDMA 3PGDB 4NNPH 1W8NA 3OVUB 1OF0A 4GMSH 4LSTH 5F0LB 3K71B 3VWKD 1XGZA 1XMWA 4KKQA 3IETB 3QB7C 4PRIA 3KDMB 3HS0C 1E9PA 1C16B 2NT1A 3WNNA 1LK2A 4DVRH 1JPGA 1RJZA 3CFBA 1MY5A 3LH9A 2FX8H 3T0ED 3ZOAA 3WEAA 1INEL 1PKQB 5I66B 3TV3H 1NMBL 1AAJA 1EPFA 2XV0A 3JUZA 4HJ0D 2AJUL 4LLDA 3QZMA 2FYYB 2NY5C 2GEEA 1CF8H 1HKLH 3MRRB 5IBUG 5DMGC 2QEJA 3NIGB 1BEXA 4OLZH 4F9LA 2JJTC 1R1CA 5T3XL 4JFXA 5T1KA 2GVYA 3SPVA 5CBAA 1J05B 1V8HA 2X70A 3ARDB 3GMMB 4HKXA 1YVLA 4GLRH 2Y06L 1JCKA 1H8LA 1FL3B 1G0YR 1AGDA 1JXDA 4M7KL 1IZJA 1YEIL 4YDNA 3JWOH 4LDEB 3UAEA 2AK4B 2VLKB 4PJIB 2VR5A 4XPHL 4FZEL 4DSYA 2VDOH 4MA8H 4NKDB 4I18A 4MA3A 1W8EA 5ITBL 1L9OA 2C1PA 5ALCH 5A2IH 5CZXD 5DRNA 3HRPA 4ZZKA 3MLTB 3K4ZA 5EPMA 3STLB 4HOXA 2X3AA 4PUBH 1N6UA 4DPCX 2CIKB 1FBIL 2W92A 3ZKNC 3MYZA 5C0FB 4YZFF 2GJJA 4XP6L 5C0RL 4DZ8B 1AS7A 1FH5H 1S9WB 4PTTA 1IQDA 3G6DH 3AG4B 3MV7B 1JN6B 5A6IA 1WUZA 4YX2H 3SQBB 1RZFL 4Q6IB 3EJQA 4U1IA 4UB0L 3TBWB 2AXHA 3HLKA 3L5HA 4NM8L 5IW6A 5L4MA 1KLUA 2B4CC 1COBA 4AQ1C 3QPQD 3J7HA 4X4XB 2XVLA 4HP5A 5ICYB 3MO1B 1MF2L 5KS9A 1GS6X 2QSTA 1C8QA 4Z7QB 1NEZB 1KTRL 2K7QA 5ID0B 4GUOA 3BC9A 2LE9A 1C5BL 4ZMXA 3F6JA 4ZTOL 3OAZK 1XTLA 5AVVB 3MCKB 4NOFA 4EE2A 1XZ0A 2EJ1A 5DA4A 2YBGA 3VU2A 3II2A 4DKEL 5F7KC 2IEPA 5GZOA 5HI3D 2DLEA 3N42B 3NFSL 3V0EA 1NCNA 5JUEH 1FRGH 4QXGH 1VZGA 4K8RL 2Y6SC 3L7EB 5G4MA 2N7BA 2B77A 4JDTH 4LRIA 4K3DH 3RWIA 5BMFL 1U93B 1RP9A 2XY2A 2QADC 4F33B 3OJVC 3LEYH 4CJ1A 4NO5A 4ODHH 2PCFA 4PIBA 1AO7E 4X7SH 1XBRA 1T1WB 4P2AA 3B34A 5IESH 2COQA 5AKTA 2RTTA 1PBYA 1CQKA 4IIZA 1JF1B 4L8DA 5L2KE 3WNMA 4GLRI 4G9FD 1RIUH 2GSGB 4CVXB 2C4FT 2N3JA 3M1CA 1BVNP 2DIJA 1NFKA 4CUCA 3GBDA 4V1DA 5C0CA 4DAGH 3BUQA 1F45A 3QJHA 2KLTA 2XA8L 3SDCB 3TBYA 5C6PB 3D39B 1FYTD 2JB5H 5EBLB 3R7RA 3ULVF 3TCLA 3MGTB 1HXYA 3CVDA 4YDKL 4WO4A 5B3JE 1CLYL 1ACZA 4ISVA 5HGGS 3FBKA 4ZFZB 3EYVA 4YBLB 4YDJA 1AGFA 3Q9QA 1QX1A 2J8UB 3SDXF 4LCIH 2A0LD 4JFVA 2FEEI 3P40A 4MAYD 1YY8B 3JVGA 1OP3K 2W0FA 3QIUC 2FB4L 2F7OA 1IAIM 4GUQA 3AB0B 4YSQA 4KPHH 5A1AA 2QQKH 4RFEB 1SXAA 4LF3A 1OF2B 3V4VA 4NBZB 5JW5B 5I5IA 2NZ9D 2OX5B 5FYJD 2WVUA 4R9HA 2L3BA 2EEBA 3VFWA 4O00A 4EIBA 5HYSG 2IFFH 3ZT6A 4AOFA 1KXQA 3OC8A 4OCRH 3GDCA 4IOSA 5C1MB 3SODB 1WZ1L 2CR6A 3MX0B 5ABDE 3NAAL 2IAND 5EO9A 1AQMA 5E8NB 1NAMA 1MHHB 3UGXA 4KQ4H 4PGDA 3RVTD 3ZTJG 3H3KA 2O26U 3WTUA 4QRQA 2P26A 1HWGB 4LEOA 3LS4H 5INCB 4TNEA 5K33A 4BFNA 2JKWA 2DLFH 2EDEA 2Q5BA 5L0QC 2ZWNA 4J23A 1DBAL 4X98B 2WXMA 4R5VA 3GMRA 1BDYA 5EC2A 2V2WB 2OPCA 4CU7A 4QOKD 3UAJA 1GYWA 3HZVA 4B97A 3TWCL 4YXKH 1JTPA 2K70A 2MIZA 1AC0A 2NUTB 1KZYA 3L9RA 4P05A 1L0YA 1I8IB 4IMLB 3LPPA 5JXED 5CILH 1R5IB 2BWIA 4OB5H 4QEGA 5LNEA 3GUTB 5IUSA 4UAOC 2H32H 4N2IA 1R3HA 25C8L 1J1PH 1QEWA 1ROCA 1VENA 4K55A 4YAQA 4WHYH 3WN5A 5I1AA 1IUZA 1S46A 2AEQL 2BZCA 1Z5HA 3PQYB 3GHBH 2VDOB 4QTFA 1KENH 1Z3GL 4K23H 3UOAB 4M5YH 1TJIH 5FO7A 5BOZG 3HW7A 3UTQA 4ENZA 5KYYA 1KBKA 5GSVA 1LTXA 2JELH 4M4RA 3PGCA 4OZGA 4IU3B 4XMWA 5L9DL 5DYOB 3N1QC 3QORC 1FNEB 1SM3H 3TM6A 1A6VL 2X9ZA 5FF6B 1UADC 4PWEA 1EZLA 4YHLL 2ZUYA 4ODSH 4CSZA 3TASA 3O0LA 3ULUD 4XOCA 3UGEA 4MCYB 4OCXH 2A9ML 3S35X 2DBLL 1CFVH 3FTUA 3QULA 3GS7A 1KZQA 2JCCF 3QUKA 3MXVL 4WLCA 5LB1A 3SE9L 4XNBA 2OTWA 2HJFA 5F1IA 4E9TA 3L5XL 1J87A 4B9IA 3ML9A 4I85A 1QSFB 1G7JA 1JXKA 3UEQA 3C75A 1CS6A 1T4KB 2WOYA 6FABH 4KZDH 2A1WH 4I88A 1QUPA 4X99B 2JI3A 4MXQC 5AYUL 1HQRA 3CH1A 2VZOA 4OM1L 2NRDA 1M6UA 5B39A 3SJVA 4M3JA 1FL5B 4RGOH 1BZEA 3FW6A 3KR3L 2YZ1A 3J27A 4FNUA 3VXSD 3W38A 1XIWD 3LZFH 3SDYH 1UA6L 1DBBL 3O6FA 5D71L 4HSAC 3UBFA 3O6KL 1WWCA 4U1JB 1G6RB 3UIZA 5KBLA 5IM7A 3IXTB 4YHNA 3UTSE 5HYQB 2W0KA 1MJUL 2MOVA 4WTZA 4AM0B 4H25A 5D7SL 4FQQB 4Z0BL 1SEBB 2EILB 1CD8A 4FKHA 1SJEB 3N44B 2ZOTA 4NM4H 2BERA 4AT6A 3EYUL 4PGZA 3GSQB 1ADQA 5EIIA 1U3HB 4PW9A 5KVGE 1J9CT 4MA1C 3C6LA 3AT8A 3O0RL 2YEZB 1KMGA 4BFBD 5BQ7B 2FX7H 5IROC 4ADGA 3TXAA 4QXTB 4P5TC 3VXMA 3U4AA 1WWWX 4IBVA 1NL0H 1K5NA 3NRFA 1WC7B 4HD9A 3VI4E 1OP5K 4LOFA 5IB1B 4RGND 1D5RA 1SBSL 4FI6A 4OLUH 1YMMB 3AREA 3LRMA 5DVLA 3MV01 1Z9SA 2VDLL 4Z7NE 4ELMA 1GC1H 4HDIB 4HALA 2R9HD 1IC1A 1RVFL 4JO2L 3K6NA 2Z31B 4XMLL 1EO8L 4G42A 1N64H 1D9KD 1V54B 5AVUB 1C8PA 1GOFA 1OW0A 1IGIL 4J27A 5D7JB 2CO2A 4FL4C 3DROA 3SE8L 4UQ2A 3SDDD 1LE5A 4PRPA 3QO1B 1DVFB 2ED8A 2OZNA 3SE6A 2K45A 3L4VA 1HEZA 3AG3B 1B4JH 4LARL 3UDWC 4JPIB 1YN7B 3P69A 3QISA 3HE6B 1SY6L 4HOZA 3T3PB 1AHWB 2G5UA 4PRID 3NABL 3ARPA 4HSQA 2IGTA 4LOUD 2P24A 1JYNA 3N04A 1WWBX 2W07B 2A7BA 3EDJA 1DJWA 3ZZQA 1UUSA 2D7NA 3ECBA 3QNYA 2N59A 3F5WB 3CZJA 3LPWA 4IRZH 4XNXL 5J57B 3IMUA 5ABZA 4TQEL 4JPWH 4HGWB 3RL2B 5EDXA 4XWOC 1I1YB 2EVFA 2P44B 1I8LA 2EDNA 3U0TA 1X5AA 4JR9H 5CD3B 1AOHA 5T1KD 4JN1L 3QG7H 1A7PH 2OJZH 5FYKD 3H6JA 3OMZA 4Z0XA 3FOMB 3ZL1A 1CBVH 1NANH 1USQA 4UI2A 1A1OA 3BCDA 3FAXA 4FDWA 5IGXL 3ULVL 2GTZA 2VDQL 1FIEA 2ISDA 1DEDA 3QRLA 4CVWA 5C7XL 4JNXA 5JW4R 1LO3H 2P8PB 4J3OC 4OZIF 4JFEB 2H32B 5A40E 4X4MA 2YOCA 3MXWH 3MFFA 2NUPA 4AK1A 2XWTB 3BH8B 3L54A 3QHZH 5K9OA 4GG6E 4N6RB 1CXHA 3HCVB 4K94L 4U1SB 1DN0A 1DJXA 4G8IB 2LU4A 1QTSA 4KTYA 4HPYL 3ASNB 3KPNA 5J1SC 4R7DB 3UFIA 1QPKA 3KNBB 5FO9B 1QVOB 3HBPA 1KBVA 5LKNA 2RH0A 2AJYH 5BS0E 3FB5B 5GGUA 5KYWB 1IM3A 3ARGA 3IDJB 2ZXWB 1AIFB 1UKSA 4LSVH 1UM4L 1UVQA 5I17B 3MMEB 4DP9X 5C0EA 2YXFA 4DFIA 2ZAIA 2R4SL 4NN6B 1WCBA 2XKUA 4AEHH 4O4YL 3VFMA 2CPCA 1U95A 2NR6C 4W9IC 4U0QB 1YPZA 5I15L 3IEAA 2UXTA 4NWTL 5D70L 1IC4H 4PJGB 4GAJL 3AADB 2F9BT 2OQJB 2KMWA 4MJ6B 3UBGA 3UTTE 4XOBA 5MI0B 4ZI8A 3OKKA 1PS3A 3CHRA 4JHBA 4RGMB 2NY6B 3PWPE 1G43A 1ZTXE 3MFGB 2YD7A 1IM9A 5GZOD 3BP6B 2K8QA 1SYSB 4JY6A 3D18B 1JZGA 1DVZA 3FUMA 4HXBH 4FQ1H 2OMXB 1ZSHA 5JIHA 5JHBA 4ILDA 2X10A 3SO3B 2Y2YA 4HHWA 2R0ZL 4R5XA 2OMUB 4PB9L 2I5YH 3NRPA 1YEJH 2DQDH 5GZNC 1G7LB 1YJDC 4N2NA 4PJ8A 4I9WE 1J8HE 1UH2A 1TQBB 2CKBH 1FN4B 3IGFA 5EH1A 2APTA 3TO4B 1A7NL 3CDZB 2DQFB 4HXAH 4LMQI 4POUB 4MZRA 2Q8AL 1PCXA 2E5EA 1NANI 4JM2A 4KV5F 3ENEA 1GGTA 2KLRA 3MYJA 4PVNA 4B5EA 4PB0L 4V1DD 1URZA 5F0JB 3H3PH 3QCTH 2PYEE 3RWHA 1RUAL 5C0CD 2BNQA 3X3GH 4KTDH 3ZO9A 4XWGH 1EFQA 4QUOA 4QT5A 5HGBB 3FUKA 3UBXI 1AGCB 4ZS6D 4R96B 2XZCL 4OCMC 4WO4D 1HCVA 3QWOB 4RMWA 5FUOL 1HHKB 1KGUA 3S34H 2CO7B 1S7UB 1E2VA 3ARZA 2KZBA 2DM7A 5CJQL 5GGQH 3V55A 4YFLF 1DFBL 1DQKA 4WJKB 3JTBA 3SKNB 2VLMD 1SOSA 1KTBA 2MHAA 2Z1KA 4FNLH 2AV7B 1JK8A 5I6PA 3CTTA 3NK4A 1LMKA 5D9SA 3SE4C 3FB6B 5LJYH 5DQDL 1S7SA 2P80A 3HG4A 3MRCA 5SV3A 2R59A 1DO5A 3ZTNL 3TIDB 4IOSD 3B7YA 2BVYA 1B0GB 3T2NH 1IT9L 1B4TA 5AW4B 2ZCZA 4IU2A 1BECA 1GZHA 3NSDA 2CUMA 3KYAA 5ISZA 3QNZB 2NY1C 3KLAA 1Z5YD 1RY7B 3TT1L 5T5FL 3F7VA 2DQGH 4HISA 3FQ1A 3SGEH 5IKCB 3L3DB 4TVUA 2XTSA 5DS2A 3HJEA 1CXLA 3S98A 3DBSA 4CU8A 1E5CA 1ECYA 5GRUH 5KAQG 2NY7H 4WWKC 3BH4A 2HWZL 2UYLA 2ORBL 3ZK0A 1S6NA 5JZ7D 1DLHB 4O58H 4RISH 4NBXB 3UAJD 3U1QA 2Y25A 4A2EA 4BA0A 3F12B 2DLHA 2XV2A 3BT0A 2A6DA 5E4EB 2HJLA 4HCRL 3C8KA 1OWWA 4TQ8A 5KYXA 1CTNA 1QRKA 1JNLH 3MV11 1U2HA 3CFJA 1OT1A 2MTAA 5KANI 3DUUB 3OAUL 1YNTF 4D2NA 5LO7A 1XEUA 4UV4L 5F72S 3T0EC 1W6LA 3ATBA 2PR4H 1A21A 4N1HB 2DQIH 2D31A 3ZKXC 3ZSSA 5D72L 3MRDB 3NH7L 6PAZA 3D52A 2WAHA 1LNUA 1F6LL 1TETH 3RFZC 5F7EH 2ZOLA 1WT5C 4Z5RB 2Z8SA 3UBXB 1L3WA 1OE2A 1CFTA 3QZWB 2A73A 1YRKA 2EECA 3BFQG 3OD3A 1QBAA 4K9JA 5HDQH 2Z65C 3KG5A 4G6MH 5HHQB 4I3RH 4HFUH 1SXCA 3KS0H 4AUJA 2CE6A 1YA5A 5D96C 3EOBB 4EUPA 3REVA 1JPFA 4NQVB 1FO0L 3LV3A 2MEJB 1YEGL 4WEBH 1F8TL 4WKZA 3EJPA 5TFSH 5I1JH 4ZMLA 4JRFA 3HBGA 2F53E 4WW1B 1YSOA 5CZXC 3SCMB 3STZA 4W9FC 2XLLA 4WAFA 4X6EA 2APVA 2DMHA 1AZRA 3BIAX 4RBPK 2ZWLT 2HA1A 5E2WL 1XGUA 1HH9B 3DIFA 2H1PL 3OF6A 3RVWD 2FWOA 3T77B 3MPCA 3DPDA 4PJFE 5EZIL 4JJOA 2OMYB 4XHJD 3SZ6A 3PJSA 5E2UL 4O02L 3SJVD 2B4CL 3GGWB 5DK2A 5G55A 4LCUA 4PJHA 3SGEI 5I8EB 3U1SL 4DO5A 1M1XA 1QBBA 1K8DB 1R46A 2GBUA 3O6FD 3RB7A 1QHPA 1A1MB 1N3NB 2H5UA 1HK6A 3RA7H 1BG1A 1A1NA 3JWNH 3OSKA 4MB3A 1KELH 3G9AB 3D50A 1UOWA 5DUPH 1GYCA 4IOIB 5DWPA 5A2BA 4OZFG 2GI0A 3W9DA 3KYNB 1W80A 1IE5A 4TS6A 4U6VH 1ZT7B 2JB6A 4U3XA 3UJTH 2G60H 1H0DB 2XN9E 2N7AA 4F58H 4JQIH 1VPOL 1BVNT 4URTB 3PHSA 1ZIBA 4MA7L 2CK0L 3TEYA 1BMGA 1JJUA 2CKBB 3C6LD 3LPGA 4PJEF 3BGFB 1PEZA 3L2LA 1S5HA 2XKNB 3S4SG 1XR9B 4UIKL 1GZQB 5HI3C 3SYPA 1TEYA 2MH4A 3VXMD 4F8QA 4NCC2 2ITFA 5MEQA 4S10A 1OLLA 5TF1L 1UB6A 4IIQC 3VXNB 1WFIA 1W0VB 1YEFH 3ARED 3O4OC 3ORJA 1A47A 3KLKA 4Y2DC 2WTRB 5E2TH 5CLXA 4MZ2A 4PJCA 2LTQB 2OA9A 1KLFA 1BCIA 3PL6A 3K81A 4P2QA 4XNZB 4OF7A 2KPWA 5AVWB 1XD1A 1MWAH 4PRPD 2F68X 2NY2C 4YDVA 5KEZA 1A2YB 1RUKH 1KGJA 4KJWD 1MIMH 4TQHA 4QHMB 3QFJB 2OK0L 2ZCKH 1XR8A 2AITA 4J3OF 3GNML 4IOFD 5KSBA 3SKJH 5GPRA 4YSCA 4OLVL 5CLYA 1T2QH 4TVPH 3GXNA 2UUDH 1PAMA 1KT2B 3CHPA 3MRIA 3QJXA 3WIFB 3J8F7 2I7OA 4JDZA 3O2WL 4M03A 3GSVA 4QF1A 5LGHH 2OYLA 1HZLA 4MMZC 1ZAGA 2AQSA 2X4NB 2BY0A 1SJMA 1S8DA 1MCOH 4H0GA 4MAYC 1F90L 5E8EA 5GGSB 1IBZA 5EIVA 5C3TA 1OSYA 5IZ7A 5B7MA 1G1YA 2R4RH 4OUUA 3V6OE 4YHZH 5BNXD 5IWLA 2VQ1B 3TNMB 3UERA 4MKTA 2MCPH 4UM9B 1IBGL 3TFKD 1A6TA 2DI9A 3GLZA 1ZDSA 3TVMA 3F7YA 4LASH 4DN3L 2QSVA 2OAAA 1F6AB 3ALPA 4I2XE 3RWDA 3VXOB 1L5GA 3Q6GH 4KO6A 1O5PA 1KB3A 1NCJA 2AQQA 1TT6A 5F96H 3ETSA 1MW2A 5JDSB 3OXRB 1IGJA 3QUXB 5KSVB 3KCPA 1UURA 3ME0A 1WO2A 4OF0A 1QA9B 2DKSA 1FYHB 2ZIDA 4MMXB 1ED3B 4JZJB 4KXDA 4N6QA 1IM3D 4UINL 3ARGD 4KK5C 2Z8VC 4K15A 3JBG7 1RCYA 3MBXH 4B9GA 5JXEC 4FQXB 2IBGA 1ZA6B 3L4WA 1U3JA 4NHUB 1N26A 1CD0A 2WQ8A 1H3VA 4ZFOA 1UKQA 4L4TA 1OAQL 5SWSB 4LSRH 3VG9B 4N2OA 3V5KA 5C08A 1TTRA 5AG8A 3VFSA 1JZ5A 3K46A 4RWYL 3IGUA 1PD6A 1INQB 2VLRB 1YYML 1E5UI 2W65B 4MB5A 1IM9D 3HI1B 3M07A 4GRMB 5HHMB 2OR9H 3VFOB 4UQ9A 2ODHA 5B1AB 4QR7A 2A4EA 4WGVB 5F3BA 5AOIA 3EH2A 3DX2A 4FTVE 1JGEB 3TJHD 2D7TL 2XN2A 1JOIA 2JLLA 1V27A 3NTCH 3OM3B 2FLMA 4HUUB 3FHAA 4HVBA 4NKOB 1XH2A 3MUGB 3ULAB 2CQVA 4XX1E 2FIRT 4NZDA 5F9OL 4YHKL 4CSSA 2BOLA 3FO9A 3UYOD 3WNLA 3BSZL 3QCVH 3T8XB 1XF5B 4TPRH 4PJ8D 5CSZB 3OMNB 1ZVYA 5I8CB 1KY6A 3G5YB 4PBWD 5FC9A 3FUFA 4LHUB 2E6JA 4HS6B 4JM2D 3ABKB 4LE8A 3S8WA 3OX8B 1RZ8A 3CZSA 4G71B 5CS7A 1OGAB 2DQJH 2CCWA 2BNQD 5F21B 5BUPA 4OLYH 3P4MA 1EJFA 2XWDA 4DPAX 4HIEA 2Y7QB 4RMVA 4TL5A 5L6YL 1CCZA 1XIWC 1XVSA 1CFBA 1CE1H 2DRUA 4JVUA 2VXQL 4KXBA 3IWVA 5CUSL 3BE1L 1FJ1B 2OJEB 2BW5A 1MI5B 4AGPA 3C09B 5B8CC 3CN2A 6CGTA 4NRYB 5FFLA 1QSEB 2CIIA 4FZ8H 1BLNA 1G9NC 2F54E 1OARL 3QUYB 3B56A 4Y5VA 3T4YA 4F7MA 5KZCD 1OCCB 3HE7C 3LIZH 3LRSB 3T4AB 1I8KA 4D9QD 2Q3AA 2WLMA 1CZ8L 3ARFA 5I18H 2CUHA 5EV7A 1SQ2N 1O9WA 1YNLL 2LU3A 2ZKMX 3KPSB 3OJMB 2PCPB 1MWAB 2VE6A 4EDWL 4ZFFA 3O4LB 4LLMA 1VESA 2P80D 4X4YA 5IT2H 1Q9OB 1BFTA 5CJBA 1P1ZA 3WTVA 4BYHA 1BIIB 5C6TH 2X4SA 3HC4L 4NO0B 2F58L 3NJVA 4M93B 1MQKH 3P9LB 3SD2A 3T2OA 3JZYA 1EJOL 3B7TA 4GEJA 2MMXA 4RGNC 4U4BA 5TTRA 5ISZD 2H4EA 1ZGLM 2QSCL 1LYQA 1KCBA 2V2XB 1I1RA 2R9HC 3GXFA 5D1XE 3FTVA 3G6JE 1MFUA 3A4AA 1MFNA 4HKBA 2X28A 2EC8A 5IMMA 3TN0A 3GJEB 2I9TB 3K5RA 2J5LB 3SDDC 2VZSA 4XGZA 1U8JB 5EZPA 2RALA 3T08A 4OQTH 3ZY7A 2XWCA 1FF5A 3H85A 4G59C 4B7IA 4PJBB 5KVMC 4C83B 4XO5A 2EDLA 1P5VA 5AZEL 4JO4H 2XBDA 2R0LH 4Y2OB 3IAQA 3FT2A 3GZOA 4OLEA 4NDMA 1WQVT 1AO7A 4OKVA 3O11A 1RJYB 4LOUC 1R75A 2EKSA 1T2JA 4NQXA 1G9MC 5EORL 5I71C 4XNUH 5L2KA 2W81C 4Z3FA 1ITCA 4U7MA 2A6JA 2QLYA 3IPFA 4OF3A 1OV8A 1VFAB 1H6FA 3D25B 1MCNA 5DQJB 2MNWA 4CILA 1WITA 4KRPC 1INEH 1G9EA 5JORB 5IB2B 2XOTA 2XY1A 2VQ4A 1DHKA 1PX3A 2AJUH 1T89A 1CK0L 3MRGA 2E3VA 1NIFA 3ZE1E 3K72B 2JKTM 3ROOA 1JNJA 3PXHA 2QDWA 2I69A 4E41E 3CMOH 1J12A 1QO3A 4K7FA 5C8JB 5LDUA 4XZUB 5EUOE 2QV4A 4JZOB 4UOW1 1ZLUH 3F6LA 2OYMA 3ECWA 4ZMYA 1U8MB 2A83A 3SKOA 3QCUH 4I18C 2MJWA 4IEFB 4DTGL 3DMMA 3FSAA 1TZIB 3QDJB 4W9KC 3BDXA 4R26H 2ZX5A 2B1HL 2YBRA 3HAEH 2GITA 1PVHA 3RGHA 2GSIA 3Q2NA 4TVSa 4X5QA 2X4QB 3OF6D 5D5MB 4PEEA 5EWIL 3ESNA 2F1AA 4XP5L 5IMOB 4AYEC 1GMIA 2R56L 2VM4A 1DQJB 2ADFH 3DETC 2DTMH 2WV3A 4GEIA 4MD0B 3VDAA 3L9EA 5A3ID 2Q10A 3BWUF 2FQGA 4XXDA 2H6UA 2MKWA 3C12A 4GG8A 2E7MA 5BJTB 3U4KA 1KCLA 2K1MA 5FO8B 5C0RH 4NKQB 1PTZA 5SWZB 5JOPE 4KO9A 5EO1B 3TS8A 1RU9L 1JTOA 5IEKA 4WEMB 5A7BA 4F7KA 4HIHB 3AROA 2IGFL 4OT1L 2LQRA 4Y1AB 4WK4B 1PKQE 4ANXA 2IH1A 4M1GH 4HLZH 4GW5B 3HZYB 2WVSA 2QHLA 4FQPA 4YBQD 1MF2H 3BEVA 5ETUB 1BQKA 2WLZA 1T6BX 3LNDA 3P4NA 4J3VA 2VJXA 5LGJB 2JF1A 4F37F 2C3XA 1C5BH 3NIGE 4ZO8A 3AWGA 1OO2A 2BRRL 4KK9C 1ILSA 4ABVA 1TLKA 2JXMB 4PRHB 1ZWIB 4M5ZL 2FJHA 3CZKA 1XGRA 4DKEH 1WWAX 1YJDL 4LLQB 5GJSL 4LRIC 4HGMA 2QDVA 3C87A 3A47A 2B8OT 2V8MA 1A9EB 1D5MA 2VLKE 4FQHB 2NXZB 2I07B 4O2EB 4PJIE 4S1QH 3CK0L 3I50H 4LGPB 5HI5D 4ECNA 4Z76B 3PL6D 5KVFL 3QJQB 3IGAB 4MCZB 3QNXB 2FJFA 4P2QD 2XBZA 3SGKA 3M1BA 5DLML 3DRTA 4FN0A 3MOAH 4QJ3B 3P02A 5E23A 4X5RA 1F2QA 1HESA 2BWQA 4H5SB 2C5DC 2AMGA 1ZHNA 1QI5A 2ZG2A 3SPJA 2BSTB 1F2XK 5DR5H 1NFIA 1JK9A 1JHTA 2X3CA 5I24A 1VB9A 3VGFA 1JYVA 2VDNH 2VSCA 4Z3HA 5TF0A 1WH0A 1YN6B 3VX1A 1S2EA 4ZS6C 3Q2LA 1QFWH 4WO4C 1TVDA 3GFUA 1KIUB 1D5ZB 1X5MA 2E8YA 5CLZA 5CGTA 1KFAL 1VRSA 4Q0XL 4BZ1H 4OUOA 4CC4A 3CLEL 2OL3L 1PSKL 5EMYA 4Z7QE 4JFDA 1BQLH 3AS2A 3UPAA 2PYFA 1IAKA 5C71A 3PJNA 5ITFA 2AW2A 5ID1A 4DN4H 1KUMA 3P0GB 5FV1L 1ZLWH 1E4JA 2WO2B 1PAZA 3N41B 4JO5A 2YXWA 1PKOA 2UY7A 2WWNA 1DP0A 4MNQB 4RNRA 2X4TB 2WOBA 4KJQC 4XXWA 3UTSA 1P4LB 4FFVD 4NSKA 3VFRB 3TVMD 3O8XB 4JFWA 7FABL 2P5WA 5LG1A 4ZK8A 2MTPA 2VITA 5DQ9A 3TJEL 1CGVA 1KJ2L 5J9PB 4XN2A 3O3UN 1EEZA 3O4OB 2CUAA 4KTGA 4QNPF 5AYTA 4KMQA 3PWNA 3TBSA 3ZVVA 8FABB 3NAAH 5FW6A 4GH7B 3R06A 5EF3A 2JH2A 3WEOA 4HWUA 1J5CA 4E9SA 1CFSA 2X1OA 3ARYA 5FA4B 4FKKA 4K9EC 3VI4A 1RZJC 3ULUF 3GSNA 3QUZA 2NY2B 3UAJC 3ZUCA 5CCKH 1DBAH 2Z1PA 3L2NA 4NJ9L 1WIPA 2QZ5A 3ZR6A 1IVLA 1AMXA 4LCWB 1A3ZA 3AT9A 4U3HA 2YAFA 1CO1A 1TJXA 3FK3A 3D39E 5K1VA 1JNNL 3WJLA 5I2IA 2P8MA 2QQNH 4FP8L 4P46A 3UG4A 2BINA 2OI9C 4M4PA 3WN5C 5JHLA 1WBYA 4L4TD 5F1KC 1E3ZA 2G9HB 4LKCA 25C8H 1NOLA 2J8UE 1D6VL 5C08D 3H42L 4YFEA 3LHPH 3M6DA 1T5WA 3D12B 3HAEB 2BOBA 1Z3GH 2AMUA 3IDNA 5IP4A 4I5BB 1VEOA 3CZUB 4W93A 1FHGA 1QFWI 3PV6A 4M3KB 5G4NA 4WUUB 2MCMA 3DRQB 1F4YL 2V2TA 2FR4A 3GMPB 4X7EC 2H0PA 2VXUH 5E1AB 3QRGH 5L9DH 4XCCH 1UM5H 1CPUA 5B4MC 1F1GA 1KTDB 1Q9WB 1L0XA 1XL6A 4BDVB 5CCGE 2ZUXA 4QRSB 1B9KA 2PXYA 3EDKA 2OTUA 1QWHA 3O9WC 1RLBA 4Z7UB 1UWXK 3GD1C 5TDPA 2FWLB 3IRPX 3NCWA 5CN3A 3GRGA 1SDYA 1NUFA 4W9LC 5AVTB 5H35A 1TJHH 1Z9LA 1OM9A 3SE9H 2WXFA 2FT8A 5ICXB 3WFBH 2OMVB 3MREA 2Z4QB 3TA4D 3RVWC 1A14H 1T3FA 5EDSA 1BG9A 4ZNEE 1AR2A 3CDFA 3AVEA 3MRKB 2E9JA 1ES0B 4HLJA 4XHJC 2Q9OA 3BPLB 1XZWA 4TSBL 1I9IL 4F3FB 3WEBA 1AVAA 2X7LB 1SHWA 1PPIA 3NCYP 5AYUH 3B6SB 3O6FC 1G1CA 1Y6NR 4JLRA 1L9NA 4DQOL 2V5RA 3BUBA 3B2UD 3ZQWA 3OXSB 1FV1A 1QHQA 3KYKL 5CO1A 2BDNL 4QTHB 5CP7A 2GHWB 3KR3H 1GYVA 4BA8A 4PM1A 1U33A 4N25A 3RDTB 4B9KC 2IQ9H 1WP6A 1HZHL 4OH2A 1UWGL 3PQYE 4HUKB 4WHTA 3BUYA 3UMNA 3MLUH 4BKLA 3CCHA 4ZXBB 3K6FA 4F2FA 3ARFD 3E0GA 4WTWA 3CVHA 1YEKH 1LO5B 2LOEA 3EFDL 3H7BA 2PP7A 3MODH 2AK1H 3OKEA 5TPWL 3RIAF 1GTNA 1JGVH 2YAOA 3HRZC 4WSJA 5HVGB 4A6YH 3C6SA 2N1KA 5E6YA 3BEWB 3VSTA 5FKPB 4F8LA 4WTQA 2FTAA 2KZWA 1QNZH 2ZUWA 4JO1L 1B0WA 3O0RH 2VDNB 3LRLA 4GP5B 3EFOA 5DLLA 3RURA 3UTTA 2XXMB 1OAKL 2C3GA 3L2MA 2Y1ZA 4HX1A 4HIXL 1JRHL 3EYSH 2BMKB 1A4AA 2R29A 1SBSH 1T03H 5JLZB 3TN0D 1O9VA 1OW0C 4KZEL 5ESVB 4X5PA 3HB3B 1NJ9A 3O2VL 1FFNA 1QSFE 3FOLA 3GSXA 3ZE0F 5T1JA 3D51A 2G5BA 3RQ3A 2HZHA 3EADA 3HPJA 4GI6A 4XCEA 5FW7A 1N5YL 4ZSOA 3D9AL 1NSNH 1DVXA 1R24B 3IJSA 3DBXB 4UQ3A 5JMRA 4OFYA 4XO3A 4WHCA 1AO7D 3NJLA 3NFPB 3VD3A 4FS0A 3TYFB 1BREA 1QRNA 4XC1H 5C2BH 2BVUA 4WK2B 5DA0B 1PL3A 2D73A 4IRSB 1TJMA 1J8HA 3NSCA 1SF3A 5L2KD 5LXGL 4H20H 4TLKA 2YKKA 4OGYL 2ZYHA 1LM8V 5B8CB 4LBEB 1TKWA 4QWWC 5IB3A 1OP4A 4P9MH 1UCBL 3OPUA 2D8KA 3OHMB 4L3EB 5FYJL 2PYEA 4BZ2L 1QR1A 1N59B 3KGUA 4HHGA 1X6NA 3A67L 2WYTA 2F08A 2WMPA 1MVUA 1M05A 2CJSA 2ICWI 2XN1A 1I8LC 4JRYB 2GAZA 4LEEA 4XNXH 4KY2A 1MXGA 4MAZA 3F8UB 3B3IB 3EKCA 4TQEH 1J0ZA 4XMXA 3NN8A 2MQ0A 2WNXA 4N5EC 4PJ9A 2DW5A 5EU5B 5FFGA 5KS9F 4NN7B 3IXAA 5DJ8A 3TFKC 1S7VB 3V4PH 1MHPL 3X3FH 4OJAA 3VSQA 3LJ3A 3TBVA 4P23C 1YMME 3QJVB 3DO3A 1RPKA 2MQCA 3DMMD 3QE5A 3LRGA 4KJPD 4LFHD 4LGSB 4TUOA 1C7TA 5KVDH 5C70A 5IGXH 3ULVH 3L08A 5J6GB 2VDQH 1UXMA 2APBA 5D1QC 4ZUWB 4WENB 5HHVL 2AJ3A 5F9AC 1KPUA 4JL2A 4J8QA 4EVNA 4NWUL 2PWHA 3R8QA 1NGQL 2MOGA 4AQAB 2KQMA 2G5RA 1UXLA 1AJ7H 4K94H 1O6SB 2EH7L 4M43L 2W9LA 3WL9B 2QHRH 2QMKA 4AQ8C 5KW9L 1AHMA 2JLPA 3ARGC 5CINL 4DP0X 2FO1A 3T3PE 1QLEH 3OAZH 1H19A 4C58B 4PJ5B 3BZ4A 1CC3A 2NNFA 1TPXC 4UUJB 3AT0A 3AJ7A 5F1NA 1XGQA 3GS4A 4DP4X 2BH0A 2WZ0A 1X7QA 3QVAA 4NRXA 2R4SH 2FH6A 1H3PH 1LJMA 3IYLW 4O4YH 4R90L 2GCYA 3G6AB 4BFRA 2CDEB 4GFTB 2FDBP 4BWWA 5D70H 1G1OA 2UY6A 1TSHA 3GO1L 1D5XB 1M7DA 4PJAA 2XZZA 2NNAA 1SDAB 2HRPH 3WY3A 3WNPA 2IDSA 4PREA 5B39G 2JIXB 4FHKA 2VL5A 3F83A 4E9LA 5C9JA 1TXKA 2IVFC 2VW7A 1OB0A 4L3CB 4RSVA 3TJHC 5IW1B 4Q89A 1PLBA 3WD5L 2ICWB 2CBPA 1N7ML 1E9OA 4Z8FL 2X9WA 4I48B 5LQBH 1LXMA 4OBRA 1FL6B 3SBWA 5KJRL 3CUPA 3BKYL 1UB5B 2BC4A 4JFEE 1T66C 4KK6D 3WFCL 1W2KT 1K72A 1DLFH 3FH8A 4UT9A 1THCA 3WHE0 3KL5A 1AP2B 1FVDB 4OM0H 3BWZA 4HULB 5K59E 1MOEA 4P06A 2IPKB 2RJMA 2RAMA 2C9RA 3FN9A 3LEVH 2VR6A 3RWFA 4QLWA 2Y36H 4JM2C 5BZXA 4NKIH 5EIIG 3EJJX 3BW9A 2W9DL 3E3QE 3JZ7A 3C8DA 1W72L 3PWLA 2WLIB 1A7NH 2G4GA 4FEMA 1BZDA 5IQLA 2Q8AH 2Z93B 1OP3H 1G9NL 1Z3RA 3L3GB 3EBIA 4O5LH 4AJVA 4D8OA 3KYMB 2KH2B 4H8WC 4OCYL 3LHAA 3ZRCC 1IILE 4PJFA 4BM7A 4JFDD 3MOBL 1SJXA 4JFFE 3S35L 3MKGA 5LBVA 1ORQB 3DIDA 4BCYA 4PJGE 1OM3H 3ZMNA 4TQPA 5FYLD 1OAYH 3MLRL 2NW3B 3AQYA 4PI2A 4UYPA 4BKSC 1I1AB 2BJMH 4OD2B 4LSDA 5K39B 3HMWH 3KAAA 4HWZB 1GA2A 1A5FL 4JY5H 3C5SA 3VWJA 3UTSD 3BQUA 4U6HA 4ZAKB 2ZXAA 4AC4A 5BRZB 2G2RB 5HPMB 4HT1H 2FK9A 1RUPL 4M5SA 4L8BB 2EIZA 2HT4D 2P5WD 5DQDH 1TMQA 3WS6A 1F56A 1GZHC 4UT6A 2Y2TA 3EUDA 3WYRA 1WICA 4OFKA 4FGMA 1AI1H 4XAKE 1AXSB 4P5KA 4OZGF 5DMIH 2XHNA 4F9PA 2DLGA 1WD8A 3OL2A 4QAWA 5IVOA 3EHBC 2A38A 4JFPB 2YD6A 5TQ0H 3BLKA 4YDLB 3W2DH 2N0KA 4KMTH 2HFGH 1VKXA 2BSBA 2EIKB 4CL7A 5CGBA 3TJPA 5JO5B 1OCWL 3WIHA 2ADYA 5F0MB 3QUZD 4ZJ9A 4LLWB 2IGLA 1E28B 4KI5E 2B5IB 1V55B 2OSLB 4HA1A 1FLTX 3H8NA 5IVXA 4L8SA 5LLIC 1QQDA 5DJ0B 3V0GA 4WCYL 4JKWA 2Q3XA 1PGRB 4TOYL 3DX7B 4AY0A 1AD9B 1BOGB 2GJ6A 1M6OB 3NQKA 4P46D 4R4FL 3V4PB 2R23B 5I1GL 5DZ9A 1KGYE 3LQAH 2CLZB 1VIWA 2Y5QA 4UV4H 4JFHE 1UM6L 1BBJA 1F5WA 2LAGB 3AC0A 5IBUB 4UDTB 3H56A 5C3LD 2VDQB 5FYKL 4K3JL 1S5IL 3NH7H 4KKBD 2EEFA 4Q2ZA 3DVIA 5JDJA 1DBKH 1TYEB 3AU1B 3IFOA 5L88L 1P4BL 3B9EA 3N3EA 1FAIL 4YPGA 5FFOA 1ASPA 2JNZA 5HJDA 4KZCA 2X38A 3BUPA 1NDGB 4XXCA 4F57L 3CPLB 2NLJB 3RL1A 4M8QA 4PJ7A 3L5IA 3W0WB 2YC1A 4PGEA 4DEWA 2OFQA 2EDQA 1KYFA 1QLEB 1NGWB 2PXYD 4O9HL 1OSEA 3BWAB 5D7LA 2WQXA 1D5IL 3VH8A 2GT9A 3RP1A 4B60A 1F4WH 1KPRA 2UXFA 5KVEL 3N0PB 3ZDYB 3L4XA 1FO0H 1YMHA 3OKMA 3FMGH 4YSSA 2QBWA 1Z9NA 1NGPL 5AB9A 2Z64C 4FEIA 1JWMA 2EYTB 3GIZH 1Z2KA 3U7WH 3OR6A 4NUGH 4HK3N 2EDXA 4ELMF 5ERWA 4I13B 1U3ZA 1YUHA 1MFEL 2JE8A 5MP6H 1O9ZA 4B50A 3QIBC 3MBWA 1JGUL 2QPFA 1HWWA 4O02H 3QQ9D 4QRTA 2FL5B 1PG7W 1IGTB 4LMQE 5D2NE 4ZUSB 3QUMA 5KJ7E 1MHEA 3BVUA 4JZNB 4P07A 4FLSA 3UZVA 1JZ2A 3WY4A 1UZ8B 4GW1A 1TQSA 4YBQC 3SBQA 5L7XL 4UNIA 4FLOA 4TTDD 3V0WL 2DQUH 4MQTB 5HJGA 5HHXL 2EO7A 4BXSV 2YGNA 4Y16C 2VMJA 4OVUA 4C4BA 2VKWA 3QNFA 2XWBA 1KCKA 4PYGA 1U8IA 2CK0H 4U1LA 1N18A 1EEUA 1DQLL 1E4XH 1J86A 4JS7A 3FKUS 4YJZL 4Z7OF 5ABAA 4G80B 1N19A 4LRNH 3UTTD 2ZCLL 3WGVB 5JQ6L 4ETQA 5DT1L 5MENE 1G5GA 1WS7A 2ZAGA 1RMFL 3CFNA 1S9XA 5TF1H 1F42A 5DJAA 3CX2A 4DZBB 3PL6C 2YRZA 4L29B 2J1XA 4GXFA 3OPZL 5CMAB 3WOVA 3GLDA 4TM9A 2HXAA 2D3LA 3MDJA 2R2HA 4FTVA 2ZXCA 2UXGA 1MG2C 1N0XL 3REWB 3I6LD 4M7JL 1G7HB 1IQWH 2JCCB 2PP8A 5KYUB 4Q9QL 2H3NB 4OFYD 3ZKQD 1BA9A 3MV8A 1PQZA 3CLFL 3JTSA 2DB8A 1R3KA 1TVBA 1QRND 2VLLB 3DXAA 1HH6A 5DJYA 3W37A 5E08H 1EEQA 2JKSA 2PW2B 2OK0H 1DVTA 3EW3B 1J8HD 3F7RA 3FUIA 5A7EA 3F05A 1FI8C 3FO2A 2XICA 3EZ8A 1AZBA 4HV8B 5A16A 4KXZH 2ADJA 3V4VL 4D0DB 4FJYA 4L4VA 2PYED 1UJ3B 1XCXA 1YUKB 3I6GA 3X13B 1QATA 2YLHA 4TMPA 5FHBL 4EAEA 5JNYA 3D4GA 3DSNA 1AY1L 3FF8A 3JV0A 1AQ8A 1UTDA 2O61B 1MCBA 3LRKA 2Q3ZA 2VJ0A 4A38A 3BVNB 3RWJA 1MRFH 1NCWH 4JG1H 1F90H 5J89A 2B0SL 5ESAA 1NAML 4PJ9D 2ATKA 4AX3A 5HYSB 5DZOA 3HRZB 1UASA 1YPZF 3QI9B 1MZYA 4Y19A 3U0PA 4FFVC 1OPGL 2F54A 1HSAA 4Y7OC 3DOSB 3QUHA 4IHOA 4HU8A 5KUKA 1PG7L 2DWDA 1G6VK 2YUVA 3KZ8A 3L4CA 1GTFA 5DHVA 2E86A 1RPUA 2AJVL 3OKNA 4K9EL 1JDDA 5D7IA 4DP7X 1RSYA 4KTEH 2FD6H 4APXB 5LNDA 1K2DA 2A74B 1LEGB 2G3NA 4Y4FC 2EAEA 3FFDA 3O3AA 4OZ4B 5SV4A 1E43A 1E4XI 4YQXL 4XPGL 5KSUB 5FX3A 3QEQB 3E6FA 4PLNC 1CICA 3QFJE 5DWUH 2AABL 1JUFB 2G4EA 4FXGA 4OR1A 1I3RA 3VD4A 1LD9B 3GMLB 3V7AG 3JWDC 3EAKA 3G6JA 1A7OL 3ZE2F 4R84A 2W60B 2Q76A 1NMCB 1KNOA 1UJTA 3ARSA 3GZPA 1LQBC 4LLYB 4FXKA 4WHDA 3CXDH 4WQOA 4YL9A 4EUPG 4GP4B 1U8LB 1KCUL 4LSSL 1KC5H 5LDSA 2R0KL 4JM2F 2WCSA 1MFBL 1ERNA 1L6XA 1ZE3C 5KSAA 1B6DA 1O7DC 1FHNA 3RY6A 3SQOL 4HWBH 2XZAH 2EP6A 2AQNA 1JZFA 2YZ8A 1FO0B 4LCCB 4PP2B 5BUGA 5E8PB 1Z9PA 3TZVB 4QRRA 2NY3B 1MHCA 1OPOA 1U8HB 2ICCA 2BRQA 4ZPVB 3U9UB 3C9NA 4KXZI 1P84J 4CA4A 5FB8A 2GUYA 4UILL 1T2XA 1EEYB 3DC0A 3GXDA 5CGMA 3BP4B 1DDHA 1MCJA 2HFEB 1Z1WA 4JRXA 4ZUVA 1UCTA 4O02B 2DM3A 1RKRA 3SYOA 3MI6A 3MC0A 1HHJB 3MRPB 1BXAA 2DJMA 3O81A 5DHEA 3S36X 5TK4A 3OKDB 2VZVA 4OFDA 3BKML 4AKPA 3BSZH 1CI5A 5L4JA 1K4DA 1QASA 2NT0A 3FT1A 4MNGA 3BPNC 4GAYB 3LPOA 1CFMA 1OK0A 4OZIB 3VGEA 3CDGB 2E75C 4XBEH 2XWZA 2PWGA 1L9TA 1VZHA 3ILPA 5DC0A 2Z0BA 1ZHBA 4BQBA 1DQIA 4HIJA 2NY4C 2Z7UA 2AZUA 4OZHA 4K07A 3N9GL 1YY9D 4ES8A 2UZPA 4FFTA 2HTLD 4GKSA 3FH7A 3PFUA 1HNFA 1G84A 1ADQL 1KN2L 3DV6A 4XX5A 1TSRA 3H7LA 4RFOL 3VFGL 5LWYH 4NZFA 1AD0A 4Y5VC 2NXYB 2Y6TE 2F1BA 5SWSE 4YFLI 1H9VA 1NGZB 2BXYA 3ROLB 4L0ZA 2FYVA 4ZO9A 1NKGA 1MFVA 2QLVB 1OE3A 1ZXKA 3WMSA 4J2QA 3IETA 3ES6B 4XVJH 4BIKA 2VLRE 2XYCA 3OJDB 1B4LA 1JP5A 4H13C 3VWJD 3BQUD 5HHME 1CZ8H 5DD5H 4XN8A 3AFLA 1SEQL 4L5FL 2VAJA 1UT2A 2IH3A 3GLAA 4LPWA 3KJ6L 5IB4B 2FYYA 2W5PA 1I82A 3MRRA 2AXJA