4QI3A

Cytochrome domain of myriococcum thermophilum cellobiose dehydrogenase, mtcyt
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
b'ENNVPNTFTDPDSGITFNTWGLDEDSPQTQGGFTFGVALPSDALTTDASEFIGYLKCARNDESGWCGISLGGPMTNSLLITAWPHEDTVYTSLRFATGYAMPDVYEGDAEITQVSSSVNSTHFSLIFRCKNCLQWSHGGSSGGASTSGGVLVLGWVQAFDDPGNPTCPEQITLQQHDNGMGIWGAQLNTDAASPSYTDWAAQATKTVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose dehydrogenase
molecule tags Oxidoreductase
source organism Myriococcum thermophilum
publication title Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
pubmed doi rcsb
total genus 45
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qi3A00
4QI3A 1D7DA 1D7BA 1PL3A 1D7CA
chains in the Genus database with same CATH superfamily
1N8ZB 2G30A 2WTRA 5IVNA 1VFUA 2GIYA 2LU4A 3VSVA 1BQUA 1FAKT 4E9YA 2H5UA 4AYFA 4Z5RB 2J1XA 3X1BA 1UZ6F 1D7DA 3KBFA 1FVEB 3ABMB 4OCSL 3JWDC 4JDVA 5CD5C 3VXSA 2WXQA 3OLEA 4WW2F 1MAMH 4FQIL 4XWGL 4ENZA 4LE8A 2A0LC 4HAKA 4R96A 3WS6A 2WM0A 1MJ8H 1F4WL 1NJ9B 1UWYA 3GM0A 1HH6A 3HB3D 1F0LA 1U2YA 3Q06A 1GTFA 2XWJA 4KKBD 1CL7I 4ONGH 1GJWA 2X0WA 4NI6A 4TSCL 2BNQD 3KYKH 1HQRA 1AD0B 1YEKL 5GJTL 5FYKL 2PPEA 2XDHA 4Q14A 2H4EA 4F9LC 2YOAA 1ES0A 2RD0A 2B4CC 2O6FA 4HJEA 3DYPA 3WN6A 4KZDL 4PWEA 2JH2A 1P1ZB 4D9QE 1FRGL 4ZTOL 3MRLA 4QXUL 4P57A 1GYWA 2FQDA 3SBWA 1X5KA 4R3SB 4UF7C 1S5HB 2GY5A 2CO6B 3UGEA 1MHHB 4WEUD 1IC1A 3IGUA 3NEEA 4LCWA 2DMHA 3SGEH 2B3IA 1DSYA 1N0XH 1TJHH 3LXBA 2R27A 3WNLA 3BGAA 1AIFB 4ZO9A 2NUPA 3KWXA 1ZSHA 4I18B 3G9VA 3BEWB 4JY4B 4BUQA 2BNUB 4TSBL 3VFNA 1S9KC 1W8EA 2NDGA 1J1PL 2CBOA 3B5TA 2XFXB 1B9KA 4MCYA 1I9JH 3TEXA 2F18A 2CPUA 3F7QA 3DETD 1GZPA 2DICA 2SEBB 1VGKA 4OFKA 4PBXA 5BVPH 2G3ZA 4OJDH 4UAOB 5DZJA 1NLBH 4JMXA 1K3ZA 4Y4KA 4CU8A 3OR6A 3GLZA 2IMNA 4GSXA 4BZ1A 2UYLA 3HCVA 1MG2C 5LQBL 3H0TA 4XCNA 4KROC 3R1GL 4UB0L 5F0MB 1WEJH 3ZE0F 1QZ1A 2VR3A 3EG9A 3MX0A 2X4PB 5DTFB 2O5YL 1A4BA 5D5MF 2E7LC 2Z7WA 1IM9A 2HVJA 2YAQA 5CMAB 2IAAC 1PMYA 2QSCH 1FNHA 1PZBA 5CJ8A 2Y7OA 3AWFA 4AGNA 4WUUA 4M3JA 4KFMA 3RTLA 4RGNE 5CZRA 4KX7A 4QRUA 3QGVA 2ROXA 4X6BA 5D7JC 2DTML 2Y7QB 2LOEA 5GS2D 4UTAL 2Y69B 4LU5H 2V9TA 5D7SL 3UCQA 4UQAA 4GAYB 3AACA 4H1LH 4W4OC 4AC4A 5DEGB 2WZAA 3MRDA 2PTTB 2CGYA 1WS8A 4ONHA 4HIEA 5M94B 4G43A 4KITB 5IJVA 1G6RH 3W1ZA 4ELMA 1CF1A 1NC2A 1I1CA 1S8DB 2W94A 2QPEB 2OR9H 4N24A 1F58H 2YQBA 4QOKD 32C2B 2Q2LA 1IRAY 2CJTA 3B2VH 2OXGB 5EF3A 2QQNH 3CSTA 5I66B 3GHEL 5HI5C 2X09A 3FN3A 4K07A 3IGAB 1UT9A 5ELIA 5AYUL 2BY3A 1AHKA 2P4AB 5BZWB 4EUPA 3QVAA 4GPVA 4POUB 2HVJB 3NSCA 3SE8L 3DURB 4F7TA 1N6QH 1K2DB 1QLEH 4TNWK 4CBPA 8CGTA 2Y3AA 4JZOA 2FR4A 3Q8FA 1WBXA 2ZJSH 4M1GL 2Y07H 2XICA 4NYLB 4X7CC 3QK0A 3QEGH 5DSCA 2PW1A 3ZE0E 4A04A 2FJGB 1O0VA 2H9GA 3WTUA 3AGVA 3HE6C 5FYJE 2WLKA 4ATTA 1UKQA 4PCKA 2HG5A 4YDVB 2PO6C 1E9QB 3CPUA 4OLVH 1MW2A 3DX4A 1KCWA 5K9KA 5F7DB 4PIRF 1U3NA 3RWGA 1NSNH 3SO3C 3NDZE 1PZ5B 4MCZB 5E4OA 4HCRH 1HHIB 3HAEA 3AG1B 3MJ7A 1OK0A 4YOKA 4LASL 3VFVB 2Z35B 1DVFA 3KM2A 5DVLA 1GW0A 3W0WB 3RNQB 3QNXA 2J2ZA 2VMJA 1JZ3A 4HKBB 1CICA 1FSKB 1AS7A 1ZHKB 1NKRA 4WVRA 4XPHH 5CSZB 2WO2B 5LUMA 1TITA 3MV9D 5LNDA 2XFGB 2EH7H 4B9PA 4P06A 3P0GB 4WW2C 2YZ8A 4R4FL 2IC2A 3D87B 5TE6L 5KYUA 1U8OB 3A6BH 2HPOA 1UXLA 1FWXA 1H3PL 2ITDA 3LNEA 3L3HA 5IW3A 2QGEA 4EI5B 5CWSB 3ULVL 1OAZH 2Q86A 4YDLC 1G7LB 2VDQL 4XHJD 2F1BA 4WWOA 4XB8A 1MCNA 3R8QA 3DTXB 4OY9A 3T65A 2KHAA 3Q05A 4LRNH 4L1LA 2CKBA 3C08L 4OAWA 1V3JA 3WL9B 3E6HB 4N8VA 1GMEA 3DPDA 5HHQA 5GRJH 3D3VD 5DUML 1ZVHA 4YIQA 2ED6A 3BWAA 4TL5A 4MHHG 5I74C 3LH2L 4AGQA 3KLAB 3PQYE 1N3NA 4KO7A 1WGOA 2A9NL 3SDAB 4H1LB 3FHEA 3I9PA 3CZKA 5C3IA 1Z9SB 4J4PD 1I3UA 4NZTL 3GRGA 4E42B 1A7QH 4P3DB 4XI5C 4XXDA 3SPVB 1CBVH 2P8MA 4GNKB 2W07B 4P5TA 3CDGA 5HI3C 4D2NA 4X4MA 4I9XA 4KKLC 4WI7A 1YYMH 4IEFB 1JGUL 1KGWA 3AG3B 1G43A 5D1QA 4A6YL 3L4YA 3QFGA 5LLIC 2APSA 3OWRA 5DR5L 3UTPE 3ZGHA 2DM2A 3EOTH 4Z7QE 3MA9H 1ASPA 1LP9A 2X7LA 2BXZA 1X5GA 1LK2B 3NIDF 5DFVD 2VLKB 3NACH 2XTJC 1PG7W 4HWEL 1OOWA 4KV5F 3WL9A 4LGSB 4RAUA 2PP7A 3WIFB 5LWYL 1U9KA 4I0PB 5E6IA 2BVQA 1CE6B 2ARJA 2CHWA 2B0SL 3BUBA 4IOIB 2FT7A 1R3IH 3IFNL 2DQHH 3O45B 5GISH 4CW1A 2YAMA 3W57A 1AOHA 2JCCA 2BHZA 4D3CH 4HFUH 2BP0B 5GGUA 1U8JA 1JP5A 1AZRA 1HNGA 2CGRH 4BH8B 2FX8H 4EVNA 3SKMA 4D8PA 4JY6A 1YSOA 2YKLH 1TQWA 3CFJA 1GVIA 2GJZB 3OHXB 3LEVH 3U4BL 2XXFA 4MNQE 5HYJA 3T2NL 5F7FA 4C4BA 1T20B 2VDOB 2FD6L 2K7QA 3DX7A 4I3SL 4KHXH 4RIRB 1R75A 2EUZA 2FDBP 5HJGA 4U31A 4XMUA 4WW2A 1HOCA 2VDKH 2FTAA 4ECNA 2Y9RT 1DBML 3FRUA 2O6CA 4I5BA 1TVDA 1QW9A 2PCFA 3GRBA 2J21A 1B2WL 3BH8B 2ZOKB 2ATKB 4GRMA 4N8VG 4OIBA 3LPOA 4LLWA 5JYMA 2AEPL 3DSFL 4TVPL 4R5TA 3QCVL 3O45A 1BXAA 3JWOL 1E5ZA 1MI5B 3RWDA 3UACA 4PAZA 2DQCH 1FCCA 2X3CA 3WDHA 4OJAA 3WLBB 1DQJA 5DXWA 3MRDB 3IE9A 2ZYSA 1JV5A 4MA3A 4PIBA 2YC1A 3FU0A 5AW9B 1WBXB 3TLRA 2IXQB 5EZJB 2CK0L 3DVFA 3T0EC 1WUNT 1JGVL 5DJXB 4UQ3A 4HBQA 4Z7WF 1XF2B 2Z31C 3JWOC 1GC1L 1LMKA 3QUMB 3UYOD 1UM5H 4IU3B 4G72B 5GGTA 5EHFA 2NY3D 1KXQA 4MZRA 4U7SA 3TBWA 2YK1H 3GMRA 1JXGA 3BC9A 4NM8H 2F53A 2W1NA 2YA0A 3J8F7 3DWTA 2YMXH 2J8UF 3MHZA 3DVGB 3B3IA 1HCFX 3GXTA 3HVNA 4OJCA 4ODHH 1KJ2L 4Y1AE 5BUGA 5L8LB 3L3IB 4E5XG 3VXRA 4HJ0D 5D4JA 4D9RE 3BZ4A 2N59A 1TQUA 3MZGB 3VFPB 2D73A 4HS8H 4E41D 5IROC 1I9RL 3CHXA 1EHAA 2AQ2A 2YUVA 2NSQA 4NQDA 1Q0YL 2YLHA 1XF5B 4Z7IA 2AJXH 3N55A 5EO0B 4M56A 1G1CA 5D1XB 3VJ6A 4AJYV 3FF7A 2CDEA 4GXVL 2V17L 1DO6A 3MBXL 5F7YC 4K8RH 4K73A 2J2ZB 3DHPA 3VXUE 1IGFL 3U1QA 3V0AC 4A2LA 4JFDE 1CUOA 2YFOA 4M8VA 3SE3C 1WISA 4LSUH 1XH1A 3GMMA 5F7HA 4I48A 3D69B 4N0FA 4OF3A 4IYKA 2DI9A 1G5AA 5GGQH 4FFTA 2R2HA 3PL6A 5EIQA 4M1DH 4LSTL 3QEHA 4IGBC 5E9DD 1ZLSH 3FRPB 1I9IH 5J06A 1QHQA 4N0UA 4GKSA 4YGVB 3L45A 2DN7A 4YHIB 3MOAL 3FZUD 1IGTA 3L7EB 2NTSP 2ZYHA 4OV5B 3PNRB 4G7RB 4IRZA 1KIPB 4LLQB 1VGKB 4M03A 1MWAB 5FOJA 4B7LA 4JFEA 2XPGB 3RPIB 3SN6N 5HHQB 3PP4L 1UB5B 1WFTA 5BO0D 1SGKA 5ICYB 2WAQA 4OFIA 1K4CA 5IMKB 1CLOL 2EC9T 4EOWL 4P2RD 3D08A 1AQKH 5MI0B 3MRNB 3E3QE 4LEOB 2TSAA 2FGWH 3RBGA 4QHPA 4MA8H 3VG9C 3DX2A 3EF4A 5MEPA 2I5YH 3HC0B 1U30A 4G3YH 1J7VR 4C4KT 2VZ1A 4D0CA 4DEPC 3NJMA 3OJDA 1DVTA 3O2WL 3B9AA 4ZODA 4XNDA 3SDCC 2Z7YA 1IM3A 5MENB 1S2EA 3S4SA 3ULUH 5L9DL 1ZT7A 2V7HA 4RQQB 2Q20A 3UZQB 1R19A 2X0UA 1QABA 3POHA 3VM7A 3CN4A 3MV7A 3BP5A 2WANA 3V79C 3QFDB 2QR0A 3OMIB 4FFYL 1RV6X 3O6MH 3O0RL 3MA7A 5L0QB 1B0WA 1V7NH 2DQJH 4O2FA 4AEHH 4M7JH 2DS4A 4KXZH 1E42A 1PVHA 4YDKL 1J5HA 3GB7A 4XOCA 5I16B 1IAIH 2ZG3A 3RI5F 4B27A 3DVNB 4UUJA 1N5YL 2EVGA 3FT2B 4X9HA 5EU3B 1NIBA 4HXBL 3UPAA 3QULA 2NZ9C 3ARUA 4Y7MA 5I1HL 4Y4HA 2NQ3A 4ZOBA 4HIEB 3RQ3A 5I5MA 3TFKD 4N2FA 2ZYRA 1G9ML 3F65A 3U30C 4MFHA 3D25A 2BOCB 4AQAB 1GY1A 3ZKMC 2RTTA 4MB4A 4TQIA 1XAUA 5H8DA 5C70A 4TVSa 2ESVB 4DFHA 4EIGB 1IC5L 3E0GA 3QEUA 4G1EA 3RWFB 1UENA 35C8L 1Z9PA 4YE0A 2FK9A 3FPXA 4PY8J 1UM4H 4IRZL 5AG8A 4OM0L 3TWYA 1KB5A 4ZD3L 3RL1B 2X40A 4HOXA 3T0EA 2YPKA 3KPMA 3LQZA 3VG0L 1KJ3H 2QFPA 2HLFD 3CFBA 3TASA 4G9FD 2FNBA 3IE4A 2F74A 1AKJD 4LSRL 3BUDA 2VKXA 1QFUH 1MFAH 3KYOB 5GGVY 3RNKB 5TE4L 4Y9EA 3TBYB 2FWOB 2GFBA 4M5YH 3OKLB 3W9EA 1ZHKA 5FHBH 2J8OA 5DZVA 1OM9A 1MXDA 4CDGC 5GRZA 2OL3A 2IQAA 3IMUA 5E1IA 1EDQA 1MJ7L 3RDTD 12E8L 2X4TB 2Y25A 3GHBL 1HK6A 4XCFL 3BVDB 3H7BB 2VH5L 4XT1C 3TCLA 1HHIA 3CC5B 5F7EH 1DJWA 3VGHA 4PGBB 1INEH 5EZPA 1TDQA 2XX1A 3HR5A 1GKEA 1T4KA 4G7VL 4JB9L 2EDOA 1MFVA 1IT9H 1KENH 2RH0A 1QWUA 1VFAA 4WSJA 3WY2A 3UC0H 5TE7H 3GYRA 4Y8AA 4DW2H 2A74C 4IRJA 1G4RA 1R33A 1IKFL 5G5DB 3A67L 1NBZB 1NLDH 5GRVL 2MMXA 1E4KC 4JFFB 2R8SL 1DBJH 2A9MH 3U4KA 2Q1EA 4ZAKB 2HLFC 4F33B 5GJSL 3LQAC 3CFBB 2D7OA 5AG9A 3WJJA 4I77H 1FN4A 1CK0L 1QRKA 3U2SA 5J1SC 4ZXBD 2E5EA 3W11C 2EAEA 3AQYA 2ZCKH 1EDHA 3FONA 5EIIA 3WEXA 1HKLH 2VW4A 4R0LA 2EINB 2TAAA 2J3SA 1Z5LA 3GMMB 3P9MA 1KC5L 4OAWB 4LLYB 4PGDA 2FBRA 3IBOA 4GRLB 4WTZG 3HNSL 4Q4IA 1B4JH 4F20A 2DY2A 3NPZB 4NS0A 1VACA 3HLAA 3JTTB 1L0XA 3PJSB 5TDOB 2DMBA 3N40F 1OK8A 1NCCL 2JWYA 4WFED 2XQYG 3MRQB 4N20A 3OWEA 2IGLA 4X5PA 3CD4A 1TSHA 4FQ1L 3QDME 4PTUA 4CNIB 3Q5OA 3KW7A 1RIUL 4OZIF 2Y22A 2NTFB 3RY5A 3LHAA 2PP9A 5A2BA 5FO7B 3EOAA 3ASNB 1IARB 3V6OA 3UZVA 4RGOL 3SJVD 2Y7QA 5LBSA 1WHPA 3BZFB 3QC5X 2YEZA 3I02A 3MR9A 1PKQB 4HKXB 4ANWA 3QQ9D 5FR3A 1G6VK 3BDYH 4P4RA 5IFAH 1MQKL 4GQ9L 1FFOB 3UBXA 1YY8A 2CLVB 2P8LA 2KDGA 1JK8A 2HRPL 4R7NB 3ULUC 4L5FE 4NQDE 1XR9A 2W81C 1FAIL 5HY9A 3MCKA 2LHAA 3LJ3A 1SLUA 3MI6A 4NQQA 2LU5A 4HT1H 3AFLA 1F45A 1XQ4A 2DQFA 3HFML 3LKOB 3QRFM 2PCXA 2J8UA 3NFSH 1FL3B 4L4TE 2BNRE 4HZLB 4IBQA 5E9AA 2H8PB 1UTDA 5ETUA 1UZGA 2W9EL 3HA0A 4ODUB 3FOMA 5L8KB 1IBZA 2XVLA 1KXQE 4IDJH 4PJ5A 4M62L 1T83A 2QADC 4Y2NA 5HYSB 1VF5C 2G75B 2JJTA 1H6TA 4TRPH 1AZZC 3FCSA 3UZEA 3K4ZA 1AZVA 1OP3H 1VHPA 3I3DA 5CN2A 4YSUA 5CUSH 2N0KA 3MR9B 1YJDH 4P07A 4R7LA 3ULAB 3ESNA 3K1DA 4HJUA 1DVFC 4PRPB 4JO8A 1NFIA 2D2CC 4WJKB 4XP9H 3ZE2B 2XNAA 1KLGA 2ZUYA 1DVSA 2ICWI 2X9XA 1E2VA 4I0KA 4JFUA 1MFBH 2G5RA 2VWEC 2MIZA 4MKMA 5FW7A 3GUTA 1KPRA 2JQMA 4BH7B 3KNBB 3KDPB 1T0NB 3F62A 5CGTA 4RMQA 3MV9E 3V6ZA 3FSVA 1QRNA 2B1OA 2V9RA 4NOBA 5CNHA 3HC3L 2CRMA 3CFUA 3NA4A 1U91A 2H6UA 3EJCA 2ZE0A 4LRIC 2J8UB 2VXSL 1G7HB 4NJAL 5AD0B 3LDBC 4ZMAT 4GY4A 4IHOA 5B1KA 2QHRH 3CC1A 4ZQKB 2HKHL 5C07E 1YEJH 2VLRD 3CZUB 3ECBB 3FT9A 2CO4A 3ZRCC 3ARGB 4G6AC 3VNYA 2XZQH 2MNUA 1JOIA 5JXEA 2ZTBA 1FPTH 4DNLA 3Q0HA 3T2OA 3VTTA 3L08A 3UGUA 4MXVE 4Q8BA 4A6YB 3S7GA 2P52A 5DJ8A 4B3VA 4MZ3A 2F7PA 5L2KD 3ZE1E 1UOLA 2VDMH 1SOXA 3MBED 1A14L 4MJ5A 4NPYA 5E8PA 1Y0LB 2DQTH 4PP1C 4G6ML 2I69A 4RFOH 5H94A 5ADOH 4Y5VC 5KJRL 2C7FA 2LLNA 5LBGA 4QGYA 1F4YH 5CBEA 3ZY7A 2ZT9C 4C56D 3L1FA 2ADGA 1MRDL 1IEAB 1JWSB 1MLCA 3GTVA 5DJDB 1NEPA 4R90H 1LP9E 1BBDL 4L0PB 3IMBA 3ARDA 3GSNL 3D39A 4GB9A 5IWLC 1CDHA 5DQ9A 2WWOA 3QAZB 2QKIC 3BGFC 5FS5A 4QLWA 5JDSB 5JIPA 5IESL 4QOKE 3VA2C 2OL3B 1U8PB 2FECL 2H1LM 1T21B 3AWEA 4GMSL 4KVPA 5CJOH 3FL7A 4XN9A 3LD8C 4WY7L 1AZCA 3LZNA 1WTLA 3DX8A 5EOTB 2VDOL 3ULVE 3QIUB 2D31A 4LBEA 3UG5A 4BZ2A 5CF3A 4Z3IA 4P2OC 3CPLB 1AE6L 3WIAA 4GW5B 4GEIA 3KGTA 4O9HL 5FKPB 2Z65C 2JKLA 4AKOA 2KLRA 4S2SA 3VFGH 1VAHA 2YRPA 3CUPB 4ENEC 3VXMB 5DRXA 4EN2A 2A1WL 2ZAGA 4Z18A 1WT5C 2X4QA 1TFPA 3RVUD 1TTFA 1QBBA 2WBJC 2VZUA 3IDGA 3WHE1 3BSZL 3NCJH 1N0LB 5A2FA 2OX5A 3VFMA 2Q8BH 3VD5A 2BVOA 4BE5A 3SKNB 1BQHB 1HAUA 3KS0J 2FO1A 5J5EA 5T1KB 4XPBL 3OBAA 4UBDC 2AXFB 3I50L 3D39B 4YR6A 1E40A 1BFOA 3DHUA 3O6FC 2K8MA 2R1YA 4IRSD 5E8EA 1N4XL 4UINH 5DUPL 2V2WB 4UQDA 4BSWB 1EANA 3L5XH 2Q76A 1TNNA 4V1DB 4XPGL 4PWIA 3DBXA 2BVTA 3A21A 5I16A 1F6AA 4MNHB 2CBQA 4PVMA 4P2OD 1BZEA 3P30H 3IMRA 4HCGA 1U8IB 2H2PC 3GO1H 1F41A 3AS2A 3PFQA 4TULH 2CLVA 5D70H 2ZXBA 1MFCL 1R5IB 3MXVH 2G2NA 5HDLA 1I8IB 2WLZA 2Y2TA 5FYLE 4JS7A 2DJUA 3MA7B 2AK1L 3E9UA 5D7JB 1HIMH 3CK0L 2IIJA 3EYFA 4PRIE 2VT0A 4OFQA 3MN8A 4NBYB 3LRHA 3E6FB 3M17A 5TDNA 5A43C 5TPWH 3D33A 3MJ9L 3A4AA 4RWHA 1CC3A 3EG9B 5CN1A 3QIBD 1JTTA 1IM3D 3MLXH 1W72H 4H13C 3OAYH 3KPTA 3BKYL 2IDSA 2DZEA 3MC0A 2V2WA 4OZFG 1U58A 4QJ5B 1XMEB 3IS0X 2WWKT 4JRYB 2L7QA 1R0AH 1RUQH 1O7SA 3VWJA 3RZCA 3FQRA 1AG0A 3ILPA 3X17A 2A99A 3JV6A 4KZ0A 3RHWF 3L4TA 5E2VL 3ZTJG 4KNUA 3IKCB 2NY0D 2OI9B 3UBXI 2XG4B 5DLLA 5C0FA 5K9OB 1MNUH 1NAKH 1EHKB 2WNWA 3DIFA 1KIUB 1T2JA 1UCBL 5ALCL 1AKJA 2J4WL 3C8DA 1J8HD 1ZK9A 3SOTA 5LCVH 3DUSB 1RUPH 1A9BB 5F9JA 2J1ZA 1KIRA 3FH7A 4FHBD 4UNTA 4A7VA 5I1KH 5TGBA 3OLGA 5KYXB 2WKGA 3M88A 3U0TA 1RH8A 2CIKA 4FQLH 1BOYA 2I7OA 4X99B 4FX5A 2I9TA 4U6TA 4AMWA 3KPNA 4LPXA 2XT1B 4UDTB 5JPNB 2YBGA 2HA1A 3GBMH 5J6HB 4DGIL 1B0GB 3QCUL 3RHWK 3NJXA 4MD5B 4YLQT 4OLWL 3N1GC 1S3RA 3GBEA 2DQDL 4MCMA 2XN9D 2V5MA 4RAVA 1CDUA 3DXAA 4W9DC 3BKJH 3MTXA 4DAGL 3LRGA 5IB4B 2WBKA 1HNFA 3JV6B 1T4KB 2QGBA 2N7AA 2V8LA 4I7ZC 3AUVA 5EBLA 3D48R 4C58B 5DD1H 2C1PA 4ZQKA 1H3VA 4ZYKA 5B3SB 3LIZH 2C9AA 3FSZA 5FUZL 1CGSL 3RGVC 1JZEA 5HPMA 2AW2A 3VI3E 4R6UA 2RQEA 1WA2X 3JTBA 3NPSC 3QEQA 1MW0A 5I2IB 4EEEA 3ZDYB 4IMLA 4YFLI 2XV6B 4ZUUA 1Y6NR 3UXFA 1M53A 3ZO9A 4ILDA 4W1TA 1T66D 3QJHA 1RZ7H 3EBGA 2W5PA 4MA7L 1JYWA 1XCTB 15C8H 1S9XB 1FRGH 2R69H 3O8XA 4BHUA 1KWGA 3SJVA 4GO8A 4JKKA 5TQ2H 3PWPE 2WXFA 3FSWA 1XL6A 1CTMA 3LKSA 5DK0A 5E9DB 4HZAA 4Y5YC 1NICA 3Q2LA 3PWPA 1AHMA 3TX4A 3EHBD 3WHXB 2PTUA 1I1AC 3U0WL 3VDAA 3VQLA 4AYSA 4EMZA 5SWQA 2AQNA 4P2QD 5D1ZA 1FGVL 4EI5A 4TSBH 2HG0A 3ECVA 4K3JH 4ONOA 1N5AA 5DYOA 2KZBA 5F9WC 3FUIA 3K6FA 1P1ZA 1XSKA 2VN3A 2DJSA 3AAZA 5L88H 5E23A 1Q9OB 1NGXA 1CIUA 4UV7H 3D7PA 4EBQL 5HHNA 1YQVL 2ICWA 1T6WA 4N2DA 3O8XD 1N12A 3BWUF 3MNWA 2Y1ZA 3OPZH 2DYPB 4KQ3H 4OZ4B 4RMTA 3V0HA 4M93C 1NCTA 1R34A 2JKSA 3TEUA 1XZ0A 3UPRA 1IGYA 3P3TA 4NUGL 4H7VA 5ES4B 3ZTCC 3MV8D 1Q0XH 5DMIL 3HS0B 2XKSA 1YEEH 2CHZA 2WB1A 2W07A 1VKXA 4BEIA 1OGAA 1KCSL 4DVBA 2YBRA 1JGDA 4V1DA 1H0DA 4AQAA 1CXKA 3DBXB 3FH5A 3GMQA 4B96A 5IF0B 1P5VB 4YDMA 5C08B 1NKOA 1ECZA 1GCYA 3WKYA 2EXSA 3WDIA 1BZ9A 4FGMA 1JPGA 3HI5H 3HNTL 4ONHB 3GUTB 4PY8I 1GA2A 3V5DB 4KQ4H 2QSQA 1LWJA 3WIFA 2DWYA 3LQZB 3L81A 4JG1L 5KSBB 1U92B 4JRFA 4XPFH 3KYMA 4HVBA 1U21A 1EDYA 3B9KA 1U3YA 3FN9A 3PV6A 5F9OH 3NUKA 2EIEA 2E9IA 4NNPH 5B4MD 1EH9A 4ZZKA 1CGUA 2DIJA 1WBZB 3BKCL 1HI6A 3G08B 43C9A 4FF9A 3KJ6H 2WBWB 4PJ7B 1FL5A 1LEIB 5IK3A 4ATWA 4PRHD 4NQTA 1A1MB 1M9WA 2XWCA 4MQTB 4UNVA 2AKRA 5TF1L 1MKFA 1E5BA 5DHVH 5JW3H 5DJ8B 3S3JA 4Y1SA 5IF0A 5GSRB 4CUCA 2YGOA 3APDA 3K4DA 2ADIB 3DX0A 2E4TA 4ZT1A 5CSGA 2CK2A 2J71A 5D4HA 4WHTB 5I6MA 5L4JA 3MRPA 1AANA 3BUIA 4KKLD 3X3FL 4K23L 5EA0L 2K78A 4NQVA 2EEDA 1EZVX 3JYBA 1M05B 4KRLB 5CU9A 4AGPA 2XWBB 1GJIA 2AJYL 4TQPA 2R23B 4HJSA 1RU9H 4XVOA 1KF9B 3CQPA 1P5UC 1KYAA 5LGHL 1H3WM 2P24B 4GFTB 1E27A 3TA3C 1XF4B 5SWSD 1D5IH 1FNEB 3OAZK 1A7RH 2XQYK 3T1WA 1BVLB 4PJ9C 1Y0LA 3BZ5A 4AL8C 1ADQH 4PWKA 3C5ZD 4KK9D 4BKTC 2BSDA 4LSDA 5F89B 4NZUH 5JPNC 7PCYA 1HHHA 2YJQA 1ZA6B 4ELMF 3NCEB 4JHVA 4DKFL 2HTLC 3FB5A 1YMMD 2XA8L 1FIGH 1MDAA 3V6OC 4AK1A 4IU2A 2YN3A 4BZ1L 4M3HA 2QKIA 3BRFA 4P46B 4RWYH 5HHVH 2K4WA 3NSFA 4OR1A 1MCEA 1D5XA 1PAMA 2LLGA 4K9EH 3SO5A 3MJ8A 4QRFA 4P59H 4XR8C 8PAZA 1KYOJ 2WPGA 4PFEA 4OCYH 3O41B 4W9JC 2F53D 1CXHA 4HJJL 4MQ7B 3NJLA 4R8WL 3TJEL 5GRJL 3MKGA 4PJBF 5ITFB 3T4YA 3ARQA 3SE4C 5EEWA 1P2CB 3BSHA 4ZQTA 4JANB 1KYUA 1E5AA 3EZ8A 3N9GH 2AXHA 3GM8A 4OGXH 3QO0B 2ITDB 2NW3B 3HI1A 3P9LA 3TZVA 3X13A 3X1GA 1TQCB 2C4XA 1QBAA 4L1HA 5FKPA 3WAJA 2UY7A 2ZWYA 4M48H 5GGRA 1A7QL 1BAGA 3HN3A 1NCWL 5I6LA 4HUNB 5T8IA 1JDDA 2F5BL 1KPUB 2B9BA 3KS0H 3LKPB 1AFVL 3I9AA 1A6TB 1KPVA 3EYSL 5HGAB 1R5VB 4GO6B 1E65A 4U1IB 2PYFB 4X5XB 3Q8CA 5E2JA 3RX7A 4X6CE 4KJWC 3DOHA 4B0MB 3DO7A 5FOBA 3V7AE 2R69A 1LD9A 4I1PA 2H6PA 4CVZA 4KHTL 3OJ2C 1UOVA 4WO4B 2PO6D 4WFEE 2Q10A 2F54E 1JYXA 2ZICA 4FFVC 2F53E 2DQHL 4D7PA 4OZFH 5JPMC 1V3LA 1AVAA 1OSPL 3SDDD 1E50A 2F7IA 5B22A 4ANXA 4F37F 5GS2H 4XODA 1DQVA 1PYWB 2P45B 3MBEB 4J8RA 3SQBA 1W8NA 3V4LA 1OL0A 4QMEA 1KPUA 3K80A 1P0SE 3NH7L 1YMME 4GSDL 2COQA 4FMKA 2EDTA 3HNVH 4LLMB 3WE6A 1Q4NX 3EYQC 3RFZB 4NUQA 5DLMH 5T1MA 1CFTB 3PABA 5E03A 5C3TA 3ZR6A 5ANME 2GBUA 4DP7X 1UVQA 2P80A 5JIQA 2UZIH 1KCLA 4XBEL 2ZCHL 3ECBA 4PD4J 2BP0A 4LHQB 3IAGC 2WWNA 1LNUB 1B2WH 5DEFA 2ENJA 4I0CC 2OL3L 5DMGD 4TQHA 2G60H 3O3UN 4PRNB 4XCEA 4HLZH 5C0ND 3WEMA 5J3HC 3FQXA 1IC4H 1PY0A 2X6CA 5F7LB 2OYPA 2I26N 1CF8L 3NCBB 3GB7B 3L3JA 4MAUH 1J5IA 2NZIA 1IGCL 4Z7OB 2R0WH 4H8WH 4ICWA 4CVXA 1G1KA 2GVYA 4NGHH 5B1JC 2FVNA 3U79A 3EFDH 4P5KB 4EAEA 5I8CB 3F85A 5DRNB 4OD3L 4JVPA 3TURA 1IEAA 2KPWA 4WENB 4PLKD 2E7MA 4JQIL 2K45A 5C0BA 2NR6D 2VTFA 2AKRB 3WUZA 3QDJB 4FQ2H 2Y7MA 4ELME 1SOKA 2RR3A 5I9QC 2JE8A 4NENA 4XC3H 4LCIL 5HHOE 5L0QC 4PGJA 4MD0B 3T5WA 5CEYA 1WAAF 1M6OB 4JFYA 3S34H 3DVGA 5FYLD 2TSBA 4AGLA 5AEAA 4NO0D 1B6UA 1YNLH 2VJ8A 3DETC 5EO1A 2BP3A 4E9SA 5HYQA 4LQFL 1QLEB 4L4JA 5IUSA 4AIZB 3QR2A 1MELA 4FZEH 2VUKA 3JV0A 5B1JA 4HW6A 1IO4C 5JW4Q 3DOSB 3BSGA 2O26U 3KYKL 5DS2A 5IB4A 4HXAL 3WG7B 5KANI 1QD0A 3FB8A 3QARA 4AVIA 3G5XB 2EDWA 3GIZH 3PL6C 2CDEB 5C0DB 4HIXL 4K8RL 3QJHB 4WWID 4XX5A 2WWMC 1CL7H 3OAZH 3ESPA 3VVWA 4KRPC 1XCTA 4XP6H 2P5EE 3D4CA 3CFEB 1G7LA 3GSRA 1NL0H 1WICA 1F2XK 3RI5K 1WFMA 3Q1SH 5E6ID 1N19A 3RWEB 4XB7A 2VZVA 4J3OF 2IAMB 2BWQA 4M61B 5AOIA 1VEMA 2NR6C 3SEPA 1L3NA 3QDJA 1NGYA 5D7IF 5DC4B 4ZUUB 1E9PB 5ILTH 3QG6A 2XTLA 4X5QA 3RDTA 3KLKA 4PRAA 1GIGL 3P3YA 2ODHA 4JN1H 1D3CA 2A4EA 1WRFA 5JW5A 2GIMA 1UD5A 2F7QA 1I9JL 3MMEA 5D1ZC 4K71B 4C55A 1LO3L 2BVPA 3G04A 4QHMB 3DHJA 5DHXB 5LAXA 2DV6A 2UX6A 2YO3A 2GEEA 2YWYA 2H0PA 2IDTA 4RNRA 2BO0A 1FGNL 1ZGLM 1QR1A 4UB0H 4ZMXA 4NRZA 3II1A 5A2KH 5FYJH 4QTHB 2FGWL 1DJIA 4KMTL 5AAPA 3OX8A 2OXHA 3TYFB 3O3DA 1B88A 3PDOA 3D3VE 2W0FB 3LMJL 4HEPA 4TUUA 3CDZA 5IB2B 3TA3B 2O72A 9CGTA 1SVCP 5D7JA 2DTMH 3IB4A 2X6AA 2VLRA 1EJ8A 4QF1B 3EYFB 4NZFA 3ULUL 2Y06H 1AD0A 2J5LC 3MNWB 3AMKA 3GTTA 1G84A 5IJCC 2PYEA 3CVDA 1H19A 1XMWA 1U36A 3FDWA 1QPPA 2BNQB 1VESA 5FM4A 4AL8L 4AXWA 4Y5XA 5DS1A 2FBOJ 1CZ8H 2Q0ZX 3DVIA 4L18A 1NCGA 2HWZL 4GIOA 4P2CG 5I15H 4EI5D 4GXUN 1JN6B 3KPRE 3V5DA 3T3ME 1AACA 3EOAB 5JIHA 2VZSA 4IIQC 4PM1A 5EORH 3VFOA 4MA1B 4NFDA 3SYCA 1N2RA 5I6OA 4K9EC 1QR1B 2J25A 2ZXQA 4Y4FB 3SPIA 2W0PA 3F2LA 1KNOB 4ACTA 1A2YA 4XXWA 3FQYA 1PCSA 1T1XA 1ED3A 4AWJC 2DL2A 3B9KC 4JFDD 2WWKO 2AXJA 3GS0A 4EPSA 4XGZA 4WU5B 4TMPA 2BVYA 1JWMB 4NQCA 3TEWA 5HY9B 5C07D 2FX9H 4HV8B 3FFDA 3GD1C 4JFOA 1XTLA 1CDCA 5BRZE 4WWKB 5F88B 1XH0A 1WWAX 4OB5H 5CP7A 2GT9B 1SRDA 5GXBB 3MX0B 1CLYL 4PJ5E 3LN9A 5IHUH 2JB5H 4OZGE 4E36A 4ONFL 1HINH 4UDTA 4X7SL 5CJBA 1IM9B 5CMAA 4DKEL 4U1LB 4UILL 3QXDB 1B0IA 1QLFB 3MFGB 4J6RL 1CT8A 3QZPA 1IBDA 4HSQA 5SWSA 3RUGB 3T6VA 2J6EL 1DDTA 3DROB 5AVVB 2ZOTA 1J8HE 2YAOA 2Z7UA 2P24A 2VDRL 2VQ1A 2ZWSA 1GGTA 3WS6C 1MDTA 2IPTH 2OSLA 4YHMH 2ATPA 4LT7A 4NQSB 3SDXF 4PU2A 3B4NA 2V2TA 2VYRE 1MCRA 5H4YA 1P7KB 3WJMB 1A66A 1RPUA 1K4DA 4QHUA 1AGBB 2DEXX 5E94A 1U8CA 4CMHB 1NMAH 2VH5H 3CG8A 3ZTNH 1EMTL 1FO0A 1R3KB 4NQDB 1KYFA 1XDTT 3ZMEA 4H0HB 4AIXA 4MD0A 1SY6H 3K2UH 4JPWH 4Z0XA 3VJ6B 5CEYB 5I8KL 4GEJA 3ZE0B 4B60A 1WFUA 4W68A 3ABGA 2W95A 4GQQA 2H26A 2W9DL 3AXLB 4U1KB 1KG0B 1LO5B 4CKVX 4UM9A 3LX9A 4PRID 3MRGB 1A9EA 4YXLL 4MSWB 3SKUD 4NWUL 1Z66A 1HX0A 3LEXB 5ECGA 2EJ1A 1ZS2A 5F1NA 3DV6B 4R7VA 4LNRB 1MCOL 4S0SD 1CE1L 3U2IA 4UTBL 3FB7B 3MV7D 1AD9B 4Z0BL 1OT1A 3K72A 3REWB 5BMFH 1G0DA 4JDVB 5FO2A 3RWCA 4YHZL 1HDMA 2DEYX 2Y5QA 1AHWC 1T0OA 5LGYA 1LK3L 2A2QT 4UANA 1E9QA 5EO1B 5DT1L 4YHNB 3H2QA 3IFOB 3UTZB 1C12A 1E90A 1WO2A 4M5TA 3ZQ9A 2C7UB 2MNJB 5L2KA 5KTEL 3AREC 5CBAB 4GG6E 5LAPA 1MFDH 2XPGA 1YNTF 1ZY9A 1DFXA 4O51B 4W9EC 1VADB 3MROB 4RVBA 3OXSA 3WENA 3ULUF 1LEGB 2PF6A 3IDYB 1H3UA 4IGBD 2HRGA 4N2LA 5H4ZA 1D5MB 2DWSA 3O2DH 4ZOEA 3W37A 5F97E 1R4XA 2HJKA 4XP4H 5F1IB 2JJVA 4HD9A 4HWEH 1UXSB 4X5RA 5ALBL 5JOEA 3CVBA 3S5YA 3IPEA 2P7TA 5HVHB 3LKPA 1I7TA 1DJXA 3QDGE 5DC9B 3EUUA 5J9PB 4PLNC 5KG9A 2HVBA 1XEUA 1MXGA 2CSPA 3GK8L 3FS9A 1KULA 4DZBB 1YUHA 1C9SA 4XRCB 3OR7A 5D6CA 5F9WB 4NIKB 2XACC 3NIGB 1OTUC 3HMWL 4KMQA 1MQKH 1YEIH 2M26A 3D5OF 5CAYB 3WUWG 3GMPA 4TTDD 2YPLA 3PWNA 4HFUL 4KNTA 4PJCF 5J0BA 3CLWA 1AJ7L 4YAQB 4ZTPH 1DQKA 1FCGA 3NFPA 5KVFE 5IROD 5AVRB 2E59A 3ZKXB 2WC7A 4E0RB 2DYPD 9PCYA 1T80A 2X89D 3P77A 3VCLA 2Z93A 3CN3A 5AOMA 3TV3H 2DQEH 1I3GH 3MTRA 5FGBC 1TJGL 4YIQB 2JI2A 4L8SC 4TLSA 5M95B 2J72A 3UIYA 1BZQK 2R0ZL 4YSCA 2BNQA 3MDJA 5AB9A 5I8OL 4FTVA 3UTTA 4MMZB 3BUYB 1S7SA 4F5CA 1B3JA 1XF3B 5DHDA 2BS9A 3MBEA 4W9IC 4RGMB 2EDLA 2NT1A 4NX0A 5I5RA 2VLKE 5AW2B 3DSFH 1OB1A 1NGZA 3SKJL 5D7LE 1PLAA 4HIHA 2VLRB 3IDJB 1Z9NA 2IADA 4Y9GA 2VISB 1EK3A 1SPDA 3DIVA 4X4KA 3H0TB 4ZDHA 3FN0L 3FCTA 4HZLA 1A8ZA 2R39A 3AQZA 1ZTMA 3I6GA 2AEOA 3RVXC 5BQDA 5I73C 5JA8B 4DJMA 2MNWA 3E2HC 1KBPA 2RHEA 4O4YL 3SBRA 2I25N 1NWPA 3VXME 4FA7B 1UM5L 5JW3L 3UX9B 2WK2A 2LE9A 5KBMA 4UT6A 3T0ED 1JZ6A 1WBYB 2QHRL 1OAXL 3G6AA 3KEHA 5T5FL 2F15A 3FZUC 3QHZL 5DCCA 4OSUL 2WGNB 1JK9A 3VW3H 4JM2F 3LKNA 3EYOB 3SYAA 3OSVA 4BKLA 5HYQB 2LW3A 1ORSB 4JFZH 4PJAE 3DSNB 5F8RC 2V9QA 4UOQA 1GHFH 3N42B 3BIBX 3GGWA 2UZYA 1ET8A 4H88L 2JJTC 2AGJL 1QSEE 1GAFL 4OJFH 1YEFH 1XHHA 4XNZB 5JO5B 4RRPG 1AZNA 4GUPA 3C60A 4IIQB 3MBWA 2MHAB 2VDNH 1Z0NA 4LFHG 5IBUB 4P5MA 4IRJB 4R96B 4IS6B 1EFXD 2WLMA 1MRDH 4FEMA 4OLYL 4MJ6A 4Y16B 1Q1JL 3PXLA 3UJIH 1U8CB 1NGPL 3T2PA 1AQ8A 1M1XA 4U1HA 3SZ6A 3I6KA 5B38A 5IVZA 1CD1B 4GG8A 1R3KA 1MCPL 3LXCA 2VDPH 3IPBA 1F6LL 1ZLSL 3UTSD 2XWTB 3US0A 4MMXC 5D1QE 3DGGB 3LKRB 4F8QA 4K3HA 3WLBA 4XMLL 2DIAA 2R1WA 3UJTL 3AXIA 4L1SA 4P57B 4IBTA 1WD8A 2QZ5A 3F58H 3GKWL 1T89C 2QQKH 2OMVA 1P84K 3IMSA 5I28A 2Y1VA 3ZKSD 3BCFA 3P9WB 1UH4A 1OT2A 3H4HA 1FV1B 4ZX4A 2KH2B 3U2JA 1E3FA 4R4BA 1MN4A 2WXHA 1J0KA 2QVMA 3LIZA 2CJUH 4JFDA 4HHWA 4K3DL 5FGCB 3RNQA 3TIDB 4ETYA 3KL0A 3UH8A 5DFVC 2O5YH 5DJAA 1N7ML 1MIEL 1W80A 1QVOB 3L13A 2DYSB 1FNSL 3MRCA 5KVDH 1OE2A 3FBKA 4N26A 2J1YA 5JXAL 3WXVL 1BCIA 3S3BB 4NO3B 3TH3T 3FTGA 3P1VA 3CWGA 3AREB 2UYLB 3HCVB 4G8EB 3OXSB 1NOLA 3UJJL 3BRGC 3G6JB 4RGND 4RMRA 1TCRB 3QUXD 4ESKA 4X4YA 5FO9B 2R1WB 2Q6WB 5I17A 4P9HC 4R7NA 1OP3K 3IFOA 3MODL 4BZYA 5A3ID 3GSVB 4KTEL 5D9SA 5F7UA 1RZJH 5LVEA 2XUWA 4GUOA 3ZMNA 3RFZA 4HZ1A 4AT6B 4YDKH 3W38A 2IH3A 3P30L 3D4GA 4PJHE 1CVRA 4R4BB 4WFHE 4XN1A 3SDXA 4DVRH 5D70L 1ZLUK 5JHLH 4GI9A 2X7LB 4N2GA 5GHWH 5LJYH 1VEOA 4OFYD 4Q0XL 4D9RD 2GK0B 2R7EA 3KLDA 2E47A 1QLEL 2E7HA 5KW9H 1KIPA 5CLZA 5D1ZD 2ZJSL 4M1GH 3KG5A 4L3CB 3X1NA 1JPTL 3BIAX 3VI3B 4HGWB 2ADJA 3T0WA 1WSST 4EDWH 2C3GA 3QJFB 2JQZA 1L9OA 4OGAC 3QORB 3BQVA 4KK8D 4OZIE 2JELL 1AO7E 2C3XA 3CLFH 3G6JA 5HDBB 1ZTXH 1C16A 2D03L 4NLAA 2YPLB 3PWNB 3BPCB 4G8AC 5GRUL 4OCLC 1ZJBA 4LDCA 3TT1L 3CFCL 2IF7A 2Z4QB 4ZD3H 2W91A 1R0AL 4PUBL 1X5ZA 4MNQA 3DECA 1YY9D 2EDXA 3SDAD 4S1QH 3INUH 1SVBA 4LP5A 4N90D 1X5XA 1SJXA 3GI9L 3ARXA 4E9VA 5HXMA 2FECI 4K5LA 2APWA 1S9YB 4NKQB 1MHEB 1I1YB 3AT9A 1SXZA 2QADB 4FP8H 5FYJU 1PL3A 2ILLA 3NN8B 1NA8A 1THCA 5D1QD 3G6DH 5IT2L 1L9RA 4QT5B 2Y23A 4I13B 5FK9A 1UCBH 3LNGA 2MJWA 4MJIB 2WUCH 5DRZA 4X4XA 4G83A 4Y88A 5LCVA 3FNKA 4XCYB 4N9GB 4AENA 1YQ2A 4FYSA 5TE6H 4AM0B 1INEL 4B9KC 2Z8WC 3FUNA 3VXUD 2H7WA 1XGPB 4BZ2L 3G6AB 2DQUH 3I2CL 5TD4A 4PJ8C 1QFHA 4H8VA 3EBHA 1DQDH 5I6XB 5E00A 1FZMA 5I9QB 4HKBA 1OAZL 5SX5H 1PFOA 2OYMA 3GSRB 3TTSA 5K9OA 2V2TB 3W82A 2BK8A 4FEIA 3QUYB 1V3MA 4FNRA 3FTZA 3LVTA 3MRKB 1ACXA 5IVXE 1XR8A 4M7LH 5C8JB 4A2EA 4RAVB 4LNRA 2H41A 5DJDA 1WGVA 4QRTA 4YDJA 5F1KC 4UQBA 1FL6B 1I85A 4N2EA 1SXNA 5CSBA 2AXGB 3PUUA 4FXKB 4X99A 3L3HB 3BUPA 4H20L 1JRHH 4OVUA 4K7PY 1EZSA 4A66A 1IZJA 5DI8B 3X1FA 3WY3A 5C08E 4YL9A 4FQCL 1NC2D 2H0EA 3BPNC 3U6XS 3KVQA 2VKWA 2YD1A 1Z0MA 4P3CL 5AVXB 1XCXA 2BDNH 2XWBA 4QOKA 4QRPA 1KTJA 5HD8C 3GSQA 5I1IH 1A7NL 4MS6A 5HHXL 1CS6A 1YYML 1X4ZA 1PZ3A 4R7DB 4XN5A 1PG7H 5KWYC 1NC4A 4WNSA 3QPQD 3OD3A 3CIAA 1GZQA 3G3LA 4BD4A 5I73B 4MA7H 4UQCA 4YDLB 4E9WA 1GSMA 4JFSA 5IMLB 2VDMB 2YQGA 1SYVB 4Y4KD 3CN0A 2XYBA 4ODXA 5FEBA 1PPIA 1HYRC 3TBTA 4P23D 2HFFB 3APCA 1J0ZA 4HKZB 4QNPE 4ZJ9A 1OW0A 2HFGH 3AW5A 1UA6H 2PETA 5DD3L 5HYFA 1QFWH 4JGNA 4JKMA 3ARSA 4W70A 2XZAH 2IV8A 3BCDA 4LVHC 4NBXB 3CVIL 3EFOA 1A7OL 4IBZA 5AZEL 5D1ZB 1KV7A 2YSTA 1WK0A 2AXFA 1S9WA 1DE4A 3ES6B 3NOIA 4U6VH 4YEFA 5C9JA 3OM3B 3QWRA 4U1GB 5EU6B 3QO1B 1KFGA 3NFNB 4R7XA 1UH3A 3QI9C 1RMFH 1FYTB 3V6BR 4WUUB 2DBLL 1UUSA 2OMBA 2J12B 4WJG3 1AXTL 1PD0A 2ICWB 3RPIA 2YPLD 4PLKC 2WYHA 3CH1A 4FTVD 4LCYA 3S0PA 3EGSA 1ZT1A 5J4MA 5J7CC 3T2NH 4XMWA 4HPOH 1JHLH 3NCYS 4Z8FH 3P54A 1F6AB 4I3SH 4MNHA 1J9SA 4YX2H 3EFFB 3SD2A 2WINB 3L1GA 1NBQA 3LXUX 4I2XB 5KSAD 3JV5A 3RVVD 1T1XB 1M57B 3RUGF 2NR6A 2OMUB 3BHBB 1OP9A 1EEQA 3N0AA 4MKTA 4HH8A 2ZKWA 2B7DT 3K1KC 2Q6WA 1BG9A 5MEPB 1NMCC 5D7KE 3QDMB 2F6AA 1KBWA 3CBRA 4QNPF 4FFVD 4DESA 1E4XL 1S8DA 4HCRL 2XZCH 5ENWB 1KCRH 1O7DC 3BLKA 4PRPD 5I71B 2Q5BA 1A4CA 1HXYB 4U6YB 4PSPA 1DVYA 3RG1C 1KZQA 1CMOA 1KDJA 2X4NA 4XBMA 4Y7OC 5E8DL 2NXYD 3RGVB 4X9IA 1JD7A 3TEZA 3ROLB 43CAB 1G7PA 3T71A 5HI4D 3MLSH 3UDWC 3K3QA 4OF7A 3U0PB 1T1YA 2Y24A 2VXVL 3OKNB 3TH4T 4HPHA 3B2DC 4X83A 2XZZA 2EH7L 3K5RA 3MVSA 1MHHA 2ZF8A 4PCSA 2YUZA 3E1F1 2AHIA 5F1SA 3CFJB 4APQB 3SIKA 4G7SB 3IDXH 3LEYH 4LGRB 3UMNA 4FXLA 5T1DH 2WXRA 3UO1H 1CD8A 2AK4D 1ITBB 2EYRB 2VN6A 4NRYA 3WIHL 1JXDA 1QATA 3IU3A 3B56A 4ODHL 5SX5K 4BKLB 4XX1G 4MBOA 1UEYA 3BVWA 4O58H 3Q2NA 4P5TD 4I4WB 4C83B 3WFEL 1VFBB 4XAWH 2XRAH 4K55A 1K85A 1RJLB 3Q7JA 5GZND 1TU2B 4U0QB 2WVTA 5DUMH 2V8MA 2X6VA 3WJLA 4FTDA 5K9QG 3GTNA 3Q6FB 1MOEA 5I1LB 3CZFB 5GSRA 4A2GA 5C2BL 1OEZW 2CR6A 5I0WA 4GUPB 2RFXA 3B2UD 4IIQA 2PXYA 1RURH 4M6ML 4IS6A 4XAKE 3X3FH 4MVBD 2EVHA 3OQRA 1FUNA 3FT0A 5C09D 3TO2B 3V0WH 3C60C 3KR3L 2EUXA 4JG0L 1JGUH 4Z6AT 4YPGA 5I1DB 2IDCA 3V55A 5BVJB 2YUXA 2DQGL 3WD5L 3W5MA 1HZHL 3F01A 2J43A 1T7ZA 4CN6A 4AEIH 2XN9E 4KU1A 4ZPTA 5HGDB 2F53B 5JQ6L 4UZGA 4HWBA 2P8PA 3MOAH 1P4LA 5FK9B 4P5KA 3GMOA 2WQ8A 2J44A 3CVHH 1IJ9A 1EEYB 1D7BA 2MQ0A 4BK8A 5DRNA 4J3SA 2CAKA 3RL1A 3ELQA 3GS7A 4CRPA 2XA8H 1DQLH 4LOFA 1QMUA 2D7PA 3I9GL 3VGDA 1NLBL 4YHPB 1BBJB 1GZHC 1ZWIA 3CZEA 5AOJA 3RY6C 5AD0A 1FFNA 3QFJE 4LKXB 5ECJE 4Y19E 4ZX6A 2OK0L 4KK5C 3QQDA 4DGYL 1TEFA 2X4OA 4DKTA 4HEME 4WSKA 4LOVA 4KH9A 5AUMB 3PG2A 1J5OH 2FJUB 2E27H 4H8WC 3MRBB 4UQIM 4YS4A 4ZNEA 2YKLL 3R4DA 1N8ZA 1N18A 2KC0A 4NYLA 5HI3D 4YBLB 4JY5L 3T1FA 4ZXBA 3GSUB 2FD6H 2YD5A 2H9GB 3II3A 1DANT 1U6AH 1E2ZA 4ZFFB 4XVJL 4P23B 3M1CA 1BJ1J 4PJHF 1SFDA 1Y1UA 2W60A 3BP7B 4G9FA 4AEFA 3FO9A 1LP9B 1EUTA 4M48L 4ERSH 2FUTA 1YECL 2ZKHL 4KRPD 4M5ZL 3S35H 4FFYH 2UXVA 1YDPB 3WSQL 1OE1A 4N8CL 1VGEL 2VLMD 3O0RH 4YSRA 1RPQA 3VGAB 4QOKB 4QO1B 2WKOA 5HHNB 1L4IA 4M9PA 1TVHA 3B9VA 3KPRD 4MDJA 2CJSA 1TYRA 2AEQH 2X2UA 1TR7A 3QQ3B 1FYTD 4Y5XC 5EN2A 2JKWA 3RILA 4WIQA 3S96A 1MFUA 5D96C 3APFA 3GMNB 2OMTB 4KVNL 2WW8A 3US9A 3WS3B 4LVOC 2H6PB 4CVZB 5AYTA 4X4YB 5D7JD 2Q3AA 1IMHC 2A6KB 5ERWB 4YDZA 2UWEB 1T21A 3IWUA 4FQXA 1Z3GL 2YEQA 2BSEA 4H2AA 3ULUD 1BM3L 3LZOA 5HP5A 2NYYD 1JGDB 5TK4A 4JRWA 1VACB 3HLAB 3F7LA 3JTTA 4P5RA 3UYRL 3VI4F 3WAKA 2QT6A 3DK2A 2D3VA 4DPAX 1G7IA 4HWNA 3FO2B 3QDMD 4DTGL 1BWMA 1FZOA 4RIRA 5HBBA 5TPWL 1WFIA 4OM1L 1KT2A 1UACL 2Y5TA 3HBGA 1OO2A 3BP7A 3RZWA 3MLXL 1N9PA 1DVXA 2ERJB 3BP5B 3OTTA 3O4LE 3BAWA 5D2NA 3M8OH 3H9SA 2ED7A 2HJLA 2N7BA 3JVGA 1H5BA 2EDHA 1I9RH 5DFWH 1C5CH 1RUQL 1P6AB 2NCEA 3PL6D 4ONGL 3PWVB 3TN0C 4NDMA 3OR6B 3GSXB 4DQOL 1RULL 1CWVA 2OS7A 1R24A 4QYOA 3UBXG 3VRIB 4MTMA 5EF1A 5D2NE 2HVKB 5TE4H 3GSNB 4TQ8A 4GKOA 5IOPB 3EYOA 1HESA 1RJZB 3RBSA 2H6OA 3OAYK 4ZTOH 5FHBL 4LSUL 4UZSA 1NAMB 3V8OA 1FE8H 2EDMA 3P0VL 5BV7B 2WBXA 2UWEA 3G5ZB 3K4AA 3M7OA 1I1AD 1ZVSB 5JOFA 2G5BA 1A3RH 4Y0GA 1OY3B 4NQEB 4X6BB 1A3LL 3DX9A 4EN3A 1JZ5A 3SGDI 5DWPA 1FLRL 5DFTA 4RZKA 4JB9H 1ORQB 4B9GA 3V0IA 3S5LA 1AHWB 1RY7B 4AKQA 4F2MA 4P3WA 2EYRA 4TUKH 2AXWA 4J39A 3CX5K 4XMPH 3KLHC 3MNZA 4PRBA 1LNUA 1MNNA 1YN7B 2MH4A 3VFTB 1IBBA 2VSDA 3UTOA 3BQUA 4OLXH 5DC2A 4WTZA 4XNAA 2XCMC 4M4RA 2R8SH 4L2YA 2YPKB 3D3VB 4J1UB 3U7WH 4ZMPA 3IM1A 1U8LB 4ZO7A 4HIIB 4QRTB 5DD6A 4AKPA 1RZIA 4JRYE 3MNDA 2J6WA 4GKZB 1X9QA 3RLSA 3RVTD 4ACPA 4EOWH 2XWTA 3OZKA 5KOMC 2OMZB 4GLRH 2MPVA 1I53A 1QYGH 2P44B 4LCCB 3IJYB 1YNLL 1RJZA 2DPKA 4QRPD 2O5XH 1T4WA 2CRIA 1NFDB 2A9NH 3GBNH 3I6SA 5DMJB 1IGIH 4AVJA 1BD2E 5EPMA 4F7CA 1BREA 3H7BA 2HP4A 3FB5B 1H9DA 4OUUB 5HHME 5T3XH 5KSAA 1XGQB 2IALA 4JRYD 1QZNA 4N3TA 4Y16D 2ZOWA 1CG9A 1XFPA 4L5FL 4X80L 4TS6A 3P73A 3FT4B 4FQ1H 3IFPA 4ZUVB 4PRBB 5TQ2L 1MF2L 2PCFB 1HEZA 4GKNB 2ATKA 4GRMB 1KCBA 1JHTA 3UAJD 2Y36L 3OKKB 4AMXA 3SDCA 2P5WD 4GXUM 3EH5B 5T5NG 3SY6A 5BXFB 1FORH 3VXUA 2LVEA 1UWEH 4YHOH 4HLEA 2JJUA 3BZEA 2EEAA 1PFCA 1ZDQA 2VSCA 1FVEA 4QCIB 4WV1B 3W81A 4J3BA 2H32A 1TJIH 4KJPC 5ESQB 5ID1A 5I0DA 4HKJB 1ZLWH 2B9AA 3QO1A 4QRQA 1J8KA 5B3JE 1FNAA 4G8GA 4OZGB 5K9KB 4XMXA 4LF3A 3BYTA 1RUKH 3V4PB 4GBXD 5CHNB 4N2HA 3SQOL 3HPLB 3BW9A 2OTWB 1QHPA 2ZUQB 1XD1A 3OPZL 1QO3A 1S7WB 4Q97A 1DVZA 3C2AH 1NBYB 4QHNA 4KHXL 3ZXAC 4EIUA 3Q2WA 2WXLA 5FOBB 3NTCH 2VDKL 3T2LA 2HAZA 5JW5B 3KYNA 1JK8B 2EABA 2N1TE 1PIFA 1GS6X 5EF2A 4LB8A 4PS4H 1YDPA 1YEEL 5FF6B 3PWUA 3PFUA 4CDHA 4MJID 4U1JB 3NK4A 4JN2A 1QFOA 3A6OA 4OBSA 3GMLB 1TTGA 2RQ8A 4N90E 1FZKB 2D31B 4LBEB 4GRWH 4JFFD 5IB3B 1MAKA 3RDTC 2VLME 1ILSA 2NDFA 1BJ8A 3HOGA 3OQ3B 5ETUB 5LNEA 2HJKB 3HI5L 1DLFL 1PJWA 1WF5A 4Y4HB 4KH2A 4YSQA 4X0NA 1AZBA 3HRZB 5JIIA 3TH2T 3GXIA 1U8NB 5CEZH 1T7WA 4JAMB 4FI6A 2Q76B 4N2NA 3OXRB 2K8QA 2V0AA 4H8HA 5IGXH 4MMYB 4HUXA 2FATL 1A6UH 1M56B 5D6DC 5SWQB 4HG4J 4N5EC 5KSBF 1PZ2A 1AQHA 5F9OL 4GINA 5K1VA 4GOSA 1KXTA 3SKOA 5H35B 4PRHB 1VENA 1JPFA 3HG5A 4OCNC 1NANI 4QXWA 4F8LA 1X5AA 4G1MB 1BF8A 5IQ9A 2R2BB 3DOIA 3VVVA 4LOUD 4ZFGH 1JZ7A 1GOGA 2BIMA 3GSXA 1JV2B 3NIFF 4OLUL 3FU3A 3FF8A 2M1KA 4AYID 2AV7B 3OKOB 1QNZL 3DJRA 4GW1B 5C6PB 3B6SB 2ZCKL 2VDML 3ZU8A 4LESA 3WCYA 1AC6A 2YXVA 1ROCA 4JZJB 4F8TA 1B0RA 3II2A 1L9NA 2BINA 3L3GA 3EAKA 3HUJE 3U6XA 4E41E 1RLWA 3UIZA 4GO9A 1NGZB 4JKLA 3R7RA 2PN5A 1FSKC 1X5FA 1YCSA 2JKXA 3JWNC 3SDXE 3NG5A 1A64A 3OLIA 1LQSR 3QDGB 1SDYA 1ZHLB 4LSTH 3WUWA 5IHLB 3LQMA 2YXMA 1AP2A 1NIFA 2WQRA 4JHAL 3ARRA 4HU2A 3GT6A 1NAMA 4X4ME 1MI5D 2OYLA 3WTYA 1RERA 4XPTH 4RGOH 3RUGA 4YHLL 2X2IA 2AF2A 4NM4L 3N5AA 6PCYA 2B0SH 3U0TB 3UP6A 4DKAA 2XTJE 3MREB 4UNUA 2O61A 5I1EL 4U6XA 2OBGA 3CVCA 2CJ3A 2D3NA 2NXZB 1I8AA 1V7MH 3PF2A 3AT0A 5DQJB 5E6IC 4JFHD 1KGXA 3V0DA 4ZFOA 1B4TA 1ORSA 2EIJB 4TSAH 3WMSA 1T7VA 2P49B 1SFHA 3CSYB 1NUFA 5KVFL 4MCZA 4V2CB 4XHQA 3WIIL 3QHFH 2NYYC 4Z0BH 1IAOA 5IJKA 3PAYA 3VFVA 1MI5A 4BGDA 4CN4A 2WIIB 1CI3M 4OKVB 3RWDB 1FFTB 3C75A 5CCKH 3U7AA 4UQ2B 1HWGB 3CBJB 2PPCA 3QWOB 3SE3A 3QH3B 1UWFA 2WY3B 3FAWA 3WFDL 1CFSA 2ZSWA 1A6WH 2AEPH 4AVKA 1NEZB 3KPMB 1KLUA 4QO1A 4TVPH 3ZHDA 4BQBA 1J8SA 1JCVA 1U8OA 2CUIA 1L3WA 2EH8L 4JHZA 4M7JL 4RBPK 3VXUB 3SKNA 4UT6H 4YZFF 5FDYA 1NCHA 2YEZB 3NSJA 5E5UB 3VI4B 4JQXC 2ESVD 4S1RH 1UURA 3WKML 3WXWH 5LNGA 4I0PC 4XO5A 2D7TL 2ZP0T 3FPYA 2UWEF 3K71A 1F13A 4GKNA 5F89A 2AMGA 2OULB 5HHPB 1HYSD 4HWZB 1Z1WA 4P5TB 3JV4B 4R0LC 3I84A 4BA8A 3SGKA 2GTZA 4K71C 1OZTG 3K7UA 2RAMA 4QF1A 1UD8A 1VADA 2OSXA 1S6NA 4BYHA 4K94H 4R5VA 4GKSB 2GQHA 5E6YA 3UTPD 4OCSH 3UOAB 4QHKJ 2F68X 4Q6IC 4QRQB 3FTXA 3PGDB 4XTRC 1QUNA 2OMYA 4LSSL 5F0JB 4BKSC 5EZOH 4LLDB 4MQ7A 1FPTL 1MY7A 4B9YA 2J8HA 4PI2A 3OAUL 4PB9H 4RAUB 3KPSE 4JRXE 3TV3L 2WD0A 1ET7A 2J6EA 4I0PA 5E6IB 2G4GA 5C0EA 2XPYA 1KSRA 4BWTA 1H5BC 4MAYB 1YN6B 2BP8B 1FN4B 1NINA 3ARDD 3D4YA 3H9SD 3MBXH 1UJTA 1H3XA 4C59B 1A3QA 4WTWA 2DQTL 4RFOL 1XXFC 1PY4A 1U42A 2C3HA 4RDQG 4X6CB 2X87A 2F19H 4QXUH 4LP4A 4LMQE 2EIKB 5E8OB 4EVNB 4P2RE 4QXVA 3B8YA 3GF8A 4ABUA 1V27A 4ZG1A 1ZMYA 2BIPA 2V3DA 1JG9A 4LBAA 4R90L 4YXHL 4PP2A 2ICCA 3AB0B 1EHXA 5C0FB 2CMRL 2NQCA 4PVLA 3W0WD 3BD4A 5TE7L 1WQVT 1DQQB 1BYNA 2AERT 2DMKA 5CJOL 2DLHA 5ICXB 1HE8A 2DQDH 5C9KA 1DSWA 2WMPB 3GFUA 2GSMB 4DN4H 4PBDA 3HW7A 1RZIB 3FC8A 3TA3D 3HUJF 4JO2L 5LQBH 1CLOH 2VLJB 4HK0B 3QHZH 4ZPTB 5HGDA 3R0MA 3VXRD 5DRWA 2MOVA 4Q2ZB 3A47A 5JPNA 1IGJA 5AB1A 4JZJA 1DJGA 2ENYA 2OJ1A 3MNZB 4YFLF 4JKNA 4A7TA 2ADGB 3BUTA 1QX1A 3DUSA 4G80B 4H88H 1KC5H 3MV8A 4HEPG 3T2QA 2UVEA 5KYXA 1FO0B 1TTRA 5KSBA 1I7ZB 1OLZA 2X4RA 3KL5A 3OB0K 1I1YA 3B7SA 4WHYH 2Z35A 5DURD 1T7XA 5DS8A 4HIJB 3I50H 2CDGB 1TZIB 3T0DA 2NY4C 3VRJA 1JK9B 2H32H 2VDNL 4KVCL 4KXZI 1RIHH 4OLYH 2BP5M 2NW2B 2ED9A 4WKZB 5JDSA 4LCWE 1Q1JH 1R17A 2KLSA 1RIUH 2GYSA 5FV1L 2G75A 4ZK8A 2P43B 1NPNA 1TNMA 1U95B 4R26L 3O9WD 5K9QI 1VFOA 3WFBH 1L6PA 2A6IA 4ZFZA 2ITCA 3T4AA 3ZZLA 4ODTH 3TN0B 1D5ZB 2EIZB 2WN2A 4JFPB 5E1AB 5MP6L 1JYVA 2F8IA 2ZSVA 5HHOB 1EO8L 1M4KA 4YBQC 2EKJA 3RIAF 4XVTH 1CBJA 1OCWL 4Q9QL 3WJLC 3N04A 3PWJB 3P4MB 3MFFB 5G4OA 2NY3B 2QQKL 4PRDA 2OMNA 4L23A 1QP1A 4UI2A 3ZDZB 4QEGA 3QCTH 3TBBA 4JQIA 2ICWJ 2BNRD 3FTWA 3QEGL 1OZUA 1DUZB 3KWWA 3L9YA 2FX7L 2VAJA 2X4RB 3BVNA 1BHGA 5DVPA 4AQEA 2G4EA 1N59B 1IC5H 2X70A 2G5UA 5ESAB 3OMAB 4WEEA 4N85A 4FFWC 4JM2A 2VR9A 4GRWF 3VXTB 4N5UA 2GAZB 4HU8A 1RVFH 4JFFE 4P23C 2VUOA 1NGWA 4XBGA 1JNLH 5BV7L 5E5MA 5CEZE 3TA4D 2EVIA 4N6QA 2ZSWB 4P3DA 4XXDB 3SPVA 4JDTH 4NN5C 3N41F 5ABAA 5BOPA 4OV6F 4MJIE 3U4AA 4YDNA 3HPLA 3PGCB 2OMWB 1DEEB 4WU7A 3RRQA 4EJ1C 2OZ4A 3A5VA 3BESR 2I27N 1UKTA 5C0DA 1JZIA 2VXTH 2WIIA 2XX0A 4OKVA 1MREH 1MHPL 1NBVL 2G3MA 1IV8A 2XA3A 3MRNA 4KTGA 4BGLA 1SXBA 5HVWA 4PB0L 3P4OA 3UFIA 2V5SA 4AIEA 4XP9L 5FUOH 1L5GB 2B2XH 1A6ZB 3ZTEA 1JF5A 5AYQA 2BSRB 3OHXC 3GHBH 5I1KL 5D2LB 3TF4A 5E0FA 3CFMA 5K9JL 1ZV5A 3TO4D 3ZDWA 4AT6A 2BMKB 3QXAA 1KENL 3UZQA 2AFNA 3UDWA 2E6QA 4MMZC 5E4IA 4H4NA 5JHLA 4JUSA 1II4E 1U8JB 2JCCF 4I9WD 1P7BA 3IDIA 2C1OA 2FJHA 3BVUA 1PZAA 1KCKA 3BN3B 3X14B 1M71B 2MKLC 5DJ2B 4NSKA 3DX6A 5KVMC 1HQ4B 1O7DE 1UJ3B 1Z3RA 4EDWL 2IWFA 3OJDB 3L6FA 5TF1H 4KROD 2X2HA 4ZUTB 5K59F 5D7EA 4JLRB 4I77L 4I18A 4R4ND 5EC1B 2R29L 5TTRA 1ZT4A 1TKWA 4ONFH 1MJJB 4X7SH 1CGSH 5AKVA 2R4SL 3DO4A 4OGQC 2BNQE 3IJ8A 3K5SA 3PIQA 4JJ5B 1P9MA 1LE5B 2DL9A 4Y2LA 4U3XA 2UXFA 4JPKH 3EJYC 3O6FA 4XNMB 3T0XA 3T3MB 1U8LA 3GSOA 1LO2L 1JV2A 4P2QA 1NIEA 4A6YH 3BDBA 3BAKA 4FP8L 3TBSA 2D3JA 2H3NB 4L9LA 5DR5H 4JFQA 5IT2H 3H42H 3QIWA 1NOFA 3NN8A 4G8GE 1E4WL 4Q58C 5I74B 1W8OA 2JXMB 5IHHA 4ZMYA 1SN0A 1GPOH 2IO5A 1E2WA 2H45A 1AAJA 1MWAH 3Q9QA 4ODWA 2BS71 3CZNA 1RZKL 5CKGA 4ZS6D 3HBPA 3U48A 5EH1A 2QL1A 2LT9A 4H0GA 3IGKA 3L3JB 4G9FE 6CGTA 4Z7WA 4BZ1H 5AWNL 1SZNA 3F5WB 5EC1A 1A2YB 2FH6A 4MLSA 5C0CB 3IDUA 4ODUA 5F3BB 2BSCA 3MRPB 5L88L 4PJ5B 2CRYA 5D5MB 4I2XE 5AZUA 1KCVH 1HAWA 1IBYA 4I4WA 4M7LL 4C83A 4HPYH 2NNAA 4MWFB 1KJVB 4X98B 4R8WH 3TJEH 2I32A 3N50A 4OF5A 4FA6A 5C07B 1J8HB 1RZFL 3M17B 5TDNB 4FNPA 4XBPA 3UP1A 4U0RB 4BELD 4HF5H 5LXVA 1W0VB 4CSPA 3HKFA 2DQIH 1NFIB 4KTYA 2Z64C 5JHMA 3NSDA 4BK5A 1Q1PA 3VSUA 2E56A 4PJIE 1KBKA 1D7CA 5F93C 5BZDA 3ZYJA 3BD5A 1Q72H 1UC6A 2BJML 2DIEA 4V33A 3OAWA 3WN5A 4Q7DA 4KY2A 1YUKB 1XGYH 4G6FB 4N8PA 3MJ6A 4PGBA 4Z5RA 1WITA 3ETBF 3GJFK 3R06B 1BVNT 4HOMA 1U91B 1V05A 3DGCR 3GIVA 4UM8B 1XAKA 3QO0A 1XX9C 4W9LC 3ET9F 1AQDB 2KBGA 2WTOA 2WUBH 2P1YA 4X8GA 2OTPA 3CFEA 3F7PC 3QWOA 2UV3A 3HZKB 2VR4A 4XVUC 4UMGA 1OGSA 4MXWH 4LSVL 4XPAL 1LL1A 2ZKMX 5E6UB 5AVSB 1CDGA 3JV4A 1EXUA 5DD3H 2H2PD 3WEOA 2EKSA 2XWXA 2CLZA 1DL7H 1GC1H 5CD5D 1CICD 1HIML 1TUPA 3OKDA 3HC3H 3CK0H 3M7FB 1JGLL 1NC4B 4KKBC 4NJAH 3BP6B 3HMWH 4NZDA 3WNJA 5T3XE 1SEQL 1OGPA 3K0WA 2WN3A 2VXQH 2GC7C 4LLVA 3LNDA 1MAML 3MRLB 2GBVA 5DO2C 1ESOA 3WE1A 3AZUA 5H37G 5L2JB 3BH9B 3GSVA 4LXFA 2PWDA 3NYKA 1DHKA 4ZXBB 4F7MB 2NXYB 2DQEL 3GSUA 3HUJA 4GG6B 4A7UA 4NO5A 4FERA 2UXGA 5K69A 5KVEE 4RMVA 4RQQA 1P5VA 1AQDA 4GXVH 5MHSE 5HGBB 1L7IH 3RVTC 4CC4C 3C2SA 3OGCA 4G6MH 1LD9B 5CFHA 2X1PA 4U1GC 3QISA 1F4YL 3RX9A 3QUXC 1C12B 4Q74A 4TM9A 2YGNA 5D1ZI 3MCKB 2DD8H 4PJEB 4A7QA 4K94C 4PBVC 3GPEA 5J13C 2NNCA 3E6HA 3IDGB 4N8VB 2YQ3A 4O2FB 4OIFA 4PJ9D 1ZLVK 5KSAC 2EUVA 4J3XA 1KLFA 2LU7A 4RMSA 4X6EA 1J05A 2HT4C 1HL8A 4PP2B 4ICXA 4ORZC 2F0CA 2X4PA 4AUJA 1ADQL 2WP3O 3NIGE 3QFJD 1Z32X 3SJVB 4U1SA 4KJQC 4S2SB 4B0MM 1QEWB 3BYYA 3L3GB 4NLHA 4F3FB 5E8OA 1PGRB 2CDFA 2EDKA 4LGPB 4RRPM 1FNLA 4MXQD 5AAWA 3DA0A 3INOA 4PJCB 3WY1A 4L4VE 2D8KA 2H1PL 2Y6SC 3V52H 1S9YA 5GGSA 1MHEA 2ORBH 2F54D 2PYEB 1R3JA 3JQOB 2XN2A 3JYCA 3D9AH 4CVXB 3R1GH 4KMLB 3AB0C 5CEZD 4MJ4A 5IW6A 4QAWA 1P84J 2VE6A 4AV0A 3PIQB 3U0PA 1KGYE 4HDIB 4L29B 4N2AA 4JZNB 1ODAA 2X4UA 4PJEA 3S2CA 5F7AA 4FG4A 4B9CA 3BMVA 4HX1A 3V7MA 2GUYA 5F3HA 4ZW5A 3L6FB 5TQ0H 1A6AA 3AY4C 3CFDA 4HUWA 1YEFL 4OJFL 5HJDA 4TUJB 1KTDB 1YRKA 2WQXA 3IRPX 4B9ZA 2YD2A 5AENA 2ADYA 3QUZC 3QIUC 2EXWC 3CCHA 1MVFA 3OKLA 4J3VA 3W9EB 3IU3B 2GJ6A 2ZOLA 3N42F 5C0IA 2CU9A 3IJEA 3Q1SL 5BZXA 2ICEC 1NGPH 1WD9A 3QAQA 4PJGB 3OB8A 1E28A 1WUZA 3GUFA 1TMQA 4FNTA 4FC3E 3O6FB 1V7NL 2DQJL 4XNMA 3WD5H 5JZ7D 1BJMA 1OT4A 1ERNA 3KM1A 1MRCH 5C0GA 4GT0A 1SOQA 2OV0A 3VB9A 4A6YA 4H1LG 2OXGA 1LEKB 1JZHA 1OOAA 4U4IA 4OCXL 3IGAA 5IIEA 1A4JA 2Q87A 4B95C 3ZUCA 3LDBB 2CD0A 3ARGA 4FABH 1FP5A 3P4MA 2NXZC 4PV9A 3DMMA 4HALA 3PAUA 3ML8A 5DEZA 2KLTA 1T83C 1KJVA 2R0KH 1CDJA 1Y7VA 4NKOA 4WFFE 4FQXD 4IDLA 3RPBA 1BZ7A 3TGXA 1UWGL 3KCWA 1FZJA 1QSEB 2DJMA 2H3KA 3FU9A 3IMTA 1Q9LB 5T5FA 1UZ8A 4DERA 4JO3H 3AROA 4XNUL 2OK0H 1LDPH 4IHBA 1W72L 2A74A 2GW5A 4FLSA 4IRJC 5IMLA 2EXTA 43C9B 1YY9C 2GKIA 4LAQL 3ARED 1IAKB 4NHUA 2CNZA 4ISVB 4AQ1C 5JXAH 2DOCA 2WHVA 3TPUA 4YDIH 1BD2A 4WGKA 3K6DA 4NC1E 4KK5D 1T5WA 5JYLA 5E2VH 4P23A 4KZEL 2C9PA 2ZNXA 4XBPB 1QFUL 3REVA 3VFRB 3GXDA 1BPVA 4JJHA 5F44A 2A77L 1BPLB 3IFPB 1AI1L 1X9LA 1BFVH 3LPPA 4ZUVA 1RP9A 3ZDYE 1NM4A 4XPHL 4Y89A 1FG2B 1VGEH 4S0HA 3MRBA 2BPBA 1NCIA 2VR5A 3SCMA 1HXKA 3KPPB 4XCFH 4NKOB 2XU9A 5LAXB 4FA8A 5KSVB 1WIPA 3C5XA 4FQLL 1DQML 4ANUA 4GRWB 2BW4A 1S7TB 3JT2A 1YHPA 1H3PH 3D0AA 5J1TC 2H32B 1HCYA 4YR6B 3RU8L 5GHWL 3UC0L 2A3TA 3BX7C 1IU1A 1G7JB 2P46B 2XKUA 3HG1B 4OIAA 4ZNCD 3ULVH 5GS3A 4BWWA 4PJDE 4MGXA 5ACLA 4LHUA 2CO3A 2G3XA 2DF3A 3JVGC 4J3WA 1IAIM 2P28B 4PWJA 5T3XD 2DWXA 3H1ZA 4MYWB 1BD2B 1HXMB 4XC3L 4LCIH 2OX5B 4DEWA 5GGTL 1HWWA 1S7RB 1D6EB 2PKDA 1CK0H 1ZRUA 1E8WA 4D94A 1DVQA 5EBWB 4NKMA 4IBSA 4AYGA 4FCAA 1DQIA 1MEXH 1RHHA 4YHIA 1IL1B 1KJ2A 3IJHB 3HTLX 4JFED 2FNWA 5DYOB 2X4SB 3AU1B 4G5AA 5FUZH 5DJYA 2VC2B 1KWKA 3TT1H 4RMWA 3QPKA 1M7DB 4MD4A 5I75C 1BECA 1DP0A 4E42A 2AQQA 4NZTH 4IJ3B 4JN2B 5F7NC 1BFSA 5ICXA 5IB1A 1S7VB 1EFQA 3GI9H 2GIXA 1J1XH 4PJXE 1XF1A 4N5ED 2N56A 2WO3B 2E7BA 4NKDA 3GRWH 1A47A 2E3VA 1RZ7L 4DFIA 2ATAA 1G7JA 5FO9A 3HB3C 3S3CB 3LS5L 5JORA 1DUYA 2M8XA 1A3RL 1OSZB 3DROA 2FB4H 3VX0A 4WV1C 1RZJC 1H0DB 3FYIB 3V6ZB 1CLVA 1G9NH 2DQ6A 1LO0L 5FB8A 5T3ZE 1TVBA 2YA2A 2VISA 1FFPB 1U2CA 3MPCA 5GS1C 1IVTA 2X6UA 1L9PA 3ZOAA 3FQUB 3QXUA 2DQUL 4GQRA 1RJYB 1F3JB 1KN2L 2CQVA 2KT6A 4MRBA 5B1CA 3TIEB 4HS6B 3BDYL 2Z8RA 2CO1A 5AW0B 1MZZA 2WXGA 1P7HL 1IAMA 2KMWA 2O6PA 2QPFA 4GQ9H 4JE4B 1DDHB 1EAPB 3L1OL 3LHPH 5KEZA 4EO5A 2C4FU 1QEWA 2YPLE 4X9BA 1JNHB 3L5HA 3PWLA 4G1MA 4YXLH 1BMGA 4KO9A 4EBQH 3G5YA 4LEEA 5JNYB 5HHOD 4DOHE 1E43A 3CZLA 4HT1L 4EI6B 3ILPB 2FIRT 2WLHA 3HFMH 1UQSB 4KQ3L 2JLPA 3IKCA 3ZYOA 1XL4A 1UGKA 1GOHA 1AGDB 1WDAA 5CCHE 1XGRB 2VDQB 4NUGH 3QULB 3NAAH 4XCCH 1KB3A 3C9NB 3NJHA 3HC2A 5TJWK 1PW3A 4LLWB 3ZN6A 3ECWA 4S1DC 5JDJA 1WAAA 4IBVA 1OAQL 3BKMH 1UUNA 3C60D 4TRPL 5LBVA 3BVNB 3UYPB 1CFVL 4ZX3A 8FABA 3UL4A 3GI8L 4AL8H 3FTSA 3VTAA 1S7UA 4JHUA 4M7KL 3O9WB 3WO3B 4P5MB 3VRLE 2BRQA 5AW6B 1EHNA 5CSZA 1Z5HA 2B8OT 4ZFQA 4KHTH 1UXWB 5CEXA 5FM5O 3PWLB 4FQJH 2GBAA 1E28B 1HSAB 3IEAA 1C5DB 3SPHA 3SDCB 2EKSB 5MERB 4OFVA 2DKSA 5E2WH 1QPKA 3SPGA 1U93A 1XCQA 3C09C 4U6XB 4ZFFA 3CVIH 2ARWA 2YD0A 2MKWA 3VDCA 5IWLA 4NM8L 3B7RL 2VR8A 1CG9B 2FQEA 4QTHA 4NI3A 3F12B 4N1EA 4N0UE 4QRAA 4KFZC 4OQTA 5GGSY 4HJ1A 3C9NA 5A2JH 4PVBA 1URZA 3POCA 5GIRB 1RMFL 1YEDB 2LGNA 4JFVA 5L7XH 1QPXA 1F56A 3CSYA 3BT2H 1PD1A 4Z9KB 4HS8L 5F70A 4MMXA 3HUJB 5FUCC 2LR4A 3CMGA 3Q8AA 5AVZB 2JMRA 2BVOB 3KBEA 2Z9TA 5DLML 2VITB 3BFWA 4WV1A 1T1WA 4DO6A 4DKEH 1IGTB 3L7EA 1SJMA 1F4XH 4PS4L 5DMYA 1W15A 3Q5TA 4PPTA 2IANE 3FU5A 4MLIA 2JKIS 1CICC 2OL3H 2Q3ZA 3QC6X 3QUKB 1ZHNA 2BOBB 1UKSA 2BZCA 1F11A 2APFA 2G60L 3MLTA 4HD5A 4N87A 1R9FA 2HFEA 4F7PA 2WCGA 1RQ5A 5LGHH 2EILB 4R5XA 1X44A 1BZOA 1JPSL 3T9WA 3FRPA 2WXOA 5E8DH 4ODVL 2XTJB 3H4FA 3E9TA 4JDEB 4KRMB 2W38A 4I0PD 4EIBA 3LOWA 1PQZA 3NZSA 4D9QD 4W81A 4F7EB 2A4ZA 2EZ0C 3EIFA 3KHOA 5TH2B 2HMIC 1EMTH 1TETH 4JFEB 2O6EA 1I3RA 5D96B 3FU7A 1PEZA 3OXRA 5TDOA 4U1IA 1A6VH 2QJDA 1HSBB 4OD1H 5EU4B 5M7QA 1A6UL 2WVSA 4MMYA 4K5NA 5GGSB 3T77B 2D4FA 3W2DL 2DWEB 3UG4A 4K9EL 5AAWC 2WKOF 1IL1A 3GSNA 3Q1EA 5INCA 2UY7B 4Y16C 1R3HB 1K5WA 7FABH 1S5HA 1RAMA 3LNFA 2ZAHA 4G8FA 1WVZA 3RTQB 4F8NA 4XN7A 5IQ9B 1BF5A 1WFNA 4UDUB 4X6DB 4ANVA 1RKRA 1A6AB 3B5HA 3WELA 1D6EA 4OGXL 3MUGB 3DX7B 4HXAH 5E70A 5C0AD 4CA4A 1I1AA 3S5LB 3PV6B 1OCRB 3ARVA 2BC4A 1U3HD 2RGSA 3AGWA 3VE0A 3VXNB 4EN3D 3VD3A 3OJMB 1J0HA 2QV4A 4QHUB 4JM0A 4F7EA 5K5YA 3TA3A 2HMID 3QA3B 1F8TH 1FH2A 1OTSC 4HCRA 1EO5A 3O0LA 4TNGA 4KO6A 1NANH 5K33A 4DO4A 3QI9D 1GJUA 2BSBA 4EUPG 3IJ7A 4FQHA 2AV7A 1IAIL 3OKOA 1EWHA 3AS3A 3NMEA 2NSMA 4RMBA 3B6SA 4BRJA 2JCCE 1XB8A 1NAMH 1KEGH 2WXPA 5FX3A 4DCQB 5I30H 4LFHD 3ZL1A 3BPOB 1DQLL 4LCVA 1SNRA 4LLMA 4BINA 4UQ3B 5EZIH 3ECQA 4XAKD 1VCAA 5I0ZA 3HMXA 4JRXB 1YYLH 1LEKA 3X11A 5C0JA 1FGNH 1OSPH 3IDNA 2C9SA 5E4AA 4HA1A 2JF1A 3ZYZA 4XP5H 4DGYH 4E41A 5KVDE 1W2KT 3FT4A 4G82A 1KIQB 1F00I 1J5OL 3L9RB 2BFGA 2IQAB 2VRAA 1FHNA 3NJVA 4NNYA 3CNKA 4ELMB 4NC0B 1TQBC 1AGFA 1IB5A 3IMVA 1EXUB 1IBFA 4Z7VE 2QBWA 3TTYA 3CXDL 1BZ7B 4KK8C 1KGCE 3ARTA 2JIXA 3RTQC 2PCPB 3PCYA 5T3ZH 5C0NC 5I8OH 2YMTA 4QI3A 2X53A 1WIOA 4PLJC 2XN9B 3E7JA 2VXUL 4HKJA 3NA9H 2NW2A 3QUYA 2OYKA 1A7BA 3WFDH 1MCQA 4OF6A 5I15L 5GRYA 1TQBB 1PSKH 3D6GA 3UBGA 1IC4L 3K91A 1WZAA 2XWZA 3FQNA 4YQXH 4JM2D 1IQWH 1C7TA 1UM6L 2AEQL 4J3OC 4KOBA 2P5EB 4PJEF 1OCCB 2R0WL 2V9UA 4H8WL 2YUWA 4Y8DC 1A1OA 5T3ZD 1BSIA 1QASA 3IVKA 5GGRB 5I17B 3TP4A 1QI5A 5KW9L 1XIWA 1JXFA 3A67H 2OMXA 2IGFL 4YPJA 2QVTA 4F57L 3LZLA 4DWHA 4QHLB 1P53A 4DAGH 2KZ1B 4X6EB 1P7QD 1S46A 3RGBA 3S34L 3CLFL 1DFBH 4RESB 5HDRA 1ZTXL 1U8KB 2NY0C 3ZL2A 5DJ6B 3O81A 1SOSA 3KJ4B 4YBHA 1KZYA 3HE6B 3L5WA 3JUYA 3M8OL 2Z0UA 3NQKA 4PMEA 3UEQA 5KBDA 4L0YA 4KK9C 4K5MA 1EAOA 1JTPA 2PR4H 3LEXA 4LLYA 4J6RH 1ZKAA 3EDDA 4LCWB 2YR3A 2K6YA 4S1QL 2QQQA 4KKAD 4JPIA 3OJVC 4PJCA 5LXGH 5EOQH 3BZFA 5KANG 4HUVA 3C5JA 2EIMB 4LVOB 4KK6C 1NL0L