3HMWH

Crystal structure of ustekinumab fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAYLQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords USTEKINUMAB FAB LIGHT CHAIN
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2009-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmwH01
2BOBA 4P2OA 5I1HL 1NSNL 1NC4A 1MLCA 4L4VA 4KWUA 2ZG1A 3P77A 2OZ4H 1FC1A 5IHUL 4GMSH 1A3RH 3FL7A 4GUPA 2DQTH 3TPUA 1QQDA 1CDHA 4XBPB 4AT6A 4O02L 1CDBA 1DN0A 5EC1B 3OR6B 1MJ8L 1ZOXA 2E9BA 4QRQB 3TBYB 4BH7A 2BK8A 2PYEB 1G9NH 4NT6B 3WO3B 5C08D 2R0KH 2VXVL 3M07A 3ESVF 5C0AD 1E27B 4LDEB 5D1XA 2W92A 1UM6L 4DEPB 1I7TA 2IEPA 5EU5B 3TC9A 4IHOA 4PREA 2FJHA 3IDGB 4JHBA 1JYVA 4EVNB 1LDPL 3FFCE 2OS7A 4KKCC 3EDFA 3O3BA 3ISWA 5EBWA 1CE1L 1KELL 1MVFA 1CVRA 4LIQE 1NGZA 3LPFA 5ESAB 5JR1H 1J0ZA 5JW4Q 5FOBA 5DR5L 3DX6B 1NAKL 4WUKL 3IDMB 1ND0A 3IDNB 1O0VA 5E8NA 4G5ZH 1C12A 1UXWB 1KOAA 2WWKT 5JUEH 1SEQH 1Z6JT 3OHXA 1I4FB 1NBZA 3C2AL 3CDYA 3LZFL 3QUMH 4MQTB 4F37F 5E8EA 4P2RA 1CI5A 3EZJB 3PP4L 4LDLB 4YDKH 4JLRB 3WIFA 2FX8H 2Q76B 4UUJB 1AP2A 4FXGA 3P4MB 1NQBA 1J8HA 1VFAB 4DZ8B 1KB9K 2VB5A 1MFCL 4JZOA 3MRMB 4K23H 4ZFFA 1IC5L 2ESVB 2YEZA 5DQ9A 3S3JA 1MJJB 1EJ6A 1CR9H 4QYOA 5I1GH 5IMMB 1DQLH 3RGHA 3STZB 4MNQD 3WUWB 3QXDB 1T3FB 4PJ8A 2J4WL 4LHUD 5FYJL 2OK0H 2IG2L 1ZHNB 3Q1SH 5A1AA 5SWSD 2VDOL 4NZTL 1S7XB 4NHUA 3GI8H 1MHEB 3ZDXE 3FKUS 3FB6B 1EZVY 2EYSB 2P4AB 2AABL 3QXVA 3W81A 5C0AA 4PJDE 5F6HJ 3O2WL 4M1GH 4XAKD 3LKRA 5T3ZD 3BDBA 3EFFA 3Q6FA 4GBXC 1SY6L 2Q6WA 3U9UB 4UB0H 3CFKA 4I18B 4XWGL 5D7IA 4Z77A 2J8OA 4EQ3A 1K4DB 3X11A 4OT1L 5EG6C 1V3MA 3FOLA 3RIFK 3VXUE 2R1WA 2E7MA 1XGUA 3DOSA 3KLHC 3LB6D 1E4KC 3TLRA 3TCXA 3DMMC 1PEWA 5TH2A 3HTLX 3VCLA 5C0EB 4LPVA 4R4ND 2BSSA 1KNOA 4FFVD 3C60C 1KG0B 3OAZH 3MACL 4ERSL 1NCWL 3U4EB 3SPVB 2EICA 2WBJA 1R3JB 3KJ6H 5EZIL 1CFVL 3RUGA 3B2VH 4FQLL 4PTUA 5FF6A 4KMLB 5M7QA 1WF5A 4WHCA 2V9TA 4MA1C 3GMNB 2CIIA 5F96L 5FYKU 4LOUD 2F15A 1XIWD 4Z7UE 4OQ1A 1UENA 4X6FA 4AEIH 3K46A 3QUYC 1IEBA 4PRAB 5TE4H 4L3EE 5I1CH 3CLFH 3X17A 5J4MA 1KN4H 1S9VA 4MNQA 4Q97A 3HCVA 4HWZB 4E41D 4ZDHA 3CXHK 2MFNA 4RSVA 4I0PA 1CU4L 3VWJA 1UB5B 4KTEH 3DUUA 3QQ3B 4D0DA 4PJEF 2MOVA 3CDGA 5TDOB 5SWSA 1O5DT 5EOTA 3ARFA 1KCVL 4Y88A 1SVCP 3RI5F 3VA6A 3I85A 4HKBA 2E7LC 5KG9A 2FHCA 5HHXH 2E3VA 4PR5B 3PGDA 3HMXL 4RMRA 3T2PA 1N4XH 5BS0E 1KGCD 5I8CA 4JREC 5FUZL 5ISZD 4NC0B 5F3BA 3S96A 4DK3A 4FTVB 2M1KA 2H8PB 2HMIC 4BFGA 4YBHA 2B1AL 1J12A 4HCRL 4NQVB 4PBWD 1T1XB 3RWHA 4M7LL 3UZQA 3DIFB 2F54E 3D0VB 4HMCA 5HJ3B 4P49A 2HFEB 1IZJA 2KQNA 5CP7B 3F62A 4ZTOH 5BMFL 4WW1B 4OLYH 5D72H 3RWDA 4JZNA 3QISA 3UDWA 1MQKL 3INUH 3IVKB 1CD9B 3BEWA 4UZGA 2VR5A 3KYNA 5T1KB 4Q9QH 1GL4B 1UKQA 1S7QA 2NXZC 5GXBB 4HGWA 4F2MB 4XVTH 2D03L 3K8MA 3ZE1F 1SMOA 3ARDB 3I6KB 1FFQA 4XVSL 4H88L 5AWNL 4BKLB 2Z31A 2NXYD 5DJAA 1FNLA 1XIWA 3VG0H 3VG9C 3I02A 4YQXH 1U2CA 3ALPA 6FABH 3TT1H 3ULVF 3KGRA 3S34L 4P4KD 1SJHA 1LK3H 4P3CH 4FZEH 2B0SH 3QDMD 1QVOB 4MA3B 5KVEH 2G75A 3IAPA 1U8MA 3PWVA 1ZVYA 4NQSB 4ZXBB 1BFOA 4XP9H 3FFCB 5HI5D 3LPGA 3V52L 2ADFL 1BBDL 2VR4A 3K2MC 3RPIA 1T22B 2GKIA 3I75B 5D5ME 3PGFL 2QSCL 3GMRB 1NUGA 2V9QA 2J88L 3O9WC 2FL5B 4N8VA 3ABZA 5IR1B 2K1MA 1N7ML 3IXTA 2R15A 5T3ZH 1JFQH 2BNQD 2VWEE 5IB5A 3RVWC 1F6AA 2QV2A 4GRWF 4X7TB 4OZGA 4WV1A 4K8RL 3L1OL 3RAJH 5J1SC 1CL7H 5IHZB 1IM3A 1Y6NR 3VFVA 4U7SA 1I3RB 3W9EB 5MEND 2COQA 4PJFF 5DMGD 4ALAH 4ETQB 1P4BH 2HRPH 3VW3H 5MHSD 1TJGL 3IDJA 1WCQA 4OFKA 1NDGB 3CCHB 3X3FL 1LQSR 2IPTH 5D7LE 1IAIL 1BBJB 3MOAH 3UJJL 5E03A 3IKKA 4GMTH 3G6AB 3AC0A 3TCLB 2Y9RT 2JKXA 4QGYA 5IFJA 5GZNC 2D7QA 4FQHA 4AENA 5HYQB 1KLGB 2IQ9H 4XCFH 5HGBA 1VESA 2FGWL 2IFGA 2R1XB 2F9BT 1EUUA 1F4WH 4RFNB 1BZ7A 4M9OA 2G5BB 3B6SA 1L6ZA 1G7HA 5GIRB 4OD3L 4PGCA 4QWWC 3EBAA 4P4KA 5DI8A 3KVQA 3OKOB 1EHXA 3GMQB 3FT4B 3BUYB 3TV3L 3F7RA 3GHBH 4J3UA 1KFAH 5IJVB 4J2XA 4GXVH 1SM3L 3GEWB 3NFSH 4JN1L 3MRDB 4HFUH 4XCCH 1Z3GH 1AY1H 5GHWL 1DVFC 1CICA 3B83A 3OKLA 2V6HA 1DANT 1B4JL 2DDQL 3QXTA 3VXUB 3VGHA 1PSKH 2W38A 5GRUH 4UILL 4R4FL 1H8NA 4K7PX 5FA3B 5HPOA 2WWKO 4DGIH 1FAIL 4QLRA 5CZVL 2BNQA 2BCKA 1X6NA 3IDXH 1FLRH 4N5EC 3S36X 5GGQL 5C2UB 3C5JB 4FOMA 2I60L 2ORBL 1EEZB 5K9OB 1JZ4A 3BHBB 4Y19E 3LV3A 4WHYH 1CBVH 4K3JL 3BW9B 5DVOA 4FQQA 1SHMA 2Q8BH 3GSRB 5MENA 4MNGA 1WIOA 1IAMA 5JO5B 1K8IB 2EZ0D 1GAFL 3D18A 2ZCHL 3I50L 4PBXA 2ARJQ 3CSGA 3BP5B 2HTKD 4Z7UB 4HHAA 3D48R 1M7DA 1S8DA 3U36A 3U2SB 1X9QA 4L3EB 3RWFB 1IKFH 3IAQA 1WFNA 4M1DL 4FQPA 4YHMH 3MODH 5EBMB 3TBWB 3N1GC 3IGAB 2X9WA 1Q38A 3DURA 4PRHA 4I8DA 5J56B 5CGTA 3ULUL 2AVGA 4PY7A 3W0WB 4PGDA 5F7HA 1A6ZA 1KT2A 1N8ZA 4G6ML 1WV7T 2AJSL 4HIHA 3T09A 1NUNB 3D39E 2VLLA 1N0LA 3TT3H 4JFED 1E0OB 1QLEH 1GPOL 4Q9RL 1RHFA 5FGBA 5BS0B 5I8KL 4YBQC 3VFRB 3U6RA 1WAAA 1VPOH 5ADOL 1XGYL 2E9JA 5MERB 2YD8A 3AU1B 1J05B 2XICA 4JAMB 3UZEA 1KCKA 4HD9A 4I3RL 4PJCA 5SX4H 1IGMH 1A7NL 2F54B 1ZWIA 2EYTA 4XGZA 3SKNA 4JFOB 4LRIC 5ADPH 1SYVA 4H8WH 5B39G 4N68A 2QL1A 4U1HA 3GUTA 1DLHB 1FZMB 3HNSH 1DP0A 5FKPB 2B1HH 1V05A 4ODSL 3EYUL 1G7IA 2DQCL 5HVWA 3BN9C 1QNZH 4F7TA 1AE6L 5T1LA 1ZS8B 1S7WA 3AFLA 3EO9H 3PWPE 4KK9C 3LOWA 4URTB 4G8EB 3RWJB 4U1IA 4Z78A 4RZCA 5I30H 1ORQB 3IFNH 1JGEB 3SDAC 2AJYL 3TBSB 4M6MH 3C08H 1KPVA 1QG3A 3RWIA 1I1AC 3SDCB 3OR7A 5DJ2B 3ZSSA 4I1NB 1TZHA 4FG6C 4OCNC 1T7YA 1HHGB 5IB3A 1CGXA 1NPUA 2YD2A 3LMJH 1IGCL 3NZ8A 5ERWA 4ZOCA 1NGQH 2UV3A 4Z5RB 2FX7L 4I18C 4WDIA 1JPTH 4XCNA 5E5MA 1JPST 3HC3L 4FA8A 3QFJE 1FO0L 2VXUL 2W9DH 4ZPTB 2D31B 1ZKAA 1I9RH 5IBTH 5JDSB 3SDXE 3PDDA 3KWWA 3WMSA 4YR6A 4DVBA 3D87B 2J5LB 4TUOA 3TO2B 4JPWH 2MQ3A 3HLAA 1TZIA 3RP1A 5JXEA 5EU6E 4YDJA 1T83C 4JQVC 2ZSWB 4NO0B 1WVZA 4ETYA 3MRJB 4PV8B 2ICCA 4PY8I 2RFXA 3V6ZB 4HKJA 4EI5D 4LNRA 5A40E 3KYAA 5DVLA 3GFUA 3RKPA 1QP1A 2NW3B 5E2VL 1NCAH 3JWOH 4U6YB 4EXKA 4FN0A 4GBXD 4DCQA 1CWVA 1R3LA 5ID1A 4Z7VE 5EIIA 3VFSB 2IAND 3MMEA 5C0GA 1IGTA 3D3VA 3ARGC 2VITA 4LDOB 1IM9A 3WJLA 5CD3B 3L3IB 2NYYC 5E94A 4R3SA 5LXGL 3JTTA 3KLHD 1DL7L 1YN7B 5B22A 1VDGA 2Y23A 4Y1AE 5DD3L 1TITA 4YHNB 2XWJA 3OQ3B 1MOEA 2W9EH 5EC2A 2I07B 5D7LB 3FT2B 3S37L 4PD4J 4NN7C 3NTCH 4X6CB 1BQHG 1HQ4A 3A0OA 5BZWB 3BGFC 1S7TA 1P84J 4KQ3H 3QIBB 4HBQA 3LQZB 3BP7B 4OJFH 3MR9B 2GJZA 3Q2CA 1SBBA 4NQEE 1UCBH 4RMQA 1JK8B 3VGEA 1OTSC 1SEBA 4WI8A 1S9YB 1A9BB 1MIML 2JB5H 5DJYA 4WI6A 5C0FA 1MCKA 4JG1L 4XNYH 3M1BB 4NFBA 2VUYA 4PJIA 4XHQA 1FGNH 4NNXA 4OGZA 5CEZD 5GGVL 3G6DL 4JFQB 1J0HA 4PJ5E 3QUYD 4H5SB 4V2BA 1ACZA 2DLEA 5ICXB 4JN2B 3VXQA 4OLEA 3L3KA 5IQ7L 3GO1H 1BD2E 4L8SA 4JZJB 2VDNH 4WFGE 5C0BB 4PRID 5C07D 2DLFH 2IF7A 4D9QE 2A74B 4S1SH 1I8LC 3NBNA 1P7QB 4LQFH 2ZCKH 4ODXB 4OZHE 1G7LA 1LO3H 5D7KE 3BPOC 5IOPA 1NCCL 4NOFA 4D8PB 3ZYJA 1CZ8H 3E6HB 4EI5A 1G1CA 1YNTA 3JV0A 4FNLH 2R8SL 1UEYA 1YC8A 5E8OA 1MHCB 4OSUH 1HEZB 4WEUD 4JCMA 3QQ9C 4Z95H 3ARDC 2HMID 2X4PB 1T66C 3HZKB 3V9FA 1U3HB 5F8QC 3L3HB 4U1MB 5EUOE 4KK5C 3VGDA 1OGTA 3GBLA 1BWMA 1AXTL 2XWBA 2DD8L 4IRJB 2N7BA 1U58B 3MRQA 4C59B 2FBJH 4L8BA 1XF4A 2C7UB 1RULL 3O3DA 1PLGH 4QHLA 2ZPKL 3ILPA 5DFVC 5DRXB 3GIZH 3RA7H 4ZXBC 4YXKL 4QNPE 1CF8L 3QDGE 1IAOB 5D2LA 4XP6L 4Y5XA 4WI7A 1A8JH 1XGRB 4NUGH 2NXZD 5IMKA 3HI1A 1RVFH 1CLOL 3FRUB 3KPLA 5KS9F 4PY8J 1IEHA 3MRNA 4N0RA 3TO4B 1DUZB 2HVJA 1U0QA 4TVPE 2VDRL 1WBZA 5DEFB 5FECB 3WFHA 1QFWL 5TPWL 3L3GA 1UXSA 5SWZA 1RUQL 3O3EB 2OXGA 3K4DA 3GMMB 4YX2H 1FC2D 4RFOH 5JQ6H 1HYSC 4HLZH 3SO3C 3FFDA 4JM2C 3AREC 4M00A 2GJ6D 4LSDA 5EOCJ 1FLTX 1FIGH 3MFFA 1AFVL 4RMTA 2Y5TB 3DBXA 2Y4SA 4LFHG 3DX7B 5FO7B 3QEUA 3F6LA 1ZEAH 5L9DH 4PRIA 5C07A 2OYPA 4X6DA 1JZ6A 1D9KB 2FIRT 5GGTA 2F74B 4Z7OF 3P0VL 4M93B 4HGKC 2EDDA 2WAHA 4LBEB 3TYGL 3EKCA 4OCYH 4EIGB 1YEFL 3LHPL 1BMGA 4MA8H 5BQ7A 1QEWA 5L2KD 4OGYL 2XZQH 5KVDH 3O9WD 2BNUB 4ZOAA 1BX2A 2VLJD 3FQTA 3MA9H 4JHAH 2J8UB 4OF0A 5D8JH 4F80A 4NM4L 5HI4C 2W0FA 2MTPA 3CUPA 4LEOA 4IJ3C 3MV7D 3PWPB 4M7KL 4MS8C 5K59F 5K33A 5EU3B 3OG4B 3QH3B 4D3CL 1CFSB 4G9FD 4MJ6B 4MSWA 5E2UH 3T65A 2R4SH 1FFRA 2FATH 4WI9A 3HE7B 4GAJH 4CNIB 4DKEL 3SGJA 2VXSH 4HEPG 1ZV5A 1YECH 5J9PA 4RAUA 3E8UL 3LDBB 4NNPL 3ZKMC 1W72L 2NQCA 1T2QL 3QO1B 5D2NC 4NGHH 4XX1G 4KGLA 1PD6A 1QA9A 3SJVE 5TGBB 2WUBL 3QFJB 4JGJA 5FCSH 1DEEB 4NQDE 4Z0XA 5HHOB 2WV3A 5TE7L 2E6JA 3FB5A 1ED3A 3SGDI 3DV4A 5I2IB 2FYYB 2P5WD 3SDXB 1C5BL 4G9DA 5DD5L 4OLWH 5C92A 5CEZH 2BP3A 4M62L 4M02A 4U1NB 3MRLA 2GJ6A 3F58L 5KJRL 4JQXC 3OKNA 3ZL4H 4QTIL 4RMWA 4IS6A 1EFXB 4FQIL 3V5DA 4UNVA 2GTWB 5JOFA 4Z7NF 4HDIB 2R9HC 4WUUB 3FB8B 4N1CA 5IUSA 1IT9L 4I4WA 4TSAL 1FYTD 4JRYE 4RFEB 4Z7VB 3WXVL 1J1OH 3QEGH 3RNQA 4KRPC 5F7EL 1UG9A 4KVNH 3H9SA 1BQHB 2R69L 3QEQA 5JPNA 4F7EA 5IV2B 3FJTA 3V5HB 2HP4A 1T20A 4LCUA 2P45B 4AIXA 1CXFA 4YDVB 3O3AB 4Y16C 5KVFL 5AZEH 4YHPA 5DD0L 4JM4H 3VXTB 1CG9B 2IBGA 4ONGL 2P5EE 3BWUC 3MV7A 2NY5L 3T0EE 4OV6F 5CILH 3FONB 1INDH 1BJ1H 4RNRB 4NQEB 1E4XL 5DJDB 4ZD3L 4QF1B 1SMAA 4NFCA 3NZHH 3EGSA 3FN0H 4TVPL 4QHNB 1W72B 5IG7B 1MVUA 3T8XB 3CC5A 2FR4B 2ADIB 1KIQA 4PJ5B 3BIAX 4YIQA 4ZPVA 4OV5B 4F7PA 4R9HA 4HPYH 1XF5B 3G6JA 5K9KB 1VFBB 4OIIH 2PYFA 2FH8A 5C9JA 1WFTA 4NDMA 1HXMA 4U31A 2H45A 1MWAB 1M6OA 1OGAE 1BD2B 2W0LA 2YPVH 3U4BH 1LO5B 2P5WA 3GB7A 2OI9C 4ODVL 3QHZH 2YA1A 4PG9A 3QHFL 1JI2A 1E28B 1A4KA 2GUOA 4OZHB 5AYUH 3HAEA 5IMOA 1ORSB 5EU4A 4X4YA 4HIJB 1I8MA 4K9EL 3GSVA 4G8GD 4N0FA 3RVTC 3SBWC 1MUJA 4HS3A 2ZUYA 4OLZL 4YBQD 4AEFA 3CH1A 4YHZH 3RFZC 1JRHI 1D5MB 5KAQG 2ZUTA 3B2UD 1S78C 4IM8A 6CGTA 1K5NA 2NY7H 1FORL 1FZJA 1YQVH 3BO8B 4K3DL 4GW1A 4HXBH 4LSTL 3ARQA 1MHPL 3QCUH 2F5AH 5EUOB 5C0RL 4JO4H 4ZUTB 5TQ0H 1UZ6F 4M5YH 5E6ZA 3SDCC 3FT3B 1ZT7B 1F4AA 4LAJH 5DS8A 3ROOA 4C55A 1JMXA 4WHTB 1AGFB 1B0GB 2Y06H 1K8DB 2B5IB 4HJ0D 4E42B 2EDXA 3OMZA 2VR9A 4NZUL 2ESVD 4XPGH 5A16B 3QDGB 5D7SH 3BN9D 4XBPA 3ZTNL 1QSZA 3NA4A 5C1MB 3OR6A 5IROC 5MP6L 4LKCB 4KK9D 3IAGC 4QRRD 1C08B 2CKNA 5ITBL 4QRQA 3TBYA 1NGWA 1CXIA 1YZZA 2PYEA 4TSCH 4NT6A 4E0RB 5C09E 1D7FA 3L5JA 3V4UH 5C0JB 4OCSH 1E27A 2CGRL 2BXYA 2DQUH 3C9NA 4U1KB 4MWFB 5EZLA 1N3NB 1A0QH 3DWTA 3ILQC 4R26H 4IMLB 3W2DL 3E3QC 2VDLL 3QDAA 2HJLB 2PR4H 1B6UA 3LKOB 5DUPH 1T2XA 3TF7C 4XNZB 1HNGA 3OZ9H 4IEFB 3SOBH 1JPGA 3ZYOA 4OM0L 1DCLA 5DD6A 5IF0B 4PUBH 5IESH 4ZFGH 4O9HL 3HAEH 4FS0A 1GOFA 3SKUD 3VGAC 3O4OB 5DWUH 3DX6A 4P23A 4NZRH 3IDMA 4J12A 1XEDA 5EUKA 3TVMC 1MFNA 1G0YR 5KOMC 2V2TB 4L5FH 3PV6B 3TZVB 5JHLH 1DLFH 2EDTA 4I3SL 2BVQB 1I4FA 4Y7MA 1LP9A 4EOWH 1RFDH 4MB5A 3WL9A 4HKXB 3MLSL 4FMKA 1KJ2A 1J1PH 4HUXB 5K9JH 3TBVB 2BSTB 2Q76A 5T1DH 3SE3C 4P5KB 4S1DC 4PJEE 1VFAA 1P69B 2NYYD 2BVOA 2G60L 2Y1VA 5DEGB 3CPLB 1OTTC 4GRMB 3MRMA 3GKZA 3ARXA 5IMMA 3TM6A 3P11H 1DQMH 3STZA 3RDTB 3WUWA 3QXAB 2GYSA 3OXSB 1S3KL 3QXDA 3NOIA 4CDGC 5K9QG 5HYSG 5FYJD 1T3FA 1MRFL 4NQDB 1FG9C 2RBLA 2YK1L 1HQRB 1OTSD 1S7XA 5T5FH 1BGXL 3L3DB 5E00A 3IS1X 1YEHL 5C0NC 5I8OL 1NJ9B 1NGPH 3MLXL 4OKVA 3QNZB 4WNQB 2XPGB 3GBNL 3DGGA 4MD0B 4CVZA 3OKKB 4UNTA 2P7TA 1CLCA 3ZKSD 1SBSH 3U9UA 2DQGH 4PJ9B 1L7TH 4W4OC 5AAMA 4FTVD 1MCDA 3GHEH 2A6KA 4LLDB 5EOQL 2VRAA 3BMVA 2NY0B 1CXEA 3VRJA 4AIZB 1K4DA 3UPRB 4JRYB 4MA7H 4JPVH 3RWGA 2E7HA 4H26B 5EULV 4MHHI 5ESVB 1OCWH 2OSLA 3PQYA 4JDTH 1RV6X 3UTPD 2EC9U 4U1SA 3MXVH 2JCCE 3MV8E 2QR0A 4L29B 4YE4L 3GNMH 4I9WD 5GS1C 3MO1B 3U4EA 3LKQB 3SPVA 1W0VB 1R3JA 4OFYD 1FZOB 3S88L 4TOYL 4LVHB 2P5EB 2ZSVB 1Y6KR 3QQ9D 1WWAX 3T0EB 4HWNA 2NY3B 3ARDD 3SKJH 5DRZB 4KXZH 2XRAH 5BOZG 3V4VL 2XZCH 4U0RB 3F7QA 3QIUC 4FXLA 4OLVH 5I1HH 3WHE0 1NSNH 4PRAA 2AAVA 4Y5YC 4GAFB 5E9DA 5IHUH 2XI9A 4OLUH 5DFVD 1N59B 1HKLL 4JRXA 1EZVX 2BRQA 4U33A 4O02H 1O7VA 3ZHLA 5IHBA 1RUKL 4ZXBD 1GGTA 5HDOA 3FFCD 4PJXE 1D9KC 1OGAB 2AI0H 3BQUA 5FYKL 5KTEL 1Z9OA 2I25N 5FM8A 4R7NB 1J5OL 1WLHA 3D5OF 5KVGL 1QFUH 2VXVH 4ODTL 4OZ4B 4E5XB 2JJTA 2EE6A 4PR5A 4TULL 2YUZA 4MGXA 4RRPA 5DA4A 5DJ6B 1SY6A 2XFXB 2AEPH 1J8KA 5BRZB 2SEBB 4P5TB 1FDLL 2DF3A 2FJFA 4PGBB 2X9XA 1HYSD 3QI9A 1URLA 4F7CB 4DKFL 2R4RH 1A4JB 1SYSB 1CE1H 1ZA3B 2CLRB 3Q3GA 1DQTA 3VFUB 5J12B 1K2DA 4KMTL 1YYML 3MBXH 5BV7C 4NQVA 4XPFL 2QSQA 1LE5A 3L3OB 3KR3H 4XPAH 4NKIL 3D0VA 2FEEL 4NPYB 3WKML 1C1EL 4XCEA 1MELA 2HFEA 5DR5H 1NAKH 3MLRH 3HE7C 5CP7A 1VADB 3NIDF 1BOYA 4OF6A 1A1MB 4BQBA 3IVKA 4ONHA 2WK2A 5T1KA 4EI6B 4OFYA 5JMOC 1IGFL 4LGRB 4TNWF 1C8PA 2NY1C 4F2MA 3TA3A 1RZ8B 5L0QB 3MCG1 5DF0A 5HI4D 1G1YA 4KJWC 2AK4E 2NY6C 3I6KA 4XP1H 4JGUA 4LPWA 4MS8D 4UDUA 2ZUWA 2P8PA 3CX2A 1L0YA 1JWUB 2YSSB 4MDIB 1I3GL 1IC5H 5C09B 4XC1H 1AXSB 4L8DA 1SJXA 5H35B 2ICWA 4MJIA 4OIAA 3ZKMD 4NRYB 4NQSA 2DLTA 1ZMYA 4AJ0A 1BVLA 4LSPL 3EJJX 1NGXB 5IWLA 1MH5A 2WW8A 5JIIA 3MRPA 1YNLL 3VXRE 2W60A 4BUHA 2NCMA 2R0WH 1T22A 3HMXA 1JZ7A 2CLVA 4J3WA 2AABH 2EDQA 3GMRA 5FM4A 1A6AB 4MXQC 3G5ZB 3DYOA 2F53E 1MCQA 4JY5H 2FL5A 4LSSH 4DFIA 1PVHA 2VQUA 1PG7W 1MQ8A 3L5IA 1U8JA 2XA8H 4X7TA 4HCRA 4YJZL 2APWA 2R9HD 3VD7A 3NAAH 5IHZA 3ULVL 1HZHH 3AY4C 1DE4A 4X98B 1Q94B 4JO3L 3W11C 1ZHKB 3WS3A 5D7JC 4X7SL 1AO7B 2YA2A 2BSRB 3C6LB 3PDOB 4ETQA 3PP3K 2APFA 4Z7WA 5HYSB 4PJEB 1UA6L 1MNUL 1UH2A 3NPSB 3GSNH 4F9PA 1XMWA 3I2CL 1NDGA 3CD4A 2C3HA 3BZEA 4L3ED 4X7EC 5I1AB 1CFVH 1UJ3B 2R1YB 1IGJB 3KYOB 4FQLH 2ADJA 3REWB 5IMLB 3W5MA 4IIQB 3TCLA 4PJ7F 2FHFA 1NAMB 2XQBL 1HI6B 4KHTL 4PJBA 3BDXA 4KVCL 5HYQA 1KLGA 5ESQB 1BFVH 2R1XA 1MCLA 3G5XA 3MV9A 2C4FT 2I5YL 2G5BA 1A9EA 3WD5H 5GIRA 5LQBL 1S7VA 3L9RB 4QXTB 1Y18A 3OKOA 4OF8A 1T4KB 4DZBB 4JO1L 3GJFA 3GMQA 2X05A 4ZAKB 3BUYA 1OARL 3S7GA 5BS0D 2PTVA 4ORGB 4O58L 5CSZB 5IJVA 1YMHA 1A22B 4L4VE 5DK0B 5EFIB 5IQ9A 4FFYL 5IK3B 2HWZL 1NCTA 3B9KB 4LIQH 3VWKA 3P4LA 2E27H 3WHXA 4MZ2A 5I8EB 4WI3A 3VXUA 1K4CA 3FB7B 4XPTH 2F54D 4KDTA 5F7LB 1OPGL 3UYPA 2JCCB 1VGKB 3MV8B 3AVEA 5FA3A 3BDYH 4QOKE 3S35L 5KSAB 1A6WL 3JWDC 4B53A 2MCPL 1FBIL 3DVNB 2B5IC 5SX5K 3OGCB 1EHLH 3RVTD 1NCNA 5B3NA 5HDLA 3C5JA 2ERJB 3BHBA 5I66B 3WO4C 3PHQB 4QTHB 1CD1B 3ORJA 3CFDB 4LSVH 3MRFB 4GQ9L 2NTSP 5HYFA 4Q74A 1K8IA 1UJTA 1OM3L 2CRYA 4NOBA 1QO3B 1RZJL 3BP5A 2V2WB 4Z7UA 2EIZB 2C3WA 4C56E 1ZGLA 1A7RL 3SDCD 1X7QB 4TPRL 3U2SA 2FX9L 4JRWA 4L3EA 1GHFL 3BPCB 4IDJL 3RWFA 3MJ8B 2FZ3A 5EB9A 3TBWA 3U0WL 1EGJL 3GK8L 2DBLL 1A64A 5D96B 1EO8L 4F58L 1NEZA 3T3PF 2J6EL 3CSYA 5IFHH 4H88H 5AWNH 4XNZC 3W0WA 4PJXB 3WN5A 5F71A 4Z76B 2X44D 3DSNA 4P2RE 4HF5H 3VXSB 5I1JH 1ZT1B 1BJMA 1N64L 3O4OC 1JPSL 1NBVL 3HC0B 5BS0A 1J8HE 1T80A 5GGUB 2ZUVA 3VFRA 4NO0D 5F8RC 5KW9H 3HR6A 3DROB 5DYOB 3TZVC 5BCAA 4ZODA 1KEGL 2AGJH 2NR6C 1NGYA 3AU1A 2ADFH 5MEPB 1J05A 3Q6GL 5HHNB 4RGNE 3RX5A 4NCC2 5D1QB 5I1DB 2MHAB 3BIKA 1CE6B 1NMCB 2C3VA 2VUOA 4JAMA 3M8OL 4PLNC 2CLZB 3LPWA 5I71B 2EDRA 2F54A 1UKTA 4MAYB 3UJTH 2MNUA 1OQOA 4G42B 4ZTPL 2N56A 3KPRD 4LPXA 5E08H 2KDGA 1FZMA 4XPBL 2DYPB 2I9LA 4R8WH 5FKPA 1H15B 2IMNA 1KIPA 3GSQB 4O2EB 4EDXB 1MF2L 5D7LD 1ZS8A 5HYJE 3ARBB 5CUSH 3O3UN 5HTSA 1QRKA 1S9WB 1HHHB 5GRXG 2VN4A 5D7IE 3QIBD 5DMIH 4W6XB 4ZQKB 3RWJA 1FVEB 2PF6A 5DEZA 4P2YA 1T89A 3QG6B 1ORQA 2I9TB 3F7YA 3HR5A 1JGEA 1JN6A 1T5XB 1QLRA 4P2QE 4S1DD 1HWHB 4NQUA 1NCBH 1TZGL 4IMKC 1XH3B 1I8KB 4U6XB 3T1WA 1OTTD 3OGOE 4WWKB 1KCRH 4PJ9C 1F90H 4NBZB 1NCDL 1UQSA 1KULA 2A9NH 4TNVF 2NY0C 4ZPTA 2FGWH 2R2BB 2D31A 3RUGE 2MPAL 3ETBF 4RISH 1F8TL 1ZTXH 2Q20A 4OD3H 3MJ9H 5DQDL 1G6RB 5JDSA 3QUXB 1L7IH 1XR8B 5JPMA 3BP6B 5HHME 3TO2A 5B4MC 1TCRB 1RMFL 3BD5A 2R2HA 2IAMB 3EYOB 5C0ND 1F11A 3QB7C 4NO0A 4U1LB 2ZSWA 4P2CG 3TV3H 3MRJA 4ZO8A 2K7PA 4BUGA 3ES6B 4HT1L 1JGUL 4NQTA 4U6YA 4LVHC 2ITDA 3J7HA 3L5HA 4Y19D 2NY3C 4C57C 3WLBB 5FOJA 2VDKH 3VFSA 4YEEA 2OP4H 4Y4FA 3H2WA 4R7DB 4FQ1H 3HMWL 4X9FA 1U3HD 2R2EB 3RTQA 5CD3A 1RURL 5KS9E 2ZZUT 4P5MB 1RZ7L 3AXLB 1RY7B 1YN7A 1OP3K 4NBXB 4Q6IA 3ZE2F 1DQJB 2AW2A 4BFIA 2YPLE 3DSFH 3V8CA 4M48H 1RU9H 5GSVB 4YXLL 2GQHA 4OF7A 2X2YA 3EJZC 3KDMB 4X6CA 3DI2B 5BZWA 4LLQB 1I85C 1U8HB 1S5IH 2X4QB 3QIBA 1FFNB 4KI5F 1QR1B 3LQZA 3IT8D 3HG1A 4FP8L 4PB9H 1N2RB 3MR9A 2BSED 1JK8A 1R24A 2V7NA 1S9YA 4WENB 1KJMB 3TO4D 5DUMH 2DL9A 4R90H 1OAZL 3M1BA 1DUYA 4YHOL 4DAGH 3D39D 2Q86B 2NNAB 4Z7OE 3HFML 3DYPA 3T4AB 4M1DH 3H9YA 1QSFE 3P4NA 4YBLB 2HKHH 3O0RH 1DZBA 1FO0A 5IW6A 1CYGA 5ICXA 2BOBB 5J3HD 4JN2A 5J12C 2EECA 1MLCB 4L4VB 4WTZA 4JZJA 4G6MH 4PRNA 2AJSH 5C0BA 1CFTB 3TPUB 1QQDB 4C83B 2C5DC 3EOTL 3DRTA 2IADA 1D9KD 1DBAL 1P7QA 3WYRA 5FUCE 1GPOH 4AQOA 3I6LD 3KXFE 5K59E 4D8PA 5I8KH 4X8JB 4P0DA 4QOKB 3WFDL 4D9RE 3E6HA 5ADOH 1XGYH 2CPCA 3MA7A 4KV5F 2DQEL 1NANH 1EAPB 2FWOB 4G6AC 4M7JL 3F12B 2Z35B 2ZG3A 4R2GB 2KH2B 1HEZA 1YUHA 5DMKA 3T2OA 1I7TB 2HTLD 2OL3L 4IHOB 2D7TL 4PREB 1QD0A 1MY5A 2X4PA 1OAXH 1A7NH 3QUZB 3O3BB 1MCPH 3PWPD 1U3HA 3RL2A 5TDPB 4U1MA 1YA5A 1BJ1J 1S7UA 1CDCA 4NN6B 2FECL 2QHRL 1NGZB 4IRJA 2VDQL 3MLVH 1U58A 1U93A 1E4JA 3TEUA 4C56B 4ODSH 3MLPA 3HE7D 3X12B 2OMBA 1NFDA 5DRXA 25C8L 1KJ3L 1ND0B 5EWIL 1A7OL 1IAOA 4HWUA 2DQDL 5C3LD 4A2MA 1XGRA 5E8NB 4XT1C 1C12B 4X83A 3THML 1NLBH 2R29H 5F7FA 3FRUA 3QFJD 2NY1D 3U7WH 3NABL 3TO4A 3IJHA 4AEEA 1TCMA 3K4ZA 5E8EB 5DEFA 1ZVSA 3K4AA 5FECA 7CGTA 4Z0BH 5TDNA 3O3EA 3AUVA 1LMKA 2HN7B 4A6YL 4OQTL 2Q3ZA 3NA9H 3GMMA 3WFEL 4JVWA 3ZDYF 1IGCH 1GZQA 3VGBA 3WNOA 4ONFH 1J8HB 2FX7H 5EU6D 1QBMH 2ID5A 3GM8A 4LU5H 3DPBA 1LO0H 2VXUH 3C2SA 2VDPH 5E6IB 5F89A 2ZOLA 4ZFFB 2YEZB 3AS1A 5DQ9B 5F7NC 5BW7C 4N90E 5FO7A 1JIBA 4X9IA 4RGNB 1P4IH 2A0LD 1MREH 3C8DA 3UTTB 2NX5A 4HKZA 2F74A 5EO0A 3RY5A 5BOPA 3C60A 4PJ8B 3QAZB 3S3SA 1JYWA 2APBA 2WUCH 2R23A 3QG7L 4NHUB 3H7BB 3NPSC 4MXQD 2GI7A 2C26A 5JIHA 4K94L 2PW1B 4ODWB 3EJYC 4WI4A 1KYOJ 2BNUA 4C54A 4WW2C 2OL3B 2NY2B 4JO2L 2J8UA 2CKBH 1UB6B 4Y1AD 5HI3C 1H5BB 2X4NB 2B2XH 2QQNL 3EFFB 4PIRF 5HYJB 3MLZH 4QXUL 3CFKB 5D7IB 4N8PA 5EU3A 4Z77B 3QH3A 1Z9LA 1CFSA 3UXFA 4MHHG 3W11D 4MJ6A 4NQED 2YZ1A 1HCVA 1U6AH 5E0QA 5T5NG 1PQZB 3FOLB 1BECA 1CDJA 1R3IH 2R1WB 3LAFA 3QULA 4K07A 3RX7A 1QYGH 3A6CL 2QQQA 4P2QB 4CNIA 4BH8B 1T03L 5C7XL 1EBPA 4YHIA 4HQQL 5TH2B 5LAXA 2BSSB 1KNOB 5ABDE 5HHQA 5F9WC 1MRDL 5LVEA 1H3UA 4Q2ZB 1ZA6A 2HFGH 4GG8B 1OP5K 5TGBA 3X14A 1DEEA 4DGYH 4XNUL 5HHOA 3B9KC 3NCEB 2JF1A 2CJUL 2WQRA 3HPLB 1BD2D 5E4EC 4JFZH 4WFGD 1CTNA 2FYYA 5I2IA 4A6YB 1MFAL 3SDXA 4MNGE 2IFFH 4D9QD 5JHDE 5HHMB 2AQ1A 4OCRH 4U1NA 5D7KD 5EIVA 4X6FB 4L3CA 1ES0A 1EJOH 1UZ6E 1IJ9A 1EFXA 3FMGH 5CP3A 2ERJC 4O2FA 4HDIA 1SJEB 4WUUA 1ZGLM 3BH9B 3FB8A 1CGSH 3UX9B 5AAWA 2VAJA 4X8XA 1KIRA 4ZDHB 2XKSA 4I0PB 4PRHE 1OAYH 1MCJA 4RFEA 3VWJB 3WIHL 3RNKA 1I9IL 3DUUB 4Z7VA 5I1EL 2DQJL 4D0DB 3CDGB 1J0KA 3VD4A 3G04B 1BQHA 3CVHL 4WVRA 4WFFD 5EOTB 5KS9B 4H20H 3ARUA 5IV2A 1T1ZA 5KG9B 1UWGL 3PGDB 4MAUL 2ZUSA 5D70L 1MIEL 2Z8VC 4YDVA 4RGOH 2YPLB 3RZCB 3P9MA 5D96C 5F3BB 3S96B 35C8L 3G9VA 3IFPB 3QDGD 3MPCA 2BY2A 4GRLB 5CGYC 2EXYC 2VC2H 1ZANL 3JBG7 2VSCA 2RCSH 2ZNWA 5BV7H 3FONA 3VFOB 4BELD 5DJDA 4QF1A 4TNWK 2PXYA 1DDHB 1D5BB 3U1SH 4TVPD 5T3XE 5JIKA 4LFHD 5FFLA 3RRQA 3IXAB 4QHNA 2AEWA 1W72A 4AMKL 5IG7A 3T8XA 5IVXF 2FR4A 1CLZL 4PJ5A 1QSFB 4NKDA 2CDEB 4Z9KB 1U8KA 4BZ2L 5DVKA 4OV5A 1KF9B 4DWHA 4EN3B 5D1QC 4DTGL 1YMMA 3OL2A 3SE8H 3GZKA 4X7FC 4C4KO 1BVZA 5HDQH 2DTML 1S7QB 4TTDC 2VDRH 3LS4H 4HGWB 3QIWC 1LO5A 1QFWH 3WXWL 1LDSA 1RUQH 1DQQA 4RWHA 1E6JL 4V1DE 1ORSA 3MUGB 4Z18A 3KXFB 2EDHA 1FRGH 2R2CA 3R1GL 3ARTA 2Z92B 4HAGA 1CIUA 5H2BB 3VFTA 3HNTL 5DD1H 1N6QL 3SDDC 5T1MB 3QQ4B 3TZVD 1D5MA 12E8L 1V7NL 3VRIA 3ARBC 2G75B 2NR6D 4M5ZL 1G7QB 5HHVH 4F33B 4TRPH 1JGVL 1AGEB 1BFOB 3BO8A 5I73C 4LRNL 2X70B 3CVHB 1QPXA 2CDGB 5F1KC 3TJEH 2H2SD 3IRPX 4ZUTA 1YEFH 2DIBA 5FCUL 3VI4F 2JJUA 4ACPA 3O8XB 1XGPB 3BP4A 3FT3A 2JTDA 5TE6L 4UQ3B 1NMAH 1X5HA 2ZWLT 3G9AB 5L6YH 1H0DB 4WHTA 4NWUL 4XPHL 1B0GA 4LLUB 4E42A 3IXTB 3HE6C 5A16A 1P53A 5IB5B 3QDGA 3U0TA 3RDTD 4PJHA 4WV1B 3WS6A 5I9QC 2YN5A 1OT1A 4H1LA 4U0QB 5DQJA 3SJVD 3ARSA 4LKCA 2DOCA 2KZ1B 4NQDD 4KI1A 1GIGH 1C08A 4OAWB 3QUXC 4K3EH 3KPSB 3IB4A 3VFVB 1JHKL 4PYGA 3D3VE 5IW3A 2P46B 4DW2L 4DKEH 4QXWA 3BKCL 5DRNA 1OVZA 1G0XA 2APVA 1KEMH 3L95A 3IU4L 3OAUH 4NNPH 4E0RA 2H1PL 1HIMH 1W72H 1A3LH 3CXDH 3EYSL 4TSBL 3C5SB 5ALCL 4I2XA 3KPMA 3IDJB 4U1KA 4MWFA 1N3NA 4PB0L 5BO1L 1KN2L 4IMLA 3H42H 5MI0B 1SQ2N 4PJ9D 4BK5A 3HRPA 4U6VL 3LKOA 4OM1L 1MWAH 5I18L 1YJDC 2NY0D 3QQNA 2F8VA 5GRJL 1WZ1L 4KDVA 3UBXB 1TQBB 3U82B 4JRYD 1GGBL 4PGZA 5DHVB 3B4NA 3WSQH 5IF0A 5FB8A 4DQOL 4NP4H 1VFMA 3F58H 2NY4C 1BZ7B 5HXMA 4PJIE 2ICWI 3B6SB 5B4MD 2WIMA 1G7HB 4YDIL 3MOBL 1KYOK 2JJSA 4W6YB 5D71L 3NCCB 1Z9MA 3T1FA 2V2TA 2H32A 2O5XL 5F93C 4ZO6A 5TJWK 2CUMA 1X44A 3FQWB 4P59H 5I1IH 2A77H 1WSST 1RIUL 4YDLB 5F9OH 2F5BL 2P5ED 1HILB 3OJMB 3T0ED 1XT5A 2QQLL 2NY3D 4DN4L 3C09C 4HUXA 2BSTA 1TVDA 1A7PH 1T04A 4P5KA 3OKLB 3MLYL 4ODHH 3F5WA 3GI9L 5T3XL 1MJUL 4GRMA 1ZLWK 1JTOA 3K80A 2D2OA 4P2OC 3H0TB 1KTLB 5EBLA 3OBAA 3RDTA 1RAMA 3QXAA 4G7VL 3OXSA 3ET9F 4GAGL 4CMHC 1WTGT 3EJZD 1J1XH 3LV3B 4KZEH 1JE6A 1PGRB 1OGAD 4FQQB 4K7PL 1GOGA 1HNFA 4KPHL 4TVPH 1HQRA 3L3DA 5JHDB 1DBBL 3MC0A 5E99L 3NFPB 3S36L 4EXPX 3ZZ1A 5GGSY 3R0MA 3T4YA 3HRZB 2ICEA 2X10A 2XPGA 4OUUA 3TBTB 4MD0A 5INCB 1S8DB 1A6VL 3OKKA 4R2GC 3UEZA 5D1XC 4P5TD 4U3XA 3BZDA 3MXWH 4AG4H 3J8F7 1F4HA 5D2LE 2EEBA 2IBBA 4AIZA 3DURB 3QHFH 1KPRA 4PRHB 4Y5VB 3UPRA 2FB4L 5B3JF 5CCKL 4PY7B 4NN6C 4H26A 4PGDB 4U05A 5ESVA 1A6ZB 1JNLH 3ZKXB 3SE9L 2QKIA 3P30H 4KHXL 1ZSDB 4L29A 1UM4H 4UT6L 2ED8A 5CKGA 3W82A 4AL8H 1DFBH 1J10A 5SWZE 3ZT5A 3N9GH 4LQ1A 4MCZA 3ME0A 3H3PH 5IVZB 2Y36L 5DFWH 1ADQL 2HLAB 1PYWB 3LKQA 4G6AD 3SN6N 3BSZL 3NN8B 1FZOA 3SDAA 4LLMB 4WJ5A 2ZSVA 4HUNB 3T0EA 1X3DA 2A38A 3DHMA 5DRZA 1UH4A 4X9HA 3AM8A 5DJCB 3FQNA 2H41A 3KG5A 1ZWIB 2IBZY 4LL9A 3SKNB 3D9AH 1RJLB 1CGVA 5C09D 2V5SA 4HZLB 4U1HB 4YH6A 4ZSOB 4BSVA 4HWBA 4S0SD 4HJJH 2R56H 2DL2A 4I3GA 1J9CT 4B0MM 5BVPH 2QQKL 1OAQL 2ICWJ 1DBJL 1J88A 5F6IC 4JKPH 1K3IA 3DARA 4F7TB 5ITBH 5T1LB 4X9BA 1OAUL 3DRQB 1BAFH 2HH0L 4PJ8C 3QAZC 3WDJA 2FD6L 1T5WB 2BNRA 5C6TL 4OZ4A 4U1IB 1IAII 3I9GH 3HZVB 4V1DB 5JTWA 3P9LB 2P8MA 5CJ8A 4GG6A 2QBWA 1MCOL 4Q7DA 2YD6A 5DJ6A 3CMOH 1I3UA 1EAJA 3CX5J 3OKEA 5BRZA 3RWIB 2SEBA 4P5TA 4OCWH 1TZHB 3N1PC 4WU7B 1HHKB 1BVKB 2CLRA 3DI3B 2EH7L 5AEAA 4S0TD 2KL6A 5C3TA 4AEHH 4XCNB 4LP5A 5ALBL 2A6JA 1F4YL 4ZS7L 3L3OA 4NPYA 3C6LD 5M95B 2D9CA 1QFWM 3WUZA 5D9SB 4HJGA 2A2QT 1VADA 4MX7B 2FO1A 1VERA 4OZFA 1A1MA 4EKXA 1U8PB 4I3SH 2DM4A 3O6LL 3EJYD 4EI6A 3QWRD 4X5WB 5CSGA 3WV0A 4Y2DB 5HI3D 4HS8H 4LNRB 2J8HA 4YXHL 1T0PB 2WBJC 1JF1A 4DN3L 1RZ8A 2LVEA 5IB4A 5D6DA 3VE0A 2M8XA 4L1DA 2GY7B 5ID1B 1R3LB 5EIIB 3SDYL 1MRCH 3IFOA 3MMEB 5GZOC 3D3VB 3QHTC 1Q9LB 1JWUA 4NSKA 5FKAA 3H9SE 4AK1A 4N0CC 2P8LA 4YEFA 5ICYB 3QEQE 5E94B 3U30C 1Q9OA 2ZUQC 1AXSA 5LGHL 5H35A 4F8TA 4ZAKD 5CZKA 1RUPH 4L8CB 3ZE0F 2F58H 4KJYA 4NRYA 3RVUC 4X4XB 1A14H 2EDLA 1NGXA 4I0PC 4HGMA 3VWJC 4GS7C 4DGVL 3O2DH 3B9KD 1XF1A 2DAVA 1A6UL 1PW3A 3ARFC 1A6AA 3BOVA 3G5ZA 3V0WL 4NJ9H 1B6DA 3CVIH 32C2B 4XNXH 2A6DA 2PTTB 3MV8D 4PJIB 1HH6B 4NNXB 4HBCL 1KB5L 4YPGA 1INEL 1A47A 4QRTA 3REVA 1WC7B 3N85H 1FE8L 2XNAA 4UT9H 4XAWL 3CFEB 3G6JE 5HBBA 2XTJE 3VXQB 4X98A 1Q94A 1ZHKA 3QRGH 3EDDA 1AO7A 1B88A 1IAKA 2BSRA 3C6LA 4PJAF 3T3PE 3U46B 2XWTB 5GISL 3IFLL 1MCRA 4YE4H 3NCMA 3NIFF 4PJEA 2Z93B 4CDHA 2XG4A 4R4NC 3ECBB 4YHLL 4B7LA 3QWRA 2WIIB 3S88H 2A9ML 3UDWC 5I1AA 1UJ3A 3IDYB 4XTRC 1IGJA 3KYOA 2AJUH 5E8OB 3JV5A 3REWA 5IMLA 2AJVL 2EDFA 4K2UL 2X4OA 4CBPA 4IIQA 3UC0L 1IC1A 4S1QL 4MJ5A 1HI6A 5CGYD 2EXYD 3V4VH 3HC4H 5FUCC 5IFAL 3V2AR 4ODBD 2BFVH 2Z31C 1OTUC 1XIWC 1EFQA 5EO1B 5EN2A 7FABH 4MZ3A 5IEKA 4QXTA 1IL1B 1I9JH 3FO0H 1T4KA 2XWBB 5C0CA 4J4PD 3MCLH 15C8H 3BE1L 3BRFA 1OAKH 4OUOA 4LSRH 4ZAKA 3MRQB 4MMXC 1RIHH 4L8BB 1XF4B 5ID0B 5TFSH 3JTSB 4QHLB 4ORGA 5CSZA 5EU7E 3RWCA 3K2UL 3VDBA 5J1AA 2HA1A 2X09A 5DK0A 5EFIA 3EIFA 3VMNA 5KTEH 5IK3A 5D1QD 5D2LB 2O5YL 4KUZH 2XV6B 1J5OH 1F3RB 3QCVL 4XC3L 5I8EA 3BPNC 3QIWD 3FB7A 2VLME 3MRNB 4X6EA 2HVJB 3GMLB 2LU3A 2BVUA 5IB1A 2WMPA 4OCXL 2PYEE 4MAYD 1FGVH 4NKOB 1QR4A 1FDLH 1U92B 3WLWD 5KSAA 4UIKH 4JJHA 1UXSB 5I16B 3OWEA 3L7EA 4RA3A 3DVNA 1V7ML 1R5IB 2DYPD 5GGRY 4KMTH 4QXGH 5I66A 1MCBA 3MFFB 4QTHA 4WIQA 4WV1C 4YFLF 1KPUA 3CFDA 1C5CH 3RVVD 5HGDA 3ARBD 3MRFA 4RGMC 3QEUB 4ZNEA 5JW3L 4LLYA 1OW0A 2AK4D 1T1WB 2VE6B 3LQAL 1AGBB 4UOW0 2PN5A 5HGHB 1QO3A 1K6QL 1UACL 2RR3A 2V2WA 3B8YA 5I6XB 3EYFB 3PV7A 3FQRB 1X7QA 2AJXL 2CK2A 3BPCA 3T0VA 2PNDA 3MJ8A 1GYAA 5BQ7B 1QEWB 1N6VA 2EH8L 4WWKD 5MI0C 3FQTB 3HE6D 1TJIL 4UT7H 1WWWX 1GGIH 1NAMH 3CUPB 3OKMB 1LP9E 3V6BR 4AY0A 1WICA 3VXRD 4BFEA 4JQXA 2NXYC 3VXSA 4F57H 4PRPD 3OJ2C 3QUXD 1OD7A 1ZT1A 4KMQA 2JIXB 4M43L 3V79C 1R0AL 4J4PA 5L8KB 2G5RA 3HUJF 2IAMD 3CX5K 3MYJB 4P4KC 4KTDL 5GJTH 4PJFA 3E2HB 5T33L 2F53D 2UZYB 3LRSA 2VZTA 3BVNB 3BYTA 2AXGB 2XZAH 1KB9J 3BKJL 1B90A 4LSPH 3K8LA 5J9PB 4RAUB 5CJOL 5MEPA 5HHNA 5I1DA 3UTZB 1RZFH 2MHAA 3IRZA 4MXWL 1WFUA 2AEQL 3D2UB 2Q7YA 5C0IA 1CE6A 1HHIA 3UTSE 3NPZB 3VDCA 4OGXH 4LMQE 1AGCB 2CLZA 2CMRL 2VH5H 2OTWB 4D9LL 1CICC 1G0DA 1Q9WB 3FB5B 4PJ7B 3JXAA 4MAYA 3EZ8A 4JB9L 2GFBA 1ZXQA 3TFKD 3WUWG 1F3DJ 1PFCA 4ZS6D 2DYPA 4PRBB 3B9VA 2M2DA 1INQA 1Z5LB 5LKNA 4OB5H 2OZ4L 3OKNB 4GMSL 1WZMA 4IS6B 3V5DB 5JOFB 8CGTA 3D85A 1HHJB 2FH6A 4QEGA 4XVUC 1S9WA 4MDJB 1VEOA 4P3DB 2FLRT 4I4WB 4ZQKA 5F9DC 5H37G 1FVEA 4LARL 1G9NL 4U6TA 2R0KL 3QT2A 3RNQB 3PQYE 4YZFF 2F19H 3K7UA 3H9SB 3OG6B 1IFHH 1I1YA 4W4NA 3QDJE 1EGJA 1XH3A 1I8KA 1RIVH 2HT3C 2ZOKA 3MRHA 3QEQB 4RMUA 1FSKC 3T77B 3GJFK 2J6EA 1T20B 1AGDA 4LCUB 4NBYB 4WWKA 4QRUB 3SY0B 1WITA 2Y07H 2XQBH 1DBML 3CZFB 3LEVH 4KHTH 3BWAA 3MX0A 5E2WH 3O6FB 4YHPB 1NC4D 2CIKA 4L4VD 2R2BA 3DVGB 2KPNA 5HVFB 5FK9A 4G8IA 5DGQA 4AM0A 1GGCH 5JR1L 1HWGB 3SQOH 1XR8A 2KBGA 2RAMA 5DFTA 2CD0A 5I19L 1TCRA 3B5HA 2IAMA 3EYOA 3OPZH 3EGSB 3MRKB 4U1LA 5FGBC 5INDA 2Y7QB 4G5ZL 1QUNA 1MVUB 5FO9A 4U6HB 5JUEL 1YY9C 2DM3A 4FFYH 5E9DE 4R2GD 1A5FH 1G7JB 3B43A 1QFWI 3DO7A 4JRXE 1WT5A 1RZKL 3L6FB 3QUML 4U3CA 1N5AB 1FH5H 1ONQB 3CZJA 3G6JB 4F7PB 3CXHJ 3O4LB 2XTJB 1N0XH 5C86A 3WLBA 2H9GB 4YDKL 2PYFB 5ACZB 3FO9A 4NDMB 1HXMB 2FX8L 4R7DA 2AS5M 2C3GA 3S35H 3GB7B 4PG9B 2OMNA 4Q0XH 4O5LH 3ZDZF 3TWCH 1DQJA 4K23L 5I1GL 1HOCB 1CR9L 2DLIA 2OJEB 4NO3B 1DQLL 4X4YB 1Q1JH 1BQSA 4H0IA 3GSVB 4FABH 4HS3B 2CK0H 4G80B 4MXVF 3PL6B 5J11B 4LLQA 4QHUB 1U8HA 1FL3A 1SVZA 1J18A 2OK0L 1QR1A 5HVGB 3Q1SL 4QKXB 4RRPG 1T6VN 1RZJH 3GI8L 4GW1B 4P2RD 4GSDH 3VXNB 1U95B 2Q86A 2NNAA 4M1GL 3OF6A 4LGPB 3T4AA 1HN1A 3CFCH 1BQLH 3U0WH 4XRCA 4ZUUA 1LO2H 3ROOB 2DBLH 3GGWA 5DS8B 1WEJH 1J8HD 4UB0L 5HDBF 5LWYH 3SHSA 5E6ID 1YEIH 4QT5A 1MFEH 4P48A 1CFTA 3JV4A 4HZAA 5B8CB 4JVPA 1BIIA 4C83A 1HXYA 5GS0L 3FO2A 4ODUA 2VISB 1G6RH 4PJ8D 1UYWH 1RJYB 4D2NA 1YEEH 4X8JA 2X6MA 1NGWB 2DMKA 1PG7H 3EYQD 3T3MF 4QOKA 1LO4H 3X3GL 1M7XA 5DDHB 5JXEC 2YZ8A 4APQA 1EAPA 2FWOA 3PXJA 3F12A 2Z35A 3QUMB 3S9DB 4DVRL 3WNKA 4M8QA 1QBLL 5DVNA 3V6OA 3C9NB 5EZLB 4MJIE 2GEEA 3MNWA 3SCMB 5DGRA 3S98A 3BPLB 1AI1H 3TJHC 3AB0C 4WY7H 5HYJD 1EHNA 3DV6A 3QUZA 4I0CC 1YJDH 4X0KA 4HPOL 4OD1H 5TDPA 4YFEA 1FJ1A 2IQAB 3PWNB 1JPGB 4AEIL 4NM8H 4N0YH 4KUCD 3WJLC 2B39A 2VJXA 5DD6B 3L5WB 2UZXB 5I1CL 4C56A 4PP2B 3CU1A 2IJ0C 3X12A 3CLEL 3KLDA 4UDTB 4LASH 4P23B 1JNNL 2YXMA 4XBEL 5EUKB 4KTEL 1L0QA 1LEKA 1NFKA 5BZDB 4POUB 3UYRH 2WBJD 4U1GB 1LP9B 3WL9B 4TUKH 1KJ2B 5HHXL 2E7BA 1MAMH 4GG6F 3VJ6B 1KTRL 1ZE3C 2IPUK 1N4XL 4GKOA 2HN7A 5I15H 5GZOD 4Z7WE 5HHMD 3A6BH 1BLNB 3GSOB 1G9ML 4N0CD 2F8OA 1K3ZA 2BVOB 5J13B 2XIDA 1E4XI 3QBTB 3F8UB 5E6IA 3JVGA 1WBXB 2HRLA 3TN0A 1CXKA 3RVUD 3QRFM 3UTTA 1X5AA 4I0PD 3UTSB 1KGCE 4L8SC 3VWJD 1HSAA 4NRXA 2FDBP 4PJBE 4KU1A 5FIEA 3S3PA 5HYEA 3VFMA 3RIAK 2HKFH 3MV9E 5DURB 4XNQB 1TFHA 4OLYL 5D72L 5C70A 3ARFD 3H7BA 5E00B 1VEMA 4XMKL 3INUL 1P6FA 2PW1A 3HPJA 4ODWA 4OKVB 3ARRA 4Q9QL 2OL3A 5D93B 4EI5C 1UB6A 3IDYC 4WWID 3DGGB 1H5BA 3WCYA 1S9KC 2ENSA 2X4NA 3GKWL 4RWYH 4XMLH 3BKMH 3M17B 4CVZB 3HI6H 5IVXE 2P7TB 4HUWB 4XVTL 5FYJU 1T1YA 5HYJA 4KY1H 1WIPA 2O61B 4KGJA 3GBMH 4OZIF 1P1ZA 4GRLD 2A6KB 5SV3A 3WJJA 3EYVA 3VRJB 1H3PH 6FABL 3TT1L 2RHEA 3T08A 5DO2C 1PQZA 3RWGB 4LSQH 3EOBB 2OSLB 1LK3L 3PQYB 4PTTA 4P2QA 2B0SL 4U1SB 4TQEH 4BH8A 2QR0B 3QDJB 4NUJB 5KVEL 1QSFD 4XP9L 5ITFA 4YUEH 5I74C 4G6KH 4Q2ZA 3MLWH 2VMFA 4GG8A 4XTRD 2YPKA 1CFNB 4MLSA 4Y5XC 1M71B 3LKSB 1FN4A 3HPLA 4UV4H 2VXQH 2YWZA 4YHOH 4NQXA 3TP4A 4FZ8H 3OKDA 4OQTA 4A6YA 2LE9A 2PO6A 3HFMH 4PGEA 2V7HA 1CGUA 2Z31D 4JY6B 1OTUD 3WDIA 2FBOJ 4P57A 3KXFD 5CIPA 1JFQL 2A83B 4R0LB 3U9PH 2VDML 3SGDH 4D9RD 2O5ZH 1SJEA 3RAJL 3NGBB 3BH9A 1VSCA 1CL7L 5E9DB 2MSPA 1NKRA 1YNKH 5DZOA 5F44A 4JRXB 2KUTA 2DWDB 3Q5YA 3W0WE 1KCLA 1P4BL 3G04A 2HRPL 3BQUB 3VW3L 5KS9A 4YHYC 5I6XC 4G6JH 1TNMA 2YD9A 2BJMH 4TTGA 3HZMA 4N1HB 2IPTL 1NEZG 3NIGF 1X5GA 4FQJH 4S1RL 3RZCA 2YPLA 4OLXH 3MGOB 3O6ML 3MOAL 2Y6SD 4GMTL 2FJFB 3QI9B 3QFDA 3IFPA 1KENL 2CUHA 4GRLA 4CU6A 4JM2F 1CXLA 4HSQA 3Q3GB 2IQ9L 1K2DB 2VL5B 3VFOA 1F4WL 5DSCB 4FQCH 4YO0B 1DDHA 2BHZA 1D5BA 4BQ8A 1LE5B 5L7XH 3IXAA 2DM2A 1KSRA 4XCEB 1D5XB 2DKMA 3D1MC 5E95B 5B38G 1QSFA 2CDEA 3GHBL 4HK0B 1A7OH 1KFAL 4LHUB 3NVQA 4GXVL 3QEHB 4EN3A 2B7DT 4R97B 3EOAB 4ONHB 4PJGF 2NZIA 5HHPB 1QHPA 4XCCL 2DI7A 4HFUL 1Z3GL 1AY1L 4N90D 3TA3B 3MYZA 1MFBL 1ERNA 1PSKL 4M1CC 5GRUL 3PP3H 2CSPA 1XR9B 3MUGA 4UDUB 4DGIL 4EDWL 3KXFA 4W70A 1AHWC 2P8PB 1T7WA 3CFJA 3IDXL 2Z92A 5E8PA 4DOHE 5H2BA 2D7NA 1L4IA 3ZDXF 4I5BB 4L8DB 1JMZA 3QQ4A 5T1MA 1YPZA 3WIHA 5IGXH 3ULUE 2ICWB 4MJIB 4PJDF 1FP5A 1G7QA 2Q8BL 4F33A 1AGEA 1BVLB 1R5VA 2X70A 3CVHA 5BJTA 1IBGH 1BM3H 2CDGA 1IGIH 1MH5B 3MRPB 3HZYA 2W60B 2IALB 1JRHH 5EORH 5CJXA 3H9HA 1YEKH 1CICD 4KK8C 2CLVB 3O8XA 1XGPA 5EO9A 5CHNA 4UQ3A 4NYLB 4LVOB 1IKFL 4B50A 1H0DA 4YHML 1MPAL 4HXAH 4LLUA 1AD0B 1B4RA 4BZ1H 5FHBL 1YQ2A 1U8JB 4K55A 2IPUG 4H0GA 4LPCA 5LBSH 4XVUD 3VXME 4HH8A 1UADC 4OAWA 1DE4B 3KPSA 5A2KH 4Z7QF 1XCTB 3TT3L 5KSUB 3WS3B 1QLEL 2W65B 1U8OB 2YKLH 4UV7H 4JCLA 4EZMA 4Z7WB 3U7YL 4F9LA 4JJ5B 3S4SG 1VPOL 3C5SA 2PW2A 1JTTA 3BAEH 3RHWF 1GC1C 2HT3D 4X7DC 3CMGA 5SX5H 4RIRB 3BZEB 3GSUB 4JFFE 4WFED 3KNBA 4PPTA 4OI8A 4X6CE 2VQ1A 2ADJB 3QUKA 1MFAH 2BY3A 3UBXA 1IGML 4PRHD 3HG1E 3SQBA 2H6PA 5DHVA 1ZLSH 5ISZB 4PJBB 5ADPL 1FNAA 4NCDA 2JB6B 4H8WL 3G5XB 3MV9B 3WEXB 3HNSL 1A9EB 2B1HL 1S7VB 2XXCB 5E8DL 5HVHC 1Y18B 5IT2H 3GJFB 1QNZL 1RK1B 3NCJH 4FFWD 3BZ4B 5J11C 4NNYB 3FQWA 2Q8AH 3EO9L 5IVXB 1YY9D 3MUHL 1YMHB 1MCWM 2DI9A 4WO4B 1HILA 1KXVC 3W9DA 3FOMB 5F7DB 5IQ9B 3CVHH 4KKAC 5AG8A 5I30L 5C0BE 5IB2A 4R96B 4FFZH 3ZMRA 4M6ML 3C08L 1GGUA 4LVNB 3VWKB 2DIAA 3WHXB 1UWGH 5T3XD 1K4CB 4ELMF 5J0BA 3RL1A 4Y0GA 5D70H 1IC7L 2YD1A 3LMJL 1ITCA 4WTZG 1NGQL 4HC1L 1TLKA 3TPKA 1JPTL 1RJZA 5EU7C 2FEEI 2UY7A 3H0TA 1KTLA 3S6CA 3LIZH 1WBYB 3DO3A 1I9RL 5IBTL 2GTZB 5K9QI 1GH7A 5T1LD 3UO1H 4XP5H 4JPWL 2EXWD 1A7QH 3P3YA 3QDMB 4LAQH 4Y4HA 5L88H 5JHDA 2LQRA 3NFPA 2AXHA 2ZKHH 4GXUM 4V1DD 2WINB 3HRZA 1R3HB 4XXCA 1X5XA 4X7CC 3PGCB 1QBBA 3IJSB 3TBTA 2OXHA 5INCA 4PS4H 2YC1B 3HKFA 3ARVA 1ZGLB 1NFDE 1NCAL 3DUHA 3JWOL 4S11A 4DEPC 4EIZC 2FZ3B 3V95A 4GKZA 3BPLC 4GKNB 3PWLB 2P49B 1NEZB 4Y5VA 1U42A 3P0GB 3CSYB 5CMAA 3MCKA 4QRPA 3MNVB 3I6GB 4RBPK 1EHAA 4JY4A 4MVBC 2B4CC 4Q9BA 3WN5B 4Y8DC 1ZSDA 3HHRB 5CJQH 1CD8A 3VD5A 4DKAA 4Y4KB 1JCKA 1MAKA 3MUJA 5DHYA 2W9EL 1N6QH 5AZ2L 4P23C 5IVZA 3RU8H 2IANE 4U1JB 5D5MF 1NC2A 5F88B 5JXED 2HLAA 1PYWA 3DLQR 3WIIH 5J6HB 3NN8A 1JGVH 1X4ZA 4KQ3L 4LLMA 3B2UC 4JQIH 4OJFL 1NGYB 1UCBL 4U1GC 4EBQH 5B38B 1DEDA 1D5IH 1OLZA 2BDNH 5TF1H 3TJHD 2JB5L 4KROB 4XNYL 3BIKB 5CZXD 2C3VB 2NX5E 5FDYA 1FGNL 5DJCA 3D3VD 1U2HA 4IRZH 4CW1A 4XPHH 1IM9D 3FN3A 1RJLA 5IJKA 4HZLA 1NLDL 2VSDA 3MJ7A 4ZSOA 4HJ0C 2I9LB 5CINL 2J8UE 3IETA 1KIPB 3O11A 2VDNL 1LE9B 1CIDA 2DLFL 3WFBH 2A73B 1HKFA 3DRQA 2ZCKL 1LO3L 1FG2A 4NCC1 1T5WA 1MY7A 4LCIH 4OIBA 3BKCH 3IU4H 1HH9A 4F8QA 4HK3J 1AQDB 1ZK9A 3HZVA 1FPTH 4V1DA 1CZ8L 3F7YB 3HR5B 3JV6A 4PJAE 3P9LA 5ILTH 1JN6B 4FNLL 5BO1H 3MBEA 4JFYA 2EE2A 4DOHB 1QLRB 1FL6A 4OSUL 3NIFE 2GK0B 5F9JA 1IQWH 4WU7A 4U6VH 1HHKA 1BVKA 4HS6A 1CT8B 3BD4A 1S9XB 4MD4A 5GRJH 2VXTH 4JHWH 2X1WL 3QSKB 1UQSB 3VI3F 2UZIH 5HHOE 2JK5A 1KCUH 3RY6A 2GJJA 4YGAB 2FBJL 1Q0XH 2DWEA 5D9SA 1PLGL 3ZLQC 5JPMB 4MX7A 2NLJB 3FRPA 1ADQA 2O5XH 5DT1H 1TENA 4UTBL 3GIZL 2R2HB 1F11B 1U8PA 1LEIA 3LD8B 4X5WA 2FSEB 4NUGL 4Y2DA 2IBZX 4IRSA 1RVFL 4WUUE 1S5HB 2AEIT 4DN4H 3EO1A 4RX4D 3S4SB 1L0XA 2Q3AA 2ITDB 5JOEA 3VXMB 3VFGH 1G9MC 4XP4H 4Y4FB 1YYLL 2YUVA 4X5XB 3HNVH 1Q9LA 5T3XH 4YX2L 5JQ6L 4RFOL 5DO2D 3RTQB 5ICYA 4JFPA 4BQ6A 3AS0A 1FIGL 1MLBB 1PY9A 3VXOA 1AR2A 3GSXA 4Q6IB 2FO4A 4L8CA 4BFIB 4OI7A 4Z8FL 4X4XA 1ZEAL 5L9DL 1A02N 4JFFB 4WEBH 1BZQK 2FIKA 1UZ8A 4K7PH 4J23A 3U79A 1II4E 2DRUA 1KUMA 3PE9A 5H94A 3UZVB 3HG1B 3BQUC 1R24B 2V7NB 4OCYL 1BEYH 32C2A 2PTTA 2JJTC 3KYKL 1DUYB 2XZQL 4IBLT 1HH6A 2ARJB 5KVDL 3MA9L 5SWZD 5ELIA 1WC7A 3OJDB 4J8RA 3P4NB 1I9EA 3D69B 3QI9C 3CFEA 4MD5B 1FO0B 5IW6B 4ZMAT 2N7AA 1YMME 3F65A 1RI8A 1WIUA 3O6KH 1F58L 4PLJC 3U46A 2XWTA 4PRNB 3S5LA 4XB7A 1K9TA 2R4SL 4BJLA 2YHGA 5I76B 3DRTB 2IADB 4GAJL 2Z93A 2D0GA 5KN5B 1YECL 1CFQB 3ZYIA 1Y0LA 3ECBA 1QZ1A 3R0NA 4KAQH 2DLHA 3WFZA 4NGHL 2WIIA 4DUVA 3MA7B 4R97C 4L9LA 4F15B 5ACLA 4RX4A 1YUHB 5DMKB 2ADGA 3S97C 4QRSB 1E6OL 3AS3A 5AUMB 5EA0H 2YD7A 4OLWL 5CEZL 5D6CB 5ANMA 1AC6A 2IGFH 3W39A 2D0FA 5EO1A 3RGVA 3RL2B 5KBNC 3HI5H 4NIKB 4JPKH 1S7UB 1X5LA 1F6FB 3STLB 1IL1A 1LILA 4XMPH 3ZL4L 4F37K 1U9KA 1U93B 1DSFH 5ID0A 5J8OA 3JTSA 2L7UA 1N5YH 3O81A 3VMOA 4U2ZA 1NFDB 1WJ3A 5EPMA 3EAKA 3FO1B 3GJEB 2EIDA 4PV9B 1J1OL 3B8SA 4M4RA 4PJHE 2YN3A 3QEGL 1JJUA 2HFTA 4R6UA 1UM5H 4KVNL 5HPMA 1QTYT 1NKOA 4KKNA 3IJHB 1H3VA 1FNSH 1KB5A 1UWEH 4M1CD 3GMLA 3CU7A 1ZVSB 3DXAA 4N5UA 4NKOA 1U92A 2WBKA 5I16A 4GBXB 1GOHA 5TDNB 4CVXB 5AZEL 1OSPH 1R5IA 2EH7H 1GZQB 1IQDB 4JM4L 4YZFE 1AQKL 2IANB 4H1LG 4B7IA 4I2XE 1MJ7L 2VOTA 5JXAH 5CILL 5I75B 2XKUA 1INDL 4NHCH 5F89B 2ZOLB 1BQUA 4TUJA 1A7BA 1JZ3A 1T1WA 3NZHL 4OFPA 2VE6A 2DQFA 3DMMB 1AGBA 5E5RB 4YHKH 5EBGA 1A3QA 4UIMA 5JLZB 5DMYA 2NX5B 3FN0L 4HKZB 1RHHA 4GOSA 5EO0B 5HGHA 3C60B 3D25B 4NWTH 5CD5D 4F7MB 3EYFA 4KK8D 5M94B 5ACMA 3FQRA 3H9SD 3O6LH 2R23B 3QEQD 4F9PC 4HLJA 4HPYL 3AROA 4XXDB 4OIIL 1S7SB 3BMWA 4KKLC 4QO1A 4MA1B 1OSZA 2D3VA 3U4BL 3LEYH 1BHGA 4IOSD 3OKMA 3QHZL 3DX8A 2WLYA 1T0MA 2BC4A 1IZKA 3ALWA 1AJ7H 5AYUL 1I1CA 1XAUA 2LFGA 3BT2H 3PWUB 2JIXA 3PABB 4RFNC 2AKRB 4PJAB 4KJQD 4A2LA 3MYJA 3QULB 5JW5B 4UINL 1DBKH 1NMBH 1QSEA 1YPZF 3BVNA 5FHAH 2AXGA 4YHIB 5SV4A 1HINH 5LAXB 1UVQB 4POYA 2BVYA 2NY7L 3UTZA 1YQVL 4FHBD 5HHQB 3I3DA 4HXBL 3D2UA 4J3VA 1ZA6B 2JJVA 2XTJD 3UCRA 3X14B 1AGCA 3QCUL 2F5AL 4G8GE 2OTWA 4JO4L 2Z91B 5TQ0L 1REIA 4UBDC 1Q9WA 3VWKC 4PJ7A 4X5LA 1GJIA 2L0DA 3RJQB 2HLFC 4KDTC 2R0ZH 1PG7X 2Y06L 3O45A 4HMEA 4PRBA 4G8FA 4XPGL 1Z5LA 2VZ1A 4K8RC 4L3CB 1ES0B 5D7SL 3RI5K 5DLMH 1D3CA 2UWEA 1CK0H 5I1KH 4O2FB 4I48B 1HHJA 3QCTH 3PL6D 1IVLA 2E8ZA 3PHOB 1YEJH 4HIEA 4MDJA 2FJGB 1D6EB 1KIRB 4P3DA 2NPLX 3IFLH 4Q58C 5F1OB 1G7MB 4KKAD 3RNKB 5GGTH 1QOKA 1NBQA 3IKCB 2YUWA 4JR9H 3U4AA 3V4UL 1MFDH 4OCSL 5LGJB 4HIIA 4UU9A 3UTOA 1A0QL 5EUOF 3T77A 1T1ZB 1RSFA 4QRUA 4OTXH 4P9MH 3BEVB 3SY0A 3UC0H 3CZFA 2FECI 2PR4L 4NQCA 5FGCB 5DUPL 3KYMA 1PZ5A 3CNKA 3MRCB 3O6FA 3OZ9L 3P9MB 3SOBL 3VG9B 3DVGA 5DK2B 3OJVC 1TETH 4PUBL 5F1SA 5IESL 4ZFGL 4H25B 5GJSH 3WN5C 5DWUL 2PXYB 2VLMD 2LU7A 3MRKA 1XF3A 2PYED 3ZYZA 4L1HA 4L5FL 2Y7QA 3C6SA 5JHLL 1DLFL 3MRGA 4U6HA 2D7OA 4NKDB 1EERB 1JUFB 4KZDH 4EOWL 1G7JA 1U8KB 1RFDL 4M3JA 5KSBF 3LKNB 3L6FA 4O4YH 3O41B 3QCVH 1N5AA 1ONQA 4OFVA 1Q9KA 3O4LA 2H9GA 1J1PL 5ACZA 1YMMB 3O2VH 4XBGB 4KROC 4CN4A 5K9JL 2YWYA 3ROLB 5T1DL 4OCXH 3K1DA 3O9WB 4MVBD 2BNRE 3DGCR 1DQQB 5DXWA 1OY3B 4LK4A 2OZ4A 1HOCA 2OJEA 4GG6E 4NO3A 5TQ2H 3P11L 2CR3A 1DQML 5BRZE 4P23D 2P24B 3DUSB 3R06B 4G80A 3VFTB 3QPQD 4HH9A 3PL6A 3HUJB 4LVEA 3EDEA 4QHUA 5F70A 5JW3H 1RUAH 3VRIB 5DUBA 2MQCA 2VO5A 1M7IB 4GAYB 5T5FL 2HYMA 3QYCA 4NC2B 1NGPL 5BXFB 5F97E 1T89C 3VXNA 3U7AA 1U95A 5EZJB 2ATPA 1DTUA 5HGGS 3BP4B 4M6NH 4AH2B 2ZUUA 1H3XA 2DQGL 1L7TL 5GRVK 2VLRA 3GHEL 2DS4A 5D1ZA 1JGDB 1MI5E 2E9IA 2LABA 1FVDB 4UTAH 3ULUC 3S8WA 3RHWK 2ENYA 4MA7L 3EDJA 3OSKA 4JPVL 3U0TB 5GS0D 2XACC 5B8CA 4PJHB 4U3HA 4X99B 1OCWL 4JDTL 1JYXA 4H1LB 5DQJB 2X89A 2VISA 3MXVL 5LCVL 2DQHH 2R0LH 4OZFG 1RJYA 2PCPA 4KTDH 5FM5O 2J5LC 3NACH 3GNML 3H8NA 3BKJH 5DRNB 5DDHA 3L95B 1OB1A 4YWGH 3QUMA 1ZLWH 4CU7A 1IARB 1GC1H 2IH3B 1KBGH 1YDPA 2VWEC 3KPMB 4I2XB 1ZHBB 4G7YH 3SCMA 1DVFB 5LG1A 3MREB 3TIDA 1D6VH 3V4PH 5FYKE 3SKJL 1D5ZB 1M05B 1VGEH 3MOQA 2XRAL 2IQAA 1X4XA 3PWNA 4JB9H 5FGRA 4QHMA 1I8IB 4OLVL 3RTQC 3L5WA 1BPVA 5FB8B 2DQIH 3PQYD 2VABB 4PP2A 1UEMA 3PF2A 4OLUL 4FQ2H 4Q6IC 3QDJD 4UDTA 3MGTB 3PNWB 4HIXL 3PUCA 4M03A 3T1FB 1A6TB 1J87A 2H32B 1IC4H 4JFDA 5BZDA 3UMTA 2AI0L 4LARH 3U0PB 3NH7H 3QIBC 2Z9TA 1QFUL 1I1FB 3LKPA 1AO7E 2JELH 1CLYL 3VJ6A 2VKWA 1U41A 1T04B 2X1OA 1BLNA 3GSOA 3H6JA 2AEPL 2GITB 1UFUA 3C5ZA 3F5WB 4CVUA 4X80H 2APTA 5IKCA 1DBMH 2R4RL 3OB8A 1T2JA 2E6PA 3V5KB 1NFIB 3MBXL 4LNVA 4J6RL 2CQVA 1WBXA 4CADB 3NIGE 5E9DD 5EBLB 4P46A 1W0WA 4L4TA 4N9OB 4JRXD 3KR3L 4XPAL 4KQ4H 3UTSA 1JHLH 4JZJC 4HWBL 5I0DA 4G8GB 5C71A 1KTKE 2OBGA 3MLRL 3UJIH 3BQUD 4XNQA 3BZFA 2X4RB 5JNYA 4OGAD 3VFWA 1FIEA 5C0CE 3T4YB 5KAQF 2ICEB 3QWOB 2N1KA 2VERN 4OUUB 1RZKH 3D0LB 2X1PA 1QRNE 3CK0H 4XVJH 1A2YB 1LVEA 3VMPA 4F15C 2Z4QA 3M17A 3L3JB 3WFCH 4HUWA 3UBXI 3EFDL 4XP1L 3FAWA 3QI9D 2O61A 2DBJA 4JDVB 2WBWB 1KLUB 3BGAA 2OJZH 4PJGE 2X9YA 4FQXA 3ARPA 1KPRB 4OFDA 1U3HC 4PLJD 2B4CH 3QDHA 3EOBA 4LKXA 4XC1L 4IRJC 2MCG1 3ZE1E 2QKIB 3A67L 5DJXB 4ELKB 3QDJA 3MJGX 1BOGB 1JNHA 4MCYA 4NUJA 1OF2A 3LEXA 3NCFB 4MCZB 5C2BH 4QRRB 3ULVE 3MLUH 1CFNA 3VGGA 2R0WL 5T1KD 1QKZH 1M71A 3SDAB 3LKSA 4WJ5B 5EH1A 5C08A 3RPKA 3P0YH 3QPXL 4GW4A 3TA3D 1U36A 1I1AB 4ZNEE 1TTGA 4YC2B 3TO4C 1Q72H 1TVHB 1KJ2H 4NRZA 4JY6A 4JY5L 4LSSL 4QGTA 1W2KT 5D2NE 1JGLL 1Q0YH 5I19H 2A83A 4R0LA 3FQNB 5DC9B 2XA8L 3HS0A 4JE4B 4LCCA 3GSWA 1G9EA 4DUWA 1A1NB 1FAKT 5BVJB 5SWQB 5J3HC 3NAAL 1HZHL 5I75C 4BSVB 2CO7B 4MJID 5GS0H 3ZKNC 1F2QA 2DWDA 4PG2A 4XI5C 1MJ8H 2VYRE 4GRWE 4LCYA 3VXSE 4JDZB 1EK3A 4M93C 1TJHL 3X3GH 2BNRB 3GSNL 2AXJA 3BFOA 4Z7QE 4DVRH 5CJBA 2MKLC 3VFNA 1QBLH 1UM6H 1XCQA 5H37H 2P8MB 4U2YA 4GG6B 4J1UB 3LSOA 4PJFE 3MGOA 3OKEB 5DVMA 2UY6A 1LDPH 2GCYB 2DJ4A 3BH8B 2HTLC 2LAAA 3ARGB 1KELH 4HPOH 5C8JB 1WK0A 1BFVL 5GS3A 2XYCA 2VL5A 5DSCA 4J3OC 4YO0A 4CKVX 5DC4B 3WD5L 2A6JB 1UT9A 5I17A 2IWGA 2HVKA 2BRRL 3CLEH 1D5XA 3OB0K 4WUKH 3TYFB 3RY4A 1JNNH 4NN7B 4XBEH 4HJGB 4HK0A 3BGFB 4LHUA 4DK6A 3LDBC 4OZFB 2EC9T 2XG5A 3QEHA 3EOAA 5JOPE 5HHPA 1MI5B 3LCYA 5HY9B 1C5DA 4KKLD 2BVTA 3C2AH 3LZFH 4LIQL 1P5VA 4Y8AA 2E27L 1F97A 1JF1B 4WW2F 1AD9B 2VZSA 3PP4H 5IB4B 4XPTL 5FV1L 3VE0B 1IILE 1VKXB 4ZUVB 2AJZA 2ZNXA 1G9MH 3BDYL 1XR9A 1EEUA 4OZIB 3QJHB 1P9MA 3IFOB 3IDIB 3KS0J 4WFHE 3MV9D 1MFCH 4NSKB 3BISA 5FKAB 1EHLL 2P8LB 2HJKB 1FNEB 1PKQE 3ALXA 1AKJB 1Q9OB 4ELME 4HULB 4I5BA 3BKYL 1ZLVK 4OFIA 4LSVL 4O00A 1X5YA 4KJYB 1NL0L 2A0LC 2J4WH 3X13B 4WRLA 5FYJH 3BPOB 2IG2H 4WO4D 2QLVB 1VA9A 4YK4B 3Q48A 1YEDB 2HG5A 1MCFA 2VDOH 5F1IB 3LRHA 3GSNB 2IALA 4NZTH 2DIJA 3LN9A 2X42A 4XMKH 4UBDD 3VWKD 1B0RA 4KRNA 4NYLA 3VXUD 5JORA 3O2WH 2HLFD 5DK3A 5FGSA 2A6DB 3GKWH 1AD0A 4I13B 4YPGB 1SY6H 2JCCF 3WHE1 4QRTB 5IFHL 3REVB 4K8RD 4XWGH 2XNAB 1MCNA 4OT1H 4G43A 4HF5L 2I24N 5I1JL 1XCTA 4FXKB 2XY2A 5KSUA 3FHAA 4ZUSA 2W65A 1U8OA 1IAKB 4LLVB 2PXYC 4HX1A 4P4RB 1AH1A 4E41A 4P3WA 4IOIB 5FDWB 5KW9L 4JJ5A 4HFWB 3MACH 1DANU 4ERSH 2AGJL 1NCWH 4RIRA 2X4TB 3GSUA 1DJSA 5EZIH 1H8OA 4KJPC 2X4OB 4C58B 3Q0HA 4MJ5B 4PRDB 1EX0A 5F96H 5ISZA 2W1NA 2BERA 3UJTL 3W0WD 3RJDA 3SO3B 4JM2B 3AREB 2JB6A 4EQ2A 5E08L 2VAAA 2VDMH 3HB3D 4PJXF 3STBA 3WEXA 1X5ZA 5EN2B 4R8WL 1PX4A 3E3QE 1B9ZA 4Y4KD 5IEKB 3OXRB 2UWEF 5C0CB 2LV4A 1RK1A 5DMJB 3BZ4A 4LEXL 1QRNB 1CU4H 4NNYA 5CUSL 5IVXA 5GRVL 3RWCB 2APXA 5DMIL 4WO4A 5J1AB 3JWNC 1I7RB 3FOMA 5F7DA 2ITCB 3KPRE 1MCWW 4R96A 5FXCH 4KROD 4PJGB 5GSRA 4ZYKB 1KCVH 3JZ7A 3QZWA 3HMXH 1NCBL 4X6EB 2GSIB 5DJ0A 2GSGB 4S1RH 3TNMB 5FUZH 5IB1B 3O6MH 1KCRL 3NCBB 1F90L 3SGKA 1X5FA 3L7EB 1KENH 4IJ3B 2A9NL 2NY5C 1RJCA 1WBYA 1I7ZB 2B1AH 3LH2L 3V6OE 4HCRH 3SE4A 2HT4C 2I27N 2GTZA 4RISL 1KPUB 1ZTXL 3WS6C 3MJ9L 4M7LH 5HGDB 1L7IL 5F7UA 3SKOA 4PJDB 3QDMA 4LLYB 1WWBX 1S7RA 3VI3E 1FFPB 2EDBA 5BMFH 5ECJE 2WINA 1R3HA 5D2NB 3PGCA 1OL0A 1MQKH 3IJSA 3FN9A 3UAJD 5J1TC 2V5YA 2YC1A 4JFXB 4QCIA 1JZ5A 1XGTA 3QNYB 4HW6A 4GKNA 3PWLA 3U83A 2VDKL 3CAFA 2D03H 2OP4L 3ULUD 1MFBH 4FQ1L 4KK6C 4XVSH 5E56A 3MNVA 3I6GA 4EDWH 4GRWB 1WQVT 2C4XA 2BXZA 1RK0A 3C8KA 2DLGA 4K9EC 3S34H 3TESA 4Y4KA 4CN1A 4X4ME 3DSFL 4M48L 1RU9L 2LU4A 4XB8A 2JJSC 4U1JA 4YNYA 5F88A 3GJFH 4PJFB 1F3JB 3WNLA 5J6HA 3LRSB 4CJ1A 1S5IL 3V52H 4PB9L 3UP1A 4KRPB 4LF3A 1BBDH 5B38A 3BX7C 1MCIA 5DUML 3UTTE 4CMMB 4R90L 2Q7YB 1EIBA 1HHIB 5C0IB 3VXMD 2H2SC 4YAQB 4DAGL 3KHOA 3PGFH 2QSCH 4H0HB 4Y4FD 1UH3A 4HAFA 4HC1A 3T2QA 1MPAH 1DQDL 3MFGB 2HKHL 2J88H 4Y16B 3RTQD 3O0RL 1N7MH 1IKNA 2GFBB 3IF1B 4S2SA 1JF6A 5FHBH 1U8IB 1AIFA 2W91A 1NDMA 4K8RH 1EA9C 2VNCA 3L1OH 1INQB 3LRGA 3RDTC 1LE9A 4JFFD 2BHYA 2A73A 3D85B 4HWEL