3HMWH

Crystal structure of ustekinumab fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAYLQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords USTEKINUMAB FAB LIGHT CHAIN
publication title Structural basis for the dual recognition of IL-12 and IL-23 by ustekinumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2009-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hmwH01
5E6IB 1QNZL 4JO2L 3LKRB 1BAFL 5DJXA 4GG8A 3BP5B 3NCMA 2G75A 1CK0L 1F5WA 1AXSB 3UPAA 2FBJH 4YBLB 4G43B 2R4SL 4M02A 3I75B 5DVOA 1GGBH 1GC1H 4NNYB 3SE8L 4YHIB 1INEL 2CR6A 2DMKA 5SWSA 1PYWB 3UYRH 1E27B 4QKXB 1CFTB 2VC2H 1BOGB 4YWGH 1YN7B 3O9WD 3G6JF 3DURA 3GSVA 3SKJH 1HQ4B 1ORSA 4FFYH 3FT4B 4M6OL 1BBJB 3MA7A 3AB0C 2EYRA 1JPSH 4HWBL 3GSWA 3MRCB 1MNUH 2H2PD 4AEHL 3RQ3A 1A0QL 2G5BB 3W82A 1NGXA 2VITB 1UB6A 2RCSL 2R9HD 4PJ5B 5GSVB 2ZOLB 3MBED 3QO0B 2LU4A 1MQKL 3TZVD 4CVXB 4OI9A 4ETQA 3HN3A 3LZFH 3EOAB 1EXUB 3W2DH 1I1AA 1CGSL 5I1DB 1S7XB 4G9FE 1DVFA 1RU9H 2Y23A 2P24B 5DSCA 4OIIH 4J6RL 5HHME 4PY7A 3P0VH 4QYOB 4K3JL 4U6YA 3BYTA 5GGRY 2EH7H 2YPKA 1JZ2A 4RAVB 4UT6L 1ZHBB 1HINL 2V2XA 2I5YH 4K3EL 3L6FB 3K81A 4EJ1C 2H32B 4ZFFA 1M7IB 5ITFA 2NNAB 5H35B 5EBLB 3INUL 3SBWC 1BJMA 2IC2A 3LN4B 3T3PF 4UNUA 3ZE2E 1OOAA 3H8NA 3P0YH 4UZGA 2C7UA 2F53E 3UTOA 4WENB 1PG7H 3MFGB 2A9MH 2SEBB 3OG4B 1LMKA 5MEND 3DVNB 3VXMA 2GFBA 4XCNB 1RAMA 4DQOH 2XICA 4Y5XB 2ZNXA 5J6HB 3G6AB 2OJZH 5I19L 1BVKB 1N0LA 4MXQC 3V7MA 1BEYH 4C58B 4GG6E 3W11C 1H0DB 3VDCA 3KPOA 1IAIM 2FWOA 2VLLA 3DHJA 3DROA 1LEIB 1XFPA 4ONGH 3QCVL 1MI5B 4YIQA 1YEJL 1CL7H 3MZTA 3RIFF 4FFWC 3LPWA 3LOWA 3C6SA 4PLKD 1SVCP 4ZFGH 3FO0L 4JJ5A 1X5JA 2BOBB 4BSWB 1E4WL 2Y07L 4LHUD 1UWXK 3S88L 5E8EB 1NAML 4PJEA 4CNIA 5JHDD 5DHVB 3L5WB 3B5GA 5KVEH 5C9JB 3T04D 3MGOA 1LP9F 3C08L 1CIUA 3WO4B 3NOIA 3MLZH 1X7QA 3DO3A 1LD9A 3OKLB 4KHXL 4J12A 3FRPG 3NIDF 4ODVH 3PHOA 5F6HI 3IVKA 4UTAH 3MRDA 2VABA 2XZZA 3KPLA 3C2AH 4WI8A 2M26A 4GBXD 1J8HD 1VADB 4RMVA 2DICA 3FOMB 3H0TA 5LXGL 4I9WE 1FNEB 3NIFF 1UXSB 4ODXB 1S7SA 1JZ5A 2QQNH 4I4WB 5FK9A 2NTFB 3SDCB 1NCWH 2VB5A 3PABA 2ICEA 3FMGL 3Q6FB 5IV2A 5EC2B 1E6OH 2YZ1A 3QSKB 3J8F7 3MA9H 4N8PA 4OM0L 1MHHB 1JWSB 2BOCA 1D5MA 3VFWB 3D0LB 2UUDK 4JHAH 4PUBL 4M1GH 4MWFB 4ENEC 1BWWA 1A1NB 4AL8H 5IMMA 3ZTJH 3KPNB 3GSNA 2C3HA 4BFGA 4N8VG 4LPXA 4AQOA 1JTPA 4Y19B 4NP4H 1OTUD 1DBKL 4MNGA 5FA4B 3VXNA 2CLZA 5IHUL 4L4TD 4UIMA 1NUFA 1B0WA 5B3NA 5C0EA 1XGTB 5J1TC 3SO5A 1KCUH 3AFLA 3SOBL 4Q58C 3F6LA 4PRBA 5D7SH 1F11A 4M7ZC 4Z7WB 5I66A 3SGKA 3WE6A 1QFWL 2XZQH 3HNVH 3STLB 5C08B 1P53A 5CIPB 3M17A 3GJFA 3MLTA 4XBGA 2XRAH 5JMRA 3WJJC 3A6CL 1AGEB 1EJOL 1WT5A 1EO5A 3S35L 1A14L 4MJIB 3OJDB 2VLKA 4GO6B 3GIZH 4S1QL 2A1WL 3EW3B 4GXVH 5B8CC 1ORQB 1M1SA 3QIWC 5JLZB 2C3WA 4JB9H 5DD6A 2J4WL 4KK8C 1B2WL 1A6TA 4K7FA 3F5WB 1U58A 2Y72A 3SCMA 1DLFL 4EKXA 1L9MA 4NNPH 3OKNB 2V2WB 4EN3C 1KN2L 5IW6A 3PDOA 3NZHH 4DKFH 4M6NH 3MNWA 4KTDL 4HPYL 1NFKA 1KJ2A 1EFQA 1AGCB 3TIDB 2R69L 2VDRH 3MRPB 4BZ2H 4BQBA 4GW1B 5FOBA 4P2OA 1QPXA 3ARYA 3BISA 4M9OA 1PY9A 3MMEB 3TBSB 1AD9A 1BZ7B 4YHMH 3P3YA 4LF3B 2J6EA 5KTEH 3GRWA 5TE6L 1JK8A 4XWOC 3HE7D 5IB4B 5I1HH 4YPGB 2A6DA 4PTTB 2AXJA 4LCCC 5DUMH 3CVHA 4ZTOL 4W68A 4WVRA 5HYSB 3MXWH 3KVQA 3QEGH 1QD0A 4TSBL 3S4SB 5F7YC 1AXTL 4HUVB 1YA5A 5INCA 1JGUH 3QZWG 4W4OA 5ANME 4XTRD 3TA3A 3P11H 1WC7B 2HT2D 4OLZH 2VXUH 5EU4A 1UACH 3VH8B 3S37H 3QRFM 2XFXA 2VLRA 4KJWD 1XR8A 1JGDA 3KJ4C 2NY7L 3VFVB 5D7LD 1GPOL 4MD0A 2V6HA 1AFVH 1K85A 4LLWA 3NN8A 4MD4B 2EDFA 2CGRL 5EZLB 1MFNA 4G9FB 2W60A 2XOTA 3HMXL 4H88L 3RZCA 4RFOL 5EOCJ 3UTQA 2YD9A 5DJDB 5HHMB 5DEFA 1ZT4A 3R8QA 5C0RH 3IU3B 5CMAA 4TPRH 3P9LA 3H9SA 1RZGA 3RTQC 12E8L 5E8NA 3P40A 4YFLF 5C0FB 5HI5D 1TQCB 1FJ1A 4YDLC 1G6RB 2R1WA 4N5EC 4R97C 1JGEB 1MRFL 4GKSA 1PX4A 1P7QD 3SE9H 1J18A 2K1MA 1EAPB 2YBRA 2ESVD 4E0RB 2EE2A 2GEEA 3ARED 5GS1A 5CKGA 2IFFL 3HTLX 4D9LH 3VXRD 3HB3D 4YDVA 3X3GL 4K71B 1FZJA 4P3WA 3KXFD 2P8MB 4G9DA 3U7WH 1CXKA 1TFHA 1RZ8B 4LPVA 5HYEA 5K59F 2AERT 2H26A 1P4LA 3FCTA 5HHOA 2YD3A 3DX9A 4IOFC 2IPUK 32C2B 4P23A 3RJQB 3QUMH 4GG6B 4MMXC 1AXIB 3PWNA 1RMFH 2IAMA 3V7AG 4V1DD 5D7KD 4U1GC 1XF5A 1BP3B 4PJIF 4DUWA 4D0CA 5D1XB 2YA1A 1H5BA 1GJIA 2J88H 1KG0B 2H41A 1QBLL 3O9WB 4HLZH 4YUEH 5I8KL 3VGDA 5EA0H 1AR1D 3QH3A 1S9WA 4NKOB 1NLBL 1A5FH 1F8TH 3AU1A 2GT9A 4OFDA 1X5YA 2H1PH 1FLTX 4XAWH 3E3QE 5D7LE 3VFNB 4PREA 1MJ8H 3B8YA 3HRZB 3MBEB 3OKDA 4TTDC 4N0UA 3TZVB 1RUPL 5KZCD 1RZJL 4OGXL 1EVUA 2GK0B 3UMTA 3NCEB 4G6AC 2R0ZH 2V17L 1Z9SA 3VRLE 4IRZH 1QR4A 2FL5A 4Y0GA 4ONFH 5DMJB 3X17A 3V6OA 3QG7H 4EI5D 4UV7H 1R3KA 4FRWA 4W70A 2AK1H 2JCCF 3U1SL 2CQVA 1I1CA 4Q74A 3CD4A 2R1YA 3NCJL 5T1LD 4O9HH 3WS6C 3OKKB 1JUFA 3HE6C 4M62H 2HJKB 2Q6WA 1PEWA 1KTDA 2RHEA 1AIFB 3ZO0A 3SE3A 1Q0XL 4NCDA 3PP3H 3PP4L 4EQ3A 1RPQA 2ESVE 1EBAA 1OAUL 2ATPB 5IEHB 4XNQA 3HG1A 3O8XD 3H9SE 5FUOL 4BH8B 2W59A 5IMKB 3O3UN 3T0VA 4U7MA 4PJBE 4XPGH 4H20L 1FPTL 2BSRA 4K3HA 1DN2A 5BXFB 3VFSB 4P46C 3LPGA 4XMLH 4NHUA 4AENA 1VFOA 4AG4L 4Z7NF 1F00I 1Z3GL 1YJDL 3OKMB 5MENB 1S7TB 2P4AB 5C09D 4XPAH 3QEUB 5DO2C 2XWTA 4K23L 1IBGL 1PKQB 4RGOH 3QRGH 4LKCB 1ADQA 3QFDA 2GITA 5DD0H 3RUGA 5EUOF 1ZSDB 3V5HB 3P77A 4U1JB 1YPZA 3OB0K 1EA9C 2NY3D 4Z7UB 3WHXA 1LWRA 3UJJL 4PRHD 1DQLH 4LHUB 5GJTH 4J2XA 3O11A 1NAMB 2WK2A 1MFEH 5H94A 4X6BA 4RZCA 1A4JB 2XV6B 3EYVB 1CVRA 4G42B 1F90L 3ZL4L 2R0WL 5GGUA 4QRQB 4IDJL 1S7UB 4XNUL 4OF6A 5J89A 1AJ7H 1GH7A 4WUUA 5GGVY 5I6XC 8CGTA 1VGKA 3F7PC 1QO3B 4ELMF 1FSKB 2ED9A 5SWZA 2WBJD 5C0GA 3QUZC 2FSEA 3HAEB 4JM4H 3NCYS 1GGYA 4OZFH 2W0LA 3U0WL 5J0BA 1A7OH 5CJOH 3RVXD 5BV7L 4GBXB 2E7HA 1J8HB 2V7HB 1HDMB 4WI7A 2EECA 5DVNA 1YEFL 3BGFB 4KVCH 4M48L 2DIJA 2BVPB 1RI8A 1AO7A 4YFDB 2ZP0T 4JRYE 2UZXB 4ZO8A 1IGYB 2AJUL 4ZO9A 3GO1H 1MF2L 1CVSC 1GZQA 5IBUG 1ONQA 2G60L 1AD0B 4D0BB 4CMHC 2FJHB 1J1XL 5I1EL 2CLVA 1T0NA 4DGYL 3G08B 4HWZA 3KPQA 3MRNA 4N1EA 5E8PB 5GGQH 1MCCA 3O3DB 1OQOA 4J8RB 3TBYB 4GAGH 2Q20A 4LCUB 4YR6B 1AGFA 5I8EA 3VXUE 1Y18A 2DQCL 2OTWA 4X99A 1KIUA 5ALCH 1Z2KA 2YSSB 2A6KA 3Q6GH 3MV9E 5C09E 4X5WA 2P5WD 1I1AC 4KTEL 5C2BL 1D9KA 4O5LH 1CF8L 5FFLA 2C26A 3V52L 5GS0H 3M45A 5CJ8A 4LAQL 4J3OC 4HPOL 5ILTH 1TMCB 5T5FL 4EOWH 4R0LA 1BFSA 2FECL 4R4FH 2DWDB 4F7TB 4IIQA 4MXVF 5H2BA 1ND0B 4H1LH 5BO1H 1S9VB 4K07A 4QGTA 1EO8L 2R2HA 3QEHA 3TO2A 4PRHE 3HI1A 3LHPL 1IGTB 1CT8A 3IDNA 5TF1H 4C56E 2ENYA 5IR1A 1T2XA 3SO3C 3U0TB 4NPYA 4LEXH 3WIIL 1AQKL 1K4CA 2NX5E 2RFXB 1Q1JH 4I0CC 2XQYK 3OJMB 3OKYA 4JHWL 5IM7A 3AM8A 4Q97A 4U1IA 3NACH 4XMKL 2AI0H 1ZT1A 1ZA3A 3ES6A 3FO2B 4UTBL 4O51B 1HQRB 1JZ3A 1ED3B 3VE0A 4WW2B 3LKRA 1DL7H 4BM7A 2X6MA 2AAVA 1WTGT 5GGTA 3HLAA 1FFPB 1KENL 1CFNB 2MJWA 4PR5A 3QHZH 3VGFA 5IB1B 1ZLSL 4HIEB 2I60L 5B38B 3G5VB 4NNYA 4D0DB 1BFVL 4FABL 4X7FC 3BGAA 5J57B 4YJZL 2FZ3A 1PYWA 5AG8A 1E27A 1OAXL 1CFTA 1RZFL 5DFVD 4ZFOL 5E8DL 1YN7A 3HE7B 1SEBA 3FT4A 4PRIA 4M7KL 2Y6SC 5E5MA 1DDHA 3FFCD 4KRLB 1BBJA 1K4DB 4M03A 4MLIA 2DTMH 2F58L 3O3BA 3HNSH 3OQ3B 4EBQL 3MRCA 4WEUD 4KK5D 3C5ZC 3RVUD 1SJVA 4U2ZA 2G5BA 2VITA 4LK4A 3VGHA 3HMWH 1YQ2A 3IDIB 1U8QA 5D7IE 2P5WE 2QL1A 3QO0A 3PV7A 4CVXA 1RK1B 3GIVA 1NGWA 1UVQA 1I1RA 1S7XA 5T3XH 1FL6A 1BQSA 1JFQH 1WBYB 1IC7H 5JXEC 3CFEA 4EIGB 1JYVA 5D7LB 4ZPVB 3OXRA 4DZBB 1WAAE 4GW4B 4QYOA 1L6XA 4HCRL 4S1SL 1JJUA 2A73B 3CZFB 3BP6B 4RMRA 4XXDA 2CK0L 4KU1A 4I2XA 2WW8A 5DJYB 2B1AH 4NM8H 4XPTH 3TVMC 2H32A 1LO5A 3RU8L 4TUOB 3JWDH 3U4EA 5T1KB 1V3LA 1QRND 5K9JH 5H35A 4XHJD 5EBLA 4JVUA 4OLYL 5I1IH 4PGEB 4YBQC 1LE5B 3T2QA 5TE7L 2VN4A 1QVOA 1WBZB 4KY1H 2W0KA 1P7QB 1WZ1H 2SEBA 4JFFD 4NCC1 3QQ9C 2ESVB 2NY5C 3NA9H 5I2IA 4LNVA 3VFRB 1T0MB 1O7VA 1KNOB 2ICWJ 1UEYA 3AREB 2EO1A 2W38A 3L3IB 2VIRB 3SKNB 4Y5XA 3SGKC 5HGAB 4PJBB 1NCDH 2NYYD 3VXRB 2IQAB 1BVKA 3N9GH 4DVRL 2QQLH 3KXFB 5HSFA 4FQIL 4YHZH 1LEIA 2HTKD 4I8DA 3BKML 1MI5A 3TV3L 4RX4A 2NY6C 4OFYA 1BZ9B 2Y5TB 3MODH 5EU5B 5EUKB 5IVXA 2NTSP 4QXWA 3QUYC 2XQBH 2ZWLT 5F7LB 4JKWA 2XNAA 1Y6KR 1KF9B 3MQIA 4LLYB 2W07A 2YPVL 3HRPA 5CFHA 4HDIA 1RIHL 5C9JA 4HUXB 1SHMA 2XN9E 4TYUA 5DQJA 4BK5A 3UTTE 1R5WB 2BY1A 1OAYH 5E99L 3TH4T 3CU7A 3U48A 3THMH 4OKVA 5ECJE 3OKLA 4MJ6A 3BVNA 4APQD 4UUJB 3MUGB 3KLAB 1MAKA 2YPLE 4LOUC 3UCRA 1LEGA 2HLAA 1VFBB 4DAGL 3EGSB 2VAAA 3GMPB 1R3LA 4LLQB 4P2OC 1R0AL 4RISL 3ARFC 2R2BB 4NO2B 3LY6A 2JB6A 2MTPA 3FOMA 4MQTB 5KZCB 1FNEA 1KCVH 4ODXA 4H8WL 3C60C 4RMUA 1CS6A 2NTFA 2X09A 3C9NA 4HAFA 4NO0D 5LGKA 3MBXH 5D2LE 1T7YA 1NCAL 1IRAY 2ZCHL 1AHWA 4ZOAA 5C07A 1J1PL 3QPQC 3ZDXF 4FZEH 1JWSA 5DJCA 3GK8H 4JFDE 1YEGL 1BF8A 5T1LB 2ZNWA 4P4KD 5E2WL 1Q94A 4KI5E 5DURD 5J11C 4URTB 5ACMA 4NC1C 3KDMA 1WZKA 1UXWA 2WWMD 5FHBL 4UILL 5ICYA 3R06A 4W4OC 4PRAB 4AH2A 3O8XB 3RL2A 2ENSA 1NCBL 3KYOA 3WNKA 5E94B 2QADD 3MUHL 3QI9D 4X6DE 4ZUSB 1NL0H 5C0CE 2VZUA 4HWNA 1S3KH 4Z7WA 3QIBA 2WQRA 1TVBB 2DDQL 3MRRB 3STLA 5C08A 4PD4J 3VXUB 1F6FB 3BZEB 4P9HH 2AJYH 1I9IL 1NDMA 3OV6A 3EOTL 5HTSA 5C09B 1G9EA 1U8PA 3C6LA 5F9OH 4MJIA 1RIUL 3ZKSD 4DK3A 5F89B 1UH4A 3GJFK 4HJ0D 4MX7B 3WXVL 2A0LC 5CEZE 3I50H 3VFUA 1RK0A 4OD3L 3F5WA 5EO0A 2ID5A 2ED7A 1MCHA 1CU4L 4PJAF 4Y4KA 5FOJA 5FUCE 1BQHB 3X11A 4PRHB 3A67L 4GRWF 4M8QB 5IMOB 5J56B 4GJTB 2V2WA 4C56B 4HLJA 2O5YH 2XWBB 4WTZA 1QP1A 2MOVA 1JHLH 4K3GA 4OQTA 2P1YA 3MRKB 2X4RB 4J3SA 3TIDA 1JF1A 3D39E 3MRPA 2C3GA 3PWPD 1OTSD 4CVZB 4WWID 1R3HA 3FTGA 5HHVH 4OZGF 3O4OB 4OJFL 2WBJB 2HVJB 3EYOA 3WLWC 4KVNH 1QSFD 5EU3B 1RIVH 1ITBB 2GSIB 3RAJL 5I15L 4NQUA 1BZ7A 1F3JA 1HOCB 3P73A 5FB8B 4OLVL 2X4OA 3SDXA 3DX7B 1QEWB 2WAHA 4Z7OF 4KKBD 1TZGH 2DLEA 3MCKA 5FECA 3NFNB 5CJXC 1RUPH 3L5XH 3FZUC 1RZJH 3P4MA 5LQBH 5GRZA 1JNNL 4XVJH 4X98A 1Q0YL 4KKAD 4C54A 1F58H 1TQBB 3BSZH 4K8RH 1XZ0B 3HHRB 1RSFA 2G2RA 3N06B 4WWKA 5TDOA 5BRZE 1YEIH 2Z35B 2PO6D 1CG9B 4HUKB 3B2VH 3BP7B 4NHCH 3F7VB 1XF2A 2J2ZA 3MRIB 4OGAC 2OL3L 4YPJA 1G9NL 3V95A 1NEUA 3VH8A 5FEBA 4QF1B 1EH9A 3RI5K 3MNZA 2B2XH 2YC1B 3AXLA 5EORH 3OX8A 2ZCKL 2XZAH 5D7IB 2P5WB 4O02L 5J13B 4L8DB 3LEVH 2FX9L 2W9EH 2IADA 2PR4H 4MD4A 3FQWA 4KJPC 5EZLA 4G6JL 4UINL 1ZLUK 1BQLL 4TUKL 4XVUD 4FQCH 1SJEB 2AJXL 1I9RL 1MHEA 5DJDA 5ADPL 5F21B 2BCKB 4HZLB 2VXQH 4LNRA 5JZ7D 1JPGB 5L88H 5JOEA 1P69B 4LCYA 3HPLB 5F9JB 3VFPA 4ERSH 5JQHC 3ZDYF 1QPPA 5C0FA 5I73B 1C7TA 4OZHA 4XNYL 3L7EA 4KDWA 4ZXBA 4AMKH 3BT2H 3SGEI 3OZ9L 5BZWA 5B3JE 4ZYKB 1II4E 3VXQA 1JGEA 1HN1A 5I18L 2VSCA 2FD6L 1FYHB 2WZPD 3T0BA 4XVSH 1P84K 1EAPA 3IFPB 2X4SA 4QXGL 3WDJA 4BZ1L 1IGJB 2ILLA 3T2OA 2A9NL 3L3GB 4CGTA 4I3RL 2I9TB 1MOEA 2ICWA 1UGNA 4OCNC 4G5ZL 1QBAA 3HZVA 2EE6A 3V4VH 3T0AA 4N0FB 2CRYA 3CJJA 4XZUA 1QSFE 1RZ8A 1MVFA 5I75B 4MZ3A 1QLEL 3KYKL 4IRJD 5KG9A 3CFCL 3RBGA 3E6HA 1K8DA 3QXWA 1UB5B 2BNUA 5KW9H 4KKLD 4LLAA 3VCLA 3PJSA 4XNXH 3O0RH 3O2VL 4L9LC 1FBIH 2A83B 1OLLA 4E41D 4Z8FH 4ZFOB 5CLTA 1JNHB 4IS6A 5IGXH 4Z5RB 1RHFA 1UJ3B 2CKBL 3OGOE 4V2BA 1S7WB 4HKBA 1VCAA 4ISVB 1MIEL 1H3XA 4MAYD 4NKOA 3FFCB 3FRUB 3Q5TA 2PW1A 5D72H 5KVGL 3TP4A 3WV0A 4LSRL 4HWBA 2X1PA 2W1NA 3V8OA 1LDPL 3MLYL 1QTYT 5ERWB 1MHCB 3UTTB 3VFNA 3HS0B 5IG7A 4LU5L 4W6XB 5F6IB 3QDJD 5I1EH 2VZTA 1MREH 4XB7A 3QNXB 5IFJA 1U92B 4XNMB 1OY3B 2GK0A 2YPLB 1JZ4A 2MWCA 1UKTA 3VI3F 1X9QA 1BIIB 1HWGB 3TC9A 2HTLD 4RWYH 1K6QH 4ZD3L 3GHBH 1JMXA 1KFAH 4NZRH 2BXZA 3FONB 2ZCLL 3OKKA 3WD5L 2OZ4A 5D2LB 4LAQH 4QNPE 1F6LL 1MFBH 1M4KA 2F5AH 4N0RA 5IW1A 2FYYB 2JJUA 2C4XA 1QRNB 2CSPA 2GK2A 3SDDD 1PGRB 2AVGA 4MDIA 2NLJB 4NZTL 3B4NA 1LNUA 5E2VH 5BXFA 5GSRA 4X80L 5BZDB 2DLGA 3OKMA 3H7LA 4LCWA 2H6PB 5GISH 3JUZA 3MV11 5KJRH 4JKPL 1GXEA 2ZOKA 4U4BA 4DTGL 3VGAC 1PKQA 5C3LD 4RQQB 4X6DB 1U95A 3VRIB 1RY7B 5TQ2H 3W39A 3MLRL 4LKCA 4B5EA 3OHXB 3QAZB 5DT1L 2BFVH 4IIQC 3WIHH 5LCVL 4UTBH 3U36B 4P49A 2R0KL 1MCWW 1N6VA 3FB8A 5JW4M 1OTTC 1IGML 4PJ9B 1YEHH 2GHWB 5F44A 4E41E 1JHKH 4M4PA 4YHKL 4Z7UA 4Q9QH 1ZHLA 4CN6A 2EYTB 3CDGB 1NAMA 4GSDH 3QUXA 1KIQB 5MI0B 5JHDA 3QQNA 3EYVA 1X44A 5HYJD 1X6LA 1NEZG 4LLMB 3KYNB 1S7UA 4OCYL 4M61B 4TUJA 3CSBA 5C0DA 4J3WA 2BJML 3RHWK 1E4XI 4TQEH 3VMPA 4KZEL 4Z7VF 5E6IC 1S7RB 3GMRB 5EU7E 4DVBB 2FH8A 4QHLA 1F6AA 4APQB 3LQZA 4OV5B 5DYOB 1MRDH 3MLPA 1ACYL 1QR1B 2P47B 4W6YB 1V8HA 4XMPL 1YY9C 3DIFA 3FO9A 2V7HA 3VGGA 1A21A 4MNHA 4QTIL 4I13B 4I5BA 2BY0A 4RRPA 4Z0BH 4NO0B 1IGYA 1XH3B 5GS2D 1T3FB 2WSKA 4K3DL 3ZZ1A 3QCTL 1HI6A 3TIEA 1VERA 2FJHA 5DZNA 4BKLB 5J06A 4H25A 5ESVB 2CRMA 1W72L 1LGVA 4KK9C 4KQ4H 3G08A 3FQTA 4P4KB 5E8PA 1RUAL 3W11D 4PRDA 2XY2A 3EFDH 5DURB 2YKLH 3TT3L 3O3DA 1TDQA 4EUPG 3IDJB 3U83A 4LCUA 4YR6A 2J7LA 1MFDH 1L7TL 4OGYL 3E8UL 2DJUA 6FABH 4L4TA 2YSSA 3BRGC 4ZSOA 1T03L 3D5OF 4KK6C 1S9YB 2QHRL 2E8YA 2VDNH 3MLXL 4YNYA 3U0PB 4XBPB 1JV5A 5GRVK 2QADB 3QI9B 1KXQE 5HI3C 1NBVL 5TDPA 4UOW0 1SEQL 2G9HA 5T3XD 4Z78A 5HGBB 3SQOL 2DWDA 1VESA 4HEME 5FGSA 5DRXA 4HMCA 3IS0X 2VXSH 3CPLA 2Z91A 5TH2A 2D0GA 4LCWE 1RFDH 2Z8SA 2OK0L 1IGTA 4FZ8L 5B21A 1GZPB 5FGRA 5AAWA 3EO1A 5CCKH 4PJDA 4YXKH 2DQFB 4HG4K 5CS7A 2N1KA 1K3ZA 2VDMH 2VN7A 4JGJA 4Y89A 4AT6B 1OP5H 2X9XA 3IFNL 5C71A 2D7OA 3G6DH 2F9BT 3WFDL 5I1CL 4GXUM 4UT7L 3VFOB 1HQRA 5ICXA 3EIFA 2O93L 5JIHA 4OCLC 4Y5XC 5E2TL 4Y2DD 1FE8H 3V2AR 2XKUA 2X40A 5A2JH 2YEZA 5IB3B 1F2XK 4J4PD 4S1DC 4GUPA 4G6KH 3V7AE 1DQJB 2JKXA 2CDFB 2I24N 2AEPL 3FQUB 1P7KB 3ZYJA 4WFFD 3VWJB 4QCIB 2WUBH 1QSFB 1MCBA 4HGMA 1YYLL 3EYSH 5F1SA 4EXKA 5DJ6B 4CAGA 1RVFH 3BZFB 4DOHB 2Q3ZA 4U3CA 3BQUD 4MJ4A 3B9KD 1HIMH 2BXYA 4FQ2L 4RMTA 3B2UC 1G7IB 1YMMA 3QUMB 4EQ2A 5HD8C 1I3GH 5KS9B 3SGDI 3WO4C 4JZOA 4FP8H 4PJ8A 1GGIL 5AYUL 5KSBA 4JANB 4RGND 3T0WA 3CFKB 2PO6B 1J1PH 4IMLB 4U31A 3BIKB 5CBEB 3KPSA 3LVEA 4LPYA 1RK1A 1CDYA 3G6JE 4LQFH 2W0PA 4FN0A 2BVEA 2X70A 4KK8D 3OG6B 5BS0D 2A77L 5TPWH 4GAFB 1EGJL 4IM8A 4ZPVA 5I1GL 4DZBA 2BNQD 3GI9L 1OF2B 2J5LB 4JHZA 2W0FB 1QSED 1L7IL 3I3DA 2W9DL 2P7TB 3VFTB 1I8MB 3G5ZB 3SDCC 3OMZA 1OM3H 5TQ0L 3HMXA 3FB6A 4PGZA 3D25B 5DK2B 2KDGA 3WNNA 1UWEH 3BEVA 4QHUA 1RHHA 4UT9H 1YEEH 1AY1H 4KXZI 4TUOA 1CFVH 1P9MC 5IF0B 4XH2A 1UH3A 2BRRL 2Z4QA 1I9IH 2P48B 4B53A 3FFDA 3BPCB 4MQXC 3ARBA 4N8VB 3WSQL 3RNQB 3CX5K 3S3JA 1S7VA 3Q48A 3DTXB 1FNSL 3PV6A 4PYGA 4BFIB 1RJLA 2AJSH 2IQ9H 4YGVA 3O41A 4DN4H 4JY4A 3RJDA 1DUZB 3EOYG 4JFYB 3STZB 3RGHA 1RUMH 2MCPL 3VFRA 4JR9L 3FN9A 1L0XA 1KELH 5HHXH 4O2CA 5HGAA 3VXRA 2KZWA 2IQAA 1WF5A 1FVDB 4LLUB 5L6YL 3KXFA 3T3PE 5HPOA 3PL6A 1TTFA 3GMLA 1KPUA 3K2UH 4CKVX 3KPMA 2I9LB 5ESAA 1X5IA 2IH1A 5EUKA 5JO5B 1CFQB 5HY9A 3RDTD 1R3JA 4NUGH 4ZUWA 2OMBA 4LSPH 1OAKH 4WEBL 4DUVA 4Y7MA 4LLYA 3T1FB 2HVKB 4V1DA 3NABH 1YC7A 4HUXA 3VMOA 5I15H 4AEEA 4E41B 5I76A 5ADOL 3O2WL 4OTXH 5LBSL 1R5WA 3TNNA 1TCRB 2J8UB 1VEMA 4R4BA 4K7PH 3GBNL 4MAYB 1A6WH 2K7PA 2NY1D 3RWEB 1H8OA 1P5VA 1G7MB 3O3AA 4UUJA 4X5LA 4ACPA 1QYGL 5BS0E 3RTQD 2AABH 3OAYH 5FYKL 3O4LD 1WCBB 4GT7A 2BNQE 2BNRE 3EGSA 1LP9E 3I9GL 4LLQA 1QSEE 5DLML 1I7ZB 4NO2A 4GMSL 4ODHL 3AS0A 1CBVL 3E1F1 2FHCA 2AXFB 2FJGB 2Q87A 4GKNB 2DQEL 3KPSE 5DD5L 1OSZB 3O3EB 2V2TB 1KIPA 4GRMA 1TPXB 4FXKB 1B3JA 2PYFB 4EI5A 3BIAX 3MRBB 5I1AB 1KIRA 3GB7A 1MJJB 3NIFE 2AK4E 5DJ8A 4K8RD 2HLFD 1S5IL 4JZNA 3REVB 1WEJH 2ADFL 2XTJD 1LO2L 2A74B 2R4RL 4KMTH 4GAJH 4WV1A 2CDGA 3SDDB 3MLUL 4NQDA 4IOFD 3BYYA 1GSMA 4XNYH 5A3ID 1N6QL 2DKMA 4WW1A 5E94A 3VRJB 4ZUSA 5IROC 3B3IA 1EHLL 2E7BA 1B0RB 2IGFL 2KL6A 4HH9A 4AM0A 4X4YB 3QQ4B 4G8GA 4U1HB 1DZBA 1YUHA 1KEML 2R56H 4M93B 5D71L 4F7CB 2DBLH 1XR9A 2WLZA 3IJSA 2A9NH 3EYFA 1UCTA 3W5NA 5GGVL 3SJVE 4R26H 4CL7A 5ALBL 3BDYH 3W0WD 3BO8A 3MREA 4MA8H 3EOBB 5IHZA 1MJUL 1TQCC 1BIHA 3KYKH 4RAUB 2X1WL 3D0VB 2X1OA 4QRSB 4LMQE 1H3PL 4M8QA 1BD2D 1HKFA 4QHMB 5AWNH 1OSPH 4G7VL 3W9EA 4FQXA 5HYJB 4MS8C 2UYLB 4BSJA 1T5XA 3L3JB 1L9NA 2X4RA 1F45A 3O4LE 4TNVF 4WUKL 1NC2A 4JAMA 1JPTL 4K71C 1C1EH 3CVIH 5IT2L 4GRWH 1GOGA 3KWWB 1E0OB 4HW6A 2HVJA 1NMBH 2IBGA 3L95B 4NKMA 2CO7B 5EU3A 4K9EC 2AJVH 2Q8BL 1CLYH 1ZE3C 5FB8A 5A2IH 5E1AA 1SMOA 2D0HA 1EMTH 3TBTB 1E28A 3L5IA 4MB3A 2FRGP 1I7RA 4JGMA 1QSVA 2NZIA 1S9XB 3L5HA 1LO3H 2VDOH 5C0AD 5D1XC 1I1FB 1QBML 3PGDB 5DRNA 1WSST 3HA0A 3O9WC 1KN4L 3BJ91 1EAJA 2XTJE 3RWCB 2Z35A 2I07A 3ET9F 2Y36H 1CG9A 3MNVA 5LJYH 1VB9A 4O58L 3IGAB 3TO4D 3F7VA 1MFCL 5JR1H 3PWLA 5EBGA 3MRIA 4JN2A 3JWOH 1A1MB 2H2PC 4DKDC 5MHSD 3TCLB 1Q72L 4QF1A 2M2DA 2DMCA 2R9HC 4RDQG 4M3KB 3MBEC 1V7MH 3AS3A 3TZVC 1S5HA 2LTQB 4PJEF 4QXTA 3MGAA 4QRPD 5ICZB 2LU7A 4NQDE 2J8HA 4FNLL 3K7UA 5F9AC 3W0WE 2IALB 4HZLA 2R29L 3BE1H 4NQCD 3WS3B 1IM9B 4G8GE 3T3MF 2WLYA 1QLFA 5T1MA 3E2HB 4TVPH 3C8HA 4U1KB 2ZUSA 1BD2E 1IKNA 1YQVL 3V4UL 4ZYKA 1JWMB 1HHGA 3BUTA 2ADGA 4OAWA 3VA6A 5JA9A 4PRPA 4QHKJ 3M8OL 4LVOB 1SYVA 4OF0A 1PDKA 2PXYA 3T0ED 1CGUA 2X4QA 3SKOB 4UB0H 3IT8D 4MSWB 2I9TA 3WUWG 1XGPB 4OFPA 1NAKH 1HKLL 3OGCB 1FH5H 1ZA6B 3BZ4A 3MX0A 4Y2DB 4NQED 4I18A 3NIGF 3TT1H 1OAQL 3VA2C 3ARDD 4Z18A 5GRUL 2VDQH 2Z93A 4OCSH 4XP6L 3ARVA 4HS6B 1F13A 2HJFB 1CCZA 4KMQA 1QUNA 4NM4L 1LQSR 1KYOJ 3DRQB 5DQ9A 1KTRL 4PLKC 2OJEB 5K9OA 5JOFB 3CLEH 5FUZH 4ZFOA 1JNHA 3C5JB 3BQUB 5CD3A 3JV6A 5K59E 1S7WA 35C8L 5D6DA 3B9KB 4ISVA 1NKOA 3FFCA 1JMZA 4F15B 2A38A 5MHSE 1G9MC 4HBQA 4Q0XL 5EZOH 4YXHH 1ZGLP 3V79C 1FYTD 3AROA 1FG9C 1UG9A 4LSVH 5DC0A 4JDVA 4I1NB 4RGNB 3WFHA 4MQ7B 4K3DH 4ALAL 2ARJQ 5D96B 4BSVA 1YMHB 4PJIE 1FSKC 4OZ4B 1U3HD 4F7EB 1GIGH 3QNXA 4QRPE 4UIKL 5E9DD 3P30L 2N7AA 1U6AH 5BS0B 1HHIB 1J05A 4GBXC 5F93C 1UWGL 3OPZH 2BNQB 2BNRB 2NW3A 1ZV5A 4HXBH 3BGFC 3RIAK 5CILL 1QSEB 4HCRA 4NNXB 4NQCE 2A6JA 1T03H 4XCCL 4HMEA 2VKXA 2EDEA 3LB6C 3QUKB 3MLXH 2HRPH 3LEYL 4MHHI 5IBUB 5L2JA 4E9LA 1D6VL 4XAKD 3TYFA 4HK3J 2IFGA 2BSSB 4MB5A 5KAQF 1Q9OB 3BN3B 4JY5L 2FYYA 3L3OA 1Z5LB 1QRNA 3CXHK 4P5MB 2X4NA 1A3LL 3CC5B 1G7LB 1F4WL 1C12A 4KGJA 5BVPL 2LV4A 4WI9A 5DUBA 1HXYA 3IETB 2NLJA 1DBBH 3OKEB 5FCUL 2AK4B 2JCCE 2OK0H 4P48A 2Q7YB 4LPTA 4JRXD 4HUWB 4JQVA 1RZKH 4JFFA 1BVLB 1F3DJ 2MQCA 2RR3A 3MRJA 5DD1L 1A7PH 4Z9KB 4HQQH 2ICCA 4RFEB 5E00B 2O61A 2ZSVB 3BZDA 4M5YH 2R8SH 1U8IA 4I77L 4F58L 5D8JH 1RJYB 1EV2E 5EFIA 1FNLA 3RI5F 5HYSG 2E9IA 5I8OL 1IT9H 3D3VD 2D9CA 1NFIB 1NJ9A 2ZPKL 4WCYH 4F9PC 1BFTA 1KTLB 4Z7NE 1H15B 3S4SG 3IDMA 1RJZB 4PBWD 1J87A 1DQDL 3RDTB 3RZWA 2ADJA 5IEKA 4XI5D 3CDGA 5MEQB 3UC0L 1BECA 3O6MH 3ILPA 3EDEA 5JIIA 4OI8A 4X5XA 1JIBA 2P8LB 2YOCA 2VZOA 4OLWH 2BHZA 1FYTE 4ZUVB 4PJXE 4G8IB 2N7BA 3QO1B 4LLMA 2DLIA 3MACL 5IW3A 1WBXA 5EUOE 3I85A 4AJ0A 2HYMA 1N7MH 1MUJB 1MCPH 4QOKA 4G3YH 3L5JA 4GXUN 2AGJH 5AG9A 2NY1B 3GMRA 2LE9A 4PIRF 3GMOB 5HVWA 4YAQA 4WW2C 1MWAH 4P0DA 4OV5A 3ZMRA 4P5TD 1NSNL 1B6UA 5EIIB 3RTQB 2OS7A 3GKWL 3O4LB 2OYPA 1KSRA 4FQ1H 3TPUA 4OD2A 2W92A 3ROOB 5GJSL 5IVZB 3DBXB 2BMKA 4YBQD 3GSXA 1DN0B 1JTOA 5F7EL 2JELH 4MCYA 1OARL 4ELME 4S11A 1U8JB 4ODTL 1CR9L 3MLVL 4XAKE 1IM3A 5E08H 1XH3A 3NFPB 3GUTA 3NZ8B 1T3FA 3MV01 4HSQA 2NY5L 3IFLH 3HE7C 2OR9H 4Y16D 4GLRI 1HHKB 3EJZC 4XWGL 3ZHLA 1PZ5A 4X4XB 3OBAA 1MSPA 4P4KA 2MQ0A 2APWA 1MJ7H 2IPKA 5IJVB 2QJDA 3IDJA 4JRXE 3JXAA 3Q0HA 2XTJB 3BHBB 4XP1L 3C09B 4J23A 4R3SA 1YEDB 5KVMC 1KB5H 1S9YA 3NH7H 1N5AA 2HT2C 4R7DB 2PYED 4O2EB 1KC5H 4P9ML 5C0ND 1BPVA 1ZTXH 1PLGH 2A2QT 3MJ9A 3CU1A 1Y0LA 4KXZH 4JPKL 5HGBA 2VKWA 4U6VH 5JNYA 5IOPB 3P4OB 2V7NA 3PWUB 2AQ2A 4FQQA 1XIWB 4HC1L 4HX1B 3QULB 5KVDL 1GZPA 4IHOB 3H7BB 4NBYB 2QSQA 1DBAL 3UBXB 3W0WB 3LQAC 3P9WB 1YNKH 2CLRA 2B4CH 2PTUA 4AT6A 5JQ6L 1N4XL 3QDGE 5DC9B 2JB5H 3Q1SL 4UU9A 2ZSWA 4MXVE 3IF1B 4XXCA 4UQ2A 1BD2B 1PQZA 3C60D 5IESH 1T66C 3ZHKA 4F7PB 4X7SH 4WHTA 3H3KA 3BDXA 4JO4H 3RKDD 4NZUH 5L2KE 1Z6JT 3AREC 3V0WH 3BPLB 1FZOA 4PB0H 1M7DA 1FHGA 3GJEA 5AZ2L 3HB3C 2MMXA 3PWPA 4POYA 5HYIA 1M05B 4P2CG 1L0YA 2APTA 3T4AB 1A6VL 4OCXL 2BY3A 4JCLA 1DQJA 1P2CB 2CDFA 1GOFA 1T22A 1P7KA 4QCIA 2UV3A 1T20B 1IAII 4MMZC 3CXDH 1GGCL 4HHAB 4N9OB 2EDOA 3BZFA 1NDGB 3ZKMC 1QZ1A 3I9GH 5DI8B 4DGVL 4OLUL 2WNGA 3UYOD 3WLBB 4RMQA 1G7IA 4HEPG 1UYWH 1U8OB 2Q76A 4X8JB 5MEPA 5CINH 4ZOBA 2YUVA 2WWKO 5E8OB 5C0AB 2IWGA 4KC3B 4UOJA 1CGYA 3CH1A 1FIGL 3FRPA 3KR3H 3GBMH 1NCUA 1AR1C 1Q9LB 1IQWL 2XA8H 3MJ8A 2PO6A 4X6EB 5EOTB 2C4FT 2Q3AA 1NGZA 3RWHB 3RUGF 3WYRA 2PYEE 3TO4B 4OKDA 1SY6H 2D7TH 2HJLA 1YPZF 2OL3A 4HJJL 4MJ5B 4TSAL 4P2QE 4JM2A 4NUJB 4OF5A 1BGXH 3S5LG 4DKEL 2ORBH 3OB0H 1N59B 3QEQD 1OF2A 3BD3A 4PJIB 2L0DA 3UDWA 2OI9B 2P7TA 2GSGB 4QRPB 4EDWH 1SBSH 3TF7C 2R15A 2HAZA 3L7FB 4PB9L 4XP9L 3D25A 1TTUA 1EHLH 3VXOB 1OT1A 5JW5B 4HWUA 3DXAD 3JBG7 4OFVA 1A2YA 4NQCB 1NKRA 4N8VA 3RNQA 1NGYB 2MCG1 3RWDA 3UO1H 2UWEA 1MAJA 2FIKB 4LPCA 1NCCL 4IRSA 1KPRB 3HAEG 4WU7B 3ZKQD 4MNQD 3PGCA 1C8PA 1DUZA 4JQIH 3O8XC 2DB8A 4JFYA 2VDLH 3T0EB 5IFHH 1U3ZA 2AXGB 1R5VB 4HGWA 4ZUUA 3IDGA 2JCCB 3FOLA 4PGJA 4LLUA 1MLCB 1RZ7L 1JNLH 3RPKA 1IEBB 4O4YL 3ABZA 4L29A 4HS3B 5FYLH 1D5ZA 2EDJA 4XX1E 2HMID 3DYOA 4IRJA 3QJFB 4CW1B 2I9LA 4M6MH 3ESUF 4JQXA 1NBZA 5DVLA 1FZMB 4Z0XB 3ARDB 1JPTH 4OGAD 3T2PA 1NLDH 3CNKA 3L1OH 2PW2A 2VR5A 3DV6A 2CJUH 4U1SA 2EDYA 3T1FA 4HBCH 3PHQB 5EU6D 1UM5H 4D94A 3FB7B 1O0VA 3DV4B 5SX4H 3TN0A 2OXGA 2CKBA 2J8UA 3QFJD 4PY8J 2B39A 1DLHB 4MAYA 3N0PB 5IJKC 1CI5A 3MOBL 2RB8A 3UPRA 1F02I 1G7MA 5JW3L 1UT9A 1FYTB 2B1HH 4JFEA 2VL5B 1N2RA 5EUOB 1D5IH 5T1DH 4M7JH 5CWSA 1WCBA 3QCUL 3CSYA 1DUYA 3QEQE 4ODUB 4B50A 2APXA 3O4OC 3QDJA 3ULVF 3S34H 1U3HB 1FAIL 1I7ZA 2WBJC 4DFIA 3PF2A 1K2DB 4M43L 2JJSC 2Y7QB 5E9DB 3CLFL 2AXFA 3BPNB 3LRGA 3RVXC 1MIML 1OSZA 4NWUL 3UTSD 3UTZB 4MGXA 4FXKA 2HH0L 1RJCA 4QRTB 3WO3B 4PPTA 3DRTA 2PTTA 1GC1C 3DSNA 4HIJB 5TDNB 1TQBC 3MRBA 1A6UH 1NGQL 5LAXB 1FORL 4NIKB 3UJIH 1N5YL 1MCOH 1MJJA 2E27H 2E5EA 1EEZB 3QZWA 4E42B 4GS7B 2VYRE 3L3DB 4MNQE 2F5BH 3C5SB 4DK6A 2C1PB 3PUCA 5I1LA 2YD2A 4NT6A 1FNHA 3SDDA 4YXLL 4KUCF 1A7NH 3R1GH 3ZDXE 5L9DH 4L3ED 5LWYL 2YZ8A 2ZG2A 3VRJA 4HT1L 4CBPA 3IXAB 3RVVD 5B38G 5A40E 4P59L 4JRXB 4G8FA 1LO4H 4M00A 4RNRA 5CUSL 5EWIH 5J13C 2G5RA 2IANE 1IGIL 1MHPH 4YDJB 5DJZA 4Z95H 1T5WB 1A8JH 1LEKA 1RZIB 4YDIH 1FN4B 1LK3H 5C8JA 4H26B 1MEXL 5IB2A 1OGTA 2HKHL 2HN7B 1WWCA 4M5ZL 5DHYB 3KPRD 1XCTA 5EU6E 3EOBA 5I73C 4P3CL 3D3VB 1YYMH 3U46B 2EDTA 5JXAL 4RAUA 2X4TB 1HXMA 3QFJE 4LSTH 3ULUF 2BRQA 1DEDA 4TVPD 4QHMA 3HI6H 1HEZA 3OKOA 5HHNB 3MXVH 4FQJH 3VG0H 3NGBB 4B41A 5HYJA 3ECBA 2ZZUT 4TNWF 1FP5A 3L3JA 3HZMA 4XHQA 1FAKT 3X3FL 1KBGH 1T7XA 1TJGL 1ZS8A 2FO4B 5SWQA 4PJAE 2DQTH 3CDCA 4BFBD 2MKLC 2VXVL 4GRWE 2VDKH 4Y4HD 5I75C 5L2KB 4P5TB 3MPCA 4GQ9H 2WWKT 1MCIA 4OLXH 2VSDA 3SY0B 2BVOB 2X4UB 1H3UA 4JFEE 2HWZH 2F54A 4OM1H 1MLBA 4NSKA 4Q2ZA 1U93B 4OFKA 4MXWL 3FQNA 3Q3GB 4I3SH 5DFVC 4OZGE 5FYJL 3RKPA 3MGTA 1I1FA 5D7JB 1UH2A 3PGDA 1UJ3C 5FGBC 4Y16B 4CADB 3MV7D 2FB4H 3WFCL 1KCKA 3QA3B 5EPMB 4NWTH 1W72A 1E4XL 1W0WB 1WGOA 4PGBA 4G6ML 5JHLL 3OJ2C 4Z7OE 1P1ZB 2OCFD 5FHAL 1A1MA 2ITDB 43C9B 4JFPB 3RVUC 1HHHB 4NO5A 4POUB 1KJ3H 2BZDA 1BBDH 5IVXF 5J1AA 1YC8A 2K9UA 5F6IC 4GKZA 2VISB 3U4BL 3WFBL 2Y4SA 4KHTL 4X9GA 3NMEA 4P2RD 2PYEB 1A7QH 3FB5A 4OCWH 5F9WB 3QNYA 1CL7I 4P2QB 3GBLA 4YHLH 3TBWB 1CZ8H 1TNNA 3X14A 1A6AA 2IALA 3KPRE 4Q6IB 4ODSH 2IG2H 3WS3A 4XCYB 4N90D 5I8CA 3O6KL 5LGHL 4IDLA 1AKJA 2GJZB 4Y1AD 3HZKA 4TVPE 5DQDL 4MA7L 4JFXB 1B6DA 3H9HB 5F1NB 1A3RH 1Q9KB 4M7LH 1FLRL 4LIQH 4XHJC 5K9KB 4KI5C 1IZJA 1M6OA 4XPHL 4TOYH 4ZQKB 3SKOA 4F9LC 3ZDYE 5F3BA 5I71B 2X89D 1R3IL 1OW0C 4MDJA 1JRHI 2CXKA 3RGVD 4ORGA 3BW9B 5IWLC 3QDAA 5EN2B 2E3VA 3IDUA 4M6AA 4W4NA 1CDJA 4AZ8A 3V4PH 4HKJB 2X7LA 2P5EE 2NYYC 3OR6B 3OSKA 4Y2DA 2FJFB 5DD3L 2DQDL 1J5OL 4Q9RL 5T3ZL 2EO9A 2EXYD 4J4PA 3QAZC 2HTKC 4L9DA 4Z77B 5DMYA 3I6LD 4PJ5D 4JFZH 4PJ9C 3DRQA 4WGVB 1LK2A 1B88A 3S97C 1LO0H 4NGHH 2AKRA 5EIVA 4FMFA 4Z7WF 3MV7E 3MROB 4NYLB 3BQUA 3DI3B 4JFOA 3J7HA 3GSNH 2H3NB 2GUOB 2XTLA 2Q8AL 5MI0C 3HI5L 4HK3N 1PG7W 4WTXA 2F54E 2XKSA 1VACB 1IKFH 1UQSA 4U1NB 2NXYD 5TE4H 5FUCC 3V6ZB 4KAQL 1PG7X 5IQ7L 1MCLA 1YNTB 4QEGA 1K5NB 3EDDA 2CUIA 1IFHH 3IDXL 4APQC 3IU4L 3WL9A 3GJFH 3H9ZA 5B8CA 2DM3A 5CKAA 5ISZA 4A6YL 1ETZB 3ARGB 3HNTH 4HWEH 4RA3A 2IMMA 1EGJA 4YHPB 4MB4A 1CICD 4GLRH 3QEQB 3AMLA 1C5DB 1IC1A 1A9BB 2DTSA 3SDAD 1VKXA 4EN3A 5EC1B 5F1IA 2JK5B 1QKZH 2R2EA 1H3TA 1AQDA 4G6FB 2VQ1A 3D9AL 3MR9B 4Y1AE 1LILA 1X6NA 4UI2A 4L4VE 1XGUB 4XBEH 5DZLA 1XF4A 1Z5LA 4OCRH 2EIZB 3CC5A 4OB5L 3O45A 1G7LA 4EUPB 5F8RC 4NKDB 2DQGL 3T09A 1J0IA 1VPOL 2ITCA 2V5MA 3IETA 2WWMC 1KJ2H 3N50A 4LCIL 3SDXF 2EXWD 5F96H 1ZWIA 2C9AA 4MNQB 1BLNA 4C83B 1BVLA 4WJ5B 3NPZB 3VXPB 1AR2A 3EFFA 4GAYB 1WK0A 3U7YH 2QADC 3ARZA 3QI9C 4NDMB 4U6XA 4CU8A 3IJHB 3DSFH 3GNMH 4LCCA 4N8CL 2WMPA 3U9UA 5FKAB 3DUHA 1A1OB 2DD8H 3BWAB 4ELKB 2J6EH 3GMQB 3I6LE 3GRWH 2KQNA 2DKSA 3G04B 3WIFB 1TJIH 1H15A 1KCRL 2YMXL 3AAZB 1NPUA 4HJ0C 3IDYB 5FGCE 3CVHH 3FQXA 3RDTA 2BVTA 1B4JH 3B6SA 4UQ3B 4UNVA 1V3KA 1MPAH 4PJ7A 1N0XH 4X6CE 1HCVA 5EU6B 3W5MA 2HFEA 4ZUVA 3D18B 1BM3H 1HWHB 1QA9A 2FGZA 4QNPF 3RWIB 4B7LA 3DGGA 3D69B 3QXTA 4NQTA 5I1JH 3QFJB 5A43C 1S8DA 5KN5A 2HFGH 3ARQA 5IBTH 1ULVA 4XC3H 3MRLA 4NOBA 1R24B 4OZHF 1G7JA 1IAIH 3RTQA 7FABL 1YN6A 4YK4B 1NBYB 1P4IL 3QNZA 2E9WA 3ROOA 4BH7A 4O2FA 4PJAB 3DBXA 3CAFA 3VWJC 3NTCL 3V5KA 4GRWB 1SJHA 5LGJB 4Z7VE 5EOQL 5HVHB 3PQYD 1W0VB 1JP5A 4XRCB 4JPWH 4L8CA 4XGZB 4KKBC 2D3VA 1U0QA 5F7HA 4UAOB 3WNLA 3I6GB 2F74A 4GQPH 5F3HA 5AZEL 1W8OA 3SKUD 1IL1B 4KKAC 1DQML 5KVFH 2YUZA 3GMMA 1SQ2N 2K7QA 2GJ6D 3MRHB 2HFFB 1FCCA 1CXLA 1FL5B 3GHEL 1E6JH 2PO6C 3DVGB 1T89C 1J0JA 5CHNB 3BHBA 1EVTC 1A6ZB 3R0MA 5JPNB 2KH2B 4R7DA 3RA7H 2EE9A 4O2EA 2MPAH 5K93A 3STBA 2MNUA 4L3EB 4JDTH 2UY6A 2YXMA 43CAB 4WO4B 3A6BL 2N56A 5I30L 2CMRH 3JV5A 2J5LC 1B90A 3QHFH 4LSUH 3N1GC 4R9HA 4F57H 5IOPA 2HFTA 1Z0MA 3GSRB 3MO1A 5D5MA 1F2QA 2XZCH 3RNKA 1PY4A 2YS4A 4HX1A 4P99A 5JZ7C 5I16B 3KPRB 4S1RH 2XG4A 5D2NE 1XGQB 4KPHL 4PLJD 4WHYG 4OZIB 1T2QH 2GCYB 2QLVB 3VFGL 4ZDHA 3IF1A 2DLFL 1XGRB 1NGPL 2OQJB 1BJ1H 4F7PA 3PWJA 3S37X 3WFZA 4H5SA 1OGAD 3DMMB 3HPJA 4N1CA 3O2DA 1YY8A 4JY6B 4RFNB 2ATKB 1NCTA 3LIZL 1REIA 3HE6A 3V6FA 4Y4HB 1Z9MA 5KSVB 1BX2A 5D1ZD 5JW3H 1BF2A 1T20A 3PQYE 4DUXA 2WBWB 4HAGA 2PUQT 25C8H 5HPMA 3IKCA 5A2KH 1NDGA 4KKLC 4WNQB 5HXMA 3OJVC 2BERA 5GGSB 3WLBA 4QT5A 4P46A 1U8OA 5HHQB 4PGDA 1I8KB 5BJTB 1JVKA 3DARA 4MA1B 3KJ6H 2GI7A 1WWWX 2OSLA 4X83A 5BOZG 3EYUL 1MIMH 1NFDA 3SDYH 1EUTA 1HYRC 3MRGA 3MV7B 4XC1L 4U1LB 4XCFL 4R90H 4MAYC 5EOTA 1IC4H 4LSQL 4F2MB 1QFUH 5HHMD 5C0BE 4DW2H 3VFMB 4PS4L 4FXLA 4PJCA 2P46B 3E6FA 1QLRB 3FN0L 3GGWB 4Z7UF 2HG5A 1N59A 3EO9H 5EU7C 4C55A 1G6RL 1G7QB 1XGYH 4F8QA 4P2RB 2ICWI 1ADQH 4POZC 2GSGA 3BGMB 3CUPB 1KB9K 1G0YR 4DN3H 3L7FA 4XB8A 2HTLC 1B0GA 1TPXC 3O6LL 4KDVA 1A22B 5SV3A 4ZS7L 5BCAA 2F53D 2BC4A 5FDWA 1PJ9A 1SMAA 4JZJB 5JW4Q 1NGYA 5DFWH 5BQ7B 2FX8L 4Y1AB 3QUZA 1DFBL 2R0LL 2Q7NA 4K9EL 4L4VB 4PP2B 1ZHNB 4JG0H 4ZAKC 4WU7A 4N0YL 3BP4A 3SDDC 2YK1L 3DX6A 3MV8E 1Y6MR 3IJYA 1RUKL 1FVCB 3F65A 4NJ9L 1J0YA 4BQCA 1OGAE 2AXGA 5DGQA 3HFMH 1HH9A 1FZKB 5B39B 3RGVB 2VLJA 1UM4L 4WY7H 2EIDA 3BKCL 1AE6H 5D1XD 3HC0B 4ZUTB 5DJ0A 3PP3K 4FFZH 3KNBA 3H3BC 4HS3A 3EDJA 4M93C 5CAYB 5FYLE 2CIIA 4KRNA 1RUQL 1YEKH 4BYHA 4NQEA 4KKCD 4F37K 5J7CC 2CDEB 2CIKA 5GS0C 4KJYA 4KZDL 5DA4A 3CK0H 5JA8B 5D70L 3S36L 2E7LC 2EH8H 1F4YH 4XT1C 3BEWA 2HKFH 4EIZC 2VAJA 3OAUH 4JKLA 5BW7A 4OT1H 2UZIL 3I02B 4GMTL 1SM3L 3HC3L 4KROD 4M1DH 3QDMA 1KUMA 3LMJL 2QR0B 15C8L 1OVZA 1H8NA 4FMKA 5GRJH 1IC5L 1W0YT 1P4BL 2EIEA 2NXYB 1T04B 3QG6A 4J1UB 4I9WD 1OPGH 4UV4L 3TBVB 1RURL 4Q9CA 4ODUA 4PJDF 2OZ4L 2COQA 1DVFD 1GAFL 3MLSH 1CQKA 4A6YB 5F1KC 3BKJL 1P84J 5EOCH 2WIIB 2EYSB 5DEZA 5AEAA 3H42H 1CICB 4ZPTA 3VW3L 3G5XA 2ERJB 2VH5L 2OP4H 3U4BH 1YNLL 3WFBH 2IPTH 4QRTA 3SDAB 3LKOB 3ULVH 5TDNA 1QQDB 3RPIA 4N9GA 5HJ3A 4Z7VB 3QXDB 5F7MC 1QRKA 2P45B 3C2SA 3GSQB 1FG2A 2K3TA 4HS8H 2R1XB 4HK0B 4J3XA 5IFAL 1BFOA 3L3DA 1LDSA 3C5SA 1YECL 2RAMA 1T1WB 4D8PB 2X05A 2C1PA 1CE6B 3WXWL 2ZG3A 2EDWA 4JVWA 4XP5H 5CZKA 4G7YL 3SEPA 4QWWD 5DRWA 3VXMD 2LTQC 4JFQA 4PG2C 2ZUTA 1HYSD 3D48R 2UVFA 5EBMB 5GGTH 1U41A 3MJ7B 5C6TH 1KB5B 4HFWB 4EVNA 1RZIA 4QTHB 1U8LB 1F4HA 3KYMA 1FN4A 3IRPX 4A2LA 1J88A 2LVCA 2FNBA 3VG9B 4H26A 2HN7A 1G9ML 4P5KB 5F7UA 5KSBF 3A0OA 4WHYH 1C16B 3C5ZA 3N85H 5SWSE 4FQLL 2VLJE 1T1ZB 3VJ6B 3TYGL 1TTGA 3ISWA 2JJVA 4TRPL 4FTVA 3H2WA 4HKZA 2DLTA 3LKQB 4LSSH 3S8WA 3E2HC 3RY6C 3U46A 1BJ1J 4R96B 1J5OH 2X4TA 4HLZG 1AGBA 1IQDB 5JDSB 4JN1H 3KPPA 5BVJA 3CFBA 1G6VK 1JRHH 1MH5B 5JUEH 2GAZB 4LVOC 1VFAB 5HHNA 3JWDC 4HIXL 1U91B 3PHSA 5JXEA 4LBEB 1IJ9A 5FCSH 5D2NB 1IAKA 2GTZA 3WUWB 4CU6A 2DQJH 3LB6D 4KJQD 4MAUL 1V3JA 1YDPB 2ZJSH 3ULUH 4D3CL 1D5XB 1HHJA 5I74C 3TVMA 1HILA 1QFOA 4Y2DC 4P5TA 4DGIL 5I1KH 3T1WA 1JGLH 1O5DT 3V5DB 3U6RB 1ZANL 2E7CA 3T77A 4J4PC 2FLBT 2DYPA 3QPXL 2FDBP 3HR6A 4U3HA 1FDLL 3F58H 4LRNH 1CIDA 1FRGL 1WVZA 2AEQL 1U93A 1FNGA 2D03L 3U7AA 3N1PC 5JPMB 1ZHKA 2YUWA 3NFSH 4LEOA 4GW5B 2EDBA 3PQYB 2F19L 5C7XH 2X2YA 1H9VA 1FFQA 3BQUC 1AH1A 4Y16A 4CADA 3B9KC 3T8XB 4NKIH 1FV1B 3UYPA 4NRYB 4F15C 4CMMB 4X9IA 4YQXH 1EUUA 1P1ZA 2GJ6B 4RGNC 3BXNB 5D96C 1CFSA 3CMOL 5C0JB 5IQ9B 3VXME 1HSAB 3WDIA 2C4FU 1DE4B 4HV8B 3RVWC 1F4XH 1YZZA 1KCSH 5CEZH 4YDKL 3QUYA 1CD1B 2VDPH 3BH8B 5JORB 1MAML 2QQKH 2LABA 1ZT7A 1I9JL 3QIUD 3JTTA 3RFZC 3OTTA 2BHUA 5DVKA 1V7NH 4PJGA 7CGTA 3H3PH 2H2SC 2VLKD 2CRIA 4HC1A 4OD1H 4XCYA 1OP9A 3WKML 2Y06L 2C3VA 1MCWM 1QHPA 4OIAA 4PJEE 3TNMB 2IBBA 1OB1B 1T7WA 4JG1L 1UZ6F 4U2YA 1KT2B 3SCMD 5T5NG 4LIQE 1NC4D 2Y9RT 3ARFA 5I17B 4YX2H 5KSAB 2XY1A 1IGFL 5DR5L 3C60A 3T3ME 1MRCH 3B5HA 3K8MA 5EO9A 4Q6YA 4YHOH 5E2JA 3LH2L 3R8BB 2JLLA 3MV8B 3MLWL 4OZFG 3EJZD 4HF5L 4WFGE 5GRYA 4HKJA 4OUUB 1OGAB 2FGWL 4R2GD 3HC4H 1U36A 1GGTA 3UJTH 1IAOB 1U8HA 5E5RB 4M1CD 5IUSA 1A02N 2YWZA 4Z77A 2H8PB 3CFJB 5CGYD 4P9HC 1FNAA 5D1ZB 3WN5B 1KPVA 4YHYB 3C8KA 1ACZA 3I84A 5ITBL 5EZJB 2EDHA 1B9ZA 2VERN 3RDTC 4HFUL 3MROA 3LV3A 3BH9B 3LRSB 2EDQA 5DWUL 2GUOA 1XT5A 3NIGE 4HJGA 1GHFH 1NEZA 2RQ8A 5MEOB 3G5YB 5FO7A 1AI1H 2DIAA 3PDGA 4FXGB 1VACA 5DF0A 4U1NA 4RWHA 4MNGE 1IGCH 1DANT 4ODWB 1F4AA 1DQQA 4XCEB 1DBJH 3BAEL 2QSCH 1YNTA 5HGDB 1K5NA 5ETUB 3GSUA 1I7TB 1FVEA 1I7UA 1EEYA 3ZTNH 5ACZA 5HGHB 3RWGA 2NY1C 3TA3D 3NCYP 4Y5VB 4AY0A 4PTUA 8FABA 4NJAH 4Y4FB 1MCNA 4TSCH 1HZHH 1ZGLB 2VLRD 3LQAL 2VUYA 5T1KD 1ETZA 1PVHA 5L7XH 1INDH 2QKIB 4JJHA 1XF3B 2JF1A 3RIFK 3GHEH 2JJTC 2BDNH 3IS1X 5H37H 2DN7A 3LPFA 4H1LG 2VLKE 3U9PL 4PRNB 2FATL 5CZVH 1TETL 4GH7B 4JO3L 5CP3A 3MOAL 1T66D 2AJ3B 2JK5A 3DOSA 3QJHB 3TWCL 4PG9A 1UZ8B 1FL3A 4U1MA 3ZKND 3BKYL 4Z76B 3WFEL 1OAZL 1T1XA 1VEOA 4QXUL 1DEEB 4LMQI 3H9SD 4PV9A 3EDKA 3DXAA 1Q38A 3MTRA 2AJZB 2C1OA 1FGVL 4KQ3L 2Q86B 4PJHA 2F53B 5EO1B 3LSOB 3DJ9A 5E2UL 3U2SA 2CPCA 4L4JA 5E4IA 1NH6A 4LFHD 4EUPA 2VXTL 4NKDA 3I2CL 3LKNA 3BMWA 1JN6B 3TM6A 4KUZL 4K8RC 4OQTH 2BVQB 1ZVYA 4XP4L 2HLFC 5GIRB 1FGNH 2DQIH 2XTJC 1ZAGA 5IVNA 3MCLH 3C09C 5DUPH 5FF6A 1C08B 3UTPD 5AUMA 3CFDA 4XPFH 5FO8B 4U0RB 3VD7A 3ZKMD 5A3IC 3MRFB 3S3PA 4J3VA 5CJXA 2DKUA 4JCMA 1OCWL 3QWRA 4K94H 5FKAA 1A1OA 2AEIT 2MHAB 5T33L 4GG8B 3BWAA 1Q9WA 1XIWC 2FX7L 4JO1H 5FKPA 4LHQB 1P6AB 1VGEL 4IMKC 1PSKH 1CE1L 4P23D 3VXSA 5JIPA 1FO0L 1MFAH 4UQ3A 3CGTA 5SWSB 4HXAL 1ZKAA 4ZFZA 1U8MA 4KROB 1TJHH 3SN6N 3DURB 3GSVB 3RWIA 2GTWB 4P4RB 4F80A 1ORSB 3EZ8A 4K2UL 1SYSA 3LAFA 1Y6NR 3MA7B 4JPVL 3GSWB 2WUCH 3OF6A 1G84A 2VLRE 3BPLC 4TULH 5MERB 1NGXB 1R24A 3L3KA 3CX5J 5CJ5A 2YD1A 4P57A 2L4OA 5AYQA 4LGRB 4JRYD 5C9KA 1S7QA 3UBXI 4ETQB 1TLKA 4KI1A 1CLOH 1DVFB 1E4JA 5DSCB 2D2OA 3HUJA 3T2NH 1XAUA 1C5BL 3LEXB 1W0VA 5KOMC 5IKCA 2XPGA 4XGZA 3UTSA 5DMIH 4PJFA 3HZYB 2ZKHH 3VXUD 3HR5A 4R8WH 5F88A 3ZSTA 5MP6H 4ZFFB 2R23B 3MV9D 1D5BA 4LP5A 2O5XH 4YFLI 5ITFB 3DVGA 3UTPE 2O5ZL 1FFNA 1KJVB 5CHNA 3TO4C 3RVTD 4PJXF 5JPNA 2C7UB 1NMAH 4PJHE 1QNZH 3S5LB 4L3EA 3SPVA 4JO2H 43CAA 2AV1A 3PGFL 1BAFH 4L9LA 4LARL 3VXMB 4ZMAT 5GXBB 2GFBB 1CK0H 3HKFA 2OI9C 4C56D 4DWHA 1UKQA 2R4SH 5HHOE 3ZHDA 1G1YA 1UM6L 2DI8A 3BX7C 3WNOA 2BSTB 3TH2T 5CEXA 4PV8A 5B22A 4S2SB 3SE8H 2NX5D 2VZ3A 3KPOB 1N64L 2FWOB 2VLLB 1A7RL 1INEH 1C5CL 3B5TA 3ZYZA 1KEGL 4YIQB 4LASL 3RWJB 2HT4C 5DTFA 3C6SB 2IH3A 2E8ZA 3RL1A 1JF6A 4M6OH 4OZIA 1BREA 5CZXD 5DEGA 1J1OL 4L5FL 2CR3A 4PJEB 4CNIB 4HWBH 4N0CC 3LRHA 4AEHH 4EEEA 1IILE 1A0QH 3VXSE 3LD8B 4LGSB 2RCSH 3T0EC 1X7QB 2FBJL 1LD9B 4WUUD 1MQKH 1GGBL 3K3QA 3I3BA 2FR4A 1GC1L 4N0UE 3VGEA 4MVBD 1CGSH 3PHOB 3MRDB 4J6RH 2XKNA 2VABB 3UYRL 3RX7A 2X42A 4G8EB 4K3JH 5KSVA 3TPKA 2VC2L 3IFOB 4YWGL 5CP7A 1TVHB 3V6OE 3MCG1 3SKJL 5I0ZA 3ARDC 3H0TB 4FFYL 1EX0A 1A9EB 4UDTB 4UT6H 4WNQA 4CU7A 5DRZA 1HINH 1S7SB 1AO7D 1JPSL 1OT2A 4K3EH 2OZ4H 3DI2B 5ID0B 5BW7C 3TJHD 2FECI 1MNUL 4X4MA 4UOW1 5BJTA 5IV2B 3JVGC 5ANMB 1D5MB 3INUH 3HG1E 3LZFL 4IOIA 3W2DL 4X6FA 1RU9L 1JHTA 4F2MA 4OIIL 3UX9B 1U8NA 5F7WC 3VFMA 4MNGB 3P0VL 3VXNB 4QRRA 2CLZB 1A47A 1BWMA 4UIMB 1EIBA 2P8PB 4WTWA 1QLRA 5C0EB 3MYJA 1U3HC 4ODBD 1D9KD 3ULSA 4HUUA 5I19H 4PRBB 4P2RA 1F11B 1KLGA 5I66B 1PBYA 3BPNC 2BY2A 3BGMA 3CUPA 3M17B 3QCVH 3RUGE 1HK6A 3MLTB 1KJMA 3QIUB 1YEJH 4XBGB 1CDUA 3LQMA 1YPZE 1VENA 3U30B 4M3JA 3FO0H 2XYCA 3DWTA 3NA4A 3KG5A 1E4WH 2VLKB 5FO9A 2Y07H 4QY8B 5KSUB 3P0YL 1DBML 3S88H 1NAMH 2DMBA 5E6IA 3ULVD 1PG7L 5I0DA 2A9ML 5E6ZA 2GY7B 5DD6B 3C08H 4GS7C 3BP5A 4Q9BA 4K7FB 3U79A 4PP2A 1U58B 1ZHNA 1UFUA 2VR4A 4DQOL 1AXSA 4WFEE 1EHXA 3SCMB 4G43A 3K8LA 3I75A 4KHXH 4WUUE 2Z8RA 1NC4B 2OJZL 3P9MB 1BEYL 1EDQA 5EULV 5IW6B 3PDOB 4YHIA 5SWZE 5TFSL 1FZKA 4KGLA 3MNWB 4NN6B 2D7NA 4ONGL 3RGVA 4AK1A 1CL7L 1NANH 1BOGA 4ZFGL 1HQ4A 4EDXB 5LXGH 1X5GA 4R2GB 3LS5L 1XMWA 2E6JA 3SE4C 5FOBB 2CDEA 5F1OB 5FM5O 1Z0NA 1AO7E 2XN9D 4KUCD 4MAUH 2YRPA 4U7SA 5KVEL 3ARUA 3FMGH 3UTTD 1A64A 1AD9B 4OM0H 3MLZL 4PJ5A 4EXPX 1CXHA 2CXGA 5GSVA 2ZOLA 3I02A 5FV1L 1JK8B 1WIOA 4PUBH 1MCKA 3EOAA 1EXUA 4ODVL 5I1DA 1V05A 4XI5C 2A6DB 2P24A 4L8SB 4PRID 4UTAL 3EHBD 2YPLD 3CVHB 1I9EA 3NGBC 1DBKH 1T04A 3C2AL 4NCC2 5IHUH 2BP3A 4X4ME 5B4MC 4ZODA 1K8IB 4RAVA 5INCB 2LU3A 3SOBH 5FYJE 3VI4F 5HDBF 4CJ1A 1ZHBA 3TA3B 4ZOCA 2QQNL 4OBSA 5EU4B 1QFWH 3K80A 3L6FA 5CLWA 1NCWL 2GYSA 2VLRB 4P5TC 4A6YA 2YD6A 1M7IA 1JGDB 1E6OL 3F7RA 4FQHB 3MA9L 3A6CH 2WIIA 3UBXG 2NNAA 5ID1B 1EJOH 5LKNA 4JFDD 2ZUUA 3S35H 1A14H 1ZLWK 1CICA 3REWB 1U2CA 3LN4A 4LLWB 4KI5D 4R4ND 4JHAL 4M1GL 3NN8B 4RA0C 4AL8L 4S1QH 2A1WH 3SDAA 2Z31D 2W60B 3UTQB 3QXUA 4NP4L 3ULVE 1E4KC 2J4WH 3FJTA 5D7JC 1ZT4B 3DVNA 1B2WH 4RGMC 4XCNA 5CSZB 4Y16C 3P9LB 3H9SB 1RZGB 1T2JA 2R1XA 1DLFH 2YWYA 1KCUL 4JVPA 5C0CD 5J6HA 3G6AA 1KLUB 5D7SL 1FJ1B 1KN2H 1T1WA 4D8PA 1H0DA 2XZQL 3HNVL 1CDCA 4KTDH 4HPYH 2XRAL 4PJ9D 1ITCA 2VZ1A 3ZT6A 2YBRB 2R69H 3K46A 4X8XA 2BOBA 4HGKC 5GS1B 4BSWA 5EBMA 2CUMA 5E03A 5C0NC 3GIZL 3DUSB 5E8EA 3BOVA 4D9RD 1KB5A 4HFWA 5CEZD 5F9WC 5DHVA 4GXVL 3L5WA 4NKQB 4G9DB 4JB9L 2EEBA 4P5KA 3TEUA 2Z92B 4Q6IC 4RX4D 4OFYD 3VD5A 4NNPL 5TE6H 3JSSA 3QISA 2JE8A 3DX9B 3NZHL 4P23B 4DKFL 4ZTOH 4JM2F 4M6NL 4PRIE 3PWNB 3K0WA 2Y25A 1FO0B 2YD5A 2IAMB 1M71B 4BZYA 1XF5B 3D39D 4TSBH 1VFAA 1BZQK 5FV2A 1AP2B 1VADA 2VDRL 1VFMA 4BZ2L 1AXTH 2DOCA 3WUWA 1DSFL 2ARJB 1UXSA 5I71C 1S9WB 2RJMA 4I4WA 4HH8A 1WFOA 3SDCA 3AU1B 2GT9B 4KV5F 3RKDC 3Q6FA 5EC2A 2D7PA 3SGJC 2NY7H 1MHHA 4YHML 3CXHJ 1GPOH 3ULUE 1P9MA 3VFWA 3D0LA 5KTEL 4PREB 2UWEF 4MWFA 5I1HL 3OKDB 3BAEH 1A1NA 4JRYB 4N0UB 2CGRH 3KPNA 5DUML 3HMXH 4H88H 1CTOA 3WJLA 4RFOH 4Y19A 4I2XE 1PAMA 5E4EB 5J1SC 3MXWL 5FA4A 4LRIC 5BRZD 3QEGL 1TXKA 4GW5A 12E8H 1XGTA 5C07D 1JGUL 4WIQA 5A2LH 2B0SL 3P11L 3MJ9L 4OLZL 2VXUL 5FYJU 1UACL 1JUFB 3S37L 2QHLA 2Q6WB 5CIPA 1MRFH 4NRYA 1CLZL 4TN9A 4KWUA 2GJ6A 1AGEA 3MV9B 3BXNA 2W65B 1AFVL 4BJLA 2YD4A 3OJDA 5C0JA 4QHKI 5JIKA 2IFFH 1L4IA 4HV8A 3WCYA 1ORQA 3X3GH 2BSRB 4BA8A 4D9RE 5JLZA 5D4QA 1CD1A 3ARGC 4NHUB 4AENB 3JUYA 1SY6A 3BH8A 5C0RL 4TPRL 4KUZH 1MI5E 2J8UF 3OKNA 3C6LD 1X5AA 2XWTB 5IVXE 5CGMA 3QFDB 2VZVA 2NX5B 4KRPD 3VMNA 2D7MA 3RUGB 3SE9L 3TNMA 1U9KA 3P77B 1AGCA 1BJ8A 1YPZB 4MZ2A 4GW1A 1QBLH 1KT2A 5I8KH 3WHXB 1WCQA 4D9LL 1OWWA 1NLBH 1SVZA 3O11B 3OB8A 5H94B 3VWJD 4X6BB 3MMEA 3U7WL 2V9RA 3TBSA 5INDB 3GM8A 3F7QA 2AXHA 4LF3A 3TH3T 1IZKA 5IB4A 4WUUB 4YPGA 1LVEA 4PTTA 1VGKB 4OI7A 3QUML 5SWZB 4OGXH 5HYSA 1RMFL 2OXHA 3CH8A 2V17H 2FSEB 3P4NB 4JPVH 4F33B 1MY5A 2HMIC 2H8PA 3CFJA 3S4SA 2J88L 4HUVA 5HYFA 2J1KA 4YUEL 5C07E 4U6HB 3IDYC 3U1SH 5EZJA 5EA0L 3NCJH 1WC7A 2X5PA 1A5FL 1C7SA 1F8TL 3BH9A 1AO7B 5IROA 4HZAA 2H1PL 5DXWA 1TCMA 5MEOA 3G5YA 3VFVA 5IP4A 1Q0XH 1GZQB 3PP4H 1ONQB 4WWKD 3LKSB 3T0XA 1MJ8L 1OAUH 2CLVB 5FUOH 1T0NB 4HWZB 4G9FA 1CDHA 3MRNB 4H20H 1FPTH 2VUOA 4HIIB 4Z7WE 2R0ZL 3OAZH 3IU3A 4AG4H 4IRZL 5BMFL 5C08E 1Z3GH 4M4RA 1YJDH 5I8EB 4K7PY 1Y18B 4H0HB 2OTWB 4X99B 3LN5B 4YK4C 2A6KB 4UV7L 2AK1L 4X5WB 2NCMA 2BHYA 1IBGH 4K23H 1D9KB 4MJIE 1G6RA 5ABDE 4PRNA 2B20A 3B8SA 2V9TA 4P2YA 5HVHC 4R0LB 4E0RA 4FHBD 5H2BB 4UAOC 3UJJH 2R2HB 5C0IB 2HA1A 2F53A 3QEHB 5EO1A 3TO2B 3LSOA 4XPGL 1CT8B 5AD0B 1CTNA 2P8MA 4BUGA 4XMLL 1F90H 4K7PX 3ZL4H 2R0WH 2D9QB 5IR1B 4JFHE 4IDJH 5HYQB 4NPYB 1K4CB 4XNUH 1QFWM 4LASH 1DQTA 4XPAL 3ROLB 3O81A 32C2A 3H6JA 4RGOL 1QBBA 3QRGL 4GG6A 3FT3B 2IMNA 3JWOC 1JE6A 3RVVC 4WO4C 3ES6B 5DD0L 3FO1B 3U0WH 5D1XA 3VE0B 4D2NA 2MHAA 4MYWB 1NUDA 4ZNCD 1KG0A 5BV7H 2DAVA 3O9WA 3V0VB 1D3CA 5HI4D 3SDXE 4AEIL 1YEFH 1DQLL 3HLAB 4M48H 5GJTL 4PR5B 1MFEL 3BI9X 1NMCB 1J12A 2DM4A 2XN9B 2AJUH 3T0DA 3DNKA 5JTWA 1MF2H 2G60H 1OD9A 2FZ3B 1IEHA 4JKMA 1J1XH 3HRZA 1AJ7L 3MBEA 3TZVA 4DGYH 5A2FA 4W81A 2GTWA 4P4RA 3OL2A 4POZD 1SEBB 2NY0D 4PRIB 4F3FB 5E5MB 1PZUB 1DDHB 5F97E 1P6FA 3O3BB 4JM4L 2LFGA 4OQ1A 2DQCH 2M1KA 4MLSA 1A7OL 5CJOL 4UMGA 3FAXA 1ZLVH 5MERA 3DMMC 4RFNC 4KTEH 5C2BH 3GSOB 1U8QB 4ESKA 1CF8H 4KVCL 3V52H 2HJKA 3GIVB 1NGWB 1UVQB 4HPOH 1AIFA 2VWEE 5T5FH 2E7MA 4Y4HC 1OWRM 1FL6B 5IK3B 1OP3H 4V2CB 3V6BR 3GO1L 4L8BB 9CGTA 3CFEB 3EO0B 4ZAKD 3OXRB 5FDYA 4JFDB 5DMGD 2ATPA 3LEXA 5IEHA 4BH8A 2Z9TA 1EO8H 5IMKA 1KLFA 4DFHA 5HDOA 4OZHE 4XXDB 3JV4B 2J3SA 3LHPH 4ZNEA 5GGQL 2Z31B 3HZYA 3ARTA 4I2XB 3VFSA 4GAGL 4MA1C 5MENA 3GI8L 1LO5B 1S7TA 3WIIH 1AQKH 5ALCL 2R23A 3U4EB 3QEUA 3Q6GL 4OF8A 2I27N 4JHWH 4O5LL 5C0CB 1KJVA 4X6CF 5GS0D 5GS0L 3NVQA 4XMKH 1HSBB 3W9DB 5ILTL 1DBMH 3PIQB 4EOWL 1ZSDA 3V5HA 1QVOB 3S5LA 4U1JA 4R4FL 3MJGX 4LCWD 4XX1G 5BO1L 1DR9A 5I2IB 4RSVA 4LHUA 1KENH 5TF1L 1ZLSH 1A4JA 2BSTA 2E9BA 4G42A 3M1BB 2I60H 4S2SA 4NN7B 1BFVH 1FC2D 5TFSH 4FABH 4QRQA 4LEXL 1OAXH 1Q1JL 1RZFH 4YO0B 3RWJA 4ZS6D 5E8DH 4JZJC 1QO3A 5IVXB 4LVNB 4C4KO 3ORJA 3IYLW 3NACL 4N68A 4M7KH 2AI0L 3LS5H 3BPOB 2XNAB 3QUXD 2F58H 3HAEA 4EBQH 4HDIB 3GMNB 2CRZA 3D39B 4GBXA 1DL7L 5DQJB 1J8HA 1HDMA 1MCDA 3UPCA 2BVPA 3GKZA 4OKVB 2WINB 3QHZL 4MJ6B 5EBWB 3RGVC 3BVNB 5F7DB 3ALPA 5GRWA 4CDGC 5DK0B 4G80B 4L1DA 1AD0A 4D0BA 1RZKC 4G8EA 1LEGB 2HLAB 4HCRH 1EHAA 2VAAB 3IFOA 4RCAA 1R3LB 1TVHA 4S1SH 3V9FA 3NAAL 4JEGB 2JB6B 2EXYC 2CK0H 4UDTA 1A9EA 2EIBA 4J8RA 3TBYA 1I75A 2DTML 1GGUA 3HNSL 5ID0A 5SV4A 3C9NB 3RU8H 5BRZB 4LDOB 5GGSY 2WBKA 1AHWB 1WFNA 3HMWL 5C07B 5ANMA 5DJCB 4Z7QF 5EZIL 4OLYH 4YZFF 1Q94B 5T3XL 2NXYC 5TE7H 2XXCB 1J11A 1JFQL 2X41A 1IC7L 4ZNEE 3KDMB 1DANU 5SX5H 1UXWB 4F7TA 5ICYB 3R06B 1X5ZA 4BUHA 1ND0A 1IM9D 1S9VA 5MENE 2P8PA 1JYWA 4F9PA 3MC0A 4AH2B 3RL2B 3IXTB 3IB4A 3KYOB 3CDYA 4R6UA 2C3XA 1PKQE 5CD5C 3EYQD 4DVRH 3QIBB 4PJ7F 1JWUB 2B1AL 2QV2A 4FQIH 1ZMYA 4NM8L 4XPTL 3K74B 2R39A 3U0TA 3JWDL 2RFXA 5DDHB 2HT3C 1KXVC 2F8OA 3BKMH 3TV3H 1CICC 3QIUA 2NZ9D 1NDMB 5K9JL 2ERJC 3B9EA 1U8PB 3C6LB 3SDAC 1TZIB 5I1IL 5KSUA 4Z7UE 4QY8A 2ZG1A 3FO2A 4O51A 4KY1L 4KRPB 2YPVH 1VFUA 1CXEA 1J10A 1ED3A 1WZ1L 1RIHH 1W2KT 4WW2A 5JHDE 3VFUB 1RK0B 3NA9L 5EO0B 1JNJA 2Z8VC 5E99H 4Y4KB 1FFPA 1CFNA 3DETD 3X11B 4S0SD 1NCDL 1NC4A 5IB1A 3P9MA 4HIEA 3N9GL 5B38A 2NR6D 2QQLL 3G5VA 4PY8I 4D0DA 4LDEB 2EXWC 4YHZL 2E6QA 2J8OA 3SQBA 1ZVHA 1I8LC 4DAGH 2EDKA 3MODL 3HE7A 1R0AH 1M7XA 4RISH 1JF1B 4UBDD 4EDXA 1J8HE 1R3HB 3FTGB 3MZGB 1DSFH 2XQBL 1K4DA 3VG9C 4H8WH 3B9AA 3EYOB 1NCAH 2ZCHH 1F3JB 3P73B 3IDIA 2X4OB 1OAYL 3SDXB 3RVWD 3THML 3MCKB 1YEGH 5FECB 4RBPK 3FHAA 4ONOA 5E2WH 5DVMA 1YMMD 4L8SA 3P4MB 1BQUA 1WBYA 4X98B 5L0QB 5D7LA 5FHBH 2EDNA 4GW4A 2BNRD 2G2RB 4UILH 5D2NC 2DI9A 4NFBA 4PJ8D 2B4CC 4WWKB 5TDOB 1I3VA 2A73A 5D5MF 3CZFA 3BP6A 4HKXB 4L4TE 2F15A 1G0DA 2H2SD 1K8IA 1NCBH 2WANA 4ZSOE 1KCVL 5DJYA 2B0SH 1ZEAL 3KPSD 1XF2B 2DDQH 3MJ9H 4XPBL 1JYNA 1INQB 1VHPA 3MBXL 5GZOC 1CLZH 5FM5M 3MNZB 4FQHA 5T1KA 4GOSA 3EOTH 1FIEA 1KV3A 3AXLB 2BVYA 5ID1A 4FZEL 3OX8B 3GK8L 3ZYIA 1RIUH 3REWA 3WJLC 4PGEA 1LE5A 2IADB 1UEMA 2AK4D 3FQWB 1WBZA 3WXVH 1P7QA 4PJDE 1MHEB 5ESQB 4OD3H 4LNRB 2ESVA 5AAMA 5CSZA 1T0MA 1KNOA 3AREA 1CU4H 4LCYB 3L3IA 3VFPB 2VIRA 3SKNA 3ARBD 4PJBA 4OZHB 3A67H 3L7EB 1KLUA 2QSTA 1NL0L 4ZXBB 1S3KL 5BZWB 1CQYA 3VXQB 3O6FD 3BWUC 4P9HL 2AJYL 5LG1A 1BZ9A 2Y5TA 4L1HA 5JOPD 5EU5A 5F9OL 2X4SB 3UZVB 4JLRB 3SJVD 5IMLB 3QDHA 3DUSA 3PDDA 4X4ZA 4OJFH 2ICWB 4OGZA 4YC2B 1PFCA 3DX8B 4KDTC 1H3WM 3I50L 3HZVB 2WIMA 4C4KT 3PL6D 1NFDF 3RAJH 4XZUB 2Z92A 3MUJA 4OLVH 3BN9D 5KG9B 3E6HB 4DEPB 1K8DB 3ALWA 2BNUB 2O5YL 4PJCF 3ZDZF 1JNNH 3MUGA 1Q0YH 1YMME 1VA9A 3KLAA 3PJSB 5ELIA 5ENWB 2WP3O 3VCLB 1JHLL 1FO0A 1A6PA 3MJ6A 3BDBA 1M71A 5A16B 1VFBA 3GMPA 4FA8A 1AP2A 2R2BA 4PLJC 5KSBE 5HDQL 5KSAC 2X9YA 4IS6B 1F3RB 3OXSB 5E1HB 3V8CA 5F70A 4HKBB 5HHVL 2ARJA 2NY0B 2OL3H 1G9NH 2PW1B 4KVNL