2Q9OA

Near-atomic resolution structure of a melanocarpus albomyces laccase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
559
structure length
558
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title A near atomic resolution structure of a Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 182
structure length 558
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA03
4M3HA 4KNUA 5B3SB 1KGYE 4PCYA 1BXAA 5D4IA 1BEXA 1JZFA 4DP1X 2PP9A 4KO5A 4GY4A 3NJMA 4AKQA 2GSMB 1R1CA 1JZGA 2IDFA 2EIKB 1AIZA 5I26A 1NZRA 1OE3A 4FAAB 2UXGA 2XVBA 3V9EA 3WNIA 3UAAA 4K9JA 1ET8A 1JXGA 4KNSA 1X9RA 4BK5C 2W88A 3N55A 3S8FB 3FPXA 1L9RA 2FQFA 3OD3A 3WG7B 5PCYA 1TEFA 3AG1B 4G7RB 1SDDA 1PAZA 2AZAA 2YAOA 2P80A 4HAKA 4PAZA 1CURA 3BQVA 1E67A 5F7AA 2GHZA 4ZK8A 2VSKB 3CVBA 1JXDA 4UANA 2BO0A 1GS7A 2DWSA 2J57A 2TSBA 3T6WA 3UABA 2VM4A 3WNJA 3AG3B 5TK2A 1WS7A 1URIA 2FQEA 3EH4B 2CJ3A 1FA4A 3FPYA 1IC0A 1EZLA 1JVOA 3WIAA 1GS6X 1ADWA 4FA7B 1L9SA 1CUOA 1VLXA 1PLAA 4AZUA 2AZUA 2E86A 1KYAA 4DP7X 1JXFA 4A68A 1PNDA 3T71A 3QJUB 1GS8A 1XB6A 3WI9A 3WKQA 4G72B 3T6XA 2HRGA 2H3XC 1BQRA 2A3TA 2UXVA 2YARA 3T9WA 4A2DA 2EIMB 4Q8BA 1JVLA 2VSMB 2FT8A 2MTAA 4P5SA 3NJKA 4WKXA 1RKRA 3IN2A 1SFHA 4JHUA 3S8GB 4A2FA 2HLEB 3NJGA 4DP2X 4YSSA 1MZYA 4RH4A 5B1AB 4YVNA 2B3IA 4E9VA 2GBAA 3NYKA 1HAUA 2BP8B 2IDSA 2GI0A 2CUAA 3ASNB 2IH8A 4MFHA 3IBOA 1SDDB 2HRHA 4KO6A 3EH3B 4KNTA 1FFTB 2BZCA 5EHFA 2Y69B 1E5ZA 4BWTA 2OV0A 3X1FA 1AAJA 1ID2A 2GIMA 2PP8A 1NWOA 3H4HA 1UATA 1IBZA 1TU2A 1ASPA 1ILSA 3KW8A 1BYPA 1SF3A 1JZHA 3FQ1A 1NICA 3ASOB 1XMEB 2XX1A 1BAWA 1EHKB 3T6ZA 2BW4A 2QDWA 1AZCA 5AFAA 4BWWA 1DYZA 2ZONA 1E30A 2Q9OA 3IEAA 1PZBA 2B08A 3QJVB 4F2FA 1OE1A 4JHVA 2XV0A 4GYBA 2XXGA 1QHQA 4HCGA 1ASQA 5B1JA 2FQDA 3X1GA 2BHFA 3OQRA 5I6MA 4YSEA 3AY2A 2GC4C 2PPFA 4KO9A 4AKPA 4BXVA 1GR7A 2NRDA 1BQ5A 2OCCB 4A2GA 8PAZA 2ZOOA 3PXLA 5FC9A 5D4HA 1AS6A 1ETJA 1WA2X 1L9TA 1E65A 1BQKA 4DP5X 3HEIB 2FT6A 3TASA 1DZ0A 1SFDA 1IKOP 1M57B 2J5WA 2YXWA 3FS9A 2GB2A 2PPAA 5F7BA 1AANA 4DP0X 4CSPA 3NT0A 1NWPA 1SNRA 1RCYA 1ZDSA 3CDZB 1OV8A 3TU6A 1T5KA 7PAZA 1V55B 1KDIA 1FWXA 3TBCA 2LLNA 2ZXWB 5I6KA 4QLWA 3TA4D 1X9UA 2QPDB 1J9RA 2PP7A 4G71B 2HXAA 4DP9X 1V10A 1AZBA 1OCOB 1WS8A 2BWDA 5AKRA 2XUWA 4F2EA 4HHWA 1A3ZA 1A65A 2OJ1A 2UX6A 4YVUA 1B3IA 1CYXA 5I6NA 1A4CA 2HZHA 3SBRA 1AS8A 4E9XA 1OCZB 3GYRA 2AFNA 1JOIA 2TSAA 2DV6A 3QJTB 4KOBA 4CSZA 2XLLA 1PLCA 3FYIB 2H47C 3OMAB 4BDVB 2PPCA 3RYMA 1L9PA 1NTDA 2XWZA 2BW5A 3H4FA 4KOCA 1GY1A 3ABMB 4YSQA 2FWLB 2XU9A 3FU7A 5LDUA 3NSDA 4WTQA 4W9ZA 5B7EA 3X1BA 3NJJA 1J9SA 3NJNA 1NINA 1AG0A 3QPKA 1ET5A 2IDTA 2IH9A 2J56A 1TKWA 3FSZA 4UAHA 4NB7A 3JT2A 1PNCA 2EIJB 2IWFA 2FQGA 3JTBA 3NJIA 3ZBMA 2EILB 2MRYA 1CC3A 4YSRA 4E9RA 2FJSA 3DTUB 4YL4A 1V54B 5B7MA 3FYEB 3N2JA 3DKHA 1OE2A 1GSKA 5B1JC 1ASOA 1L9QA 1A4BA 2BZ7A 5I5IA 5E9NA 1JERA 3MX0B 1WA0X 5PAZA 1NPNA 1KCWA 5A7EA 3QQXA 3FSWA 2QDVA 3X2QB 4GP5B 3C75A 3ABKB 1GY2A 4BWUA 2I85A 2YAEA 2DYSB 4GP8B 5AZUA 4G70B 4UF7C 2VMJA 3AW5A 1JZEA 4AKOA 5I28A 1OOWA 2X87A 2VW7A 5I5MA 3FSVA 1ZPUA 1BXUA 1KBWA 1KV7A 2GC7C 1OCRB 4YSOA 2IAAC 1AACA 2JKWA 3NSCA 1ZIAA 2N0MA 1SF5A 3D12B 5B1KA 1PLBA 2VM3A 2RACA 1AS7A 5IY5B 2R7EA 2YQBA 2XXFA 2YAHA 4YSUA 1PMYA 2X88A 1SHWA 1N68A 2IDUA 2HX9A 1AZNA 1ET7A 3FQYA 2CBPA 1RZPA 3FSAA 4NERA 1NIBA 1I53A 2UXTA 1IBYA 2PPEA 4L0PB 4A2EA 2YAFA 3NSFA 4E9SA 4A66A 1TEGA 3H56A 2W8CA 1GYCA 4E9TA 3T6VA 2WSDA 3AG2B 2IWEA 3ABLB 1N70A 4KO7A 1NDTA 3SQRA 4DP8X 9PCYA 1CYWA 2VW4A 4BXSV 4Q89A 1XB3A 4F7KA 1JZJA 1KCBA 1SHXA 3NP4A 3PPSA 3ZDWA 3ZIYA 1J5DA 2FNWA 1AQ8A 4W1TA 1OF0A 1ILUA 3FQ2A 1NIAA 4TXVB 4A67A 2CCWA 3NJLA 2IWKA 3UACA 1ZIBA 2QPEB 1PZCA 1J5CA 3DIVA 1SJMA 2J55A 1YLBB 2XV3A 1AR1B 2HX8A 2BP8A 1A8ZA 3KW7A 2UXFA 4N8UA 1RZQA 2ZWNA 4GXFA 3U25A 1KDJA 4E9QA 2R7EB 1WAEA 2PCYA 3ABGA 1OCCB 1BYOA 4DPCX 2JFCA 2P80D 2PLTA 2QT6A 3X1EA 1MG3C 3WKPA 2AVFA 3EF4A 1E5YA 3PLYA 3CVCA 1ZDQA 3V9CA 2UX7A 2YXVA 3UAEA 1GW0A 2Y1AA 3PAVA 5ANHA 4YSDA 2YAPA 1M56B 2AANA 4GP4B 2CAKA 4AX3A 1PY0A 1MZZA 1PZAA 3G5WA 1XB8A 2BP0A 1BXVA 2PPDA 4M4RB 2DYRB 2I7OA 3IE9A 3NJFA 3NP3A 2WO3B 2HX7A 2DY2A 3NSYA 3EHBB 3MBWB 4DPBX 5TK4A 2YAMA 2XV2A 2FT7A 3S3BB 2FTAA 4NAJA 2H5UA 1F56A 2DWTA 3FU8A 3QJSB 1AZUA 3EH5B 2PCFA 1IUZA 3IN0A 4P5RA 3UGEA 3PAZA 4E9YA 3BVDB 3OMIB 3UADA 4YSAA 1AOZA 5B1BB 1MG2C 1JZIA 2CALA 3GDCA 4YSCA 1QNIA 3SBPA 3CG8A 3CZUB 4A2HA 4HALA 2XX0A 4X4KA 1J9TA 4DP6X 3TBBA 1PCSA 4G7QB 5D4JA 3NJHA 3S3DB 4HCIA 4HIPA 4E9WA 6PAZA 7PCYA 4YSPA 3PAUA 4YSTA 5I6PA 3CDZA 3X1NA 2XYBA 3FU7B 4QKTA 1W6LA 3QJQB 1ZV2A 4G7SB 3GXUB 2I7SA 1NIFA 3OMNB 2VN3A 3PCYA 2IDQA 1A4AA 3AZUA 2JXMA 1HAWA 4EF3A 3HB3B 6PCYA 3FT0A 1KBVA 1WA1X 2BWIA 5B7FA 4N4YB 1J9QA 4DP4X 1NIEA 1NIDA 5I6LA 1W8EA 2WO2B 3OM3B 5I6OA 1L9OA 3S3CB 2BP0B 1MDAA 4DPAX 3ERXA 4HHGA 4HZ1A 1PF3A 4JKNA 3CVDA 3FU9A 2EINB 3SBQA 1HFUA 1M9WA 3AG4B 3QJRB 4HCFA 1QLEB 3L45A 5I5JA 4AI7A 1AZRA 2YAQA 4BDVA 4ENZA 1W6WA 3ZX1A 1NPJA 2Q5BA 1AG6A 2VW6A
chains in the Genus database with same CATH superfamily
1ZWIA 5FB8A 1AGCA 4FD0A 3N40F 4Z7QE 1JMXA 3MMEB 4DP1X 3CU7A 4GRLD 3WL9B 1Y07A 1N18A 1S5HA 5JOFB 2EDEA 4Q9RL 4YHNA 3CN0A 4L0ZA 1F4XH 1TITA 3WUWB 4V11A 1B2WL 1D6VH 3VX1A 4FLRA 4LHUB 3BHBA 1SMAA 4FAAB 2ATKA 2IC2A 4ZFFA 1P7HL 1TJXA 3HG0A 2W9DH 3RPIA 1DJGA 2NY7L 1WAAF 5DEZA 3PJSA 2W88A 1DUYA 4OCYL 3FPXA 1WFTA 4I48B 1T83A 2FQFA 1JK8B 3EGDA 4XN4A 3S4SB 5DTFB 5BOJA 2I24N 2HJKB 4DKAA 3TO4B 4HGMA 1AD9A 1FNHA 5D2NA 3O6KL 1OGTA 2X4RA 2EH8H 2EABA 1QLEH 4Y7OC 2H32H 1S5IH 2R1WA 1KN4L 2KZBA 3S34L 4AIEA 3R0MA 2NX5D 2C26A 5DGQA 3JUZA 1WK0A 3FUDA 3ZRCC 3UFIA 1JPGB 1DVTA 3BX7C 2YFOA 1QLRB 2VDKH 4Y1AB 4HJJL 4NM8L 4ABWA 1QSFE 2X1QA 4JNXA 1BJ8A 3GMNB 3KPMA 5LBSL 1INDH 3U79A 1PNDA 3C9NB 4JPSA 5INCB 1BA9A 1QNZH 3TCTA 3DURA 1MCSA 1JZ3A 1T03H 3BLBA 1QI3A 1A3LL 2IMMA 2P24B 4GAAA 4CUCA 2AK4E 5LBGA 1M7IA 4AQ1A 2NY2B 3U7YH 3OXRB 4E42B 2VQUA 3DNKA 3GSQA 4KXZH 3I50H 3IDIA 1MCPL 2CK0H 2W94A 1GJWA 3MI6A 5GRYA 3QDME 2JJTA 4A55A 2NXZD 1AQDB 3ZOAA 2BFGA 1MW0A 1QASA 2F5AL 1HU8A 3O6FD 4AGPA 3JTSB 3I3BA 3BP7A 3F5WB 3PL6D 1Q0XH 3Q2NA 3RVTC 4N3UA 1FFTB 1NDGB 3KJ4B 4MVBD 2Y36H 3QHTC 4FTVB 4GOSA 4GRMA 4B9KC 1ZVHA 1A6VH 4F93B 1ILSA 5LWYL 3SKNA 1DBJH 2WINB 5I0VA 3L2LA 1DVFD 1MHEA 2FZ3B 5C0GB 4JN1L 3NJVA 3WMSA 2BS9A 2HVBA 1G5AA 3RTQD 3VXMA 3TCLB 1PZBA 3L3DA 3CQFA 4CJ0A 5FO8B 2IFFL 1FC1A 4LHQB 4PWJA 5D7LB 3A5VA 3VFMB 2HB0A 1U3JA 3L1EA 4ZMXA 3O3EB 2MTPA 4DKDC 4EIGB 3DO3A 2XFGB 1E28A 4LCWB 3SN6N 5I6MA 4MA1B 2GC4C 4Q4IA 3VJ6B 2VDOL 4RGNE 2C34A 1W0WA 1FN4B 1FHGA 1A1NB 4OLXH 4R96B 4NZRH 5DQ9A 5TQ2H 3VWJD 3NCFB 2X4OA 1WA2X 5FM5M 1F86A 1BQKA 1UB6A 1X4ZA 4KJWD 5KJ4A 4XN1A 1JV2A 4KI5D 4XTRD 3V4UL 4IS6B 3WV0A 1XGTA 3R06A 2JK5B 2KT6A 5H4YA 1R24B 4O00A 1HQ4B 3RNQB 5INDA 4MDJA 3B2MA 1CFNA 3CE1A 3KLHD 1IQDA 4JPWH 1KJVB 5IW3A 4ESKA 1V55B 4PG2C 1SBBA 3UPRA 1FG9C 2VDLB 1YMMB 2WVVA 4TUKH 3TH2T 1GRWA 5EBWB 1CLZL 4HKBA 1YPZF 3MLWL 4YHKL 4PN6A 1GGUA 4NRZB 1F4WH 4JREC 2XT1B 1M4KA 3IDGB 4LQ1A 2C1PA 4PG9A 4JFFD 3WLBA 4I3GA 1CD8A 1D9KC 1KB5H 3GMLB 4HWZB 5BZWB 2D4DA 2YGPA 1IM3D 2JH2A 2YQ3A 2V7HA 4OJDH 3SDCB 1FF5A 4FL4C 1JPSL 3I84A 3ZTNH 5C92A 3L4YA 1NOLA 2AFNA 3F58H 1QACA 4GMTH 3LDBB 2X38A 2AXFB 2X70A 2A99A 5HY9A 1FO0H 3V0JA 4DQAA 2ED9A 2CJUH 1UD3A 2VERA 4PVNA 1OAZL 2XWZA 5HHPA 2G60L 3LKRB 5I0XA 1MJ8L 1ERNA 4HJ0D 4PD4J 2HT3C 3OMZA 2P8LA 5F7UA 1MCOH 1C5BL 3KR3H 3MJ6A 1X5MA 4HFUH 1HZKA 5IHUH 2VYRE 3KL3A 2HG0A 2APWA 4MLSA 5GGRA 5ESAB 3A67H 4HV8B 5T3XL 2VO5A 5IVXF 2C9PA 2O26U 1FLTX 2G3NA 2IWFA 3O4LD 3H85A 1Z9MA 4W93A 4LFHD 1P2CB 5ES4B 4E9RA 2UY6A 4LCCA 1G0DA 2XFXB 3ARUA 3AT0A 4YZFE 5I5IA 3TIDB 1IC7H 2Q87A 3KWWA 4F9PC 5GS0C 1UXLA 3H0TA 4XGZA 5KOVC 3OWRA 4XOEA 5AEAA 1BLNB 1F58H 1OGSA 4POYA 3KYMB 4KUCF 4GRLC 3C75A 3VFGH 4K8RL 1KYFA 1T0MA 5LHDA 1DJHA 3B9KA 5T1DL 5FYKU 1GVIA 1XBDA 4HSCX 1T80A 3FQRB 5EC1A 5MP6L 4JM4L 5GSVB 4NKDB 4F91B 2VQ1A 2J1XA 3T2NL 1HS6A 1DHKA 4KROD 2W07A 3HZVA 1KBWA 3VTTA 3PHOA 4J2QA 4U33A 3V0HA 1KV7A 4LEEA 5GHWL 4CMHB 3LSOB 4LLQA 3QZLA 1UJTA 4IRZL 4AM0Q 4PIRF 1DCLA 1M2OA 2V9QA 1RULH 3IMVA 3EBGA 5HP5A 1N19A 4HT1L 3QI9A 2JKTM 4N1HB 4Z7WE 1ZE3H 2GSGA 3D4CA 2YKLH 1KGIA 2RACA 5DMGC 4IGBB 1T3FB 1NMCB 3MUGA 3W3BA 5DHVA 3KLSA 4BQ8A 1G7JB 4HKJB 4OZHB 4EI0A 3GLDA 2EC8A 2ROXA 1NGWA 2QHRH 3Q7JA 3SBWA 2H3KA 3QXWA 1Z1WA 1J5OL 4X9YA 4Z7QF 5JIIA 1EGJL 2QQKL 3EH1A 2V7NA 3HBZA 4QY8B 4JRYB 2CO1A 2A74B 5JQHC 2EYSB 3MV9B 5LGKA 1LEGA 1WITA 2Q1EA 4AEIH 1TTFA 1OAXL 2ZKXA 1IZJA 4GAJH 3Q05A 3TVMC 5BCAA 2OCJA 2JJUA 3D25B 4Y2DA 4DIXA 5J1AA 5CLYA 4BZ2L 3GBNH 1S3KL 3BKCH 4KXBA 3FRPB 3FFOA 3CBJB 1VFOA 5BRZD 5L0QB 3L7FA 4BXSV 4FQ1H 2D31B 3DJZA 3A22A 3KPLB 4RA3A 4PRID 2CUMA 3ZRFC 2ZUQB 1Z7JA 3CFJA 3UDWC 3OKEA 3L3OC 4NUPA 4PR5A 4HG4K 1CFTB 1FORL 3UTZA 1UCTA 2ZWYA 1CTOA 2P26A 4F9LC 2OAAA 3RFZC 3WEAA 1FL3A 3QRLA 5HDQH 1ES0B 2NXZC 3PWUB 4LVEA 4KQ3L 2Y7QB 4PRHB 2XV3A 3JV6A 4LLMA 3WSQL 2VAJA 5J7CC 3QA3A 3O6FC 4OIAA 4HJ1A 1LDSA 3APCA 4LQFL 5F7MC 5KSAB 3ABZA 3ME0B 3PL6C 2WWOA 2JFCA 2FEEL 4MVBC 2W9LA 1MHCB 3QZWA 4HGWA 4PRPA 5M7QA 4KHXH 5DFTA 4M5YL 4M1DL 1QSEA 1G84A 3SCMA 1BJ1J 1SJHA 1GMEA 1RZ7H 4WU7A 1K4DA 3LMJH 2WP3O 5HGAA 2QFPA 1PFOA 2BC4B 1L7TH 3EFDL 4XBMA 1TTRA 1EERB 2X4PA 4AW7A 4UILH 1WDAA 4NXKA 5ISZB 2Y3AA 4FNPA 4QGYA 2PYFB 3SE9L 4NENA 4JB9L 1BXVA 3ZYOA 3NP3A 3IE9A 4HS3B 5GGUB 4I5BB 2EICA 5CR8A 2ICEB 2OSLB 4XP5L 3HAEB 1E27A 4X7DC 4FXGB 1NCWL 3CFBA 1DE4B 1J05B 1WHPA 2C9AA 4K2UL 2D0HA 3FU8A 5MEPB 3Q6GH 4OBSA 4CGTA 1B2YA 3F65A 1NC2A 1A2YB 2VTFA 3PWPE 1NC4A 3RY4A 1RXLA 5EU6E 5IJVB 1IGCH 1W0VB 3IFOA 3VWJC 5KSBA 3SDDD 1RIHL 3WNLA 3C2AH 4OV5A 4YSCA 2ROYA 3QUMA 3D87B 1BM7A 3D9AL 1ETB1 4KI5C 4S2SB 4BINA 4HXBH 3WUWA 3OGCA 5CIPB 3NA9L 3UJIH 3BAEL 1ZANH 5CEXA 1DBAH 1MPAH 2UZPA 1OLLA 3U4BL 4DCQA 1T20A 5F9OH 3ZKQD 4UAOB 3SQOL 1J8HA 5I6PA 3FO1A 3MLYH 4Z7UE 3KLHC 3GGWA 1NLBH 2AQRA 2ZXDA 3U1PA 4FI6A 1ZV2A 2CSPA 3CH1A 3L3HB 2QKSA 5GGSB 1OSPH 4ZOEA 5BVJA 4G43B 3S4SA 5SWQB 2L4OA 1TSRA 2DM2A 1KBVA 3AGWA 3S37L 2HJKA 3EO0A 1NIDA 4Y16D 4YQXL 1JFHA 3V10A 4PJ5A 2VDMB 1HKLH 4X99A 1NAML 2MJWA 1A14H 4AL8H 2P8PB 4PLJC 1YO4A 4Q7DA 3PQYD 4QTIH 1TZHB 1M9WA 3I6GB 3QJRB 5LAXB 3FTSA 5CCGE 3OR7A 4DZ8A 2UUDH 2Z31A 4P3CH 5D7IE 1YC8A 5L4JA 4IEFA 4ENZA 5FECB 3HC3L 1JK9B 4Y1AA 3U7WH 1P7BA 2K7QA 3TO4D 4PJFE 3BVNB 1GZQB 2WBJA 4TL5A 1ZPLA 4HEMA 5D4IA 4M7KH 3X14B 1GKEA 1B6UA 4FQJH 3VXSB 1GTFA 5INCA 3DO4A 4E36A 5C0CD 3DIFA 5AOZA 2E46A 4ZJ9A 4PBXA 4AGOA 1PU0A 4CVXB 4FXKB 5DMJB 3FQWA 3MBEC 3QXVA 5D7SL 3TEUA 1EJOH 3D52A 3G5VA 3ET9F 2BJML 5JR1H 4X6CB 5T33L 5H35B 2XQBL 4YFLI 1Y18B 4LOUD 5F0PB 4XO8A 4TVSa 4HUCA 5IMOB 1BPVA 1PD1A 3AB0B 3EYVA 2K8QA 3AY4A 1CT8B 5JNYB 1CURA 4NQEA 3FU0A 5A2LH 5KWYC 3CVBA 1M1XB 4DGYH 3GHBH 4JJ5B 4D8PA 5DJAA 2CWRA 3VGBA 5IUCA 3WN5A 2CPUA 4W9DC 4UTAL 1ZHKB 1KTLB 1URIA 3RBSA 1BFOA 4BD4A 3IPEA 5B39A 2V5YA 3UG5A 5C0GA 3C08H 4CADA 4FA7B 5EZOH 2H7WA 3QQ9D 3WE1A 3Q2CA 4IIQC 5IQ9A 5JPMC 2KYIA 5JXEA 4UQIM 2FJGB 4PB9L 1S7TA 3HI6H 4K3HA 5IBLC 4N2FA 2JKRM 2VJ0A 2OSXA 4L8SC 1IE4A 2G5BA 2Z8RA 4FTVD 4QRSB 2DWDB 3U46B 4M1GH 4RZCB 2ZOLB 2P5WB 3GPEA 4HWBA 4B0MM 3HN3A 1MRDH 4A2DA 2NW2A 4M6OH 1NFDB 1GGIH 3L9EA 1SEBA 2K9UA 5AOKA 3CHPA 3VJ6A 5DJXA 1CD1B 4PGDA 2HLFD 1UWXK 1Z0MA 2UYLB 4ELMF 2WXJA 4MXQD 3DX1A 3MBXH 4AXWA 3DUSB 4QXGL 4CBZA 1AYRA 3FFDA 3NJGA 1NGPL 4RH4A 1HEZB 1BZ7B 3EYFB 5D7LD 2P9RA 3RVXD 3TIEB 1U2HA 5HYJB 5I1JL 5I1LB 4H7VA 4IS6A 4H44C 4QO1A 3K2KA 5H4ZA 3ASNB 1NBVH 1RUMH 4LCWD 3GNML 2HRHA 3GSUB 1A6ZA 3L7EB 2K8MA 3FUMA 3AFLA 1HQ4A 3BWSA 2Y1VA 2O6EA 4B5EA 5FYJH 2VXUH 3QE5A 4N0RA 3TTSA 2BZCA 5JHDE 1TZOA 4Z7WF 5H94A 4BELD 5LAPA 4DESA 1UM5L 2GTQA 1AXSB 5CEZL 3KPSB 4OM0H 1ASPA 3KD4A 5MENB 1M05B 3OPZL 1P5VB 1XVSA 4HSQA 3VSUA 4ZNEA 3EYQD 1OIOA 1RFDH 3LB6D 3LNDA 5DEJA 5HJ3B 3VXRD 2CNZA 4PBDA 3TT1L 5BJTB 2QGDA 1RH8A 1WFJA 3FCGA 1DUZB 5BZWA 3L9RA 3LKOB 2VNCA 3D69A 1RQ5A 2P52A 2NNCA 2YPLE 3D48R 3QH3B 4LCUB 2VDOB 4OGAD 3BCDA 5C07B 2CCVA 5EUKB 2J1ZA 3AQXA 5I17A 1OSZB 2HKHH 2IXQB 4ABQA 1G7QA 4DZBB 3QIWC 2ODIA 4DN4H 3LN5B 4XPBH 1AQHA 2ITDB 1FZOB 2H8PB 2BHFA 4DFHA 5ENWB 2NY5L 3VA2C 3C6SA 1P5UB 2WKLA 3GI9H 4WQOA 3SDCD 5FM5O 5FHBL 1KC5H 3MROB 1UZ8A 5LCVL 1BZOA 1WV7T 5KS9F 5HD8C 4MA7L 4ODXB 4TNGA 5CEYA 4F33A 4BFNA 1M57B 5F6HI 2OW7A 3WIHL 1G87A 4YHZL 1SY6L 3IDJA 4HCRA 3LZLA 3C60D 4JO1L 5F7KC 2GB2A 2PPAA 1YEIH 2HJFB 3OPUA 1AANA 3AU1A 4FJYA 3UYRH 1I9EA 3NRFA 3IRCA 1I7ZA 1L6PA 1G7IB 2QKIB 1WBYB 1C5DA 1EMTH 2XFXA 3ZUCA 3D8MA 3DHJA 1MFVA 4GW1A 4WJKB 4I1RA 4IBVA 3TF7C 2AEWA 1A64A 5EU5A 1KIQB 1J9RA 1U8JA 3TZVA 3EDFA 3U0WL 3SJVA 5IP4A 5AKVA 5DZ9A 5ALBL 2JQZA 3RWFA 2B15A 4KI5E 1PZ2A 4Q4EA 4UV7L 3SDDC 3MJ9L 2DDQH 1GA2A 3P77B 3O6LH 1CDGA 1EA9C 3D7PA 4ZNCD 3WFBL 1OCZB 2G3XA 3MOBH 4D3CH 5HYFA 2DV6A 1NKRA 4WUKL 25C8L 3BKJH 3PV6B 4LEXL 3ZXAC 1MVYA 5BNXD 2APFA 4H8HA 3LSOA 3UP6A 5TE7L 2HKFL 4KOCA 2Z1PA 3ZE1E 2WUBH 15C8L 4RRPA 4R4BB 3ZZQA 2CIKA 3FAXA 3NSDA 2E9WA 4QF1A 5LDUA 4ZMWA 3MRRB 4GXVL 3KVDD 1FFPB 4FGMA 1EZVY 1HOEA 1LEKA 4KVNH 1G7JA 5AENA 1TEYA 2BCMA 4H40A 4JGJA 2IH9A 3G5YA 1IGML 4FULA 3VU1A 4QT5A 4ZPTA 4W9HC 4TULH 4HF5H 5FOBB 4F80A 4P2OA 4BSWA 2FQGA 2QV4A 1E7VA 1OCWH 2DS4A 2YO3A 3AS2A 5JQIB 3BPCB 4QRRA 3X3FL 2SODB 5GISL 4MA3A 3W5MA 1NEZA 3DTUB 2BCKA 4OZGE 5CP3H 2MCAA 5B7MA 4YNYB 3FYEB 2V2XB 3IDUA 4OSUL 3EH2A 4IGBD 3Q06A 1GSKA 4X6BB 1L9QA 1FHNA 1AD0B 3J8F7 4GI9A 3G6AA 4PJGE 4BGDA 1BF8A 3SPVA 4MX7B 3VGEA 4Z7UF 1UH4A 4PGBB 4NNYB 1NANI 2WLIB 4JRYD 3RLSA 5C9JB 1YY8B 5CLWA 3U9UB 5GS1C 2BNQE 1QSZA 1FGNL 5E6RB 3EJSA 4Y89A 2FYYA 5CBEA 2R29A 2D03L 5AZUA 3HRZC 5DI8B 1V3LA 1I8LC 2MSPA 4UIKH 3VFOB 5JHLL 1K85A 4OT1H 5DEGB 1NM9A 1HL9A 3UAJD 1TJIL 4B3VA 4F7CB 4S1QL 1TUPA 5EZJB 1FDLH 1GHFH 4FQCL 1TFPA 1G9NC 2NY3C 2OTWB 2FECI 1T5XB 5GRVK 1UCBH 4KDTA 2WY3B 4FMFA 1TDQA 2P46B 3BP4B 3U9PL 2IH1B 1N2RA 2Z4QB 5KSAA 3ME0A 1ND0A 3OKYA 4L5FE 3TNMA 4PJDF 4FA8A 5HGBB 2DJUA 1D6VL 1QLFB 4ZTOH 1GOGA 3B1TA 1F11A 2X4QB 3Q2VA 1HE7A 4L3CB 5DR5H 1KJ2H 3WJJA 1IQWL 2PPEA 3QDHA 1YZZA 3QUXB 4PRHD 4AVKA 4J3OD 3CPLA 3ARFB 2BRRL 2BC4A 3DX4A 4B9GA 1F18A 3VCLB 1DQLL 3LN9A 4AWJC 2PYFA 3TWCH 5I73B 1RPKA 3ZKMD 4PJXB 3BPOB 1R3KA 1M2VA 2QQLH 1OY3B 4MJ6B 2WXFA 4QRQB 2OQJB 2BSEA 5GGTA 2XN2A 2EDFA 1NOAA 1XX9C 2FIKA 2YC1A 5HPMA 4Y0GA 3O11B 1MXDA 1S5IL 1UD2A 5L4FA 4Y4FD 5EO1B 1EAPB 5HI5D 4X0KA 3GI8L 4K07A 2HLFC 3F7KA 1S78D 3WD5H 1H3VA 2NOYA 1W0VA 4QHLA 5E1GA 3UL4A 5KBLA 5ISZD 1LYQA 2VC2H 1XHHA 1ZIBA 1YSOA 4FYQA 2VDKL 3ULUD 4BA0A 2Y22A 4S2SA 4N86A 4OBRA 1I1FB 5C8JB 1PCXA 3F12B 4LHJB 1INDL 1AGDB 3KXFA 4FRWA 4HZLA 3VFSA 5BRZE 1NGYB 3K7UA 5J9PA 4GKSB 5IZ7A 1QNZL 4WFGD 5A7BA 3KHQA 1T03L 1BHGA 4MYWB 1OM3H 1EDYA 4PRIE 3TNNB 5ICYA 5DHEA 4L48A 5K9OB 1DQQB 3UTOA 4IBUA 1S9WB 3RWHA 3U7YL 1FGVL 4M5ZL 2VLMD 4P4KB 4X8JA 2H2SC 5L8JB 5SWQA 1JGIA 1U8NA 1FFNB 1NCDH 3JWOC 4K7FB 4WV1A 4XB7A 3LB6C 4IMLB 4F92B 1QG3A 3QHFH 2Y06H 4OKVB 1TZ8A 1T1WB 3O0LA 4LVOC 5FYKD 3NCJH 4DVRH 2AANA 4GP4B 3UZEC 4AM0B 4KRPC 3Q6FB 1O0VA 4P9ML 3D85B 3MRCB 2XWBB 3N1FC 2ODHA 4PWHA 1ICTA 1S46A 5TF0A 3TX4A 1Q0XL 5DQJA 4K3GA 3WEXA 4GQZA 5CCKH 1KPVB 2F6AA 3I6GA 5LAXA 3JWOH 1QBAA 1YG9A 4K3EH 4JANA 1G7MA 1A6VL 2DWTA 3U0TA 1TVDA 3QWRD 4PRNB 1O6SA 5C0IB 2ESVB 3X13A 4Z7VA 5KYWA 1DBJL 4JY6B 2YJLA 2J5LC 4LKXB 1P84K 3BVNA 4PW4A 1FYTB 1ZVSB 5D7KD 5HJGA 3VXSA 4WNQB 1VAHA 4JPIB 5JHMA 3II1A 4PJIB 1JZIA 4ONHA 3SDAD 5I9QC 1P4BH 2VLKE 5I1HH 1T04B 1D7CA 2MWCA 3B3IB 4NZ8A 3NH7L 5F44A 1QBBA 3VRJB 5JTWA 3C60C 1JGEB 4IRJB 3DXAD 4G11A 4FXKA 2OMXB 4OQTA 3P11H 3T2OA 1D5MB 5F1SA 1KCSH 4FQHA 4XI5C 1F45A 2F54A 4Q58C 1QVOB 3ZTJG 5FF6B 3FB6A 3OB0K 3I2CH 4X6CA 5DDHA 4M3KB 4OGYH 4M29A 4RQQB 4NZRL 5TQ2L 1NAKH 2VN3A 4FI8A 2EXTA 2X0UA 6PCYA 4Y4KB 3ARBC 5JNYA 2FE0A 2RTTA 3KBFA 5JUEH 2AQNA 1TKWB 2PCXA 5I6LA 1OM9A 1P9MA 5BS0B 4JJ5A 1IAIM 1KN2H 1OPGL 3FN0L 2BP0B 2Q86A 1KTLA 2X89D 3B2PA 4E0RB 4PIBA 2VIRB 3WO4B 5J12B 3GHEH 4JPWL 4PRDA 4XH2B 3AUVA 5KBDA 4PJHA 2BSSA 4AI7A 2ZSVB 2GJJA 1Z5HA 1CICB 5IQMA 1SOQA 4IMKC 3X17A 2M1KA 1CD0A 3KHOA 1JXKA 1YJDL 3UZQB 1F4WL 2R2EB 3KCWA 4R9HA 2CH8A 2F2HA 2CR3A 5FA3A 5HHQB 2EUVA 3GXNA 4NQVA 4PCYA 4WENB 5G55A 1BVNT 4LIQE 1KB5L 3A4FA 2GTWB 4KKLD 4Q97A 1WZ1H 3W0WD 4TQHA 5C0AE 2HSIA 3ZTNL 1KLFA 3F58L 4GMTL 3V6OC 4XMLH 4CNIA 3HCVB 3PQYE 1FO0L 2IDFA 3VMNA 2CJUL 4KX9A 5I26A 3W9DA 4AYMC 2D2OA 3N50A 5B22A 2ITCB 4E5XB 3WNIA 4YBQD 3RKDC 4GH7B 2JELL 2IQ9L 3G6DH 4BK5C 1XF5B 2XN9E 3OD3A 1JPFB 4UZGA 4GBXB 4HFUL 5PCYA 5IHUL 4Z7OF 2CG9X 3GSUA 3L7EA 1H0DB 3ZE1F 1NQBA 5D7JD 4M7ZC 3A67L 4JDEA 5C0CE 4MNGA 4ZMTA 5L88H 5I0ZA 4WTWA 3RGBA 3A24A 3DX7A 3L3IB 1HHIB 5EF3A 4MMXC 2C4FT 1M05A 3GSRB 5DHMC 4N0FA 2IADA 3T4YB 4QRUA 4XMKH 4EN3B 5HJ3A 4M8RA 5KVMC 1JZ7A 4M48H 3VFPB 4WHYH 4UM8B 3UAJC 3FN9A 4Z0BH 2OZ4H 1NLDH 3WJLC 4Y9CA 3OAZH 3UBXG 5C07A 1WCQA 3BW9A 4J3BA 4M7LT 1I1YB 4I9XA 4OZGF 1A0QH 4HA1A 4DZBA 3KPTA 1J8SA 4R90H 2VMFA 3KBEA 3VFGL 4QRPE 5MEND 4ISVA 3LZFH 5FKAB 4UNUA 3HB3D 3Q44A 6FABH 5ID1A 3MO1B 2H8PA 3ULVD 1JP5A 2Q3XA 4TSAH 2FEEI 2Q8AH 5ENWA 4GUQA 5DK3A 5DA0B 4WKXA 1OGAD 2ZZUT 4J7RA 3U2JA 1BZ9A 1KIUA 4TKWA 2CLZA 1SFHA 2X4NB 4PS4H 4A2FA 5HGDB 4PWKA 3PIQB 4D9RD 3I9PA 3KGTA 1UXMA 6TAAA 1RULL 4J3OC 2H0PA 4MAYB 5C0BA 3VM7A 2WLHA 4TVPH 1CS6A 5A2FA 3EXJA 2VLJB 1YEKH 2YKLL 4XBEH 4MFHA 1U3HD 1N0LB 1QRKA 1DCEA 5AOIA 4NKQB 4XMZA 1CI3M 4LBEA 4U4BA 2DMGA 4WHDA 2UWEA 3FCTB 3D3VB 3AXLA 2J6EH 1XD1A 1HXYA 2OV0A 1INQB 2ERJB 2Z91A 3SPGA 3X1FA 5L9DL 3IJEB 4PJ7E 4OFYD 4OF6A 4YDKL 4Y4FC 1E4JA 1P0SE 2HRLA 2EVGA 3O2DL 3GSOA 1BYPA 2V5TA 4RDQG 3SPHA 1S78C 3BPNB 4GAJL 3IJ7A 2JMRA 2XX1A 4JRXA 5I0DA 3NIGE 2KLSA 2RD0A 4ANXA 1H9VA 5AFAA 4G9DA 3BEVB 5F89A 4EDWH 3BKCL 1E30A 3UIZA 5KBPA 2R9HD 1VB9A 1M7XA 4RFEB 1AQMA 1EJFA 4XNYH 2XVKA 3ULSA 3F7VA 4FQ1L 5C0FB 3RP1A 1Q9OA 2PYEA 2ZKYA 2K3TA 3UTSB 4KJYA 3REVA 4AIXA 4HZAA 1TQSA 5L4IA 1PZDA 4WDIB 4MCYA 2QGBA 3CHSA 3SPJA 1I3GH 1MEXL 2CNYA 3VXRE 4BXVA 4FP8H 3MRRA 1FH5H 2ZOOA 5D4HA 3MGOB 5HDQL 2QV2A 3DX8B 2JV6A 2Z0UA 1OARL 2J73A 2DTSA 4WWKD 2E6PA 4LP4A 1NUGA 2Y1YA 4NNXB 2J12B 4FNSA 4KHTH 5CJXA 2IQAB 4Z18A 4Q52A 2HUHA 3LPWA 4ZZFA 4AEEA 3HLAB 1WAAA 3NT0A 2YRBA 4IHOB 4P2RE 5JORB 3GRGA 3L5WA 1OV8A 3CVHH 3LD8C 1T5KA 4NC2B 5CLTA 2V2XA 3V2AR 1HC1A 3MRGB 4X6BA 1Z9LA 5C0ND 1L5GB 4X6EB 3HNVL 3P9WB 2JIXB 3C12A 3DOHA 1MW2A 4JL2A 4MS8C 5AW9B 4MX7A 1RZ7L 1SMDA 3EFFB 5I1KH 3AACA 2AQSA 3B9EA 3DJ9A 3MRHA 4HPOH 1DBMH 2G3ZA 1L7TL 4UIMB 5L8KB 4IRZA 4HKZA 5BQDA 5I6NA 4BZYA 1A7NH 3AMLA 4TUOB 3S6CA 3VFOA 2TRHA 3OAWA 4NO5B 3IFPB 3JYBA 3CSGA 5DEGA 4ELDA 2H6PB 4G82A 3W56A 4B60A 3AABA 3EG9A 3M17B 1S7XA 3Q6GL 3QDGE 2NYYC 4BSJA 4LLVB 2HRPH 4HAGA 1EGJA 2IIJA 3ABMB 3UP1A 4GG6E 3HRPA 5C0EB 1G9MH 1ZT7A 2HJLA 4JM2D 5DVPA 1OP9A 2PO6C 3VXPB 1EX0A 2AJYH 3EJJX 1OZTG 1ZLDA 2FO4A 2IH1A 1WIPA 1EXUB 5HI3D 3C2AL 3ZQ9A 5GZOA 3GMMB 1HH6A 5E8NA 4M61B 4OJAA 1VCAA 4Y5VA 5GIRA 3E9TA 4RBPH 2WKGA 3FSZA 4BZ2A 5L6YH 3TGXA 3UJIL 1ZANL 1DBAL 1MPAL 1N12A 2ZXBA 3QAZB 3NJIA 1SM3L 5F9OL 2K3HA 3GJFA 1CF1A 3I75A 4L3CA 3LRSA 3POCA 3C6LD 3MLYL 3QUXA 2D8KA 1PG7W 1CIUA 1NLBL 2FJSA 3HHRB 3K6FA 4EOWL 1FSKB 1E8WA 1AKJA 3DTXB 2OP4H 1TVHB 1Z9NA 1A4JA 1OSPL 3ZE0E 5JIPA 4UMGA 1FVCA 3CV5A 3UO1L 2VAAB 2L7UA 4TNFA 3WS3B 2VT0A 2YA1A 1XZ0A 3GKWL 3MLPA 2VXQH 4KKLC 2J8HA 1A1MB 1VZGA 4QRQA 3P4MA 5CD3A 2DMBA 3O0RH 1UT9A 1HKLL 4YOKA 5EUOE 2Q3AA 2YAEA 4NHCL 4U3HA 1A14L 4ADIA 2HMIC 4OFDA 5EO1A 4AL8L 4U7SA 2AJSH 1JF5A 4WWPA 4QTIL 4QD2E 3ARFD 1NKGA 3BPLC 5D1ZB 2DM3A 4P3CL 1OAUH 3HUJE 3ETSA 1N4XH 4X5PA 3EJRA 3U7WL 1KBPA 2MKLC 4YBQC 5MHSD 3RWDB 3KWVA 4L8BB 2VABB 4MJIE 2E76C 5B1KA 5HYSG 4YXLL 3V4VH 4Z3JA 4LARH 3QCTL 4FQJL 4L4TD 3NIDB 3U82B 2Z7YA 5IEHA 2DQFA 2EVIA 4QJ4B 5BV7C 2KZKA 2OK0H 5K1JA 3SYCA 5DJ6A 5DC2A 3TNNA 5E95B 2WJ5A 3C5JA 1J0KA 1RK7A 1DQQA 5F97E 1XGPA 1S9WA 2CO3A 1K6QH 3OHXC 3M45A 2XI9A 3NN8A 5CO1A 2NNRA 2W59A 2GFBA 4TL4A 4RFNB 3S8WA 3SGJC 2PCPA 1EJOL 3RVWC 2GTZA 3KEDA 3VXUE 5IJDC 1T1WA 5JR1L 4XNUH 2CK2A 5DD3H 2XWRA 4HUXA 5IVZA 4AM0A 1VACA 3Q6FA 2YJQA 4Q14A 3T3PB 1K8IB 1KYOK 3M7OA 5JOPD 5DK2B 1ZT1B 5LJYH 3BXNB 1NDTA 4DGYL 1CYWA 2VW4A 3GHBL 1VENA 2BP5M 2VDKB 3B8SA 4MWFB 4P4KD 1N8OE 2ZXAA 1YPZA 4OI8A 3RHWK 2ZOUA 3HB3C 1ZLWK 3UIYA 3ULVC 1LNUA 5IMLA 3QRFM 4PRNA 5C0IA 3IGLA 1KGXA 5IEKB 1YNKL 3NGBC 4K94H 3OKLB 5I8KL 4DTGL 1KGJA 2FWOB 1FYTA 4M00A 1E3FA 2A73A 3BZ4B 3C08L 3PABA 4R7DA 4WNQA 5EZOL 1IGYB 5EB9A 4PJIA 4K5OA 1GGCH 1E40A 4NQXB 5JPNC 3H2PA 3DMMD 9CGTA 1R75A 3HI6L 3N9GH 2XTJB 1JGUH 3B3IA 3LXAA 4OLEA 4MGXA 3VRJA 3F7PC 2ZNWA 1I82A 4M1GL 1TQCC 3QUHA 4QPEA 4B9CA 35C8H 2ESVD 3Q9PA 1CXIA 4QHKI 4M6OL 5FF6A 3WKPA 3L08A 1X7QA 3FFCE 1NAMA 3GXMA 4RQQA 1NDMB 3NIFB 5FCUH 2UZIL 3MBXL 1C9SA 3KLAB 4YHOH 3B9DA 3MGTB 4HYTB 3FH7A 4R0LC 4OF5A 3IMBA 2YXVA 2FB4H 4KMLB 3DHPA 4IRJD 4X42A 5D9SA 4PJ9C 3S5LB 5DVNA 3TESA 3I9IA 1XGQB 1NBVL 1PY0A 3DIDA 2ED6A 5BS0A 1RUML 4KI1A 5G5DA 5A43C 1PZAA 2BP0A 1EQWA 1JUFB 4UNVA 5F7HA 5DRNB 2Y23A 5FYJL 2VXUL 1V3JA 3B2VH 5D96B 4XH2A 4OLYH 2IAMA 5IHLB 2VZVA 3D50A 4OM0L 1RK1A 2FHBA 2G4EA 3QFJB 2VLME 3QJSB 2P8MA 4IIZA 1YNTF 1AHWB 2IPKB 2R0LH 4XAWL 4Y4KD 1HYSC 2I07A 2XIBA 1RFDL 2R2EA 3RWJB 4ALAH 5HDBF 5CWSA 4E9LA 5ILTH 1TPXC 3CC5B 4YBLB 3VQMA 4IBLT 3UC2A 2WLNA 5E1AA 3N6YA 5F8RC 3UPAA 2JJSA 2E3VA 3M1CA 4WWKC 4HG4J 1QQDB 2X9YA 1OSEA 4D0BB 5ADPL 3NIGF 3L1GA 3L2NA 4JY4B 4DN4L 4CAGA 1E4XH 3ARPA 3DX9A 2FUQA 3RWCB 5LNGA 3NQIA 4P2QB 3HPLB 1WWCA 3PAUA 4UV4H 3CXHK 3D51A 2AJUH 1MREH 4HC1H 2E9JA 1H5BB 1QTYT 3LQZB 4PMFA 2B16A 1TQBB 1XF5A 3B34A 3GI9L 1NGZA 4I9WD 4I87A 1JPFA 1KC5L 1NL0H 1A4AA 4KC3B 2BVEA 1VF5C 3EUUA 1H0DA 4OJYA 2EDTA 2NY6C 1BOGA 4TUJB 1IFRA 3RVVD 4UINH 2ARJQ 3QEQB 4G83A 4HUNB 1CFQA 4QJ3B 4ZD3H 1MH5A 5AZ2L 1WD9A 4GUPA 2LW3A 3MV7A 3DXAE 1YEIL 2X40A 4YDJA 1NSNH 3VXMD 2DRUA 3GSRA 1CFVH 4NT6A 5CHNA 5C09D 3T4YA 1X9LA 4P5TC 3J27A 3MCKB 5FO7B 2EINB 1EMTL 3SBQA 3O4OC 1TJHL 3VFPA 1JZ2A 3EO1B 4UM8A 4IBQA 1MI5B 1RERA 3MREB 4R4NC 4N5EC 1XCTA 4KNUA 3DRTB 2UZXB 3HG5A 1L7IL 4JM2C 1A4KA 3DLQR 3GSVA 4OZIA 5DO2D 5JW4N 3WJMA 4RGMB 2WK2A 1RU9H 3O6LL 1LE5B 4LE8A 3MO1A 1DJIA 3MOBL 5TDNB 4D3CL 5DVOA 4S1SH 2GK0B 4I89A 3BKJL 2FX7H 3X3GH 1AIZA 3HE7B 5HGDA 5G4NA 2DF3A 3C6LC 3NACL 4X80H 4A7GF 1D2PA 3WNMA 4JFQB 3RVUC 1ACCA 3FONB 4CVZB 1RUKH 3BIKA 4A7SA 1PKQA 3QZNA 4I4WB 4X6DF 2RBLA 2XDHA 1Z3RA 4MCNA 4KVNL 1FL5A 3GSNH 2WCPA 3R4DA 4PAZA 5EBMB 3W0WE 1KENL 3FCTA 1RK0A 3MXVH 5E5LA 2VSKB 2FX8H 5GSRA 2B4CC 3QG6B 3EUDA 4HF5L 2K78A 3HZYA 1T66D 2VM4A 4YGVB 1OF2A 4WW1B 4XVTH 4X2UA 2X4TB 5AW4B 3VRLF 4WO4A 3QS2A 2VDQH 3ATDA 3WEMA 2FR4B 2WNKA 4P46B 4LLDB 5AD0B 2VLJD 3W39A 3CUPA 3HZMB 1IC0A 3MRNA 4NBYB 2IANA 3VDCA 1BDYA 5AUMA 2I5YL 4M5TA 2A9BA 4WI6A 1EO5A 4H1LB 2ZX6A 2RB8A 2YGQA 3D3VD 5AL0A 3VXQB 3U6RB 1FNFA 3D2UA 1PGRB 5LCVA 2LTQC 1NFAA 1X5IA 2BIQA 1EEZB 5HI4C 5C0FA 5C2BH 3OAUL 4QOKD 4GO6B 3ZE0F 5DXWA 1P7QA 3ENEA 1SY6A 2A9NH 2PUQT 4UIKL 4XX5A 2PXYD 4JPKH 4LFHG 5DZLA 4OT1L 1SGKA 3LEXB 4CILA 3VH8A 3LEVL 3FOLB 4ZRGA 3DVGB 4WCYL 4KXZI 1JTTA 4TSCH 4N2BA 2RA1A 5DT1L 1DBKH 1GHFL 5DJYA 3NZHL 3NABL 4JO4L 4HJUA 5FEBA 1G6RH 2GW5A 4H5SB 4NNXA 2CDGB 2LVEA 4AZ8B 2AITA 2EDXA 3NYKA 1BGXH 4QRBA 3BSZL 4NN6B 5IB1B 3ES6A 3HUJF 1HE8A 3UTSD 4G8FB 4IHOA 4KO6A 5MEQA 2ALWA 4ZW5A 3ULVE 5FM8A 3MJ9A 4Y2OB 5BOPA 4YDLC 4ZTOL 2KPWA 4HISA 3U0PB 4E68A 5C08B 4NO2A 1OGAE 4MD0B 1XR8A 2NTFA 4I2XA 3IM1A 2JIXA 4NBXB 5DR5L 2H3NB 4XC3H 1KJ2L 1K3ZA 4UQDA 5B1CA 3IJ9A 3ZTDC 4DUWA 3GMPA 4D9RE 1MJJA 2R1YB 2NY4C 2BW4A 5DC9B 1OT2A 3LS4H 4E41E 4TS6A 5MI0B 2XY2A 1SXCA 1VFAB 3KWXA 5M95B 5ESQB 5HHOB 4PW9A 1YEDB 3IJYB 4XCNA 2BMKB 1K2DA 3IFPA 2QQLL 4WJG3 2H6PA 4LPYA 5JO5B 4KTDL 1T83C 2OFQA 1S7QB 1CXHA 2CO4A 2VQ4A 4K3DH 5EIIG 1IGJA 4PUBH 5AVTB 5B1JA 5IK3B 4LPXA 2GJPA 3ZKND 3QJFB 4Q6IA 3GB7B 5C0EA 5IROA 2O6PA 5E2VH 3WD5L 1GR7A 5HHVH 3S9DB 5D2NC 2VC2L 5ETUB 4C8XA 3RJQB 1ETJA 1A6UH 4CN6A 4Y7MA 3FB8B 1DEEA 1RY7B 5ABDE 1I9IH 2AXGA 4OUUB 4P9HH 1M9SA 4TQEL 3HBPA 4UU9B 3FS9A 5F3HA 4Q2ZA 2R51A 5D5MF 3O3UN 3HS0B 2CGYA 1JVKA 1HHGB 4LVNC 1RCYA 1M6UA 1EFXB 3CDZB 3L81A 1BQUA 2CMRL 3MUJA 1Q94A 1ZLUH 1BIIB 1KDIA 3ZT5A 4Y8AA 5EWIH 5CJOH 1Q72H 1QUNA 2N0KA 4NQCD 5JHLA 4V1DB 2HAZA 1MVFA 3NFPA 4G71B 4X5QA 3UPCA 1S7WA 3KLKA 4DVBB 1TLKA 3E2HB 3SKUD 3QHFL 4K7PY 4DVRL 3A6OA 1BQHG 4PTTB 3KCPB 4D2NA 4AQ1C 3D39E 3FMGL 2XUWA 3ZT7A 4LLWB 1GIGH 3LPGA 5I82A 4JVPA 1QRNB 1KJ3L 2JJTC 3HMXH 3C5ZB 5ACZB 5JDSB 5BZXA 5CCKL 4ODWB 1KSRA 3WFZA 2VZ3A 4ZPVB 1MIMH 4JMNA 1I1RA 3O9WB 2VZUA 3L3GA 4K3EL 4DK3A 4BDVB 4JO5A 2XZAL 2Y72A 3A4DA 4GG8A 4XPTH 5DEFB 4L8BA 3RWDA 2D0GA 4AEFA 1TMCB 4BGLA 3VI4A 1TQUA 5B7EA 3WENA 1JF6A 2ATPA 1QSED 3QZPA 4HD9A 3SCMD 1TIUA 5EF0A 4LSDA 4HHAB 1P4BL 1AOHA 5D1XB 5AOMA 5I1HL 2BSBA 2VLRB 4EUPB 1SYSA 3QIBA 5AVQB 3RL2B 4ELMA 1HHKB 5C0JB 1JZ5A 4KVPA 5I18L 1Z9PA 2CIIA 2FL5B 5D1ZD 3JT2A 5DJ2B 5IFHH 1F00I 3OB8A 5HBBA 4IRSB 5SX4I 5E1HB 3PUCA 1KCSL 3LVTA 4NPJA 4OCXH 4IOIB 1OWRM 4FZEH 1CC3A 1MWAL 1THCA 1A66A 4JG1H 3I2CL 2J8UF 5IV2B 2H32A 1B88A 3ML9A 1KIPB 4M43H 4OCSL 4UTBH 2C9VA 3IJ8A 1O9ZA 1NAKL 5GRVL 4IU3B 4LPCA 1U8IB 1O6TA 1NC2D 1IEAB 5JUEL 1E9QA 1NC4D 3EBHA 2BNUA 1ZD6A 4GP5B 4EI6A 2Y5TB 2BNRA 2NY0B 4OZFH 5FM4A 3KGSA 1VGKA 2YBRA 5EBLB 2IGLA 5E8EA 2IBZY 3BWAA 3TM6A 3LXBA 2VMJA 4MZRA 3HE6A 5GRJH 3OKLA 1T5WB 1DN0A 1WJ3A 1FE8H 3FQ4A 4G7VH 4OKDA 3NPSB 4A7TA 4PJ8B 1IGYA 2YPKB 4X4MA 4WVRA 1XMWA 1SZNA 4NKMB 4PCKA 1UWYA 2F58H 5DSCA 1FFQA 3C8KA 4G9FB 4EI5A 5F72S 3BH8A 3WUWG 2FJHA 3H9YA 3DOSA 4RGOH 1OB1B 1WZ1L 5CBAB 3B7YA 4LHUG 3GBLA 3WFDH 5H37G 4CDGC 1JDDA 2R8SL 1YEWA 2Q10A 1ZK9A 3V4PH 5CD5D 4C58B 3WTTA 1N7MH 4YSUA 4GQQA 1S7VB 4XMLL 1BV8A 3QORB 4QWWD 5BVPH 1T66C 4PJ5D 5KS9A 4UDTB 5HSFA 2JQAA 5K59E 3S98A 3S4SG 4ZSOA 2I9LA 2DEYX 3NSFA 5MHSE 1WE5A 1C12A 1TEGA 3UTTB 2VUYA 2W8CA 3OKMA 4IBZA 2Z31D 1Q9LB 5CMAA 1F6AA 2RMNA 4L4TE 2YMTA 3BWUF 3T6VA 2AI0L 1RJYA 4KRMB 1B0WA 1E2WA 2WBJD 5L88L 4U3SA 1BPLB 1QFUH 1V7NL 1JZJA 3U4EB 1TTCA 1S9YB 2ZT9C 3MNVB 2DYPA 4J4PD 3P0GB 5E6YA 2JQMA 2EYTA 4M48L 2F74B 3VSQA 2MQ0A 4Z0BL 2OZ4L 2WXRA 1NLDL 3HS9A 3LZRA 4DAGL 3QHZH 3BT2H 4XCEB 2Y9RT 2BVQA 2IOMA 1E8XA 3AQYA 3B3BA 4KX7A 1EEUA 2JLLA 4RMVA 5CINH 4LCCC 4CC4A 5JOPE 1QQDA 1A0QL 4IBSA 2HPTA 2GQHA 3ZDXB 2W0FA 2MCMA 4LLUB 4JO8A 3FRUA 3LZFL 5D2LB 4HU2A 4P2QA 6FABL 2DH3A 3HPLA 1GJUA 4TSAL 1BYOA 1R5IA 5HDOA 1Z6JT 3BO8A 1MG3C 2Q8AL 4DNLA 1NMAH 5E6ID 5CFAA 2J21A 2JCCB 2HWZH 4ZS6D 4LOVA 3B9KC 3NG5A 3FUFA 4PS4L 4FJZA 4FJ6A 3F7QA 4TUJA 4IBWA 2R27A 4IBTA 1QPPA 4HIJA 1E5AA 4TVPL 1E5CA 1U8LA 4G7YL 4QYOA 2EQDA 3K0WA 4XBEL 3TYGH 3ZZSA 1XF4B 5JXED 2O6FA 1KB5A 1EXGA 1X5HA 2WO3B 2EEDA 1H15A 1RUAH 4LDLB 3QI9C 2J6EL 1RHFA 4UQEA 5EZIL 3BH9A 1BM3H 1JYVA 4MD4A 4JFZH 3MRLA 2CRZA 2HPOA 5F1OB 3NQKA 2Z35A 4OZ4B 1HXMB 3LQAC 5D2NE 4O2CA 1XCXA 3FOMA 4QNPE 3EH5B 3SBWC 1FO0A 5EC2A 2EC9T 1QW9A 3TBSA 5K9JH 2XVLA 4H8UA 4JFOB 4F8QA 2A6JB 3OJDA 4EDWL 1AOZA 2GCYB 2AQPA 3JSSA 4AK1A 1KNOB 4BH8A 4NP9A 2GK0A 1GAFH 1UOVA 3LQAH 4JLRB 1J9TA 4XNYL 3TBBA 1SYVA 2OJEA 1MI5D 3QJOA 4GKZB 4Y2DC 4DF9A 2JB5H 3AITA 4PY8I 3RU8L 3ZTCC 4UYQA 4HIPA 1B0IA 1B0RB 2CO6A 4I18A 5F9WC 5I2IB 2PTTA 1JZDC 2WLJA 3AC0A 5JIDA 4RDQF 1OOAA 1I3GL 4MMYA 3BZFA 4FP8L 1FH5L 4HUUB 3K72A 3GXUB 1QFOA 2D9CA 1QWNA 5F3FA 1R3HB 4PJDA 4YE0A 3S35H 3ZO0A 3UJTH 1TQWA 4WU5A 1ZLEA 4J3UA 5FFLA 4ZUUA 1HIML 4BCZA 1IEHA 3BCFA 1AJ7L 3HE7D 4KHTL 3JWDH 1EH9A 4U1NA 3BUTA 2JB6A 4OH2A 1I1AB 2GY5A 1TTGA 2V8LA 2DIEA 3ISRA 3ZT6A 3ZKXC 1F97A 3CVHL 3CVDA 2TAAA 3WMPA 3CMGA 5AD0A 4B97A 3EJYC 2ZE0A 3HZMA 5I5JA 1NPJA 2WXIA 2XZCH 4I9WE 1W6WA 5CCJA 4ZAKA 3RURA 2Q5BA 3NEXA 2X1XR 5I1KL 2K7PA 1SXSA 4HPOL 2CBQA 3E1F1 1KTBA 1AFVH 1DBML 3GBML 4JGUA 4NN5C 2PR4H 2O61B 1QSVA 4F57H 1S8DB 3SYPA 5HHXL 1A7NL 5CAYB 3VXME 4NZTH 1P84J 4O9HH 4TM9A 2F7RA 4KZ0A 3RJDA 1YUKB 3R1GH 2LOEA 3LNEA 3RWGB 1KTJA 1S7SB 2KL6A 3IYLW 1J9CT 2HRPL 1XSOA 3OQ3B 4UBDC 2YWZA 1A22B 3ZE2F 1G9ML 1KYUA 1VSCA 2CDGA 2XBDA 3QUKA 4YMPA 2AJYL 3ZDZB 2EKSA 2MOVA 3BZEB 1DSFH 4ZMLA 3PWLA 3CFCH 1TJMA 2AZAA 3TZVD 1AMXA 1RPUA 4QRTA 1YEEH 4WJ5A 1G4MA 3K2UH 1C7SA 1I7UA 2A6IB 2VR4A 5L6YL 4YPJA 2WKOF 4TOYH 2NR6A 3WNJA 2DMCA 1IGTB 3QP3A 1WS7A 4U1HB 1R3JA 1U2CA 4D9QE 3KNBA 4J3WA 3N5AA 1XIWA 5B21A 4YE4H 2OP4L 3VFRA 1ADWA 1A6AA 2F7QA 3FCBA 1U8QA 3H2WA 1RIVH 4PP1C 1L0PA 1VLXA 4NO0A 4M93C 1PLAA 2DQGH 4KXAA 2B1HH 4XO9A 4B53A 2VXQL 2ITEA 3O0RL 5C08D 1ZXQA 1U33A 1FNGA 3CFIC 3W1ZA 2J20A 1WC7A 4XWOD 1U21A 3RGVB 2VRKA 4TTDD 5CD5C 4FQIH 5H37H 2UXVA 3DV6A 2CBOA 2WTRB 2XXCB 4YPGA 1ZTMA 4RRPG 1RUPL 3L3OA 4ZOAA 2BSCA 4F7MA 1OAUL 4L23A 4XVOA 4F7EB 3IK2A 1JHTB 2OX5A 3PWNA 1RUQH 5LGHH 1TF4A 4WTXA 3DSNA 5AW1B 3FUEA 2W0PA 4OUUA 3T3MF 3CDCA 1F1DA 4UU9A 1A3RH 3V4VL 4LARL 2Q8BH 1TYEB 1KPRB 2Z31C 3B5GA 1E2VA 3MV01 2X1WL 1SDDB 3HS0A 4QOKE 2OK0L 1IM9B 2WXPA 4PJCE 2ZOKA 4U6YA 2WBJC 4L3EB 1KLGA 1R3LB 1NEZG 2DLIA 1LTXA 3L4XA 2OTUB 3L8QA 3CLEL 3B7UX 2F9BT 5C71A 1K6QL 3WU1A 1SMOA 3GSXA 1UATA 4JFUA 1VEPA 4V1DA 1VKXA 1AKPA 3G6JB 4U05A 2X28A 1A7RH 5KSUB 4YGAB 5EOCH 1QZ1A 1RVFL 2R0ZH 3WNNA 4ES8A 2M26A 3ASOB 3L5JA 1TETH 4XNUL 5EA0H 2NY2C 1EHKB 5DD3L 4F15C 4P23A 1LO5B 3QULA 1LO0H 3CC1A 3IEAA 4KVCL 1M6OB 2BS8A 3IE4A 3LKNA 5ESVB 2VC2B 2HG5A 1K72A 1IFHH 3EO9H 1KCUH 4GYBA 4H88H 3T4AA 1LWJA 2FQDA 3UBHA 1UJ3A 3LH2H 3IKKA 4ZS6C 4A2GA 8PAZA 5HYQA 1R34A 1X6NA 2JJWA 2QL1A 5FC9A 3WN5C 5F6IB 4NEHB 1QRND 4PJ6A 1GGCL 2EEFA 3O3BA 4HHAA 5K1VA 2AXJA 5D1XA 2D7MA 3N9GL 2VLRA 4EKXA 2ZCZA 1JGUL 1SFDA 1HHKA 1TXKA 4XHQA 1SDAB 1Q90A 5DURD 2H9GB 3RDJA 2J5WA 3O9WD 2CU9A 3MRMB 4JFEA 3UMTA 2YXWA 1MIEH 1MW1A 1XGRB 1BX2B 5JXEC 3CLFH 3VD4A 2EYRB 1WFOA 4XC1H 1M7DB 1SNRA 2NUTA 3BAYA 3QXAB 3WDIA 1KGWA 1KIPA 4N2NA 5I6KA 5F7NC 2LVCA 2WXKA 3UERA 4YHOL 4YR6A 4AUJA 1JYWA 3KGRA 1LLAA 2PTVA 5SWSB 4FERA 1IEAA 2IF7A 2ILLA 3MLZH 3RX9A 3PHSA 5BMFH 1WS8A 2A38A 3T77A 3HAEG 2HTKD 4IRSD 2FRGP 4GQ9H 4XPAH 1CDJA 1UYWH 1QR1A 2DD8H 3IKCA 5F9DC 2OJ1A 4FQXA 1CDHA 1B3IA 4C54A 4Y4HA 2O30A 5T1LB 4MNQB 2ZSWA 1FZMA 2G5RA 4HWBH 3VWKB 1HDMB 2RHEA 3B2VL 2C4FU 1Z9SA 5CZXD 4OLYL 5SWZB 3GZKA 3RE0A 2EE0A 2ADFH 1NCIA 3UGUA 1UD4A 1JXJA 2H47C 2DWYA 4PJ8A 4N0UE 2VR7A 3ISWA 4E2OA 3TYFA 1USZA 2NNAB 4ALAL 2FWLB 2XU9A 3VMOA 5JIKA 4G9FA 4YHPA 4GSUA 1Q9KA 5L8LB 1MWAB 3S97C 2EIZA 5J6HA 3F83A 1C16B 1T22A 3AQZA 3L6FB 3COOA 2OPCA 4QHUB 1WBXB 2J56A 1AIFA 4GAFB 4KZEH 3P02A 4UAHA 1KLUB 1SJEA 1VIWA 1BEYH 3ARZA 1NEUA 4FLSA 3D1MC 4HKXA 4NO3B 1P1VA 3O2WH 3ZBMA 3W38A 3ARDA 2VDLH 2WZ6A 4UV4L 1CI5A 3Q3GB 1EWHA 2AJUL 4WF7A 1UXWA 1E2ZA 5AOLA 4Y5XB 4NSKB 4XNMB 3UOAB 1MREL 4HC1L 4OD1L 3V6FB 5FGCE 1K4CA 1HL8A 2VZOA 3UTTA 4PRPE 1FAIL 2EO7A 3EOAA 1A4BA 1T6BX 1NL0L 5FDWB 4NQDB 1AGFB 1YUHA 5SX5K 1JD9A 2NY1D 1QSEE 4JO3H 5F88B 3QUZB 4JFDB 2VN4A 5IM7B 3T0EA 1EUTA 3QORD 4MQ7B 3S3SA 3VD3A 3FXIC 4ZD3L 3VG9B 5IB5A 2P43B 4ILDA 1ZV9A 2XG4A 1KCLA 1NSNL 3T09A 1CFVL 3K6SB 3VYOA 3AW5A 5IVXB 4HS6B 2DBJA 2WW8A 3LPPA 3QNXA 3QYMA 3MLXH 4GMSL 1BXUA 4EQ3A 4RNRA 1ZEAH 4AE1A 5BQ7B 3BGFB 4XCEA 4WY7H 3FUIA 3P3RA 3RUGF 2F54D 3EHBC 1G94A 1DLHB 4LEOB 2JKSA 5IQNA 1RZJH 4LLUA 4LSQH 2ZYIA 1RU9L 3TZVC 4L4VA 5KSBE 4A2MA 3VD1A 4HCRH 5D2LA 1HHJA 3HI1A 4ZW7A 3T1FA 2COQA 3HC0B 3WEBA 2BP3A 1YECH 2JCCA 5D72L 1TSHA 2FX7L 2X88A 1VESA 4R7NB 3X3GL 1Q38A 4YDMA 4BYHA 5FYLD 2EZ0D 4X80L 4M03A 2FX9L 5FA4B 1IBYA 2AEQH 1LQBC 1F42A 2YAFA 1J8HE 1G9HA 1RUKL 1D5XB 5LGJA 3QIUA 2ADGA 4OF7A 1ZA3A 1OGPA 3NPZB 3RWEA 3V7AG 3QR1A 4XNZB 4B9FA 1KXTB 3QQ4B 1GGTA 1LEIB 5T3ZD 3GSNL 2XWTB 3BIAX 3AG2B 2FWUA 2Y0SA 1SUJA 1U3YA 3MXVL 4QHMB 4KO7A 3PREA 1MCQA 2XA3A 2YD6A 3LIZH 4Y19B 5LO7A 3ZHKA 2ZX9A 2GT9B 4Q89A 2ZUYA 3KM2A 4XWOC 3NTCH 4KK9D 4WGVB 4XVTL 4PJ5E 4U1JB 2VDQL 2FNWA 4H2AA 3L9BA 4Z7QB 1VCBC 3C5SB 5EZLA 5AVVB 1NBZA 2RCSH 3FQ2A 5H8DA 4P2OC 4X4XB 2XKUA 2QTVA 4LBAA 3NZ8A 2Y3NA 2GCYA 3K8LA 5F9JB 2E7DA 3SDYH 3SB3A 5EN2B 2ORBH 1YEJH 4Y1AE 3IJHB 2Q7YB 5AWNL 1Y1UA 1OKEA 3LXUX 3QRBA 4DEPB 3QO1B 4RAHA 4TNWK 4EQ2A 3GMOA 4MZ3A 4HEME 4ZDHB 3FH8A 5C2BL 3APNA 1AHKA 3K3QA 4X9IA 2E7LA 2A9NL 4JPKL 4NKIH 3SSGA 3UGXA 4MTMA 1ZRUA 4N6RA 3EF4A 3WIFB 4HULB 1WP6A 5KJ7E 1A7QL 3OF6D 1H8LA 5DD5H 3LRKA 3DROA 4TSCL 1SJVA 1JCKA 2ZUTA 3M1BB 3W9EB 3ZO9A 5G4MA 4MRBA 4PU2A 4WKZB 3S96A 5TGBB 4PJAA 3WDJA 3NEOA 3QWQB 1L9NA 1I1AA 3AXIA 4QTFA 2A77L 2FIRT 3SGEI 4KDTC 5L7XH 5KVEE 1UC6A 2ZWKA 4NQEE 5GRWA 1H6UA 4ADGA 5KSAC 2FT7A 4BQCA 1CR9H 5I15H 1FJ1A 3BDBA 1GYWA 2VN6A 1KYOJ 3ZPDA 4XC3L 5L2KA 3QQNA 4JQIL 5DRXB 2IGFH 1QSFB 3TN0B 2Q6WB 3QXUA 4P5RA 2DIAA 3UGEA 4IK7A 5HGGS 2YSSB 3MOQA 2EE3A 4M8QA 5TF1H 3LS4L 3BVDB 1AH1A 3F2LA 2CLRA 2GITB 3US0A 2Z92B 1PSKH 1S8DA 3FO9A 4P3DA 4PTUB 5B1BB 4POZC 4KBPA 3WJJC 2IOIA 1YYLH 3M8OL 5KG9B 3I6KB 5CLZA 1PCSA 5KYYB 5D1QD 4K3DL 3BZ5A 3FTYA 3BP6A 3PAYA 1BWMA 3QDMB 3SDXB 5DS8A 5DWUH 3LJ3A 1N0XL 5F96H 2DAVA 2XYBA 2V5SA 1J11A 3KPOB 2O5NA 2C9UA 2WZ5A 3DGCR 4Q56A 3VFVA 5JXAH 1A6UL 2BY2A 3PCYA 5CP3A 3UCRA 4NC1C 4YDVA 5IW1A 1I9IL 2VO8A 4LSSH 4QIRA 3APFA 1I3RB 2A6IA 3W11D 1W72L 3ULUH 4P59H 2LHAA 3HAEH 5ANMA 5K5YA 3S3CB 3ZIMA 1O75A 2X05A 3ERXA 5JZ7C 3T6QC 1I4FB 3KAAA 2W81C 3N40P 3OLDA 2R1XA 2FWSA 3L45A 5EWIL 5CJOL 1Q72L 2AQ3A 3S5YA 5B8CB 5T1KA 4H8WH 2XBTA 1KTDA 1HZHH 1AO7D 2PYED 1T7YA 3Q1EA 1GGYA 5T3XD 4U2ZA 3TBVA 1XGUB 1HOCB 4MJ2A 4GAYA 4GRWE 4ZNEE 1LVEA 3VG0H 4N20A 2APTA 1GIGL 1KEMH 3OSVA 4GKNB 5CIPH 5FYKH 4WV1C 3SEPA 1SHSA 3CFDB 2I9TA 2ARJA 3HMXL 4K9EC 1KG0A 5I8EB 3MZGB 4UOQA 4AG4H 4RGNB 4L3AA 3BSZA 1X4XA 3IFLH 3T0BA 1LE9B 1MIML 1T0NA 2B5IB 1RZKC 2WNXA 4LSTH 1JZGA 2AXWA 3QEGH 3ROLB 4DKFH 1JF1A 5ITFA 3A6CH 1TMQA 1FQ9C 5F7EH 4EDXA 5IT2L 4PVLA 4ERSL 3B9AA 3S48A 3GQFA 1T4WA 3SKJL 3LH8A 1TTAA 1CLCA 1KJ2A 4JRLA 1CTNA 5AVRB 2HT4D 4NX0A 3RGVD 5BRPA 1TEFA 2ICCA 2NY1C 5BXFB 1SDDA 2JXMB 4DGWC 1FNEB 4ANWA 1IM9A 3CXHJ 2VDMH 4RAUA 4L3EA 2GHZA 1DQKA 3KPRA 4M8VA 2OTUA 4X6FA 4AGLA 5IFHL 2J57A 5DZOA 3VDAA 3PJNA 1OTSD 4FN0A 3KM1A 3MNDA 2PWFA 5SV4A 2XOTA 2X2IA 1UA3A 2QZQA 2XETA 4OCXL 4M9OA 2P5EB 1BBDL 2GPZA 4FZEL 4LF3B 1YDPA 1J88A 2J88H 4DN3L 4JG1L 4K5PA 4UNIA 3H9SA 1FA4A 4M43L 4FXKC 4KH9A 4UTBL 3EOBA 3G3LA 2CO7B 3LNIA 5E1IA 5E9AA 2APVA 3B43A 4M3JA 1UFUA 2CPCA 5EEUA 4JFHE 4UOJA 2Q3ZA 4TV3A 2VM9A 2XNAB 4D0DA 2CDEA 5JMOC 1RJLB 3SJVE 4HH9B 1KYAA 3TO2B 3VD0A 1BD2A 1ZS8A 4C55A 3BJLA 1CFSB 4XN7A 5GJTL 2EDDA 3V4VB 1UACL 5GRJL 1NFKA 1X5KA 5KVGH 4QHPA 3ZDYF 2MTAA 3Q48A 3VGDA 4BQ9A 3AROA 1P9MC 2OA9A 3BQUA 4M6AA 5DHXB 4YAQB 3H7LA 1JWSA 2E9GA 3MTRA 1KN4H 1NBCA 4QCIA 4R6UA 3S34H 4EE2A 2XQYA 4I0PA 2F58L 1N6UA 2GIYA 3QQDA 3IU3B 2WGNB 1ZGLP 2GBAA 5T1MA 1RIUH 4RGOL 4XMWA 3P73A 4ZX5A 3QXDB 4V2CB 2F53A 4WWID 3WFDL 2YLKA 3AAZA 1PLGL 1TNMA 1J18A 5A2CA 4NUJB 4HJJH 2BSTA 2EJ1A 3T8XB 3QXAA 1N7ML 2NLJB 4PJBF 4WFED 3ECBB 3MJ7A 1P69B 5LBSH 5BVPL 2PP8A 2ID5A 3K91A 1NWOA 3EGXA 4ZODA 4EJ1C 5SWSA 2ARWA 1MDTA 4QRRE 3NCMA 2IG2L 3K8KA 4N2IA 3S36L 2XQ0A 3PDDA 4Y9BA 4PV8B 2CBMA 2K4WA 2XRAL 3VGHA 4UQ2B 4NN7C 1TZGH 2CHZA 4MQXD 2GSIB 4JUTA 3P9LA 1QFUL 2KMWA 4KK6D 2GYSA 4DOHE 2P7TB 2WJ7A 3NK3A 2Y7SA 4QLRA 5EOTA 3LZPA 4MNHA 3FU3A 4GW4A 4ZUWA 5FHAH 4ZG1A 5E94B 4Z7WB 1GH7A 3DK2A 2AEPH 4L29A 1CDUA 2IPUG 4P5MB 2B14A 4EZKA 3GIVB 3BT2L 2ZP0T 5FWQA 4R8WH 5T1LD 2H0FA 3HEIB 3AWGA 3VWKD 3BVWA 1J0HA 2HLAA 1FVEB 5SWZD 1H8SA 4A7QA 5J8OA 3FT9A 1WZKA 4G42B 4JN1H 4OLUH 4JGNA 2E7MA 4NQSB 2LU7A 1NMAL 4X6DA 1T4KB 7PAZA 3CBKB 5IB3A 2HWZL 4M62L 4LMQI 3S88H 4ZFGH 3DO7B 3K80A 4X98B 5FKPA 3AREA 1FPTH 3F6LA 4JAMB 4ACPA 2X4SB 4FLOA 5F88A 3I6LD 3OKNA 4BV1A 3ARBA 5IM7A 2C3HA 2VDOH 3LN4B 3DI3B 2GVYA 1GW6A 1VDGA 3PNWA 4PBWD 5B38B 4LKCB 3WO3B 1J8RA 4NRYA 3K6SA 2HZHA 3CH8A 4Z6AT 1GL4B 5FK9A 1RUAL 2H2PC 3GYRA 5I66B 4GW5A 4HIHB 5E03A 3FW6A 3V4UH 3WAKA 5I76A 4JFZL 1PLCA 3OSKA 3O8XA 1ZS2A 4FKEA 3QDJA 4KJQC 4NQDD 4PJEA 2PPCA 3SQBB 2C5DC 5EU3B 4I88A 4XVUD 1NBYA 4QAWA 4IBYA 3HR5B 3VXTB 1PDKA 1D7BA 4BZ1H 5K9JL 2BOCB 4HH8A 5DRZA 3SYQA 1HI6A 3SE3A 1VADB 3FL7A 3OVUB 4RX4D 3R19A 2YD3A 1R3IH 3NJNA 3KE0A 1XFPA 5FGBA 2FJFA 3UEQA 8FABB 4PI2A 32C2A 3GMQB 3MNZB 3PFUA 4LVHB 3V6OA 5EH1A 4C47A 3RIFF 2QELA 3FTGA 3KXFE 2E9IA 2ZKMX 4ZXBD 1F0LA 3T2LA 1JPSH 2G75B 2MRYA 4MXWH 3QPQD 2V9TA 1D5XA 1MRCH 1JHKH 2IAMD 2AJVH 1WQVT 4AQEA 4EXPX 3QQ4A 1ZMYA 1YC7A 3CFMA 3QO0B 1LEIA 2XWTA 2VXVH 3LNGA 5PAZA 4ORZC 2HH0H 1M71B 4NPYB 2OZ4A 4KUCD 3UJTL 2FGZA 3LS5L 5DD6B 4GB9A 1Q9WB 3FT3B 5DGRA 3PUUA 5IJKA 4NI3A 4MZIA 3GTTA 4HK0A 2GT9A 1FVDA 2RFXB 3VGGA 1N5YH 1C5BH 1QOKA 3BLPX 2NQCA 5E6SB 4ZFOL 2VUKA 2DYSB 2OXHB 3N04A 3PWPB 4C4KO 2L7JA 1OOWA 4P57B 1E4KA 2NCEA 5EU6B 3WN6A 3FSVA 2XZCL 1ZPUA 2OW6A 5CJXC 3IRPX 3WY1A 2Y07H 1OCRB 1G7LB 3AT8A 2CKBB 1HZLA 4PS7A 1THAA 1SF5A 2BH0A 4K8RC 4Z7VE 1BSIA 4P3WA 4Z0XB 1AFVL 1HWWA 1W8OA 2PR4L 4PRBB 4F57L 4C56A 4ZFZB 1Q4NX 4P5KA 4L37A 2E8YA 5DHYB 1NKOA 5ID0A 4Z7UB 3I3EA 3IDXH 4O9HL 1CB4A 2XXFA 3EW3B 1AE6H 4DJMA 4JREB 4PS8A 4L8CA 3KMDA 1PMYA 4OCNC 1BJ1H 3R1GL 3DVNA 3MV7D 2FLMA 3RX8A 5F1IB 4FQ2H 1AZNA 3LY6A 1FZKB 2J6EA 3M1BA 4UQ3A 1UZGA 5MP6H 4FL4B 2QGEA 4WKZA 2F54E 1A7OH 1OQOA 2UY7B 2VERN 5D5MA 1AXIB 3RI5F 1X44A 4LSVL 5K9KA 1DSFL 3CFCL 4E9TA 3KLLA 1YEEL 2WSDA 2WBXA 1A47A 2V3FA 1CQKA 4AENA 1KF9B 5KUKA 4HT1H 4M56A 3FT4B 5D7IB 1EHLH 4P2CG 5GZOC 1II4E 2X42A 3C6EA 1U8KB 3N1MC 4Y5VC 3ZDWA 1J5DA 4PJFB 3GMRA 5DJ0B 1QSFA 2XG5A 5FYLE 4G8AC 3LXCA 2NPLX 4KAQH 5DZAA 4YE4L 4X5LA 5L2JA 4O2FA 3NJLA 2A0LC 2IWKA 4PJHE 5IJCC 2XJLA 1N5AA 2Y2TA 3D4GA 1RIVL 2AAAA 4YL9A 5FW7A 3QUXC 3H1ZA 1RZGA 4O51B 2DQGL 2B1HL 5CEZD 3I6KA 4DW2L 4MA8H 3ZZ1A 4PBVC 2UXFA 4N8UA 2YGVA 4LIQL 2ZF8A 5AG9A 3MV8A 5I1AB 1S3KH 1WAEA 2OR9H 4FQIL 3SDXA 1QHOA 4ZBJA 3TN0D 4F27A 4PWFA 2J43A 4ZYKA 4GEIA 4WI5A 1AP2B 2DMKA 3ILPB 3CHQA 3RTLA 2VDPB 4ODHH 4GI8A 4GRLB 3T65A 5JQ6H 3CVHA 3V0VB 1RUQL 2AK4D 3SE6A 2AK1H 4CVUA 1KWGA 3ZKSD 4HUWB 1PKOA 5I1EH 1A3RL 4ATWA 3DETD 1SOKA 4XCFH 1EHAA 3QDMD 4U0RC 2X2YA 3D06A 2XPGB 4MQXC 1V7MH 2J8UA 4NIKB 4D94A 1QATA 4FG6D 3MBWB 3D2UD 1W15A 4KK6C 3QARA 5B8CA 4XP4L 1VFBA 3WLWC 4MNGE 4X7TB 2OL3B 1ORQB 1OXYA 1WIUA 3IXTB 1A7RL 2XWEA 4UWQB 1P7QD 4HIXL 5EOCL 4OZHF 4U1KA 4K23H 5EO9A 1RSFA 3K2MC 1TETL 5EA0L 4YFLF 4ORGA 3W81A 4M1DH 2WLLB 3RWIB 3L95B 1LO0L 2VL5A 4AQAB 5I8EA 4EIUA 1XTLA 4MJ5A 1FAKT 5JIQA 3GJEB 3B2UC 4HALA 4LASH 3EO9L 1CG9B 1KCUL 3S3DB 3MCLL 3TVMB 4H88L 4HCIA 4E9WA 4FOMA 4XOBA 4JB9H 3SY0B 1W72B 3C8HA 5GGRY 4GSDH 1S7RA 3X1NA 3LH2L 4QKTA 3H9HA 1DVQA 3RX7A 3KYNA 2I7SA 4K2UH 4G1EA 5J06A 1U93B 1ZJAA 4HAFA 2JXMA 4CC0A 4L1TA 2C1OA 2VXTL 4GIOA 2YGOA 5JHDB 1ID5I 1NIEA 3AUWB 3M88A 3GM0A 5C0BE 1MIEL 3CFKB 1AVAA 3DBXB 1RIHH 1U2YA 3CLFL 3IT8D 4A2LA 4XC1L 5DUPH 3CX5K 1G6VK 2W65A 2VXQA 2P5EA 1J12A 1HN1A 4MDIB 2NXZB 1AR1D 1W9XA 3FU9A 4JHBA 4MXVE 5KYUB 1R0AL 2UWEE 4IU2B 3MNWA 4U6HB 5DYOA 2YPLB 1QFPA 1KBGL 1S9XB 3O6FB 1TQVA 1IC4L 1U8OA 4HS8L 3ARGD 4XVUC 3SQOH 3VW3H 2BFVL 3PL6B 2XNAA 3MLZL 5DJDB 5B3SB 1DQIA 5BMFL 3TO2A 4Q74A 4XPAL 4JRXE 1JZFA 3DV4A 2YD0A 1ZVYA 2DD8L 5IFAH 3BT0A 1NGQH 5KN5B 4F5CE 5DK0B 3V4VA 1XCQB 1U91B 1B4JL 2DI7A 5FUOH 1NOFA 1XSIA 3KJ6H 4I0CC 3MNMA 3TBYA 3ZZLA 2FH6A 2F08A 2ADFL 4YQXH 3BUQA 5IMMB 2EDHA 2J4WH 5DVMA 2UXGA 2ENJA 5GRXG 4X9HA 2ISDA 2BVPA 4F37K 2PYEE 3WO4C 5T3XE 4C4BA 3LOWA 3LKSB 4BFIA 4KKZA 1R5VB 5BUGA 2IAMC 1AHMA 3E0GA 4CL7A 3QEUA 2GJZA 4PWGA 2D7QA 3UYPB 1CGXA 3EOYG 5EFIB 3QXDA 1NUFA 1O7VA 3WG7B 3HC3H 2J7LA 1DDHB 1SXNA 3POHA 3PWVA 4ENED 4PY7B 4J12A 4FQLH 2NLJA 5MEOA 1G7HA 3OLIA 3ZR5A 2XICA 3HJEA 4XAKE 1BEYL 5FGSA 5EEYA 3UBXA 1U92B 1D5BA 1KY7A 3VWJB 3O2WL 1U8HA 4IJ3C 4YHYC 2JJSC 2G5UA 3JV4A 2BM3A 1ED3B 4W9LC 3MGAA 1WAAE 1XV8A 3MJ8A 1ORSB 1JVOA 1OT4A 5EOQH 4R83A 1RD6A 1WT5A 5D7SH 1HVXA 1VGEL 4JO3L 3GLZA 2BJMH 3G5XA 5IMKA 1AGEA 1QZNA 3TA3A 3WS6A 3T0WA 3UZVA 3K71B 3ZE1B 1TTBA 4XP9L 2BXYA 2H3XC 3DUUB 3RZWA 2YARA 2ZF9A 3QIBD 3FQNB 1JVLA 4Q8BA 3V8CA 3VUAA 2D0FA 4KZCA 1RKRA 3PXHA 1IBDA 1ZEAL 1I8AA 1TQTA 5D6CB 3IN2A 2WQAA 1I8MA 2EC9U 1IM3B 3DDGA 4WY7L 4Z3IA 4UTAH 4JZNB 4XPFL 4MAUH 5J89A 1MZYA 3PFQA 5B1AB 1FVEA 1TG8A 4PGEA 3WYRA 4E9VA 2V37A 2GI0A 4BRVA 3IBOA 4Q0XL 4NFDA 4J3SA 4XXWA 2W1NA 4NQTA 1ZHBA 4OZGB 4QUOA 2KLRA 4G8GA 4Z3FA 2O6CA 4NWUH 1YECL 5AYTA 4BWTA 1OT1A 1AAJA 4F8NA 3QXTA 3ZGIA 4PJGB 2BNRD 4MCZB 4Y9EA 4LT7A 3CN3A 2KH2B 1YN7A 3Q5YA 3HE6D 3PDOB 4WW2A 3STBA 2AEQL 1GKOA 3WFEH 2AEOA 4JFXB 4YLBA 1BAWA 2IBBA 1F1GA 2E0PA 2SEBA 3LN4A 3T6ZA 1R5WB 4BM7A 4J1UA 5B38A 3GM8A 1AZCA 4LKCA 4FKKA 4BWWA 3C09B 3ECVA 1YMHB 4UUJA 1OQXA 1UHVA 2A6DA 2YA2A 3MBEB 4XB3A 5I66A 2IALB 1I31A 3LIZL 1DVXA 3IDMA 1X5LA 4X6CF 5ADOL 2BHYA 4BHUA 1OAKH 2XV0A 2ZCLH 3N42B 3NMEA 1J10A 3PGCB 3EYOB 4ZUVA 4TPRH 3A23A 5EU4B 3VXTA 4GQRA 4X4YB 2F15A 1XF3A 2DQEL 2RCSL 5FO9B 1BQ5A 3CFEB 1UM5H 2YXMA 1VADA 2Y6SC 1AS6A 2MFNA 2PWDA 4UDUA 5GJSL 4HFWB 2Y7OA 4WO4C 4HC1A 5IBTH 3SDYL 2ORBL 5JOEA 8FABA 2FT6A 3BPNC 3MNZA 3GK8H 4YWGL 3TT1H 1CDIA 2J2ZA 4FQQA 3WEOA 4KROB 5I71C 2Q76B 2YOAA 3DX2A 2AKRB 1I85A 1IAKA 5JPMB 2G75A 3WKNA 3MR9A 3MRJA 1EFQA 4FLHA 2JI3A 4LSUH