2Q9OA

Near-atomic resolution structure of a melanocarpus albomyces laccase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
559
structure length
558
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
molecule tags Oxidoreductase
source organism Melanocarpus albomyces
publication title A near atomic resolution structure of a Melanocarpus albomyces laccase.
pubmed doi rcsb
total genus 182
structure length 558
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA03
3BQVA 4PCYA 2FJSA 2FWLB 5I6PA 2JXMA 4EF3A 1L9QA 4DPAX 1AS6A 1ASPA 3FU7B 4FA7B 1ZDQA 3FPXA 2DYRB 3PAZA 4JHUA 2PPFA 3L45A 3ZBMA 2AANA 2EILB 1PZAA 3X1EA 2EIKB 3OMNB 3X1FA 1L9SA 1SHWA 2AZUA 1NPNA 5I28A 5I5IA 1W8EA 1NTDA 3NJIA 3PXLA 5B7MA 1KBVA 2IDUA 2YAQA 1AZUA 1ZV2A 4A2DA 3T71A 3ABLB 2XX1A 4AKQA 4BDVA 3OMIB 4E9WA 1M9WA 1BXVA 4E9QA 2GHZA 2UXTA 1PMYA 3FPYA 2W8CA 1MDAA 2HX7A 3H4FA 2J5WA 1ILUA 1AIZA 4HAKA 2BHFA 3NJHA 4KO6A 1NIDA 4YVNA 3UABA 2FQFA 1X9UA 5I6KA 1B3IA 4DPBX 4G71B 2FTAA 2CUAA 4BWTA 4G72B 1NIBA 2GC7C 1XB6A 1NWOA 1EHKB 1ZDSA 2A3TA 1PY0A 2WSDA 1SNRA 4DP6X 5I26A 2QT6A 3NSYA 1WA2X 2WO3B 3G5WA 3NP3A 2XWZA 1T5KA 3H4HA 5TK2A 2PPEA 2XXFA 1WS8A 2XU9A 3T6ZA 3FQ1A 1NZRA 4L0PB 1GS7A 2GBAA 2HLEB 5B3SB 3T6XA 4E9SA 1IBZA 1NPJA 1ZIBA 2YAHA 1JERA 1OE1A 1XB3A 3CDZB 5I6LA 1PLCA 1JOIA 3WG7B 5F7AA 2IDTA 2PP8A 2IWFA 2VSMB 3EHBB 3NSCA 5AZUA 1PNDA 2VW6A 2WO2B 3X1GA 4F2FA 1OE3A 3AG4B 4DP7X 2DY2A 3EF4A 1PCSA 1JVOA 4G7RB 5B1JA 2QDVA 1HAWA 1BAWA 1SDDB 2J57A 2B3IA 2H5UA 1BYOA 1MZZA 2I85A 2VN3A 1EZLA 4E9TA 3SBRA 3AG3B 1ID2A 1KCBA 1J9TA 3NSFA 1J9RA 1N70A 2QDWA 1ZPUA 3HEIB 2UXFA 1DZ0A 4A2EA 1MZYA 3FQ2A 3MBWB 2PLTA 4N8UA 3IN2A 1AZRA 2ZXWB 2P80A 3ZX1A 3S3CB 3V9CA 3EH5B 4BDVB 2BWIA 5TK4A 3T6WA 3OMAB 4YSDA 1ET5A 2AZAA 1J9SA 2YAFA 3NJMA 1J9QA 3NSDA 3QQXA 3NYKA 3GXUB 5B1BB 1BQKA 1JZFA 1JZEA 1ASQA 3ABGA 2GC4C 2DV6A 2GSMB 3NJKA 4MFHA 4DP9X 1E30A 4UANA 4UAHA 1PLBA 4DP0X 1WA1X 2YAMA 3BVDB 3N2JA 4HIPA 4DP2X 3PAVA 5IY5B 1URIA 3NJJA 4A67A 5B1KA 2CCWA 4KNTA 1J5DA 2LLNA 4M4RB 1F56A 3UADA 3AG2B 1CYWA 5B7FA 1XB8A 2Y69B 5D4JA 4W1TA 2IAAC 2X87A 3NJNA 4A2FA 3WKPA 1FA4A 4BXVA 3TBBA 1MG3C 3NP4A 5E9NA 3H56A 4BWUA 2B08A 2HZHA 2PCFA 3CG8A 1W6LA 3PAUA 5I6OA 2IH8A 4YSSA 1IUZA 1V54B 4HALA 5AFAA 4GP4B 1BYPA 3EH4B 1BEXA 1X9RA 5D4IA 4TXVB 2UX7A 1TKWA 1ADWA 5B1AB 2PPAA 1ET7A 2CALA 4HHGA 3QJUB 4YSEA 1AR1B 1E67A 4YVUA 4E9VA 2CJ3A 1L9OA 3WI9A 2AFNA 2IH9A 4KOCA 4AI7A 1DYZA 4F7KA 2MTAA 1AG0A 4YSTA 1AACA 3NJFA 1HFUA 2BWDA 4X4KA 3UAAA 2HRHA 3FSVA 3SBQA 4YSAA 1I53A 4GY4A 3CVBA 2IDFA 5PAZA 3CVDA 2YARA 1GS6X 3OQRA 1A4BA 1PAZA 1E5YA 2CAKA 2XYBA 1NIAA 1RZQA 2N0MA 3IE9A 3NT0A 8PAZA 4WTQA 1WAEA 3JTBA 2IDQA 2FQEA 1SF5A 4K9JA 3ZDWA 2FT6A 2NRDA 3X1BA 2DWTA 1PZBA 4GXFA 2XXGA 3TU6A 2Y1AA 1NDTA 3IBOA 3WNJA 1SJMA 2E86A 3WNIA 1GY2A 3C75A 3T9WA 2J56A 1GYCA 2BP8A 2GB2A 2OV0A 3X2QB 2YQBA 2PCYA 1QLEB 3TA4D 2R7EB 2XV0A 3KW7A 2QPEB 4AX3A 5I6NA 1IBYA 2YAEA 3AZUA 4A2HA 1TU2A 1QNIA 2IWKA 4GP5B 2BP8B 1AANA 2HX9A 4Q8BA 1KDJA 1AS8A 4Q89A 4KO5A 2X88A 3QJSB 4ZK8A 3GYRA 1KCWA 1ASOA 3S8GB 1W6WA 1KBWA 4UF7C 1A3ZA 1GSKA 4JKNA 3S3BB 4AKPA 1OOWA 1KV7A 6PAZA 1GS8A 2UX6A 4BK5C 1NIFA 2DYSB 1OCOB 3OD3A 4HCIA 4A66A 5B7EA 3WIAA 4GP8B 5LDUA 4E9RA 4KNUA 4DP5X 2BW4A 3DIVA 1OF0A 1SFHA 2XUWA 1R1CA 1IC0A 4A68A 2AVFA 3NJGA 4P5RA 1A4AA 4M3HA 1WA0X 3ZIYA 1JVLA 4P5SA 3S3DB 2UXVA 2HXAA 2CBPA 5D4HA 4AZUA 1SF3A 2Q9OA 5B1JC 2H3XC 3ERXA 5AKRA 1E5ZA 4YSRA 4DP4X 4AKOA 2FT8A 2XV2A 2MRYA 1TEGA 4BWWA 3EH3B 1M56B 1WS7A 1BQRA 1CYXA 2JFCA 2GI0A 1JZIA 3CDZA 1SHXA 4QKTA 3X1NA 1JZGA 3HB3B 1FFTB 2PPCA 2ZOOA 5PCYA 3AG1B 4G70B 4KO7A 1AZCA 7PCYA 1J5CA 1RKRA 2FQDA 3JT2A 2IDSA 5F7BA 4YSCA 4YSUA 1V55B 4F2EA 2VSKB 3RYMA 2VM4A 3QJVB 3UACA 2FNWA 2VMJA 2YXVA 3QJQB 3FU9A 3D12B 1V10A 4W9ZA 4NB7A 2ZWNA 1XMEB 1QHQA 4YSOA 5FC9A 1AG6A 4ENZA 1RCYA 1KDIA 1OCZB 2P80D 2XV3A 1CUOA 1E65A 3WKQA 4G7SB 3FYIB 2TSBA 3AW5A 1A4CA 2BO0A 1ILSA 4HCFA 1TEFA 1MG2C 1NICA 2EIMB 3OM3B 4HHWA 3SQRA 4NERA 4DPCX 1OCRB 3NJLA 4FAAB 1PZCA 2OCCB 3UGEA 1BXAA 4DP1X 4PAZA 5I5JA 5EHFA 3FYEB 2PPDA 2BZ7A 1ETJA 2PP9A 3AY2A 4CSPA 5A7EA 2J55A 3QJRB 2FT7A 3CZUB 1AOZA 4CSZA 2ZONA 2OJ1A 3ASOB 2BP0A 4E9YA 4JHVA 1GR7A 1NINA 4RH4A 2I7OA 1KYAA 1RZPA 1L9PA 6PCYA 3T6VA 3FQYA 1AQ8A 4KOBA 3IEAA 1ET8A 4N4YB 3U25A 1AAJA 2BZCA 3TBCA 2FQGA 2DWSA 4QLWA 2QPDB 3S8FB 2YXWA 4E9XA 1BQ5A 1UATA 4YL4A 1SFDA 2VM3A 3DKHA 1OV8A 1AS7A 3TASA 3FSAA 4YSQA 1CURA 2VW7A 4A2GA 1IKOP 1SDDA 1PF3A 7PAZA 2YAPA 3QPKA 4G7QB 3ABKB 3CVCA 3SBPA 2XVBA 2JKWA 3IN0A 3UAEA 2I7SA 2BP0B 3FSWA 2UXGA 4YSPA 1NIEA 2BW5A 3ASNB 1GY1A 1CC3A 3PCYA 4NAJA 1OE2A 2EIJB 4HCGA 1JZJA 5ANHA 1AZNA 2YAOA 1N68A 3N55A 2PP7A 3KW8A 3FU8A 1HAUA 2TSAA 4HZ1A 2HRGA 3QJTB 3PPSA 1BXUA 2VW4A 2EINB 1M57B 3FU7A 1ZIAA 3ABMB 2R7EA 1NWPA 4BXSV 1L9RA 4KNSA 3MX0B 5I6MA 1JZHA 3FS9A 1OCCB 4KO9A 2HX8A 1KGYE 2W88A 1A65A 1JXFA 4WKXA 1JXDA 2XLLA 5I5MA 1L9TA 2H47C 1GW0A 2Q5BA 1PNCA 1JXGA 1PLAA 9PCYA 2IWEA 1YLBB 3GDCA 2XX0A 3FT0A 3DTUB 1VLXA 3V9EA 2RACA 1FWXA 4GYBA 3FSZA 2GIMA 3PLYA 1AZBA 1A8ZA 4DP8X
chains in the Genus database with same CATH superfamily
4IBYA 3O6ML 2EACA 4X5QA 1QSEA 4AUUA 1RK0A 1PD1A 2ZKMX 5DI8A 4HF5L 2NY3B 4OCSL 1U91B 1ZMYA 2X40A 4YHZH 4BGLA 5CFHA 4QMEA 1I4FB 3VFRB 5MHSE 4NO0B 4GUQA 1IM9A 3HZKA 1OAXL 3T0EB 3H7LA 4JHWL 5I28A 4HV8B 4FLRA 2O93L 3UJTH 4RMVA 1KLGA 1U91A 2C3VB 1YAZA 1FL5B 3DOIA 4XWOD 2WXLA 4DSYA 1MW0A 1SHSA 5K9QI 5BZWA 3OJDB 3ZT6A 3T71A 1ZHBB 2XX1A 3K1KC 4BM7A 4ZFFB 1JRHL 3OJMB 4WWKC 5D1ZD 1N64H 1B4RA 1IM3A 3Q8AA 1BFOA 2GJRA 4JAMB 2YPKB 1CK0L 2B1HL 1CL7H 1NAKL 5I1LB 35C8L 1KBKA 5CCHE 3B2PA 3L3DB 4LOUD 5EEYA 5FYJL 1JHLH 4BFBD 2WW8A 4MDIB 1NCNA 2B1AL 2LHAA 3VXRD 1WCQA 2EDHA 3BP5B 2ICEA 1NIBA 3QQDA 1YQVL 4G72B 4GAFB 4NYLA 5G5DA 2B9AA 2A3TA 3BVWA 3WN5C 4XCYA 3MJ9A 5EDSA 3NP3A 4LCCA 4JHWH 1NDGB 2PPEA 2R69A 5DUML 1U3JA 1CS6A 3VXSD 2F15A 4APXB 3BDYH 3CFIC 1A47A 4I88A 2QQLH 1N19A 1KB9J 4PJ5A 3NBNA 3RKPA 4GG6A 5E6IB 3N44B 4RGNB 1Z0MA 3JV4B 5D1QB 5HGDB 1T1WB 3IMVA 3RNQB 2VDPB 1RV6X 1JOIA 1S3KL 4N8CL 3VWKD 1LO4H 2ZSVB 5I66A 4O58H 5F93C 1PNDA 4R0LA 4XPGH 1MCEA 3U4AA 5KVEE 3KL5A 1CK0H 2B1HH 2VXUH 5C0CD 4DP7X 2VDPH 4FQQB 4QOKA 1L9MA 3VD7A 3ZMNA 4DIXA 4KKLC 4PP1C 1CG9B 4K7FA 1OARL 4M02A 1MY7A 2E75C 4M7LT 3AC0A 5IOPB 4Y7OC 5F9OH 4GKOA 1CD1A 4WO4C 1OVZA 3US0A 4TQIA 3QQ4A 4KMTL 5EZPA 3EOBA 3IS1X 4GO9A 5BRZE 2ZYRA 5K9KA 1UWEH 3VD1A 4RBPH 3ZHDA 5EWIL 4M00A 3TWCL 1L5GB 2HT4C 1NKRA 2YD7A 2WQ8A 2P48B 3MRCB 4PIRF 2BWIA 4POYA 2BP5M 5KVFH 4D8PA 2IVFC 5T1JA 3RVXD 2VDOL 1ET5A 1HXMA 2Y5QA 2C8NA 3QORC 4W9DC 3BUTA 4ZD3L 5I19L 4ZUWA 3O8XA 4X0KA 5DYOB 1ORQA 1UZ6E 1DJXA 2Y7MA 4HS8H 3SYPA 4NRYB 1FNFA 2ZUQC 5C6TH 3GIZL 5JTWA 2WQSA 3QJFA 4KKCD 2QGEA 1SXZA 3EZ8A 4MNGE 3LOWA 3HLAB 4UANA 4J4PA 4H1LG 4NUQA 1MRFH 4PJEB 4NP4H 3FH5A 1E4KA 1RZ8A 4NFDA 4H88H 3D69B 1AKJB 4ETQB 4K07A 5TJWK 1R3HA 4I1PA 1G6RL 1L0XA 4M6MH 4P57B 1RURL 2X87A 4D2NA 2ODIA 2FJHB 4LVNB 5D1ZB 1PQZA 4Y16B 3TBBA 3PP4L 2BXYA 2XA8H 2YBGA 5J13C 4MJIA 5KBMA 4LLUA 3G6JF 4GSDH 4NWTL 1NBYB 1IBFA 2CGRL 1IGFH 5T1KD 1CFQB 2QLVB 3DROA 3IAPA 4UT9A 5E6IC 4I0CC 1G43A 2PR4H 1OL0A 4LT7A 3LRMA 1DLHB 1W72B 5IVXA 5I18L 1JGDB 5F97E 5DRZA 3QXAB 4ONOA 5K1NA 1BJ8A 3VFOA 1C8PA 4YVUA 2K4AA 5HHQB 2I26N 2ZXAA 5DJ2B 3LKNA 2ZNXA 1I1YB 1GOFA 2BY0A 1EWHA 2IFFH 2PW2B 1X3DA 5E5MB 3EYQC 1Q9WA 1S4IA 1ZLEA 2O6DA 3ARDC 4HWZB 4OCWH 2KZ1B 3BIAX 3KPSE 1HH6A 3O11A 4PH8A 4XP9L 1QAWA 2F8OA 5HVHB 4X0NA 4N2BA 4Z5RA 3HHSB 1TQWA 1UD3A 3MRMA 2IG2L 5DZOA 1DCLA 4JN1H 4ANKA 1FO0H 4R83A 3HG5A 5EIIG 2OS7A 3IMRA 5JPNA 1DDTA 3OQRA 1RZKH 2O5ZL 1P4LA 3EXLA 2Q3AA 4JVWA 5I8CB 3MRLA 2A6DA 3FTWA 1HHGB 3H9HA 4M5ZH 2J88L 3OXRA 4ZO6A 2DDQL 2DS4A 4JKPL 3TF4A 2J2ZA 4L4VD 3U2SA 5LGHL 3FUMA 1DSFL 2J20A 1GJWA 1ODAA 1ZS8B 3BQUB 5ALBH 1XCQA 1WAEA 2B14A 5DEFA 4KXDA 2XWDA 3VUAA 1D5RA 4PN6A 4FQ2L 2IDQA 2OSLA 2JMRA 3HBQA 5E8OB 3JQOB 1V7MH 1X5LA 3SYOA 3K2MC 4WFFE 3S37L 2A9MH 1FAKT 3OAYH 4D9RE 4BGDA 4LCWB 5K9QG 4MAYD 3VI4E 3IFOA 1GYCA 4GRWH 3UTTD 3L7EB 5D7HA 4QDGA 3AGWA 3DK0A 2R7EB 2BOBB 2V9RA 2XN0A 1Z9SB 4JO4L 3TS8A 4LP5A 3EFDH 5EU5A 3U1SH 5AW4B 1TZHA 2YKLH 2FGWL 4LCYA 2FO4B 4A04A 1I8AA 1DN0A 1MHEA 1BD2A 2IWKA 3KNBB 1RZKL 2O5ZH 1AANA 5DJ2A 5HHXL 4PGCB 3L7FA 4YWGL 4IMLB 4DQOL 4WU7A 1A6AA 2IH3A 5GS1B 2AMUA 3KYKL 4WHTA 1KCWA 1PS3A 4MS8D 1MUJB 5ESVA 3FHQA 2BSDA 3LRLA 2AK4A 3N43B 4YEFA 1HQRB 4ZDHB 1F1GA 3GS4A 5C0JA 5HJ3A 2NY7L 4YO0A 3QRLA 1JPGB 1YN6B 1TVBA 2EVGA 2H3NB 1LP9F 1I7RB 1RMFH 5KJRL 4E9RA 2X44D 5DEGA 4F3FA 4U1LB 4CN6A 3SGJA 4XWGL 2O6CA 3M17A 4RZKA 5BJTA 1BBJB 4KPHL 4Z95L 1XF5B 3LEVH 3NA4A 1VZHA 4S2SA 1Q9LA 4CN4A 1CLYL 4C4KO 4V33A 4A68A 3GJFA 2DIAA 1ZEAH 4NQEE 3N1QC 2HT2D 4FQJL 3MV8A 1A4AA 3GLEA 3V4VB 5DEGB 3J2PA 4DEUA 4D9QE 2ATAA 4H8PA 1FLTX 1S9XA 1SEQH 3EXJA 4HG4J 1WJ3A 2J3SA 2XTJD 4LEXL 4KY2A 2HA1A 2WQAA 1E4HA 1A7NL 3VXNA 3RVTC 4AZUA 2CGZA 2X10A 3QUXB 4WEUD 3TNMB 3KYKH 4NN5C 1G0YR 4OJAA 4BQBA 5JLZA 3DXAA 1KB3A 2JJVA 5F21B 3U0TB 5IHHA 4R90H 2HJLB 1MW2A 3BQUC 1JNHB 2W65B 4GW4A 5BW7C 2NTFB 5BVJB 1CXLA 4FNQA 1MCFA 3QEHB 2DD8L 2Q7NA 3KBHE 4Q56A 1B2WH 4MYPA 2XN9E 3NGBB 1X5YA 1OAYL 2NDFA 2X4UB 4HJUA 1BFVL 3F12B 4UZUA 4HH9B 5A1AA 1FYHB 2YPVH 4JFDD 1V3LA 2CXKA 3LKPB 2W60A 5L88H 3CLWA 5HGBA 4KPHH 5LBVA 5AAMC 2BOBA 2C9UA 3SB3A 1XR9B 4ZG1A 1DQLL 5E5RB 3C8KA 1OT1A 4WTWA 2XCMC 4P4RA 4TM9A 2R1YA 4DGUA 2DOCA 3PWPB 5LCVL 4RA3A 1IE5A 4HCRA 3CQQA 5C86A 1RSYA 1V10A 5MEQA 4QT5A 2WQVA 2ZUXA 4YDLC 3RAJL 5CMAB 4RAVB 4MZRA 3D3VE 3VXMB 5LHDA 3MLWL 3IKCA 2DAVA 4X5WA 4TOYH 1JGLL 1TJXA 2GEEA 3TJEL 3RL2B 1ILSA 2C5DC 1LEGA 1A9BA 5C0ND 1NMCB 1XCTA 3VFPA 3ZZQA 1OCRB 3MBEC 1OAYH 3AADB 1JGEA 3FT9A 2X4TB 4BCXA 4U1SA 2AHIA 4IEFB 3TO4A 4ZYKA 1DFXA 1VEMA 4FG6C 3CZUB 3EYSH 3L2NA 3BP4A 1BW8A 4MNGB 1H5BC 4O2EA 4JLRA 1KEMH 1KIPA 1F3DJ 1FE8L 1PAMA 4YH6A 2Q10A 4MXQD 5E7FA 3VG0L 4Z7QE 4K15A 3ULVL 4GQPH 1O9ZA 2A6JA 3MREA 3PQYB 4ZXBB 2FIRT 2QPDB 2H0JA 4FI8A 3RAJH 4XTRC 3IDIB 2NY0B 1K4DB 3RFZA 3CFCH 3QUYA 4NN5B 1LEGB 4NXKA 2NSQA 1I7TA 1KPVB 4L1TA 2XWJA 4ODVH 5DQJA 3F58H 1XSJA 1DSWA 3MLYH 3CWGA 3SBPA 3HTLX 4EMZA 5T5FA 2I7SA 4EDWL 2CO7A 3D0VA 4AYSA 5BO0D 2K9FB 5BOJA 4LO9A 3QZBA 5IFHH 4I1RA 4DVRH 1NEUA 1UM6H 5E2WL 1OE2A 1WO2A 1AE6L 5KVFE 4JRWA 2BHZA 3ZKXB 1MFCH 4UCFA 3TYFA 1I1FB 1UOVA 4IDJL 4XP6L 4DKAA 1N68A 2ICWB 1CTNA 4MXQC 2EYTB 2AJZB 2AJVL 4NQCB 5LNGA 1QPPA 4F24A 1HAUA 2TSAA 1UCTA 1KXVC 1JAEA 4PYHA 4JPVL 5E00B 4JFHE 4Z3HA 3OKKA 3HMWH 2WTPA 4XBEL 4YHKL 2XZCL 3U7YL 3GXDA 4GH7B 1DJSA 5AEAA 1C1EH 1INDH 1JZHA 2H26A 1HE8A 1KPUB 3L6FA 4F8PA 3VTTA 4K3JL 3KLAB 1Q8MA 4OF0A 1KLFB 3B56A 1YEIL 2E76C 4NQEA 1CDJA 2YBRA 3T0BA 4G9DB 4Y5XC 4NIYE 1XV8A 4JZJC 4Y2DB 4HLJA 3MUZ1 5FYJU 2NNRA 4NOBA 3DX2A 3CFJB 1HN1A 2FWLB 5HI5D 4U2YA 3ESMA 3FU7B 1DJZA 1CE6A 1P9MC 2ZKYA 2R0ZL 1MI5A 3V6ZA 1LD9B 5I1IL 2PPFA 3O2VH 4HYTB 3QUXD 4JPVH 2BSTA 1F6FB 1H0DB 2JJTA 1A9VA 3QUXA 1CTOA 1F6LL 5AZ2L 1LK2A 1CGTA 4N2FA 2NZIA 3PHQA 2YRZA 3FTUA 4XVUC 1ZV2A 4JY6B 5EB9A 4WUUE 4A2DA 1MCCA 2CCLA 1S7RB 4L1DA 1WWBX 2GT9B 3K1DA 3PU7A 4KK9D 3H2PA 3D06A 5CINL 5IVZB 5LNDA 4PD4J 3C5SB 4KX9A 5E1HB 4NNXA 3EF7A 3FPYA 2IGLA 4DO6A 3UP6A 4M7ZB 2AF2A 3BAXA 4LKXA 3NUKA 2AK1L 1P5UB 5SWZD 1RVFL 4HCRH 2HTLC 2J5WA 3VGGA 4BH7A 1KNOA 1ILUA 3FN0H 1H8SA 2MOVA 3LN9A 1T20B 4KO6A 2Y5EA 4ZX5A 4GAYA 3DBXA 3U4BL 3KR3H 4P59L 1OM9A 5DZJA 4AG4H 3VDBA 2H6PB 4Y5VA 1CFSA 4OZGB 2V17L 4IRZA 2FJUB 4TVPL 3CLEH 3T4AB 2WAHA 1FIEA 1T0MB 3FKUS 3WO4B 4XNBA 1BM7A 1WA2X 1R5WA 2ZX7A 2XBTA 3LEXB 4Z7OB 1XF2A 3QUZA 4HBCL 5H35A 5CZVH 1BVKA 2WVUA 1SMAA 3PV6B 4RFOL 1JS4A 1I8UA 2EZ0D 5E9AA 2C9VA 4JQXA 1KIUA 4OD1H 5FDWA 2QHLA 3CZFA 4RMSA 2NYKA 4PJGA 5DK0A 5C0AB 4XRCB 4QAMB 3RGVC 1RZKC 1T4KA 2C1OA 2A6DB 2N56A 4ZMYA 2VSMB 4F2FA 1LLAA 5EZIH 3S7GA 1FZJB 4PBXA 4A6YH 3SGDI 3BUBA 4WEBL 1UWFA 3FW6A 4WNQB 1A1OA 3VI4F 4QCIB 5LVEA 2RR3A 2OSLB 2EYSA 3GBML 4NQXA 2A73A 3O41A 4J3TA 3RL1B 4OLYL 3N40F 1NFDA 1NL0H 1MFAL 1TTAA 5BUAA 4TSCL 1UGKA 1O6SA 1J9TA 3EBGA 4M61A 5DS8A 32C2A 2ZX9A 4G8IB 4IJTA 4AEIH 3O6FA 4MAYC 4OUUA 4QY8B 4QUOA 4A38A 1AKPA 5FDYA 3GSOA 2VMEA 2VLKE 2ZXWB 1QW8A 5D1ZI 5FWRA 4HK3J 2EDEA 3LKNB 2BIQA 3V9CA 43C9B 3B9KB 1MVFA 1IGML 3RLSA 3T8MA 4TLSA 2X6AA 4WW2F 2EUVA 2F54D 4OQTH 4YDJB 2R8SL 3VRIA 2EP6A 1FDLL 2EDQA 4JRLA 3ZHLA 3ETBJ 3E3QC 2F53D 2Z6FA 3LPPA 4J39A 3JVGC 3MLVH 4M7ZC 4MFHA 1A6ZA 1WZAA 5SWSA 1FAIH 2XVGA 3HS0A 3NACH 3EDFA 2VABB 2XXMB 3T3PF 5IT2L 1XZWA 4KNTA 3CIAA 2A77L 1F4XL 2W94A 4R0LC 4NAMA 4OLYH 5AVXB 4I3SL 5DSCA 1M3JA 1XAKA 2VQUA 3PXJA 4Y19A 4FABH 4NENA 5D4JA 4C56B 2MCPL 3BOVA 4LQ1A 5D2NC 2PXYD 3HS8A 1IGJA 4LCWD 3SDAC 1BVNP 4O02B 2D3NA 3H56A 5TQ2H 2B08A 2PWFA 4BFEA 4N25A 5ES4B 1CQKA 1KGXA 2FGZA 4NGHL 4PCKA 4XPFL 5E4AA 5CSBA 3R4RA 1PZ5A 3IDUA 1B3JA 1D6EB 3I75B 2YA2A 3V8CA 1N0XL 1G94A 1KIRB 1AH1A 3BQUD 1E43A 3C09B 3DV4B 3O6KL 3SEPA 4JQVC 1FDLH 2ZP8A 3N0PB 4U6XA 3SE3A 3NCYP 2VL5B 1AKJA 4X5PA 2FJGA 1LTXA 4X6DF 4ETQA 2A7BA 4YLQT 1E67A 2P5PA 5FGBC 3DX7A 4MZIA 4IJ3C 3NACL 3MRNB 3P40A 1R3IL 1C9SA 4L8SA 1SYVB 4G3YL 1FORH 3KPRA 2XWCA 5AAPA 2IBZX 3Q5YA 2FSEA 2LVEA 4I3SH 1QBML 2F54E 1AG0A 5E8PA 4HKJA 2PXYB 5IF0B 4NWUH 4X4KA 5C0DA 1JDCA 2H1PL 2CR3A 3MXWH 3UAAA 5HJDA 4C56D 4Z3TA 1JJUA 3TH3T 1MW1A 3IU4H 4U6HA 1IVLA 2R69L 3CZEA 1KC5H 2YD2A 2IDFA 2YS4A 3IFLL 3OKDB 4BE6A 5SX4I 1UKQA 1PAZA 3FH8A 4QYOA 3TA3C 3UMNA 4S1RH 3Q7JA 3ZTDC 3QQ4B 4KKCC 4JS7A 4CADA 1E40A 1X5FA 4JRYA 3GXNA 4LRIC 2Z1PA 3CXDL 4RVBA 3RB7A 4ZNCD 5IBTH 4BQ6A 1IIKA 2FHFA 3ZE2B 4FXKC 3DMMC 2DWTA 5KVGL 2A1WH 3H9ZA 3QEGL 4RMRA 1U8QB 2Y1AA 5IJVA 1P5VB 1H8NA 4G1MB 5FO7B 1GY2A 3C75A 2AXFA 3EO1A 4K5LA 5GRZA 5CLWA 5ADOL 4QOKB 4XP4L 3BFQG 4RGND 4UU9A 2DMKA 2E9IA 3C12A 4RWYL 4WK4B 3UTSB 3S34H 2NYYD 1T2QH 2XV0A 1RIHL 4NUPA 4FZEL 3WHE0 5F89A 3QB7C 1LO0H 3RX7A 4HZLA 4O2CB 4QRRA 3GSRA 1F3JB 3FO1B 3BN9D 2ZUYA 4OLWH 2OL3L 3I6SA 4HZAA 4R26L 4M1DH 4UV4H 4A6YA 5E4EB 2OI9C 1XH1A 1NDMA 3Q3GA 4Q89A 5JHDE 2V3DA 4HJJH 4K2UL 4QWWD 3P11H 3RVUC 1NFDE 3II2A 4P23C 3GYRA 1K9TA 1T03H 4L3FA 3ZTJH 1Y18B 2E8ZA 3RIAF 2B3RA 2CUHA 3HI5H 5BOZG 5L2KB 4HUXB 2PUQT 4UF7C 4XHQA 1JYXA 1BECA 4ANVA 5JPNC 4MDIA 3F6IA 1ANUA 4WI6A 2C3VA 1NCCL 3ILPA 2AGJL 2BCKA 4YBHA 5I15L 3AQXA 1HOCA 2OMNA 1OCOB 5C08A 3SDXA 4HPYL 3GSNA 5EZOL 3D6GA 4MNHA 3HA0A 4OZFA 1TTRA 2DWEA 3QG7L 3STLB 3DETD 4BWTA 4GXVL 3WE1A 4BSWA 4WUUD 2V9TA 4NO0A 2EO9A 2WIIB 4PWHA 2FLRT 4KVNL 3WFDL 3ZE0F 5TTRA 3DSFL 4LB8A 4YGAB 3FQTB 4F80A 1WWAX 4DKEH 5EU7C 3QUML 2VDQL 1WISA 2MEJB 4Z7VF 3L3HB 2K7QA 3UAJA 4Q9QL 2BS71 4D0BB 4CW1B 3S3DB 1R3JA 1U8KB 3BE1H 4FFZH 5SWZB 3EHBD 2JI1A 3MXVH 2OZNA 1T6WA 1X5HA 3QYCA 2F5BL 1VADA 5FV2A 3LHPH 2R59A 2AV7B 3FRUB 4OB5H 1OM3L 2C1OB 1VERA 3HZKB 5TH2B 1FFPA 5SV3A 3QWRA 3O3DA 3VB8A 4JQVA 2FO1A 4QTFA 4WUKL 3WJJA 2BSCA 3PPEA 5GS0H 3C5ZD 3IGLA 4N24A 3D1MC 3GXIA 3ZKQD 1JGUH 3BUQA 1D2PA 1YQVH 2X9YA 5FO8B 3WFDH 3F5WA 3TBVB 4HUUB 3VQ1C 3Q2VA 3Q8BA 4DKEL 5AD0A 2NX5E 3QUMH 1DJIA 3RYMA 4LNRB 3MJ7B 4YE0A 5TPWH 1J0IA 5C0BE 1U9KA 4MLIA 4Q9QH 2VZOA 5GRJH 1WHOA 5E4EC 3DVFA 1N6VA 3LMJH 3ME0B 3IGUA 4AOFA 1VGEH 1W80A 2WD0A 5JR1L 4JPWH 4PFEA 5DVLA 1GOGA 4X98A 3MNZB 4V11A 5HDBB 1E27B 1CGSH 2CHNA 5JHDD 3RY5A 3ULSB 3HC0B 3P0YH 4QHKJ 2CNYA 4Y2LA 4LDLB 5E1AA 1NM9A 4JKMA 5DHEA 2YWYA 4AVJA 5TE4L 3APMA 4F9LC 1XH0A 4AC4A 4CKQA 3LIUA 4Z7WF 4PLKC 1QPKA 5HHOE 1YPZB 4JHVA 1NINA 3VNZA 4S10A 5T3ZD 2Z3FA 1OK0A 1A3RH 4NQCD 1SQMA 2HMID 1S9XB 2E4FA 1UWEL 2ESVA 1I8MB 1KN2L 4KKLD 4OZIB 2DPKA 3UZQB 1E9OB 2R29L 4E9XA 3DX6B 1SFDA 3QZOA 1A22B 4LCYB 1EH9A 2VLRA 1MI5D 1AS7A 4QKXB 5JR1H 2HTKD 3VDAA 3I02A 3POCA 4LSUH 1TJHH 5DJ6A 7PAZA 1MXDA 3U6RA 1GGTA 1JPTH 2VCOA 1K4CA 3WTYA 4PRAA 1CLOH 2JKWA 2MHAB 1B2YA 1HXYB 3HI6L 5ILTL 3BGFC 3IETB 4QHUB 3RKDD 1GGCL 3EYFB 3FJTA 5JHDA 5HYFA 1JZJA 3LQAL 3QGVA 2V7HB 2F19H 1Q94A 1WBXB 3TJHC 4CVXB 3N1FC 1BZ8A 5CEZD 4LBAA 5FM5O 1I1RA 4U3SB 5HJGA 3RHWF 3FUEA 1KJ2B 2OFQA 4I13B 5HDBF 1HHGA 3H9HB 1TQBC 5C0GB 4DW2H 2WINB 3SDXE 3LPWA 2R7EA 4JFUA 1WCBB 3HW7A 3Q6GL 5GGSY 2W07A 4KNSA 4UILH 3TBTA 4G6FD 1A5FH 2Y7LA 2HRPL 4O5LL 1QZNA 1AC6A 4K8RC 4JFXA 2EDJA 1MJJB 3RU8L 3IMUA 1HZKA 4LARL 4P2RB 2YBRB 2BOCB 3FQUB 3QDME 3EGSA 3IDGB 4JO5A 2PCFB 4LNVA 2V33A 4W4OC 2Y1VA 2YA1A 2VZUA 2XX0A 3DTUB 2JJWA 1QQDB 2FR4B 4KK8D 4OD3H 1YEKL 3LV3B 3MJ9H 4GRLC 4X9GA 3ZZLA 3C6LC 1YNLL 3U2SB 4XMLL 4N2MA 2F19L 5EUOE 2BVYA 3MRQA 3SPJA 3UAJC 3RZCD 2WNWA 4Y89A 3FT2B 5DEZA 3WLBB 5C08B 2CNZA 1MCLA 3CHXA 3BH4A 5ITFA 5DQ9A 5I1AB 4H7VA 4DH2A 2HLFD 5JIQA 1FL3B 2R2CA 2JI2A 5KYYA 4KY1L 4QOKE 1AD9A 3MN8A 6CGTA 2ZQKA 3BYTA 2HCZX 4DAGL 5IHUH 1UT9A 2EDOA 1TO4A 2J88H 5DJDA 1AQDA 4ES9A 2OR8A 2ITDA 2VDRH 4LQFL 2PW2A 4FKEA 4APQA 1JPST 1GZHC 1Q9KB 3DC0A 4G80B 5ALBL 2W91A 4XP5L 1Y18A 3MRJB 2Z0UA 4LCIH 3WYRA 2H9GB 4IS6B 1BF8A 1NCAH 3PWJA 3CN3A 3L4ZA 1EAOA 4UM8A 3SDCB 3DO3A 3PIQA 1ZANH 2HX7A 1BVZA 1AGFB 1A4KA 2OMWA 1U58A 3QEQA 1X5ZA 3GK8L 2BHFA 3SDXB 3WEXA 3IKCB 4YVNA 3V6BR 3A6BL 5L2KE 3RWJB 5I1HH 5IIEB 4Z7WB 2M8XA 2GJ6D 3L3GB 1YY9D 5CGTA 3A4EA 4G71B 1PX4A 5EOQL 2AQTA 5JQHC 1WIPA 3MMEA 4UTAH 4NJ9L 2BNQE 2AEOA 5CCJA 1WFOA 1NWOA 4X99B 2W9EH 4GQRA 4MNGA 4JJ5A 4B5EA 2Y72A 4GAJL 4LVOC 4KY1H 5E95B 3D85B 2YJLA 4MX7B 5CAYB 5IHUL 4JFQB 2GBAA 3PJLA 4PLJD 5JDSB 2NNXA 3PQYE 3EOBB 2VDRL 3E8UH 3L17A 4KZDH 4ZMNA 4PY7A 2HLFC 1AGEB 4FI7A 3D4GA 5FO9B 5FW6A 1F58H 1FNEA 2FUTA 4JUTA 4M43H 3BISA 1UVQA 3CFKA 3U9WA 2CLVB 4LGPB 3NSCA 1I9IL 1U8HA 2C1PA 2YUXA 3GS7A 2CO6B 1LEKB 5ENWA 1CO1A 1LXMA 4M4PA 4LIQH 3SCMB 2VR8A 4IOSA 1KJ2H 4F8LA 1ORQB 4PJIE 5FM4A 2DQEH 5F9WB 1UA3A 3CZNA 1WZKA 3HZYA 4QHMB 3SCMD 1FNGB 2VDNB 4CVWA 3HN5A 2VN3A 4UT9H 3CZGA 2IAMB 3TNNB 2W9EL 3UZVB 2DYPD 4OIIH 4CDHA 3TGXA 1DZ0A 5TQ0L 4NKOB 2ZZUT 4JFQA 3LKPA 4RRPM 3KPRB 1ACXA 2DL9A 1QOKA 4EOWH 5HYJB 3B6SA 3HRPA 1SVZA 4HS3A 4LHUD 3DGDA 4NBZB 4BDVB 4PWGA 1QI3A 3NG5A 1FFOB 3WKYA 4BH8A 1ITCA 3VXSA 2W0LA 2OW6A 3SZKC 4R90L 2Z4QB 2NTSP 4UB0L 5J11C 1DBJH 2B0SH 3B43A 4PCSA 4QF1A 1PGRB 4RMBA 1RJCA 2WLNA 5C0BD 3CSPA 3C8HA 2VLJA 1P9MA 2FX9H 2WQXA 5EFIB 4NQUA 5B1KA 3BPNB 2BIHA 3Q2LA 3NQIA 4PJ5E 1XB8A 4UT9L 2VJ0A 5B38A 3KPSD 5EU4A 3GHBL 4NXSA 4WWKB 4X7SH 4B0MM 3MA7A 3PGFH 3WKPA 4HUKB 3FB8B 2BNRA 2XY2A 3ARBC 5CSZB 2OTWB 2IIJA 4YX2H 2JTYA 2RD0A 4EOWL 5F7HA 5J12C 3VXRE 3MLSL 3V4VL 4KNQA 3BPCB 2NY5L 3W3BA 2ZJSH 4OZGF 1XTMA 5F0PB 2YMXL 3VSUA 3RGBA 1JGLH 4WJ5A 1I4FA 2FATL 3VFRA 2FYYA 2EO7A 1OWRM 3NMEA 3P0GB 4NSKA 5J57B 3OKLB 2FEDD 3V0FA 1NUFA 3H6JA 4G7YL 3Q2CA 4HHGA 3TESA 1HYRC 4ZUSB 3NEOA 3E0GA 3VWJA 1HDMB 5D55A 3ULUD 5BW7A 4NC0B 2LFEA 1ND0A 3G9VA 1R3LB 2BSEA 2Z7WA 1JNNL 3MCKB 4BHUA 1JZ4A 4QXGH 2EDXA 2I69A 4ZW6A 3HZMA 2EADA 4MBOA 4HJGB 1G7PB 1N59B 4L23A 2DB8A 5F7YC 5DGRA 5G4NA 2APSA 32C2B 3EDKA 4JK0D 2DWYA 4YGVB 2IAMC 4GQZA 4J27A 3VJ6A 4ZQKB 1H8OA 4KTEH 3B3BA 1UWXH 4NQQA 4Y4KD 2EVFA 4JFHD 4YX2L 4MAZA 1G7PA 1N59A 1T4KB 4NZFA 4OZGE 3L9EA 4I85A 5C70A 1AXTL 4HIIB 4Y1AB 3GHEL 2ISDA 1BAFH 1AR1D 3CFDB 1YEGL 5AB1A 3Q1SL 3WKNA 4K5PA 4QRPB 4H5SA 4IIQC 4YN3A 3BVVA 5D93B 5HVFB 2FL5B 4HIJB 1KGIA 1JRHH 2P49B 5DZPA 3ZDZE 5KYWB 5J11B 1TZOA 5I73B 3DOHA 1IO4C 3QAQA 4DN3L 4B6ZA 3OAZH 3UZEA 3BPLB 4NIKB 2NY6D 2NNFA 2FT6A 2WXIA 3VCLA 2XWXA 3WIIL 1T83A 4QXGL 1CL7L 1X4XA 4XNUL 5J6HB 4O00A 4JZJA 2E7HA 4LDOB 3G9AB 3LZNA 2EE0A 2JTDA 1T20A 5BO1H 1EXUA 1NBYA 5CNHA 1QP1A 1JCKA 1KXQE 3PHOB 3HG1D 3VH8G 4Y9CA 5MERA 2WLKA 4PJ9C 3V8OA 4EQ3A 1XEUA 2DM4A 3JWDH 4F57H 4YHKH 1T04B 4A2HA 5T3ZL 3UYOD 4C58B 1XGUB 4GO8A 4LKXB 3QUZB 3DURB 3CMOH 4AEHH 1E4JA 3NCXA 4EUPA 4QPEA 5KTEH 1XR8A 1W0WA 1YMHA 1VRSA 2GTZA 2RGSA 2Y24A 3ARSA 3C60A 1ECYA 3CDGB 2VERA 3FCBA 3VWKB 1UOWA 4EI6A 3BAJA 2W80C 1S3KH 4AKPA 2X53A 3UL4A 1W91A 5E8EB 4L2YA 3T2QA 3IFPA 5AVTB 3PGDB 3AGVA 2O61B 1TNMA 1A6UH 1CI5A 5KVMC 4XNUH 3V6ZB 2IANA 3LNDA 2V6HA 4LRIA 5FUCC 5I1IH 1G0XA 4P0DA 4FHJA 4V1DE 1NLBH 4OT1H 4QLRA 5IB2B 2WCPA 3E9TA 1T5XB 3KJ4C 4N6RA 4TUOB 2HKHL 3F7VA 4L29A 1JSYA 2ZKWA 5TF1H 4L0YA 3KDMA 5D6DA 2H2PC 2IF7A 2WUCL 5D2LE 5DZVA 1M6OA 3U9UA 4DF9A 4KUZH 5I1KH 2LT9A 1FYTD 1EANA 3VRJB 2IQAB 3O4LA 1BOGA 5KTEL 2VDOH 1PZSA 5HI4C 1HHKB 5AKRA 4E41A 5FO9A 2PXYA 1X9QA 4P3WA 4FCAA 4J23A 1TEGA 3QPXH 1NEPA 1W15A 5FV1L 1PYWA 5FF6B 4OFVA 4LVNC 4R4BB 4KFZC 2YRPA 2R1WA 4FNLL 1TZIA 3SE3C 1RPQA 5ERWB 1BQHA 4PUBL 1JMZA 2EKJA 4MRBA 4P07A 1MIMH 3RRQA 3PWNB 4M8RA 4K7PY 1URZA 4DWHA 2XNAA 3GMPB 4OD2A 4IMKA 4KHXH 4N1CA 3WKML 4I9XA 5F3BA 3QZMA 2IDSA 4H26B 4F5CA 3KLAA 2G0LA 5JW4Q 2JJSA 1UGNA 3KHQA 4X8CA 3KXFB 1PVHA 4L1HA 2VH5H 3B9AA 4UUJA 3MRGB 3SGDH 4IMKC 1KUMA 3GMNA 3NAAH 4G8GA 5FWQA 3DPDA 4PRBA 5GGVL 3P4OB 3A23A 1RK7A 2EUZA 5AENA 4ENZA 3RILA 3N0AA 4N90E 5E1QA 2KUTA 3DVIA 4F7TB 3BLBA 2HH0L 3VXQA 3KPOB 2X89D 1TDQA 5IESL 1BM3H 5EC1B 1G7QA 4MVBD 2ALWA 4NERA 3AWGA 1U30A 3RI5F 4LEBA 4HD9A 5LN4A 1QBLH 3NABL 4PAZA 5DD0L 1KIQA 4JDZA 4N6QA 4W9GC 4WY7L 3KLLA 4J6RH 3FYEB 4Y9GA 3W5MA 1ETJA 1BZDA 5F70A 2NR6D 1YMMB 1B4TA 3ILDA 3S96A 1NBZA 3UTZB 2CSPA 2ZONA 3K3QA 3P54A 1TJGH 2ZE0A 5CGYD 3L5HA 1GR7A 1TR7A 5LGKA 1WRFA 2HWZL 3JT0A 1AD9B 2Y5TA 3DXAE 3HI1B 3QHFL 4UBDD 5KYNA 1PFCA 5AOIA 4AEIL 4N20A 2DMHA 4N4YB 5C0IB 1A3LL 3JWNE 5SV4A 3ULVD 3C8DA 5KVDL 2X41A 3B9KA 1GCYA 3L3DA 5FYKE 3VGFA 4CU6A 2C7UB 1MLBA 3AT9A 2FL5A 4HIJA 4A7SA 3V5DB 4YZFE 5I1JL 3T2OA 2NY4D 1KXQA 3EBHA 2E7LC 2OSXA 1T1YB 4M5ZL 3UTSA 3K6NA 25C8H 4G7QB 3CC1A 3NSXA 2KI6A 4Z7VB 5LGHH 3SJVA 4MKTA 1NFDB 5IJCC 3TONA 3I6LD 2DEWX 3DJZA 5E99L 5CF3A 3HG2A 1QFHA 1QASA 5IMMA 1DE4B 1FFQA 1Q0YL 4P4RB 3IFNH 2EDNA 2GTWB 4Q4EA 3C60C 2WXOA 1BZEA 3ASNB 5CN1A 5GGRY 1JI2A 1CU4H 2X1PA 3VRLE 4L8BB 2VMCA 5D70L 1X5GA 3FUIA 1KPRA 1F5WA 4P05A 5KS9B 3RE0A 1JTPA 1RD6A 3QIUC 3N55A 4U7SA 2MCPH 5BQ7B 1LWRA 1NC2B 3GSXB 3HVNA 1VB9A 2D8KA 1CQYA 2KT6A 1ZTXE 3ZXAC 4FG2A 3JTSB 4UTBA 3NOIA 4ZUVB 2YKLL 4HOMA 1U8IB 4LBEA 2NXYC 4ZPTB 4KGLA 4POUB 4PPTA 1I8KA 1JXFA 3IETA 2EEAA 3ZHFA 4HWUA 1L9TA 1UXMA 3GMOA 4V1DA 1J12A 1GW0A 3L16A 1HZHH 4AIEA 2AITA 1F4YL 4ELKA 3MRIB 3PDOB 1DQDH 3OKEA 2O6PA 5JYLA 4FL4B 4PWIA 1A21A 2R2EB 3N9GL 4FF9A 1R75A 1J88A 1B0RB 4ZX6A 2OR9H 2XKNB 1VZGA 2HFFB 2CXGA 4MNQA 5D70H 1L9QA 3WTTA 3OXSB 1EHLL 4FA7B 5AUMB 5HPMB 1HH9B 3HAEG 3HE7C 1G5GA 4PJGE 1RUPL 4KAQH 1U8LB 3LEVL 4YDKL 3RGVD 2VR3A 3IFPB 4OM0L 3M17B 5BJTB 5ICZB 3D39E 3HOGA 1NMCC 4FS0A 1T1ZB 3KVDD 1IAKB 4JDEB 3TH2T 5BCAA 1WZ1H 1UXLA 3CCHB 4ODUA 4FXLA 1AO7B 2EXYD 3KM1A 4GBXD 5C0JB 3F8UB 4S1RL 2IOMA 4QHMA 4KJYB 5HDRA 4P46A 2WWKO 3GSQB 3ECWA 4H8VA 4IU3A 3VFTA 3TIDB 4YK4B 5IBTL 3D0LB 3ELQA 5DJZB 3TH4T 5AYQA 3GMRA 4P23A 5GJSH 4EXPX 4EQ2A 3W11D 5AYUH 1SMDA 2A1WL 1B2WL 4APQD 4PU2A 4AYID 1C12B 1G7MB 4CSSA 2BRQA 3SPGA 3MRHB 2X9WA 3PL6D 4HLEA 3BWSA 3TM6A 4YDLB 2XQYK 1OB1B 1LQSR 2CUAA 4GMSL 4ADJA 4DGYL 5GGTL 3QRBA 1MKFA 1IFHL 4LCUA 4ZMAT 1JV5B 2NY2D 1FGNL 3IXTA 2G5RA 5DZAA 2NY1C 2ZXCA 2R4SH 1SHMA 5A6IA 5IROC 4NC1C 3U83A 4LKCB 1LP9E 3NIGE 3V4UL 2R29A 3I9PA 4OLWL 1AZVA 2DLGA 3IJYA 2VB5A 1GS7A 3WFBH 3LNFA 3O6FB 4OUUB 3HB3C 3HG1B 4M29A 4DCQA 4TOYL 4ZNEA 1UFGA 2BMKB 2YRBA 4HIIA 4Y1AA 3BO8A 3Q5TA 1S7VA 4PGEA 3WJJC 2ZOLA 3KYNA 1ZVHA 4OZHE 4AK2A 1U3NA 3VVVA 2J4WH 2H7WA 3UBGA 4HPYH 5KW9L 4E41D 4KV5F 2VR9A 5K1VA 3ZLQC 1OP4A 4G7RB 5IMMB 1HAWA 5J3HC 3UTSE 1HILA 2OCFD 3L8QA 3QZPA 4KKQA 4R4ND 1BYOA 2D7TL 5GIRB 4BSVB 1D7FA 2H2SD 3DJ9A 3SJVE 4EIBA 1IFHH 1U58B 1KCBA 3OGCB 3QEQB 1MFBH 3T77B 2C7UA 1NCTA 1P7BA 3L3HA 5C0AD 1LMKA 4X6CF 1ZPUA 4EZJA 3NZHL 2X4NA 4OIAA 3SGJC 5IWLC 1K8IA 4ODTH 1FLRH 3GBDA 4N0YL 4ZAKB 3BP7B 1K85A 3NIDE 1AZRA 3ARDA 1OY3B 1UXWB 2GHWB 3BE1L 2Y5TB 3MREB 1G9NC 3KD4A 4BQCA 1RIVH 4U31A 3O3EB 1HVXA 1I7ZA 2YUWA 4TULL 3WNOA 1AJ7H 5C0IA 2YKKA 2YAFA 4M1GH 4O9HH 1IIIA 3AREA 4ODVL 4EUPH 1P6FA 2AEPH 3A67L 4NQDE 3HE6D 1IAMA 3CXFA 4PJ6A 5JA9A 3LYRA 2ZWYA 1J0ZA 1MRDL 5D4QA 1KYFA 4UWQB 5JPMC 4GT0A 2GC4C 2QGBA 1PKQA 3NJKA 2CR0A 1VPOH 4G8EA 4JFPA 4ABQA 1CDGA 1LNUA 3NJJA 4QTHB 4RGMC 5HSFA 1UM6L 3TN0C 1AE6H 1AGBB 1J8RA 5H37H 4EN3C 3MV9A 4IDJH 4KQ4H 4ZX3A 1NGQH 4JRYE 5I6XB 3EOYG 4NN6C 1L0PA 1GGBH 2IAAC 3MGOB 3ZE1E 3P30H 4PGDA 4A7GF 1S9VB 2VR6A 3BUPA 1HNYA 5LWYH 4NPJA 3L3KA 1S7UA 2ED7A 5D6CB 3KHOA 1E2VA 2VDQB 1WE5A 4TSAH 3BVTA 3K8MA 4NKDA 4V1DD 5I30L 4QRTB 4LPXA 1E4WH 3ZHKA 1MAKA 3DX9A 5CCGE 5D8JL 4TULH 5E4IA 4LPWA 4TNWF 5GRVK 4D0DB 1IGCL 5F3BB 1U8QA 3D39A 4MSWA 4XNXH 1YEIH 5EPMA 1NFAA 4TL5A 1AI1L 1XTLA 4ZOCA 3UBHA 1ZHLA 3G6AB 1J5OL 5TE4H 3RG1C 5L6YL 3CVIL 4PTTA 4XPTH 4E41B 4EE2A 1E2WA 1KENL 4HEME 5F1IB 4Y2DA 3WFZA 4KKZA 3ZMEA 1DYZA 1MCQA 3WGVB 2B16A 5D9SB 4HT1L 4LL1A 1VEOA 3TBSA 4U1IB 2UY6A 4AV0A 5DWUH 4NRYA 4UQ9A 2Z34A 4QHUA 5E8EA 5E9DB 3OR7A 4CU8A 2XTLA 3CFKB 4AYBA 2BNQB 2NW2A 5KWYC 1XH2A 2F6AA 3QUHA 4TN9A 3UBXI 2CA4A 3PFQA 1ETZA 3JSSA 4JFYB 5EZJA 3C5ZA 5DJ6B 2BCMA 1A4BA 2K6ZA 5DLLA 3NCMA 4HUWA 3SZ6A 4JANA 3BAKA 1BQLH 4Y19E 2IV9A 2EXTA 5EV7A 4WK2B 2DJMA 4TNGA 4RMUA 5JPMB 4YL9A 5IQOA 2OAAA 5GGQL 1EA9C 1AGDA 3S4SA 4EVNA 5C2UB 4N5ED 5KSVB 3GUTA 1RVFH 2DMGA 3GMLA 3ALPA 4KMQA 4YDVA 4MMYA 3RGHA 4EIGB 1PIGA 3SDDC 1LQBC 1D6EA 2NR6A 5LQBH 1UC6A 3BYYA 4E5XB 2EC9U 3JV5A 4HJSA 3QRFM 4X6EB 3QNXB 3TT3L 4K3EL 3TBWB 5EUKA 2QSQA 4N2OA 3TYGL 1WITA 3DIFB 4G82A 2QPEB 1M1SA 4GG6B 1E4KC 2BVPB 2CM6A 3N5AA 4YBLC 3RX8A 2YWZA 5I8KL 2DLFH 3QZNA 5JW4M 3MRJA 4UILL 4GG6F 2J8UF 2ITCB 3QWOA 3TXAA 4BKSC 5C6WH 2CO3A 3AAZA 5BZWB 3KPRE 4ZK8A 3PF2A 1V3JA 4XCYB 5C0CE 5L2JB 4X6FA 1NGYB 1DN2A 3GSVB 1RZFH 2HT2C 4XNDA 5EU3A 4GXUM 5EO1B 2JKSA 3BP4B 3PHAA 4TSBH 4BUHA 5C0BA 3S3BB 4TPRL 5E56A 5FR3A 3EFFB 1KCSH 1QBBA 5K39B 4APQC 1UWXK 3LCYA 2CPUA 2KKQA 4HUUA 1W0VB 3GJEB 4HGWA 3KH3A 5IK3A 4Q9CA 2ZUUA 1CN4A 2JQAA 2XA3A 4G59C 4PG9A 1DJWA 2EECA 1HL9A 1HI6A 3WS6C 5ISZB 1M1XB 3B9KC 2V2WA 3VGEA 1R1CA 1YNKH 5I1CH 3ATBA 5EOCL 1DBKH 2J2ZB 4NCC2 1I1AC 1RK0B 3PWLB 3Q8CA 4P5RA 5IHLB 1H9DA 1A7OL 3GGWB 4IJ3B 3FFCA 2OZ4H 1P4BL 1R0AL 2V2WB 4X8JB 5HHOA 3TCTA 1NGWA 1P7QA 4GRLA 4OJFH 1T7WA 4FZ8H 4HJGA 4GW5A 4Z7QB 2G3NA 1QEWA 1T89A 2Z93A 4L4TE 3RVWD 3PP3K 4F8NA 2OTWA 1NCAL 1A4JB 1TTBA 1DP0A 2A99A 2AI0H 3DUHA 1OAUH 4PRPB 1FCGA 2ZPKH 4HISA 5DK2A 5K5YA 4F7EB 3ATAA 1GW6A 4GBXB 1S9WB 2JFCA 2VDML 3CDZA 3FO2A 3KBPA 3CHQA 3II1A 4FQXA 4TMPA 5T1DL 4KFMA 5JIMA 4R7NA 4YFEA 1FFTB 2A77H 2IAND 2ZOOA 5D2NE 3OX8A 3DIFA 4U1NB 3UJJL 4MNHB 4MJ5A 1NEZB 4FG0A 5C07A 4UTBH 2RCSL 2ZOTA 3UJIH 5FS5A 1VHPA 1NCOA 1E4XH 2QZ5A 3LKSB 3SDYL 4F7PA 2XFGB 5B4MC 4PRBB 4X2UA 5BV7B 1G7MA 4M62H 2EIZA 1WIOA 2IPUK 4KK5C 3U6RB 1HEZA 3K6DA 3ZRSA 2CHDA 4AJWA 1RCYA 4JFFE 3IXAA 2VJ8A 4G7SB 5IVNA 4FQIH 1EPFA 1OAUL 4NCDA 5CBAB 3RDTC 3CHRA 1F97A 3ORJA 1SOQA 4GAGL 4GRWB 1TZAA 2BIPA 5D1QE 3FTVA 3EOAA 5DD6A 3QXDA 4HU2A 4R2GB 3U7AA 5KBKA 3F7KA 4FNTA 2Y1ZA 4OCMC 3X14B 5KSUA 4AIXA 4KITB 3RY6A 1GGIH 1N5AB 5JIKA 3C2AH 5KS9E 2APVA 1NGXB 2GSGA 1MI5B 1SGKA 1MN4A 4M7LL 1UWGH 5D5MF 4PRNB 3ZTEA 4LVHB 3HRZC 2EDKA 2WHVA 1FN4B 3HCVB 3S8FB 4U1KA 2UY6B 4FXKB 1OQXA 2NSMA 2K0RA 3TL5A 1J05B 1K8DA 3O9WB 4I18B 1UASA 2V2TB 1RK1B 2WXGA 3HZYB 4J3XA 5DU7A 5EF1A 1MFDH 2E9GA 4D0DA 2ICES 1FN4A 3DYMA 4NLAA 4PJXF 5GZNC 1U3HC 4MHHI 4KKRA 2UYLB 2K6YA 4P06A 5D72H 4ZT1A 4L0ZA 3V4PB 3JZYA 2BW5A 2J1YA 3TO2A 3II3A 1IJNA 1MLCB 3QEGH 3PE9A 3MVSA 4NAJA 4Y4HB 4YHIB 3QYNA 4NO2B 3EYOB 2HUHA 4WKZA 1QLRB 1EZSA 3B8YA 4J8QA 5AOKA 1KB5H 2MKWA 2PP7A 5E0QA 4PIBA 3EJSA 5INDB 1OSPL 4LL9A 1J1OL 3W0WA 2A4CA 2VAAA 1CF1A 2NW3A 1B88A 4NC2B 5IEHB 2BNUA 2ZCHH 2CDFA 2DQGH 2VC2B 3TYFB 4U2ZA 4DQAA 5JPNB 4GG8B 3UPCA 1LNUB 3VWJD 4BFFA 2EYTA 1Q9KA 2NY3C 2ICWA 3MRBA 4UTCA 5L0QB 3UJTL 2QR0B 4PRHA 4EKXA 2P43B 4MXWL 4PJIF 5D7EA 4D9LH 3K6SB 1MCOH 2IALB 1A6ZB 4P3CL 3B2XA 1AC0A 4LPUA 1I7ZB 3UYRL 1CDCA 4MJ6A 3L3GA 5F88A 2LU7A 3RDTB 2RACA 5IIEA 3ES6B 3FSZA 4FGMA 1T2XA 4Q7DA 4W81A 2J6EL 3AREB 4F7CA 2VDLL 3PQYA 4NENB 4JAMA 2ICWI 3ZL1A 1K4DA 2GEQA 4GXVH 1WD8A 3KPNB 2DWEB 1JTOA 1YEJH 2FYVA 1QSED 4XXWC 3STLA 5IVXB 1OANA 3BD5A 3FULA 1BQUA 4KJPD 5JW3H 3HAEB 4OZ4B 4QHNB 5CBEA 1L7TL 1X7SA 2VISA 5FM8A 4BFOA 15C8L 2A9BA 5JOPE 3QUZD 4N9GB 4N22A 1OTUD 2Y0SA 5CEZH 1EX0A 1JNLL 1T0OA 3JWOC 2ALAA 3D52A 3OQ3B 1CD9B 5GIRA 4BSVA 3Q1SH 7TAAA 2QQLL 4Y16A 4RGOH 1MCJA 4HA1A 1JPFA 4AKQA 2E74C 5F44A 5BS0D 1OSZA 1WUZA 1DBBL 5C97A 1LO4L 5KVEH 3K2UH 2W8CA 2WBWB 3WEAA 3SE8L 4XRCA 2GPZA 2KLRA 4M8QB 4FXGC 4U6VH 2PO6B 1G7JB 4OZHB 2CJUL 4XR8C 4JO1H 4WV1A 4UQBA 1ZT1A 2FH6A 1OHZA 2ZUSA 4PG9B 3ZL4L 3FONA 3NZUA 1JGUL 5T3XD 3V9FA 1ZDSA 4GG8A 3DX1A 4NN7B 4XNYL 2K45A 4GW1B 3WCYA 3BN3B 1XSKA 3U1PA 2W60B 4NT6A 5T3ZH 2J6EA 3K0WA 4BK8A 5JOFA 1IKNC 1QUNB 1ZE3H 1BZ7A 4PGEB 4CC4C 1A14L 1KJ2A 5CEZE 4HIHA 1PYWB 3CMOL 4X6CB 4DCQB 4Z18A 3UTSD 1GPOH 2DQIL 1BMZA 3WTWA 3PG2A 1AY1L 2EJ1A 1IKFL 1TZGH 4PS3A 4XNQA 4PD4K 1OW0A 2XWTA 3WG7B 4B7LA 4N0UA 3QDAA 3GIZH 2OYLA 1Q94B 4ZTOH 5ICYB 1XH3B 2FB4H 2QQQA 3MV8D 4E9LA 3QORB 4DTGH 1MRFL 4I8DA 1D9KD 5KOMC 2J57A 4BRJA 3GFUA 4AC2A 5ICZA 1CXKA 2I85A 2ITEA 3MRKA 1WVZA 4YDVB 4OT1L 5KUKA 3EOAB 2Y6SC 3IPBA 1BIHA 1YYML 2XIIA 2DTML 3LNIA 2CO4A 3HEIB 5F1NA 3DRTB 1XZ0A 4LCVA 3MV7B 1KN2H 3ULAB 3IN2A 2DLEA 1FH2A 3ZX1A 2K3HA 3VXOB 1N5AA 3MRKB 2R2EA 2FX8L 3CX5K 5CLZA 3W0WD 1ZS2A 4RSVA 1Y6NR 4MNQB 1T22B 4NKMA 4XMKH 1I7RA 2VXVH 3BAEH 2YLKA 1DQML 4JRXA 4P4KC 3GXUB 2EH7H 1BZ9A 5J13B 1JZFA 2XHNA 3LTVA 3U6XS 2BNQA 2FEDC 2NW2B 5E1AB 1BSIA 1JZEA 2F53E 3M8OL 2VIRA 2K3TA 4ZS6C 5T1MA 2DV6A 2GSMB 1EERB 4EIZC 3PDOA 4QJ3B 2AK4B 3APCA 3RY4A 2EEDA 3LXBA 4UV7L 4ENEC 3D48R 3EYVB 3GSNL 4V1DB 4PRPE 1QHPA 4M4RB 3TFKC 1A1NA 3DTDA 1E28B 4BFIB 5GSRA 5EF2A 4EDXB 3CFJA 1XVSA 1YYMH 1WAAF 4QRQA 1PTZA 3VTMA 1ZHBA 2Q20A 2TAAA 4WGVB 3VFGL 4XN2A 5DK2B 5JW4R 4HIQA 4PJDA 1L6PA 4R96B 2BOLA 4K94C 3GSUA 2BY2A 3NP4A 3MV01 1KZYA 4PW9A 5L8KB 3DUSB 2HPTA 3H9SE 5GGVH 1RHHB 2OZ4A 3INUL 3O3BB 3E6FA 1W72L 2EE2A 4PJIA 2Q8AL 1GRWA 1NUGA 4LE8A 4EZKA 3BMWA 3OX8B 4YEEA 3Q5OA 4YPJA 4F20A 4GP4B 4FI6A 1HCVA 4CC0A 3CSTA 4RDBA 5F7EL 2UX7A 1ORSB 1DSFH 3FONB 1QACA 5JA8B 5TH2A 2DZEA 2QELA 3UC0L 1K5NB 4AMWA 4PJEE 2PCPB 2XDHA 4E9VA 4KVCH 4UV7H 1BGXH 1YEKH 4MB4A 3WI9A 2J6WA 2V7NB 1IC7H 2Y9RT 3HNSH 4FNPA 4P46C 4EI5C 1ZKAA 4F7KA 2ZAGA 4TNWK 3MLXL 4IGBC 2HWZH 6FABH 4J5VA 4YDIL 2X28A 3QHFH 4QTHA 3NJFA 1HFUA 3I9GL 4AGLA 2R0KL 1B4JL 3B37A 4ADIA 3KPTA 1J1XH 3IDJA 3CSFA 5IR1A 4NWTH 2MQ3A 4K7PX 4QGTA 2OMBA 1IEAA 1IZKA 4AW4A 1FL3A 1WC7A 4LPYA 5DUJA 2WZPA 3PABA 4C4KT 1AXSA 1D2OA 3D2TA 3F7YB 1E5YA 2CAKA 3KPPB 4FFWD 4YWGH 3RWGB 2VISB 3ARFD 3WDHA 1MFUA 25C8L 2BP3A 4LQFH 3NK3A 1DQVA 1ETB1 2LAGB 2LAAA 3ZQ9A 2P5WD 4ZAKA 5D5MA 1NQBA 1QLFB 1O9WA 4IKNA 3IAGC 3IDNB 1SJEB 5LDSA 1U6AH 2IOOA 3PABB 1SF5A 3DHJA 4KRPC 2H0PA 5SWZE 3RL2A 1VSCA 2QBWA 3NDZE 2P24B 3EJJX 4DETA 2IBGA 5E5LA 1S9YA 2FWOA 2GUYA 4GIAA 1KXTB 2DYPB 3I9GH 1HNGA 4PJAE 2PCYA 3SDDA 2CO2A 4QHLB 3GUFA 2NNCA 5GZOD 2D7QA 2WLYA 1G7IB 1JTTA 1KGJA 4Z78B 3EGXB 4FQJH 3HZ3A 2IH1A 3AZUA 1YUKB 5H2BA 4G83A 4Z77B 5K9JL 4F7MA 3V7AE 2GJ6A 3CC5B 4UU9B 3E1F1 4PTUB 2X3BA 2YZ1A 1A7NH 1GH7A 2EVIA 2UWEA 4AQZA 5F89B 2GJZB 2X70B 1F4YH 1ETZB 4ZUTA 4R4BA 4FMFA 3LXAA 1F58L 1DVFB 2BVQA 3BH9A 2NOYA 4RA0C 3ZUNC 2WN2A 5HP5A 4U6HB 2DL2A 4UOW1 3LB6D 4PVLA 4DZBB 3VW3H 1A6VL 5F1SA 1V7ML 2WY3B 2DM3A 3TIEB 3OGOE 3IXTB 3QC5X 2OR7A 1HHKA 1PU0A 4GP8B 3QCTL 2A9ML 5DMIH 1ADQL 3TBSB 2DI8A 1EAPA 2YPVL 5B8CB 4KNUA 4G6JL 3OAWA 4GKNA 3SQBB 1SFHA 1E5CA 3JZ7A 5IB2A 4JHZA 4U1KB 4OM0H 4M6OH 3H3KA 1KBPA 4B53A 3FK3A 2AAAA 4I18A 4N6RB 4U4BA 3U7WL 1UD4A 5DT1H 1SY6A 4NQEB 1EEUA 3QDMD 4ZSOA 3JTTB 5KSUB 4U1IA 4YMPA 2HFGL 3C6LD 3MNWB 2E6JA 2Q6WA 3L2MA 3J8F7 1CL7I 3VRJA 4NKDB 1ZSDA 3QHZL 4WI8A 3UAJD 1H15B 1PEWA 4RETB 3IGKA 4GT7A 3IDXH 3FB6B 4UB0H 4DUXA 4I4WB 3AMLA 3VH8B 2WLZA 3PY9A 3S4SG 4ALAC 5HYSA 3MDJA 1M56B 5AYUL 1BQRA 2Z92B 3NDYE 1FZMA 4IRSA 1KCLA 4WFHD 5DMIL 4XH2A 4WEMB 3VFMB 5KJRH 1XX9C 1TIUA 3X1NA 4Z7IA 3UDWC 3EJCA 3MBWA 2P45B 1TMCB 4YIQA 2Y7SA 3AG1B 4BZ1L 4HAFA 1HEZB 4WUUA 1X7QB 1FH5H 4IGBD 1B9KA 2ADGB 3UACA 3QJVB 4BYHA 4HQQH 4OBSA 4F58L 1G9MC 4MA1C 3QJQB 2X9XA 1PD6A 5D71H 1QX1A 4F15B 2G3MA 4HBQA 4MWFA 3WN5A 4OFQA 5FOBA 3V4VH 4XMZA 4EI0A 4EO5A 3Q48A 1JF6A 4O02A 4LP8A 1T5WB 1OLZA 4L3AA 1AP2A 1ONQA 2L7JA 3VXTB 5A7BA 2YRLA 4PVBA 2YOAA 3IMSA 1MG2C 4YXKH 2EIMB 1QTYT 4RAUA 5KW9H 5D1XE 1XCQB 3LNEA 5DS8B 5IUSA 2HTKC 5I5JA 2BIMA 3TEXA 2X4QB 4A1RA 1TQCB 3ASOB 3QDGB 5J8OA 5JO5A 2VT0A 2ZX8A 3QISA 3PWUB 4IOIA 4P2CG 5FK9B 2I7OA 1XHHA 3CD4A 1W9XA 3ULVF 1U8OB 4G11A 4KOBA 2HMIC 1QYGH 4IQHA 4JKLA 5DC9B 5B22A 3VD2A 3GBNL 2DWSA 4ONFH 3KLKA 3U7YH 3ZKXC 4B3VA 5D7SL 1ZHKA 3CDFA 4W9LC 4DZ8B 3ARFA 1INDL 4M48L 1MIEL 1R6VA 2EUXA 2OXGB 4CC1A 2W0PA 5D1XC 5E2VH 3BD4A 3MCKA 1PF3A 3OKLA 4UIKL 1I1YA 2OMVB 2BY3A 2E47A 4P2RA 4ZW7A 2P5ED 1UA7A 5DXWA 5CZRA 5AKSA 1NIEA 1UJTA 4JFZL 1CFSB 1BBDH 3KL3A 5GHWL 1GY1A 4AWJC 5MHSD 3WIIH 4AGOA 3CBJB 1RL1A 5FK9A 3KLHD 2YD4A 4GNKB 4HCGA 5CSZA 4ZZKA 1S78C 2IO5A 1HQ4B 2E3VA 3VFUA 3KXFD 3CN0A 1G9MH 4L9LB 5KAQF 3DI2B 3ZKNC 5ANMB 3BC9A 3IU3A 1DVZA 4JG0L 4Q6IC 4TL4A 3L9RA 2X7LA 3PPSA 2XZQH 3OAUH 4L8CB 1M57B 2NTFA 3MA9H 3SJVD 3QQ3B 4ZOBA 1DL7L 3QDJD 1MIEH 3HPJB 4UM9A 1UM5L 2MTPA 4XI5D 4UIMA 1U0QA 3CFCL 4HOWA 2VRQA 1T66C 5E2VL 2B5IB 1INQA 3DX8B 1J8HD 3AS0A 1YEDA 3BPCA 3BVNB 1YDPA 1M7IA 1YLBB 4WUUB 1K5WA 3GINA 1WDAA 1UJ3A 4EDWH 4JFDB 1REIA 2FEEI 3WEBA 4WI4A 1BZQK 2KBGA 1A8ZA 3DX6A 4OQ1A 4XZUA 1BWWA 4NO5A 4QGYA 3GS0A 3BQVA 4YHNB 5DS2A 2C7FA 4H40A 3UZQA 3ZR6A 1P5UA 1FZMB 4HWBA 4IRSB 2WV3A 4JNXA 1XZ0B 3N50A 5DEJA 1QFUH 4ONGL 1CPUA 1K2DB 4NPYA 3PAZA 5HGGS 1YN6A 1J87A 1NLBL 1P5UC 3B1UA 3ZDXF 1H3GA 4YHOH 3HMWL 2HKHH 1IARB 1LE5A 1DJYA 3C5ZB 1I85A 4XCFL 5ICXB 2EVJA 2WVTA 3N91A 5CR8A 3CMGA 5EO0A 3ECUA 1NTDA 2COVD 2X4PB 2MPAL 2NYZA 3CK0H 1UYWL 4AMKL 5AW1B 3Q8FA 4JGUA 4OU3A 2X4OB 2JELH 2F54A 4IBUA 4BDVA 1Y0LB 1DQKA 5KSBB 3QULA 1MPAL 1CIDA 1QFWM 3WDJA 3DWTA 4BZ2L 4PY7B 4E9QA 4NUGL 3RUGB 3U4KA 1JZ5A 1DQTA 4PJCE 3KEDA 1BLNA 1JPEA 1NA8A 3Q1EA 2VN4A 4P23D 3HZVB 1M9SA 4NKIH 5HGDA 1NSNH 4K9EH 2V8LA 4QRFA 4WWOA 1HHIA 3FO9B 4K94L 4U1GB 2Q2LA 1IKNA 2NCEA 4P3DA 4DPBX 3JYCA 4L9LC 1CFNA 2IGFL 3IRZA 3L3IB 4RAHA 3RVUD 1EHKB 4LCCB 3TZVC 4XBGA 1KGCE 3W2DL 4O2FB 5AW2B 3L6FB 3FB7B 5TFSL 1JD7A 3SN6N 4XOEA 1DBMH 4H8UA 5HYIA 4XGZB 2VSCA 1RZJL 3VA2C 3BHBA 5JIDA 2YXFA 4YC2C 4HG4K 4IDLA 5CXPA 1PLCA 3D85A 5DWPA 3D30A 4MJID 2VZVA 1HSAB 1OT2A 5HHNB 3GT6A 1JK8A 3O8XC 2AQPA 4KJWC 2X4RB 3E6HB 4XMXA 1EXUB 1JPSH 4X9HA 4X7DC 3NPSC 1LK3L 1T1YA 4GQ9H 5DJDB 1EQWA 2B3IA 4CMMA 4HIXL 4PJAF 3OLEA 2CG9X 5F96L 2DQCL 4F92B 1U2CA 2V17H 2WBKA 3S8WA 1BVNT 3WJLC 1YYLL 1F1AA 2Y7QA 3WJMA 5KN5B 4HS6B 5J89A 4Z8FL 3V0VB 3TA3A 3KPPA 1KT2B 3I9IA 3NFNB 1WV7T 4FL4C 4R7NB 5CZVL 4ZMZA 1DLHA 1W72A 1KIPB 2UVEA 4XE5B 3WXWL 1QKZH 2Z31B 4UDUB 4KROD 4OD1L 1KEGH 2AZAA 4JFFD 3SDAB 2AQRA 2F74B 1KLGB 3O6KH 3LZLA 2DIEA 2JH2A 5AL8A 5HHNA 3SE4C 3RL1A 3MLPA 2ZPKL 1MJJA 1Z5HA 3MAWA 4GJTB 4WTXA 3WDIA 5DJ8A 2Z7YA 4LPCA 3KAAA 1EUTA 5LGYA 1KCRH 1S7XB 2CCWA 3O0LA 3GSUB 3HG1A 2CRIA 3IE4A 4HIXH 4HZLB 3V55A 1WAAA 5LG6A 1MFAH 4LHJB 3BIBX 2R1WB 3BO8B 4YHMH 4CVZA 3EO0B 2OJZH 3F7LA 3SDAD 2F54B 3G5XA 5DHXB 1FO0B 3TCXA 3VX0A 3DV6B 2DJSA 3DJTA 3K4DA 3TFBA 4RIRB 4OTXL 4BWUA 3QXTA 1P5VA 3QUGA 4NUJA 2QVKA 5EIIA 1V7NH 2HZHA 2PCFA 4PGZA 4U3SA 5ITBH 4LMQI 4CMHB 3GI8L 2E9WA 2IXQB 2PXYC 1ZAGA 1IUZA 1SZNA 4J28A 5HGBB 2QSVA 1OP9A 5AFAA 3WFEH 3IDYC 1G1CA 3PS6A 4TXVB 1YEEH 1JGIA 2O30A 1OTSD 4OVUA 5GSRB 5MP6H 3ATEA 5JHLH 1IBBA 3CVHB 4TUOA 4KU1A 2E7BA 3DA0A 4UNTA 2X3CA 4MMXC 3NZ8B 4XX1G 5T1MB 3A0OA 2GSGB 1A02N 1GGIL 2H3NA 1E5BA 3EYVA 1QNZH 4Z76A 1RY7B 3FOMA 1GC1C 1IM3D 2LLGA 2HRHA 3N40P 4OLUH 3AS1A 4MLSA 2VAJA 1T5XA 1PIFA 1K4CB 1SDYA 1P1ZA 3ROLA 3WFCH 5HBBA 4NGHH 4NPYB 4XPFH 5IUCA 3NQKA 3V4VA 3MOAH 1COBA 1N0XH 1RZQA 3LIZH 2XKNA 3LH2H 5LAPA 3QFDB 2VDNL 1NDGA 4ICWA 5D72L 5DA4A 3CFNA 5JHLL 4OZIA 3N04A 2I07B 4QRUB 2WO4A 3IMTA 2BNQD 1PZBA 1ACYL 2Z64C 3D33A 4Q6YA 3K91A 3ESUF 5M95B 1OW0C 4FRWA 3MJ7A 3VQ2C 3S37X 2EDBA 4ODSH 1KTCA 3A3YB 4PJAB 4B9GA 2XWTB 1SEBB 3MLUL 1QLEB 5C2BL 4OLUL 2ZCHL 3GMOB 3DSFH 3NCJL 2DICA 1IBYA 3G08B 3QIUA 1XMWA 3KH4A 1SVBA 4M7KH 4WFEE 1ZLVK 1FG2A 1E27A 2GITB 4LIQE 4OBRA 1FVDA 1AS8A 1QUNA 4FFZL 3B34A 3ARXA 3MOAL 4FLOA 4D9RD 3ZYJA 3D5OF 5GS1C 4X9BA 3U0WH 1JK9B 4HKBB 3T0VA 5DHDA 3WMSA 1J7VR 4FMVA 5IQ9B 4OFPA 4MX7A 4PWFA 1A3ZA 1RIUL 3P3RA 1L9NA 1SBBA 3V5KB 3VJ6B 5T33L 2DYSB 3F7QA 1CF8H 4HCIA 4A66A 3MCLL 4ZAKC 4NUJB 5EIIB 1HINH 3QCUL 2CO7B 3RUGE 4AM0B 3BEWB 3T4YB 4OZ4A 3GI9L 3D87B 3CFDA 2XUWA 2YN3A 3MRPA 3ZGHA 1S2EA 3VXTA 3T0DA 4OCLC 1FFNB 4A2MA 3B7RL 3RWHA 2YSSB 4WTZA 2BERA 2EYSB 2ZG2A 5SWSE 3NTCH 5HYQB 1FLRL 4N0YH 4M7KL 4IK7A 3TJPA 5C6PB 3ZUCA 4NSKB 4EN2A 2V3EA 3FOLA 4X4XB 2J8HA 2UXVA 4ABUA 3P9WB 1I9JL 3QUXC 2F5AL 1FYTE 3W37A 4YR6B 3MHZA 4HHAB 1T03L 5DHVA 2X4QA 2OMYB 4FQPA 5LXGL 1RZIB 3VU1A 4LSVL 1P53A 5GS0D 1AVAA 2BSBA 4GRMA 4BWWA 4F1ZA 1X5KA 3QR1A 5FUCE 3QRGH 2KDYA 1U8CB 4WGWB 5DQ9B 5I1AA 4RGNE 1JZIA 1Y07A 3S2AA 3ZDZB 1VAHA 4HJIA 3H7BB 3LEYH 3QCUH 4PRHD 4WHCA 2VZSA 2A6KB 4JDTL 2Z8SA 1S7SA 3WIFB 5IVOA 5PCYA 2KQNA 3CN2A 3QEQD 4UQEA 4PJ5D 3GQFA 2HLAB 7PCYA 1RKRA 4PWEA 2O6FA 3FO1A 8FABA 4XI5C 3K6SA 4JCLA 5KSAD 5FUOH 1N9PA 3P0VH 1ZWIB 3D2UB 1TENA 1MH5B 2N7SA 3QS3A 5EF3A 4NB7A 3QH3B 4R5XA 4MXVE 4AH2B 4AL8H 2XNAB 4ZXBD 5B39A 4S1DD 4JY4B 4HUVA 5C09E 1H6FA 1HHIB 1E4WL 4GMTL 5I23A 2KERA 3P4NB 2XV3A 3JV0A 1V05A 1CUOA 1TZGL 1WFJA 2AXGB 2G75B 3FFDA 4PJFB 3WE6B 3C87A 5KYXA 2EXWD 3MCYA 4MTMA 2D03H 2X4SB 1TEFA 5EO9A 3OM3B 4FQ1H 1J05A 2ED6A 2FB4L 4WKZB 3UGEA 3UZVA 1EJFA 4L3CA 1XGTB 4NZDA 4XX1E 2VXQH 3AQYA 2BZ7A 3FT4B 4XTRD 1DVYA 1E8XA 3WY1A 2B1OA 4LLDA 1UT1A 5EBWB 2VN7A 1U2HA 3RTQC 5HHPB 3G7TA 4EJ1C 4QHKI 3K5SA 3LIZA 1O6TA 5IQNA 2N0KA 2LTQC 5A2KH 4OZIE 3UEQA 3LKOB 3B3IB 4QO1A 4TQEL 5JLZB 1ET8A 1AQ8A 4XAKE 4K0OA 3GEFA 2P5EE 4DW2L 4XMWA 1Z5YD 3D9AH 4XMUA 5T3XE 3ZTNH 1ZV9A 4ACPA 2WVVA 3N44F 3DKHA 1E5AA 5FECB 3F64A 5TE7H 3SQBA 2V2TA 4YSQA 2VWEE 2V2XB 5D2LB 3DDFA 3SDDB 4LARH 1DQMH 5EEUA 1CGSL 1YJDH 3D34A 5TDNA 5HHVH 2XVBA 3VFWA 3P0YL 2RFXB 3NSJA 3G6JB 5C92A 4FKKA 1NGZA 3KWTA 5FYKL 4YSPA 3V0WH 2VXQL 3PWPE 5C0DB 4XCNA 4YBLB 5EO0B 4K4KA 5C0NC 5KBLA 1RH8A 4H88L 2KHAA 5LGJB 3I6KA 3WS3B 3ETTA 5LKNA 1Z1WA 1J0YA 2XTSA 1HJCA 1OPGH 2D9CA 5HGHA 1X44A 1KCVL 1TTFA 3I3BA 3TBYB 1XGUA 3OPZL 3TT3H 3GRWA 4NEHB 4HZ1A 3PREA 3RWGA 5KYXB 3HG3A 4L8CA 4X7EC 1C5DB 1ZA3B 4LLMA 2CKBA 4LSPL 1VCBC 3PHOA 1U8CA 4UZSA 2FO4A 2GYSA 3D0VB 5H4ZA 1U3HA 3OMZA 1KGWA 4JR9H 2HN7A 5T1LB 2RIKA 1KTJA 1NCBL 5E8DH 1HXKA 1YDPB 2XYCA 1USZA 4HV8A 3UP1A 5E51A 3SPIA 4QNPE 2XSKA 3LZOA 3QDJA 1RZIA 4UM9D 1JDDA 4L8DB 5LAXB 4W6XB 3ZN6A 3QUYB 4PB9L 4W9CC 1VLXA 3ZGIA 4P5KA 5FUZH 4ZMVA 4X8JA 3EJTA 5ITFB 1AZBA 2BNRE 4JRYD 3T6QC 1JXKA 1IC7L 5BV7C 2AJ3B 1BDYA 5EORL 5F6IC 4PCYA 5I6PA 1KTDA 4FFYA 3GK8H 2E7CA 3KWUA 5C1MB 2YSSA 5ACMA 4MMZB 4HMCA 3ZR5A 2OX5A 1A4JA 3SO3B 5BUPA 1WWCA 5FYLL 4UTAL 3IDJB 3X3FL 2EIDA 5A2IH 2A73B 2V9QA 2XTJC 3O41B 4JN1L 4YR6A 4J4PD 1QHOA 1DDHA 3U30B 5KVGE 1O6SB 4GKZA 3RPBA 3UO1H 3UPRA 4XXDA 3IJ7A 1W8EA 2PR9A 3NJIA 1IBGL 5A2CA 3GGWA 3HJEA 1UTDA 5DRWA 2W92A 5C0FA 3PUUA 2E56A 4M7JL 1EXHA 3GKWH 4XNZC 1UA6H 1HWGB 4YGVA 4F9LA 1R24A 3LQMA 1KGCD 5ISZA 1KIUB 5FUZL 5JNYB 1M7DA 5CMAA 3SBWA 5CEXA 4PWKA 4RISH 5IOKA 4WHYG 2B59B 2X6BA 5IK3B 4HK0B 1HKFA 4M61B 4JFED 1MHHB 5CIPA 1NIDA 2GQHA 3P3YA 3SKOA 2DQEL 2JB5H 2P5WB 1PY4A 2DQDL 4PJIB 3IK2A 1E6JH 3OKNB 2DH2A 4OCXH 2W1NA 3OV6A 1XB6A 3KLQA 5IBLD 3EFDL 3U1SL 1R5WB 3PWUA 4IOIB 1NGYA 4OIIL 2RCSH 5EZLA 2MH4A 5TK2A 2YD1A 3Q6FB 5F9WC 5K9JH 3SDYH 3E7JA 1WS8A 3B5TA 4PJEF 1CXIA 4NNYB 5HHMD 3GRBA 3EGDA 2JKIS 4KI5D 5DQDH 2E27L 4PJGF 5FDWB 3WU1A 5A16B 4LSRH 4OJEH 3QUKB 5C0RL 3RPKA 1MWAL 5HGHB 5F7AA 1AP2B 1ONQB 4M56A 5AVYB 4RISL 4E42A 2G2RA 4RFNC 3QORA 4FQLH 4Z76B 3O0RL 1GZHA 3DI3B 4HMDA 4KKAD 1R47A 5I2IA 3S48A 2OYPA 1PG7H 3APNA 2LABA 1MZZA 4J2XA 3ARFC 5IJVB 1CLYH 1PLGL 3KWWB 3K5RA 1ZLUK 3WY4A 4B96A 5BV7L 4QD2E 2QDWA 3S4SB 3QARA 4MAYB 4EVNB 5KSVA 3PGFL 3L13A 4A2EA 3MBWB 1UZ8B 2YEZA 3GSWA 3OZ9L 5L9DH 4G6AD 3SOBL 4LMQE 5G2NA 1D5XA 3EO9H 2EE9A 5FF6A 3EADA 2ZJSL 2FCBA 5ESQA 2F0CA 1E5UI 2YMXH 4KTDL 3NJMA 3N85H 5EZJB 3VH8A 3L48A 4K5MA 3C6LA 1WEJL 1LILA 4IW4C 4JREC 1BQKA 2EH8L 1FYTB 3ABGA 2AKRA 3OKMB 1E9QA 1ZTXH 5DO2C 4DP9X 1JWUB 1QI4A 1IE4A 2YA0A 4UAHA 3SKMA 3W39B 4DP2X 5IEKB 5IY5B 1TCRA 4KTYA 2ROXA 1DN0B 3BKCL 3GXFA 1F56A 2Y22A 1CYWA 4PV8A 5IMKB 2DIBA 5AW3B 3ZVVA 4JM4L 3IJSA 5B4MD 3F3HA 3HVDA 3RWIB 1MCPH 3Q13A 1W0YT 1D5MB 2YD5A 5E6IA 1HC1A 4HPOH 2AV7A 3VFNA 2NR6C 3SODB 1AGBA 1T66D 1EDYA 4PG2A 5JDSA 4HKZA 3QR2A 4QR7A 2GG1A 4WTZG 3LVEA 3CG8A 3CHSA 4K5NA 1RUAL 5DLMH 3GO1L 2D2OA 1YEGH 4PGDB 2R56L 5MEPB 3TJEH 3PFUA 1WEJH 3AFLA 1QW9A 5C09B 1RZ7L 2CHWA 1Z6JT 4QRPE 4WFGE 4FOMA 4RNRA 2DLHA 4F5CE 1M05B 5I8CA 4ENED 4HIEA 2FBJL 1IILE 3O8XD 1E6OL 2H9GA 4IS6A 1KJ3H 2DQHH 2UWEF 4KJWD 4KROB 1L9OA 4UQCA 1DVTA 5C0CB 2Z91B 3BP7A 1CLVA 3D39D 1JPFB 4G8GE 5D93C 1QTPA 3WGUB 3MRMB 1AMYA 1IGIL 3ZE1F 2JJUA 1MVUB 2VC2L 3FCGA 4AJVA 1FE8H 2C4FU 4IRZL 2OKMA 1RPUA 3O4OB 5EC2A