2Q9OA

Near-atomic resolution structure of a melanocarpus albomyces laccase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
559
structure length
558
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A near atomic resolution structure of a Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 182
structure length 558
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA03
4G7QB 2AFNA 4AKOA 4G70B 3HEIB 3X1GA 1AR1B 4YVNA 2JKWA 1GS8A 4JHUA 1FWXA 2PP7A 3V9EA 4YSUA 3ABGA 3FQ2A 3X1EA 1A3ZA 1J9TA 1PNDA 1VLXA 1OE1A 3NSDA 3X2QB 1ZDSA 2GBAA 3D12B 1PY0A 1HAWA 1JZEA 1NIEA 6PCYA 4ENZA 2IAAC 3EHBB 3CVCA 3FQYA 1SNRA 5I6MA 2YXVA 4TXVB 2IWKA 1A65A 1BEXA 3FU7B 1OCRB 1SDDB 2PP9A 3QJQB 1AZRA 1MDAA 4UAHA 1KGYE 3WNJA 4HHGA 3TU6A 2CAKA 3EH3B 4NERA 1ET8A 4HCFA 1J9RA 1L9RA 1JVLA 1RZPA 2PPAA 4A2GA 2DY2A 1GS7A 4KNUA 2VSKB 1AZBA 1A4AA 3ASNB 3CDZA 2CUAA 3IEAA 3PLYA 1CURA 1BQKA 1AS8A 1IC0A 1RZQA 2CCWA 4YSOA 3S3BB 3HB3B 2EILB 5E9NA 3IBOA 1AIZA 1J9QA 2HRGA 3FSVA 1KCBA 2QT6A 3CZUB 2YAFA 1PCSA 2XV0A 1J9SA 2XV3A 2DV6A 4YL4A 3X1FA 3DIVA 1L9OA 3BQVA 2BWIA 1JZHA 4DP8X 2YXWA 1B3IA 2CJ3A 2YAPA 1ETJA 2CBPA 1EZLA 2OJ1A 2UX7A 3BVDB 2X87A 1AG6A 2J55A 1YLBB 3WG7B 1ADWA 4GY4A 1QHQA 2PLTA 2J5WA 4YSPA 5I26A 3FSWA 2CALA 2B3IA 3WI9A 4QKTA 4YSSA 3S8GB 4M4RB 2VW7A 2HZHA 2HRHA 4DP4X 3WKQA 1M9WA 1OE3A 4E9RA 1BYPA 3AG3B 3EH4B 1ILSA 1V55B 3OMIB 3NJKA 2BP8B 4AZUA 2FT6A 3SBPA 3L45A 3FU7A 1WAEA 2BZ7A 7PAZA 1SHXA 5B1AB 1AACA 2N0MA 2IWEA 3MX0B 1AZUA 1GYCA 3AG2B 2QPDB 1N70A 1OF0A 2HX9A 1CYXA 2Y69B 5I6KA 4BXVA 1ASPA 2Q5BA 2PPDA 1N68A 2ZXWB 3NSCA 3UGEA 4W1TA 1CUOA 2BW4A 2Y1AA 3CDZB 2HX8A 3PPSA 2XUWA 2EINB 2WO3B 3FSAA 2FWLB 1SF5A 2FNWA 3X1BA 3FT0A 3OM3B 2VM4A 3JTBA 3ZBMA 1XMEB 4YSDA 3AW5A 3ABMB 5B3SB 1L9QA 2IWFA 2W8CA 2QDVA 1NPNA 3CG8A 3KW7A 1RKRA 4BK5C 3QJTB 1JZIA 2FQGA 2YARA 4KO6A 2DYRB 3NJJA 1PMYA 4HZ1A 3N55A 2VW4A 1JXDA 1URIA 2I85A 4DP2X 1AOZA 2VN3A 2XLLA 4YSEA 3CVBA 4CSZA 1PZBA 3ERXA 5I5JA 3QJSB 3NJIA 3T9WA 2PP8A 1AAJA 1X9UA 2J57A 3WKPA 1PLBA 2OV0A 4P5RA 2BWDA 2J56A 1E5ZA 2VSMB 1A8ZA 3FQ1A 5AKRA 4DP6X 2HXAA 2FQDA 4AX3A 1EHKB 3C75A 5EHFA 2IDTA 3NYKA 4P5SA 4FAAB 1W6WA 1KCWA 1DYZA 4HAKA 2FQFA 2VW6A 5F7AA 1CC3A 1PLAA 4KNSA 1BXAA 1OCCB 2UXGA 2H3XC 3AY2A 3X1NA 1NZRA 5AFAA 2IH8A 5PCYA 3OQRA 4BWUA 1E67A 1NICA 4G7SB 1ET5A 1WA1X 1FA4A 4KOCA 2P80D 4K9JA 4YSQA 4HCGA 1T5KA 3FYEB 4NB7A 4W9ZA 4HALA 1BQRA 1JXGA 4YSCA 4CSPA 3AG1B 5TK2A 1JOIA 4UF7C 4HHWA 5D4JA 1KBVA 5B1BB 2FT7A 1ILUA 1ID2A 4GP4B 3QJUB 3NP4A 1TU2A 2B08A 2IDQA 4Q89A 3H56A 1M57B 2UXFA 4A2FA 1JXFA 1ZPUA 2Q9OA 3FS9A 1WA0X 4GYBA 4YSTA 1SJMA 2GC4C 5I6PA 1IBYA 2P80A 3EF4A 1ZIAA 2H47C 1I53A 4L0PB 2VM3A 4JHVA 2GSMB 2BO0A 2BP8A 2UXVA 1M56B 2GHZA 2R7EB 3NJLA 3NT0A 3V9CA 4E9TA 3NJFA 3IN0A 4N8UA 4A2DA 4NAJA 1GS6X 3NP3A 3SBQA 1OOWA 2W88A 1NIFA 4YSRA 2BP0B 1W8EA 2EIMB 4DP5X 1IBZA 1JZFA 5B1JC 2ZONA 2BHFA 1RCYA 4AI7A 2IDFA 4E9XA 3NJGA 2DYSB 2PPEA 4BXSV 2QPEB 1NTDA 3PAUA 4E9SA 2IDSA 1CYWA 2GC7C 2TSBA 1KYAA 3TBCA 7PCYA 2GI0A 2DWSA 1JVOA 1ZV2A 4F2EA 1L9TA 3DTUB 1NDTA 1AS7A 2GB2A 5LDUA 3FPXA 4DP7X 4PAZA 1X9RA 3NJNA 4KNTA 1NIBA 4E9QA 3NJHA 4BWTA 1NWPA 1HFUA 1V54B 1F56A 2XXGA 5FC9A 1A4BA 1FFTB 5B1KA 3ABLB 4DPCX 4F2FA 1OE2A 3ZDWA 3NJMA 1PZAA 3FPYA 4G71B 2VMJA 1WS7A 1W6LA 3TASA 3WIAA 4E9VA 3UAEA 2HX7A 4BDVB 3UABA 3S3CB 1IUZA 4KO9A 5IY5B 3QJVB 1PZCA 1QLEB 4UANA 1AQ8A 2IDUA 2HLEB 3PAVA 2MRYA 2AZAA 3T6ZA 2FJSA 1AANA 2WO2B 3IN2A 3FU8A 4AKPA 5I5MA 3UACA 1OV8A 2R7EA 2XX0A 2EIKB 1KBWA 1SFHA 1L9PA 4KO7A 1IKOP 3H4HA 3NSFA 1PLCA 4KO5A 2YAQA 3PXLA 1ET7A 3WNIA 2BP0A 4X4KA 5ANHA 1NWOA 1XB3A 3UAAA 2DWTA 2NRDA 5I6OA 1J5DA 5D4IA 2WSDA 4ZK8A 1GSKA 1KV7A 1NIDA 4DP0X 6PAZA 1BYOA 4A68A 3QQXA 1TEGA 5B1JA 2XX1A 1PNCA 2XV2A 3G5WA 4DPAX 4JKNA 1AG0A 1E5YA 2XXFA 2JFCA 3FYIB 5AZUA 1KDJA 1SDDA 2YAOA 3AZUA 1GW0A 2AANA 4PCYA 5I5IA 5B7EA 3N2JA 3SBRA 4QLWA 4A2EA 4GP5B 1MG2C 5D4HA 1JZGA 4HCIA 1SHWA 1QNIA 3PCYA 4GXFA 4N4YB 1ZDQA 4MFHA 3GDCA 1J5CA 1HAUA 1SFDA 8PAZA 3ASOB 1R1CA 2XU9A 2X88A 3DKHA 4A67A 2BW5A 3T71A 4AKQA 2OCCB 4A66A 2EIJB 5I6LA 2LLNA 2I7OA 4BWWA 1V10A 2FT8A 2QDWA 1XB6A 3TA4D 2PCYA 2XVBA 1NINA 2YQBA 3RYMA 1A4CA 1JZJA 1OCOB 4E9WA 2FQEA 3GXUB 4YSAA 1ASOA 1E30A 1OCZB 2YAEA 1GY1A 4DP9X 3T6VA 3T6XA 3ABKB 1TEFA 1PF3A 1DZ0A 5I28A 3JT2A 2H5UA 4EF3A 4GP8B 1BAWA 3MBWB 1PAZA 5B7MA 2PPFA 2PCFA 3S8FB 1BXUA 9PCYA 1GY2A 2RACA 1L9SA 3S3DB 3TBBA 3IE9A 1GR7A 1JERA 3OMAB 1WA2X 2MTAA 4HIPA 4RH4A 2XYBA 4WTQA 4F7KA 3UADA 4G72B 4DPBX 3QPKA 1SF3A 5A7EA 4FA7B 5B7FA 2E86A 2UX6A 1ASQA 2IH9A 1AZNA 2JXMA 1AZCA 2FTAA 1TKWA 2AZUA 3ZX1A 3GYRA 2TSAA 3NSYA 2YAMA 3QJRB 4DP1X 5F7BA 2ZWNA 5I6NA 1WS8A 2I7SA 1XB8A 2ZOOA 4YVUA 3T6WA 2YAHA 1MZZA 3PAZA 4A2HA 2GIMA 3FU9A 5TK4A 4M3HA 1MZYA 3CVDA 2UXTA 1E65A 3OD3A 4E9YA 1BQ5A 3KW8A 3EH5B 1AS6A 3ZIYA 3H4FA 3U25A 4BDVA 1BXVA 2PPCA 1NIAA 1KDIA 3SQRA 1ZIBA 3AG4B 4KOBA 3FSZA 4WKXA 2XWZA 4G7RB 3OMNB 5PAZA 4Q8BA 1NPJA 2A3TA 1UATA 2BZCA 1MG3C 2AVFA
chains in the Genus database with same CATH superfamily
1ZTXE 3ZT7A 1OPGH 4U1KB 1I7RB 1EXGA 3GXDA 4QNPE 3FUNA 4KI5D 3AU1B 2WLIA 1JHLH 1OAZL 3SKOB 3C2SA 4OZHA 5F3HA 3RWCB 1VACB 3MODL 4XCYA 4HF5L 5J1AA 4XP4H 3KWVA 4Y4KB 4PRPA 3G6DH 4OZIE 1XF3B 3FU6A 3GKWL 3LKRA 5T1LA 3QA3B 4S2SB 3CDYA 1WO2A 1OSEA 2YGOA 3FT4A 5T1DL 5E2WL 5GS0H 5I6MA 3C5ZC 2YXVA 1O5DT 3E6FA 4MSWA 2X05A 1L0XA 2HUEA 3AADB 3DVIA 4Q9RL 4NP9A 2A83B 2K1MA 4HC1A 4KTYA 4XTRC 5D1QE 4LLYB 5ISZE 3QQ3B 3I6GA 4YHIA 1U8PB 3F7YA 1U36A 3MLSH 4KK9D 1J86A 1EO8L 1MVFA 1PBYA 2C3VA 3BWAB 4Z0XA 3ZTJG 1FF5A 1KIPA 4CC1A 4HEMA 4Z7UE 1J5OL 3GRWL 2V2WA 1INQB 2JKXA 1GOFA 2ESVB 3B2XA 4JY5L 1R3JB 1G9MH 3ML9A 2Y6SD 1U6AH 4U1SA 2CUAA 2V8LA 1DJGA 3TFKC 1RULH 1RZQA 3EJRA 3QORB 4YPGB 1NL0H 4GAFB 4HISA 4QY8A 3DJTA 3HIZA 4WO4C 1A6VH 4BKSC 4NZRH 4TTGA 3LAFA 1NUDA 3L4ZA 2KQNA 3MRJA 3FQRA 2G3NA 4Z7VB 2F58H 2J2ZB 2ZYHA 3MNWA 3FQUB 3AROA 4UNVA 3BJLA 4CUCA 1AMYA 1GRWA 3KPSA 1O7VA 5A40E 1NJ9B 1RL1A 4P5TB 3V6OC 3OKMA 2ROXA 1MAMH 2N59A 3QBTB 4Y4FA 2KYIA 2CALA 1BVOA 4I0CC 5EU6B 1G1KA 1T2QL 4LVHC 4N5ED 3RDTD 1TDQA 5IF0B 1E43A 2ATKB 1SVZA 3AG3B 3IKKA 1ZVSB 2A6JB 3OAUH 3DBXA 3QQ9D 4FQ1L 4ZSOA 5EC2B 4BZ2H 3ELQA 4PD4J 5JPMB 5ESQA 1AACA 2WQVA 2Q86A 3GXIA 1YMMD 2FAUA 3I50L 4PP1D 3BUYA 3MX0B 1TQBC 4WSKA 2OTWA 1SMDA 2QSCL 1UVQA 4NPYB 2DBJA 2PYEB 3NJXA 5SX4H 1T0NA 2AJVH 1EIBA 1P1ZB 4DIXA 3D85B 1R24A 4TLKA 2B0SL 4MA3B 1BPLB 5D7KD 2Y1AA 1F13A 4OGAD 2XUWA 2IQAB 4NS0A 4HIJB 3S5LG 3E6HB 3PL6D 4KUZL 3VDBA 1J8SA 3H9SE 1FGNL 3QNYB 4DKFL 4Z3HA 2VDPL 5E08H 2DIJA 5LXGH 3RVXD 1QA9A 3AS2A 3F6JA 1JGUL 3WJLA 3M45A 3QUZB 4N2NA 5DJDA 3ZHNA 5B3SB 5IVXA 3LZNA 1KIQA 2YXFA 3G9AB 4XMPL 3B7UX 2QDVA 1QFUL 4O00A 1W91A 4XMUA 2BRQA 4Z7VE 5KYUB 1J88A 4QD2E 4KI1A 3IPBA 1JDAA 1JWUA 2XSKA 3EO9L 4C4BA 1NUGA 1CGUA 3MV7D 3OGCB 4JN1H 2VB5A 4E41A 3N55A 2OJEA 3QULA 1GZHC 2AK4B 3WE6B 4YH6A 5KVFL 43CAA 3GHBH 4G8IB 5GGTH 2OYKA 3ZYJA 4DZ8A 5EORH 3QPXL 4PGBB 3RJQB 5BUGA 5IREA 3MJ8B 4MNGA 1FLTX 3IDYC 5H94B 3RBGA 3FRPB 4NLHA 3O3DB 5KSAA 2VSMB 2Q7AA 5JNYB 4EDXB 1PZ5B 1X5GA 3KPLB 3UDWA 1KFGA 4UYQA 4HKXB 3BEWA 4AX3A 1QNZL 1ZHNB 4N90E 1MCNA 5FGRA 1XF4A 4K7FA 2AXFB 5KEZA 1GGUA 1KY6A 4X80H 4ZX6A 4L18A 3OKDA 5FW8A 4GW5B 3PWPE 1NZRA 3P2BA 3VMNA 4QRPE 4CKQA 1K6QL 1I7TB 4IDLA 4OLEA 3F7RA 1CE6B 4PLKD 1YRKA 1E8XA 2PWFA 1OSYA 2RJMA 1IJNA 4L0ZA 4UB0H 1Z5LA 1T1WA 1GC1C 2V9RA 4DZBA 5EZPA 5HDBB 4EEEA 2VN5A 2WZPA 4PJDA 1HNGA 2A9CA 2Q7NA 3EGXB 5BS0D 1UXWA 2NY7L 3HC3H 3HG1D 1SZNA 4N5UA 4ZUTB 1DEEA 3RTQA 3TESA 1KTDA 3IDGB 1LQBC 1KB9J 2AABH 4OSUH 4OZGB 4GMSH 4WVRA 3K6SA 1HEZA 4WFGE 3EO1A 2AQRA 4GIPD 1TU2A 4ZPTA 3H55A 3HPLA 3RWFB 4LVNB 4BRJA 5EOCJ 4D8PA 4N2CA 1D3CA 1ZLUK 1ZPUA 3FS9A 2OZ4L 4AYID 4QWWD 1P7QA 4ES8A 3D3VA 1JGEA 4TPRH 1SXNA 1JI2A 2C3GA 4FXKB 4B27A 4H0IA 4Q0XH 4C58B 3KXFE 4KK6C 3RX7A 3MV8E 4U6VH 1H0DA 5I0VA 4WWID 1M56B 1PLGL 3WXWH 4HC1L 1UGNA 1RIHH 1UFUA 1WT5A 1LXMA 2R15A 1P4IL 2WVVB 5C6TL 4A2DA 1COBA 2QHRL 2HKAA 3A23A 5D6DC 1BF5A 5E1HB 1G7PA 2YK1L 4PS8A 2UY6A 1ES0A 3M1OA 4IK6A 4PG9A 4G42B 2I5YL 5EULV 1TSHA 1TMQA 2OMVA 5KVGH 3QFJA 4AK1A 4YHLL 4X50A 1U8OA 1A6ZB 4N0FB 2JQZA 3DV4B 3IFLH 4G3YL 1FVDA 1JCKA 1OZUA 2WYZA 4OF7A 1HHHB 4JFEB 2J6EL 3ARGB 3FN0H 2O6EA 3G5VA 4EE2A 3KLHC 3GMLA 2XKSA 4X9YA 1N64L 1OAQL 4KKBC 2OSLB 1QQDB 3P9WB 3QH3B 5HHOE 3S35H 4CN1A 4J23A 4ZFFA 3PL6B 3BVTA 1TQUA 2K9UA 4TRPH 4DGIH 3EYQD 3S3PA 2R56H 1AMXA 3FZUD 4RFNC 1FNFA 3O8XA 5FC9A 3O6LH 5KSBE 2DMKA 2ZX9A 2ZXBA 3T0BA 2APFA 1Y0LA 3MLRH 3JV6B 1H3GA 2E3VA 2XY2A 4UDUB 5TJWK 4ATWA 2NY5C 2AW2A 2FIRT 3UJJH 2VWEE 3UAEA 4ZG1A 1WCQA 5H35A 4QRRA 4X5XA 1V7NH 4KZCA 2PF6A 3LH8A 3MV7E 5CMAA 3GMPA 2IDUA 1D9KA 2CKNA 4YHKH 3ARWA 5IG7B 3VRJB 3ZRCC 3QUMA 5FCUH 3TBVB 1EJFA 4P46B 3SKNA 4XP9H 4Y5XC 1EMTL 2HJKB 4LSQH 3ZZSA 3MBWA 2RBLA 5JLZB 4L37A 2AJUH 5BZWB 3O45A 3KYMA 3MCG1 3K6DA 3O6LL 4JY4B 4X4KA 2R56L 2ZP9A 1XCTA 4X6EA 4HWBA 1C16A 4G6JH 3BN9D 1KV7A 1NMCC 3Q1SH 5IFAL 4A68A 1RHFA 2YWZA 4X4XA 1TEGA 1DBMH 4A2MA 4OD2B 2XX1A 1PNCA 1SBBA 4ZO8A 1QACA 3KL0A 1ZWIA 4W9HC 3N9GH 4GAJL 3A5VA 1WHPA 1X7QB 4U4BA 3ALWA 4TUJA 5I5IA 3O3BB 3B43A 3L9BA 4KHTH 1ZS8B 3LXUX 4N28A 4RWYL 3N43F 3RI5K 1IKFH 2TRHA 1QPXA 2J43A 1ODAA 3PCYA 4N4YB 4MFHA 4MAYD 2YD4A 3CX2A 2XNAB 4JFUA 1NLDH 4LF3A 4U1KA 3BSHA 4X5QA 4ZMAT 2H4EA 4I3SL 1RMFL 1K5NB 3SKJH 3OXSA 3VDCA 2RA1A 3T04D 1F3JA 2BSTB 2LLNA 3Q2CA 4G8FB 4I0PA 3KLAA 2LW3A 1XB6A 3S3SA 1CU4H 5D6CA 2OZNA 1AGDB 5KYWB 3D0VB 2QPSA 4U6VL 2Q8BH 3EYOA 1CDCA 1CL7I 4G8GB 4H40A 3F65A 1E30A 1VAHA 3UAJC 1FC2D 1RK0A 3L9EA 3NZHH 4AENB 2E7LC 3PDOA 1FZKB 2GJJA 4F91B 2CDFA 4FL4C 4QRAA 3V52L 2OZ4H 3H9ZA 2P46B 5I8EB 5D1QD 2H5UA 3EH1A 3I6GB 1B9ZA 2CO2A 5C0IA 4AVIA 3L1OL 1M9SA 4F7CB 1VFAA 1BXUA 2N7AA 2UWEA 4HIHA 4FLHA 5F6HI 3BP6A 5IESL 1AVAA 3HC3L 3GRGA 4JDEA 2QQKL 4A63A 3ZKNC 1KENH 4TSAL 1CF8H 3WSQL 5F1NA 4Y2DD 2VDOL 3ZOAA 4GAAA 5J0BA 4PGDA 2GHWB 4X7TA 5EZIH 3ZKXB 1EHXA 4J3WA 3KVQA 4FQXB 5JW4R 2UX6A 3VGEA 1I8AA 5KVDE 2EIZB 4NQCD 4G5AA 5HBBA 4JDTH 5IBUB 4NC2B 4QPEA 4BGLA 2XN1A 5DRZB 1DVSA 1JTPA 3PJSB 4LCCA 1OB1B 1KBPA 4Z7WE 4ZW6A 1T4KB 4XWGL 2JH2A 4FFVC 3INUL 5LGJA 1KFAH 5JO5B 3C2AL 2PR9A 4ZMWA 4I3RH 2P5ED 2R1YA 3B6SA 4FNLL 3SDDA 3FSOA 2Q7YB 3S96A 1E4KA 3BSZA 1KTKE 4KKCD 4LGSB 5FECB 3IAQA 1BQ5A 3S3JA 3L54A 4X8GA 4M48L 1N8ZA 1S9XA 3U25A 2RH0A 1U3NA 1B0RA 2EDJA 4GO8A 1KDIA 3WJMB 5JR1H 4PRNB 3S48A 4L3EA 1BLNB 5TQ2H 5I1JL 3TZVD 5KZCB 4P9HL 3LEYL 1JHTA 2BVEA 2VDQH 1A47A 3KYKL 5KSVB 3DETC 3LVEA 2HT3C 1K4CB 2PTTA 4AKOA 1PZ2A 1MN4A 4D9RE 3EO9H 3Q7JA 2YRLA 4AYBA 3JWDL 3DX6B 2WMPA 4I9WE 3K72B 1AHWC 2AP2A 2X6UA 4B3EA 1LE9A 4PJ7F 3NPSB 3VAEA 4YX2H 3CH8A 2COVD 2OTWB 1GZHA 4YSUA 1VADA 1TIUA 1PNDA 1QX1A 2W38A 2XXMB 3O4LB 5ISZA 1HAWA 2OMUA 5F1SA 5CLWA 6FABH 4YXKH 3Q9QA 1U3YA 3EOAB 2BS8A 3BUBA 4ZRGA 4MDJA 5E6IB 4O2CA 2OMYA 3ORJA 1JTOA 2F08A 4ZQKA 1UD8A 3Q2WA 2VRAA 1OP5H 4Y1TA 3D4ZA 1D5MA 4G7VH 1ZLVK 2LU7A 4D9LL 1YEHL 1KGYE 3EFDL 3V2AR 3GMMB 1A7OH 1I1FB 4IMKA 2V7HA 3TO4C 1ZPLA 4PJXF 2YMXH 1RUKL 4WUKL 2ZOWA 2BNRE 2ZCZA 3VWKB 2P8MA 3TJPA 1A7RH 3U2SB 5DEFB 2QLYA 1LP9E 3WHXB 3P77B 4W4OC 1Q72L 5D93B 2ZE0A 3DIFB 4OGXL 3V0HA 1KG0A 3C60C 1CURA 1LGVA 4MNQE 3A24A 4X42A 5CIPB 1J1XH 5FCSH 5T3ZD 3S3BB 3KPSE 4E41B 2QT6A 4CVWA 2ZUUA 4OLYL 4LCIL 4K8RH 2ZXAA 2DQDL 1XGPA 4LP8A 4O2EA 4K2UH 4PS3A 2VDKB 3ZZLA 2NY3D 5AAPA 1SXSA 3DYMA 2H8PA 1KTCA 3D30A 3K3QA 4IOSA 3JTSA 4BFNA 5EO9A 2G3MA 4GY4A 1DBKL 1XF1A 5EFIA 2XZCH 2P49B 3K6IA 4OF3A 5AKTA 2YR3A 3V10A 2NUPA 1G6RB 2H2PC 2ODHA 4F7MA 3EZ8A 1RZKL 2HZHA 3MCKA 3MXVL 3ULUE 4IDJH 4S1SH 1PCXA 3EJQA 3HR6A 1ILSA 3SDCC 1F3DJ 3IMSA 4NZRL 3N41F 3NBNA 1TZAA 3ZKQD 3MRQA 4TSCL 3QUKA 1T7ZA 3N5AA 5KSUA 1BJ8A 4XBGA 4U6YA 3POCA 3UP1A 2G60L 1G9ML 1KOAA 3JWNE 1N0LB 4RGMC 2C3VB 5IHBA 4DVRH 3U0WL 2Y69B 3H9SA 5DJAA 2D3JA 2E0PA 5MENB 1RUQH 1SLWA 4A6YA 2IOIA 2WOBA 1GYAA 3RTQB 4YDLC 5DC2A 2WAHA 3ULUH 2BIPA 1GGBL 3GB7A 1I8IB 1BQHB 1AI1H 1R3JA 3TTYA 3K1DA 1JHKL 5FHBL 2XT1B 4UU9B 5HYIA 2BW4A 5IOPA 3VRLF 1WFJA 2IFFL 2WBXA 4TVPL 4L8DB 5H37A 2HX8A 1AQDB 3VXRE 4RAHA 2P5PA 2WO3B 3EDKA 4EN3A 3VGAB 3H3KA 5LN8A 2XN9D 1H15A 5EUKA 5JTWA 4Q6IC 4N22A 1OT1A 3VXQA 5KJRL 4ODWA 4RAVA 2AEQL 4PJFA 5DJ6B 1MNUL 5FKAA 2K6YA 4Z0BH 2J6WA 2AQSA 2N7SA 4KK6D 3AM8A 3BW9A 4NQEE 4E41E 3EDFA 3G6DL 3B3IA 2KHAA 4U7KA 3CQPA 3UBXA 3ZMNA 2W9LA 4XP4L 1E27A 2P24B 3WTWA 5D72H 1YN7B 5TF1H 4YC2C 4BH8B 1EDQA 3AGVA 1JTTA 3LKNB 3NJJA 3BWZA 4CU7A 1I4FB 3TBYB 2ICWA 1I9IL 5I74B 2EH8L 3CZSA 1F58H 1URIA 1SYSB 5ECGA 3WFEL 1F3RB 3QDGA 1ORSA 2WZ6A 1ZHLA 4JFQB 1A2YB 5T1MB 4UT6H 5KANI 2AMGA 1IO4C 2HFGH 3P4OB 3S6CA 3QEUA 5GGQL 3QUHA 3B9VA 1I31A 3SCMC 2WXRA 2VLME 3T3MF 5BXFB 3AAZA 3BUYB 1KWKA 2EIDA 4PGEB 2Q2LA 4QRPA 2VZ3A 1HDMA 2EXWC 2X1OA 1EEZB 4WENB 2GT9A 3WDHA 2D3NA 1WEJL 3BRFA 3HS0C 3ZPDA 1KYOK 5IHUH 5IMKB 1J18A 3ETBF 2ZSVB 3C8KA 1LO5B 1M2OA 2OI9B 3M86A 5D7LB 5AQ0A 4ZUSA 3VRIB 2UWEF 4HYTB 1J0YA 4IIZA 3TN0A 3U7YH 4LHJB 1MNNA 1GJIA 2P7TA 1QRNA 4KOCA 3D33A 4ADGA 4YGAB 1DUYB 5GGUA 2ENJA 3WLWC 1NBVL 1L3WA 3UBGA 3D3VE 2BSRA 3IXTB 4JFXA 3V4VL 3VXOB 1TTUA 4R96A 3E3QC 1M2VB 2XZAL 3QGVA 3CC5B 4J5VA 2HJKA 1HYSD 4NQDB 1YEKL 1TVDA 4G6FB 4LHUA 4UZSA 3GSWB 2FH8A 1AP2B 1K3IA 3QDMD 3KXFA 4F20A 2WUCL 3NAAH 4KVNH 5T3ZL 1M57B 2FJHA 4ZFZB 4A2LA 2P9RA 5L8LB 3NGBB 1ETZA 1ZA3B 1WA0X 2D3VA 4LOEA 5IMMA 2EP6A 5GJSH 5AG8A 2NR6C 3MV01 1TYRA 2CWRA 3CPLA 3FTGB 5E1QA 2G0KA 4GG6E 3BN9C 5KVEL 3SKMB 2CJUH 3GS4A 1XEUA 2DTML 1F4YL 4AEFA 4GSQA 1MF2H 1T83A 4JHVA 2ALAA 2GSMB 3SGJA 1F6LL 2BP8A 2JCCA 2VZSA 3HN8A 2JKIS 2Y1ZA 4Y7OC 3LS5H 3VD5A 2OP4H 3NT0A 1E40A 3RIFK 4HVBA 5CCKL 4NAJA 1I8KB 3RDTA 1HHKB 1AQMA 3UTQB 4LSUL 3HNVH 2NUTB 3BP7B 3LS4L 2QVTA 3KPLA 4TV3A 3V0WL 4M3JA 1Z5YD 3Q2LA 1CR9L 4JE4B 4AXWB 2J7LA 4X7EC 1WF5A 1YN6B 2ZONA 3BPOC 2BHFA 2CRYA 1LJMA 4ZX5A 1IZKA 4F33B 3P4NB 4OF0A 1E2ZA 2W9EH 3AREB 2F1BA 2QQNH 3G5YB 4H20H 5KJ7E 3WN5B 5HHOB 1Y18B 3GMOB 1MAJA 5GS1A 3Q0HA 2IDSA 1GAFL 4HQQL 4JRFA 3IDIB 1I7TA 1SEQL 4JGMA 4ZFOA 3QI9A 2XICA 1XGTA 2V3EA 4MXVE 3K2KA 1Z9NA 2LU4A 1YQVH 3TWYA 2Z8VC 1IZJA 1OGPA 4YE4L 1QI5A 3UTZA 4H25B 3WUWG 1PZ3A 1XBDA 1J12A 4QRRE 1UEMA 3NJHA 4HT1L 1S7SA 4BWTA 1HFUA 3D2UD 2WLKA 2DQIH 3F7LA 4PPTA 1HC1A 3R06A 4KKLD 2KT6A 1RZJC 1JZ5A 1OE2A 3FQNB 4FJYA 3T3PB 2ED8A 4ZPTB 5FA4B 4LSPL 2N1KA 4HIEB 2APVA 3TBSB 2HX7A 1SUHA 3N1MC 2SEBB 3KWWA 1F2XK 5IJVA 1AQ8A 1RZ7L 2GYSA 4Y2NA 2A99A 4Y2DC 4ZAKA 2QR0B 5CP7A 4I89A 5GRUH 3RY5A 3VTAA 4MQ7A 2ZXQA 2BSDA 3OVUB 3VSVA 3STZA 4QTIH 1R3HA 4QRRD 3Q8FA 3AU1A 4K5MA 2OW7A 4LOFA 4B50A 1GXEA 5DJZB 5E4AA 3IMRA 3N1QC 1IKOP 2COQA 5KG9A 4PRPD 4XCYB 1SOKA 3KPOB 5E56A 5CEZE 1QI4A 1HL5A 5C0NC 3IRZA 3IJYA 2WYIA 4R4BB 3N1FC 3PXJA 1U8CA 5ENWA 5HGAA 3NABL 4AUYA 4ZUWB 1IAKA 2K7PA 1EERB 3LXAA 1VCAA 3QNZB 4APXB 1DSYA 4WRLA 3FO0L 4NDMA 4GEJA 3SBWC 4JPIA 3UTSA 3F58H 4BHUI 4NRXA 1S8DA 4OJYA 2PKDA 3QUZC 2PW2B 2PWDA 2YD3A 1CGSH 2E9IA 1U58A 3DURB 3CHSA 1QUPA 4KTDH 5FUCC 1CDYA 1OAJA 4XPTL 3KHQA 1U8PA 3F7YB 3PWPA 4ETYA 4ZMOA 4PRHE 2EE0A 5E9DB 4FYSA 5IW1A 3DETD 2D4FA 3ZK0A 2XU9A 2UYLA 2ZICA 3B5TA 4KH9A 4BH7A 2AC0A 3V0EA 4JB9L 4I3GA 2P43B 3CCHA 2I7OA 3KPQA 4P4RB 4K3EH 1HOEA 1T03L 2EYRB 3DWTA 4JKLA 4FQJH 2GAZA 2CH8A 1C5CL 2BY1A 2OMNA 4MS6A 3EOAA 3LVTA 4HUCA 4Q7DA 3QUMB 1DVUA 4P99A 4G9FA 5CEXA 5J5EA 1EJ8A 3VFGL 3VJ6B 3QEQB 4E5XB 5C71A 2X42A 1P7QD 2I07B 1KWGA 1UD4A 3QZWG 4HCRA 3BGMA 4GOSA 3H7BB 5FK9A 5F7EH 4GSXA 3OXRA 2JJSA 2X9ZA 4BIKA 4JS7A 3S8FB 4MMXB 3KYMB 4PWKA 3RNQB 3U0PB 4HPYL 5CJXC 2D7TL 4G7YH 3II2A 1OXYA 1MH5A 5E99H 3LRGA 5AL0A 4BFRA 4E0RB 2BDNL 4Z23A 4FA8A 4YHZL 1XL4A 3K71A 4P05A 5TQ0H 4Z7WB 1WTGT 4HV8A 1C1EL 4CNIA 3BGFB 4JRXD 3ZGHA 4LEXH 1JYVA 1JNNH 1ZSHA 1PQZA 5JPMA 3LOWA 4FQ2H 4FTDA 1UD5A 4LGRB 1TJIL 3CFEA 2NZ1A 1WD9A 4GQQA 5HDRA 3ULAB 1ZS8A 3CH1B 3MCYA 2R2CA 3CPUA 2Z4QA 1Q9LA 1F90H 1XB8A 1WLHA 1E9OB 4GMTH 1CXLA 4BCYA 1BECA 5TK4A 2OSYA 5H4ZA 1QBMH 3HBZA 3O2DA 3ROOB 1SY6L 4ODXA 3H9HB 4PRAA 4XAKE 2VAAB 2W60A 5JHMA 2KQMA 5DK0A 3KW8A 5FO7A 3U9UA 2YFOA 1NC4D 4BDVA 2CHXA 2RHEA 2PPCA 3BP4B 1A3QA 4W6WB 5LGHL 4JUSA 2DKMA 5PAZA 1QA9B 2EEXA 3DJSA 4DK6A 3CN0A 5IB4B 4G7QB 3U46A 3HEIB 3HRZC 2FGWH 1SN0A 2AXGA 4L3AA 1B4JH 3MV7A 1FWXA 1YSOA 3ILQD 4K9EC 4XH2A 2VIRA 2FX8H 1ZA6B 4UWQB 4RGOL 5I1GL 2P5EA 4C83A 1PJWA 3HI1A 2EH7L 1M6OA 5SWQB 5FYJE 1AGCB 1MWOA 1BZ7A 3EUDA 4DERA 4HUMB 3QJFB 2OJZL 3V4PA 2R0LL 4QO1A 2ZOLB 2AK4A 4WI6A 3TJHC 3O2WH 5MEPA 4LP5A 1BQHA 1GW6A 2QL1A 4RFOL 3OLDA 4JHAH 4UTAA 5EZJA 1NFIB 4MCYB 1WZ1L 3L3GA 3FF7A 5IBTH 4QRQB 2BNRB 5E4EB 4YDJB 2VDRL 4RLDA 3V6BR 2EYSA 4IHOB 1BDYA 4L1HA 1CZ8H 1YAIA 1GOHA 5D7JD 1PG7X 5T5FH 5C9KA 5DTFB 4X4YB 4MYPA 1NBQA 5ADOH 2YOCA 4ZNCD 1FAKT 2R69L 4S2SA 3CVIL 3QJXA 3D18B 5C08A 3DRTA 1JFHA 2IJ0C 4BK8A 3B6SB 3SDDB 3CE1A 4XO9A 1AXTH 3MVSA 5E4OA 3C9NA 1XSOA 5J3HD 3VI3F 3IEAA 4JANB 2FEEL 3SSGA 1H3VA 2Z31C 4JFTA 5LCVL 5E9NA 5I1AB 3JBG7 4MDIB 3FOMB 5DLLA 3JWOL 3HBPA 5HI3D 3PHQA 2WGXA 1T04A 1KB9K 3G7TA 4MMZC 4HKZA 1BJ1H 1JZHA 4OZFB 4ECNA 4V1DD 4Z7UF 3LRSB 3P11H 4OZIB 2X6MA 3QXUA 3QEUB 3Q48A 1CICC 2V37A 1AG6A 3CFNA 4UV7L 1HINL 2V5YA 1OK0A 1QLRB 2WKOF 4DO5A 1NGXB 4QHMA 3CN3A 3K6SB 4Z5RA 5A7BA 1WCBA 3I6LD 4LPTA 3DHUA 4K71C 3VGBA 1W0VB 5EBLA 4EXPX 2JI3A 3LNDA 1CO1A 4LCWA 4YSSA 5HDQH 4BSWA 2GITB 3L7EB 3CFKB 1G7LB 3QCUL 3JT0A 2WZ0A 1A4KA 1VCBC 2YRZA 3MGOA 4MAUH 4P2AA 1HILA 1CYGA 4HPOL 1DJWA 3RB7A 4KTEH 4WDIB 2QPFA 1KJ2B 1MRDL 2QVFB 2VDLL 5IWLA 3SO3C 1MIEH 2RMNA 3QUZA 3UAFA 5JMRA 5C0AE 2ARWA 2G9HB 2BVTA 1KPUB 4Y16A 5DEFA 4FJ6A 1E3FA 1QFWI 3I02B 3KM1A 3QQ4B 4KJYB 4M4RA 2MOGA 1U41A 1NCWL 2J25A 3IFNL 3DX8B 3QJHB 1MW2A 4APQC 5F7UA 1MXGA 1XFPA 3C8HA 2WO4A 3SE8L 4PRID 5I0ZA 1GGIH 5E6SB 1HHHA 3FKUS 5IMMB 4ENEC 2VDRH 2VN4A 1UOVA 4OQTA 4ANXA 1K3ZA 1RPKA 3B1TA 1DL7L 3RPBA 1HOCB 4PI2A 3LXCA 1UACL 1UC6A 4GW1A 4I9XA 2FNBA 2VR8A 1FZOA 4GAGL 2R0LH 3TA3D 1DVFD 3IJ8A 3CK0L 3PS6A 5KYYB 2AI0L 3ZU8A 1Q9WB 3LN4B 3A67L 1J0IA 1JPFB 3NCJL 4Q56A 4ZS6C 4AL8C 4EDXA 3UPRB 1NGZA 5AZEL 3V6FA 1T1ZA 3PQYD 4M8QA 2W59A 1VEOA 2IQAA 1WE5A 1M7UA 1XR8A 4WI7A 3Q43A 2FGWL 3MFFA 3NIGE 3QVAA 1Y6KR 3P4NA 4RRPM 4PGCA 2NY1B 4WW1A 3F6LA 2JTYA 3CVBA 5J6GA 5EEWA 1XZ0B 4IS6A 3QFGA 4MSWB 1N4XL 1A1OB 4PJ8C 4TOYL 3C6LC 3QB7C 1XR9A 4PP2A 4WZ9A 3CX5K 3QWOA 2BSED 1CG9B 4P4KB 4E5XG 3W3BA 1DQKA 1IKNC 3WKPA 1KXVC 3RFZB 2OV0A 4P5RA 2BNQA 4X6DB 4XMWA 3JUYA 4C54A 3D6GA 2CXKA 1WQVT 2RGSA 4BFEA 3QFJD 3T0VA 3ZYIA 4GKZA 1MELA 1XCTB 2VT0A 3SJVE 2V2WB 4FHBD 3D4CA 3PWJB 2AJYH 2OSXA 4LQFH 5AFAA 2VRKA 3C09C 3O6FD 3D3VB 4P2RE 3QPQD 1X7QA 1SOSA 1DANT 1NICA 2SEBA 5BO0D 1FA4A 2W9DH 4XNYL 4DFHA 2ZPKH 4JFFB 4YSQA 4YHZH 2Z35B 4DN4L 1FNEB 1WAAF 3D51A 4HALA 4TL4A 5C6WH 2C3XA 4HKXA 4UTBA 1ZHNA 3L4TA 5HHMB 4YSCA 3MUUA 2EO7A 4ZD3L 3EBGA 3VFUB 1U33A 5FPIA 5IEHB 4PV8A 2OMXB 4GG6A 1HCVA 2R39A 2FT7A 5DJZA 2EDHA 4HWZB 1IGTB 2IDQA 4UOZA 4AVKA 2Z7UA 4RISL 4WHYH 1CGTA 4G42A 4ZD3H 2B8OT 3BUQA 2DQEL 4ZFOL 4U7MA 4V1DB 5E6IC 2QZ5A 3VXUA 8FABA 3DX1A 3TEUA 4Z7AA 1CFQA 2P80A 1KLGB 2EYTA 3DV4A 3WIHH 2XTJC 2H3KA 1TZIA 4MX7A 5D9SB 4NDMB 1VGKA 3MOBL 4NUMA 4V2BA 4DZBB 1A2YA 4KH2A 2IG2H 2Q8AH 2CO4A 4KXZI 3LNGA 5DHVA 4O4YH 1MIMH 3HB3D 4MZ3A 5D1ZB 2LV4A 4K3EL 4N8UA 4C56D 4K9EL 3BISA 3BWUF 2VTFA 3DIDA 2F7QA 1M4KA 4JB9H 4PV9B 4LBEB 1FPTH 1QABA 5DJXA 3I3DA 2DEWX 2WQWA 4WI3A 2DDQH 2EIMB 3RY6C 1JCVA 5JQ6L 3Q05A 4NQDD 1DTUA 4KK5D 1FE8H 5T3XE 2VDNH 1N6UA 5F97E 5KSAD 5TE7L 4MD0A 5CHNB 1FIGH 3D06A 4XOEA 5C1MB 5IMKA 4WAFA 5E6RB 4OF8A 1KPRB 2HLFC 3E6HA 3GJEA 4EUPB 4AVHA 2VITA 4PYGA 4L3FA 3OSKA 3N1PC 1IFRA 1WZLA 1L9TA 3V5HB 3OB8A 1G43A 3LZRA 1ANUA 5DMJB 1WWCA 3O0LA 1VSCA 4RQQA 5MP6L 4M43H 5IT2L 1WWBX 3CC5A 3QZWB 4MD5B 4YDKL 2WKGA 3FUIA 5DU7A 5C70A 3VVWA 3MA9L 4UQEA 1DFBH 3KS0J 1AZZC 3V0VB 2CO7A 2YSSA 1G1YA 4XAWH 3TASA 4E9VA 3FULA 2OCJA 3LQZA 4N8CL 2UZXA 2FJUB 3CZGA 4OJAA 2PMZA 2KZBA 4GAGH 5CBEB 2OJEB 4XVUD 3C5ZA 1WC7A 3PWNB 3VX1A 1UACH 4RRPG 4OZHE 4FZEL 4JY6B 1RZ7H 1GCYA 1KT2A 2BVOB 3GSRB 3CQQA 2KKQA 5KSVA 3PL6A 4TF4A 3ZMRA 3OZ9L 1E90A 2A1WL 2IGFH 2WKLA 2NNAA 2NLJA 3CFIC 3RL2A 4Y4FC 1L9PA 1KCLA 4IRZA 3AABA 5AB9A 1O7DE 1UEYA 2YAQA 4X7CC 3CFTA 4P04A 5E2VL 4I7ZC 4YR6A 2NUTA 1AKJA 4CN6A 5C0DB 2NRDA 3LKOA 4J3XA 4ZXBD 3WL9B 3QG6B 2A74C 2GY7B 4AEHH 3MU3A 1URZA 4MRBA 2ARJQ 3VH8A 4P8QA 3VD3A 4LEOA 2WD0A 4LRIA 1YQVL 1BX2B 1BMWA 3BPCB 1S6NA 3P3UA 3MNZA 4UQAA 2OYMA 4MJJA 5ERWB 3UG3A 1CE1H 3BRDA 1D5MB 1I3UA 2NNRA 1QASA 4MQXC 2J8UA 4KMTH 1JZGA 2AJZA 5IHZA 2NY0C 2VDNL 4M5ZH 4PJDB 4OZ4A 1XQ4A 3FH5A 3MV9B 4GRLC 5IB3A 5JQ6H 5KS9A 3RLSA 4XCNA 2OXGA 3OHXC 5E1AA 2PO6D 2FWOB 4AJYV 3F7VB 3HNVL 3QR0A 3U6XS 3ZDXB 4A66A 2XIBA 3DROB 4OAWA 4HIHB 1HHGB 1HINH 3R0MA 5DDHB 2YRPA 4LK4A 3MJ9A 2VRQA 3JV4B 4HIIA 4CMMA 2DTMH 3D69A 3POHA 4ETQA 3I75A 4UNIA 1U8LA 2NR6A 3SCMB 5DQJB 1RPQA 5F9OH 4BE6A 2Q6WB 1YYML 4O58L 4JVUA 5JW4M 1YUHA 2HWZL 2QLVB 4RDBA 3DSFH 5F3HB 1JRHI 4PBXA 4WK0B 3IGKA 3MRHA 3MHZA 2G3XA 3CVIH 4CJ0A 4GJTB 3V4VA 5DHYA 5E9DD 4MLSA 2DLHA 1BAGA 1J1OH 4HIPA 4LLMA 1TOXA 3ARYA 1USZA 2ZPKL 1CBVH 3QPKA 2GEEA 3RPIB 1QR1A 5A7EA 3U2IA 2WLLA 5DFVC 3U7YL 1PYWA 2AHIA 1YECH 4YE0A 2PNDA 2E9WA 3K4AA 3SDYH 1FJ1A 1WZ1H 2E7MA 3EDJA 1ZT7B 4KKRA 3LD8C 3F85A 1QQDA 2VABA 1QFHA 2G2NA 2ZWLT 4O5LH 1ZV5A 5IHUL 4W4OA 1YEGH 2JJUA 3BWAA 2AJYL 3GUTA 2XG5B 3T6WA 2YAHA 5JYMA 2O5XL 2A2QT 3GMNB 3V9FA 4D9QD 4QGYA 2G2PA 4YQXH 1B2WL 3FB6A 4BH7B 3CVDA 5C0CD 1E9QB 3FB8B 4OBSA 1E8ZA 5IJKA 4NN5C 5I1LA 1GHFL 3H4FA 3ATFA 5LGKA 3ZSSA 2UY7B 5C0CE 1QKZL 3CFKA 2IAMD 5E8EA 1DE4B 3QAZB 1YNTA 1YG9A 5E6IA 4LAQH 4E42A 3IK2A 4AG4H 4NQED 4EJ1C 2AFNA 3FOLB 5AOMA 2LHAA 3CU1A 2D73A 3E8UH 4GO6B 1N19A 1MCWW 1BM3L 2FSDA 1AO7A 4HXAH 1RY7B 4PEEA 1N2RB 3V9EA 4F15C 5IQNA 4Y4FB 1GYUA 3OXRB 1N6QH 1ITBB 2NZIA 3ME0B 3NSDA 1OE1A 1CT8B 3U2SA 1VENA 3AXHA 4JRYD 2JMRA 5IR1A 4J39A 3RI5F 4P3DB 4MB4A 3M88A 2NYKA 3RURA 1JZEA 2ATKA 3DA0A 4E0RA 3BAIA 2UV3A 3PQYE 35C8L 1JF1B 3IB4A 4TXVB 4AQ8A 4BM7A 2IWKA 2PXYC 5CIPH 5CKAA 4PCTA 5CJBA 1JNNL 2YEZB 5EBWB 1GJWA 3ATBA 3BT0A 4JO1H 4CL7A 5C0JA 1JV2B 4HUVB 1Q0XH 1SYVA 4JGJA 5DA4A 3SE8H 1DUZA 3EH3B 1CJYA 1JHKH 5FHBH 5FYLH 5E4IA 2R4RL 3JWNG 4HCFA 3IFNH 3ULUL 2YPLB 1FZOB 5E99L 4A6YL 2NCMA 4W70A 2DIEA 4Y19E 4HX1B 3ZL2A 4DGVL 4NO3B 2FO4B 5F7DA 4PTTB 3ARDC 3RTQD 3RZCB 3BH4A 3OC8A 5IM7B 1MIEL 1OM9A 1PFCA 1T7WA 4AQ1B 1MW0A 4G8FA 4I0PB 1S7TA 1DQQA 2XA3A 3L4CA 4J3TA 4FN0A 4NRYA 4TSCH 3K91A 5C09D 1UB5B 1D5IH 4XPAH 1FNAA 1KCBA 2ADIB 4JQXC 4MZRA 2X4TB 1FCGA 2HTKC 2DV6A 3Q8AA 3TPUA 2MKLC 4OZGF 5J6GB 1VKXB 1S9KC 1SXAA 2YHGA 3QCVH 4GRLD 4TM9A 1BD2D 1X4YA 2XIIA 1RZKH 2HJLB 4JLRA 4Y5VC 2X53A 4OW6A 2B4CL 1T03H 4FTVD 5E7BA 2F9BT 3BPLC 4AYGA 4DUXA 3L4UA 1ZE3H 2WNWA 3K74B 4Q97A 1GKOA 3IFOB 5LNEA 2W65A 3EGDB 4AM0A 5DRXA 4FYQA 3OX8A 3L6FA 5MENA 5IVZA 2DQJH 3FTGA 4X98B 4J3OG 4FXGC 2XACC 2CK0H 4ZTEA 1CTOA 1UOKA 3OHMB 3PG2A 4FKKA 4XPTH 2BP8B 1EK3A 3FAXA 1EBAA 4LPVA 3QFJE 2FHFA 4AE1A 2EVFA 3SKOA 3TVMD 5IB2A 4E41D 5BV7B 4LLQA 2IWEA 2E27H 3WTYA 2VR4A 1WZKA 1PZ5A 4W6XB 1QLEL 1P6FA 4MNQB 3FCSB 4H1LG 5IB1B 3S37X 5LGJB 5JO5A 3AJ7A 4NRZB 3F5WB 5LO7A 1RZ8B 5FECA 2AXWA 2ITEA 4CC4C 4S11A 2EUWA 4N25A 4H1LB 1XEDA 2JQAA 2RQ8A 2APBA 3VA6A 2OTPA 1H6EA 3WJMA 3LKQA 5IZ7A 3X1BA 1JZ2A 3TJEL 1HN1A 1KTLB 1T1WB 1NFDF 1M6UA 3UH8A 3BHBB 3MRGB 4X8XA 1F4HA 3GIVA 4Q9QH 1L9QA 4QCIB 3QW9A 1YPZB 2W8CA 4E68A 4JAMB 4NUGH 5DS8B 4XWOC 3SE9H 4RX4A 3GB7B 3QJTB 2JLPA 4RGOH 1Z3RA 2CG9X 5L7XL 1UZ6F 3GBNL 5E8DL 4B7IA 2IXQB 3JWDH 3L3HA 1B4JL 2C5DC 4W9LC 4XNMA 3BFOA 4DAGL 4BKLB 1JIBA 2Q1EA 1MPAL 4WUUE 5A16A 1MFEL 2OQJA 3FO2B 2VDQL 5HHNB 2HPTA 5FWRA 3BVUA 2IBBA 2WBKA 5LGHH 4PRIB 5JR1L 1CFMA 2J57A 3STZB 1CI3M 1GAFH 1NAML 3FTSA 2DICA 2PW1B 3KR3L 4GBXB 4XXWC 4NZUH 3W39B 3X3FL 4DQOH 4LE8A 2Y7QB 2V7HB 3E2HC 1KNOA 2BSBA 2HJFA 4QHLB 3NRFA 2OMWB 4I3RL 3IDXL 4QXTB 4DP6X 2BZDA 1QBML 4Y16B 4PJCB 3VW3L 3L4WA 1JS4A 3S5YA 1MCPH 4P2RB 4R96B 4F9PA 5HGAB 1Z5HA 5IW3A 4MD5A 1URLA 4RA3A 2XWBB 1EA9C 2UXGA 5I1EL 4L4TA 4U05A 5FUCE 4ZFZA 4ALAC 4JPIB 1TUPA 4FQ2L 4FG2A 1PIGA 3P4OA 1MHHA 4PJEF 4AGNA 2WXLA 5BVPH 4G7SB 4YXLL 4B9KC 4B6ZA 4FTVE 5I0DA 1F4YH 1WT5C 2BNRD 4MZ2A 2E4TA 5DSCB 2HN7B 1HVXA 4RA0C 2H1XA 2J3SA 2NDFA 2QQKH 3O3AB 4NZ8A 5SWZD 4JQVC 2E8ZA 5IESH 2EQDA 4UF7C 1IQDB 1HHKA 2FLMA 3UTQA 4DKEL 1M7XA 4CRPA 3CX5J 4BQ9A 4MCZB 1KN4L 4A2FA 1ERNA 4CSTA 3V52H 5J12B 2VXVH 4N1CA 2JKSA 2YUXA 1M05B 2AJ3B 2OA9A 1CGWA 3NZHL 3GI8L 2H47C 4PGCB 4WW1B 4Y19D 4BK4A 5J06A 1G9NL 1I53A 1FNSH 1P84K 2EXSA 5AZ2L 4OKVA 4IBTA 1NAMB 4KKAC 4BE5A 2HMID 3GZQA 2WGNB 3HMXA 4I9WD 1MHPL 1XF5B 4OUUB 4NO2B 3VD0A 4TQ8A 1P4BL 4Z7QB 3LZFL 3W11D 3GSWA 4HDIB 5DZJA 3A6CH 1BMGA 4I1PA 3RVXC 4B9JA 1D2PA 1JNLH 4H25A 4X6CF 4X5WB 3H9SB 5DJAB 4W4NA 2PO6A 4OY9A 1NLDL 2VR5A 1PEZA 2X4UA 3TVMB 2IDFA 3EYFB 3BKJL 3OB0H 4MVBD 3H42L 3DSNA 3NEXA 1Y7VA 4UDTB 4BXSV 2QPEB 2OW6A 5I66B 2XKNB 5BQ7A 1MRCL 3MRLB 4XMLL 2NZ9C 3MBEB 3ZE1F 3F58L 2GC7C 2WVSA 2FBOJ 3JV4A 1ZHBB 1L4IA 2B39A 4UT6L 4D0BA 3BIBX 2GB2A 4PAZA 2QADB 3Q1SL 4AXWA 1S9WA 2EH8H 4KNTA 5FA3B 3TONA 5IFAH 3VACA 4MMYA 1XF4B 3RVUD 4E9QA 4XVSL 1NWPA 4YAQA 3VU1A 1A4BA 3K2UH 1Z2KA 2VDNB 5DZAA 2MPVA 4PIBA 1F3JB 3WAKA 3A4DA 4HK0B 2W0PA 3EGSB 4EUPH 3PABB 2K4WA 3PNRB 2W0KA 2WNKA 2XWTA 1IRAY 3VXUB 4ZUWA 5K9OA 1QLEB 4BFJA 3OKNA 3MPCA 1BPVA 2VXSH 2Y25A 4O9HH 1U3HD 4LDOB 4JVWA 4J8RA 1AANA 1V7NL 4AKPA 3A6OA 2X6BA 4JGNA 2WB1A 3EO1B 2PCFB 5HYSG 2Z0BA 1ET7A 3WNIA 4PLNC 3GUTB 5I9QB 4HT1H 4DGIL 2IFGA 1LK2A 1T1YA 3FB5A 4AL8H 43C9B 4YE4H 1KGIA 3ET9F 5D7JB 4N0YH 3CSBA 1Z1WA 3NIDB 4LPYA 3KNBA 2ZSVA 3C8KB 4JREB 1T5XB 1LO5A 4MA7H 3VGGA 5K69A 2XWDA 2D2OA 1GZPA 1D5XB 4LPXA 3N2JA 5B7EA 1RVFL 5IP4A 4QLWA 4P2CG 4D9QE 5D4HA 1FI8C 2Y6TE 3SDXB 1X9LA 4I0KA 1TQCB 4NN7C 2NXZC 3GDCA 3X3GH 2AEOA 4IKKA 3VJ6A 5CD5D 1HAUA 2LTQB 3WXVH 1EFXA 5BO1H 5KBPA 1WK0A 1T0PB 2QPUA 1CR9H 1A64A 4Z77A 4U6TA 3V0WH 4HG4J 4N0FA 3CIQA 2DI8A 3SGEH 4LSUH 2C3HA 3MYJB 1TR7A 3QORC 2EIJB 5I8CA 2ZKHL 3W0WA 1C5BL 3GSUB 5CCKH 1JK8B 3PWLB 5GGVY 1UKSA 1MOEA 1E42A 1XCQA 3VVVA 3Q01A 3SYAA 2IAMB 3PHOA 4LKXB 3QWNA 1YMMB 1F4XL 3FFCA 4OIAA 4XBPB 3KYOA 3ULVD 1D7FA 1MF2L 1C8QA 4Q0XL 4LOUD 1RZIA 2OLDA 2YAEA 3OSVA 3MOAL 5LAXB 4BUGA 4PJBE 2VE6A 1A6UH 4X7FC 1P9MC 3BVNA 2MEJB 3VXUE 4AK2A 1PQZB 2ITDB 3RWIB 1TEFA 3RDJA 1TQWA 1J1XL 3ZE2E 3RDTB 1FVCB 2K0RA 4NFCA 4OGXH 3QHZH 5JHAA 2XBZA 3QRLA 1NFDA 4GMSL 1OLLA 4JFEE 2XZAH 3MZGB 1MLCA 3IE9A 1KGWA 1MFAH 1MI5A 3EF7A 3GSXB 2V2TA 3ZRFC 2WLZA 1TYJA 2DWEA 3H9HA 3HC0B 3RPKA 1MJJA 1G7HB 2LFEA 5AENA 2CHZA 2VKXA 2XZZA 3SPHA 4CDGC 2VOTA 5HHPA 4EN2A 3KYNB 3CFDB 4LMQI 4ZFOB 2IBZY 5K1JA 1Z66A 3O6FA 3CHXA 1IM3D 1S7RA 1FORL 5JLZA 4KKLC 5HHOD 2ZOOA 4JRYA 3FH7A 4R97C 5LBSA 4A55A 3ZRSA 2QKIC 1CD8A 3NFNA 3HRPA 3FJTA 1DVTA 4CGTA 1E3XA 3LKPB 3DYOA 1U8HB 2HG0A 4GI6A 3ZMEA 5CGMA 5I16A 3IJHA 4OCMC 4QXWA 1T20A 3MUGA 2Z92B 1M7DA 4A39A 4ELKA 1LWJA 2Q76B 2HFGL 3GDBA 4NQEA 3KDPB 1FO0B 5EORL 2ALWA 1WDAA 5F21B 4B9PA 1TVBB 2OMZA 3ECWA 3LHAA 4UUJA 3MRIA 4MYWB 2BZCA 3D69B 1CFBA 4P9HH 4IU3B 3G5ZB 3SCMA 1IBDA 3ATDA 4QRQA 3HE7C 1RK1A 4PR5A 1LK3L 1KB5L 2YMTA 4ZOAA 4YBQD 4TNWK 3OWEA 3I6KA 2CSPA 1ZANH 1BJMA 2H8PB 3MFGB 5DD6B 5DMIH 4U2YA 2EVJA 3MBEC 5AVUB 3WU1A 3PQYA 4YLBA 2XZQL 3QDGE 5HYFA 3PWVA 4L2LA 4PLKC 2YN3A 1E4JA 4R4BA 4UIMB 1U8CB 2CDEB 5LBGA 1Y07A 4ZUVA 3AVEA 4JL2A 1DDTA 1K8IB 1UXMA 3H3BC 5KBMA 1FLRL 3MACH 3D0LA 1CDJA 1SDDB 1LO3H 2JKJA 3IDJB 3FOMA 4TNVF 2AERT 5I8EA 1PPIA 2R59A 3TU6A 4C56E 2VIRB 4CBZA 1KTLA 1ZA6A 1AI1L 4HJIA 1KENL 3PJNA 4TSAH 1ZLVH 4JPVL 4EBQL 1JVLA 1I1AA 1MFAL 5F1OB 4WWNA 5E5MB 2AQ3A 1CTNA 1AD9B 2QSCH 3MRRB 3UPCA 1QRNE 5ECJE 4AYEC 5D1QC 1HXKA 4MHHI 3CDZA 4NO5B 2CD0A 3L1FA 4PJIA 2O72A 3ZKND 1OWWA 4OCWL 5E2JA 1IT9H 3S37L 2EILB 5DO8A 3OAUL 3CZUB 3A4AA 2YAFA 4OI9A 4G80A 5DHMC 1BVKA 1PCSA 1J9SA 1S9VB 5BJTB 1GZQA 1OB1A 1IILE 1T4KA 5JMOC 4DP8X 4S1SL 2EKSB 1F4XH 2B5IC 3UZQB 4Q6IB 3FOLA 1EV2E 1UHVA 2OJ1A 2HFFA 3BVDB 5CJ8A 1CN4A 1TO5A 4M1DL 2VZOA 3VFUA 3VH8G 2ZAHA 5IEHA 2ZKHH 5GZOC 1ADWA 4U1IA 3SY0B 3MROA 1P5VB 1DBKH 3FSWA 1RMFH 3OG6B 2FO1A 4I3SH 4NX0A 2KPWA 2VC2B 4J1UB 2B9AA 4WFHE 3WI9A 5J6HB 1KMGA 5BO1L 2E7CA 5IR1B 2EC9T 3P9LA 1R46A 2SODB 3PP3K 2PWGA 4DP4X 3DGCR 4LEEA 4FQQA 4G11A 1MHEB 1WIOA 2APTA 1WD8A 1A14L 3TA3B 5FFOA 3CZLA 3HG2A 5T1MA 3VWJD 3EYVB 3V0DA 4ZJ9A 4AZUA 1A6VL 3IMBA 3I84A 1BVLA 1KJMB 2WIMA 4RAUB 3X17A 1FYTB 2ADJB 1CFVH 1BQHG 4RMVA 5EBLB 4N0YL 3DMMC 3WD5L 1CICD 1UJ3C 4LLWB 4B9GA 3DJRA 5C08D 1RI8A 4AL8L 5I6KA 3GRWH 4FFZA 5CSZB 5HJBA 1J1PL 4WTZA 2IVFC 4M6NL 4KRMB 4WU7A 5IM7A 2BXYA 5CF3A 3TGXA 5AALA 5FOBB 4POZD 1GGTA 1U8JB 1B6UA 3VD1A 1P5UC 2FNWA 2ZOUA 4OCSL 1FLRH 3MACL 2K9FB 2ZWYA 3ARZA 3DO7A 5FGBC 2VXSL 1DUYA 5GGUB 4HSQA 4YXKL 4IS6B 1A1OA 3Q5TA 1S7QA 2AXGB 4OQTL 5F6IB 4P23C 4P2QE 3FUHA 3QQ4A 1W0WB 4WUUA 3VXPA 3B4NA 3TO4D 4HF5H 2BVQB 3KBFA 4JM2D 4K5NA 5GRWA 3PGDB 3IJSB 2ICES 3DOSB 4LVOC 5DMIL 5HHQA 1ZANL 4PRIE 4GKZB 2MQ0A 2Z91B 5F9JA 1NEZG 1T83C 1LK3H 2X4UB 2V9TA 5DGQA 4IKJA 1JXDA 3TVMA 4N2FA 3CZKA 2Y23A 2XLLA 3ZXAC 4F2MB 4OV5B 1X5JA 1XGPB 1BXXA 2A77L 3ERXA 5I1JH 4MCYA 2JB6A 3KG5A 4Q6YA 4UOJA 1DJIA 1E3ZA 2CKBB 2EDNA 3RL2B 4G9DA 5EO1A 4BQBA 1ND0B 3FQ1A 5IW6A 1TQSA 3MR9A 1BVNT 2EE2A 2XVLA 3UTSE 3PIQB 2CLZB 3V4UL 4YHLH 1DVQA 1KB5B 2X7LA 1UA3A 5I76A 3DTXA 3MRFB 1N3NB 1UWEL 4LLUB 4NPKA 4PLOB 4FTVA 2VW6A 4R5XA 1CC3A 4LEOB 2CO1A 5F0MB 3ULUD 1NKRA 2QHRH 1QMUA 4ESKA 1TNNA 4K8RC 1FYTD 1QBLH 2ZAIA 4FNTA 1BWMA 1IGFH 2GABA 1WA1X 4MJ5A 4PJ8A 1YYLL 3CMOH 1G9NH 1CL7H 4IOFD 4RFEA 3WSQH 1IKNA 3WFHB 2ZUYA 4J8RB 4WI9A 4TPRL 4ZFGH 2G2RB 5GS2D 1E50A 2UZYA 2FZ3A 2B2XH 2OXGB 4H8WC 4MS8D 4WW2F 5E1AB 3PWJA 5D4JA 1KTRL 4ZMQA 4UT9A 2EIBA 4R3SB 3FQNA 3QHZL 4JO3L 4G9FE 4BSVB 2B2XL 4KU1A 2J88L 1T22A 4Z7QF 4PWFA 3FAWA 3MOAH 1J10A 3LRMA 2CLRA 4HIIB 1CFTB 4HUKB 3B9KA 3NCCB 1OP3K 5C07D 5CP7B 2VM3A 4FMFA 3JSSA 2R27A 3RWJB 4PGJA 3GJEB 4EUPA 5MENE 2X12A 1CU4L 3H9YA 1K6QH 5SV4A 5MHSD 4MZIA 1FAIH 3N6YA 3LRHA 3T4YB 4F2ME 4NQUA 1RAMA 4OJEH 3VCLB 5I1EH 2OR9H 1NCTA 4U1NA 4KI5F 5K1VA 3SKJL 2BOCB 2BNUB 2CA4A 5FV1L 4DP5X 5CP3A 5B1JC 5IWLC 5CKGA 4AW4A 1GOGA 3V7AE 2CUHA 1RCYA 4KKNA 3WXVL 2N1TE 4RGND 1OZTG 2F8IA 2X4RB 3N0AA 3DX0A 1IKFL 1ORSB 4PJGE 5BW7C 3V0VA 2FD6L 2WXMA 1QOKA 4KHTL 1WFUA 1NAMH 3KR3H 4A7UA 5E6ID 4KC3B 4M5TA 4OJCA 4MQTB 2X4NA 3TBCA 3TA3C 7PCYA 3JQOB 3QPXH 4MA7L 5JIKA 3V95A 2CIIB 3GBEA 1U8IB 5JXAL 4F2EA 2C9QA 3GHBL 3HE7A 5D1XC 4H8UA 3VE0A 2WQSA 4JM0A 3HMWL 3DHPA 4HOMA 4OLXH 4OJDH 4G6JL 2VZVA 3KCPB 3ARTA 3N42B 4Y4KD 3SO5A 1TTGA 1Z0NA 3N41B 4NJAH 1OSZB 5FXCH 3GBNH 5E8DH 3EH2A 1KLFB 1TZ8A 3HCVB 3IGUA 3RWDB 4P4RA 1EJOL 1W16A 3GD1C 1THCA 5D7LA 2V2XB 3FO9B 5AYQA 3NCMA 3WL9A 3DV6A 4OQTH 4QIRA 4XAKD 1TTRA 3CVHL 4KHXH 3MXWH 3MRKB 4QKXB 1Q9KB 3PAVA 3KBEA 4JFOB 4AIZA 3VFPB 2VDLB 2WCPA 4I48A 5F0PB 3TJEH 3DUSA 3D39A 1JWMB 1OV8A 1QYGH 2R7EA 3NSJA 4MJID 1M2VA 1F3DH 4MRCA 5D96C 5ACLA 1JN6B 1OW0A 1AO7B 3DVGA 1G7QA 5FK9B 4KO7A 3MLRL 4M93B 4HDIA 1DJSA 3MQIA 2L0DA 1YNTF 3K2UL 3T4AA 2NOYA 2GSIA 2VLKB 2WM0A 4JFPB 5D4IA 1MCLA 5E1GA 4FFZL 1DJZA 1GSKA 4D0DA 3WD5H 3VXTA 1IEHA 3ARFC 4LQ1A 5B1JA 4FQCL 1HYSC 3L9YA 4OFQA 5C8JA 1E5YA 1N64H 1OAQH 2EDLA 4CNIB 2NR6D 4W9GC 2JTDA 1T7XA 2PN5A 4PJAF 3C60A 3NQKA 4JKKA 2Z92A 4FQ1H 2NNAB 3PHSA 4PCYA 5LQBH 4RNRB 1W8OA 3TBTB 3BKML 3T0XA 3F01A 3RVWD 1U8QA 4ZX4A 3IVKA 4YR6B 1NKGA 4IU3A 4NQTA 3S0PA 5JA9A 1YN6A 1YUHB 1JF5A 1T2QH 4GG6B 3HZYA 5FM5O 4PI0A 4A67A 2YK1H 4OZHB 3RWCA 5IB5A 2O61B 2ATPB 5FFLA 5I6LA 3T3MB 3UZEA 3GBLA 5C6TH 5JZ7D 2B4CH 4HA1A 5I71C 1MHPH 4PRPB 3WXWL 4Z7UB 5IQ9A 4M6OL 2KUTA 4EPSA 5CM1A 1EXUA 1KLGA 2O5NA 4ZUVB 4YSAA 5I75B 3VG9C 4WHYG 3K5RA 3UTZB 2X2UA 3VFNA 2PCPB 3O9WC 5IB3B 4EDWL 4Y2DA 4ZAKC 1HWHB 3IXAA 4OGZA 3R06B 1T5WA 1U42A 4IRJC 2IANA 4DKEH 1DCEA 1XH3B 3QDMA 4M7LL 4JY5H 4J4PC 1OALA 2AABL 3GSNB 4OSUL 4Z0XB 5IUSA 3TBBA 1HSAA 4P5KB 5GQBA 5ICXB 4EBQH 3NEOA 3GHEH 3S34H 3KBHE 2ESVA 2J72A 4NAMA 5D7JA 4AOFA 3V5KB 1EAOA 3L1GA 3MLSL 1PEWA 4N24A 5L8JB 1RSYA 1ZHKA 2DMCA 2C1PB 2HA1A 1IEAB 1C7SA 3MMEB 3HHSB 4JRYE 2OL3A 4JFDA 1DCLA 5IMOB 1R3KB 3JTTA 4L1LA 3EJYD 4X9BA 4AYSA 2YPKA 1B0GB 2FHCA 1IAOB 4XP1H 1QSEB 1XH2A 1X5MA 2AZUA 3WLBB 5I2IA 4G80B 3VWKC 35C8H 3EBHA 2XCMC 3MA7B 3RRQA 5BJTA 3FQRB 3ZDXE 7FABH 2FBJL 5GS0L 2RD0A 1J0JA 5T1DH 3M8OL 4YVUA 1LL1A 3FCSA 3US9A 3V4VB 1FL3A 3GKWH 2V17L 2AQ1A 4H5SB 2E47A 3W2DH 4JDZA 3MUY1 1ZLWK 2DI9A 1Q8MA 2EDFA 1JNHB 2XZQH 4QRPD 5A43C 4FI6A 4AITA 3H2PA 4AGLA 5SX5H 1U8MB 1U0QA 1BM3H 4HXAL 3ZYZA 4L2YA 5FAAA 3MLTA 1N5YL 2UZXB 1JV5A 1KB5H 2BS9A 1EEYA 4NZDA 3QQ9C 1QP1A 2XG4A 5DK3A 4KVPA 3KYOB 5AOKA 3UIYA 3UTTE 1NPJA 4ICWA 4OFIA 3S35X 4ZNEE 5KVFH 2IOOA 3Q44A 4Z3GA 5BCAA 2NW3B 3QDGD 4PRPE 1NC4A 4OZIA 3X1GA 1MFNA 4GQPH 4P59L 3PGFL 2I27N 3GXNA 3HW7A 3SQBB 2CCVA 1TZOA 5DYFA 3EG9B 3TXAA 4CC0A 2K6WA 3ZE0E 3X1EA 1VRSA 4L23A 5C0DA 3SE9L 4XRCB 1O5PA 3WJLC 2RCSH 3WDJA 5JA8B 1I9EA 5KW9L 4PTTA 4NM8H 4C56A 4FG6D 3WHE0 3BD5A 1G0YR 5HDBF 3TCLA 5ILTH 3MLUL 3IKCA 2GBUA 4JFED 4WKZA 5E95B 1QHPA 1SOXA 5HHPB 3BT2H 1KF9B 1YY8A 3ENEA 3VWJB 1TCRB 1QD0A 4G8EB 1YECL 1D9KD 3EOBB 5CZRA 4HETA 2AEPL 4OQ1A 4ZW3A 2F53A 2ADYA 4HHGA 3UX9B 3JV0A 3CN2A 3MRCB 2R4SL 2ETWA 1ET8A 1CS6A 2NNFA 4XOAA 4WSJA 5D7LD 4C8XA 2VDKH 3VNYA 4CJ1A 3SE3C 1MH5B 2YZ8A 3HBGA 2XY1A 3A47A 3JWNC 4P2RA 1RH8A 4A2GA 3H9SD 5G4OA 3O8XD 4DSYA 1GSMA 4KJWD 3K71B 4F8QA 3OMZA 3O41A 3ASNB 3DROA 1HHGA 1U2CA 4JM2C 3LB6C 4BZ2L 3WFZA 2WXNA 3WY1A 2AITA 4EI5D 4FQHA 4ERSL 1YYMH 4O58H 3LV3B 4X98A 3VSUA 5D1ZD 2XV3A 2NMSA 2OMZB 2CK0L 2ZOTA 5EV7A 3IPEA 5EIVA 5GSVA 2CJ3A 2Q2EB 3COOA 3LNHA 1JZ4A 4FLQA 3UJIL 4LLVB 4BK5A 1YUKB 2DQJL 1EZLA 1HH9A 2BJML 4F5CA 3CFUA 3I6KB 5IB2B 1OGAE 4ODXB 5M94B 1MAML 3NGBC 1CFNB 2J5WA 1G7MB 1YEJL 1UD3A 5ALCH 1FN4A 4WHTB 2QSTA 1PVHA 1QFWH 4IOSD 4MAYC 5DHYB 3RZWA 1AGEB 2VW7A 4ORGB 2NY4B 4NKIL 2NNCA 5EO0B 2GK2A 5IHHA 3TF7C 2F58L 1FNLA 2N7BA 3DRQB 2A6DA 1QTPA 3PDGA 5HJ3B 5FF6B 5GJTL 4XPAL 1AGBA 2FJFB 1KZYA 1CE1L 1THAA 1DQLH 2YUVA 4N90D 2A83A 4BCZA 2VLMD 1G6RL 1VFMA 3B3BA 1ZT7A 1CLCA 2CRIA 4PJ8B 1Q1PA 3ILDA 4WFED 2GTZA 3AB0C 1JVKA 4K94H 5DJYB 4IEFA 4IOFC 1J7VR 1K2DA 2O5YL 4DGVH 2CE6A 4S1QL 3T8MA 4ZUTA 4N0RA 5E03A 2CM6A 2Y4SA 3CBJB 1RV6X 1I9JH 4BXVA 5FM8A 5C0RH 2F8XC 5FYLL 1EO8H 2ZXWB 4XB8A 4TNFA 3EJYC 3QP3A 1Q0XL 5D5MA 3RWFA 3CDZB 4NO5A 4WIQA 4I18C 3GTNA 1G1OA 3FSAA 3MBEA 2FWLB 3D34A 2XJLA 4JO1L 2Y0SA 3OZ9H 4IIQB 1RLWA 2MCG1 2E8YA 5CZKA 1TTAA 1QAWA 1RLBA 4IKNA 4E42B 3KCWA 1WZMA 2DIAA 8CGTA 2EO1A 3ARFB 4M61A 5FO8B 3AC0A 4BUHA 3F5WA 4H26A 1SVCP 2BY2A 4BK5C 4HWZA 5K39B 2H26B 5CN2A 5HVGB 3KZ8A 3ME0A 3L16A 3VFMB 5TTRA 3WUWB 4H1LA 3QUZD 3E8UL 3NCWA 3WEAA 4GSRA 2E6QA 4JFFD 3T2OA 4AMKH 3LPFA 4ZI8A 3NACH 4WCYL 4AG4L 4M56A 1KACB 3U30B 1R5VB 1PZBA 2YA0A 1AXSA 4B0MB 1R33A 5AW4B 2FJGA 5JYLA 5TH2A 3DMMD 2ZXGA 4DTGH 1F8TL 1PFOA 4QHMB 2J56A 1WCBB 1HJBC 3FRUA 4L3CB 4N2GA 1IAII 4AJVA 3ARDD 4NKQB 3RTQC 5TE7H 1HEHC 3BKJH 1B2WH 2O5XH 5IMLA 2IDTA 1T1YB 3FB5B 5IQOA 1ZEAH 3QEHA 4IMKC 1T2XA 2DDQL 3CMGA 1FSKC 4UOW1 3MKGA 3TO4A 3FK3A 4UIKH 1PLAA 1HWWA 4MD0B 4WUUD 2I69A 5CHNA 1DBJL 2BCMA 4LFHG 1IM9A 2W07A 3RL1B 2IH8A 3V8CA 5I73B 4XN5A 4YEEA 1OARL 5KTEL 1K72A 4ZS7H 2ADIA 2NY1D 5AOZA 2E46A 2EUZA 4UQ2B 3X14A 1D5BA 2VMEA 3FYEB 2FLRT 2G5BA 3T8VA 4OKVB 1L0YA 3LN5B 1BQLH 3MI6A 2WANA 4LSRH 5BOJA 1NEZA 3W1ZA 1F11A 4CSPA 4PYHA 3BUDA 4FQXC 2WK2A 5TK2A 2PXYB 3DX8A 1TJHH 1WV7T 4HHWA 3IF1B 1IBGL 5JW5A 1QFOA 4ZT1A 4A7VA 4Y5VA 4LIQE 4L37B 3ARPA 2EEDA 4IJTA 3W9EA 4F27A 4J8QA 1AJ7L 1XCQB 1BEYL 1SM3H 4N68A 4PVNA 4IOIA 1XMWA 1MJUL 3G04B 5K5YA 1WC7B 4X4XB 1HHIA 2AAAA 3FUEA 1SPDA 1HOCA 2WBWB 1IGMH 2VDOB 5T33H 4KZDL 2ZX8A 1OCWL 4EKJA 5BVPL 3PNWB 1RIVL 4YGVB 5DJCB 3RWIA 3DARA 5BZDA 3NJFA 4EIZC 1E8WA 3BZDA 5F88B 5EOQH 3BQUB 2X70A 4DN3L 4IJ3C 4XO4A 5TDPA 4LQFL 3VNZA 1IBZA 5C7ZA 1NQBA 4PY8I 4LF3B 1T66D 3ULUF 3QG6A 3VW3H 1JG9A 4N26A 4XXCA 1CLZL 1ZV9A 4V2CB 1XDTT 4CAGA 2G30A 3MNVA 5EUOF 5LBVA 3RILA 2PPEA 2EC9U 2WWKO 4WTWA 3HZ3A 2B14A 2ZNXA 4KMTL 4XP6L 3GSOB 5FM4A 3X3FH 4DQOL 4X9FA 5DUPL 4UT6A 4J6RL 1OTSD 3GI9H 5CNHA 3SODB 3UO1H 4UNUA 4B7LA 5JIMA 2YD1A 2AQQA 2Q3XA 5D1ZI 4PHZA 1XF5A 1REIA 5DD5H 4PJ7B 3D0VA 2LE9A 5JW4Q 5J7CC 5LDUA 3TEYA 4TUOB 5DZLA 2ERJC 4L8SB 4OZ4B 4NLAA 4FA6A 4AEHL 1MPAH 4KJQC 2VL4A 4H8PA 3EGXA 4OM1H 4FERA 1N12A 3O9WD 5C0CA 4WNQA 5AOJA 3OAZK 5L7XH 3ABLB 3RVVD 4UT9L 5DT1H 2UZIH 3QIBA 2HRLA 3CWGA 1LEKA 3B34A 1CTMA 1WS7A 1AHWB 4P2QA 2A1WH 2IGFL 5E8OA 3CLWA 2R2EA 43C9A 4U1MA 3O3EA 1JGEB 1G7JA 1FO0A 4GKOA 2EDMA 4OFPA 1AHMA 4CADB 3V5KA 5EEVA 1LWRA 2FVNA 4OZFG 1T5XA 3Q6GH 4P2OC 1ROWA 4PREB 1AFVH 2QVKA 1I7RA 1NMAL 4N8CH 4NSKA 5E8NA 4GINA 1EO5A 2BVUA 4NXKA 1G1CA 2E76C 4JO2H 4WTZG 4WSGA 2WBJA 4BZ1L 2BNUA 1XB3A 4AUUA 3IRPX 4LXFA 4M43L 4ZK8A 1BOYA 1JSYA 3SD5A 2XWTB 4UMSA 1TSRA 2G0LA 1F4AA 5INCB 2R1YB 2X4RA 5GRZA 2HSIA 3ZR5A 5D9SA 1JDCA 2XV2A 4FMVA 4EO5A 2V4LA 5D1XD 3U7WL 1U8MA 3TO2A 3FYIB 4QTHA 1YMHB 2ZKXA 4LDLB 1FFNA 1WG3A 2CDGB 3II3A 1FVEB 4Q9BA 5C92A 5IFHH 4Q2ZB 3DX2A 4GRWE 3ZL4L 1Z9SA 2WXGA 1RUAH 5DD0H 1MCQA 2AGJL 2HTLC 3P4MA 4GXFA 5DK2A 3U9WA 1WBXA 5CFHA 1VFBB 5K9JL 3O3AA 1J48A 1EEQA 2IIJA 3VD7A 3F12A 4UV4L 1TTCA 4JRXE 3OWRA 4S0SD 2BW5A 1M3IA 2R0WL 1KGXA 3CHQA 3M7FB 1MLCB 3M46A 4O4YL 4PJIB 4B95C 4Z78A 1OT4A 4WFHD 2IG2L 2JELH 2W94A 4KQ4H 2Q8AL 2OMUB 5DI8A 5AAWC 1F5WA 1BGXH 1OP4A 3WTXA 5D7HA 4Y5YA 5LG1A 2XA8L 3EHBD 1D5IL 3N40P 3QXAA 2VISA 2XQYG 4NO2A 1DO6A 3EOBA 4Z77B 1KTBA 2X4OA 3DVGB 1N2RA 4GP8B 1DLFH 2H6OA 3NIDE 5FYKE 1AXTL 2AJSH 5CZVH 4H8WH 3W9DA 3GSUA 2Y2YA 5EU6A 1DBBH 4ENED 5SWSA 4PJ6A 1CLVA 5J13C 2HFTA 3HG1A 3BQUD 1QSEE 2FIKA 2MTAA 2R4RH 3GRBA 4HH9A 4GH7B 5EZLA 3SDXE 4XNYH 2IQ9L 5C8JB 4KJWC 3BI9X 4N0CC 4XXWA 4WV1B 3CBKB 3RDTC 4PMFA 4ZSOB 5CWSB 3ZE2F 5BRZD 1TYEB 5DUMH 2VERN 3SZKC 4BZ1A 2ZCKL 5GS1B 4R2GD 5DR5H 4WI4A 4NUJA 5F1IA 1DHKA 4PHXA 4MQSB 2NDGA 3LEVH 4AE0A 4LOVA 1A1MA 1LO2L 5D1QB 5JZ7C 4PP1C 3C6LA 3HZMB 2VN7A 4M62H 3NFPB 1AE6L 1HTYA 4OKDA 5EB9A 5EO9B 3GSQB 2OMBA 4ZNEA 5J9PB 1NUFA 3BPCA 5I1GH 4E9YA 2J8OA 4WHTA 5E23A 4WEBL 3DUHA 2NUPB 2Z8WC 2CR6A 3QT2A 4NRYB 3PF2A 1HESA 2LU3A 1CDUA 1T3FA 1TETL 1NIAA 5GSRA 4NQQA 1TJGH 1M71A 2EDDA 3KLKA 2GFBB 3WEOA 5K9OB 1CK0H 3FSZA 3HNSL 4I13B 2EUXA 1X5YA 1PKOA 5CUSL 5E7FA 4I0PC 5CEZD 1YY9D 3LH9A 4XVJL 4UILH 3RTLA 4UNTA 4Y1AB 3ZE0B 4GUQA 4WEUD 4A7TA 5A2IH 2W91A 4YVNA 5A3IC 1GHFH 2J6EA 5JQIB 1FYHB 2GVYA 2BOBA 2OBGA 1A6WL 4YHIB 2ODIA 5AZEH 2PP7A 1HQRB 4W9KC 5DWUL 2GTZB 3NCJH 1AE6H 3EGDA 3OKLA 2UWEB 3X2QB 5DDHA 3BP6B 3FFDB 3CK0H 1MKFA 4GO9A 1O6VA 4GMTL 4DOHE 2C4FU 3UBXG 2ZUXA 5B1CA 2A4ZA 5F1NB 5T1KB 3HI5H 4HWEL 3W5MA 1WHOA 4PLJC 4U1SB 3KPRB 4PVBA 5T8IA 1TJIH 5D5MB 1LEIA 3ULSA 3NRQA 5B4MD 2OYLA 3HI6H 4JFDD 4LEXL 3G3LA 3ZLQC 1C1EH 2R0KH 3ZT5A 1CBVL 4NERA 3VXQB 1XD1A 1J1OL 4L4TE 1SLXA 4BQ8A 4P57A 1WRFA 2MSPA 1FL3B 2LR4A 4UT7L 4WWPA 4H8WL 5FYLD 5FWQA 4N5EC 2Y1YA 4HUWB 2VSKB 1DLFL 4A7QA 2ICWJ 5EPMA 5FIEA 3APMA 3KH3A 5EU7C 2BHYA 2QFRA 3B7SA 3HB3B 4IRJB 3U6XA 4IGBC 1K8DB 1NCOA 2XA8H 4KV5F 4LLYA 2EDKA 3CLEL 5F9OL 4OJFL 4FQQB 1BLNA 1PAMA 2O93L 2QVIA 4P5MB 5JPNB 2BFGA 1YA5A 2JELL 4KQ4L 3FONA 1K4DA 4OV6F 2PTTB 5AYTA 4F8LA 1ICTA 4FQJL 1DQIA 5HJGA 5ADPH 3FTXA 3GSVB 4CGUB 4OZGA 1FH5H 4JG5A 4C47A 5EEZA 3D2UB 1BIHA 5CZXD 4D8PB 2B3IA 4KKPA 3IDUA 2DL2A 4ODHL 3ARDA 3QORA 4UV4H 3HVDA 4PJDF 4MCNA 5EIIB 3S8GB 4PUBH 5HDLA 4FE9A 1T0MB 4KFZC 4M5ZL 3QDJB 3VGDA 5K9JH 1BVKB 4NQDE 4IBQA 4NI3A 5DD0L 4YEFA 2OXHB 4GFXA 1AD0B 3OAWA 1FC1A 2GTWB 3S36X 3JUZA 4PIRF 3TN0B 3ARED 4LASH 2H32B 3ZTEA 2N0MA 5HYEA 1GYWA 2YZ1A 1D5BB 2DQHH 2IAMC 5D5ME 3OV6A 3U0TA 4QHLA 4JFDE 2OMWA 3ESPA 1QHOA 3FF8A 4QLRA 1R47A 1HE7A 5ADOL 4GSDL 4EI5C 3NK3A 2ROYA 3DIFA 1ID5I 5D7EA 5D8JL 5T5FL 1H9DA 1IGYA 5AVXB 5F89A 5IHWA 1SN5A 4QTIL 5DRNA 1TQCC 4AYFB 5FGCB 1O7DC 1DANU 1AFVL 1F6FB 5HY9B 3WE6A 2HLAA 1QO3B 5IBTL 2F2HA 4R2GC 5GRUL 1YJDL 3VI3A 4RFOH 2KDYA 1UOLA 2ISDA 4LIQH 1JZ8A 3B9EA 1RK1B 3A6BL 3QRFM 3B2UC 1E8YA 2WCSA 3MCLH 3PNWA 2ATAA 3UOAB 3IU3B 3OR6A 2FO4A 4G9DB 5EO1B 4LSVH 1RKRA 1DFBL 3GZOA 3C12A 5LVEA 2FX8L 3X11B 4GXUM 1FN4B 2DQIL 5EA0H 1B9KA 2DYRB 3DX4A 3EBAA 4DO6A 2NY6D 2V2XA 3FO9A 3OAYH 4IBWA 3OAZH 3GZPA 5HVHC 3NSXA 2P8PB 3EJTA 4BFIA 3EDEA 3GSOA 3E6FB 2MH4A 3QJSB 2YO3A 1UURA 2XIDA 3DUUA 2H6UA 2WWMC 1TVHB 1OTSC 2R9HD 1E4KC 1JI1A 2AQ2A 3VXPB 3BFQG 2DMHA 5FX3A 3IM1A 3UTPE 3QUMH 5C7XL 4WO4A 2DH3A 1KIPB 4Q9CA 2H2SD 2JF1A 3P3SA 1KXQE 3APCA 2WCGA 3K80A 2WQRA 1KCSL 1EHKB 3BDBA 4XPGL 5F93C 2F53E 1T1XA 2A38A 1HEZB 2NY2C 1ACYH 4JVPA 2WZAA 1YC7A 2XKNA 5BQ7B 3RVVC 2FO8A 3OQRA 1MIML 1AHWA 4W9DC 5T3XD 5DD1L 1OY3B 4IIQA 1GKEA 3Q2VA 3B9KD 2E7HA 5TQ0L 2NCEA 4KZDH 1P2CA 3H7LA 4HCGA 2CJUL 4X4ZA 1T21A 3O2VL 2P28B 2WVVA 3GBML 4EOWH 4F8PA 3P9MA 4RISH 1BLIA 4U1NB 2UUDH 1IFHH 2IPUG 3FTWA 2O61A 5GGTA 2JCCE 2D3LA 3LXBA 4JHZA 4BINA 4PRHB 2X9WA 3GM0A 3CHPA 3SEPA 3WUWA 4CVXA 3TIDB 3LKQB 5BRZB 1GI