2Q9OA

Near-atomic resolution structure of a melanocarpus albomyces laccase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
559
structure length
558
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title A near atomic resolution structure of a Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 182
structure length 558
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q9oA03
3EH3B 3T6WA 2CBPA 2YAOA 3FSWA 4G71B 3WIAA 5B1AB 1WAEA 4YSEA 2CJ3A 4WKXA 4A2EA 3WNIA 1AANA 1WA2X 3QJVB 1M57B 1DYZA 3IN2A 1AQ8A 1EZLA 2YAFA 4ENZA 2AFNA 2XV0A 3OMNB 1AR1B 1ID2A 3L45A 1JZEA 2VW7A 4QKTA 4YVNA 3NSCA 4PCYA 4YSUA 4JKNA 1FWXA 2IWEA 1E65A 1W8EA 2FWLB 4BDVB 4KO5A 8PAZA 1BQ5A 2B08A 3EF4A 3FYIB 3GYRA 3FPXA 5EHFA 2YAEA 3PAZA 5IY5B 1QHQA 3GXUB 5B1JA 6PCYA 2W8CA 1EHKB 1NTDA 3JTBA 5B7FA 4A2GA 2J5WA 4DP5X 3BQVA 1AS8A 2Y69B 2W88A 2AZUA 2FTAA 3T71A 1HAUA 4AI7A 3ABKB 1JXFA 2E86A 2DWSA 4AKQA 2BP8A 2BZCA 2EIJB 3IBOA 4HIPA 3ZIYA 3OD3A 1J5CA 2B3IA 1AS7A 2YARA 2Y1AA 1VLXA 5LDUA 1AZNA 2UX7A 2AANA 3FU9A 2PP7A 3OMAB 2JXMA 3D12B 2TSAA 1X9RA 4G7QB 1AOZA 2J55A 2WO3B 5TK2A 2FQFA 1NIFA 4ZK8A 2A3TA 2IH9A 2UXVA 4GP5B 2VMJA 2GSMB 2NRDA 2I7OA 4Q8BA 1ASPA 1AIZA 4E9TA 3AY2A 1SHXA 4K9JA 2YAMA 3NT0A 1GS8A 1BAWA 1ETJA 1XMEB 1A3ZA 5B1KA 2BW5A 3HEIB 2XXGA 4YSCA 1CYWA 3NJFA 4YSRA 1JERA 1OCZB 1OE2A 1OF0A 2GBAA 3SBRA 1NIBA 1BXUA 4KNUA 1ZDQA 3JT2A 3PXLA 1L9OA 2JFCA 3NJGA 5AKRA 1ILUA 5F7BA 3BVDB 3S8FB 1OCRB 7PAZA 1NPNA 2VN3A 1XB8A 1A4AA 3T9WA 1KBVA 4E9VA 1AACA 1GS6X 2PPCA 3QJQB 4DP0X 1PF3A 1SDDA 2DV6A 3WKQA 1NIEA 4DP9X 2GB2A 3TBCA 1N68A 4AZUA 4YSPA 1ZPUA 1KBWA 1GYCA 1WA0X 5A7EA 1PZCA 5I5MA 4DP7X 3PAUA 2FT6A 1OE3A 3NJJA 9PCYA 3AG2B 3MBWB 4P5SA 4GYBA 1SJMA 2P80D 3QJTB 3RYMA 2AVFA 1L9PA 1WA1X 2CALA 2PPFA 1HFUA 1JZJA 1A4BA 2VM4A 2I7SA 3IN0A 3QJRB 3S3DB 1TKWA 2HRHA 1GR7A 2DWTA 1FA4A 1JVOA 1PZAA 2TSBA 4YL4A 2PCYA 2UXTA 1OCOB 4AKPA 1SFHA 2PPEA 1PY0A 1IC0A 2YQBA 2HX9A 2YXWA 4BDVA 3FSVA 4GP8B 3OM3B 4DPCX 1NWOA 3ABMB 1A65A 1QNIA 1URIA 1AZBA 2XXFA 3FQ2A 1WS8A 4YVUA 3CVBA 1NDTA 2BZ7A 1W6WA 3FS9A 1ADWA 1DZ0A 1SFDA 5AFAA 2PCFA 3NSYA 4DPAX 2CCWA 5I5IA 5PAZA 2PP8A 1J9RA 4G7RB 3ABGA 1JZFA 5B1BB 2J57A 3KW8A 2BHFA 2BWIA 5PCYA 3T6XA 3OMIB 3H56A 1KDIA 2HRGA 3V9EA 2BWDA 3ZDWA 2H47C 4UAHA 3X1GA 3WKPA 1AS6A 2VW6A 3S3BB 4NAJA 3TA4D 2ZXWB 2RACA 3C75A 2CAKA 2GHZA 4DP2X 3NYKA 4YSTA 1V55B 1A4CA 2DYRB 5D4JA 5I26A 2YAHA 2FQEA 1JZIA 1PLCA 1NINA 3QQXA 2VM3A 3HB3B 4A67A 3FYEB 1OE1A 2QDWA 2QPDB 3DKHA 4Q89A 2XV3A 2PLTA 1OCCB 1MZZA 3GDCA 2X88A 1AZRA 2FT8A 3NSDA 4BXSV 2BO0A 4WTQA 2XU9A 3CVCA 1V54B 3NJIA 4DP1X 4A2HA 2OV0A 4TXVB 4BXVA 3V9CA 1BEXA 4HHWA 4GXFA 4G7SB 1TEFA 1SHWA 1RZQA 4FA7B 2VSMB 2UXFA 1L9QA 3FQ1A 1MDAA 2BP0B 2GC4C 1PMYA 3X1FA 4YSAA 5I5JA 6PAZA 3WG7B 1PNDA 2IWKA 3S3CB 4GP4B 1FFTB 2H5UA 4G70B 2IWFA 3AZUA 2HX7A 3EH5B 1NICA 1PCSA 2MRYA 2VW4A 3G5WA 1L9TA 3KW7A 4FAAB 1NWPA 1IKOP 4AKOA 4E9RA 2WO2B 3PCYA 1XB3A 4JHUA 5D4IA 2MTAA 3T6ZA 1L9SA 3AW5A 2FJSA 3X1NA 4KOCA 4UANA 2PPAA 3UGEA 2IAAC 1OV8A 3QJUB 2QDVA 1ASOA 3AG4B 2ZWNA 1X9UA 2GI0A 4BWWA 4A68A 3PLYA 1MZYA 5I28A 3UABA 2HXAA 2OJ1A 1PAZA 3MX0B 2ZOOA 1JXDA 3FSZA 1SF3A 3IEAA 2AZAA 5FC9A 4CSZA 4BWUA 3FU8A 2EIKB 1ET5A 1IBZA 1M56B 2HLEB 3EHBB 3SBPA 1AZUA 2PP9A 3NP3A 1L9RA 2IDFA 1NIAA 2VSKB 4F2EA 3FU7B 2J56A 4KO9A 1BXVA 2GC7C 1R1CA 2XX0A 3N55A 1KCBA 3CDZA 1J9TA 1MG3C 1W6LA 1J9QA 1A8ZA 1ZV2A 2PPDA 3X2QB 2XV2A 4HHGA 5I6KA 3ABLB 3CDZB 1KGYE 1JZHA 3S8GB 2OCCB 2UXGA 2R7EB 4MFHA 5I6OA 1BYOA 1TU2A 2ZONA 1HAWA 5I6NA 1GSKA 2DYSB 4HZ1A 3U25A 1CYXA 1RCYA 1ZIBA 5B7MA 2XUWA 2FQGA 1YLBB 3FQYA 1SNRA 4QLWA 1ZIAA 3NSFA 1OOWA 3FT0A 3X1EA 2XX1A 3CG8A 3TASA 1CURA 1M9WA 1RZPA 3NJNA 3AG3B 3DTUB 2N0MA 1JVLA 3ASNB 4YSQA 1KYAA 4F7KA 3CVDA 2EINB 4W1TA 1CUOA 2LLNA 1IUZA 3UAEA 1T5KA 2QT6A 1JOIA 1I53A 1GW0A 2FNWA 5I6PA 1NIDA 1V10A 2JKWA 2Q9OA 4YSOA 3T6VA 3OQRA 4A2DA 3PPSA 5ANHA 3TBBA 1E30A 3NJLA 1ET8A 4M3HA 4NB7A 4AX3A 1KDJA 2HZHA 1J9SA 4HALA 4YSSA 4RH4A 1GY2A 1F56A 2XWZA 4UF7C 1BQRA 4A2FA 1E67A 3EH4B 3NP4A 5B3SB 4NERA 4L0PB 4KNTA 1PNCA 2BP8B 1SF5A 1ET7A 4PAZA 2BP0A 2GIMA 3H4HA 1GY1A 2WSDA 4E9WA 1GS7A 4DP6X 4E9XA 2YXVA 3AG1B 4M4RB 3QPKA 1WS7A 1BQKA 4KO6A 3NJMA 3UADA 4E9QA 3NJHA 2IDSA 2IDUA 1JZGA 3UAAA 3TU6A 2HX8A 2UX6A 1BXAA 2IDTA 4N4YB 4DP8X 2EILB 2FT7A 4HCFA 2X87A 2XLLA 2H3XC 3ZX1A 4F2FA 3FPYA 1PLBA 7PCYA 1CC3A 4DP4X 3DIVA 3QJSB 4KNSA 3ZBMA 2I85A 2IDQA 4KO7A 4E9YA 4EF3A 1KCWA 1N70A 4HCIA 3SBQA 1AZCA 4HAKA 3UACA 1BYPA 1XB6A 2EIMB 4KOBA 2YAPA 1NPJA 2CUAA 1KV7A 1NZRA 1E5ZA 1ZDSA 3H4FA 3N2JA 3ASOB 2XYBA 2YAQA 3WNJA 3X1BA 1AG6A 4N8UA 4YSDA 1PLAA 1J5DA 3CZUB 3PAVA 5TK4A 1MG2C 5I6LA 4G72B 2Q5BA 4P5RA 5D4HA 2QPEB 4BK5C 2DY2A 5E9NA 1B3IA 3FU7A 5F7AA 2IH8A 1IBYA 5AZUA 1JXGA 3ERXA 3IE9A 5I6MA 3NJKA 4E9SA 4GY4A 4HCGA 5B7EA 4JHVA 1AAJA 2P80A 1SDDB 2FQDA 3FSAA 1UATA 4X4KA 4DPBX 4BWTA 4CSPA 1ILSA 1AG0A 1E5YA 1ASQA 3WI9A 1QLEB 2BW4A 2R7EA 4W9ZA 2XVBA 1PZBA 3SQRA 1RKRA 4A66A 1TEGA 5B1JC
chains in the Genus database with same CATH superfamily
3GBLA 3WEXB 3VX1A 5CGYC 2R9HD 3K4DA 4JGMA 4X0KB 1NCGA 2EQDA 1U8HA 4YHZH 1DVZA 1IRAY 1DQMH 2QBWA 4UZSA 2UWEB 5FEBA 5CLYA 4QO1B 4WKXA 4WNQB 1I1RA 3IETA 1L3NA 3HZKA 2VDKH 4R0LA 2X7LA 4QHUB 4PWJA 4XN8A 2VL4A 1KUMA 1FN4A 2F2HA 4I8DA 2PWDA 4MD0B 1WEJL 5DMIL 4PW9A 4EDXA 1KIRB 5AVRB 5BV7H 1GGCL 1XIWC 1BQ5A 3PNWB 1WZ1H 5D1XA 1VGKA 1U8NB 3ECWA 4N0CC 1O6VA 4Z6AT 4LAQH 3VXSA 4HC1A 1KGJA 4WHDA 4MJ6B 4WWKA 5DJYB 4WI4A 4F5CA 2V5MA 6PCYA 5KBDA 2XWCA 5KVDE 2X6UA 4G6AC 3UG4A 2NY6B 3KH3A 1NCWL 3QUMB 2Z35B 4RIRA 4XBPA 5TDPA 1AS8A 1NBVH 2PW1B 4TS6A 4KH2A 5LBSA 4AH2A 2C7UA 2ICCA 2MWCA 1HAUA 4MQ7B 3TBSA 4XPGL 3VFPA 4HKXB 2KDGA 5D2LF 1ZD6A 2NY7H 5C6WH 3DVFA 3PF2A 2VDQB 4HWNA 4TLKA 4JPKL 3DGCR 2PO6D 2FDBP 4Q0XL 1YUKB 3N41F 4NQDA 3SHSA 3QO0A 5IWLC 3U0PA 5IV2A 2F19H 2VC2L 1X9RA 5D7LA 4KI1A 3D39B 3CMGA 2WO3B 3I74A 3FF7A 1QSFD 3UEQA 4DZ8B 1XF3A 4IIQC 1DBKL 1RVFL 4FYSA 4MZ2A 1MIEL 3IF1A 4PJGF 2B16A 2DM3A 4IDLA 1VB9A 1XF3B 2CPCA 3RZCA 1RHFA 2YAMA 2P24A 3QW9A 5HYSA 3WL9B 1GS8A 1HHJB 1BAWA 1JIBA 3DJRA 3PV7A 2EYSA 3U1SL 4PJDF 3G04A 1NCIA 3D0AA 1DBML 4JHBA 5C0IA 1P0SE 4BD4A 1CYWA 4WTWA 3CVHB 3NJFA 2E0PA 3K2KA 4BFIB 2FYYA 2X1WL 1T2XA 3MXVL 3BSGA 4Q97A 5BS0A 5I0WA 5I1LA 4H8WH 1DFBL 1KTKE 5DUPL 1JYXA 4I0PD 5GZNC 3B9KD 3SBWA 4E5XB 2MNUA 1WFJA 4IMKC 5DD1H 5BS0B 1OCRB 2ZCKL 1F8TL 1U8OA 3MLZL 3MUGB 2NR6A 2LTQC 1Q9OB 2J1YA 1WP6A 4ADGA 4PMFA 3DIFB 4PRHA 4ZFOA 1TYRA 2CDGA 1GS6X 3OLGA 3Q44A 4GRLA 4X98A 2PPCA 5FWRA 1HYSC 2H32A 4QWWC 1PPIA 3IJHB 4L1BA 4LCWD 4ZFOB 4X8GA 4ODTL 1V27A 1OM3H 4DP9X 2H8PB 3OZ9H 4M8VA 4WCYH 3EHBD 4MXVE 1Y18B 3RBGA 1HILB 2H32B 3D2UA 4WW1A 1IFHH 2JQMA 2VXSH 1EWHA 2YMOA 4OZGF 1UH2A 2OYMA 2VUKA 3O6FB 5A7EA 3HUJA 4YFDB 5HHNB 2X1XR 4J3OF 3D2UB 2ZWSA 1HT6A 5IBUG 1C16A 4OT1H 4PJ9C 4QGTA 1QABA 3FO2A 5KOMC 3MZTA 1S3KH 2AVFA 2DQGL 4LPCA 5T3XD 1S9WA 4Y4KD 1N64L 3ARFA 5AVWB 3SODB 5J1AB 2ADJB 3EAKA 1FBIL 4FF9A 4OLYL 1MFNA 5K39A 1A2YA 2EDJA 2E7BA 3MV9A 3HAEB 4L4TB 2YKKA 3D9AH 3QB7C 2JQAA 4P3CH 1SVBA 1BZ7B 4FG0A 5FDYA 3MV9B 1Z3RA 3DSFL 1UKSA 1S7VB 4XB8A 4IGBA 2JJUA 3BEVA 3H2QA 2OCJA 4POUB 3UDWC 4NQEB 3HC4H 5AW2B 4K8RC 3F7KA 4JVUA 5F7MC 1RPUA 3LSOA 4PRDA 1SEBA 3HE7B 1T4KA 2EDBA 2ZSVA 5FA4A 1R47A 3B8SA 3LD8C 2DQTL 4DO5A 4NQCD 2A6DB 2PCFA 4BFEA 2CBQA 2DKMA 5DHDA 1BAFH 2E76C 4M6ML 1X5JA 4NQXA 4H8VA 1PU0A 5E8PA 2D7PA 2IWGA 3Q0HA 2C4XA 4QAMB 4APXA 5E24E 1M3IA 1JK8B 3QUXB 4YDKL 3OF6A 1P5UB 2Y7MA 4PR5B 1KDIA 3L5HA 3ZE2B 2OMWB 2V6HA 5C0FB 2H6PA 3GM8A 3IVKA 1G1KA 4MS6A 4XX1G 1TQBB 1NGXB 1JPGA 3OF6D 4IJTA 3S3BB 3SQOH 3S3SA 3BP4A 4HS6B 1Q9WA 1BZ9B 4J3TA 1V55B 3MLRH 3B43A 2QTEA 2ZYSA 2A1WH 4MZ3A 4BFFA 4MCMA 4GG6F 2HJLA 3QG6B 4U1GC 1F11A 2XIDA 2KS0A 5I1GH 2J7LA 4K3GA 3HB3B 4BSVB 4LESA 1B88A 3T4AA 5C6TL 2AQQA 43CAA 4Y4HA 2NX5D 5INDB 1JYVA 2QR0B 2IBBA 2VXTL 1MZZA 2VOTA 1NGPH 4UTAA 1ZMYA 2QVTA 4BXSV 2YR3A 4OZIE 4OZHA 4X99B 3JSSA 1QR1A 1F2XK 2RTTA 1X5FA 3KXFA 2DWEB 4XNMA 4BXVA 1F4WL 4WW2C 4U3SA 5DRNB 2WCSA 3QJOA 1I7TB 1QR1B 2O26U 2VSMB 2UXFA 3H42L 2BP0B 2HAZA 4MA8H 2XETA 3ULVE 4UNVA 4G9FE 4U3SB 1DUZA 4AGPA 1MAMH 1JPST 1NMCC 2IWKA 4QHLB 2AJYL 4L5FL 4EXPX 1FFTB 1TTAA 3WS6C 3QG7H 1U6AH 4MWFA 3DMMC 3EDDA 4G8IA 2X6VA 1EAQA 1NEZA 3QDMD 3WMPA 3GMPB 2VW4A 1T1WA 1Q0XH 3PWPA 4FAAB 1L7IH 5BRPA 3WY3A 5TQ2L 3V5HA 3HR5B 3L5WB 1QZ1A 2B9BA 1T1WB 2VL5A 3K72B 5DRXA 4JN1L 3TIEB 2VLJA 3TZVB 5F7HA 3JZ7A 3QA3A 3UZEC 3MRBB 4J4PA 5HY9B 2D0HA 2VL5B 1LO2H 2X2HA 4YL9A 2D3LA 4MZIA 3M46A 2G3NA 2GI0A 3CC5A 1CDJA 1UA6L 4LHUB 1BD2B 3S35H 3VX0A 3L4VA 4I5BB 3JVFC 2HXAA 4MJHA 1MCOH 4JPWH 5F7KC 1YYLH 4AMKL 4MJID 2BX5A 3R19A 1RPKA 3ARDD 5K59E 1GOGA 4E0RA 2BOCA 4XO5A 3LIZL 3ZVVA 3PQYB 3AADB 4P2RB 4LSVL 5F3BB 2ZX9A 4WUKH 2NNAA 3LQAL 4QRBA 5LVEA 5IB5A 1ZV9A 1R6VA 3VG0L 2QGCA 1VFMA 4B41A 4CUCA 1R1CA 5FV2A 5EFIB 4A37A 1U92B 2XPYA 3W82A 3Q3GB 2N59A 5BZZA 4RRPG 1A0QH 2ISDA 1LE9B 3TBTA 3TX4A 5F1OB 2R7EB 2K45A 1HKLL 4Z7QB 4YIQB 1ZEAH 1Y7VA 2NTSP 4KXCA 4PRIB 5ACZA 5EOTA 5AOKA 5CZRA 4DEPC 3MOBH 3DGDA 4LCIH 3NSFA 3D3VA 1OOWA 5EU5B 2ID5A 1G7PA 3H9SA 3OBAA 3SOTA 4M5SA 1F90H 1ZVSB 2AXFB 3LPOA 2MEJB 2XX1A 4ZFFA 1OSZB 2WINB 1FFQA 4ZFGL 4AVKA 4CVWA 3G6AA 4TQPA 4MKMA 2A9ML 4W6YB 5A43C 3SKOA 3G7TA 4X6CA 4WFED 3IJ9A 3ZSTA 1A9EB 5GS1C 3IJYA 1BFOA 5MERA 3ATEA 1S78C 4KGLA 2DMHA 1QW8A 3LHPH 4E41B 3UTTA 2G0LA 1SDYA 3MRNA 3OQRA 5HJ3B 1YMHA 3UTTB 3F01A 3F5WA 4UI2A 1AP2B 4GBXD 1FSKB 4PP1D 1MFMA 4ZPTA 1XR8A 5T5NF 3MRNB 4MS8C 4YSSA 4NO0B 3HPLB 4RNRA 4UB0H 4UF7C 3P2DA 3TV3H 4HYTB 4PJGE 2EDEA 3BN9D 5EBLB 2J20A 3MFFA 3WTWA 5D7IF 5KSAD 4TQHA 4XNQB 3ZHDA 4E2OA 1GCFA 1SXNA 4NBYB 3N0AA 4G6KH 4XE0A 3RHWK 4X6FA 4YWGL 1P1VA 3QCTL 3MFFB 4M4RB 4OI8A 4QRPB 3HKFA 3HNVH 2G30A 5DO8A 4ODXB 2B8OT 4IU2A 4JAMA 3RJDA 1JV2A 3EBIA 1NBYA 4JN2A 3PWVA 1DSWA 5GRJH 5T33H 1WC7A 3VQ1C 5D93B 4GH7B 4LSRH 4ZW6A 2BCMA 3WXVH 3DV6A 5AOZA 3M8OH 4F2FA 1OF2B 1OO2A 1RZ8A 3MRDB 3HNSH 4JN2B 3K5SA 4LSTL 4DESA 1A7QH 4DP4X 3CPLB 3BHBA 7CGTA 1AMXA 1CFNB 2H41A 1EAJA 1GOHA 3DV6B 5GJSL 3DETC 2WMPA 3K2UH 4FL4C 4FNLL 4JY6A 1S7RA 1P84J 1U3JA 5FAAA 4KAQH 1OB1A 3ZE2F 2F7RA 4JY5H 4PJHA 1NZRA 3ME0A 1QI4A 1KPVB 4CADA 1FJ1A 5JLZB 4EMZA 3MX0A 4FFZA 2HPOA 3X1BA 4GAGH 1PLAA 1E4WL 2NQDA 4W4OC 2V5TA 3SQBB 2RH0A 1DJYA 4QRQB 4PW4A 2WXRA 5F1IB 5I16A 3GUTA 4CADB 2WK2A 3DUHA 1RULH 1QO3B 1K8DA 3RWDB 4XNUL 1JNLH 4GLRH 5T3ZL 4ZZKA 4Y5VC 1B3IA 3L1OH 1K8DB 3POHA 2K70A 3CVIH 3QRBA 3RGBA 4JY4B 2HT3C 4ONFL 1SJEB 4QCIB 1RJCA 2YPVA 4NZDA 4JR9L 3BGAA 2IALA 4BINA 1UT9A 1DANT 4G7YL 2OK0L 1BW8A 2F53E 1N8ZA 5SWSB 3PGDB 1LD9B 2DLEA 3FC8A 4DFIA 2IQ9L 4LOUD 1H3PL 2J8OA 2ESVE 1Z5LB 2E9BA 5GZOD 1OP4A 1A7RL 2WKGA 4PV9B 4YBLB 5SX4H 5A16A 4FTVA 3G6JA 4KBPA 2W9EL 4KFMA 1KJMA 3LQMA 2IH1B 3K5RA 1MJUH 4A7UA 2DQEL 2EKSA 4K73A 4JFDB 3MCG1 3DC0A 4ZUTA 1GPOL 2P7TA 5FF6A 2ZOKA 3UTSE 2CIIB 2FATL 5AQ0A 3VXQA 3SD2A 4KTGA 1EXUB 3CBKB 3JTTA 3L45A 2Q2EB 4FZ8L 3AXHA 4PB9H 1B0GA 4NKOA 1WBYA 4OLWH 1P4LB 1G7JB 3IRCA 4NJAH 2WWNA 5F6HJ 1GTNA 4N2AA 4G1EB 4UU9B 2X28A 1A66A 4P5MA 5B39G 3NIDF 5LNDA 2Q7YB 3GUFA 2WNXA 1OAYL 3RX5A 3VXNB 2XG5A 5B1JA 2BC4A 1XD1A 3K6FA 1X5KA 2NTFB 2XVKA 1CU4L 5HYQB 2WXOA 3MREB 1KOAA 2Y5TA 5K1JA 3SD5A 2JKNA 3OKOB 1AXIB 4PLKC 3P3YA 2OA9A 2GIYA 1ZS8B 4N2MA 2LAAA 2D8KA 1RLBA 3PP4H 5FS5A 1VLXA 5HGHA 2OL3A 5DEGB 3C9NA 1G87A 1J18A 4K07A 2JXMA 1XIWA 2UWEE 2QMJA 3AREA 5LXGH 1K2DA 1E8XA 1FPTH 3V0AC 2X3AA 5CS7A 4FG6C 4TRPL 1BM3L 4JL1A 1TJHH 4GP5B 5JORA 4YGVA 3WLBA 4HDIA 3O2DH 1S9XA 1K2DB 2VXQA 4I77H 4JZOB 1QR4A 4Z7QF 5IHUH 3L5XH 4C56D 1BQLL 5JORB 3WFCH 1VGEL 2X0VA 1HWGB 2BVEA 25C8L 2J88L 2WAQA 2Z93B 2Z4TA 2E7DA 4HDIB 4JS7A 5E1IA 3HTLX 4C47A 3FQXA 4HFWA 4HGWB 3CIAA 3EFDH 4JK0D 1JRHL 3KYNA 3T2NL 3VH8G 4BHUI 2VH5L 4PWEA 5D1XE 3FQXB 1OF0A 2A0LC 3VXSE 5GRWA 4M03A 4HPOH 3S88H 4EPSA 5JIHA 2Q6WA 1MEXH 2CKBL 1E4HA 4Y5XB 4YDLC 1EEZA 3G5XA 3FT3A 3FOMB 5IOPB 1KCSL 3HBGA 5AG8A 1HJCA 3Q5OA 4H26B 4HXBL 5AKRA 4MNQD 5F97E 2E9WA 4ZOCA 1S7SA 3MJ7A 5D1ZD 1T1ZA 2WYZA 1AGDA 1A4AA 1WISA 4UQ2B 3QULB 3W3BA 1XGPB 1E0OB 3JUZA 4IIQB 2X4RA 4H13C 3DO7A 3AB0C 4B27A 2CK0H 1VFBA 5EC1B 3BSZH 1QFOA 1A7NH 4DP0X 1M7IB 3L08A 2VZSA 1JPSH 5ILTH 1I75A 1LEKA 4X7DC 4W9EC 3TYGH 1IBGL 3TBCA 3AU1A 3PABA 1N68A 1FGVL 1X5GA 3BC9A 3E8UL 4U0RB 2Q8AL 4XTRD 1GYCA 1FL6A 4OCWH 1ETA1 3PABB 2WXLA 1R3KB 3W39A 2VR5A 5GZNA 4D3CH 9PCYA 2EP6A 2GJ6B 1A6TA 3ULVH 1FL6B 1SJMA 1S46A 2BHYA 5E2WH 3RYMA 4YO0B 3VNYA 4BJLA 4Y2OB 3OXRB 3PUCA 3UGUA 1BMWA 1UD8A 3STLB 1BJ1J 2BPBA 2DWTA 1FA4A 1W0WA 1YDPB 1T2QH 2ORBH 3RJQB 3KGRA 3U79A 2YQBA 2XWTB 2WANA 2YXWA 5BS0E 4CDGC 2X05A 1QFUL 4B9KC 4M43H 3LS4H 1M7DA 5A2KH 2VLRB 3FQ2A 2BMKA 4L4VD 4MDIB 2EIZA 3NN8B 3FF8A 3SYPA 1EZUA 4M1DH 3R0NA 1HIML 1M7DB 2XC8A 3U4AA 5JO5B 5ICYB 4PJ9A 4PRHE 4YFEA 1RK0A 1A47A 1U91B 4YHOH 3OX8B 2CNZA 5CKAA 1KT2A 3K80A 3UG5A 3PRZA 1XR9B 5FK9A 3TJHC 4AEIH 1KJ2A 5B1BB 1MFDH 3VFWB 3DLQR 3OPZH 4GMSH 2FO8A 2GY7B 2NY5H 5CN2A 4L8CA 1PGRB 1CDGA 3KPSB 2O61A 1ZV5A 1O7DC 2CGZA 4HJ0D 3TNNA 3TEWA 5CIPA 4UAHA 5JZ7C 4KQ4L 1P6FA 3KL0A 1I7RB 3UDWA 2Z91A 1O6SA 3TA4D 4GW4A 2RACA 3GSOA 1CE6A 4M9PA 4L4TE 1JD7A 2WWMC 3BAXA 1X5HA 2AJZB 1UB5A 2HB0A 5I1CL 3FN9A 3KPQB 4OCRL 3MV9E 3SB3A 1KTJA 2D0FA 1NGYA 4P49A 4AYEC 2WIMA 3CN4A 4TNEA 3VMPA 4QF1B 5IR1A 1IAOA 4JB9H 2P5WB 3N06B 4DVRL 2XU9A 4L1SA 2FB4H 4A7SA 1FYTD 3LZQA 3U1QA 3RPBA 1IAOB 3E1ZA 2HTKD 1JCKA 2MKWA 3DX8B 1MFAH 4PVNA 4MX7B 3LKOB 1N18A 2DTMH 3LRKA 4U1KA 1KIPA 1S5IL 2WP3O 1T21B 3E8VA 2NZ1A 3S3PA 3MKKA 2Z34A 5HPMA 3OQ3B 1OP5H 4RZCB 1AGFB 5DJCB 4G42A 4RLDA 1NICA 2AF2A 4YH6A 1EV2E 1SLXA 3SPIA 4B53A 1DBAL 3KW7A 4HW6A 1YUHB 2G0KA 4QXUL 2CO6B 4YZFE 3MLYH 4XX5A 1MHCA 3NH7H 4OU3A 1JZ7A 5HVWA 1IM3A 3UO1L 2Y2YA 1M4KA 3ZKSD 1WLHA 1L9SA 4W68A 4MB1A 3GXMA 2V9UA 3PDGA 1CF8H 1LMIA 2PPAA 1GYWA 3T65A 2G2RB 4WW2A 2XRAL 3TBWB 1OV8A 1KXTA 2BINA 2ZWNA 4OFYD 4YHZL 4FXGC 1DQML 1KY6A 3VFGH 4L48A 3HNTH 2QSCL 3ZE0F 5BPPA 3WS6A 2VDKL 4KKNA 3DMMA 3R7QA 1MI5A 1FZJA 1JXKA 1NMCB 4AJYV 4M5ZH 4AG4L 3PDOA 1J0JA 3P4OA 2XBZA 5I8CB 4UNTA 4V33A 3ARBD 2UZIH 1JVKA 1I8IA 2XNAA 1MI5B 4JX0A 3EOYG 1WZ1L 2WPGA 4G5AA 4UOW1 4WI0B 2AQ2A 4BQ8A 5J5EA 2LGNA 4LAQL 3AQDA 3UZEA 2G9HA 4IK7A 1MG3C 3M17B 3W9EA 3QXAA 3BUDA 3CD4A 1HHHB 2WYTA 2WGNB 3A4FA 2JB5H 4XN2A 2I9TA 1WZMA 3MOQA 1ZHBA 3MV01 5A3IC 3HMWH 3UZQA 1F45A 3WEMA 3AC0A 1SVCP 3W9EB 1RZKC 3QXAB 1NCAL 3KCWA 4QKXB 3PWPE 5H35B 3NZHH 1BYOA 4F3FA 5I6NA 2QVKA 3ECBA 3FB7B 4DNLA 5CD3A 2NY7L 3E9TA 1FNEA 3LB6D 3KWTA 5G5DA 3BPOB 1OAUH 3QUZB 4NC1E 4RRPM 4WO4B 5A2JH 1YAIA 4B50A 5CD3B 3DVNA 1AYRA 1QQDA 4U3XA 3S5LA 1BD2E 3CG8A 4X9YA 1PDKA 2WP3T 1FHNA 1XSJA 5IB3A 1CLVA 1RZFH 1LO5A 2PTTB 3HFFA 3WXWH 1KJ3H 4ABWA 3KZ8A 1G6RA 3O3BB 2QADD 3IGAA 3PQYE 4P2RE 2YC1A 4J6RH 1INEH 4GINA 4WF7A 1UTDA 2P48B 4NRYA 1UT1A 3HVNA 1FV1A 4FQ1L 2Y24A 2DW5A 3FO1A 3HZVA 5EU6D 3V5DB 2QSVA 1OGAB 4JM2B 5AB9A 4RISH 4PJIA 2YEZA 4IRZH 5E6ZA 3TO4D 5K5YA 2VLKA 1N19A 2BY1A 4RQQA 4HK0B 2A83A 3GGWA 4EDWH 1IGTA 4H8WL 1KCLA 2BVYA 3NP4A 4PJIB 5EU4B 4Z7QE 1UH3A 5JUEL 3CXHK 1L5GA 1QZNA 3EYSH 4YDIH 4UV4L 2ED7A 5DD1L 4PRIE 3CZEA 4MD5B 4DP6X 4Y9EA 4PRAA 2LLLA 2YXVA 4MJ5B 1T66D 2HLAA 4KO6A 3NJMA 4JZJC 1F3JA 2WBJD 3LHAA 4D0CA 2DQCH 3FT2A 1NGWB 3VWJD 3IDNB 2XPGB 4PGCB 4Y4FC 3GKWH 4N4YB 5GS1B 3QWRD 1G7LB 3L7FA 1OM3L 5JA9A 4P2QA 1F1DA 5EBMB 3OZ9L 4HK3J 2CLRB 7TAAA 4WCYL 4XO9A 3FKUS 1B0IA 1CLOH 1IFHL 1A6WH 4P8QA 1NBZA 2WBKA 1J8SA 2XFXB 1DLFH 4DKAA 3GMQB 4LHJB 4E41E 4ISVB 4XZUA 1QLEH 3MCLH 1L7TH 4LRNH 1QLFA 4N0FA 4KOBA 1J11A 1S9KC 3MLXH 1XV8A 3UTTE 1L0YA 2ROYA 3I6GB 4L3CA 1W8NA 3AXLB 3QS2A 1CTOA 3KPLB 4HMDA 4IQHA 5HHXL 4ELMA 3DECA 1VESA 4IJ3C 4P3CL 3Q01A 2GKIA 4L3CB 1D6VH 3MROB 5E5MA 3ETBF 5DWPA 2J8UB 4G43A 5FO9A 5IJDC 3MRPB 1ZGLM 2ADYA 5K9KA 4G9DB 1JWMA 2R83A 2AK4A 4ENEC 4QRPE 5AOMA 5MEPA 2W0KA 5KTEH 2PXYC 2FSDA 4UTCA 4OI9A 1J10A 5F7DB 2FX7L 4F33B 5I30H 2W0PA 3L9YA 1UHVA 4UZGA 4QMEA 4UYPA 4ZO8A 2BFGA 1HI6A 3EYUH 4QRRB 3SKNB 3DX7B 4JNXA 3F85A 1CXHA 5DD5H 1UJ3C 2JI2A 4R26H 5SX5H 5DMKB 3AUVA 5CP3A 4HC1H 1AY1H 4W4OA 1TITA 2G3XA 3FRUB 3PFQA 5TE7H 1FG9C 1IU1A 1VFUA 1ZLVK 4OGYH 3FSWA 5TQ0H 4WRLA 4Z7WB 1WAEA 4HOMA 2VDQH 1DTUA 2N7AA 1KB5B 4Y5VA 4Z0XA 3D18B 3QDJB 4OM0H 2L0DA 5FGSA 3SQOL 4D94A 3S8WA 1IQDA 1XL6A 3D09A 4N22A 4F7MA 3LV3A 4P23C 4PHZA 4X9BA 2APWA 3QZNA 3ULVD 4Q52A 3RNQA 4JKNA 1W8EA 2A1WL 5ESVB 3STZB 3AJ7A 5I1GL 3EF4A 3VRJB 2V2TB 2C3GA 3RNQB 3C6LD 4MQXC 5KSBA 3KDMB 4X8CA 3HG1A 1AO7B 3L3GA 3EJZD 4FTDA 1E6OL 2YAEA 4IKKA 2FEDC 5IY5B 1ZE3H 3G9VA 3EJUA 2ADGB 1ZTXE 4WJ5A 5IF0A 4JQIA 1CN4A 1TENA 1XH1A 1SZNA 5B7FA 3JV5A 3KYOB 3T0AA 5JHMA 2Q1EA 3QEUA 2Y69B 3SDXF 2FTAA 2VLLA 3E38A 4F58H 3T71A 2Y4SA 1RQ5A 4LVOC 5SWSE 2X2UA 5FECA 5EN2A 5AYQA 3VD4A 3GHEH 1RAMA 5EV7A 1IGYB 3I9GH 4N9OB 3T4YB 3Q6FA 1AGCA 1HH6A 1MAML 2LW3A 3VWKC 2K0RA 5AVVB 3RI5F 3QG7L 1U6AL 2D4DA 3OMAB 5D7SH 2NXZD 3P54A 4JFDE 4G8GA 1MHEA 1Q0XL 4L23A 1YZZA 4ACPA 1L7IL 1SY6A 3ATFA 3ILPA 4EVNA 2OULB 3VGHA 3MBED 2VMJA 2EZ0C 2FJFA 3KG5A 1E90A 3SGKC 4EKJA 1OD7A 5AENA 4WU5A 4JFEB 5D70H 2VRQA 3QWNA 1SQ2N 3B83A 4IKIA 1LXMA 1JHKL 3NCYP 5JQIB 4CVXA 1A6PA 4XHJD 2HLFC 4WU5B 4NX0A 1R3JB 2H32H 3IU4H 4Z3TA 1LO2L 5B1KA 2BSCA 2Y7QB 2K8MA 1BGXH 1VKXB 3DK0A 3I6LD 4ZX5A 5KSUB 1AXSB 3UOAB 4O58H 4JHWH 4JANA 5A2FA 1VEOA 1MCOL 2VCOA 3AS0A 4HA1A 4JPWL 1YYLL 2MCAA 4N2KA 3VB8A 1DVFC 1CD8A 5FOJA 2LT9A 1JWUA 1UWFA 1DBJH 3EJCA 2R27A 2XWBA 1Q4NX 2XVGA 3BVDB 1CGUA 4RMBA 1ZLUK 1QWHA 4KX7A 4WUKL 3DRQB 3AT8A 2BP3A 3GRGA 1WUZA 3TN0B 1KCUH 3TEUA 2NUTA 1A1OA 3LRMA 5E2TL 4R2GB 5C09A 2XT1B 3T1FB 4I48B 2UY7B 5HHOD 3O11A 2YO3A 1A0QL 1PD6A 1GJWA 2PWGA 1GW6A 3VNZA 1QX1A 4RDBA 4Y9FA 3F12B 3TCLA 1I8UA 4JFSA 1ZEAL 1P1ZB 2XN9A 4Q6YA 1R75A 2GTWA 3VSQA 4BSWA 5IHZA 5E6UB 3PAUA 1S7WA 3MOBL 3NJJA 4UOQA 4LCIL 5FO7B 2XN9B 3IXAB 1F90L 3EGXA 4PLOB 3CFDB 4BSWB 4DZBB 5E7BA 1S7WB 2BNQD 1UM6H 2BJMH 5F8RC 2I7SA 2H0FA 4PJDA 2D9CA 3FULA 4NN6B 4IU3A 3C60D 2JIXA 4NI3A 4BUHA 1H6EA 4JUTA 1H8OA 3MRCA 3WFHA 2D7MA 4IU3B 3ZPDA 2UUDK 5CU9A 2XFGB 2WSKA 4I87A 1R46A 1TCMA 3KPPB 3Q8BA 1TFPA 3QIWB 5DFWH 4YJZL 3U2IA 4HBCH 1U8KB 1B2YA 3GD1C 1LNUB 2BVOB 1BZOA 1U2HA 3GSVA 3IYLW 4J3OG 3UJIL 1N67A 4KQ0A 1TNNA 4JMXA 4BFGA 1X9LA 1DZ0A 5L2KA 3AWFA 4Z3GA 1XZ0B 4NQQA 3LZOA 4O4YH 3GSVB 3LN5A 2BSSB 1CWVA 3TV3L 1UQSA 1UXWB 3GBNH 15C8H 4PSRA 1LJMA 4AXWA 4GPVA 5L2KB 2E5EA 2R2BA 3BQUC 1U95B 4NAMA 1QRNA 2J8UF 3GEWB 4UTAH 3MRFA 1HEZB 2DN7A 3GZQA 2XTSA 1QKZH 4G6KL 2OMVA 3ZKQD 1EFXA 4ES8A 2X10A 2GJ6E 2ETWA 3HNVL 1K3IA 4H8UA 5BVPL 1HXMB 1UH4A 2O5XH 3GPEA 5GRJL 5T33L 1S5HA 4LSRL 5DVOA 3BVTA 3WXVL 3M8OL 4P46B 1OARH 1ZSDB 1ZA3B 1ULVA 1JPFB 1M42A 5I26A 2CQVA 1CBVH 1I3VA 4J3OD 1F1GA 1S5HB 1FUNA 4H5SB 1NUNB 1RZJH 1YHPA 2EC9U 1TVBA 2QDWA 5DEFA 1KIUA 3JWOC 2VLRE 5KS9A 3IMVA 2MCMA 4KAQL 4MAZA 1K6QH 4OIIH 1OKEA 3ARTA 3LKNB 2A6IA 2PETA 4JY5L 1ITBB 2VE6B 3NIGB 3TH2T 2OMXB 1U93A 5IJVA 1IKNC 2VM9A 2AJ3A 2F53D 4JPQA 5KVMC 4CW1B 2ARJA 4X5PA 2RHEA 4FA7B 1JDAA 2BY0A 1YRKA 3V0VA 4FMVA 1NDMB 1XF5B 4KZCA 2ESVD 1RULL 4LEOA 4V1DA 1JNLL 1TVHA 4AEFA 4UT6A 3WG7B 4D0DB 2V2WB 1ONQA 2KZ1B 2H5UA 1MFCL 3KPSE 5FW7A 4PUBH 3RVUC 4YFLI 1HDMA 2HX7A 3CVIL 1WWBX 1KYFA 3BESR 4WSGA 4Y7MA 3UTSD 3UMTA 1R5IA 1SOXA 5FKPB 1ONQB 2X44D 4LU5H 5AUMA 2ZG3A 3LXAA 2KBGA 5ALCH 2RCSH 4ICWA 4KUCF 1JZ3A 3DV4A 4WGKA 4CU6A 4XAKE 4ZQTA 1FFRA 2ICEC 1MRFH 4HUVA 1PS3A 1COBA 4LLQA 3IDXL 4OW6A 1MCNA 4OAWA 2X4SA 4X4XB 1DSFH 3DV4B 3APNA 2EE9A 1NC4A 5EA0H 4K3DH 2YPKA 4HUVB 4U1IA 3QPQD 1MRDL 1CG9A 4GS7B 3LPWA 5DD6B 3QORB 2GUOA 4XCEA 4GG6A 2WXJA 3CHPA 1MJUL 5E1AA 2ZD0A 2P5WE 2YPKB 4U1IB 4NNXA 1J5OH 4KRMB 2OJ1A 1PAZA 4POYA 3U36A 2B4CH 3OGCB 4DUVA 5HGAB 3O81A 4LSQH 4ILDA 2EIKB 4XO3A 3MRJA 5AOJA 2ZAIA 1SYVA 3GMRA 4OLWL 4LLMA 3QUYB 3P0VH 4WK0B 2XXMB 2DQIH 5JA8B 2IEPA 3QHFH 1MCRA 1OGTB 1PZSA 1E8WA 1N0XL 2NNXA 4LLMB 1LK3H 1WK0A 4UQBA 2BIIA 1X4YA 3LN9A 1DUYA 3CX2A 2DD8H 1MCJA 3QQ3A 5JDSA 2X9YA 2P42B 2P5PA 4R5TA 2IADA 4NPKA 5INCA 1F02I 1KGYE 1U8CA 1JZHA 4PJ8C 4FXGA 2IBZX 2B9AA 5JPMB 2XCMC 5D1QB 5I15H 1JG9A 4HZ1A 1LK2A 1ZIBA 3EADA 4GSXA 4OSUL 1NFDA 4FXGB 4AM0B 2YOCA 2R0KH 3M07A 2QEJA 4IDJH 3E1F1 4WU7A 2A4EA 4F7PA 2YUZA 3LNHA 5LXGL 2X9XA 4B9IA 4IHOB 1MWOA 1WRFA 5IMLA 4PD4J 4HX1A 1TJHL 4MMXC 4PV8A 1QA9A 3O2DL 4I77L 3NBNA 3ZYOA 5IHUL 3L5XL 1W9XA 1JOIA 3CWGA 3WFCL 1JRHI 3WFBH 3IS1X 1MI5E 4IEFB 3PP3K 3CZNA 3U30C 4E5XG 2ZSWA 3F83A 5TE6H 4YSOA 3EFDL 1AR2A 1TZGH 3CLEH 5L8LB 4AYMC 4DKTA 5GS0C 3D39D 5DYOB 3WLWC 3DX2A 2CLZB 2VDRB 2ZSWB 3SCMB 1ZAGA 4HHAB 1AQDA 1KIQB 4OF7A 1BJ8A 4NHCH 3S88L 4HPOL 1MNUL 2YLHA 2F6AA 1BQRA 5DR5H 5L7XL 3CU1A 3LPGA 5EC2B 4KNTA 1PNCA 2BP8B 4LLWA 2DEYX 5KYYB 1GS7A 2R23A 3CH1B 1GGUA 1NCUA 2IOIA 2FWUA 3ARRA 2GQHA 4UDTA 3PFUA 5CLTA 3I3DA 4FFZH 2V7HB 2ITDB 2OI9C 2D9QB 2ZE0A 4AUJA 4FFWC 4MCZB 3SJVA 4OB5H 3BYYA 3OLIA 5GGVY 2GSGA 1SLWA 3O3UN 1JZ6A 4Z7UA 2CK0L 5DUBB 3BSZL 4DP8X 3MAWA 4HH9B 3Q48A 2DH3A 4JQVC 1CMOA 2XLLA 3SE6A 1F00I 1ZTXH 1HOCB 3TYGL 2LLGA 1FL5A 1DFXA 3GB7A 5T5NG 3KPMA 4NC0B 1S7XA 3ETBJ 2X70B 4U1JB 3VQMA 3HAEG 3GSNA 2OZNA 4OCWL 4Q9CA 3PHAA 4A6YA 2VRKA 3QZOA 2YPVH 5EPMA 2F54B 2CWRA 3BIAX 3NK3A 4OJYA 3A47A 2WQRA 4OZFA 3KNBA 4D3CL 1ND0A 1P4BH 3OTTA 5E2WL 4S1QH 3B9VA 1OGAE 4QOKD 2QFRA 4HIEA 4JFUA 2OQJB 3U7AA 5FGCB 4JZJA 4CSSA 5F3HB 2F8VA 1G1OA 1OALA 1T2QL 2H3NA 2ORBL 4NZTH 1JGIA 4PJIE 3SE4C 4N2FA 1DQDH 4Y4FA 3O6FD 4O51A 5HJBA 4AMXA 4NZUL 1AR1C 1H8SA 3FFCA 5FOBA 4DCQA 4DWHA 2F0CA 4TLSA 3C09B 2YJLA 2MOQA 4M43L 4YLQT 3LS4L 2H0EA 1J1XH 5D7IA 3ZU8A 5E2VH 4J1UA 5C0DB 3T0WA 1U3HC 1U58A 2Y25A 1AAJA 2CNYA 3EFOB 3GPSA 3X13A 3CXDH 1RPQA 4KUZH 3NIGF 4HULB 3INOA 4L4TD 1SDDB 5HDQH 4D0BA 2K78A 3Q5YA 4DPBX 2NY2B 3D1MC 4YHOL 4BWTA 3GIVA 1CFQA 4QRTB 3EOBB 3IMSA 2XVBA 3FFDA 4NO3A 3O2WH 4AEIL 3UAJC 1PBYA 1MFDL 1CICB 1XX9C 3OPZL 4GMSL 3JWNH 4NQED 4P2QE 4KRPC 4XCNA 3EH3B 2QFPA 3SDAB 4ZXBB 3V4VB 4BUQA 2NY5L 2FK9A 1YQ2A 3NSXA 4K3HA 3BZFA 5CF3A 1XTMA 2FZ3B 4J8RA 4Y2LA 5IQ9A 3HE7D 2OW7A 5IGXL 1CR9H 3N85L 3RVXD 2P8LA 4PRNB 1EZLA 2E7HA 5IQLA 5GGRA 1WTGT 1C5BL 1WH0A 5EF1A 2PXYA 2VW7A 2E7MA 4Y2DA 5GGRY 1JP5A 5TDNA 2Y07H 4TPRH 3B6SB 1ED3B 1E65A 3PY9A 3LEXA 4TSBH 3QUXD 2OL3H 5L9DH 1X7TA 2RD0A 2J8UE 4OLUH 1AGBA 4R7DB 3PE9A 3FO0H 3ROOA 1UJ3A 1J48A 4PJAB 4Y2DD 3UTZA 2ZF8A 1JI1A 3L3IB 2IFFH 1N2RA 1I82A 4HP5A 3PU7A 1JZ2A 2OTUB 3ROOB 4JB9L 4U1MA 2QSTA 3DBXA 3GMLA 5DWUH 3EG9B 3I75A 2FB4L 2JJWA 3NK4A 4QRRE 1ZT7A 4WZ9A 3Q9QA 4U1MB 4OM1H 1A1NB 3WELA 4YHPB 1N8OE 4K7FB 1MFAL 1R3IH 2C7FA 5EO0B 4AKQA 2PYEB 3HB3D 2DBJA 3F6JA 1KB9K 4HIPA 1CI5A 2GK0B 4P23A 3CFKA 2GITA 3QYNA 3CFUA 4JKPH 1KGUA 5ITFA 3WE6B 1AZNA 4Z7WE 4UIKH 1VAHA 2CJUH 4PG9B 5EBWA 3D12B 2K6WA 1GYVA 3QT2A 4OFVA 3TC9A 5FX3A 5TGBA 4S11A 1P2CA 2FQFA 3QDJE 1ZHNA 3MLYL 4LHUG 3IMBA 4M7JH 3NH7L 4NDMB 1OT1A 4AV5A 5AEAA 4E9TA 2H2SC 4QGYA 1CF8L 4U3HA 3O2VH 1BAGA 2EDYA 5TDOB 4KZDH 3NT0A 4WUUA 3LZRA 4PJEF 3FUNA 2HPTA 3GRWA 5I0VA 1MQKH 1AO7E 3OVUB 2R56H 1SJHB 3VFGL 4JZNA 1H6UA 3BPLC 1N3NB 3HNTL 5ABDE 3VWKA 2K9UA 1ZT4B 3V7AE 1WFNA 1GKOA 3GSWA 3TZVD 1ODUA 2YKLL 4KNUA 1L6ZA 3OHXC 1L9OA 1L0PA 4NZJA 3ZE1B 4RFEB 2EYTA 3GSWB 1BZ8A 2VAJA 2UZIL 3DHPA 3H9YA 4RMSA 3EYVB 3SGKA 1SHSA 2IXQA 4LHUD 4RMQA 1TCRA 1BD2D 1H3TA 3BKCH 3LRSB 1UWYA 2FX8L 3IPBA 1K4DA 2C1OA 5J8OA 3WE1A 2GTZA 2JB5L 1BWWA 3RWFA 2VN4A 3FCTB 3HMWL 1QLRA 4HKJA 3TP4A 3V5KA 3PQYD 1AVAA 2B3RA 2H26B 3VFMB 4P2RD 3VRLF 3WTYA 3DWTA 4PCKA 1K4CA 1DEEB 3QNXA 3NZHL 4JFEE 3X12B 5FUCC 4N25A 3U2SB 3L3OC 4PGBB 4PS7A 5E00B 3S35X 1OT4A 1DVFA 2FT6A 5FHBH 5IW6B 1OAUL 3MBWB 5D5MB 3BWAB 3C8KB 3MLTA 4CGTA 1YYMH 2PPFA 4IRSB 1HFUA 1Y1UA 2GJZB 2JI1A 1A4BA 2EEAA 4BSJA 1KJ2H 3Q5TA 1RZFL 4H1LB 4WSKA 4X5LA 2VC2B 5I1IH 4LNRA 2Q3AA 2ZX7A 4NHUB 5AYUH 3FZUD 2ZICA 3WXWL 1H15A 1Y1DA 3G5ZB 4PRID 2JJTA 5LQBL 4J6RL 1A3LH 2XKNA 2M1KA 1INEL 1YQVH 4RFNB 3B2XA 3ABMB 3K3QA 1JV5A 4P3WA 1URIA 2VMEA 4IKNA 4X7TB 1EVUA 1F3DH 4K8RH 2E8ZA 2VERN 4HGKC 3WY4A 1EH9A 4RISL 3FS9A 3BZDA 4HS8H 4JLRA 5T1KA 4IRZL 3ECVA 5EO1A 2F74B 1JFHA 5CXPA 5H2BB 5C09E 3W37A 3POCA 4EDWL 4PP2B 5IFHH 3E3QC 3KPNA 5T1KB 5ID0B 3EYSL 4YDIL 4ZQKB 4E41D 4LVNC 1F6AB 3F7RA 1F6FB 4L9DA 4RMUA 3WEAA 3EH2A 3QK0A 3S98A 3VYPA 1FAKT 5C0EA 1P7QA 2XN9E 4NQSB 1JFQL 4NT6A 4XMKH 1WFOA 4NO0D 5C0EB 2VR7A 5T1MB 1AS6A 3GKWL 4IOFC 3C75A 1YEFH 4GT0A 1MUJA 2WIIB 3M6DA 2AEWA 4FQ2H 5EZPA 3LZLA 3WGUB 1CLOL 4YHNB 5EUOB 1HJBC 4NO5A 2FQEA 1A6WL 5LG6A 1LQBC 2WLMA 4L8BA 1DLFL 4X80H 4QRPD 4Z9KB 5T5FH 3V4PA 5K9JL 4XN4A 4PJXA 3GBEA 3UG3A 3MCLL 4LRNL 3BQUA 2VKWA 1N6QH 3FCUB 1LHZA 2EUXA 2Y6TE 3C5JB 3I9PA 3H85A 3V4PB 4GEIA 4KHTL 4G80B 4EUPB 3FUJA 3ETSA 3C08L 3O4LB 3BQUB 5BO1H 3ZW3A 1BEXA 1TLKA 2DJUA 2YGPA 2FECL 4J3VA 4MYPA 4EI5A 3ESPA 3O41A 4U2ZA 1KACB 4LKXA 5L2KE 2R2HB 1D6VL 5HI4D 1ZOXA 2E27H 3JXAA 4B60A 5KG9B 4JVPA 1JNHB 2YGQA 4GRWH 4DKEH 4P5KA 4MB5A 4F37F 3UIYA 3VE0A 3WMSA 4R7NB 2ZP0T 3BH9B 1FH5H 1O5PA 1MVYA 3IU3A 4K5PA 5KTEL 5MENA 4ZAKC 4N1HB 4HD5A 4WI8A 3T09A 2HN7A 3ZR6A 5I30L 2EE3A 1IKOP 3QEQA 5DA4A 4P4RB 1Y6NR 3PCYA 3W81A 4WIQA 4GQQA 1NFIA 1U8IB 5DD5L 3BP6A 4M61B 4R26L 1QI5A 4PEEA 3VGFA 1ZWIB 2ENPA 4HC1L 1AY1L 4JHAH 4W9KC 1PFCA 5ADOH 5I1AB 5I5RA 1WV7T 1BZEA 2D2OA 3DARA 5TE7L 3A4AA 3QJUB 2VDLH 4OGYL 1TQWA 5TQ0L 2WM0A 2AKRB 1J87A 3VGDA 2Z92A 3MYJB 1RUMH 4MSWB 4F2MB 1HOEA 5LBSL 4JUSA 3BO8B 5C0BB 5DFVC 1T22A 1HNYA 4OM0L 3U4BH 2Z92B 5SWSD 3IEAA 4CAGA 2YSSA 5C9JA 4OF5A 4BWUA 4HUUA 1N6VA 3MC0A 2HLEB 1U8LB 1O7DE 3P4NB 4XB7A 5C9JB 4K55A 1H3GA 3MVSA 1EVTC 1PSKH 3MMEA 2ICEA 4B5ZA 3EDJA 2ZG1A 4JFDD 1UD3A 3QAZC 5IBLD 1WD9A 4R83A 1UGKA 2J1KA 1TZ8A 3ULUC 4BE6A 5T1LA 3SZ6A 3TVMC 4N2EA 5GISH 3PWLB 2CRIA 4F8OA 2FIKA 1VFAA 3S8GB 1BQHA 3KGUA 1OTTD 3BXNB 1EBPA 5EZOH 2R51A 3GHEL 4TQ8A 3ZE1F 3UBXI 1Q1JH 1E5AA 3V2AR 3K2IA 2FIRT 3I9GL 3VXRB 4XNBA 5HI5C 3UAFA 3QIBB 2R59A 3N91A 4FFVC 4ZDHB 4PCSA 3ZDYB 5D7SL 3ARUA 3CJJA 5F0MB 3TASA 3VRIA 3VXMB 1AKPA 3CLWA 4WQOA 2R8SH 4FN0A 3AACA 1X7QB 4Z7OB 4AQAB 1DJIA 1MWAA 5D70L 3FHAA 4OF3A 1LVEA 1VERA 7FABH 4ZFOL 3HLAB 4HPYH 2NNFA 3O9WB 2P1YA 5E99L 4OCXH 1NOFA 4PY7B 4XVJH 2CK2A 3IU4L 4QHMA 1B9ZA 2B1OA 4XP4H 5D5MF 1BGXL 2W92A 2IJ0C 4LL1A 4PJ8B 5E94B 3WSQH 3X11A 3VFNB 4XN5A 3NJLA 4JHWL 1AD9A 1J8HA 3GSRA 2ALWA 4MTMA 4RH4A 35C8H 3T2OA 3RX7A 3R8BB 2F68X 2YD1A 4LEBA 4AQOA 3BJ91 2X4OA 4LQFH 2IPKB 5IJCC 3QH3B 4C58B 2H1PL 2NSMA 5EZJB 1J8HD 1AE6H 3KLHD 4MMXA 4N85A 1UOVA 4TTGA 1WYJA 5DMGC 4OJEH 3WIHA 3II2A 4LCYA 1XGRB 2E9GA 3GINA 1KCUL 4PHXA 1IZJA 4XPHH 1QTPA 1JZGA 3T04D 2DM4A 1D5XA 1NUDA 4LCYB 1NGZB 3NACH 5BUAA 2XTJC 1FDLH 1YNTA 5HGBB 1IGJA 1BMGA 4CKVX 4PJ7B 4X9IA 3BAIA 1PLBA 1TNMA 2Y1VA 3QJSB 4DSYA 2QMKA 4E9YA 3RJOA 5IB1A 1OAZH 4P05A 1PYWA 3IGFA 1SBSH 2K7QA 3MOAH 4G7VL 2BRRH 1UM6L 2BJML 2XYBA 4P4KB 5CZXC 5CP3H 4TYUA 5IROD 2PUQT 4S1SH 1HQ4B 3WNJA 2G5BB 5F9OH 3FOLA 3PAVA 4P5TC 5ICZB 1W72A 1PTZA 3ULSA 3TBVA 3G08A 5DQ9B 1F5WA 2CO1A 2Q5BA 4Z18A 1T1YB 3DTXA 4JQVA 1PQZB 5L2JB 4P2OB 3FB8B 2GJ6D 3K4ZA 4Z3EA 1PKQA 4BQBA 5K9OB 4HIJB 1MPAH 4HBCL 3DRTB 4E9SA 3SDCC 4JDTH 4PJ5B 3W0WA 3GT6A 1ACYH 1NFAA 5K69A 3CBJB 3KBHE 4AJVA 2GT9A 4LARL 4DAGH 4O4YL 4JL2A 3SJVE 2MFNA 2GFBB 4NJ9H 4AGOA 3GBNL 4MHHG 4XWOC 3G3LA 4WHTB 3WNKA 2HRPH 4W9ZA 1F4AA 2QQNH 2CG9X 3QXUA 4FADA 3KH4A 2AP2A 4W6XB 4HETA 4UTAL 2DLTA 5E5LA 1QKZL 2VLRD 1P6WA 4JQIH 3AM8C 3SE4A 3T8XA 5LGJA 2FNBA 1HL9A 3L4TA 5DC0A 5E1HB 3WIAA 3A6OA 3BVNA 2P44B 3D0LB 3QJVB 4M48L 4ORGA 3TFKC 4OD2A 3LDBB 3T8XB 2A5UA 2O5XL 5D4QA 5FGCE 4ENZA 4AYID 2KZWA 3FQWA 4ODUB 1AR1B 1ID2A 4QKTA 4HIIB 1G94A 1CLYH 1SM3H 1U3HA 2KDYA 2WVSA 3BKYH 4M5YL 4OD2B 1A4JA 1OARL 2UVEA 2WZ0A 5AW0B 4K7PY 1FNGA 2Q86A 4KKLD 1CBVL 5DLLA 2WLIA 3SZKC 3BZEA 3EYOA 3KPSD 3IMTA 4OUOA 1RZJL 4Y5YC 4JDZB 3VFOA 5EEZA 4GQZA 3FPXA 3DUUA 1SY6H 3CGTA 2O93L 2FEEI 1L0XA 3UAJA 3FB5B 4NOBA 4QEGA 1K6QL 4OIIL 4PWIA 4KK6D 3UH8A 4CC0A 1Z9SA 3DUUB 4CILA 1BBJA 4HUWB 3FRPA 5F2FA 4EI0A 3H6JA 3W9DB 3M1BB 2ZUYA 3DVGA 2LU4A 1YJDL 4HKBA 4M7LL 4GLRI 4K8RD 3BPCB 1MXDA 4L9LC 1NANH 5FUOH 2AJSL 1AS7A 4GKSB 4NM4H 4XPAH 2P5WD 4PUBL 1HSAA 2AANA 4Z7NF 1F18A 4ZI8A 3BGMA 4CBZA 2OTWA 3VSUA 1SYSA 1D5IL 3EOTL 3TONA 1FO0A 3VXUA 4PBVC 4PTUA 2A3TA 3F7VA 4A7VA 1CVRA 5ALCL 2RCSL 3X3GL 4JO3H 2X0UA 4YDZA 3VFVB 1HL5A 3VGEA 5IVNA 4WJG3 1ASPA 4OKVB 4ETQA 4G8FB 3VD9A 1MRFL 4RZKA 1FO0B 1UVQB 4N2OA 2FL5A 5SX4I 2W07B 3Q8FA 4FRWA 4LDLB 4N5UA 5I8KL 2ZP8A 5LCVA 1J05B 4HZAA 1DSFL 1AKJA 5JIKA 4ZFQA 4H44C 5EA0L 3QZMA 4K3DL 4JFFB 4KK9D 2FVNA 5E4EB 4PJAE 3CFEB 5DJ6B 3X14A 1CK0L 2HUHA 2JCCF 3CSFA 3RQ3A 3DHJA 4A2LA 2XJLA 5DO2D 5EUKB 3N6YA 4LT7A 2GBAA 4CU7A 4PJBB 4Z7VF 5I1JH 5IEHA 3MUJA 1J5OL 2HFGH 2B4CL 3FT1A 3ZL2A 3C87A 1BXUA 5E8OA 1A7PH 2YA2A 4LSQL 3U82B 5D7EA 2O4EA 4Z7OF 2Q76A 5JHDB 3DXAA 5GGUB 4L37A 4X4YA 4MBOA 2PYEE 4TSAH 3P0VL 2RAMA 3SDXA 5DXWA 5CHNB 2W94A 1L9NA 1I7UA 1J5HA 2DQIL 3QHFL 4AVJA 1P6AB 3ASWA 2CUMA 2HVKA 4UMSA 1CFVH 3MO1A 1LK3L 4E9VA 2ITCB 1Q38A 4Y19B 2DD8L 4PRPB 3QDAA 1EEYA 4WWOA 3NPSC 3B2MA 4KKRA 5A7BA 3EJYD 1JDDA 2C3HA 3SE9L 2BNRB 4POZC 3PJNA 5I15L 1JI2A 3LMJH 4RDQF 3RUGF 2R0KL 4GKNA 3BPLB 4IDJL 1KELL 3OHXA 2R4RH 4N3UA 1T6VN 5GXBB 3VUAA 3D52A 2YMTA 2GI7A 1D5BA 1R3HA 5C6PB 4XN9A 2IGFH 2HG5A 1JNNH 3CDGB 2AI0L 2YIHA 5FYLD 3PIQA 4EKXA 1G0DA 1TKWA 4N0YL 4UMGA 2P4AB 3T77B 2BSRB 4LLYB 2VUYA 4XVOA 1KGIA 1AI1H 2H6UA 2J6EA 3HI1B 4YK4B 3ARGC 3ZE1E 1BVNP 2VAAB 3FSVA 2JJSC 4BDVA 3VGAB 3QUZD 4WO4D 3WFBL 1EFQA 5IW3A 5TE6L 3HRZB 1U3ZA 2E75C 3L2NA 3TA3C 3CLEL 4MLIA 2BSBA 3CVBA 3L3OA 4YC2B 1NDTA 3MV7B 5I0ZA 2E47A 3MJWA 2NLJA 1E9OA 3N1MC 3NQKA 4K94C 1BA9A 2DQJH 1CE1H 1T0MB 4F24A 1AGEA 5DR5L 1G7QA 1RZ7H 3CFQA 3ZSSA 4CN6A 2VLME 2CKBB 5B3JE 1T7VA 5EU7C 1XEUA 1T0NB 5PCYA 4IRJA 3T08A 2N01B 2R0LH 4ZUVB 3LEYH 3BP5B 1OGAD 5D5ME 4JM2D 5CGBA 4FFZL 1BEYL 3SGJC 3ZYIA 4X6DB 4OB5L 3NABH 4N2DA 5DJ8B 5C2BH 2GYSA 3H9HA 3BUTA 3I6KB 1I85C 1UWGH 3F62A 2EACA 5ID1B 5EMYA 2X6MA 3QDGB 1ZTXL 4UT6H 4YSTA 2MCG1 2J44A 3FQUA 4B6ZA 1KTRL 1ZHKB 3P3SA 3KVDD 1Q0EA 4N24A 4YN3A 1J0KA 1TFHA 1K85A 3A6CH 3FT4A 2MHAA 2J1XA 3MJ8A 2YPVL 3FQUB 2DWDB 2PLTA 5LGYA 1OTUD 2X88A 1QSEA 4MNGB 3VW3H 5DDHB 5HXMA 3HZYA 4S1QL 4WI5A 5C0RH 1S78D 4R96B 1M2VB 4WGVB 3B4NA 4LVNB 3VI4B 3OJMB 3U1PA 3OAYK 2YEVB 5DZLA 5JPNC 4NZTL 2Y6SC 3LTVA 2GC4C 3ARXA 4CVZB 5CUSH 4GI6A 4HCRA 1EAPA 1QUPA 4FXLA 4R3SB 1KTDB 4YHLH 3MUZ1 3V7MA 5GSRA 5K1VA 1NLBL 4LSUH 1J1XL 3KJ6H 5E2VL 1PCSA 2DYPA 5E4IA 3DDGA 1OAKH 1H3XA 3CXDL 4KUZL 4NSKA 4AKOA 4E9RA 4FG2A 5IZ7A 2WO2B 1MCLA 5HDQL 5E2UH 1C9SA 2DYPB 2A74B 2Y3NA 3LX9A 4ZYKA 5EOCJ 3VSTA 4N1EA 3UGEA 5EUOE 4PCTA 3MLSH 3OKMB 1IC7L 3DSNB 3O2WL 1T1XA 3WFEH 5HGDB 1QVOB 2ZG2A 4XGZB 2F15A 2IVFC 4PG2C 5HD8C 4XNYL 5J7CC 1O7VA 5JXAH 1CR9L 1OHQA 3G5YA 3RVWC 2PYFA 4PJXE 1C5CL 3O4LE 2EEBA 1IAIH 3FTGB 5FC9A 3FTXA 1QHPA 3G5YB 1UKQA 3AT9A 1XGYH 1DQKA 4M1GH 4RBPK 4YFLF 2Y07L 4ZAKA 5LAXA 2OYLA 3P69A 3V7AG 3VM5A 3FCSA 4TSBL 4DQOH 5I18L 2OL3L 5L9DL 2GSIA 1L9RA 3GJFK 2YA0A 2J56A 5LAXB 3FO0L 4G59C 3ARZA 4KO9A 5DJDA 5KJ4A 4K5OA 3FUEA 1XF1A 4N8CH 5KYXA 2GSIB 2IFFL 4ZW8A 1IIKA 3QDJD 1ZLVH 2VXQL 4ATWA 5HDRA 5DWUL 3ABLB 1AYOA 3D8MA 1RZKH 1EGJA 3BD5A 3S37H 4OVUA 2VDRH 3KLKA 5EBGA 5FDWA 2HT3D 2HKHH 1MJ8H 3IFPB 5CZKA 1YY9C 3MRLB 3THMH 1AO7D 4CMHC 4QLWA 3BAKA 4EN3D 2VITB 1TZIB 3K8KA 4JKPL 3H3PH 4UIKL 2YN5A 3RTQD 2YQ2A 2CJUL 4F2ME 1E8YA 2ZX5A 5IM7A 4DO4A 4KUCD 3T0EC 5C0BE 4D9LL 5A1AA 1GA2A 1NSNH 4QXTA 4UNIA 3AG3B 4KKQA 4NRXB 4M7JL 4DHLA 4EBQL 3KYKH 3QQNA 2GHWB 3F64A 4F7KA 1GZPA 1KYOK 3OKEA 5MEOA 3NRPA 3O3AA 1C08A 3TVMA 5A6MA 5GGVH 4ZMZA 2ZWZA 1YC7A 3CNKA 2QT6A 2RQ8A 4HWBH 4YXKH 3O2VL 5AZ2L 4KZDL 3B2UC 3MJ9A 2AV1B 4LCVA 4RGNC 3VVVA 3GTVA 1Z5YD 2HMID 2X89A 3RRQA 2D4FA 2R56L 2KHAA 4XP1H 3GSXB 4N90D 3GSNH 4JFED 2H9GB 4Z0BH 4A6YH 3V6FB 1SF5A 3K6SB 4OZFH 5SWZA 3H4HA 2GIMA 4U1HB 1T04B 3EGDA 4L1DA 4WV1A 1HYRC 1HNFA 3VXRE 4HG4J 2WCPA 4YAQA 4I9XA 3EJPA 2CLVA 1BQKA 5KANI 3EGDB 3BVXA 1FHGA 5HPOA 3ZOAA 4AGQA 5E4AA 3EGSA 4L5FE 3ZDYE 1M1XB 1HEHC 1I1AC 2UX6A 4PGDB 3VXME 4JDEB 4YBQD 1CDIA 3ZTNH 3MRMA 4IOIB 3HE6C 3GI9H 5I8EA 2QVMA 5C07A 3IPFA 1OCWH 4LCCC 1KXQA 4YHKH 3MRGA 3NCCB 3PWUB 4M02A 4M1CC 4RMRA 5ISZA 2I85A 2XICA 3LCYA 2E8YA 3TN0D 3HG0A 3SBQA 4HAKA 4AGLA 2X3CA 3U48A 5FHBL 1ZLUH 3T1WA 4NIYE 4R2GD 4N1CA 4XOEA 5ADPH 1HL4A 3FH5A 5A6IA 1C8QA 1YYML 4JRYA 3FUIA 5BRZA 4U31A 4X8JB 3U6XA 1KJ2L 1E4KC 3FT9A 4MVBD 3H7LA 2WOYA 4WI6A 5I1IL 1D3CA 3HG2A 5AYUL 1G7HA 2RQEA 2CJTA 4YQXH 1VCBC 4MA3B 4MDJA 3FXIC 2N4IA 4I18C 3LKRA 2BCKA 1A3LL 3ZXAC 2A0LD 1WFUA 4NPYA 4OJCA 5DC4B 4CDHA 1YQVL 3HBQA 5CEYA 4NP4H 2IH8A 5CSBA 3B9DA 2HT2D 1I1CA 3ERXA 3KEHA 1E2VA 4K8RL 4Z8FH 3VG9C 2AJXL 4PJFB 2ENYA 4GY4A 4HJGA 4GFTB 3EUUA 4FQXB 4HS8L 3RY6C 2GBTA 4GUQA 5IHBA 4HJGB 2PCPA 3VFSA 1ASQA 4PJ7E 2VQ1A 3HRPA 4LO9A 1G9NC 4LBEB 4YEEA 5IFHL 1Z7JA 1HL8A 1OB0A 2WXPA 4UM8A 1CIUA 1FFOB 3QIWD 3QAQA 4O2FA 3D2TA 2FAUA 4P5TA 2BLFA 2YAOA 4G8EA 4ADJA 3RB7A 2UUDH 4UM8B 5IHHA 5EOQH 4XB3A 2OMBA 1MFUA 3WNIA 2PMZA 4FD0A 4Y16C 4XMKL 1NAMA 5LXVA 2FJGA 4M5TA 3KS0J 2ICWA 4ODVH 3VXPB 1DJZA 3V4UH 1ECYA 1JZEA 1YEFL 5KW9H 2YD7A 2Z31B 1MCPH 4FQ2L 1IE4A 1RJLB 4XOAA 2EUWA 2IWEA 4RX4D 1ZKAA 5IMMA 3SDCB 3Q8AA 4GUOA 3EUDA 3O6LH 2JELH 1M9SA 3DJ9A 4MXQC 4N5EC 4V2BA 2JV6A 5CILH 5IMMB 3G6DH 2YJQA 3RDTC 5D96C 1N6QL 1BIHA 2FECI 2W8CA 3OLEA 4PJ5E 4ONHA 1PEZA 2Y72A 3AM8A 4KU1A 1H5BB 3GHPA 5C8JA 5LB1A 3O3EB 4HEPG 3QJFB 2W88A 1TOXA 4P46D 5BO1L 1N6UA 1OK8A 2X38A 2TAAA 1KEMH 2ZAHA 3GRWH 4ODSL 3VI3A 4A7GA 1DO6A 1VZHA 2P8MA 1MLCA 2ZUTA 4APQC 2XQYK 2DDQH 1I9RL 4OV5B 4DKEL 3VI3B 1U9KA 3RGVB 1DQQB 1G0XA 3EFFB 1C5DB 5ETUB 4F8QA 4OCYH 2KQNA 2BIHA 2IGTA 2WJ7A 3I02A 1FH5L 2X6CA 1Q72H 3REWB 4AYSA 3VD0A 1TJXA 2VXUH 4XMPH 3P9LA 3NEEA 3PL6C 1PZ5B 1XGUB 4QT5A 2PR4H 4Y5YB 4DJMA 3KHOA 1AIZA 3OJVC 1S7UB 1XGTB 3QIUB 1WQVT 4WK4B 3ZT7A 1SXCA 4JHAL 1KLGA 5ADOL 1MDTA 3IMRA 1XCTB 1CZ8L 2NUPB 4BCXA 2UYLB 3WUWB 1ETJA 2XZZA 1AC0A 2VDLL 1E27A 4L9LA 3PG2A 2BFVL 1IVLA 2NYKA 1CGVA 4FEMA 1TQTA 1HWHB 1RUML 1X6LA 1WICA 2CDFB 4PRBA 4QTHA 4ODHH 3O3DB 4P06A 1AHWC 3UC2A 4KXBA 4NQVA 1T20A 3QI9B 3U4BL 4PRBB 4YDVA 4N2GA 2Z4QB 2JFCA 2OMZA 1RZIA 4U05A 1DDTA 7PAZA 1YPZB 5D7HA 3HOGA 1TJGH 2NW3B 3DOHA 1PSKL 3QORD 4Y89A 5DMJB 1G43A 5HYIA 5T3ZE 1NCCH 1GYAA 1U8PB 4RGMB 1VZIA 5KYUA 4N8VA 4ZFZA 2NYYD 1G6RL 4PW3A 2NDGA 1R5WA 5GISL 2C9RA 4Q2ZA 1NIEA 5FIEA 4LDOB 3RILA 3OLDA 3BLKA 3FO9B 4YR6B 2GVYA 3KBPA 3QUYD 3WEBA 4K0OA 5EZOL 5D2NC 4XXWC 5B38A 3FONB 4B9PA 5JXEA 4OLXH 1I8KA 2BIPA 2YMXL 5I75C 2WD0A 1BMZA 4JFFE 5D6DA 3TTSA 4P5SA 2BVPB 1DFBH 2CH8A 5DUPH 1HSBB 5DJ2A 5AD0B 1WA1X 3UBXB 1NCDH 4LGRB 5GGSA 4PJBE 4G6FB 3S9DB 2ZXBA 3N9GH 4XNXL 2R8SL 4UT9A 2BVQA 4F8LA 3MLZH 3IPEA 5GGSY 5IVXB 5D1QD 5DT1H 2K9FB 1TTFA 2QJDA 3FU0A 4ZD3L 5JHDE 2BVQB 4JFQA 7FABL 2OP4H 1X5YA 4PTTB 5D7JA 1FG2B 5DTFB 4HPYL 1IM9A 1FVCB 1QUNB 1HCZA 4OCXL 4XVJL 3S34L 2D3NA 5KJ7E 3NPSB 5ERWB 4XP4L 3V8CA 2W59A 4QUOA 3QXDB 1IM9B 3WSQL 1CS6A 3V0HA 1LMKA 5I73C 4Y19E 4PRPE 3L7EB 2G9KA 3GJFA 5HYJB 4URTB 3SDDB 35C8L 2QLVB 3CHXA 5IVZB 4PBXA 3V4PH 4LQFL 4JM0A 2R2CA 1MNNA 2BNRE 2Y0SA 1BOGB 4AQ8C 3KLAB 1UURA 1B90A 1RZGB 3RVVD 3S48A 4OLYH 4K3EH 3EF7A 1SGKA 3S4SB 3UYPA 4FHKA 3RDJA 1G9EA 4TNFA 5ENWA 4BHUA 3CFJA 5CJ8A 1D6EB 3ARGA 3AGVA 2JJSA 3SCMD 1YY8B 3MNMA 3PP3H 1BXXA 1CBJA 1ML0A 3F58H 5CJQH 4FHBD 2XA8H 3NACL 5ENWB 1CFSA 1E3ZA 3ARGB 1FDLL 3MXWH 2GHZA 2UZXB 2OSLB 4UDUB 1A4CA 1EZVX 4LDCA 5F7EH 3U4EB 3ZHKA 1Q94B 4F93B 1FVDB 3TA3B 2EIBA 4LLVB 3GBDA 4LASH 1XHHA 2O5ZH 2J4WH 5AW1B 2G5UA 3WNOA 3ZKXC 2XN0A 1OAQL 1B0RB 1OAZL 4IS6A 1MY7A 1GZQA 5IUSA 3ABZA 4M6MH 4NRZA 3MOAL 1ZJAA 4PI0A 3MV7E 2PF6A 2BRRL 3EO1A 3NJIA 3ZDXB 3QNYB 4S1SL 1KBPA 2FBOJ 4GRMB 1P7KA 5F9OL 3SGJA 1LP9F 3WJMA 2X40A 4HLZG 5IIEB 4NAQA 5E6IB 4CBPA 3L3KB 4PS3A 1C12A 4MYWB 4AZ8B 2CMRH 2F54D 2ZIDA 4MD4A 4BH8A 4HIHB 3DROB 3V0FA 4X7SH 3GMNA 3COOA 1YN7A 3GMMB 4FMFA 3GXNA 3AZUA 4ZNEA 3EH5B 1OHZA 1MPAL 3V52L 5CBAB 1U42A 3RWJA 4X6DE 3I9IA 1NWPA 3R4DA 3GF8A 2N7BA 4YOKA 1YN6A 3RKDD 3LKSA 1OZUA 4B0MB 4JRXA 5AKVA 2AEPH 2ZP9A 5C6TH 3Q13A 3QDGE 1S2EA 4NJ9L 4OCSH 3REVB 1VZGA 2VXTH 2HRPL 1CJYA 2GCYA 2QQNL 2R0ZH 2OMUB 2Z3FA 3EJQA 3ZGHA 5H8DA 2R9HC 3H9ZA 1FLRH 4Y1AA 4ZMYA 1AHMA 1JZ8A 5JPNA 1SMDA 5FW6A 4JQIL 4LP8A 3KL5A 4WEMB 5EO9A 4FYQA 4PY8I 4Z77B 4LSSH 4U6XA 4MNGE 3PGCA 4H0HB 3H42H 1M7XA 5E9DB 2D31B 4QDGA 1XO8A 2NY2D 3E3QE 4AYFB 3TYFB 5DHYA 3CMOL 2WKOF 3FQTA 2AZAA 2NY1B 3VI4E 4PWFA 3KPRA 3CCHB 1CLYL 1IBZA 1SM3L 2V3EA 3BKYL 4M7ZC 1CICD 4KITB 3SDAD 2O5NA 5DS2A 3NP3A 4ZXBD 3CFBB 1RJYB 1F4YH 4XHQA 5JTWA 2MCPH 3KPRB 4MQTB 2F18A 3W2DH 1M1SA 1SY6L 3D05A 5CEZE 1J1PL 5EIIA 4MBRA 5DJXB 4LE8A 2X4NB 2B7DT 4ZRGA 4FKHA 3ZKMD 5I76B 2GJJA 4ZS6D 5JW4Q 1BVLB 1S7TA 4AT6B 5EEYA 3TCXA 3ELQA 1W91A 1IEHA 1I8MA 4WI2A 1H9DA 4OJFL 2FJHA 5DCCA 4BGDA 1JBJA 3RGHA 1BYNA 4Z78B 4M93C 4IMLB 3WIFB 5FUOL 1RSYA 1M6OB 4GSRA 1XH3A 3OKKA 2A6JB 1D5ZB 2PO6C 1FNFA 3ILDA 4J23A 2Y5EA 1WBXB 4NUJA 4U3CA 4WWID 4XPAL 5HVGB 1UA7A 4HV8A 2H1XA 4PWKA 3B2VH 4X5WB 4OF8A 2R4SH 5BQ7A 5FM5O 1A9BB 1SUHA 3CX5K 1EHAA 2W5PA 3GS0A 1E9QA 3TURA 1P9MC 2AXGA 3MNWB 3U9UB 3FQNA 4JO3L 4TNWF 5I1KH 2N0MA 1X5XA 2PYED 3GXDA 4S2SB 2IAND 1KPUA 2QQKH 3BW9B 4XNZB 1CDCA 2IF7A 5IK3A 1HHKB 4WTZA 4BUGA 4D7BA 5FCUH 2WKLA 5BXFA 2XWJB 3TBBA 1HKLH 5GS0H 4XH2A 4QNPF 5I1JL 1EJ8A 1OM9A 2AVGA 4I0PC 1E4XH 1H6TA 2HFGL 3B9KC 2XWZA 3WTXA 1HNGA 1A7PL 5IVXF 4JKWA 2Y7OA 3T0EA 5IKCB 1X4XA 3W5MA 4TSAL 3P9MB 4YE4H 5J12B 5BZWB 1BIIA 4MDRA 3HC0B 4NENB 1F2QA 2VO8A 1QHOA 4AK1A 1CFVL 1YEGH 1O0VA 2DMGA 3CN3A 3T8MA 1XF2A 2R39A 3BT0A 4Q6IB 3BGFB 4L1TA 3R0MA 4X0NA 4RMWA 3C5ZA 5L4FA 4J2QA 3EHBC 3ESNA 4U1SB 2EEDA 1TTUA 1OOAA 2VN7A 3ZX1A 4J8QA 2XQYA 5I6XC 5E51A 1IC5L 3FK3A 3NUKA 4H1LG 5I66B 3VDCA 1MJJB 4UQ3A 1BBDH 4ZT1A 2PN5A 43C9B 1A3RH 2V3DA 4DGVH 2B1AL 4YS4A 2R4RL 4Y4KC 3UL4A 3OR7A 3KYMB 2SODB 2WZPD 3ZHLA 1EO8L 5C08B 1KV7A 2IGFL 2EAEA 4ONGH 3UP6A 1JNNL 4F7EA 4DK5A 4O2EB 1S9VA 5KVEH 4GJTB 4LDEB 3OZLA 2UZYA 3NEOA 3RIAF 2D3VA 2VLMD 1JHTA 4GAJH 3C5SA 1EHNA 4F7EB 3WENA 5HHQA 1F1AA 4R9HA 2QV2A 1ROCA 1FVEA 3MODL 5DK3A 3UJTH 4BK5C 5DZVA 2IMMA 2X4PB 3WHE0 1F42A 1I1AB 3BPNB 1BSIA 3D85A 3NIFF 1Z9NA 2OMYA 4IRSD 4MMYB 3HE6B 2VT0A 4K7PH 2O72A 4LCCB 2YZ8A 2WO4A 4LVEA 2LVEA 4HKZB 2V2XB 5C3LD 2DQJL 5LDSA 1NEUA 2WUBH 2E4FA 1CE1L 1IO4C 4DVBA 1TEYA 1KBGH 2J3SA 4C8XA 5BVJA 5L8JB 3IK2A 4FG4A 4FQPA 1XCWA 3IAQA 1H3VA 3MRIB 1RP8A 4I0KA 5HDOA 3VXOA 2APTA 1UZ6E 1LE5A 4I18A 3MV8B 1AANA 1WA2X 4R7VA 5C2BL 3NABL 2KYIA 3BZ5A 1AQ8A 4WY7H 4XNUH 3VXOB 4MNHA 4LIQE 5T3ZH 4WJKB 2EXYD 1UWGL 5ESQB 3LRLA 2D7NA 2NXYB 3AQYA 4JPIA 4TVSa 3W56A 3ZHFA 4UT6L 2FO4A 4EUPG 5I1DA 3UCQA 4JRYE 4AGMA 3RY6A 3L3JB 4NNYB 2WYHA 1CFTA 1UB6B 4JFHE 4ZMLA 5J56B 2VSDA 1FO0H 2L8AA 3P4LA 4G6JH 1X9QA 2QL1A 4AV4A 1RK1B 3VW3L 3N04A 4PJFE 3IRPX 3OV6A 3RFZB 3I3EA 1IGFH 3HCVA 5C0RL 1FAIH 3HS0B 4K4KA 4G9FB 5LCVH 1WFMA 1A7RH 3WD5H 4AVHA 5TJWK 3VACA 1NKGA 2P9RA 4H0GA 3HCVB 4Y16A 2W0FA 5FO8B 1M71A 4MAYB 4B9CA 4D9RD 2EXWD 5CUSL 1GPOH 2B3IA 4ZUSB 5LBVA 1ORSB 1I1YA 4YHLL 3FN0H 5ECGA 3NZUA 5LDUA 2JSFA 4LSUL 3KJ6L 4A39A 3FTVA 3IDIB 3MGTA 2CDEA 3O4LD 4UV7H 1V3LA 4PMEA 1INQA 2P5EB 3QFJA 3QC5X 1SOQA 3DGGA 2MTPA 1BG9A 1MHHA 1LWJA 5E2UL 5FWQA 3MGTB 3RDTA 4F15B 3AS1A 3ZMEA 2GAZB 4XRCB 4HEMA 5C97A 5F1KC 3MLSL 3TEYA 3P4MA 2R2EB 2XDHA 4P9HC 2N3JA 1RH8A 5JOEA 3B3BA 4XMUA 2IQAA 5J9PB 3HEIB 1CU4H 4ZW7A 1BF5A 5HYEA 2WXGA 4NFBA 4YSRA 2OR9H 4DK6A 5JXAL 4APQA 1G1CA 2J72A 3ARDC 1VIWA 1BZQK 2UY6A 3HJ0A 3T2PA 2CO7A 1IEAB 4C4UA 1NIBA 4R4BB 1IAIL 4IBUA 1N10A 4APQB 3AITA 3S36L 4UIMB 3TBYA 3Q1EA 3OSKA 1ILUA 4CL7A 4JMNA 2WLLA 4DQOL 1UZ8B 3IJSA 3O45B 4LBAA 1AOHA 2B0SL 3PL6A 4I3RH 4RAVB 3WS3A 2HJKB 4LLUB 4GUPA 3ZDZB 1SJVA 2NDFA 3A4EA 4MMZB 4N8CL 3VI3E 5B8CC 5C0CA 1NCOA 5E6YA 4U1NB 4X6EB 5C0BD 4WHYH 4NQTA 1SMAA 2CM5A 3T0DA 3K0YA 3LQZA 1VGEH 1T03H 1R3LB 5IJBC 3MN8A 4JO8A 1BVZA 1RZKL 5I17B 2V5RA 3NZ8B 2K1MA 3BP7A 3VXTB 4IBTA 2OYKA 2VDRL 4ANVA 1KBWA 1TVDA 1GSMA 3V6ZA 3Q8EA 2HKHL 4P3DA 2VH5H 5AVQB 2I9LA 5GHWH 5I5MA 1A6ZA 5IUCA 3HBPA 3D69A 3THML 1AHWB 4BQ6A 1IAIM 3AAZB 2CKBH 4TQEH 4AYGA 4P3DB 2P80D 4KMLB 2DIAA 3H3PL 3GC3A 1RL1A 2DZEA 1KCSH 4MXVF 2SEBA 3J07A 5H37A 4LSPL 1DN0A 1HC1A 4HXBH 2AV7B 5BZDA 5DK0B 1ETZB 4KKBD 1PD0A 3QJRB 2NY3B 3QC6X 1NSNL 2O6CA 2JCCA 4YL4A 5GRYA 2PCYA 3KYKL 3MYZA 4NQUA 1PY0A 4Z7VA 1JTPA 4OZ4A 5GGVL 4YXKL 3VXRD 2APSA 3OR6B 3OM3B 1NL0H 1MFBH 1YPZE 3QIBD 1A65A 1N5AA 5I19L 1EDYA 1ZT1B 4U6YB 1AZBA 3O8XB 1H3UA 4HD9A 1G84A 1USZA 4PP1C 5BV7C 1NC2B 1MHPH 4PVLA 5D2NA 1FGVH 2B59B 3ATDA 4XXWA 3FH7A 2Q8AH 3VXMD 1N5AB 3SPJA 5FB8A 1FFNB 3IDJB 3BN3B 4XP1L 3V10A 3BN9C 3GSNL 3RE0A 3BZ4A 1MCCA 3QVAA 5KSAC 3VD2A 4Z0BL 4A6YL 1K8IA 1TU2B 2PP8A 4W4NA 1TQVA 1IT9H 1JF1B 3LIUA 3O9WD 3Q06A 3PWNA 2LHAA 3OMIB 4HXAH 4R4FH 3G5VA 3FUKA 4QRUB 4RGOH 1OQOA 4BFBD 2QSQA 4PJ8D 4U0QB 3WYRA 1QEWA 1PG7L 3STBA 5GS2H 1GHFL 3BRDA 3RUGA 4AQ1C