2N59A

Solution structure of r. palustris csgh
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein CsgH
publication title Electrostatically-guided inhibition of Curli amyloid nucleation by the CsgC-like family of chaperones.
pubmed doi rcsb
source organism Rhodopseudomonas palustris dx-1
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n59A00
2XSKA 2Y2TA 2Y2YA 2N59A
chains in the Genus database with same CATH superfamily
1FIGH 3TV3L 1IVTA 2C1OA 2DQEL 1RZFL 3EO9H 2XDHA 1HAWA 1V3JA 4XBEL 4M48L 3IMSA 2DEYX 1RZ7H 5EWIH 1NGPL 3RILA 2BVTA 1EGJH 3L17A 4FQQB 5GSVB 2GCYA 4G8GA 2C9VA 4P49A 2FX9H 4YHIB 3CGTA 4HS3A 1L3NA 3KJ6L 2VLKA 2WIMA 4XBMA 5AKTA 1CLZH 3DARA 3ZE0B 1COBA 2XXGA 2G2PA 4ODBD 2HRPH 4EF3A 1E6JL 1IBGH 2P7TB 3G6DH 2G75A 3NIDB 2V2XB 5TH2A 5KS9A 1KFAL 2J8UF 5H94A 2ENQA 2ZUSA 3VTAA 4J3WA 2R1YB 4L29A 2DMKA 3MR9A 1RZ8A 4AVIA 2K8QA 3SYPA 5LXVA 4W9IC 1T22A 1TZAA 4XVUD 1A65A 1T80A 3CVCA 1W8OA 2C7UB 4WHTB 3PY9A 2Y06L 4FGMA 4HISA 1E4WH 1EFXD 4MGXA 3U0WL 5KW9L 2CZNA 1I53A 2FHBA 2AI0L 5JPNB 3REVA 5T3ZL 2LU7A 4FFYL 1R3LB 3T0XA 4QTHB 1A7RH 3L3HA 1E43A 1QSED 3L95A 4J1UB 1OARL 1OCRB 2DOCA 5DLLA 2XVKA 1JNLH 4JFXA 3VSUA 3ZTNH 1MJUH 3B3IA 2HT4C 2ALWA 2F58L 3IJHA 3L6FA 5E94B 2Y7MA 3DHJA 1CGSH 2AK1L 1AQ8A 2Z4TA 4WSJA 4B96A 5ESVA 4CUCA 1KB9J 2CRMA 2GSGA 3W9DA 2VW6A 1G0XA 5D5MA 3NMEA 4HWUA 3SE9H 3FU0A 4RRPA 1A14H 2R2CA 2XY1A 3KL5A 4RZKA 5EU6D 2YAPA 4W68A 2IFGA 3LPPA 1HEZA 2BHUA 2BFGA 1DQLH 4MNQE 2NT0A 4PRIB 3Q0HA 1R24B 4PJ8C 3VXOB 4E2OA 1HESA 3WXVH 4C4UA 2XG4B 3APCA 4EBQL 2B3RA 3D85A 4NO5A 4PFEA 3WJJC 3UH8A 4K15A 3SBRA 4PRHD 5CMAA 3O8XC 1CD8A 2PR9A 3O3UN 1KN4H 4XHQA 1GRWA 5IOKA 4ABUA 1P5VA 2PCFA 3DMMD 3RL1B 3O4LE 4HCIA 4HUUA 5KTEH 3V4UH 2F74B 4QIRA 4RQQA 3DIFA 4N20A 5LAPA 2WOYA 5AW9B 3EG9A 3F2LA 2QVKA 3QUYA 4HBCL 5DUML 3KDPB 2BERA 3OB8A 5IGXH 2VR4A 1BM7A 2JVUA 4Q2ZA 3MMEB 2P43B 3QDJD 5E9DD 4URKA 2FDBP 5T1KA 5B1KA 1JI1A 1E9OA 1FVCA 2CXGA 3JZYA 2VOTA 1T4KB 3F84A 4FQXD 3V4PH 2EVFA 4PB0L 1TQBB 1Q1PA 3L4YA 1H9VA 2VTFA 4EE2A 4WW1A 1HQRB 3FO1A 4OW6A 2EXWD 1CN4A 4HLZG 2ITDB 2EE6A 2WKLA 4G8EB 4HCRL 3VX1A 2WN2A 3VD1A 1QLEH 1MZYA 4MCZB 4R8WL 4U1NB 1J1OL 3AG3B 3FL7A 4F15B 1E4XL 3FQYA 3PF2A 3HI1B 4LLVA 4OJFL 5KBKA 1OTTD 5CN3A 3P2BA 1IIKA 3IGUA 4CVZB 5JPMA 4NNPH 5CAYB 1RK1B 3P4NB 4Z7UB 3VM5A 2YRBA 3WS6A 3RAJH 3I9PA 3Q8CA 5EF1A 4R96A 4JZOB 4H44C 1PGRB 5IR1B 1N2RA 1OGTB 3OJDB 4GBXB 5D1ZB 3SKJH 1T03L 2BNRD 2C9SA 3E3QE 3QQDA 3ARFA 4Y19E 4ATTA 4QOKA 5E1IA 3W82A 3QXDA 2C9AA 2ENSA 2A6JA 1CGVA 2FX7H 4MNHA 1CGUA 3ULVH 4NZUL 1P7QA 5KYYA 1U0QA 4P9HL 4P3WA 5G4NA 4EQ3A 4FTVE 3PUCA 5MERB 3CU7A 5DJDB 3BAYA 3BVTA 5FM5M 3RKDC 3W5NA 1BVZA 1SY6L 2IAMA 5HI3D 4OLXH 1L0QA 5TDPB 4A2MA 2BVOA 5CU9A 5KZCB 3S88L 1DBML 1EZSA 1Q90A 4X5WB 5JTWA 3L7FA 5IVOA 1UB5A 2P48B 2YD4A 3OB0K 3P3YA 4TF4A 4JFDA 4KVNH 4KI5F 2KS0A 4NM4H 3O6LH 5IW6A 4F8TA 3ILQD 2IO5A 3ZTDC 2F8OA 4P2QA 2NOYA 1FFNB 3BSGA 4K07A 2PPDA 1RIVL 2J8UA 1S9XA 3IFOB 3KW8A 3KXFA 3HE6B 4QRBA 5EDSA 3KLSA 2ESVA 2EAEA 4OM1H 4YEEA 3RVWD 1I1AB 1N4XL 5ICXB 3GSRB 1X5XA 1Y6NR 3LSOB 3LN5A 4GAAA 1G4RA 3CN0A 1JDAA 4GKNA 1XR8A 4LESA 5DA0B 4M56A 4AQ1B 2UZYB 3JV4B 2BS9A 2Q8BH 4FCAA 4PY8I 5JYMA 1KEML 4LKXA 1E8YA 4JRLA 3S6CA 1YUHA 5H37H 5ISZB 3SDAA 3WFEH 2OSLA 4WUUA 2O30A 1ID5I 3C09C 2CALA 2QQKL 3AMKA 1EA9C 1UWEH 4NQEB 1ZSHA 1EO7A 1RUKL 2CAKA 2YC1A 4XPGL 1UURA 4FN0A 4MS8D 4K9JA 4G7QB 3C5ZB 1NCOA 2HWZH 1WPCA 3LV3B 1NBCA 4NHUA 4PLJC 4XP1H 5BXFA 4DHLA 1SYSA 2XETA 4PRNA 3R7RA 3BZFA 5F88A 1UT2A 3OXRB 1QVOA 3D39B 2W0KA 4WO4A 3Q6GH 3RUGB 4B9IA 5DURD 2MQ0A 4BFGA 4F7CA 3C60C 4P99A 3ZHDA 4ZXBA 4U0QB 4DK5A 3ARGC 3WFBL 3H7LA 2IV9A 2EILB 1SHSA 2VLJB 4PJ8D 1E8XA 1A4JA 1MWAL 3UADA 2P46B 2HX7A 1QPXA 1VIWA 1AQDA 1U92A 2SEBA 4D3CL 3UIZA 4K2UH 2EO9A 3BP5B 4PU2A 2BMKB 3EUDA 2P4AB 3GMQB 3O8XD 3ROLA 3PWNA 4HWZB 1LEKB 1PZ3A 4HLEA 3F58H 3K3QA 4ZUUA 5E8DL 3G6JE 2ADJA 3FQRB 1F3RB 5IMMA 2A9NL 3DRQB 4DAGL 5L9DH 2CBQA 1DUZA 1GY1A 1JXGA 5I5MA 3NCWA 2AC0A 4LASH 3ZGHA 5CEYA 2YMXH 3RI5K 4ICWA 1AR2A 4X8CA 2VR6A 2GPZA 2AXGB 3QQNA 3D07A 4H26B 3CFEB 2C3WA 4YLBA 3HI5H 5I5JA 4WI0A 4WEBH 4D0BB 5F1KC 1RI8A 1BFOB 4PB9H 3FQWA 2NRDA 1A6UL 4JQIA 1A4CA 3LTVA 2P5ED 4Y5XA 3F7KA 3SQBB 3JWOH 5DT1H 3GMRA 3TYFA 3US1A 3WD5H 4ZD3H 5BQ7A 1OP3K 1JP5A 3EF4A 1AKPA 2JIXA 1PIFA 4IK7A 1PD6A 3CZLA 3OKMA 1G9NH 2Y3AA 2R59A 1OAYL 3OF6D 5LGKA 3A4EA 2H32H 4X7FC 3BDYH 5CN1A 5IG7B 4WU7B 5L8LB 4U6XB 3JT2A 3IFLL 5B1AB 1DO6A 1FJ1B 4I3RH 1MXGA 1KCRH 1DN0A 4M1GL 4Z7NE 2HSIA 3CVHB 2ZG2A 3LEYL 4D7BA 1MFDH 4N1EA 5MEPB 4PEEA 2R39A 3MRRB 5EOQH 1F2QA 3B9KC 4J28A 3JV5A 3DVNB 1RHHB 4S2SA 3UJJH 2MPAL 1ZD6A 1WA2X 2D4FA 3L2MA 4XE5B 4MA1C 3RKDD 1YPZE 5I28A 1NOAA 2WLYA 2VC2B 5F2FA 3STLA 1XGTA 4ONGL 5GZOC 4Z77A 3VXTB 3OR7A 5D7JC 3V4VH 3ULUE 1BMGA 1C16A 1H5BB 3WN5A 4K3HA 1V10A 2R0WH 3AT9A 3P9WB 3O6ML 1E8ZA 2WXGA 4EMZA 2YGOA 4KOCA 5HHXL 2ZCZA 3RQ3A 4PJXF 1QSEE 3FONA 1DSFH 1GZQB 5ENWB 5I1DA 2X4RB 2N7BA 1SXZA 4RISL 1XB3A 1L7IH 5GPRA 1NFKA 3UDWA 1NOFA 2AHIA 1UA6L 3Q44A 4PWIA 3BHBA 1F2XK 5CINL 4CMMB 2JKJA 1W2KT 1FL5A 5C09B 1IC1A 1YMHA 4OZHE 3HC3H 5BV7L 3EYUL 3GPSA 2KDYA 3BH9B 4ZSOB 5AW0B 4KKBC 4BK5C 2XN9B 1E67A 1UEYA 1IEHA 5EU6E 1WFJA 4D2NA 4DGVH 2JFCA 4LSQL 4NZRL 4TL5A 1PNCA 1ETZB 1RH8A 1MFBL 1ZSDB 3LIUA 3BRDA 1I3UA 3MX0A 1A6TB 1HZHH 6FABL 1TT6A 4PV1C 3SKOA 3TN0A 3RFZB 1MCSA 3BISA 1A2YA 3QEQD 3KBEA 3B5TA 3V5DB 1QPKA 1YECL 5ADOH 1A6VH 4J6IA 3A6OA 4PP2A 3VI4B 2UXTA 1YYLH 4PLJD 1L4IA 4UOW1 4PRHE 2BHZA 3VXUB 3AU1A 1DQML 1QRNA 4FQCH 5J1AB 3DYMA 5GS2H 1MRCL 5FYLE 4X0KB 2NTFB 4RMUA 2VQTA 2W9LA 3TV3H 2DQEH 3QEGL 1P5UA 1RZFH 3C60D 4PGBB 4R26H 4XBEH 5DD0H 2ZKHH 2AV1A 3ARGD 1NGPH 5JIDA 1KPVB 2AAAA 3TL5A 3AVEA 2YXMA 5E9DE 2E76C 3QDJE 2AJXH 1S7WB 5HHPB 1BEXA 3GS7A 4EIUA 2MMXA 3FCSA 4HQQH 4U1GB 3ARDC 1E6JH 2BNUA 5D9SA 5FF6A 2UWEE 3BAKA 4S1QL 3S36X 3OMNB 3EH4B 5EIVA 3N55A 4AV4A 4JFQB 3UC0L 1RMFH 3PWLA 3LHAA 1A1NB 1LO5A 4F2MA 3IPFA 5F3HB 1E2ZA 3WXWL 3BE1L 2CLVB 5FWQA 1GMEA 2Y06H 2VLRB 5KW9H 2MIZA 4XOAA 3L3IA 1B4TA 1HZKA 1RLWA 4FDWA 4ZRGA 3WLBA 2AI0H 4S10A 1FUNA 4IKNA 1ZPLA 2PUQT 5E6UB 5T3ZH 4A55A 3GI8L 3BEWB 4E0RB 1QR1B 2N0MA 5C0JA 5K39B 3QHZL 3KYKL 1ZMYA 1OARH 5KWYC 4PR5A 3WMSA 4MB4A 3OGOE 2F58H 4M6OH 2CHWA 1X7QA 4PN6A 4Y2DB 1OW0C 2AK1H 3BIAX 4I0PA 3L1OL 2XI9A 4UU9A 2YJLA 2ICEA 4NUMA 3LEVL 4HKXA 3OGCA 3P3UA 3BUPA 2NNRA 4NSKA 3D7PA 1MCWM 2ZF8A 2PN5A 3HTLX 5DVMA 4OIFA 4PJIF 4NUJA 2Z35B 4X7TB 2FQGA 1XH1A 3QISA 2J5WA 4KMTL 4WNQA 3ULVF 2VJXA 4BM7A 3FB5A 2VM3A 1M6OB 4X2UA 3GJFB 1SUJA 1A6WL 3L4WA 4HH9A 4D9RD 3QIUB 4EBQH 1GCFA 1UZ8A 4FP8H 3V79C 3IDUA 2CDFB 3B9KD 3KPRA 5MP6L 1EGJA 3FK3A 1QWUA 3CVBA 3HNTH 5A6MA 4P5SA 3NFSL 4EN3B 3C87A 3CZEA 5BRZA 3VMOA 4C56B 3LRSA 2CDGA 1SEQL 1TG8A 4I5BA 5E6IC 5DRXA 3CX5K 2HTLC 1UQSA 2D2OA 4LVHC 1W0WB 5DUMH 3CSYA 3M17A 5D7JD 5DS1A 1I4FB 4PJ5A 2UY6A 4JRYD 2WWNA 4PJXA 1RULL 1ZCRA 5IB5A 4QRTA 4BWUA 1KYFA 3BPCA 2OL3B 1MY5A 5CEZD 2D3LA 3B2XA 4OZFB 1EZLA 5L8JB 1CC3A 1MPAL 2D31B 3QXUA 4JZJA 3HG5A 4PB0H 3WUWG 5GS0L 2YFOA 5HJ3A 5I66A 3CPUA 3C5SB 2EEDA 3UBXG 4HCRH 3V9EA 2A0LC 1DJGA 1LWJA 3LKRB 4ZQKA 1S9WA 4P4KC 1THAA 1L0PA 4R8WH 1J1OH 3L4ZA 3NRQA 6TAAA 1E4XH 2PCXA 5C7XL 1N3NB 3POCA 3RB7A 2X9XA 1UG9A 2P24B 4UTBL 5E56A 3X1FA 1PFOA 1XV8A 5GGTL 4DKEL 3HS9A 3KPQB 1ORSA 3OJMB 3VYPA 4JO5A 1IAIM 2E4FA 4X8XA 2OBGA 1IC5H 2VDLH 4QTFA 3SO5A 1T03H 1CXLA 3JXAA 4QGTA 3GBEA 5AAWA 3GMMB 4JEGB 1FFOB 4HPHA 1QATA 4NZUH 1HQ4A 4D0DA 1M53A 3QCVL 1KV7A 5B1CA 1QFHA 4RWHA 4QRRE 4G3YL 4UQBA 3F8UB 3M1BB 4AE0A 2VN4A 1SY6H 1PD0A 1LE9A 4QNPE 1SHWA 5I30L 3S88H 1DBMH 2ZWZA 5FEBA 4GO9A 1IZJA 1NGQL 3U30C 1J0YA 1S7RB 1U8OA 1D5IL 1TFPA 4Z7WA 5D6DC 3LMJL 4E5XG 2EINB 4J3UA 3DJZA 2MCPL 4UM8B 4U1MA 2O6DA 1RIVH 4PGDB 2HMIC 3I3DA 2XZCL 3TURA 3BSZL 1PYWB 1MXDA 3ARDD 3L1FA 3P4MA 3AWGA 3O3AA 1D6EA 5GZND 1N4XH 4QRAA 3M1CA 5HYSG 1V5JA 5LBSL 1J0KA 1P53A 2MQGA 3IN0A 5A2KH 5AW1B 1B4RA 3BPOC 4WZ9A 2P5EE 3FSOA 3PFUA 4NRZB 3QO1A 2BDNH 1ANUA 2NPLX 5E5RB 3STBA 3V4PA 4G6ML 5B4MC 4X6EA 1PLBA 1S3KL 1W15A 1J10A 1KEMH 1CWVA 4F33A 5CLZA 4GUPB 5DI8B 2WW8A 4A6YB 1CXEA 3MNZA 5ITFB 3VWJC 4RA3A 4BUHA 5IUCA 5SX4H 4Z3TA 4LLDA 1XGYL 3ZR5A 3CHSA 1W0VA 2QQKH 1SM3L 4EI5C 4AKPA 3T2OA 1BJ1H 4PW9A 3EJUA 4XPGH 2Y3NA 3BWAB 5IF0B 5GGRY 2OS7A 2NY6C 2OMUA 4XXDA 4G1EB 3PNRB 1MJ7L 2G4EA 3G5VA 4NT6A 3DX8B 1BVLA 5IFJA 2E9BA 3LRLA 3QJTB 4NYLA 2N56A 1S7QA 3QK0A 1PZCA 3CSBA 4LSUL 4PJIA 3MBEC 4HIIB 1P4BL 4M6NL 4HWNA 1IBYA 5CZRA 3PLYA 4K3DL 1F1GA 4FXKC 3OZLA 4XXWA 5I0DA 2R1XA 1SVZA 1KBVA 2EDKA 3QJOA 3ZHNA 2X4QB 3WFBH 4KROC 2W92A 1WEJL 3UTQA 1LE5B 2Z0UA 5DVPA 5ID0A 4LOVA 2MEJB 1A9EA 1F6FB 3P30L 4MMZB 1KLGB 5I82A 2ZXAA 5GGRB 3QFJA 3BLPX 4H0HB 4TVUA 3D0VA 2C1OB 5LN4A 4WRLA 3BYTA 3ZE1E 4YHYC 1BQSA 1OPOA 3ZBMA 3GDCA 2VMEA 1BQHA 1PLCA 3L3GA 2YR3A 1BAFL 2GCYB 4G8GB 4AJVA 4HS3B 4NQQA 4JJOA 2VLKB 4W6YB 3RY4A 5LHDA 4YQXH 2GBAA 1NIBA 4N2CA 3VB8A 2IQAA 1QUPA 2NSXA 4Q4EA 5E6ID 1G0YR 4JPQA 2G75B 2HTLD 5TH2B 5KS9B 5E4IA 2A9NH 4KY2A 4UDUA 4LOFA 4OBRA 2DI8A 3QUXA 1JDCA 3QUMH 2XQYA 3D09A 3K91A 2QGBA 4L29B 3MA7B 1DQIA 3MR9B 1RZ8B 4N0RA 1T22B 1X4ZA 3ULUL 4DGUA 2ZXQA 1A8ZA 4LHUG 1JK9A 1DSWA 2MQCA 1NEUA 4KK8C 7FABL 1XEDA 3T65A 1D5XA 1QBLH 1Q9OA 1YO4A 3REVB 1A6UH 4L37A 4NWUH 5H37A 1F11B 2ZWYA 4A7UA 3CG8A 1OVZA 4P4KD 3L3HB 1DSYA 2HG5A 3ZY7A 3L95B 4YPGB 4ZMQA 5FC9A 3HR6A 5F0JB 1GYUA 4GRLC 4JFXB 2DIJA 3GLAA 1G9ML 5H8DA 2VW4A 3B3IB 4B60A 1OAYH 2DJMA 3VH8A 3L6FB 4BH7A 2UUDK 3BKYL 4HIQA 2F15A 5ESVB 4EI0A 2GSGB 2J21A 1N68A 1T0PB 3DK2A 3SY0A 4M1GH 1YMMA 4M8VA 3W9DB 2YGVA 5D5MB 5F7EL 2YUWA 4ZO9A 4YSUA 1JGEA 1HEZB 2GY5A 1YC8A 3UEQA 2MPAH 2COQA 2NY2B 2XX0A 5HDQL 1TZ8A 2C7FA 4WWKC 1RUAL 1HE8A 2YBRB 5DWUL 5JNYA 1QD0A 1YQVH 5DYOA 1PY9A 5DVOA 4JDZA 4BXVA 5GJTL 4I2XE 1TSRA 3D85B 3KPMA 3QC6X 3MREA 1M71A 5J0BA 4NO5B 4GNKB 4KK9C 2OTPA 4QLRA 5FYLL 2ZZUT 5CMAB 4OFDA 2Q87A 5FUZL 2VM4A 1OKEA 2ZKMX 2Q86A 3Q5TA 4L4TE 2FTAA 2E27L 4X4XA 1P5VB 2PCFB 2ZONA 4CU6A 1CURA 4HUUB 4YZFE 5HHXH 5H2BA 4RQQB 3DIFB 4HIPA 2HMID 4WWID 3UXFA 3EG9B 3QUYB 1U93A 4AZ8A 4HUVA 4Q2ZB 2OMWA 4AYGA 1I31A 2BSSA 3RGBA 1RPUA 1UA6H 2VDOB 1E9OB 2LAAA 3OMIB 3LN9A 1FVCB 4XODA 5IEKA 5CINH 4L8SC 2PWDA 4QRPD 3QCTH 3C6LC 4HUWA 4KTYA 3WUZA 3KPPB 2H5UA 5BV7H 3EYUH 4NGHH 5B4MD 1WZAA 3WY3A 1KXQA 3X11A 4CKQA 4WW1B 1TNNA 3FO1B 1N64L 2WYTA 3Q2NA 5E6YA 2UZXA 5EOTA 4LSQH 4B3VA 4NZRH 4H0IA 1AGCA 3VWJD 2P5WD 4AH2A 1MFBH 3FU7A 3U2IA 3BKCL 4LLVB 6FABH 1CFSA 2XWRA 2ZX6A 4J2XA 4EI5D 1RHFA 4OZ4A 3TJHC 3HLKA 4WHCA 5JORA 1YECH 2NNCA 2VQ1B 3UO8B 2B08A 4D9RE 2NY6D 4XX5A 1E3FA 4R96B 5EOCL 1IL1A 3DKHA 4ONFL 2C3HA 3QQDB 4DVBA 3AM8C 3ARFB 1WJ3A 1DQMH 2IVFC 4QOKB 3MODL 3QXDB 1MRCH 3MBED 1JPEA 1NIAA 2A6JB 2YS4A 4MNHB 3KWVA 3HBGA 2KMWA 1P7QB 5KYYB 3QEGH 5D1XA 3PAYA 3LQAL 5HYIA 5IFHL 1KBBA 4KROD 2FB4L 1KNOA 2GIXA 3DGDA 4JRYE 4KDTA 5HVGB 3TTSA 4DP6X 5HJBA 2IAMB 1KY6A 2BVOB 3DI3B 2J1YA 3IWUA 3GSWA 5CEZE 3L7FB 2DJSA 2DKMA 1UB5B 1XX9C 5HDBB 3BN9D 3V4VA 1PY0A 5TE7H 4S1QH 1NCBL 5A40E 5IB2A 2NX5A 4JFDB 2Z64C 5FWRA 3UC0H 5IW6B 2E7CA 3F5WA 3VGFA 4ODTL 4P2QB 1H6FA 1KC5L 3WXWH 2DWDA 3BE1H 2J8UB 1S9XB 1BMZA 3DA0A 3KXFB 4XPAL 4PJAE 2Y4SA 4JRXE 3RU8L 1ECZA 2ESVB 4A37A 1XMEB 1SLWA 4KXDA 3CHXA 3DC0A 1OY3B 5F1IA 1JPTL 2DL9A 2FO4A 5EDXA 4UZGA 2E3VA 3DETC 4N2IA 4GKNB 1XR8B 5C7ZA 3Q13A 3FB8A 3KYKH 1M4KA 3KPSD 4Y4HA 3VFSA 4KK6C 4Q74A 4KWUA 2F61A 4KK8D 1UJ3A 2KBGA 3FO9A 4HWBL 4LKXB 2CHZA 3HBQA 1HE7A 3HAEG 4GIPD 5I19L 1YUHB 3SDAB 4HK3N 1V3LA 5DVKA 2YD5A 1ZGLM 5AVUB 3T6ZA 4PJEE 2OSLB 4WUUB 5IOPA 1AP2B 3EZJB 3LEVH 5DQDL 1ASOA 1MCKA 1CGWA 3IDGA 1MFAL 4GRLD 2E59A 2YC1B 4I87A 4QRUA 3SDCC 3GJFK 3ARQA 2GBVA 4RGMB 5AB1A 1J12A 5DHXB 4NHUB 3SBWC 5BXFB 1SYSB 1Q0YL 4PRNB 2AP2A 3BZFB 4LHJB 4J3VA 3SDXE 3DVIA 5F88B 2ZNWA 5DWPA 1QVOB 4QRSA 4WO4B 2V2TA 4FNLL 4QF1A 1KELL 4YR6A 1A6WH 3BWSA 3F7VB 3GMPA 4F7CB 1AHWC 4WO0A 4ZXBB 1E28A 1MFVA 2Y2YA 4RFNC 2QZQA 3O3DA 2ZWSA 2XN2A 2WXJA 3EBHA 3NFSH 5I6LA 5KSAB 4WWKD 3TX4A 1LD9A 3BDXA 1CLOL 1A4JB 1U3HA 3MRCA 1EMTL 2AJVL 1AQDB 1U92B 1F41A 1X5GA 5JOEA 5EORH 4MBOA 4Z7QE 2OJZL 4KK9D 4H13C 1F56A 1RULH 4XXCC 3ROLB 3SE3C 3IFNL 1TZOA 1BYOA 3PWNB 1JXKA 2WMPA 2YPVL 3MN8A 3S5LG 2ADJB 1BFTA 5IMMB 5GS0H 2WGXA 3C9NB 1YC7A 3ECVA 2DWXA 4XCFL 3QRBA 1DUZB 1UGNA 4X6DF 2ZAGA 4BK8A 4KO6A 3P9LA 3C6SA 1FO0H 2QSCH 5CEYB 2EDOA 3P4LA 5C7XH 1SMDA 3C6LD 2NMSA 5DJ6A 4TV3A 3ZYZA 1YUKB 1ZJBA 4UTBH 4WI0B 4XP9L 4DKEH 5GGTH 1T7XA 4Y4KA 3FQWB 3WHE1 1JXFA 4FI7A 5F7LB 3DYPA 4Y5XB 3BWUF 3SGKC 3GMRB 5D4IA 3TYFB 1I7UA 3L9EA 4FFVD 4N2GA 2WCPA 5F8RC 5B21A 5BQ7B 2JIXB 2I07A 3QZPA 2Q3ZA 4LGRB 4GP5B 1FAIL 1FQ9C 3OKMB 4QJ3B 5FS5A 1YG9A 3WO4B 5EIIA 3WJMA 3QCVH 1KDIA 1QI4A 4XB7A 4AYBA 1I1RA 5SV3A 5TK4A 2HKHH 4AQEA 3CIQA 1IGTA 1MCOL 2R2EA 1DBAL 1KBKA 4X7SL 3KLHC 4G3YH 4XWGL 1CI5A 5GRXG 5HGDA 3HG1E 3L3KA 2HX8A 1UD4A 2WXLA 4GI8A 4GXFA 4MQTB 2DIAA 5I30H 1MHHA 2H7WA 3PYCA 2GVYA 4HUCA 3D3VD 3KGTA 4EZKA 1MJ8L 3MLTA 4WSGA 1A7OH 3DRTA 4S2SB 3IAQA 3U6RA 7PCYA 1D5IH 3LMJH 2PPFA 2L7QA 3WDHA 3I6LD 2MCPH 5C0CA 4M61A 4P5TC 4ZFQA 3STLB 4PVMA 3ZR6A 1XGTB 4DKAA 3QR0A 5D72L 4Z77B 5D7IE 2XZCH 3OR7B 3BSZH 4G7RB 1T2XA 4XVJH 2XU9A 1C16B 4NQTA 3WN5B 5KSUA 2RALA 1C7TA 5CBEA 5LBSH 5BPPA 1AI1H 1NCHA 4I7ZC 5CIPH 2GHZA 5SX5K 4Q97A 4KOBA 4CC4A 3HZMB 3QJUB 4J2QA 1UWGL 3FONB 2GJRA 4G6MH 4UQEA 5K9KA 5DQJA 1S3KH 5I1DB 1RXLA 5F1OB 4K55A 3BUIA 1ECYA 4KX8A 3QORA 4FNSA 4HCRA 1J88A 3IM1A 4EXKA 3A6BL 3BHBB 3DETD 1XGYH 4R84A 1FL5B 2KL6A 2IWGA 4CSTA 1YMHB 2D3NA 4KK6D 2ED7A 5A2FA 1YNKL 4DP4X 1UYWL 2ZIDA 3NGBC 2NR6D 4F80A 3UMTA 5IHBA 4FLOA 3HRPA 3QJRB 5SWSD 3CDZA 1MJ7H 1NPJA 5MEOB 3QG6A 4LARH 2YQGA 3MX0B 4LSUH 3SKOB 3TN0B 4LMQE 4JX0A 3PUUA 3BGFB 4M6NH 5I5RA 3TT3L 5B7MA 1A2YB 1WAEA 4K3DH 4P57A 4AK1A 3SDCD 3WNPA 2JV6A 1F6AA 2CIKA 1YJDC 5KYXA 5ALCL 4PP2B 2PNDA 3NOIA 3RIAF 5INCA 1WEJH 2Y22A 3QWNA 1CTNA 2PR4L 4OUUA 1SY6A 1QRNB 2I60L 2DYPD 3MNDA 2JI3A 2PO6C 3RDTC 3VU2A 4ZMOA 4GQ9L 1P5UB 3KL0A 3SPIA 1DQJA 1VSCA 1T1XA 1VJSA 3TJEH 5L7XL 1MVUA 5FGBC 5FM4A 4I18C 4EN3C 3T1WA 1AVAA 2YXVA 2ODHA 3GSOA 2DM7A 2BNUB 4QRPE 3NCFB 4QPEA 3QWQB 5D9SB 2Z1PA 4YLQT 1JD7A 5FF6B 3NCXA 4YXHL 3TBTA 4LPUA 3VWKC 3MV9D 3PWLB 1N8OE 4POUB 1FBIL 3A23A 4QXGL 3T09A 5A16A 4Q9RL 1LO5B 4F2MB 4DIXA 2OSXA 2XVBA 3AB0B 1JZ8A 3TGXA 3ULUH 3OKDA 2JJSC 2VKWA 4LGSB 2KI6A 4NX0A 3V7MA 7FABH 3L3IB 2EO7A 1GHFL 3A21A 4X6DA 5C0AD 3VXSA 4JFWA 4L4VA 1E0OB 3WLBB 3WKML 2X7LA 4BFNA 3P54A 4UMGA 2YWYA 5JIMA 4XNZB 1GW0A 5C0JB 1XXFC 3NA9L 3LJ3A 3STZA 3O81A 5HVFB 4PR5B 5D1QD 2HUHA 1G9MH 1ADWA 1F13A 4I88A 5KBNC 5IBUB 4G8AC 1X7QB 5E1QA 3WEMA 3FQ2A 4I0PB 3BKYH 2WXQA 4GKSA 4UU9B 2E86A 1SJHA 1TYJA 3UABA 2ICEB 4HKXB 3OGCB 4PD4J 5C08A 5MI0B 3VXRD 2YSTA 1AJ7L 3FU3A 4OI9A 3ATEA 5F7EH 2B1OA 5DC0A 5AAMC 2G3XA 4NUJB 4U7KA 4TUOA 4JMXA 3TA3A 5D7LE 1QQDA 4F8PA 1YY8A 4WNQB 5HDQH 1E65A 1RUAH 1U2HA 2VUKA 3FB5B 1BLIA 5DWUH 1HL5A 4XBPA 1ZVYA 4UYPA 1E27A 1WVZA 3K4AA 4G5AA 5GJTH 5FX3A 1RPQA 4HH9B 1EIBA 3JVGC 4FKKA 1UZ8B 4Y5YA 4XMTA 1T7ZA 4UZUA 3KPRB 4JM2C 3QI9A 5FYLH 3M1OA 3FOMA 3L3OA 5FUZH 4QT5B 2CG9X 2YRZA 1Q9WA 2NLJA 2E27H 5BRZB 3LRSB 4P5TD 3GBML 4I5BB 3NSDA 3DV4A 5IJVA 5DRXB 2E9GA 3VD4A 3KPSE 1T5XA 1UQSB 2OR7A 2VDNL 3CSYB 4BZ2L 3M17B 2X4UA 1JYXA 3AY4A 4PJ5B 1F1DA 2UY6B 3WFZA 5L2KA 2DICA 5IB5B 4QRTB 1DCLA 3BPCB 3RJOA 4ZO6A 4MAYC 1K9TA 1WSST 4I3SH 3JYBA 3MXVL 4H1LH 4HEME 3S98A 4OFIA 5GS3A 4JZJB 5KSBE 2NXYC 3G08A 1ZLUH 3CVDA 3ORJA 5HJ3B 3HBPA 3QHTC 5I66B 1N64H 3CHPA 3AABA 4U3CA 3LIZL 4ZQKB 1S9WB 3FCGA 2FCBA 3BKCH 1TTUA 3RIFF 5TQ2L 1YYMH 3BMWA 4NKOA 4Y7MA 5K69A 3ZRFC 2P8LB 3WIFA 2RB8A 4DPBX 5CZKA 1ORSB 2KLTA 4ZZKA 2R2HA 4IOFD 5EOCH 2X44D 4ONFH 1MCCA 4KXZI 3U0TA 4ZNCD 3EOAA 4OV6F 3IF1B 4UOQA 2ATKA 4XR8C 2XLLA 2QADB 5KOVC 5CGYC 1EVTC 1HQ4B 4D0DB 1AS7A 3ATAA 3LQAH 2CJSA 4AC4A 5C0DB 2FB4H 4WI4A 4AI7A 1EHLL 2VO8A 1KIRA 1FVDA 1LE9B 3DHUA 4EOWH 4ELKA 3X12A 4ABWA 1OE3A 2K70A 2PO6D 3RDTD 2DYSB 2ENYA 1A5FL 2WOBA 4AIXA 1W8EA 1U8OB 3N40P 1NCBH 1E7UA 4Z7WB 3FRPA 1MVFA 3THML 2DLIA 4X50A 4NN7B 2VDML 4ODTH 2NY4B 4OIAA 5CD5C 4DCQA 1TO4A 1ZXQA 4U1MB 1TTAA 4ZTPL 1Z5HA 3S3SA 1RZQA 4EN3D 5AVWB 1BGXL 1U30A 4ABQA 1OE1A 2IQ9L 4XPAH 4GRMA 4UT6L 3P4MB 3ZHLA 1YN6A 2GC4C 3ARUA 3O3AB 1D6EB 2GJ6D 4L9LA 4WEUD 1BWWA 1QI3A 3VWKD 2XV2A 2K3HA 4N8UA 4N68A 1LVEA 4OLUL 1JPTH 1WUZA 1NIFA 1D7FA 3ULSA 3QO1B 4N28A 2OK0H 3C2AL 3V4PB 3TBYA 5B1BB 4LVNC 4YHMH 4X6EB 3UACA 3TCTA 2MNJB 4HWBH 3PCYA 4F33B 4A04A 2ZUYA 4KKZA 5I0VA 5I19H 3L5WA 1Q1JL 3MNZB 2BH0A 1ZANL 1QLEB 2X3BA 4P46C 4LLDB 3O9WA 5K1JA 1W0VB 4FMKA 1MFAH 1EFQA 4JQVC 1RPKA 4OZFG 4WNSA 1N6QH 3D3VE 1BD2D 2O72A 2OMUB 3FCTA 2WXMA 2E6JA 4XXDB 3G5VB 4XPTL 4M7LT 4FD0A 4NT6B 4WGVB 1BVLB 5IFJB 4L48A 3GKWL 1S7QB 2CUAA 3I6LE 5B22A 3RHWF 1RUML 4FNLH 4JFFD 3UAEA 3MDJA 2R1XB 5AD0A 1V54B 3V0GA 1T0OA 1E2WA 3UTQB 4G43A 3QRLA 1NMBL 5ID0B 1A9EB 4W70A 1TVBA 3QEUA 1CLOH 1K85A 3QFJB 2AJVH 1DEEA 3D0VB 3MRQA 4MNQA 4WLCA 3VGHA 3RTQC 1BQHB 1IM9D 2H0FA 4U05A 2OJZH 3L3GB 4BDVA 4O2FB 5DD3L 7PAZA 1PG7W 1BVNT 5ALBL 5L6YL 1AMYA 1QASA 5C6TL 2PABA 3MJ9L 3QQ9D 2YPVH 5D2NC 2IQAB 4DKFL 5HY9A 4FYSA 4IMKC 2R1WA 1KN2L 4UDUB 5BMFL 3S8GB 4Z3IA 3EUUA 3PWJA 3QUXB 4XCFH 1TIUA 4O00A 1BXUA 1GS7A 2H0EA 5SWSE 3RWDA 1H15A 4FQJH 3FT4A 5FA4A 4ZMLA 1JK9B 3P11L 2FWOA 3GM0A 3G6JF 4ZW8A 5JA9A 1OHZA 5BRQA 4ZOEA 5D2LA 3T65B 2NXYD 1D5XB 4XP9H 1Q9OB 3V8OA 4IKJA 2QGCA 2X0UA 4L37B 1QO3A 1SZNA 1VFOA 2B8OT 5ICYA 3S3DB 2HG5B 3E8UL 4PBWD 1KFGA 1MCQA 1X44A 4P2OA 4TQPA 4C4BA 3EDKA 1F8TL 1D9KC 1WAAE 3KEHA 4UINH 3VH8B 3DNKA 4IDJL 4BH7B 5DJYA 4TNVK 4R0LA 3U0PA 1MCOH 1DBAH 3COOA 4X7SH 4XWGH 3SY0B 1OIOA 3ABMB 1YMMB 4JQXC 2CM6A 2B15A 2IH3A 3NCYS 2IMNA 3ATFA 1QFWM 5F71A 5CGYD 4XMPH 5T1LB 4Y19A 1JGEB 1IT9L 5DEFA 1UT9A 1P7BA 3MV9E 4JUTA 2F7OA 2W59A 3DDGA 3PGCA 3CHQA 4K3GA 3VQ2C 5DYOB 4AW7A 4Z7NF 5I75B 4HUXA 4MHHI 4JDZB 1FP5A 3OPUA 4FTVA 3ESPA 5D72H 4F7EA 4K23L 2EEBA 4PQXA 4Y16A 3NN8A 3KPMB 4JFVA 3MREB 1M71B 3MNMA 5C0AE 2VN3A 1P9MC 2J25A 5CWSA 2Q86B 1YPZF 3MV01 4L3FA 4X4XB 3GXNA 4XPHH 3CUPA 5CD5D 1AR1C 4BZ1L 4R3SA 5H2BB 3G6AA 1UWGH 3MO1A 3EO1A 1ZV9A 3T6XA 2IBBA 3CFKA 5JMOC 2OMXA 1TCRA 4PLKC 1U93B 3ULUF 4AZ8B 1I8MA 4N2KA 4ZOBA 2OMWB 4PVNA 3VE0B 2BSSB 2DQUL 1TPXB 5I8KL 3A6BH 4ODXA 1TLKA 5IEKB 5IY5B 4XWOD 1FO0A 3S4SA 3K8MA 2NZIA 1QBAA 4HUWB 4K73A 5FKPB 2X6VA 4GFXA 1LWRA 3VXRE 4WCYL 1YNKH 1UYWH 3X11B 4UTBA 4FQ1L 5GGTA 3S34L 1WF5A 2UZXB 5EOTB 2FT6A 3L4VA 2ZUTA 1XMWA 1FCCA 1AGCB 2HAZA 1SVBA 5F7NC 4AH2B 1XF2A 3FU7B 4Q58C 5EEUA 4CMHC 3HIZA 5J7CC 3BIBX 2J7LA 1CFSB 4Z1PA 5A7BA 1ND0A 3F05A 4MRCA 4HZAA 5F3FA 5AW7B 4OZHF 2F54E 3RPBA 3TT3H 2CO3A 4OZ4B 3D4YA 5ELIA 1SXAA 3ESMA 2H32B 5ALCH 5TF1H 5PAZA 1IL1B 1E5YA 4EVNA 3NFNA 3GI9L 4DVBB 4NC2B 2I60H 5B3JE 3MRKA 3JUZA 4Y9EA 1WTLA 4WUKL 4GQ9H 1PZSA 5D1XB 4BQCA 1QW9A 3K2IA 5DGQA 4JFHD 3ARBA 3NAAH 3UZEC 1KNOB 5F7HA 5L7XH 2H1LM 2XSKA 3MSPA 5AZEL 1ES0A 4AGQA 1UEMA 4X4ZA 1JBJA 1GXEA 5I71B 1FZOA 1MOEA 2FWUA 2GSIB 3GSWB 3Q06A 2VRQA 3BSZA 1GTNA 3TBSA 3GM8A 4NAQA 3V4VB 4Y4FC 1UD3A 5ACMA 5E03A 3RTQD 4YXHH 5IB2B 2NX5B 4RRPG 5LBSA 3CLFL 4CSZA 4QXGH 3F5WB 2IJ0C 5CIPA 2Z7YA 4X4ME 4KKQA 2XQBL 2DWDB 1L5GA 4WV1C 2PTTA 1FLRH 2G4GA 3SCMA 1GHFH 1YZZA 4Y9FA 5CJXA 2UWEF 3WKMH 4W9EC 4GY4A 2R9HC 4HAKA 3FH7A 2LTQB 3G6JA 1GC1C 3FMGL 5F1IB 1NMCB 2FO4B 1YLBB 5I74C 4HALA 4Z3EA 5JZ7D 1VGKA 2AEWA 5KOMC 3U4AA 2DS4A 3FB8B 1I8IA 2A6IA 4FA7B 1DFBL 2VXVL 3CXFA 3NA9H 4Y4HB 3QQXA 3VFSB 2WVUA 5FUOL 4CDGC 3O0RH 2HRLA 1GIGL 2I69A 2ZP9A 4OH2A 1G7JA 3FO9B 4XPBL 2GC7C 5E7FA 5DQ9A 1SDAB 3X2QB 4YL9A 4BJLA 3NEEA 1A22B 4KZ0A 3CJJA 3SPVA 3U83A 2D7QA 2NDFA 5IOPB 5J6SA 2FZ3A 2LQRA 1ACYL 3IDGB 4OLVL 1AJ7H 2WNWA 1F3JA 3DDFA 1TR7A 1IC7L 2ZICA 4QRUB 2LU5A 3PXJA 1OM9A 1D5ZA 2G2RA 1LQSR 15C8L 5AOMA 1E40A 1I1CA 3V55A 3D18A 4OBSA 5KYUA 5J5EA 2R4SL 4QRSB 4YDKL 2V2TB 5CJOL 4QF1B 3SGJA 3QXAA 4YR6B 4NN6C 1ICTA 3GMPB 1TFHA 1IAIL 3BDBA 2WV3A 1E28B 2AV7A 2DLHA 5BS0E 4DOHB 3O3DB 2GJ6E 4ADIA 4P2RD 2HYMA 4J27A 5I17A 3M7OA 3AXIA 4X9FA 1LD9B 2WSKA 4M9OA 1KB3A 4K5MA 4XRCA 4Y1AE 2GABA 4GI9A 4NO3A 3GBMH 1U3HB 3HG0A 3BPNC 3MRCB 4XI5C 4FXGC 4ZAKD 3ZKXC 1YPZA 4MASA 3BYYA 5B7EA 4BZ2H 4F57L 1MVYA 5ADPH 1I9JL 2APBA 1W72L 5DZOA 2J6EH 3QS3A 4MJHA 1DDTA 2C3GA 1PZAA 2WMPB 2PCPA 3LZFH 3MXVH 1IGJA 2JJTA 2APVA 5C07D 1AZRA 3F7QA 5IQLA 2NZ9C 2OMNA 4PLKD 2G30A 3M7FB 3B7YA 2HT3C 1S4IA 1QSEA 4KZEL 3LIZH 4WGKA 1BA9A 3P9LB 1QSFA 3C6SB 3QT2A 2W5PA 1KLFA 3WNOA 4BH8A 5DJ6B 4KAQL 3CBRA 1QHPA 4JFFE 3W56A 2OCFD 3OPZL 4Y4KB 1QWNA 4LOEA 1VAHA 4UI2A 2O93L 4OZHA 1RFDL 4HUKB 3UO1L 3SGDI 4HFWA 3VGDA 5EU6A 1I7UB 2I07B 4LCCA 3N1QC 4LSRL 1AFVL 3PHQA 2GKIA 2Z9TA 4XNQB 5EIIB 3T8XA 1HYSC 3WJMB 2QVIA 3ZRSA 2XWZA 1DUYA 4XH2A 2Q7AA 4AQEB 2NY3C 1IGTB 2R2EB 2B77A 1EHLH 3S36L 5HGDB 3WLWC 3L3KB 1KIQA 1IKOP 4HXBL 1FL6A 1MHHB 4CJ0A 4U49A 3V0IA 4OSUL 3DPDA 2W1NA 3WNNA 2M1KA 3MLTB 4DP8X 3DRTB 3U6RB 1FYTD 4M6ML 5EF0A 3THMH 2VDMH 3AADB 5C0CB 4M61B 4WKXA 1HDMA 2FSEA 4QNPF 4ZTPH 3TH4T 4M7ZB 4FKEA 3NIGE 1UD6A 2IQ9H 1L6PA 1HK6A 5E9DA 4UT6H 3UPRA 2YKKA 1C12B 2AEPL 4K5LA 5LDSA 1Y18A 5CBEB 5BRPA 4ENEC 3U4BL 4BFJA 2VJ8A 1KENH 4OLUH 2Q1EA 3Q2VA 4YOKA 4FHBD 4H1LA 2UWEA 4KBPA 1KLUA 5I18L 3REWA 4H8UA 3GO1L 5K9KB 3B1UA 5DQJB 5HHOD 4FNTA 4L8DA 4NPJA 1X9UA 4J4PC 3QORB 1Q1JH 2W81C 3UMNA 1ZANH 4LK4A 3WGVB 4ZW3A 1NFIA 1MW0A 3G5WA 4YSTA 1CLCA 3QPXL 5B39A 4OLYL 1G84A 3MRMA 2EDWA 3D2UA 4X8JB 1DHKA 3CDZB 2VXUH 2NY0B 2ORBL 4XPTH 2VDLB 2K78A 2PCYA 3QG6B 2E7LC 3FHQA 3GKWH 3ERXA 3MKKA 4L1DA 5JHDE 2Q10A 2AMGA 4DZ8A 1U4EA 2VIRA 4P57B 1RIHL 5ACZA 2CIKB 5KYXB 3ECBA 5AL0A 1F1AA 5INCB 4M7KL 2DQFA 4OUUB 1NMBH 2IH9A 5A6IA 3U6XS 1PX4A 2PW1A 3BESR 2UVEA 4PWGA 2EEXA 3JT0A 4IMLA 4DK6A 3SPCA 2YIHA 1AZVA 1HNYA 4P3DA 4BUGA 1DQJB 1TZIA 3AQYA 1T1XB 3NEOA 1J8HE 1MRFL 3CX5J 5DD3H 4XBGA 1S7SA 1G6RL 2EE0A 1MVUB 4FCHA 5ALBH 5L6YH 1EV2E 3K0YA 1NKRA 5AOLA 3ZHKA 3IGLA 4L5FE 3MJ9H 3ARED 4DKFH 2Y7QA 4UT7L 3TPKA 2DLEA 2VDPH 4O02L 5K5YA 3TBTB 3KCWA 1KN2H 1M1XA 3VI3E 3FQ1A 3ZE1F 1MRDL 5BMFH 1IGYA 4HG4J 1BFSA 5A16B 3QZNA 2EO1A 1DVYA 1IE5A 3NSCA 4ORZC 3BGMA 3OKDB 3MCYA 5DD6A 4I0CC 3P11H 4LF3A 4YS4A 1KTBA 4TPRL 4X6DB 1S9VA 2BIPA 2NZ9D 4HWBA 3VXSB 4A2FA 4L4VB 4CGUB 4KXBA 2X7LB 1U8IA 2OTUB 5E0FA 2XWBA 4LOUC 3RIKA 1YVLA 3GJEB 3N0AA 4DEPB 4AWJC 5J13B 1K5NA 4N8CL 3STZB 5IT2L 1F8TH 4CBPA 4P07A 2ALAA 5FKAA 4H40A 4KJWC 3VG0L 4IDJH 3R4DA 3IXTA 5KVEE 4JFHE 2VW7A 4GKSB 4NBYB 5AYQA 2B4CC 1SJHB 1X5JA 3RY5A 1KV3A 4N2NA 3JTBA 3T04D 4JFPA 3GSXA 4DUVA 5F97E 3HNSH 4Y2OA 3WN6A 5AB2A 1HYSD 1WK0A 4QUOA 4TUOB 4Y0GA 3TA3B 1QQDB 1IT9H 4OF8A 5AUMA 3BRFA 1QR4A 2BVQA 5JPNC 4PJ8A 1OQXA 1SBSL 4MDJA 2WC7A 3WLWD 4XBPB 1VZGA 1E27B 2QDWA 2WWKO 1QRKA 4QRRA 5JIQA 3FT2A 4DT2A 3AGVA 1UTDA 4K23H 1DQTA 5D2NE 3WJJA 5F44A 4Y5YB 3HZVB 5FA3A 4LLYA 4AGLA 3O8XA 3VFMB 2W07A 3EAKA 2I7SA 2V17H 3EHBC 4RSYA 3FOMB 2F6AA 4MJ4A 5DC9B 3CXDH 3L3OB 5AW3B 1Q9WB 2NLJB 3L3DA 4U0RC 5CHNA 4AYEC 3MYZA 3QQ4A 4J6RL 1FVEA 2YPVA 4BZ1H 3DV4B 4W9CC 5IJVB 2GTQA 4OF3A 1WTGT 3SJVD 3WFCH 1T5XB 2FJSA 1LK2A 3CTTA 3IXAA 4NPYA 3CXHK 2X4UB 4QKXB 3QUMB 5AW6B 3GC3A 4C57C 4PWKA 4AYSA 4JFED 4M43L 1IAMA 5I8KH 4V1DD 3WMPA 4YZFF 3QDGE 4OLZL 2DI9A 3MCG1 4WCYH 1G7HA 4FNPA 4XP6L 4FQ1H 1CFQA 2F7RA 4MMXC 4R5TA 1QABA 3LN4A 4KKRA 3S34H 2DLTA 5EU4A 3HHSA 4J4PD 1T20A 3RPIB 4LCIL 4XP5L 1OLLA 5IJKC 3ZKNC 5JQHC 4IBVA 3K80A 3IDXL 4LHUD 4NKOB 2QVFB 4S0TD 1TZGL 2QPFA 1CE6A 3NCEB 3LZOA 3UBFA 3X17A 2ZOKA 2AK4D 3WDJA 1IARB 1C5DA 2R2HB 1CK0L 4MA3A 1J18A 3U0TB 4JS7A 2OYKA 5F96L 3QBTB 3EOAB 3NJIA 3MV7E 3DIVA 1NGXA 3HW7A 3LKNA 1QNIA 4KRPB 3VCLB 5C0FA 6PAZA 3US0A 2ATKB 1GMIA 4OFYD 1YJDL 1NCCL 4MFHA 4MJ2A 4WUKH 1EO8L 4L3CA 5EEVA 4Y88A 3TH2T 1TQBC 1HL9A 1SUHA 3MRJA 3II3A 3IT8D 4QXUL 2YUVA 2W94A 1KIRB 5AZEH 1ZRUA 5GS1C 4ELKB 3X12B 5E5UB 3LH8A 5I1LB 1TMCB 2FH6A 2DN7A 3MV8D 3FU8A 3QXWA 1AAJA 1T5KA 1I7RA 3KPLA 3FRPB 3CLFH 1ORQA 2E4TA 2X09A 5D7KD 1GGBH 4TL4A 2A6DA 1KCLA 4W4OC 4DCQB 2H2PD 5D1ZC 3L2NA 4GBXC 4XO3A 2XQBH 2KZBA 2X87A 2C3VA 3PL6D 4GRMB 4F37F 3SDDD 4FG4A 3CCHA 4L9LB 1BZOA 3PPSA 4RGNB 3NBNA 3FMGH 1IKFL 4P9ML 3QULA 5EBMB 3HN5A 3MLRH 5IW3A 4B7LA 3ULSB 2QPDB 3QYNA 2AJYL 3SKMA 1DFBH 2VXVH 1KXHA 5BV7B 2BNQA 1GIGH 4PJAF 1ZA6A 1Q0EA 2YPLA 4F24A 4XPBH 4RIRA 3VFRA 4S0HA 1PY4A 4LOUD 3L5WB 5EN2A 4ZMZA 4IIZA 32C2A 2ICWJ 3O9WB 5AW5B 4G82A 2DIBA 1T21A 4EKJA 4QAMB 5EF2A 1ACYH 4UANA 4HOZA 2IALA 2XTJC 3LS4H 4OLVH 1ZLWH 5I2IA 1IC7H 1NZRA 1SF5A 1L9OA 1LDPL 4ZTEA 1ZK5A 3V8CA 3HE6C 3FCTB 4FA8A 4YSSA 3HJEA 1IGML 4M3JA 4HHAA 4KJWD 4OCMC 1I1AC 3ARZA 1OSEA 2AQ2A 1M05A 1FYTE 4RNRA 4PJEF 2Z34A 4ANXA 2WANA 1WDAA 3X13A 2R4SH 2WUCH 4YDKH 3C60A 5CJOH 2YA0A 4QHNA 3ML9A 4N0CC 4HHGA 5A2LH 4AQ1C 5AD0B 2FUQA 1IAIH 3RKPA 2QVTA 1KGXA 4HD5A 4M3HA 1EJ8A 1G7MA 2HPTA 1BW8A 2AMUA 4G43B 3CZFA 1ROCA 1ZXKA 5FGSA 3SO3C 3N3EA 4NEHB 1GY2A 3SDXF 4CILA 5BUGA 1YEWA 4I89A 3QRFM 1TVBB 1CR9L 1OGPA 3QEUB 4KVPA 2IDSA 2O6CA 4JJHA 1DEEB 1YCSA 3MRQB 4MNQB 5IWLC 4W9KC 3UJIL 4AQZA 4F57H 4AE1A 1I9JH 4AGOA 4N0FA 1W72H 5HHOE 2V8MA 3C8DA 3IFPA 3LKSA 3EHBD 4MXVE 4RDQF 4BDVB 4I2XA 4YDLB 1WQVT 3GUTA 3UTSE 3SPJA 3UTPD 2Z91A 1F58L 5HY9B 1ONQA 2F1EA 1WFMA 2R1WB 4KQ4H 4L4TA 3PWJB 4Z7QF 3KJ4B 3LRGA 1WBYA 2XBZA 3RWDB 1H15B 4RBPH 3FT4B 4GG8A 4HJGA 1EEQA 2X41A 1QLRA 2XY2A 4E36A 1P2CA 1AC6A 5FA4B 4MKTA 4E41A 4TVPD 2FWOB 1XB6A 1X7SA 4M8RA 4PRID 4IRJC 4A7QA 4KAQH 1OF0A 5D2LB 4CN4A 2EJ1A 1RSFA 2BS8A 3OPZH 1OK0A 3JV6A 3BZEA 4KXZH 5KANI 1QO3B 4X9IA 5ICYB 3MUY1 1RFDH 5I1CH 4LDEB 4YNYA 1JNHA 3UO1H 1CXIA 5B8CC 1CIUA 3O2VL 1I9IL 4P2OB 3ZKND 2ZX5A 4M02A 4JGJA 1LO4L 2CUIA 3BAEL 4FLHA 2ROXA 4QRQB 4LSRH 1AFVH 3US9A 3QWRD 3P1VA 1KG0A 4TLUA 1KCSL 5DJYB 1FDLL 2GB2A 4I77L 2WLMA 4POZC 4R0LB 4FE9A 3U0PB 5JW4N 5J4MA 3S36H 5KVDH 1UFUA 2R83A 2IH3B 2M26A 3CSPA 4MX7A 4HXBH 4IBTA 4OD1L 2HVJB 1AC0A 2ZOUA 4P5MA 3ZZLA 4NXSA 3B9KA 4OSUH 4ETQB 3OL2A 2R51A 5F9OL 1R0AL 1WD9A 3PABA 3RDJA 4Y19B 4GMSL 5DEFB 3SPHA 3OMAB 3RVUC 2N3JA 4I48A 4JVWA 4NBZB 2TAAA 3WEOA 3PGCB 5GZOA 3UFIA 2OMZA 4HUXB 4J39A 4FTVB 3CK0H 4F7EB 1WAPA 4JRYA 4Y16B 1MY7A 3NN8B 4KFMA 4BZ2A 1OPGL 3ZDWA 2AEPH 2Q2LA 1HJCA 1HOCA 1EEUA 1F02I 1N19A 2J6EA 4X99A 4RMVA 3NABL 5CWSB 2GSMB 4A2GA 1UKQA 4QR7A 3CUPB 1MSPA 5JIKA 5D1ZD 1JTOA 4GBXD 1DQDH 3L1EA 5F6HJ 5BZDA 3G6AB 4OT1H 3B5GA 4OR1A 5I18H 4KZDL 3MO1B 3EO1B 3GO1H 3MRGA 4HX1A 5D7IF 2X10A 3CFKB 4HPOL 2OMXB 1TCRB 1DLFL 4UAOC 3WNIA 3PHSA 5A6LA 4L5FL 4N1HB 2OCJA 1E90A 1I8MB 2BOCB 1T66C 2XPZA 2VSMB 3GLEA 3QEHA 4IHOA 4PJAA 3LIZA 4JRXA 3DV6A 4XN7A 1N7ML 4K8RC 4ODXB 5IW1A 3ZVVA 1FO0B 3S4SB 1URIA 5I6PA 3QPXH 1OSPH 2LOEA 4BK5A 2X28A 4M1DL 4OLYH 4IRZL 5KZCD 5DK2A 4FQLL 5DEJA 2ORBH 2D7NA 1XAUA 1ZE3C 2O5NA 1H5BC 1E2VA 1XF2B 2XQYG 4IGBC 1KT2A 4ODHH 2KPNA 3ZE2F 1QZ1A 2W38A 3SEPA 1ND0B 3S3BB 1C5BL 3BH4A 4GJTB 2Y7LA 4KMLB 4XC1L 2XTJD 1OAZL 4RFOL 4P04A 4BBWA 4PJEA 2WZ0A 3HE6D 5C0BD 4OZIE 1GGTA 4KY1L 4EVNB 1I1AD 3NFNB 5F8QC 1OT2A 4O4YL 2E75C 4IIQC 1SOKA 3MRKB 3UAJC 5JHAA 2QV4A 2F9BT 3D6GA 4XTRC 5KVEL 3SJVE 4N0CD 3SDXA 4A2DA 4GT7A 3HFFA 3BJLA 2CO2A 3ARBB 5A7EA 4WW2C 4NO2A 1HX0A 2A38A 3O11A 5DLML 3NYKA 1UD5A 4JFEE 5ISZD 1ES0B 3TZVC 3D4CA 4V1DE 1FZOB 4UT7H 3ESOA 4UT6A 3F12A 1VFAA 3TBSB 3ELAT 2JI2A 1MI5D 4DZBA 1U2YA 4B9CA 1ZIAA 1MRDH 2B2XH 3I3EA 3MCLL 3M46A 4LP5A 4OI7A 3LKQA 2ZPKL 5CIPB 5CBAA 4Z3HA 3C5ZD 4HW6A 5TFSL 3BGAA 3EJPA 3MC0A 2HVBA 1L5GB 1C08A 2PTTB 3P4OA 5EV7A 1OGAA 4G70B 3SCMB 3EYFA 2R0LL 4TPRH 2ZUUA 1H3VA 2XX1A 3D39D 1AQMA 2OW6A 3DROA 2J57A 4E9TA 3G6JB 2PP8A 2AK4E 1J8RA 1VGKB 1K72A 1LJMA 5DRNB 1I8IB 2A6IB 2Q3AA 5B7FA 4N8CH 1DCEA 1ETJA 4IRJD 1G7JB 2OJEA 1A25A 2HH0L 1NM4A 3B1TA 4KK5C 1OAQL 2VLJD 4MDRA 5D8JL 5DQ9B 1OW0A 4M1CC 1X5LA 3UZQA 3T6QC 3IMUA 2R23A 5IQ9A 3DLQR 4PI0A 3SPVB 4MVBD 4F3FA 1BJ8A 2DQIL 1X5AA 5ANHA 4G6AD 4CBZA 2FZ3B 3RY6C 1CO1A 1BF5A 1F3JB 2LR4A 3LPOA 5E4OA 1FHNA 2HJKA 2VT0A 2IGLA 1W6LA 3K1KC 4XZ4A 5DO2C 2G2RB 2ID5A 3MV8E 4BRVA 5AW4B 4ETYA 2WZPD 3D18B 5LXGL 5KYUB 4N2DA 3F83A 4NJ9L 5D7KE 5FFLA 3VXPA 1X6LA 4G80A 3QXAB 1X5IA 2QV2A 3I6SA 4X6CA 1FFTB 4LEXL 4CC0A 4Z7NB 1S2EA 3HG1A 2AV7B 5JW3L 2K6WA 1I9RL 2GHWB 2F53A 5I1HL 4KJYB 5I17B 4LLQA 1BJ1J 4Y2DC 3GNML 5E6IA 3T2LA 4HVBA 3M86A 1EXHA 4XRCB 4J6RH 4KQ3L 3MJ9A 4NO3B 3VDBA 1R17A 3B9VA 2MFNA 4CW1B 1AGEA 1YPZB 3UJTL 1E5UI 1G5AA 2EXTA 4U31A 3AG2B 1ZLVK 3TASA 5SWZA 3ZX1A 2BJML 3CFMA 2BY2A 5A43C 4L2LA 5D7IA 5IROA 2P80D 2PCPB 3EFDL 1IGJB 1ITCA 3FW6A 1BECA 4OLZH 4GSUA 3U9UA 5F7FA 4XP6H 3TWYA 4L0ZA 4P4KA 2A74C 2WZAA 5IUSA 1FNSH 2GYSA 3NIDE 1VFBA 2JQMA 3KHOA 4LCIH 2MTAA 3L9BA 2EDXA 1E5ZA 2JXMA 1QSFB 4K8RD 4XP5H 1JI2A 4FQIH 1KLFB 3IDXH 4BH8B 2IPTL 1TZGH 3BP7B 3QR1A 5KSBF 5J1TC 5TQ0L 3EGDA 4IU3B 1P84J 4EZJA 1HHJA 1TVDA 4OZHB 1XBDA 1AQKL 4B9KC 1CCZA 5F96H 5EHFA 4HFWB 5L4JA 2B16A 4V11A 5EU6B 3TA4D 1L9QA 3CZSA 3QG7H 2O5XL 4WHYH 5T5NF 4NM8L 4FHKA 4LCCB 1YJDH 5DHDA 3T8XB 3PHQB 1ZK9A 1EO8H 1PQZA 3NUKA 4XX1G 1XTLA 1Z5YD 2PPEA 5EIQA 1UA7A 1MLBA 1ZOXA 1DUYB 4XH2B 5A3IC 4K3EL 1KTKE 2IFFL 4QXUH 1OGSA 2EH7L 3QZLA 1KIQB 1FL6B 2Z7WA 3UAJD 1AZNA 4AM0A 5J12B 4XTRD 2FO8A 1G1CA 1YN7A 3MU3A 4NRYA 5C09D 3HRZC 4KUCD 3FCUB 4XVTL 5E6RB 3SYQA 1S5HA 3U7AA 2ATPA 2XN9D 1OAUL 3FRUA 3GXTA 4YHLL 3ARSA 4N0YH 1HDMB 3ZL2A 4BZ1A 5GJSL 3B2VL 2HTKD 4TVPE 5E9DB 3WYRA 3UPRB 2I32A 4PRIE 3HLAA 4XT1C 1O9WA 3PWUA 2EVJA 3CBJB 3OKOA 1Y18B 2OLDA 3V0HA 3AC0A 1CQYA 4QRPA 4PCKA 1IKFH 1RKRA 3EDEA 1DFXA 3K2UL 2UWEB 2A83A 1KLUB 4FFWC 1GZPA 2AJYH 4H1LB 2OCCB 4R4NC 3SD2A 3REWB 1UM5L 1MAML 3TNNA 3UYRL 2NY5C 3VXUD 1MCPL 2ZX8A 5E8PA 5EU3A 4L8DB 4M5YL 3T1FA 3O2WL 5C6PB 2AABL 5DZLA 1CJYA 1NFIB 2PWHA 3BAXA 4RMSA 4H25B 5F7MC 5B39B 2KQNA 2V4LA 2YK1L 3BQVA 5AL8A 3QUZC 1CG9B 3MRMB 4KK5D 3D2UB 5T3XD 4ZTOL 4M1CD 4ADGA 4R7NA 1IGMH 4EIGB 4YMPA 4F93B 1T0MA 3MBEA 5FHAL 1BXVA 4FXKA 4PTUA 2HRHA 1MDAA 3Q8AA 4DZ8B 4TOYL 1OM3L 1MIML 2VIRB 5E9AA 4QRFA 5ACZB 3SYAA 2VZTA 2JKLA 4M6AA 3ECBB 3N43F 1NLDL 4NLHA 4X4KA 5DO2D 4O9HL 2DQFB 3LVTA 5I8EA 5C3LD 4I1NB 5JUEL 3EBIA 1CR9H 5D7LA 2PW1B 3MRPA 5IJDC 1J05A 4IMLB 3UJIH 2MCAA 4IEFA 4P3DB 2XYBA 3A4FA 5EIIG 4XBGB 1S7SB 3ETTA 3X1NA 5HHME 1AKJA 3H1ZA 2XG5A 4Y2DD 3J27A 1QFWL 2VZSA 3QJVB 4FX5A 1F58H 4G8FA 2ZKYA 3JUYA 3U9PH 3NTCL 3LPWA 1YEEL 5HHQA 1M1XB 1U8QA 1SOQA 5EC1A 2FEEL 2YO3A 1HCFX 3AW5A 1BZ8A 1EX0A 1IGYB 4KO9A 2OXHA 3LNHA 1U58A 2XFGB 1HN1A 3KPSA 4TTGA 3IPBA 3LAFA 3BAIA 5KJ7E 2AQSA 5JHLL 2WO4A 5DD6B 1O75A 3D05A 1JGDA 3CZNA 3WO3B 1PSKL 2EDTA 2P26A 4E42A 4P23C 1IEAA 1S9VB 1ZLEA 2XTJE 1U8IB 2Y1ZA 2XWBB 4HEMA 3W37A 1A3LH 5JW4M 5IB4A 5C0BE 5KSBA 3SGDH 4E9RA 1I8LC 4JPWL 1G9EA 4GRLA 4HEPG 1G7PB 1K5NB 3WHXA 3EOYG 2DZEA 3EDJA 4FNRA 1LO4H 4IBLT 5FKAB 3KR3L 3R18A 2WNGA 3IN2A 4TNGA 1MFCH 5I24A 1R9FA 1KCSH 2Y2TA 1B2YA 1FDLH 3IXTB 4I77H 5HDRA 1OCWL 2JE8A 3M6DA 4XMWA 4AJWA 3LZQA 4GB9A 1FNFA 1UKTA 4JFPB 3GSXB 4OD1H 5DJCA 2Y7SA 5ISZE 4Y2OB 1X5MA 4F27A 1D7DA 5F9OH 1R0AH 3CIAA 3T2PA 1S7TA 2J1KA 1UGKA 4GMSH 4YHPB 1MI5E 4MB5A 4WWKA 5AUMB 3SGEH 3R8BB 3ZQ9A 5A3ID 2BVQB 2G5BA 4PJ8B 4MDJB 4DPAX 5FO7A 4NO0D 4DETA 5K9QG 3G5ZA 1M2OA 4QRRB 3FT2B 4TNEA 4E9LA 3T4AC 2VR7A 4HJSA 2VDRH 3MJ8B 5FA3B 4LLYB 3O8XB 1OPGH 2L8AA 2ZUXA 2W07B 3ASOB 4QMEA 4U7MA 1W72A 3LXBA 4NZTH 3TH3T 2V8LA 1XIWC 1ZT7B 3NABH 3L3DB 4K3JL 5EFIA 3MLZL 5CHNB 1E9PA 4KH9A 2WB7A 3QQ4B 1FVEB 3IJYA 2LFGA 2BVUA 4RCAA 1NJ9A 4KZDH 1OP5H 3INOA 1IUZA 2AITA 4NPYB 2NY7L 4HF5H 1DLFH 2Z7ZA 4Z0BL 3UPAA 4TQIA 2B1AL 3SDYH 1OOWA 3S2CA 4L8SA 4A7SA 1N7MH 3C6LA 1M7XA 4R4ND 4FXTA 1RIUL 2EABA 1DZBA 3LB6C 2VDQL 4IRZH 4ALAH 1G7HB 3JWNC 3NCYP 3PP3H 1CFQB 5JHBA 3LN4B 4FQLH 4HIEB 3I2CH 5DVLA 5EU4B 3HHSB 1T20B 2X1XR 3K74B 2Z0BA 2DTSA 1J0ZA 4IOSA 3D9AL 1C5BH 4XC1H 4UMSA 2E47A 4Q7DA 5FYKL 4RFOH 2E7BA 4ANKA 1E4JA 2ZOKB 3HBZA 1C5DB 4MA3B 3E7JA 4LSTL 4ZX3A 4KY1H 4TULL 4LLAA 1KZYA 2VGLM 1NGXB 3NJHA 5C0FB 1VCBC 1VDGA 5DVNA 4L3CB 2DWEA 3WE6A 3L54A 3MRJB 1LNUA 3F7RA 4XNDA 3FU6A 2V7HA 5DLMH 4DUWA 5B3JF 4GRWH 4F8QA 4ANWA 2F1BA 4B0MM 2ZCHL 4AV5A 1G1KA 4N6RA 1YEKH 2CGYA 3B9EA 2CRIA 4JO2L 3MCLH 1XD1A 1NUDA 4P48A 1QTSA 1I7RB 3DJ9A 3KPLB 4F9PA 4BE5A 1ORQB 2ZPKH 4OCYL 2A6DB 5TFSH 4JO1L 3DTDA 4UILL 2K7PA 5FECA 2C3VB 5FFOA 3CFDA 2R0LH 5KN5A 4JPKL 3CCHB 5GGSA 4APXA 1MW3A 2RIKA 2ISDA 4WFFD 4YVNA 2FHCA 3QULB 1P69B 1QFPA 2AERT 5K9OA 3EFOA 1PZ5A 3SKMB 2NYYD 3NQKA 1T6BX 5D4QA 2IC2A 2IAMC 3LXAA 2AKRA 2X3CA 2BNQB 1ZA6B 2YPLB 2F19H 3BD4A 4RIRB 4MA7L 2HH0H 1OAQH 2G3ZA 5D8JH 1E3XA 2FJFA 3VFRB 4KNSA 3I75A 3Q2CA 5EN2B 3F7PC 2H2SD 1ZY9A 2X2IA 1BOYA 3C09B 2DQIH 3RJQB 1NKGA 4G8GD 1T21B 3SDCA 5I2IB 2IALB 4XMZA 3QJSB 4GINA 5L8KB 4OJEH 3SBWA 1YNLL 3SZKC 1A9BA 3X14B 4HHAB 5C09E 2FJUB 2B4CL 4PWJA 2XC8A 5DJZA 4RNRB 1M05B 5LB1A 2XIIA 1A4KA 3BQUC 5LXGH 2XN9E 4NJ9H 2XZZA 3X13B 1ETA1 3C60B 1L6ZA 2EADA 3U25A 4Z7OB 1AHWA 2PYFA 4QHNB 4F7MA 2RJMA 3ME0A 1EHAA 3GTNA 2Q76A 5LAXA 4LEXH 1ZVSA 1JV5B 3CSFA 5JW3H 1G7MB 1EDYA 1PLAA 3CZFB 3CSGA 1G7LA 5BOJA 3ZKMD 2ZNXA 3GNMH 2G2NA 4AMKL 2DQJL 1HXKA 4KQ3H 2LLGA 5FCUL 2D3VA 5E1AA 1NDTA 2BVPA 5KVFE 1TU2A 2DF3A 2GT9A 4S1DC 3N6YA 3UJTH 4EDXA 5F6HI 3ESVF 3VB9A 4N0FB 5AYUL 3SE3A 1OCZB 1DVUA 4OGYL 3IFPB 3LKSB 1FSKC 1VLXA 3K8KA 4I2XB 1PCSA 4P5RA 5B38A 3HPLA 5C2BH 1YSOA 3FUMA 3QVAA 3GUTB 4GLRI 4ODUA 1AIZA 5C0AA 5CR8A 2Z91B 4M3KB 1ONQB 4YO0A 1J9RA 2VYRE 4A2HA 4L4TB 1N70A 3H2PA 5L4FA 1KTLA 5T3XE 1WBYB 2FQDA 5F7UA 1JZ3A 4LQ1A 4GG8B 4TVPL 2FYYA 1WD8A 1QLRB 4JDVA 1P2CB 5LBVA 4E41B 1HVXA 1M42A 2YAEA 2Q6WA 3UG3A 5KSAC 3LB6D 4R7VA 3MHZA 3W0WB 1TTBA 3JV6B 5HTSA 3SGKA 4F7PA 3BZEB 2J71A 4JB9L 5EG6C 1AQKH 1MF2L 3VXRA 5CFHA 3FHAA 2GITA 1JFHA 2VUYA 4YNYB 4GIAA 3T0EC 5T1MA 2K6YA 4NJAH 2YKLL 4FMVA 2O5XH 5C70A 4PJBE 2WWOA 4UWQB 3O45A 2AJUH 3QA3A 1KG0B 3W9EA 1F4XL 3QUYD 2JLPA 2F54A 3IRZA 3P2DA 2EH7H 3MGTA 2ADYA 1E4XI 5CJ8A 4NQVA 1LO0L 4MX7B 3ZDZE 3QDAA 2GTWA 2NNFA 1B6DA 4P5MB 3UGUA 3B9KB 4BCZA 5I1AA 4LVOC 3GZQA 3PABB 1O9VA 1XF5A 3AITA 4ZMXA 4UV7L 1Z9MA 2VN5A 4MA1B 3S96A 1OV8A 3H6JA 4XVTH 3A67H 1ZAGA 1OF2A 1A3ZA 4P5TA 4Q52A 4I48B 5F72S 4JM2F 2EUWA 3EFFA 2QSQA 1OAUH 3BVUA 4Y5XC 4YHLH 2OMZB 4HS8L 3WEBA 4M7JL 5GJSH 4P2AA 1JPFA 3B2VH 4JRYB 5AEAA 4AMXA 4FAAB 5LGJA 4NP9A 3LPFA 3B34A 1J87A 1A3RH 1NBYA 3HG4A 1HOCB 1ZLUK 1NUGA 4X99B 5HDWA 2QEJA 1JYWA 2QLYA 1XSIA 5BO0D 5J6GA 4YK4C 1R34A 1O7VA 5BZDB 3N40F 4QGYA 1UM5H 1MAMH 5D4HA 1RZIA 3MOBH 3NIGF 3ARFD 3UYRH 3IJEA 3MRGB 4HX1B 4P3CL 4QOKD 1IC4L 1R3HA 4CL7A 1EVUA 1IGFL 3MOAL 5E8OA 5KUKA 4M5YH 3KPTA 1G94A 1JFQL 3QEHB 3GXMA 4IHOB 2XTLA 4M5SA 4PJAB 4JRXB 2AABH 3H2QA 5IW1B 3UBHA 2ZUWA 2BIQA 2XJKA 5IP4A 3SE6A 2JCWA 2LT9A 4MLIA 5HGAA 2YK1H 1BAGA 2IAMD 2V5MA 4GMTL 3RX7A 2I85A 1WHOA 5TJWK 2ZCKL 3H7BA 5DK2B 1JZHA 3PQYD 4NIKB 4ZTOH 2W88A 4CSPA 3QB7C 4IRSC 3BIKA 2CNYA 2FGZA 1JUFA 5FHAH 1KT2B 1ULVA 2X1WL 4JFDD 4WEMB 4CAGA 1U8KA 3BD5A 4TS6A 4JFYA 4YLCA 3OB0H 4TOYH 1OM3H 1A1MA 1MIMH 2NSQA 5TDNA 1ACZA 1U6AL 5BVJA 1K8IA 3ELQA 1U42A 3KXFD 4DSYA 1DBJL 1ZGLA 1NLDH 1MNUL 2ESVD 1EDQA 3IVKA 2EVGA 3TV8A 4JFOA 2HKAA 3H54A 4TYUA 1IV8A 3RDTA 3BQUD 4PCSA 4UB0L 1KCVL 5JUEH 1YNTF 1KSRA 5LUMA 5IHUL 5I9QC 4U3XA 4I9WE 4F7TA 3ILEA 3SDXB 2R27A 2K9UA 2WP3O 3WIIL 4NBXB 5D93C 3BW9A 2LVCA 2DQHL 1AIFA 5CSGA 3VFNA 1CPUA 4I18A 4NO2B 4EN3A 4YHNA 1PF3A 3SQRA 2VDMB 5F21B 3O11B 2Q0ZX 2XWCA 25C8L 4WF7A 8FABA 3SDAD 3RX9A 5BS0A 2GJ6A 2Q20A 3TN0C 3VRLE 4WUUD 3F12B 1VFAB 3LDBC 1LP9E 2ZOLA 3T8MA 3VWKA 4DO6A 4WK2B 2HKFL 4S1DD 4DZBB 4PYHA 4R4BA 3KPOA 4Y1AA 3LKQB 1JG9A 3MRFA 3MPCA 1U8PA 4ZQTA 5CBAB 2CR0A 4XHJC 4WWNA 5DMJB 5JHLH 4YXLL 1C08B 5LO7A 5CEXA 3P4OB 1OGAB 1PSKH 5F7KC 1HJBC 3UCQA 1G0DA 2YA2A 5HYJA 4KHTL 3HG3A 4UCFA 3VI3F 4WHDA 4LL4A 5DMKA 3MTXA 3CFTA 1XDTT 4URTB 2LV4A 1ZEAL 4JPWH 4KDVA 3JVFC 5KSAD 2OJEB 4ZOCA 1ITBB 1CBVL 3KR3H 1XB8A 1TQVA 5HHNA 2AQQA 1RZKC 2RCSL 3TU6A 3UZQB 1V7NL 2R23B 1U21A 4HHWA 4W9DC 3X1EA 1OCWH 5IQ9B 2XA8L 4F3FB 2Y7OA 4KO5A 2BSRA 1RL1A 2VQUA 4JFFA 4NUQA 3VGBA 3P0YL 1E5BA 3T0ED 4R9HA 1JXJA 3D87B 5I15L 2OZ4L 1M9SA 2A2QT 2BFVL 3TPUA 2HJKB 4Q8BA 4PYGA 4MXQC 3Q9QA 5BVPH 4AKOA 1I82A 2VKXA 3DX9A 1GGYA 2KT6A 1M1SA 4R6UA 1I75A 2Z8RA 3VXPB 3BWZA 4X7CC 4G80B 1NLBL 4JM2A 4X6CB 1H3PH 2UYLB 5JMRA 3HG1B 3BH8A 4J7RA 3T0VA 2F53B 1GJUA 1JRHL 4LLQB 4WFFE 5ABAA 5E6IB 1BAWA 4N25A 4K3JH 5BCAA 1QW8A 3MLZH 2M2DA 1M6UA 2WM0A 1QKZL 4HKBA 4LVHB 1PLGL 2VDPB 3IDIA 3VQLA 2ICEC 4W81A 5I0WA 1J5HA 5MI0C 1AGEB 4AGNA 2NY7H 3HMWL 2Y9RT 4PJHB 4Z0BH 5SWZB 4FLSA 2B1AH 2EH8L 4MAYA 4PWFA 2A9ML 4IOIA 5B3NA 5D7IB 2RACA 1OP3H 1GS8A 4J3OG 3DX4A 1RIUH 2VDQH 4G8GE 1I85C 3P0VL 3U9UB 4XN2A 4XP4L 1GJWA 1L0YA 4P4KB 8CGTA 1BZ9A 1K3IA 2YZ1A 1FGNH 5AYTA 1AO7E 4NOFA 4FQXC 2JXMB 4ZMAT 4EN2A 1M2VA 3D9AH 2EXWC 5FYKH 4XN5A 4FF9A 3ZE2B 3EGDB 3HUJB 5DC2A 3RBGA 3U46A 1HHJB 4UQAA 1S7XA 5FXCH 3BLBA 1QBBA 4G1MA 4IRSD 1OTTC 3OLEA 4TULH 3CMOL 2ZAIA 3T77A 2DLGA 2EC9T 2DL2A 3NZUA 4HXAL 3KLLA 2ITCA 1VRSA 4N2FA 1PQZB 3WJLC 5JHDA 3SE4A 1OCOB 5E5MA 1MLBB 1YNTA 3SODB 3FF8A 2P45B 2JELL 1JCVA 2ARJA 3KL3A 3V7AG 4O2EB 1JZGA 3MJGX 5FYJE 1HNGA 1JPGA 4A2LA 3A6CL 3IPEA 5C8JA 1TJHL 3B6SA 4H5SA 3TLRA 3QIBC 1H19A 3NIFE 3S3JA 4AM0B 3ZYJA 2ZCHH 2ZYRA 5FW8A 1YN7B 3WTXA 4NRYB 4JO2H 1XGZA 4NIYE 1S5HB 4LXFA 2NSMA 2QPEB 2ATPB 2H8PA 3FRUB 3HC0A 3OD3A 1TQCC 3WIHL 1SVCP 3J2PA 5FK9A 1J8HA 5GGQL 2XHNA 1BBDL 1KB9K 2XKUA 3TN0D 3HLAB 4JPKH 3PWUB 3Q1SL 4V2CB 3WNLA 3ILQC 1KPUA 3DVGA 1FG9C 3BPOB 3JWNE 3VMPA 4ZW6A 1VFMA 4QRPB 2JB5L 5KVFL 1S7UA 4P2CG 3CLWA 2A83B 4XHJD 1GZPB 5I8CA 3TNNB 3RVWC 4GS7C 1TF4A 2OYLA 5TE4L 1B2WL 2WQWA 1SJVA 1UH2A 4IRZA 8PAZA 5E8PB 1FRGL 2YARA 4HGMA 2YLHA 4P46A 5AQ0A 3T1FB 4GG6E 5B3SB 2K7QA 4Z9KB 2H3KA 3MLUH 2FSDA 4JQVA 3KNBA 3KDMA 4AV0A 2NY4C 4JGMA 1A7NL 2H3XC 2NY6B 4G2AA 5JOPD 2VN6A 2EIKB 4R7NB 1OZTG 2Y1AA 2B4CH 4ADJA 1T0MB 3MBEB 3BI9X 4DKTA 4NB7A 5TE6L 5BO1L 2V3DA 4FXKB 3ZDYE 1TLMA 1OWWA 4PTUB 5C0ND 3UTOA 4F1ZA 1HL4A 1DEDA 4MS8C 1IAKA 1PU0A 3VXNA 1HTYA 5CR1A 3Q1EA 2WXOA 2H9GA 4MXQD 2YUZA 4HMDA 3VFUA 1MREL 3ZKQD 5I8EB 5L88L 4AMKH 3WEAA 4BKLA 5D7LB 4RSVA 2H45A 5FCUH 3RTQA 3MRPB 2QFRA 3LCYA 3V0WL 1IBHA 1XGRB 4JKMA 1JWMA 2HFGH 2VL5B 4IEFB 1QZNA 5AYUH 5HYEA 3W1ZA 4OGYH 1HU8A 2D3JA 2PYED 5EU7C 3MLYL 4C54A 1AKJB 5D2NA 2XG5B 3S37L 2XRAL 4IMKA 1YEJL 4I0PD 2GBUA 4WY7L 3FUNA 4UQDA 4G8FB 2WD0A 3EYVA 1RUPL 2YMTA 5JIHA 5JO5A 5HHQB 5EC1B 5IKCA 2IEPA 3CH8A 4KVCL 1AGBA 2A1WL 4MB1A 3PQYE 2OXHB 3I84A 5J11B 1U58B 4MXVF 5HDBE 5D6CA 4TVPH 2QQLL 4JFZH 1LMIA 4PREA 5D7EA 4TUKL 4E9SA 1UFGA 1JGDB 5BW7C 3FSAA 4MB3A 4OIIH 4E42B 1ERNA 1IEAB 3QXTA 4JY4A 5DRWA 2XBDA 4UQ9A 2IDQA 3D48R 1HKLL 4OM0L 4NQXA 2O26U 1JGLH 3PGFL 3QDGA 4X9HA 2VWEE 4JB9H 5IB4B 5JHMA 1BXXA 5KSBB 1DANU 3KPRD 4FQ2L 3WHXB 4H8PA 1D9KA 4WK0B 4NZJA 2DLFL 3ARRA 3QZWA 3GHPA 3BAWA 3HAEH 4G5ZL 1DZ0A 2EDRA 1JOIA 1UM4L 4WI7A 1F4XH 4UTAL 3OAZK 1NBQA 4O5LL 4FA6A 4PJ5D 3PWPA 1N5YL 3MUGA 5L4MA 1J0HA 2R0KL 3MGAA 2Y36H 4AVHA 4WI6A 1LO0H 4N85A 5DJCB 1SFHA 5A2AA 5E99L 1N6UA 4M62L 5B39G 1S7TB 4WUUE 3MV7A 4UV7H 1XF1A 5F7AA 4WWKB 4P4RA 5DDHA 2G5BB 3PP4H 4IJTA 4BQ6A 5FO7B 1EJOL 3G5ZB 1I3RA 5AOKA 4F37K 4L18A 4HS8H 3QIBD 1FWXA 4M7JH 1P9MA 3CDFA 3HI6L 2YBGA 4AC2A 4UM9A 1W72B 1ZV5A 1B6UA 1H9DA 2OX5A 4LPXA 5EFIB 4KGLA 1AY1L 1E9PB 2MHAA 1GOHA 3QSKB 1NJ9B 4EEEA 1U8CA 3OAUL 4P3CH 2ZOWA 1IC4H 2V3FA 2ZX9A 3AQDA 4MJID 4JMNA 3OKNA 1IGFH 3FUKA 3MOAH 2QADD 1Z5LA 2DQCH 4XB3A 1JFQH 4JY6A 3FAWA 4L8SB 2A4CA 2HRGA 3C6LB 4M00A 2NY5L 1SDDA 3RWFA 4GP4B 1GGCL 3U2SA 3T0EE 1S6NA 4GMTH 3VFGL 4QHMA 2ZCKH 1TYRA 1WIPA 1F4HA 3WDIA 4HSQA 1EXUA 4KUZL 1D5BA 2B1HL 3MA9L 3KE0A 3FTGA 4G9FE 1X9LA 2QPSA 4YC2C 5ABZA 2C9QA 3FCBA 4HU8A 3FFOA 4WTZA 3GBDA 3HC2A 2NY4D 1FAKT 5SV4A 2WBXA 2AZUA 3W3BA 4BFEA 4F8OA 3JWDH 5E5LA 1DBJH 3TT1L 1MNUH 2WLKA 4YSAA 4GW1B 3MLSL 4LAQL 1SRDA 3FTSA 3TFBA 3NVQA 3N43B 1KCVH 4K4KA 3NSJA 5IHUH 4P5KA 1NGZA 3GWJA 5AENA 5EEZA 2YPKA 4KNUA 1ZDQA 3GMOA 3UZEA 4NQDA 2DWEB 2V5SA 2YWZA 5K9JL 4LGPB 3WE6B 3WIIH 1XH0A 4OZIF 2D9QB 5GGSY 4N8PA 1CDIA 2UY7A 2V7HB 3IE9A 3MRBA 3GBLA 4YBQD 1DQKA 25C8H 4PGCA 2GG1A 5LLIC 3JWOC 2ZT9C 3OC5A 2BWIA 4Y4FA 4N6RB 1V3MA 3RI5F 3HN3A 1LEIA 2EDMA 2HKFH 5D71L 3ZL4L 1Z9NA 1G9NC 3LNEA 5C9JA 1CVSC 3NCMA 4D9QD 4HJTA 4GW5A 3CQQA 3QUHA 4WV1A 3RNQA 1KGJA 2DBLL 2KERA 4YXLH 5FECB 2FR4B 4G7YL 1SOSA 1L9NA 5E95B 2IF7A 5AG9A 3CFDB 2KYIA 1F0LA 3FF7A 2ADIA 5KN5B 1RAMA 3GRBA 3GZKA 4APXB 4N22A 3P73A 5TTRA 3UTSA 4MD5B 3HHMA 2J1XA 4PP1C 1LEGA 4NHCL 3RWIA 2XICA 4U1IA 3QJZA 5DTFA 4YGVA 4F9LC 5DHVH 1ZEAH 5K9OB 3VRJA 3HCVB 5E1GA 4KDTC 3EFOB 1PZ5B 1CLYL 4NC0B 2E5EA 3WUWA 1AGDA 4LFHG 2AKRB 3DOSA 4D8OA 1IB5A 3EDDA 4FOMA 4ANUA 4R97B 3UBXA 1CBVH 4D0CA 5I73C 2FJFB 3QFJD 3I75B 2RCSH 1V7NH 3RA7H 3FT0A 2XA8H 1TTRA 4QTIH 4ZUTA 3PJNA 3PXHA 5EBWA 1QPPA 3GSNL 4Y1SA 3Q05A 1NWOA 3SDCB 1DYZA 5I15H 4RESB 2OZ4H 1U8LA 2IANA 4KV5E 4E9VA 3K6SA 2BFVH 1E50A 3C2SA 4WQOA 1A9BB 5DEGA 5JDJA 1DJXA 1IBDA 5JIIA 5DJZB 1RCYA 1PAZA 1K4DA 5I8OL 1A4KB 3QUXD 1QEXA 3ZTJH 2JI1A 4XN4A 3A24A 2J55A 5HJDA 2JH2