2N59A

Solution structure of r. palustris csgh
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein CsgH
publication title Electrostatically-guided inhibition of Curli amyloid nucleation by the CsgC-like family of chaperones.
pubmed doi rcsb
source organism Rhodopseudomonas palustris dx-1
molecule tags Unknown function
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n59A00
2Y2YA 2N59A 2Y2TA 2XSKA
chains in the Genus database with same CATH superfamily
2PN5A 5I6XB 3MXWH 1OGPA 2A9AA 5J56B 4CVZA 1RL1A 4ZX5A 1RZFL 1U8HB 1YN6B 4DEPB 2B4CL 5LN4A 1XCQB 5K9JH 2FH8A 4Q56A 4DGIL 5CF3A 3GS0A 4PFEA 1LM8V 3N40F 2DM2A 3D2UB 3F04A 4XX5A 5FDWB 5IVZA 5C7ZA 4EDWL 2PO6A 1PKQB 1AXSA 5AKVA 2MFNA 2R1XB 2BCKB 1GC1L 2B14A 2BO0A 3HE7C 3JYBA 4FQLH 4J3OH 4NS0A 2VDNB 1TCRA 3FO1A 4IGBA 4XN4A 4XXDA 2BIIA 3J2PA 1WC7B 2YN5A 5HHPA 2JKRM 1WP6A 3O4LE 2EDHA 5I8CB 4PUBH 1WD9A 1EJOL 2CJUH 4LNRA 5LLIC 3N42F 3SQBA 2VR4A 5SWSA 2TSAA 4QTIH 2IOIA 5FLUA 1GGIH 2QLYA 3ZKXC 3GUFA 4TRPH 2OTUA 5DHEA 1UYWH 5BO1L 3H85A 3G7TA 1GY1A 3BUYB 4WSGA 5IQMA 2X5PA 3GLZA 3EF7A 2D7TL 4H13C 1IKNC 1K9TA 2AEQL 1DVFC 2YGOA 3EFOB 3QHFL 4OT1L 4DZBB 1QABA 2P8PA 3HZYB 1JPTL 1J88A 1W15A 3PXJA 4GUPB 4JPIA 3T71A 3LKPB 4L23A 3MV9E 2J4WH 3I50L 1JDCA 1SLVA 2ROYA 2IO5A 3HNSH 1RMFH 5EO0B 4RAVB 3ARVA 2IGLA 1SFDA 4PJEE 2YUVA 3QC5X 4CVZB 1X5ZA 3BSZA 2MCG1 5I6LA 4MDIB 5H37G 2SODB 5DRZA 4HOXA 1IILE 4P2OD 5HJ3A 1DQTA 2NQ3A 3O2WL 5IVZB 5T3XD 1CT8A 2PW1A 2PO6B 1Z5HA 1AXSB 1NAMH 3L9EA 5FB8B 1CXIA 2XY1A 4O2CA 3C8DA 2Y25A 4L3EE 4ZNCD 1J1XH 5TE6L 4PJ8A 2WVVA 1TCRB 1YA5A 3OPZL 3FO1B 4IGBB 1EAPA 2BINA 4B9CA 2WGNB 2J12B 4XXDB 2FIRT 3C6LA 1EZLA 4L29A 5HHPB 4WTWA 4YSDA 3C08H 3KZ8A 1RLBA 3R7QA 1KBBA 4FXLA 2CHWA 4XPHL 5EC2A 4OVVA 2DBLH 4LNRB 2ATAA 3SQBB 4EOWL 4FJZA 5SWSB 4BZ1A 4JG1L 1KBGL 1CICC 2NX5A 4BXVA 3S96A 4I8DA 4BBWA 5B7FA 4Z95L 4JM4L 5IOKA 2EIDA 2GITA 1N6QL 3GMNA 4GS7B 2NR6A 1Q8MA 2OTUB 5IB4A 4ABVA 1BGXH 4ZFOL 4AIEA 4M56A 4OF7A 5I2IA 3RIFK 2XQ0A 4YZFF 1G6VK 4V2BA 2X6VA 5CZVL 1XF1A 4JW3A 3UBXG 3BAKA 2EINB 1LO3H 4PJGA 4GT0A 3RILA 1Q94A 2P8PB 2CRMA 2CU9A 3VXSD 2WC7A 1ERNA 3E80A 1RLWA 1GGBL 4UAOB 4JPIB 3VH8G 5I18H 4HJ0D 4WY7L 1YC7A 3CHOA 3GSRA 4XGZA 3NJGA 1A6UH 4JFVA 1T4KA 2NYZA 3W1ZA 1Q72L 4OGYH 4Q0XH 4RGNC 2LABA 4LFHG 4DP9X 1DN2A 2WBJD 3A4FA 2JXMA 2R59A 1YEWA 1P5UC 5MEOA 2FB4L 5DO2C 5DWUL 1A65A 3B7YA 3QW9A 3WMPA 5M95B 4PWKA 1DQQA 4NC2B 1YEKL 2BFVH 5DRZB 5I0VA 5HJ3B 2VR5A 3WIIL 1CT8B 4WI6A 2PW1B 2P48B 2A5UA 4HPYL 5CKGA 5D7LE 2OSXA 4N0CC 4O2CB 4Y4HD 5DJZA 5EU7C 5J12B 4G9DA 4FF9A 3EOTL 5TE7L 1LO5A 4PJ8B 5D6CA 2W9DL 2WVVB 2W95A 1YG9A 4XPAL 3HN3A 3JUYA 3EDJA 1MJUH 1EAPB 1DBJL 2NRDA 5L2KA 1CUOA 3C6LB 2ZNXA 4JM2D 4L29B 2JE8A 2CNZA 3IJSA 4EXPX 5T1JA 4PH8A 4ATTA 4L5FL 1ET8A 5EC2B 4XP4H 3CH1B 4JFUA 1W91A 3FT4A 3SDYH 4JCMA 4B9ZA 2NX5B 1I1AC 3S96B 2Y69B 4Q89A 1JF6A 4D0CA 4FA6A 3OG6B 2GITB 5LXGL 3GMNB 1VCAA 4YSEA 5C0RH 5IB4B 4OZIF 3BRGC 2DWYA 1ETZA 1Q9WA 3PWJA 5I2IB 2QVTA 1HJBC 3LQAH 1OXYA 5AVRB 2FSEA 1TU2A 1Q0XL 1TVDA 1F45A 1AXIB 2FUTA 4PJGB 3VW3L 4X8XA 1LO2H 1Q94B 4N5EC 4FXKC 4MB4A 4K5NA 1T2XA 1EEQA 1TEYA 4QOKD 1IBYA 5KSAA 1E4WH 4MJID 3GSRB 4XGZB 1J0ZA 4Z7IA 2QL1A 1T4KB 2HPTA 3U1SL 1HT6A 5FM4A 3RZCA 2ED6A 2EJ1A 3V5DB 3BYYA 4K5OA 3RWIB 4GRWE 2A77H 2JXMB 2WTPA 1EXGA 4QKXB 5AKTA 5MEOB 2V33A 4WJG3 3QRBA 5D2NE 3CLFL 4ZI8A 2FWOA 1KPVA 4PGEA 1DQQB 4ZMYA 3FTSA 1PCSA 2F8IA 3EO9H 4YXLH 3LX9A 3QWQB 4X5LA 4R4FL 3LHPL 1JNHA 4BELD 4EUPH 3VACA 4ZMPA 5I5MA 1F4WH 2WINA 2BZDA 4KK9C 2NCEA 3CVIH 4J3UA 4MYPA 5DJZB 4UDUA 4G9DB 1KCSL 2AP2A 2Y7OA 3FSVA 4O02H 4Z7QE 1LO5B 1OWRM 5D6CB 4D7BA 1BJ1J 4JM2F 4A55A 1MCBA 1NEZG 5MHSD 4NN6B 5L2KB 4FL4C 2A6DA 3QZBA 5KZCD 5AB2A 3IJSB 1BG9A 5F9WB 4U1GC 1FL5A 4JQXA 4QYOA 4PRPE 2ADFH 1UM5H 4NAMA 4TYUA 1VZHA 3LQMA 3FT4B 3GIZH 2QQNL 4YHNA 4IW4C 3ATDA 4ANUA 5BO0D 5IESH 3TJHD 1DDHA 4JHWH 2M83A 4D0CB 5HVGB 1YVLA 3SPIA 2E86A 2V3FA 4UB0H 3FUEA 1ETZB 1Q9WB 3PWJB 5CP3H 1DANU 3JWDC 4P2RD 5C70A 5DT1H 1JHLL 4KXZI 3RU8L 4AITA 3UJJH 1F4HA 2FSEB 1TU2B 3UERA 3OR7A 2H2PD 4BFJA 1P1VA 3C9NB 1YUHA 4N25A 3GSUA 3B5TA 1F4YL 3R0NA 1CI3M 3U1PA 5KSAB 3K6DA 2IANE 2VMJA 2DTMH 1ED3A 3HTLX 5FYJE 3HG0A 4ZQTA 1BJ1H 4X42A 3INUL 3ESPA 3LSOA 3RZCB 1E9PA 2C9PA 3HC4L 3WBDA 3QAQA 4U1LA 1YMMD 1KGCE 4FYRA 3HW7A 5BMFL 2O5YH 1DJSA 4NIYE 4Z7VE 3GNMH 1TJMA 2DQUH 3LH2L 1IKFH 2UWEF 3MLRH 4GINA 3RX9A 2F53A 5AZUA 2AK1H 3ZL4L 4X4YA 2FWOB 4H8HA 1KPVB 1P4UA 4PGEB 1QFUH 1B3IA 1UZ6F 1NFDF 2YKLL 1HZLA 5A6LA 3N41B 1BWWA 1ZHKA 4HMEA 2VZTA 1JNHB 3ATBA 2WINB 5GHWL 4A7GA 1X5FA 2WVUA 5A2JH 1YN7A 4UDUB 2Q7YA 1M42A 4KAQH 5C2UB 5HVHC 3Q9PA 1JFQH 1TZOA 4XWOD 4S2SA 3D07A 2YSSA 3BE1H 2O5XH 2HT4D 2DLGA 5HD8C 3KXFE 4ZO8A 1MFDH 1SVBA 1UUNA 2KQMA 4MQXC 3DJZA 4MQTB 1SMDA 4G6JL 2A6DB 4RMWA 1LWHA 2WN3A 1FL5B 2ZT9C 3EHBD 4QYOB 5EO9A 1OPGH 2Q9OA 2GJ6D 4XBPA 1FLTX 2HKFH 3IJHA 3HMXH 1CBVH 3D30A 4F7MA 4YHNB 1MDAA 1N59A 2NY1C 3AM8C 1DDHB 5ILTL 2PPAA 3CHQA 3FS9A 1E27A 4HV8A 1WAAA 5IUSA 4NN7B 1IAIM 4MAYD 1N70A 4MNQA 3MLSH 2JJWA 5JUEH 3HJ0A 3DK2A 4HSCX 3BUDA 1ZJAA 4R3SA 2BPBA 4OBRA 3F7QA 3OR7B 2BNQE 4I85A 4V1DE 4ZMLA 4LBEA 4WTZG 1YUHB 1R19A 4M62H 3CK0L 3T6QC 1EVUA 1CR9L 2LVCA 5F3FA 1PDKA 3OB8A 5KUMA 4JN1L 4JEGB 3GRGA 4I3GA 5DFVC 1ED3B 2MCAA 5LUMA 4NUJA 3AB0B 4MB1A 3KVDD 1B6UA 4E9YA 1HOCA 2H0EA 2F61A 3ZDZF 5I1IH 3LSOB 1E9PB 4U1LB 5GISL 3KPMA 1RZJH 1J8RA 5E8DL 2I85A 4GH7B 4IBVA 3ISRA 2A2QT 1OE2A 3LNIA 5IFHH 5EOQL 2F53B 4X4YB 3PAVA 4JO3L 1RP9A 4QPEA 5DURD 5E6UB 3CIAA 4KMLB 1N0LA 3H9SD 2R29H 2RH0A 3CFNA 5E2UH 4E68A 4PJ6A 4JO4H 1AS8A 3HI5H 1ZHKB 4EQ2A 1THCA 4GQQA 4HIXH 2V3EA 5ERWA 2DQIH 3FFOA 5DCCA 5HP5A 4FP8H 3BWZA 3BPNB 5CJOH 1YN7B 2Q7YB 4PJIF 3MRHA 1QQDA 3S6CA 1ZT7A 4XP9H 4NQQA 4S2SB 2ZP9A 1J5HA 2YSSB 2ZKMX 5HHQA 3AACA 2CDGA 3QCTH 3WE6A 1WUZA 1SLWA 2H9GA 4YO0B 4EIZC 5KVGL 1T6WA 5BRZD 5DZAA 1T20A 3A5VA 4G8EA 5EO9B 5DRWA 3S3PA 2OBGA 2VUYA 3UADA 4XBPB 1EBPA 2XZAL 3IJHB 3GZKA 4F7MB 1N59B 3CDYA 2GKIA 1BD2A 2YBGA 5TF1H 3MO1A 1E3XA 3EH4B 4MKMA 4GEJA 1E27B 4HV8B 1BXVA 4P2QE 1L7IH 4JRXD 4MNQB 3JV4A 4QJ5B 1JMZA 1KXTA 4KRPD 2BRRH 1K8DA 4K8RL 3BJLA 4L05A 3UOAB 3VFSA 1NAKL 4R3SB 4XNMA 3WCYA 3FB6A 5J5EA 1YECH 3WFDL 2XA8H 4LKCA 4TNGA 5E9DE 2LLNA 4N22A 2KC0A 4LBEB 3WJJC 2NXZB 2AEPL 3RVUD 2YRPA 4BE5A 1MY5A 5I5IA 1PDKB 2G9HA 2R56L 3HFMH 4UZSA 3VI4F 4Z1PA 1T4WA 4NUJB 1UWEL 4PJDA 1U92A 2DKMA 4QWWD 1HOCB 3H42L 3U1QA 3VYOA 3EF4A 4X98A 5CXPA 2Z31C 5FGRA 5CKAA 5GSVA 3KPMB 4NC0B 5HHMB 5BXFA 2VXQH 2JKSA 3AY2A 4IOFD 2P3YA 1RFDL 1QUNA 1X5GA 3JWNG 3LTVA 1V27A 3ILEA 4UT9A 1QFOA 2WVTA 3V9FA 1SXZA 1N0LB 2VDNL 3WY1A 4HWUA 3D9AL 2NY2D 3RJQB 2AABH 3D52A 5ERWB 2VR8A 5E70A 4B9IA 2O4EA 4KY1H 4F2FA 1BFVH 1UOVA 4ZXBD 4LPXA 4ELDA 1QQDB 3FSOA 2SEBA 1ZT7B 4NIKB 4R97C 4X6FA 4KROD 3L3DA 2F1BA 4JCWA 5HHQB 1WCBA 2CDGB 2K6ZA 1WJ3A 1T1ZA 3B2VH 3GEWB 5C0CA 2EDMA 3WFBH 4HKXA 3WE6B 1JWUA 2H9GB 3I6GA 4BH8A 1MCQA 2QADB 4PY8I 3F85A 5ES4B 3QPXH 5BUAA 1T20B 4G8EB 4WWKD 2RA1A 4WEBL 5AVQB 5DRWB 3S35H 1AC0A 3BLBA 2OMZA 1J9QA 2C9UA 2DYPA 3IE9A 3SCMC 3OPUA 3UZEA 3W9DA 3G6DH 1BD2B 3CX5K 3MO1B 4BK8A 4IKJA 3RGBA 3FULA 3WLWD 5JNYA 1JTOA 4G42A 2Y6SD 3JV4B 4LCWA 4HIIA 1D7DA 1KXTB 1QFWH 2HA1A 4OQ1A 5ABAA 3VFSB 1T04A 2VRAA 1IU1A 1DQJA 2O30A 3QBTB 4XNMB 5BS0A 1ACZA 5C0NC 3FB6B 1OW0A 3T0BA 4Y2DD 3DARA 4LKCB 5H37H 3EJRA 4TQEH 3REWA 3DX3A 2WBKA 3Q2LA 3MRQA 4UM9A 5IW6A 4HIJA 3QIUA 4DP0X 3GPEA 4PPTA 4L1DA 2DMCA 1L9RA 3OWEA 4PJDB 1M3IA 2VZUA 1SDAB 3FH7A 4NI6A 2ZAIA 4X98B 2G30A 5GSVB 1EAQA 1DCLA 1N6VA 3KW7A 5BXFB 2VDLH 1TFHA 3NGBC 1RZGA 2BIPA 2ARWA 4AVHA 4E9TA 2WLYA 2DLHA 1ZLSH 1QUNB 2JTDA 3RZWA 3FC8A 4A1RA 1V55B 5IGXL 3ZHFA 3ARSA 1S7XA 4J6RH 4MVBC 3V6OC 1BF8A 4JY4A 3CQQA 2OM5A 1AH1A 2QGCA 4Q9RL 2EKJA 1HKFA 1RH8A 3WO4B 2ERJC 5GZNA 4X6DE 2X2YA 4X6FB 2SEBB 1NGYA 4Z3JA 1WHPA 3L3DB 3MBWA 4OD1L 4LAJH 3GO1L 1WCBB 4YHOL 1T1ZB 3BVUA 3FTVA 4M7LH 5C0CB 1IB5A 2I9LA 4HKXB 4ZFGL 3ZKNC 1A7NL 1JWUB 4D9RD 2UXGA 3I6GB 4BH8B 4X5PA 4UTBH 2VDOB 4I18C 4QTHA 1ZMYA 2QGEA 2F8VA 4KKBD 2OMZB 3T0EC 3IMSA 2DEYX 3MX0A 4CMHC 2HT3D 4FFWC 2DYPB 3W9DB 3U6RA 1ETA1 1IE5A 5D2LE 4KQ3L 4IM8A 4P9MH 3R18A 3O6FD 5JNYB 5B3JF 4G42B 1EJ6A 5G4OA 4LCWB 4HIIB 3SPJA 5J9PA 2CKNA 2QZQA 1NUNB 5IFJA 1T04B 2EP6A 3ZTNL 3H3PH 5BS0B 4YHIA 5E99H 4OFIA 2IPUG 3MNWA 5E8NA 4HSQA 2GT9A 4PJAA 5IKCA 3C60D 3UPAA 3SYQA 5F9JA 4ZMXA 2V17H 3MRQB 4UM9B 5IW6B 1JI1A 3BSZL 3EAKA 4HIJB 1CXLA 3QIUB 1S78D 4WLCA 5I8EA 2VM4A 3QP3A 2NT1A 1O7VA 4FQQA 5DGRA 3UMNA 4HD9A 1MRDH 5J89A 2APXA 1RK1B 2Q0ZX 5IJDC 1F8TL 1KCWA 2BMKA 4JFZH 1JZ7A 1DVZA 1ZE3H 1O75A 3L2MA 3UGUA 4UI2A 5AVXB 1NCGA 1RZGB 4ONFL 2WN2A 1WAEA 1X44A 1P84J 3FUKA 3LIZL 2ZUXA 1C5CL 3NFSL 2UZYA 3O2DL 3OG4B 3OGOE 1S7XB 4DGWC 3D85A 4JY4B 3NPSB 1MRFL 3RVWC 1VDGA 3CVHA 4XI5C 2WTRA 4GAJL 4ELKA 1X5AA 1E6OH 4Y1AA 5CILH 5DLLA 2JI1A 4NJAL 3VD0A 3GBNL 2ED8A 3L9RA 4HUKB 5SX4H 5FR3A 1NGYB 3K8MA 3MBWB 3L5JA 3L6FA 2Y1VA 3GI9L 2WXLA 2I9LB 1OP3H 1JL8A 3FTUA 4OAWA 2DQJH 3ABGA 4WTQA 5DZPA 1AVAA 4XO5A 3F05A 1N0XH 4BHUA 3HMWH 2LU7A 2ADYA 1S9YA 4IYKA 3DURA 5JZ7D 1HCZA 2EECA 3MX0B 4Q97A 1RHFA 2L4OA 4N85A 4J3OD 5D1ZD 1HS6A 3WJMA 4OFYD 5AKSA 2VN4A 3CDFA 4H8WH 2J8HA 1V05A 4MLIA 3U6RB 4LEXH 4FFTA 3QYNA 2J73A 3I9GH 1MCOH 2XTLA 2ZONA 5LVEA 2F58L 2GSGA 4Q9QL 5J9PB 5EBLA 5KS9F 4GFTB 2NY5L 5IFJB 3KLDA 3NFPA 4GG8A 4YHIB 4P2RE 5EEUA 3MNWB 5E8NB 3CVCA 3H2QA 2GT9B 4PJAB 4YSCA 3FO0H 5IKCB 3WFEH 2ZTBA 1WDAA 5HYSA 1D7BA 5AENA 5F9JB 2AANA 3SDAA 4JREB 4XNBA 2E7MA 3QK0A 5ICXA 5C08A 5I8EB 3EH2A 4FQQB 2YIHA 1QYGH 1X4ZA 3E3QE 5IEHA 3FFDA 2BMKB 3E1F1 1BV8A 4WFED 5IP4A 5B38G 2ZYIA 3QS3A 1JRHI 4TUOA 1R75A 2VISB 1YMME 1Z0NA 3KBEA 1NCBL 3KAAA 4OV6F 1GYAA 2BVEA 3O9WD 4L4TA 4MQ7A 4HJ0C 5EIIG 3ZTDC 3QHZH 2XCMC 5GS1A 4HK0A 3X1NA 2DWXA 4C4BA 1G7HA 5KTEH 2ROXA 4JZNA 2UZYB 1A5FH 3ORJA 1A47A 3D85B 1COBA 2EDTA 2Z0UA 3CVHB 3HR6A 1IAIH 2J8OA 2WTRB 1JHTA 4ELKB 4Y1AB 4NQEA 4XB8A 3GSOA 1NFKA 3QEUA 2CA4A 3BLKA 3L9RB 3HG1D 1MIEH 4HK3N 3L6FB 4AQZA 1O5PA 2Y1YA 4XP6L 2MRYA 4HCRH 2D2CC 3NAAH 4OAWB 2G5BA 5MP6L 2WYTA 5KAQF 4J3OF 2X53A 1BVLA 3KPOA 1OTTD 4G8GA 1UG9A 1S9YB 1AE6H 3PWNA 3DURB 3QIBD 4Y4HC 1A3LL 1ZANH 3WJMB 3L7EA 3KPRD 3NJLA 4ZFFA 4JFDA 1F3RB 3OM3B 4WCYH 1FBIH 1ILSA 4IRSA 3VFNA 2NNRA 4M43H 2C9XA 3MLZL 4DP5X 1QW9A 3QH3A 2GSGB 3B5HA 4P5RA 4WWNA 5FIEA 1T22A 5H8DA 5I9QB 3ZQXA 2BK8A 5EBLB 1DJIA 3EH3B 4L8CA 3NFPB 4GG8B 1KEGH 2YAEA 1A14L 2FQGA 3P2DA 5HYSB 3SDAB 5ICXB 3BKYL 1AG0A 1DBMH 1J9SA 2ICCA 2JQMA 3HAEA 4X7EC 5D1XA 3ESNA 5K69A 1A64A 3UACA 1H15A 1MW1A 5IEHB 1RY7B 4F8TA 1KENH 3FFDB 1XGRA 5I15H 4AE1A 5D7JA 2HMIC 3R19A 1LP9E 1MAJA 3HHSA 4TUOB 3IU4L 1XZ0A 4FQCL 1XB6A 3KR3H 5T3ZH 3NIDF 7CGTA 4L4TB 4MQ7B 5CFHA 1G9ML 2DQHH 4S1SH 5GS1B 4HK0B 3HBQA 4U1HA 1G7HB 1HL4A 2N56A 4JFYA 1EH9A 4JZNB 2DDQH 4L8SC 3H9SE 2EXWD 4FXGA 3DGDA 2GI7A 5JQIB 5JPNA 2KL6A 3UIYA 4JRYE 4WGKA 4QIRA 4D3CH 1JHTB 1SJMA 4AZUA 1NWPA 4BFGA 4DERA 4A38A 2ITEA 3GSOB 3QEUB 1Y18A 3U6XA 1C5BL 2ZKWA 2VLKA 4GQPH 3KE0A 4N90E 4OB5H 1MFAL 4W93A 3C2AL 3IDNA 2C9QA 4QGYA 2ZAGA 3IM1A 3Q6GL 4IRZA 5C0JA 2G5BB 3QJQB 1TQCC 4JJHA 5I75C 1RV6X 1BVLB 3KPOB 1MCPH 4G8GB 4WK4B 4Y2LA 3PWNB 4YZWA 4D2NA 3DYPA 3WNPA 4OLYL 2F0CA 3L7EB 5BUPA 4BGDA 4OLZH 2AXGA 4JFDB 4TUJA 4ZFFB 1MNNA 4WO4A 5DC4B 1KMGA 1OQXA 4MDJA 4IRSB 3VFNB 1QWNA 4GSDL 3ARFA 1RJZA 1JVLA 2WJ7A 4YSUA 3QH3B 5HDBE 3RTQD 3BUTA 4DCQA 4YGAB 1WT5A 2KLTA 1M7IA 4XNXH 4UYPA 5EF0A 4L8CB 2BY1A 3UTQA 1UGNA 3NVQA 3AMLA 5DJXA 1R3JA 5AW4B 5JMOC 1I8KA 4P99A 1EO8H 2QZ5A 3HAEB 5D1XB 4GRLD 4ILDA 1WBYA 4WI4A 4PS4H 1M53A 1H15B 4BHUI 4MDRA 1TFPA 1CDJA 2HN7A 2V37A 2RBLA 3VGHA 2K6WA 4ZJ9A 5D7JB 2BSSA 1G5AA 4AYMC 2H2PC 3HHSB 4E0RA 4U0RB 3DETD 1XZ0B 3KJ4C 3SKJH 3TWCL 2YO3A 4EN3D 2GJRA 2QQLH 3SGEI 4U1HB 1YYML 1QRND 2DS4A 4G9FD 1GMIA 4HUXA 3MREA 4O9HH 4FNRA 3QUGA 1VF5C 4FXGB 1TTBA 5I1KL 5JPNB 1DLHA 3GB7A 1R5WA 2DYSB 1KXQE 2G3NA 3INOA 1HJCA 5I17A 4H20L 4LL9A 4FLOA 2RACA 1MVYA 3WD5L 3Q1EA 1Y18B 4KOCA 5L88L 3IJ8A 3GXMA 3UP1A 1NZRA 2VLKB 3OJMB 2WO3B 4LPCA 3ZO9A 5EUKA 1GW6A 5C0JB 1K6QH 3NH7H 2YWYA 1U9KA 2K45A 3SE3A 1WZ1H 4ADIA 2OJZH 4BFRA 2CKBH 1X7TA 3MRIA 4AGNA 1BMZA 1BIIA 5EIIB 5JOFA 2AKRA 1F56A 2ZXGA 1W72A 3W38A 2AXGB 3MRBA 4TUJB 3FTYA 4Q2ZA 3KVPA 4HCIA 4WO4B 2OYLA 1DQML 3NABH 4MDJB 6PAZA 1CXHA 3OR6A 1GJIA 2XOTA 3ARFB 1RJZB 4NLAA 1U8LA 5HTSA 4NC1C 5B39G 4B0MB 4DCQB 3MA9L 5ACMA 1M7IB 1L4IA 1JZDC 2VRQA 2NQDA 4NRXA 5EDSA 1HCFX 3UTQB 3JWNH 3PQYB 2K8MA 3C09C 4RISH 1OB1A 5DJXB 1R3JB 2L7JA 5CP7A 5AQ0A 5AVWB 5CEYA 3L13A 4KKQA 4OIAA 4AVIA 4MAYC 4OIBA 4PREA 4AIZA 2B59A 1WBYB 2VLJA 3APMA 4XPFL 2HN7B 4X6BA 2NY7L 3RGVA 2KT6A 2BSSB 3KPPA 4O4YH 4E0RB 1F6LL 4WEUD 4HFUL 1XO8A 2X1OA 1JN6A 4UQ3A 4XAKE 4CL7A 5H35A 5F89B 2LE9A 4PS8A 1C8PA 2XA3A 2VXTH 3DX7A 3MFFA 1BBDH 1YY9D 4F9LC 1JWSA 5JHDA 4OJYA 4HUXB 3MREB 2ITCA 1NC4A 3N0AA 5DC0A 4Q4IA 4NNXA 2Z92A 5TTRA 3CV5A 4E41D 1IBFA 2FJFA 5E56A 1L0QA 1DLHB 3CHPA 1R5WB 3GB7B 1DSFL 3RAJL 5DS2A 5I17B 1CE6A 3ARWA 4R0LA 1NQBA 3RBSA 4KX8A 1YEHH 3HI6L 3KGTA 3UO1L 4YHLH 1HL9A 4TQ8A 5EU3A 3VWKC 1AACA 2X3AA 3VGGA 4BSJA 5H4ZA 5KUKA 5EUKB 1GGCH 4TQHA 3ML9A 5LNEA 2HFGH 3HE6C 4D9RE 1JVOA 2I26N 1ET5A 1KTRL 2X40A 3FT0A 3GMRA 2D0FA 1UXWA 7FABL 1TZGL 3MRIB 5JOFB 1BIIB 1USQA 1HZHL 2YZ1A 2AKRB 4AMKL 1W72B 5EULV 2XBTA 4ZOCA 3MRBB 3ZBMA 2VLRA 4Q2ZB 5E2TL 1GAFL 2Q3XA 3EH5B 2XDHA 3OR6B 1KV3A 2PWDA 1EFXD 1U8LB 4X5RA 4RWHA 5E6IC 3P3UA 4N0YH 1LEIA 1UM6H 5EORL 4L4VE 4HK3J 2EXSA 3ESUF 4K9EL 1EHLH 4NRXB 3HUJF 4PM1A 2VITA 5GS0L 3FQUA 3ET9F 3WO3B 4OR1A 4XB7A 1OB1B 2WB1A 4JFOA 3TT3H 1IZJA 5CP7B 4FFZA 5CEYB 2A4EA 2V7HA 4Z7NB 1JYNA 4KI5C 1IGIL 1N7MH 3AAZA 4YK4C 5INCA 3NCJH 4JMNA 5DEFA 4QCIB 4AIZB 4CVUA 2B59B 2VLJB 4NNYA 4UT9L 2YQ2A 4LASL 4LLDA 4XNDA 3DX1A 2Z6FA 4X6BB 1A6WH 3RGVB 3MLVH 3FSAA 1XD1A 1BCIA 2EC9U 3KPPB 1PAZA 4XXWA 4AIOA 1F3JA 2JH2A 3WNIA 4I2XA 3D4CA 2I32A 5ALBH 4UQ3B 5H35B 2Y9RT 1JN6B 3TO4A 1O6TA 1R3KA 2YAPA 1X5HA 1Y7VA 3DX7B 3KLAA 3MFFB 3J7HA 2P43B 2WZAA 4M1GL 5EZPA 5F9AC 4I1PA 5I24A 1JWSB 3L3OC 3Q9QA 4M4PA 4YUEL 5JHDB 2ITCB 1NC4B 1A22B 1P5VA 2Z92B 1AI1H 2Y0SA 3II2A 2BRQA 3GK8H 1SEBA 3IRPX 2FJFB 5J11C 3WMSA 2YPKA 2A1WH 3DI3B 3F65A 2VDOL 4IOFC 1CE6B 4PB9L 4R0LB 2PYED 3ZUNC 1JRHL 5EU3B 2BS71 2Y72A 1CZ8H 1QLEH 5FO8A 5CD5D 4MCMA 3DNKA 2PF6A 4JKMA 1SUHA 3SHSA 1KCVH 3B9VA 4KUZL 1BJ8A 2WMPA 4ORGA 3GMRB 5T33H 4M02A 1BAGA 1QSFE 7TAAA 1UXWB 4KROC 4N8VG 4ZS7H 3NA4A 2VLRB 3MV01 3GBLA 4RFEA 4PJCE 1F0LA 4I4WA 1EO7A 4YFLI 4YWGL 2GG1A 4WWKC 3GYRA 1J5CA 1LEIB 1QOKA 1USZA 4KHXH 2MCPL 2FNBA 1A9BA 1KY6A 3LMJL 1KGJA 2VITB 3FQUB 4JFOB 5IJKC 3ESVF 2V7HB 4HEPG 1RUMH 2CXGA 3MBEA 3AAZB 3BFQG 5INCB 3NA9L 4DNLA 2XQBL 5DEFB 2KERA 3FN0H 4NNYB 2AI0L 4W9DC 5ESQA 4LLDB 3U7WL 5HPOA 3D0VA 3V0IA 2WQAA 3QUMA 4P2YA 3W11D 3L3GA 1P53A 4WFEE 3MLYH 1F3JB 1GHFL 4XN5A 3ZYZA 4M1DL 1HNGA 4G7SB 4I2XB 5D71H 5E1QA 3WKPA 4AQ1A 3TO4B 1R3KB 4LARH 2C9VA 3KL3A 3KLAB 3U9PH 4BJLA 1HE8A 4QHKI 2FHFA 2IAMC 1CYWA 5E9NA 1PLGH 1P5VB 2KLRA 1A6PA 5E7FA 3K6FA 4XMUA 1SEBB 4HJGA 2YPKB 4HJ1A 4P23C 3SZKC 3TV3H 3V52L 2NY3B 2CGRH 4X6CF 1IGJB 2ZXWB 4KK5D 3DIFA 4LIQE 4JPVH 5F2FA 4KZEL 4R4BA 3SPHA 2NYYD 1HN1A 2R0ZH 3LB6D 3HG1E 4XOCA 2VZ1A 3EW3B 1YJDL 1YYLH 4YHYB 3M7FB 4RSVA 2JKJA 3M6DA 4OQTH 5EMYA 1PL3A 4YE4L 4W9FC 5EUOA 2OZ4L 2WMPB 3QG6A 1OD9A 1JVKA 4ORGB 3TZVC 2AQ3A 2B16A 4LP4A 1C1EL 5DHDA 5IB1A 4CADA 3ABKB 4MMXC 2XXFA 3ATAA 3QULA 1OSZA 3ARED 4UT6H 2OS7A 3WFCH 3KBFA 4Y19A 3RY6A 5B4MD 4XPBL 2JLPA 2PR9A 4WKXA 5AYTA 4P5TA 3WXVH 2EUXA 3BKJH 4ORZC 4FFVC 4IJTA 1BWMA 2MNWA 1KBPA 4N2BA 4HS8L 3GZPA 1NM4A 4A7UA 2DW5A 2UVEA 5EU7E 2VR7A 4AYFA 2G3MA 4L3CA 3MBEB 2BERA 3BHBA 2YLKA 3ZW3A 3EJYC 5C97A 4GRMA 1ACYL 1CG9A 3L2LA 1UCTA 2IDCA 4LOVA 5ESQB 4WSJA 4IBWA 5GGRA 3D0VB 1YEIL 3QUMB 1VFUA 1MJ8H 2DMKA 3L3GB 1EJ8A 3JZ7A 3WTWA 3ZKMD 2A3TA 3F64A 2AXWA 4QUOA 4AQ1B 4KJYA 1S78C 3ZRCC 5DVNA 3N40P 1HXKA 1LE5A 1GC1H 1RZKL 1SBBA 4LPYA 1LK3L 3WLBA 4DP4X 2C4FT 4JL2A 1SNRA 4A63A 1T7WA 5BOZG 3IFPA 4ZTOL 4RCAA 3NIGF 4KRMB 4AJWA 4HJGB 3NRFA 2CO6A 3SIKA 2OW7A 2QHRL 3DIFB 1EJOH 4R4BB 2JJSC 1ZLUH 2OMVA 4P46C 1JBJA 4U31A 3POHA 1DBBH 2Y1AA 5CJ8A 5EUOB 3QG6B 4S1QL 4S1DD 5HI4D 3EO1A 3QVAA 5C0BD 2AXFA 3NRPA 3VXMA 1Q9OA 4CADB 5IWLC 4JFFD 1PLAA 4BH7A 3QULB 1OSZB 2FZ3A 2V9UA 3QHFH 1P7QD 4UV4L 4PJ9C 4Y19B 1L9PA 5E8EA 1EHXA 2FEEI 4ONOA 3MODL 4M93B 4P5TB 4HUMB 2DLFL 3VXOA 1SMAA 2ZSVA 1AG6A 4BCXA 4KKLC 3ZKQD 4DUXA 1IKNA 4XVJH 4AYFB 4BFIA 5IF0A 1Y1DA 2VL4A 4LFHD 4L3CB 1LJMA 4DKTA 5GGTL 3BHBB 3LKRA 1BQLL 3RYMA 2M26A 5D7IA 4PJXA 4NPJA 5GRWA 1FL6A 4X7SL 1SGKA 4GRMB 2HAZA 1CG9B 3QDMD 4XAWL 4JDZB 2WCPA 4UNTA 3M1BA 4XPGL 2D7NA 4M5YL 5GGRB 2XVGA 2J72A 4RFOL 2VDQL 1YZZA 3H6JA 4OCRL 2COQA 4GKSA 2NZ9C 1CU4L 1NLBL 3P11L 4KJYB 2DQTL 3S36L 5CZXC 4PBXA 3WKML 1LE5B 3ZPDA 5TE6H 1KCUL 4HAFA 3SGJA 2DQDH 2R2BA 3WLBB 4G9FE 4BCYA 3P2BA 3OPZH 4P8QA 1G0DA 1IC5L 2TRYA 4X0NA 2R4RL 4YOKA 3IFPB 2J6EH 4YEEA 3V9EA 2Y7LA 2ZG1A 2H6OA 2CO6B 3EUDA 3O9WC 2Z4TA 4JO2L 1KGWA 4XPHH 3MRGA 3KL5A 4Z0BL 3MJ7A 5EZIH 3WNJA 2P5WA 2O6FA 4OLEA 1ML0A 4EOWH 3IKCA 2OMVB 3AG1B 2X9ZA 2ORBL 1KBGH 1PX8A 1ZVHA 4JG1H 5I1HL 2PPEA 4UYQA 1DFBH 5HYEA 1N6QH 1JPSL 1QPXA 5J13C 3ROLA 1L3NA 3EO1B 4DTGH 2CRZA 3VXMB 1Q9OB 3HBZA 3M1OA 5AB9A 4NZJA 4BH7B 2FX9L 1CICA 3JXAA 4Q6IA 3TEUA 2FZ3B 4N2KA 5E8EB 1B88A 3O4OC 5HHOA 1D5IL 1I9JL 3PDGA 4HH9A 1ZV5A 4WY7H 1NWOA 3ZUCA 3OAUH 3VXOB 1IGMH 2XC8A 2L8AA 3BT0A 1W8EA 3CXHJ 1Q72H 1WYJA 2OULB 5IF0B 2YD0A 4N2LA 4BFIB 3OAZH 4TQPA 3LKRB 4D9LH 3A22A 2D4FA 2E46A 5D7IB 4PJXB 5F7UA 3GXIA 1FL6B 4ZQKA 4AL8L 5DWUH 2OMTA 3M1BB 1U36A 2JB5L 2FTAA 2HYMA 2K78A 3BAWA 5LGHH 3WIIH 3HC3H 2DTSA 1O6SA 5LQBL 4HPYH 4GKSB 1SVCP 2JKIS 3FQWA 1R47A 4G5ZH 5TE7H 4TTDC 2R2BB 2PWFA 3DSFL 3H9HA 2OMBA 4XPAH 1FH5H 1IBGH 1JF1A 2PWHA 3CZSA 1DBJH 1FVCA 2DYRB 1R3LA 3F6LA 4I3RH 3I84A 3LXBA 4IRZL 1PZDA 3DVNA 3Q5YA 3MRGB 4HGWA 3GJEA 2QV4A 3MJ7B 4N2HA 3WTXA 2P5WB 1OHZA 4HUWA 1CLZL 3IKCB 2JCWA 1DZBA 2B3IA 1QA9A 4LSQH 5FCUL 1FGNL 3UAAA 1TUPA 3CSPA 4YVUA 4GO6B 3ROLB 1AHKA 5FW8A 1UA3A 1DVTA 2PXYD 4HAGA 2F15A 1L5GA 3MR9A 3RVTD 1CICB 1I1AA 1F02I 2NY6C 3L5XL 4Q6IB 5LDUA 3P0VH 3OZ9H 4XTRC 1CVRA 9CGTA 2ZUWA 4AYDC 5HHOB 3CCHA 4NP9A 3MDJA 1A9VA 4HH9B 2QHLA 4X9HA 2VSDA 4L3FA 4AKOA 1TTRA 1CXEA 2ICEA 4LLQA 3EJJX 1CD0A 4UNUA 1FAKT 5D8JH 5E6ZA 4LQFH 4R7NA 3P0YL 4O2EA 3O3UN 4QKTA 2YLHA 1JPEA 4ZQKB 2DH2A 5CUSL 1YNKL 2OMTB 2XU9A 5GGUA 1A4KA 5IHLB 3E2HC 4RGNB 5DMYA 1Q90A 3GPSA 1O6SB 3MGOA 4DO6A 5AAWC 4R4FH 1F42A 1VEPA 5IB5A 3A6CL 3Q8BA 4OUOA 2PPDA 1E40A 3FQWB 2ALWA 4NJ9H 4NYLA 3P4LA 4RAUB 4GRLC 2EDQA 4KNQA 3H9HB 3S2AA 2FD6L 4JK0D 1B4RA 1JF1B 5FGSA 3IJYA 4JX0A 1FVCB 5K5YA 4DO5A 1R3LB 5JIDA 3DETC 1CD9B 1LEGA 5A3ID 3G6JF 3M8OL 5T3ZD 3RFZC 1XB3A 1QACA 2ESVD 4MD5A 3PHAA 3GRWH 3DVNB 5FKAA 1PLBA 1R6VA 3GJEB 4HGWB 3V4PA 2IQAA 2PYEE 5D5MF 3ZDYB 3IXAA 4HUWB 4XMPL 4DN3H 1W72L 2B9BA 4LXFA 5D72L 4HLZG 1QA9B 2HCZX 4HHWA 1U2HA 5DYOA 3D8MA 4XMKH 3QJZA 1OTUC 4GKZA 4EE2A 1E28A 2WWMD 4NI3A 3FU9A 2GBUA 3DUSA 4QRQA 3T08A 3VA6A 1SF3A 3MR9B 1L5GB 4QRPA 2XYBA 1I1AB 3KNBA 2EZ0D 4UOW0 3T3MF 4PLJD 3V4UL 3CCHB 3N04A 3P69A 4P4RA 3B2XA 3VXRD 4XMVA 1I7ZA 2DQ6A 4B95C 3HC4H 2GJZA 4LLQB 5FWQA 4HHGA 1ZAGA 4WJKB 2H2SD 4R7NB 3LH2H 4O2EB 4QRRA 4M6NH 3T09A 2NY4D 1PZ2A 2AEWA 2VZOA 2XRAH 1U30A 5GGUB 3UC2A 1A4KB 1DE4A 4P5SA 1WA2X 1OEZW 2HT2D 2YKLH 1LHZA 5F0LB 5IJVA 2N1TE 2EH7L 4DP6X 3MGOB 4AEIL 1EIBA 1OALA 5IB5B 2XZCL 2Z7ZA 5DJDA 3NFNA 4HKZA 1A1MA 3I75A 1NCNA 5ANHA 4NYLB 2JKNA 3OJVC 1CL7I 2BWDA 2EVGA 5F3HA 2RIKA 2FGWH 1XIWC 3N43F 5HVWA 1OCOB 3DJ9A 4MNGA 5I1JL 2E7DA 1INEH 3IJYB 2Q87A 5HDLA 4JDEA 2BIHA 3TVMD 5DMGD 1LEGB 4G6JH 5KBKA 3VGDA 2EDKA 2X70A 1O9ZA 4MD5B 1VPOL 1K85A 1G7PA 5FKAB 4YHPA 1JXGA 1QHQA 3BZFA 3DX4A 5L6YH 1SJXA 3BC9A 2BP8A 3LNHA 1E8YA 2IQAB 4Q4EA 4WFGD 3IXAB 3V4PB 1A1NA 1B2YA 4NQTA 4RQQA 1G0YR 1INQA 4GAAA 4G72B 5SWZD 5DYOB 4OGZA 3K91A 4Y5XC 4FL4B 3IDGA 3KYAA 4HWBA 4GKZB 4BZ2H 5I1CL 3VI3E 1LGVA 3FO9A 1CVSC 4D0DB 3Q5TA 1E28B 2E0PA 3VFWA 4A2EA 4ODBD 2UY6A 3DUSB 4QRQB 5CIPA 4JUTA 1OLZA 3G04A 2BOBB 1GIGL 4QRPB 2VN3A 2YJQA 3AM8A 3KNBB 3L16A 3T2OA 1RIUL 4FFZL 3WNNA 2R69H 3BUIA 4GAFB 3S3JA 4JN1H 3EKCA 4RMBA 2VXUL 1AOHA 3PG2A 4P4RB 4LVOB 5ANMA 5C0AA 5F7EH 1H3PH 2WQSA 4M48H 4M9OA 3ULVD 4FTVD 1I7ZB 1XD0A 2MOGA 4DGYL 1JNNH 2JV6A 4CRPA 2GJZB 1LYQA 1A7OH 3N1MC 2HJLA 4JGNA 4UMSA 3ZXAC 4JFWA 3WXWL 4NEHB 4M7LT 4QRRB 2AJUL 3HKZA 4HT1L 4XMTA 4DK6A 2UUDH 3T3PE 2DI8A 2GK2A 3HOGA 3K7UA 3F6JA 3TXAA 1DE4B 2FEEL 2Q6WA 1V7NL 4MFHA 4JPKL 5IJVB 3GBDA 1XXDC 5BRPA 1XH3A 3DX6A 3PREA 1J8HA 3LDBB 2ZQKA 1U93A 5DJDB 3NFNB 3N06B 1A1MB 4HKZB 4U49A 3I75B 3WY4A 3SQOL 2OW6A 1DQDH 2K6YA 3TF7C 1X6NA 5F3HB 2W59A 4MNGB 2VDRB 1QTPA 1Z32X 3PAYA 2FVNA 4JDEB 1AZBA 4KVCL 1FNFA 2X70B 4Y88A 1A7BA 1FNEA 4NM4L 5D2NA 4BYHA 1G7PB 4YHPB 1FPTL 3BZFB 4Z7OB 2BP8B 5HVHB 1HX0A 3CX2A 4OCMC 4PJHA 1A1NB 4UT7L 4KGLA 3GSWA 4RQQB 3U7AA 3MXVH 1INQB 3CSBA 4I5BA 3OC5A 1EUTA 5JR1H 2X4QA 2G0LA 3IDGB 1L6XA 4OJDH 4KO6A 2EVHA 3FO9B 3JBG7 4FNPA 1ADWA 4MASA 3VAEA 3VCLA 3VFWB 5C0BE 2UY6B 5CIPB 3OAWA 3WDIA 4AXWA 3G04B 3BDBA 5TGBA 3SKNA 2WM0A 3SDXE 5CD5C 3QR1A 2FWUA 4PCTA 2M8XA 4YBLC 4HF5H 4N26A 4PRPA 5ISZA 1BJMA 5ANMB 5C0AB 2GHWB 3AUWB 1HQ4A 4RVBA 4FABH 5IVXA 1UWXH 4YPGA 2HRHA 3QUML 4Q8BA 1D5MA 1ZPUA 2ZPKH 4N0UE 1D5ZA 5B1CA 1CLOL 1JK9A 2HJLB 3EJTA 4QRUA 2V5SA 2XACC 5D70L 1KGXA 4LDEB 1RFDH 3T0VA 3FCUB 2JI3A 1WQVT 3G5VA 2VDNH 1I82A 1WGVA 4Z18A 3X17A 3D9AH 3CXDL 3QXWA 4WGVB 2Z31A 2VDKH 1XH3B 3DX6B 1DDTA 4P57A 1J8HB 1A7PL 3ECUA 2E27L 1U93B 3TN0D 3NDYE 3DKHA 2VLMD 3QUYC 1DVYA 1MCNA 3N44B 3T2NL 3X3FL 4QY8A 5IQ9A 2QPSA 1Q1PA 1V7ML 4RX4A 4K8RC 3WS3A 3PWVA 1YUKB 3FT2A 3LRMA 5D2NB 1NSNL 2OYMA 1TETL 3BH9A 4BZYA 2MWCA 1AGBA 3GLAA 4LLVA 4PJHB 4BEIA 4TNEA 3GSWB 1MF2H 1TVHA 4ZX3A 3TBTA 4I5BB 4LCCC 3VXUA 4GIOA 3ZL1A 2W0PA 2X4QB 3BCDA 3BMWA 3BVDB 4FZEH 3ZDXF 1SEQH 3D33A 4OFVA 4FQJH 4JY6A 1NCOA 1OL0A 1HHIA 4OCXH 3DXAE 3VCLB 1X6LA 5KVDE 3TURA 4AXWB 4P4KD 4HWEL 5TGBB 3VFRA 3SKNB 1MQKL 3SCMA 5A7BA 4ZMOA 3A0OA 2MSPA 1NIFA 1IGCH 2FLBT 5TFSH 1IIKA 5B8CC 2RAMA 4PRPB 4FCAA 5ISZB 1NUFA 3SDCA 2HVKA 1Z9SA 4DPCX 2W92A 1NPJA 3GHEL 2DLIA 3CSYA 3E6HA 1CN4A 1HQ4B 5IVXB 4OD3H 1WICA 2EXTA 4YPGB 3V0AC 1D5MB 1J86A 1EFQA 2EXYD 1D5ZB 1KYFA 1JK9B 2CJ3A 5B4MC 4QRUB 4YDLB 1WIUA 5DD3L 1E2ZA 2D7MA 1T7YA 1QNZH 3I6LD 4AC4A 5C09D 3QXTA 1LO0H 3ABZA 2GFBA 2B0SH 3G5VB 4UMGA 5IGXH 5L2JA 3QAZC 4FLRA 4WEMB 2Z31B 4CKVX 5DMKA 1T1XA 4CN1A 4P57B 1DBAL 4Q9RH 2X89A 3LRGA 1VACA 2CZNA 4NP4L 1Y1UA 3ZR6A 2CJSA 1KY7A 2VW4A 4G80A 4P3DA 3V4VH 3FT9A 2D8KA 4QY8B 1S7VA 2V2XA 3WSQL 1D6VH 3JYCA 5IQ9B 2RGSA 4OD1H 5CMAA 4KVNL 3GO1H 3NZSA 4MKTA 4YHOH 3V6OA 1HL8A 3QZNA 2MH4A 4ZFGH 2P80D 3WS3B 1WIOA 3PWVB 1JGLL 3FT2B 3V5KA 1ORSA 2DY2A 2VZ3A 4BFEA 1OSPH 1H3GA 1SY6H 2X1PA 1DP0A 3BH9B 1TXKA 1S7SA 2F7QA 2Q7NA 2A0LC 1AGBB 4LLVB 2B3RA 3NN8A 4R97B 3GXUB 1TVHB 5TDNA 3CZGA 4WGWB 5F0PB 3T4AC 3TBTB 1KCBA 1UM4L 3VXUB 5D4IA 4X80L 5DJ8B 2FBOJ 3RPIA 3E6FA 3GINA 4I18A 1JMXA 3A47A 1OAKL 4JY6B 1HHIB 3ARPA 2PO6C 3ZTNH 1G43A 2I5YL 2DD8H 4X2UA 2YPLE 3DX9A 3S5LA 4HQQL 3SCMB 3TA3D 1D9KD 3BDXA 4AWJC 1RD6A 4WWID 1YEEH 1NC2D 1OAYH 4NWTH 3GMMA 4AOFA 1QATA 4S1DC 2W9EL 3SDCB 2HVKB 3W2DL 1MCSA 5HGBA 3CSYB 3E6HB 3MUJA 2CMRH 1F8TH 2NW2A 5DUBA 1JCVA 3N42B 4NKIL 4TVPL 4WRLA 5FKPA 3UEZA 4N3UA 2X3BA 3M17A 2MKLC 4KXZH 1P7BA 2Z34A 1MI5D 3AQZA 3QQDA 1U8JA 3LIZH 4L9DA 4PR5A 5DFWH 1SXAA 3FSZA 2GFBB 3PUCA 3TEYA 1NBCA 3NFSH 4CBPA 3O2DH 3J07A 5L2JB 3D39B 2XV3A 1MRFH 2VM9A 1TDQA 4HULB 5DMKB 3E1ZA 1HCYA 1T1XB 1TVBA 2YA0A 3ZY7A 1HTYA 5J6GA 1H6FA 1VACB 2AVFA 4N5UA 5HGAA 1QBMH 1WFJA 1FH2A 2VMCA 4HX1A 4G80B 4P3DB 4NJAH 3L4VA 2VZSA 5I5RA 1FORL 1S7VB 2V2XB 3QNZA 1Q9LA 3UTOA 5CMAB 5I5JA 1FYTD 2COVD 5EA0H 1IARB 2V7NA 4BFOA 2ICWJ 3ZYOA 1MAKA 5D1QD 3V5KB 1ORSB 2NSXA 3RUGF 4URTB 3UJIL 4MAUH 2ESVE 2MNUA 3WEBA 1FE8L 5E6SB 2WYHA 1S7SB 4BKSC 4JLRA 3P4MA 3NN8B 3OAYH 2WXIA 5TDNB 3OZKA 3HFFA 1TZ8A 4YDNA 4M00A 4LEBA 4GIPD 4N2AA 1GCYA 3RPIB 4YXHL 3HC2A 4B9YA 1CL7L 3E6FB 4BQBA 4Q9QH 4I18B 5KW9H 4KTDL 5HVFB 4NENA 1NGZA 1K4CA 4AKQA 5JHAA 2NY5H 2QPEB 4OF8A 4K2UL 3U4EB 3DX9B 1Z7JA 3LZRA 3S5LB 1ASOA 1HKLH 4BINA 3HRZC 5FDYA 5KVEL 4ETQA 8PAZA 3FCGA 3HA0A 1A0QL 3SY0A 4X4KA 1A1OA 3B83A 1ZT1A 4PJ8C 5IROD 4FZ8H 3AS2A 4KJQD 4PCKA 1ASQA 3GMMB 4W9KC 4RETB 5HGBB 1KJ2H 1ODAA 2I60L 1N26A 4R5XA 4W6YB 3WNOA 5FWRA 2N7BA 2NW2B 3Q13A 5DUBB 2AERT 1FC2D 3QHTC 4MMYA 5ACLA 4PJBE 4YSAA 1PF3A 5FKPB 4KU1A 1GGYA 2JELL 1NMBH 2BNRE 3M17B 4QHPA 1AGDA 5AKRA 2WUCL 4AM0Q 4PR5B 1F41A 3QQDB 1U8JB 2CM6A 4E9WA 4OZIA 2HFFA 2ZD0A 4R7LA 4H8WC 1F11A 4BFKA 3QO1A 2WOBA 4QF1A 1OD7A 3VFVB 4S10A 1TVBB 4HLZH 1BVNP 3VXSA 2GK0A 2HXAA 2EDXA 5J6GB 5HGAB 1L7TH 4HX1B 5F21B 4HBQA 2CRYA 3V6ZA 4XP1H 3AQDA 2YD4A 2W07A 3QNZB 1Q9LB 3AS1A 3IDIA 5C07A 2J88H 3EOBA 4NC1E 1MQ8A 4NX0A 3D12B 4TMPA 2V7NB 2CCLA 4KX7A 4MXWH 2DWSA 3AT8A 2WBJA 5MP6H 4HA1A 1KEMH 3ARZA 4PJ7E 1X5IA 5F9DC 3QEHA 3C5SA 1PY9A 2X88A 4PCYA 3RWJA 1A3LH 4JLRB 1E4KC 3P4MB 5EH1A 3PNWA 4U6VL 1OP5H 4HUVA 2Y07H 4M6OH 1NCDH 3KVQA 4HZ1A 2E9JA 4P9HC 5IMKA 5TPWH 1SQMA 2WLHA 4W70A 4ZS6C 2OR7A 1H5BC 4IU2A 2XWTA 2DV6A 3U83A 5SV4A 1X4XA 4F5CE 2XICA 1SVZA 4NENB 1NGZB 3BAJA 4IDLA 1K4CB 4NQDA 4Y4HA 1OCWL 5E00A 5AB1A 4Y2OA 4ACPA 1PBYA 1A14H 1DQKA 3D6GA 4AYBA 4YFEA 3NZUA 2J8UE 4ETQB 2PCYA 3SY0B 3UCQA 1A1OB 2B2XL 1ZT1B 4BUGA 1DANT 5K1NA 4JM2A 5MEND 3KCPA 4DW2L 4WDIA 5CBEA 2X4TA 4HJJH 3RVXC 4PJFF 4GXFA 5E4OA 3TS8A 1P4BL 2CO4A 3L8QA 1BZ9A 3MV7A 3B2PA 5HYSG 3ULVE 2UZIH 3BGAA 4WFHD 1F97A 1KTDA 4MMYB 1OAUH 4QRSA 4KO5A 4E9LA 5J4MA 1G9MH 2AJVL 1AGDB 3LKNB 4DQOH 1KBWA 2PR4L 2DKSA 4M61A 3Q1SH 4OZIB 2HFFB 4KPHL 4NUGL 2X2JA 2H1LM 1JYXA 1F11B 3NIFE 4PY8J 1BQHG 3FKUS 3QO1B 1FLRL 4QF1B 3VTAA 2ZWZA 5HHNA 3VXSB 2GK0B 4JE4B 5ACZA 3HNTL 1S9WA 4QOKA 1EBAA 2DJMA 3OMIB 1SDDA 4MJIA 1S5IL 2IWEA 3V6ZB 3WEOA 2W07B 1AGFA 2APFA 3IDIB 1C5BH 4QMEA 5C07B 4CKQA 3EOBB 3KW8A 4L8SA 1VEMA 3MRFA 3OKOA 2GI0A 1WBZA 4ETYA 2O26U 4WAFA 2WBJB 4KK6C 1J1OL 2ZG3A 1ZIBA 3QEHB 3C5SB 4FXTA 3RWJB 5BV7H 5JTWA 4AKPA 2BWIA 3NYKA 2UWEA 3PNWB 2EILB 4HUVB 3MOQA 3LXUX 5C92A 1M6OA 4FNTA 5IMKB 3ZQ9A 3VGFA 5AAMC 3BZ4A 4GSDH 4U3SA 3LZFL 4IU2B 1NFDA 2XWTB 3SJVE 3QPQD 4XMKL 4Y4HB 4NQDB 1P6AB 3PP3H 5D7SL 2CK2A 5E00B 4Y2OB 3JWDL 35C8L 3BGMA 1KYUA 2XG5A 2VDPB 3FU5A 2WW8A 3MLPA 1RZ7H 2WVSA 2E59A 1DUYA 4JM2B 5J7CC 3FYIB 1FZMA 1P0SE 3KCPB 4WDIB 5CBEB 2X4TB 4QRTA 4PHZA 4I13B 3RIKA 2A9ML 3QDGD 5FGCE 1EXUA 3L5HA 2OV0A 3FU8A 4JQXC 3MV7B 1BZ9B 3ETBJ 5I0YA 3GF8A 1FVEA 3IFNH 4PGCA 1KTDB 2YKKA 4QRSB 4LPTA 2XIDA 3ZN6A 2WWOA 1UHVA 3SPGA 1BXAA 3KPSD 3CTTA 4CDHA 3HRPA 4CNIA 4KTGA 4ANXA 3K8LA 1BQ5A 4POYA 2QELA 3X11A 4EBQH 1GZPA 4M61B 5HI5C 4P2RA 4N1EA 3JQOB 4PRBA 4FG2A 2VDRL 1JV2A 1TQUA 3O8XD 4KKZA 2IDSA 2IMNA 1NCUA 4N28A 5HHNB 3MCLL 3ZSSA 3QR0A 1S9WB 4QOKB 4R5VA 4RSYA 1AHWC 1SDDB 4MJIB 4I3SL 1U8PA 3WD5H 4LSRL 2J57A 4C58B 1AGFB 2XTJD 2E3VA 3H7BA 3L1OL 3NEXA 3T8MA 4GXUM 4G7RB 4L8SB 4PU2A 3MRFB 3OKOB 3A67L 3K6OA 1MCEA 4HWBL 1RU9H 1E2WA 4OLVL 1PS3A 1RUAL 4ONHA 4K4KA 2LAAA 3EH1A 3O3BA 5AOLA 1WEJH 3UAFA 4J3XA 2UWEB 4LRNH 5CLYA 4B9JA 3ZGHA 3ARYA 4YDJA 1M6OB 3LEYL 4HC1H 2GBAA 1MEXH 4OZHE 1KC5L 3WS6C 3TVMC 3BZ4B 4U3SB 1UA6L 3FO2A 4OBSA 1NFDB 5JOPD 1TQCB 5I75B 3FRPA 4L0PB 5J3HD 4LESA 4PTTA 4BSVA 3UTSE 1ONQA 2ZX6A 1TZAA 3BGMB 5I16A 3V0HA 3V10A 3EFDL 2WSPA 4PJIA 5DR5L 1MLBA 1F90H 3SZ6A 3SQRA 1LD9A 1DUYB 5KZCB 1JZ6A 4LSUH 1FZMB 2YRLA 3UJTH 3BUQA 3JV5A 4QRTB 3ARXA 2GJ6A 1XGUA 1VADA 4I1RA 4XPFH 1EXUB 1JE6A 2NY7H 3FZUD 3GJFH 3O6KH 3F5WA 4IK7A 4H25A 4PGCB 1AO7A 1FVEB 4U1JA 1RP8A 1T66D 4GXUN 4OSUH 2RMNA 4NNPH 3Q8CA 4HFUH 1ACXA 5AG8A 4F7EA 4MAYA 4CNIB 1I8IA 2A74C 3QZPA 3X11B 5E24E 1GZPB 4P2RB 2WXPA 5CSBA 5F96H 4JVWA 4PRBB 1NBVL 4R4NC 1JV2B 3QCUH 3OKKA 2PCFB 2XBDA 4GW5A 3NTCH 4M7ZB 4UZUA 2XPGA 2IQ9L 2XZZA 3KJ4B 4JHAH 4OJFH 3ULUE 4NPYA 4PHXA 3U0WH 4J3SA 4N6RA 1U33A 4XE5B 4PBVC 4GRWH 1U8PB 4XC1H 4ELMF 3HI6H 2NXZC 2PW2A 3BIBX 3PGFL 4F9LA 3JWNC 4IDJL 3C5ZC 2W65A 3VI4A 1CGVA 5GJTL 4GPVA 3T8XA 2CPUA 3WDHA 1T1YA 1X7QA 3TFKD 1G6RA 3ZDZB 2VCOA 4YDVA 5JW3H 4UV7H 3I2CL 1GTFA 5JXED 5IV2A 1F58L 4ZTPL 4JDVA 4ONHB 3HN8A 5F0JB 3O3BB 3O41A 2B1HL 1M6UA 3MJ6A 1IC7H 5D4HA 1QRKA 3VWKA 5EU5A 2KHAA 3NJVA 4AMKH 4QLRA 2VSCA 4YDJB 5E2TH 3AT0A 3EDDA 3BFOA 3BDYH 4X4ZA 1QSEE 5DQJA 1A9EA 3FO2B 3DI2B 1KTJA 5E03A 3MC0A 4KKCD 3FRPB 4GAGL 5I8OL 3P2TA 3UDWC 5EORH 4PTTB 4BSVB 2JMRA 3CJJA 4K9EH 1ONQB 2C9SA 4FKEA 5LGYA 5I16B 4DVRL 2HTKD 2YMTA 3CHSA 4PJIB 1MLBB 2IEPA 2GCYA 4XCCL 1LD9B 3BVNA 3SOBL 2KKQA 1FJ1A 1D5RA 3EADA 2KPNA 5BRZA 5EBMA 2K1MA 4B0MM 4DWHA 3G5XA 2GJ6B 1XGUB 4UT9H 2F54E 1VADB 2Y06L 2QADC 2DMBA 3C09B 5TK4A 3F5WB 4H25B 1AO7B 2YD2A 3PDOA 4U1JB 1R5IB 1KELH 3CZUB 3VX1A 1Q0YL 2Q2LA 3F8UB 4GG6F 1R3IL 4XO8A 3VRIA 3D08A 4F7EB 2BIOA 1YPZE 4JRXA 4MAYB 2VAAA 2IJ0C 3X1EA 4AG4H 1I8IB 2BSCA 3LQZA 5JHMA 3MCG1 4TVSa 1DN0A 1PTZA 5CN2A 4PLKD 4DOHB 2OTPA 3OKKB 4GW5B 1TZHA 3SO5A 1PNCA 1QW8A 2XPGB 3LEXA 2QKIA 2IGFL 4ECNA 3TEWA 4KFZC 4NPYB 4OU3A 2IDUA 3GRBA 3IDYC 4N6RB 1N6UA 4GW1A 2EE9A 3BZEA 4M7KL 2H8PA 3QXVA 3L3IA 2PW2B 1H6UA 5CGYC 3L3OA 2ADGA 2W65B 3BQUC 3VI4B 4AYSA 3OGCA 3T8XB 1T1YB 1X7QB 2HFTA 1G6RB 4H8PA 1UWYA 4ZD3L 4YDVB 5FYKL 5D1QE 2NY0D 4OGXL 1NCHA 3P9MA 4GNKB 5IV2B 3H56A 4JDVB 5IBUG 3O41B 2GEEA 1BZEA 3FUFA 4S0TD 5EU5B 3VWKB 1XX9C 4S0HA 1WA1X 3EJPA 1CFQA 5DQJB 5HHVL 1A9EB 2A9NL 4U6XA 1MREL 3HE6B 1Z5YD 3CFMA 3UABA 3ZZLA 1R46A 1A25A 3GDCA 3HNVH 5IBLD 5J1AA 4ZXBA 3EBGA 5BW7A 3EXLA 15C8L 1JZEA 2BOCA 3LMJH 1DQLH 5FUOL 1HESA 1V5JA 4QXUL 3LV3A 4UQ2B 5FM8A 4ODXA 5DQDL 2GCYB 4YBQD 2XJLA 3BVNB 3NA9H 5DS1A 2XQBH 1FJ1B 2WUBH 3BCFA 4H1LG 4HG4J 4YS4A 5BRZB 4WWKA 5KOVC 5EBMB 3G5XB 3F7YA 4WUKH 2AI0H 3SPVA 5KJRL 3MUZ1 3PL6D 5I1GL 1FN4A 1I1RA 2I69A 2E7HA 4LHUG 5EBWA 3PDOB 4UILH 3ZHLA 3RURA 1GHFH 4K3DL 4PJFE 1ZSHA 3VRIB 5E9AA 4GXVL 3UZEC 3J8F7 4JRXB 2VAAB 1GL4B 2X87A 3LQZB 1KT2A 4MB5A 4JQIA 2B1OA 2XWRA 3HG2A 1DN0B 1A7RL 3MSPA 2QGBA 3D2UD 4Y2DA 4OM1L 5KSBE 1TZHB 1BZ8A 3LEXB 4GUOA 3UBGA 2QKIB 1OP3K 3V52H 1NCJA 3JWOC 4OUUA 3BEVB 3BZEB 4KZEH 4XC3L 1JHKH 2H8PB 4OCYL 3L3IB 4GSXA 4M8VA 4UF7C 3PP4H 3VD9A 1JD7A 4GMSL 3L3OB 2ADGB 2IAMA 2EYTA 1NANI 1YJDH 1U8CA 3OGCB 3QJFA 1L9QA 2W60A 4JFED 1QR4A 1SN0A 4YE4H 4P23A 3TH2T 3VRLF 4BQ6A 2AC0A 2OZ4H 4J7RA 3RKDD 4C57C 2OK0L 2GSMB 5KANG 3P9MB 3KBHE 4C56E 1G9NH 4A68A 1BQKA 1FA4A 2YXVA 5EDXA 5AVSB 5AW8B 4Z76A 3EJZD 5DUML 1MRCL 5F9OL 2AGJL 2NY2B 2IOOA 1CFQB 3IDXH 3ZDWA 2CAKA 2HKAA 2IH1A 4U6XB 4N8PA 4UIMA 2R39A 4G8IA 1VKXA 4J8QA 1IC4L 3TZVA 2AXHA 1DVUA 3NPSC 5C6PB 4EO5A 4WI7A 4ZXBB 5J1AB 4N2EA 4WFFE 3BAEH 1E5YA 4ZNEA 3QIWD 2BOCB 1DLFL 1RUPL 4HU2A 2PWGA 4KROB 4QXVA 3B1TA 3LV3B 2LR4A 3FU7A 2J43A 1J48A 4ODXB 5GZNC 2AAVA 1N12A 2YA2A 3VX0A 3CN0A 1PY0A 1RUQL 4IBLT 1YDPA 4WWKB 4YSOA 5KWYC 4JB9L 5MENE 2B8OT 3FONA 1HEZA 1MJJA 3LN9A 5DO8A 3SPVB 4ZW5A 3E38A 5I28A 1YEIH 1FN4B 5EBWB 1ZLWH 5I6MA 1MJ7L 1D9KC 2Y2TA 4G59C 4WFHE 5LHDA 4G7VH 3WDJA 5KJ7E 2LFGA 2ZXEB 2VDMH 3TNNA 1KT2B 2HG5A 4YLBA 5F1NA 5DJ0A 4PY7A 2VR6A 1LK3H 4AYEC 4YDKH 4XVUD 2BXZA 4Y2DB 1ZEAL 4YQXH 5KS9A 3C60A 3NK4A 4ZTOH 3ZE0F 4NCDA 3VXTA 5HSFA 2X12A 4PB0H 2CO2A 3JT2A 4OUUB 4FA8A 4X4XA 2N4IA 1K3ZA 3H2PA 4G6AD 1NBZA 4JREC 2IAMB 1A6TA 2VSKB 4C83A 1WCQA 2EYTB 4JJ5A 5C71A 1U8CB 3RJDA 1S9VA 2C8NA 4XMLL 5T3XL 1Z66A 1U3ZA 1RULL 2LQRA 2C7UA 2W60B 1F1GA 3QDJE 3QJFB 4P23B 4Z7UE 5B22A 4LP8A 1YEJL 4L2YA 4S1QH 3AITA 3VG9B 5E5LA 3OF6A 2FBRA 3B6SA 2JJSA 3T6WA 1MCHA 2IFFL 5JXAL 1IVTA 4KDWA 2V5RA 2X6BA 2XVLA 4Z76B 3H3KA 9PCYA 2DZEA 3IDMA 5IIEA 3B4NA 2IH1B 3NCXA 3OD3A 1VKXB 3TZVB 2DLFH 3NSYA 4L5FE 2XX0A 2HWZH 1JZ2A 1UCBL 1SJEA 2KH2B 1CO1A 3FU7B 5AOZA 2CLRA 4PJ9A 4LBAA 2YQGA 5GGTH 3S37X 2I07A 1YDPB 5HDOA 2NUPA 2XIIA 3V0EA 3FONB 1HEZB 4WUUD 2LU3A 1MJJB 3N1PC 3SO3C 1IEHA 2FX7H 1TZIA 5D1ZA 4M5YH 4JKLA 3ZE2F 4X6EA 2VDQH 4HS3A 1KXVC 4V11A 2AJ3A 4KKRA 2YHGA 2ISDA 5DD1H 1JDAA 1H8SA 1EJFA 3SYPA 4OCRH 1NLBH 4DGVL 1MN4A 2DQTH 3TNNB 4UOQA 2HG5B 3V9CA 1BPVA 2R0WH 1KCUH 3KYMA 5DJ0B 4PY7B 5F1NB 3ZTJG 1M57B 2W38A 4FG0A 3THML 2H3XC 5SX5K 2R4RH 5KS9B 5I9QC 5BUGA 2VIRA 5EF1A 4LSVH 3VXTB 1EAOA 1SZNA 4MHHI 4X4XB 2NXYD 4JO2H 4GQRA 3CVBA 4I0KA 6PCYA 1MFBL 3ZKSD 1NBZB 5AZEL 2ORBH 2XTJE 1A6TB 3IFLH 1M71A 1PAMA 3EOAA 4J27A 4JJ5B 4C83B 1OKEA 1S9VB 2P44B 2P49B 3DYOA 2C7UB 4JDTH 1JPSH 2WGXA 2ZWKA 3HB3D 4OJAA 3O9WA 2BZ7A 3FDWA 2K4WA 2YAFA 5E2WH 4HAKA 2J71A 3L54A 3B6SB 3MJGX 4U6YA 4CILA 2IV8A 2H5UA 4X83A 4GP5B 4MRBA 3WTTA 2BFGA 2JCCF 2VDPL 2OP4L 2LOEA 3IDMB 4LL4A 5IIEB 2F19H 1D5IH 1I9JH 3QORD 1NJ9A 3KGSA 4H88H 1TEFA 2H32H 2F74A 4XPTH 5ADOH 1SJEB 2RTTA 4M5ZL 1J18A 2V9RA 1YQVH 1INDL 4BQCA 1U2YA 2CLRB 4PJ9B 1CE1L 1CTOA 4MJJA 4GOSA 1NAMA 2I07B 1IFGA 5CLXA 2NUPB 2P52A 1I8AA 4PJ5E 1YCSA 5D1ZB 1TZIB 4X6EB 1ETB1 2JB5H 4N0RA 4HS3B 3KPRA 3ERXA 2AJ3B 2DQEL 5HY9A 2ZUQC 2PTVA 3SYOA 4DVBA 5DD5L 2P5EE 1MAMH 4K3EL 4PRHE 2WLLA 3KYMB 4IRSC 4OCWL 4Z7WE 1VFAA 3DSFH 4JG9A 2J1ZA 2ZNWA 5DJ6A 1RIHL 3NJXA 4XVTL 2VIRB 1HOEA 3SYAA 5B7MA 1U58A 4N8CL 5E1HB 2MOQA 3GI8L 3QR2A 4HBCL 3SGDI 1U3YA 5AOIA 1OAXL 1T5KA 2XWXA 2UZPA 1PKOA 1U6AL 1M71B 3EOAB 5CCKL 4YPJA 5FCUH 1FGNH 1M7XA 2QTVA 4OZGE 3QGVA 2DN7A 3P9LA 3O9WB 1MW3A 4PRIE 4AH2A 3GGWA 1CS6A 3MLTA 4U6YB 2FEDD 4Z3EA 1W9XA 4ICXA 5BZZA 1DVSA 3NIDB 3NBNA 1SYVA 3I02A 1A6VH 4QNPF 3L5XH 2O6PA 4UQ9A 3FH8A 1UWGL 3SDDD 3BSGA 5J13B 1NJ9B 3RY5A 5T1KA 4FXGC 3WENA 2FE0A 3SE8H 3UX9B 2X2UA 4BUHA 3CC1A 4MXQC 2F74B 4DZ8A 1K8IA 2NPLX 3A23A 4F2ME 1NDMA 2A9DA 1L3WA 3X3GL 5JMRA 2QBWA 3WUWG 3L95A 1UASA 1XH0A 2QFPA 4AEEA 1AKJA 3WIFA 1NAMB 2B08A 2XKSA 3NCFB 4JM0A 4FEMA 5CEZL 4HUNB 4KV5F 3O4LD 4H5SA 1N8ZA 2CH8A 5E1AA 2ZCHL 3KPRB 3Q43A 3NZ8A 4OZFG 4G11A 2WLNA 5HY9B 1AAJA 3BYTA 1DJGA 3HZKA 3S8GB 3A6CH 4APQD 4DVBB 3RTQA 5DK2A 5G4MA 3KJ6H 3ASOB 4WO4C 2F08A 5I30H 1A8JH 2WLLB 6FABL 1JZ5A 4BK5C 1NLDL 3ARFC 5DD0H 1VFAB 4B9GA 3GXDA 1KDJA 2AZUA 5I74C 1AQKL 1J0IA 1S2EA 1SOSA 1KIPA 2FD6H 4QHNA 5DJ6B 1WT5C 2N7SA 2WLMA 5IFAH 1NPUA 3M8OH 1U58B 5BRQA 1J5DA 4GRLA 3VNYA 2OMXA 3AJ7A 3TYGH 1UUSA 4BM7A 3DPDA 4M1CD 4XMPH 1W72H 2CLZA 1AGEA 4ODTH 5D72H 4ERSL 1KDIA 5D1ZI 4AQEA 1EAJA 3N2JA 3RFZA 2I7OA 3ZE1E 1CTMA 3P9LB 3CBKB 4RMUA 5CS7A 2HRGA 5AL0A 3GGWB 4AH2B 3MLTB 5I6KA 1NGPL 3VRLE 5E4EC 1QRNA 2YEZA 1WWWX 3T9WA 1SYVB 4KH2A 1L9OA 3I02B 1OSYA 4JVPA 5FUCC 4PW3A 1JXDA 2EDWA 5K9KA 3V4UH 1TJHL 1VENA 2E7BA 5KVGE 4NT6A 5T1KB 1S7TA 3FQRA 5I1DA 3WV0A 4XN8A 1SHSA 5EWIL 1CK0L 3T0AA 4DZ8B 1K8IB 1JNLL 2V5MA 3D2TA 4W81A 4XP5L 1NDMB 3NP3A 2NY6B 3RJOA 4Z3IA 3BP4B 3L95B 4K3GA 4IJ3C 2V8MA 2ZCLH 3QZWA 4EUPA 1VGKA 4G82A 1AKJB 3WIFB 4DSYA 1JOIA 1F2XK 2UVFA 2WXNA 4KJPD 1NGWA 5H2BA 5J3HC 4MCNA 4UNIA 4O02A 3UC0H 2ZOUA 3LNFA 4H5SB 2WCGA 1N8ZB 5E1AB 4PG2A 3DMMD 3NZ8B 5C0GB 2BDNL 1H3VA 4OIIL 3UYOD 4AEIH 2XZCH 3HZKB 5ALCL 3NJHA 3IJ7A 2XPZA 2Z35A 4DKDC 5DK2B 2F53D 2RFXA 1BP3B 4BFFA 5I66B 4G71B 2ZUTA 3FZUC 5I1JH 1KIPB 4QHNB 3E2HB 3KWVA 4FLHA 5IVOA 1T66C 2VC2B 2IPUK 4NHCL 4XN1A 4JR9L 1G6RL 3HUJA 1PKQE 2V2WA 3QJHA 4J3TA 4WZ9A 3T2QA 4F9PC 3NSXA 1AIFA 3MACL 4WI2A 1HNYA 1NCWH 1XH2A 4PV8A 3B2UD 4K94C 4GRLB 5CP3A 2OMXB 2EH8L 3MVSA 5TD4A 1DFXA 2VL5A 1P1ZA 1XIWA 2CLZB 2KI6A 1AGEB 1HWGB 3A6OA 3W56A 4PJEF 3TJEH 3RFZB 4YSPA 1QHOA 4ZBJA 2XYCA 5FYJU 2IALA 1LLAA 5FFLA 1CFBA 4H1LH 1F86A 2FJUB 1ILUA 3C8HA 2OMUA 4WI0A 5AW5B 1G1CA 3W0WB 1QRNB 2YEZB 4BA0A 1GIGH 3LXAA 1BYNA 5K9KB 3NEOA 4E41A 2KZKA 3GDBA 4Y5XA 5EHFA 4B27A 4MNQD 4LEEA 3QDHA 2RB8A 4Y4KC 4TPRH 4NT6B 1E9QA 5I1DB 1S7TB 3FQRB 3HIZA 5JXEC 4S1RL 5L4IA 3IBOA 1NCCL 5D7LD 2WO4A 5JQ6H 4GKOA 2AVGA 1L0PA 4OFDA 2N1KA 3QZWB 3OX8A 5H4YA 1VGKB 4EUPB 2M1KA 3WXWH 1GJWA 2QQKH 1NGWB 2AJUH 2EE3A 1TMQA 5GPRA 5H2BB 5KVFL 4HT1H 1XEDA 4O02B 1OTSD 3F7RA 1V3KA 2NSMA 2VXVH 3K46A 4O58L 4OJEH 4P49A 4Z3HA 1V3JA 1V7NH 3ZZ1A 1WFOA 5A2AA 2A73A 1A3RL 2DI7A 2ZF8A 3PGCA 4JPKH 4K7FA 2ENQA 4FADA 2WTOA 5GGSY 1YYCA 2R4SH 2GB2A 3I3EA 1Z2KA 5FO2A 4BGLA 1EFXA 2Z35B 1AQMA 4P48A 2RFXB 3BKCL 5GGVL 3SQOH 2ZJSH 2APVA 3HMXA 1GYVA 1FGVL 4U1NA 4NO5A 3FJTA 2ID5A 1ROWA 1B4LA 3ILQD 1OCRB 4KHTH 3WUZA 3V0DA 2KUTA 3HUJB 2V2WB 3QJHB 1OGSA 1HQRA 1FPTH 4PV8B 4B96A 5IQOA 4JGJA 2R9HD 1IO4C 5E0QA 3ZLQC 2VL5B 1JYWA 1P1ZB 1XIWB 4PLKC 1XCWA 2NNCA 2MOVA 3REVA 4XOAA 4HXAL 1WRFA 3KPQA 4F8LA 3QXAA 2ZOKA 2CD0A 2IALB 1OZTG 2CG9X 4WI0B 2OMUB 5C8JA 1AMYA 1NIBA 1XMWA 3QJSB 4AVJA 3TESA 1V8HA 4TVUA 1VEOA 1BD2D 2WHVA 5I19H 3ARGD 5SWSE 4AM0A 1F13A 5F6HJ 4E41B 4HP5A 2IBGA 4Y5XB 1I9IL 1YLBB 4K5MA 5JPMC 3ETBF 4K3JL 3LN5A 3QZLA 1E9QB 4EI6A 2BSDA 3LKQA 3S5ZA 3D5OF 3MYZA 1XL4A 2R29A 4J4PD 4X6CA 2JJUA 1CLOH 2CSPA 5LDSA 4XXCC 2AV7A 2QVIA 3OX8B 3APCA 4OFQA 4WWOA 4FQIH 4MAZA 1BZQK 5D70H 4OKDA 2V2TB 4A6YH 3FRUA 1EHKB 4TSBL 5DMJB 1KLGA 4JQIL 3CDZA 3C2SA 4TNVF 2O5ZL 2Q76A 4ALAH 2A73B 4K7FB 3PGCB 3ML8A 4ZK8A 1MFCL 1OT1A 5ECGA 3OZLA 4G6FB 4FKKA 4NQUA 5CN3A 2WD0A 1EFXB 1J5OL 1HIMH 4IMLA 1JERA 3D50A 4YSSA 2H6PA 3T2NH 3DX8A 2X0WA 3IS1X 3ZYJA 1QI3A 4U1NB 4NO5B 3PL6C 3QJRB 3H9YA 1PEWA 2DIAA 3BT2H 2IV9A 2PPFA 3CZLA 2ATPA 3KLLA 2XZQL 1N4XL 3MOAH 3SE4C 1NSNH 1HQRB 1TETH 2VUKA 3IAPA 4G3YH 1J9RA 5FO7A 4L1HA 1ADQA 3MBEC 4ZO7A 3CZNA 4J39A 4MA1B 4LPWA 1DO6A 2XWJA 3REVB 4GRWF 1WIPA 2CPCA 4FQ2L 3MV8A 1HH6A 3BPOC 3KPQB 4YX2H 2CHZA 2FATL 2XWZA 3QXAB 2ZOKB 5F7AA 1HE7A 1KGCD 1FIGH 2X4NA 3BZ5A 1Y0LA 3OHXA 4LMQE 2D3NA 5C8JB 1I1CA 5LWYL 3PU7A 5ESVA 3NUKA 1MQKH 4DKEH 4AM0B 2FLMA 1DL7L 4LCCA 2CNYA 3GMPA 3P40A 4W68A 3TEXA 4YH6A 2F5AH 2BSED 2OLDA 4Q9CA 2VXQA 5I0XA 3P3TA 2JIXA 5EF3A 3LN5B 3T0XA 4QNPE 4EI6B 3LKQB 4Z7QF 1IT9H 2YA1A 3CFEA 2EUVA 5CAYB 3NJMA 3ZTJH 4X6CB 3BWUF 1P9MC 1Z9LA 4KKNA 5CU9A 5HHXL 3L4WA 3F84A 3KLHD 4PJGE 4AQ8A 4HUUA 3UEQA 1KB3A 2AV7B 4WI8A 3QIUD 4IHBA 1WE5A 5ITBH 5EEYA 2BWQA 3V6BR 2R0KL 2WPGA 3FRUB 4W9EC 3X13A 5C2BH 4PRNA 1KLGB 2HJKA 2E9WA 2PP8A 1NCAH 3CDZB 3O6LL 4MD0A 3OLGA 2Q8BL 2AJYL 2Q76B 3FK3A 2DAVA 2DQGL 2PP9A 3AREA 4M03A 1E4HA 1DBAH 2V9TA 2A4ZA 3P1VA 1OF0A 2DIBA 4D0BA 4NP4H 4IMLB 3TT1L 1AIZA 1XGYL 2PTTA 2H6PB 4J12A 5L4FA 3DX8B 1OM3L 3CFCH 4JBSA 4P07A 4GJTB 1IL1A 1AXTL 2HKHL 1BREA 2KDGA 2MNJB 1IZKA 2FO8A 1JZ4A 2ATPB 3E7JA 1EXHA 5ICZA 2BNQD 1XTLA 3B1UA 4V1DD 4MLSA 3QUYB 5DEJA 5DZ9A 1OT4A 5FO7B 5IHBA 5TE4L 3DV6A 2FBJL 2XWEA 1YNLL 4JPWH 2YAMA 1UM4H 2YD5A 2XWJB 4KKAD 3IU3A 5L2KE 1BLNB 1HH6B 3MV8B 4Z7VF 2I24N 3LVEA 4L1BA 4JQVC 1KGIA 2J5LB 2X4NB 5IBTL 1QPPA 1Y0LB 3VFTA 3OHXB 3W3BA 3MCKA 4GB9A 4ZRGA 4G6AC 5ESVB 5K9JL 1L0XA 3UTTA 2BP3A 3CZFA 4HQQH 3T4AA 2D7OA 3WU1A 4LCCB 1IMHC 3GMPB 3KH3A 3DHMA 4ICWA 1FYHB 3OAZK 2DF3A 2JIXB 5EN2A 3W2DH 3NIGB 3CFEB 4FQLL 4GO9A 4PMEA 5AL8A 3OJ2C 5E23A 3X14A 2CO3A 1EHAA 4HUUB 3P30L 2GVYA 3WTSA 2XETA 1YEDA 2L7QA 4MGXA 3TBBA 4AGMA 5B8CB 4PUBL 2WWKT 4PRNB 2HJKB 4MD0B 4XZ4A 4QJ4B 4JFFA 1E4XH 4UUJA 1ID2A 3S4SG 3UBXA 1KF9B 3AREB 4IRJD 3KBPA 4FI7A 2BY2A 2E8ZA 4UTBA 2H26A 4D0BB 2WXOA 1HYSC 3FH5A 2ETWA 1BFOA 3RPBA 3VH8A 2PTTB 4AMXA 1RZIB 1FORH 1B6DA 4P2QD 5JIHA 1A3QA 5KN5A 5I73B 4GP8B 2QSTA 1IL1B 3D85D 3QAZB 3OMZA 4HDIA 1MHHA 2BVPA 4FE9A 5EU4A 4FCHA 5ICZB 5E9DD 5A40E 1X9RA 1CLYH 4ODUA 4Y1AD 1FE8H 3NZHH 3QDMA 5AD0A 3QZOA 1EGJH 2Z4QA 3DV6B 1PYWA 2YSTA 1S8DA 4Y9EA 5KBNC 3QXDA 1UGKA 3II3A 3UIZA 3S3DB 3IU3B 2DKUA 2IDTA 2CBPA 5DFTA 1NGQH 3VFTB 4XNZC 3DRTA 2HFEA 3MCKB 4K2UH 1TQBB 1RURH 1RKRA 1U8MA 2GW5A 3IMTA 4Y7MA 3RVVD 3UTTB 3CZFB 3KYKL 3T4AB 4LIQH 5KVEH 3MFGB 4OZFH 3FQNA 3SGJC 1NAML 5IT2H 2ZXBA 4WW2F 3CXFA 5EN2B 4FNUA 4GSUA 4BXSV 4C54A 5FFOA 3X14B 3TWYA 3HRZA 1MKFA 4FMVA 3F62A 1ES0A 3CN4A 3SDAD 4G6KL 4LU5H 1YEDB 3C08L 2DQCL 3B56A 1XGQA 2E76C 3QORC 2WUCH 4WHDA 2V3DA 1GKOA 4POZD 1MNUL 4CA4A 2BCMA 3UP6A 1UB5A 4JFFB 5FOBA 4RZKA 1WD8A 4UUJB 1OY3B 4WKZA 3UBXB 4FHJA 1FHNA 2MMXA 5JQHC 5K59F 1HWHB 2FQFA 4DPBX 4L4TD 2H26B 3R4RA 3TX4A 4Q6IC 1BFOB 1EX0A 2F53E 3WOVA 5KN5B 4I89A 1WZLA 5HYJA 1DQVA 4NUMA 4OV5A 1LO3L 1IRAY 4HDIB 1MHHB 2BVPB 3ZX1A 2VR9A 3GM0A 5EU4B 2C34A 1BXXA 5I18L 5AYQA 4U1SA 2IMMA 4ODUB 4ZUTA 4KXAA 4WHTA 3QDMB 4NKDA 1J1PH 2Z4QB 1I3RA 1DJXA 1PYWB 3IPEA 4TF4A 2D7QA 1S8DB 4OGYL 2HSIA 2QSCL 2OR8A 3QJTB 1TLKA 2ZKXA 3IPBA 2FX8L 5AVVB 1WHOA 1ZVSA 3IMWA 1EEYA 4HIEA 4L8BA 4JAMA 5D7KD 4Q6KA 3QDAA 3VD2A 5I1EL 3DRTB 2HFEB 3RDTD 1E4KA 4MXVE 1U8MB 3U6XS 2Z65C 1D5XA 5G55A 2CJTA 3BQVA 5MI0B 4KQ0A 1NEZA 1DJWA 5F7KC 1S3KL 2B2XH 4JFPA 1A7QH 3FQNB 1H5BA 1L9NA 1A3ZA 1WAAE 4LSTH 4AGQA 4DW2H 2FDBP 1CD1A 4MNQE 1HH9A 1LDSA 4P3WA 3G6JA 1XH1A 2LAGB 2NTFA 1QFWI 3LKOA 1GS6X 2ZKYA 3HRZB 4YSRA 4PIBA 3GXFA 4NM8H 5D5MA 2OL3H 2IDQA 5KG9A 3CU7A 1ES0B 5FGBC 3DOIA 3SDDC 1KGYE 5D1XD 2AJVH 1XGQB 4BUQA 2PR4H 2CHDA 1FDLL 4WI3A 2W0KA 4RFNC 3S48A 3MUGA 3SDYL 4KPHH 3FUNA 3HEIB 1UB5B 5D7JD 5FOBB 1M4KA 4WKZB 1AD0A 1FLRH 2VC2L 4HCRA 4ZAKC 3NJJA 3IMVA 3HNTH 5C0RL 2EYSA 3EDFA 1BF5A 1ZHBA 1S5IH 4UAHA 4MA7L 1ZLDA 2EDEA 3EYUH 2HX7A 5HYJB 1ZHLA 4OV5B 3Q05A 1LO2L 5LBVA 4GQ9H 2Q2EB 4ENED 4Y1SA 3VFGH 5C1MB 2ICEC