2N59A

Solution structure of r. palustris csgh
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatically-guided inhibition of Curli amyloid nucleation by the CsgC-like family of chaperones.
pubmed doi rcsb
source organism Rhodopseudomonas palustris dx-1
molecule tags Unknown function
molecule keywords Putative uncharacterized protein CsgH
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n59A00
2Y2TA 2Y2YA 2N59A 2XSKA
chains in the Genus database with same CATH superfamily
3US1A 4PJAF 2ZUVA 4Y9GA 1KIQB 3RU8H 3CC5A 1O0VA 3IPEA 1HNGA 2UY7B 4H0IA 1W0WA 2WCPA 2QELA 5GHWL 1ZA3A 1U8KB 4JO4L 5TQ2H 3KEHA 3SCMB 3ZR5A 2HJKB 3Q6FA 5E6ZA 5B3JE 1YEDA 3VTMA 1RU9H 4CNIB 5L7XL 2KI6A 4I7ZC 3BI9X 2ENSA 1NCDL 4L37B 1YUHB 2W9LA 4GLRI 4WCYL 5GGVH 2CGRH 3DUSB 3S35L 1TO4A 4G5ZH 4FYQA 5GS1A 5K9OB 4WY7L 3BUYB 1QRND 1UZ6E 4UT6H 3EH3B 4UAOB 4TNFA 4G8EA 1BEYH 4DGUA 1H8NA 1QQDB 3LB6C 4UDTB 3TURA 1XB8A 4ZDHA 1J05B 1SN5A 2FD6H 3EUDA 5AQ0A 2YD8A 1B4JH 2XZAL 2Z91B 3FB7A 4LHUA 1A9BB 1ZA6A 2AANA 1S9XA 4ODTH 2OTUA 3ARYA 1M2VA 4KDTC 1WZAA 3UTSE 2W38A 1MJ8H 2X4OB 1YEFL 5EU6D 3FQ4A 4G6FB 4X5QA 1QWNA 5C07D 4WFHD 1K3ZA 4L9LA 1C5DA 2EH7L 3KJ4C 4X5WB 4DSYA 1XH3B 2H0FA 1OP5H 5L2KA 1S7SB 3L5HA 2DQCH 4XCEB 3WKQA 2IMMA 2ENQA 2FLBT 4AEHH 4EI6B 2AW2A 4HGWA 2NUPA 1BLNB 1DDHB 1CYGA 1EMTL 2IFFL 2R8SL 4YFDB 2VC2B 4Z7NE 2DYSB 1JNLL 4WKXA 1WC7A 1LK2B 4XE5B 3ZO9A 2F7OA 4M5ZH 3QEUB 4F8LA 3G9VA 3K6SA 5TDOB 2QQNH 4IK6A 5C0RL 2WZ0A 4YK4B 4JG1H 3A67H 5LBSL 2LABA 2RJMA 1CG9A 2A9MH 3C12A 3DBXB 1A1NB 4P04A 5FOJA 2C3GA 3O4OC 5FGCB 4D9LH 5I0ZA 5KBPA 1B4TA 2OKMA 3HR5B 3BQUD 2FO4A 3IXAB 4IMLB 4LIQE 3APMA 1IZKA 2E8YA 2I85A 2UZPA 3EBGA 3I50H 2Z31D 1MCQA 1OF2A 3VFRB 3AGVA 1GYVA 4ZUSA 1XFPA 4LCWD 2GBAA 1H6TA 3FUHA 1YYLH 5CLXA 4PJ9B 2XWEA 3EYFB 4GB9A 1MDTA 4ZPVA 1TPXC 2IOOA 4TV3A 4NHCH 1KCSH 4O2FA 2YAQA 4GAYB 2PO6A 5JO5A 2CR0A 2EDXA 1NBQA 1JMZA 1UWEL 3WD5L 3SOBL 1R0AH 2V5TA 1IGJA 2VN5A 7PAZA 1IAIM 3IJYB 4X98A 2ROYA 4IHBA 3PV7A 3IFPA 4QCIB 2VDPL 2XYBA 4DGIH 3CV5A 1C16A 3KL3A 1OVZA 5BW7A 5IQ7H 5DSCA 2A83A 1J0ZA 2O26U 4A63A 4PCYA 4P2CG 1RJYA 3UTTE 4R83A 3TH2T 3MCKB 2CIIB 4PH8A 5T1MA 1Z66A 4CGUB 2IDTA 4M6ML 4G7VL 1BOGA 1EFXA 5JIMA 2ZUXA 2G3ZA 2JH2A 4JMNA 5E6ID 3JXAA 3LEYL 1JP5A 1TQWA 1WWWX 2BWQA 1N7MH 5E4EC 3T8XB 3V0VB 1JDAA 1L9RA 4LCWB 1BZ7A 1E5UI 2AERT 4QTFA 5EUOA 3DLQR 5HDQH 2VDPH 2F54B 1NIDA 2BHFA 1WEJH 4UQ2B 2AV1B 2VLJA 5I1HL 1ZY9A 2RIKA 2XRAH 2VXQH 4IKKA 3MYJB 2BSDA 3BEVB 1JPGB 3D39D 1UWEH 3WD5H 3KBEA 4PVNA 3K91A 1HC1A 3V7AE 1AI1H 2OTUB 1JK8A 1PX3A 1JGLL 3OHXB 5I19H 4FGMA 3QJSB 2BRQA 5BNXD 3CX5K 2BY1A 2EECA 3JT2A 3QUMA 4OJCA 4ZUTB 2D7PA 3OLEA 1HXMB 1M42A 5D70L 1W8OA 2FVNA 5A40E 3GXIA 1A3RH 2HH0H 5I1KL 3H1ZA 1OP3H 2OL3L 2OLDA 3CMOH 2GBUA 3ET9F 5I16A 3AACA 4UZGA 1WQVT 3BIKA 3DUHA 2EKSA 3H9YA 3CN3A 4XVUC 4ZO7A 3RIKA 4JDTH 1DEEB 1GYCA 4K9EH 1UWGH 2EEDA 3IS0X 3PLYA 3HAEA 5HGHB 4L8SC 3BW9A 2KDGA 5IJBC 3V6FA 4GP5B 4MXWL 3PWPA 3B2VH 2I32A 1B6DA 4FN0A 4L2YA 1PDKB 2PF6A 3RPKA 1NCOA 4Y2LA 4H25A 3ZDZF 1NKGA 3WS3A 3SPGA 2AXGA 2DJ4A 3O4LE 5CD3B 3DVNA 2YPKB 2XN9E 2Y72A 1MW0A 2FEJA 1KGWA 1F41A 4GRWH 3SE4A 2VXUL 2W0FB 1LEKB 3EDEA 3L3KB 1M7IA 1SYVA 3L4UA 3C6LA 1OE3A 4PJXF 5FO8A 4PMFA 1J8KA 1XL6A 3E2HC 4ICXA 4WO4A 3UYRH 2QV4A 4PJ5D 3HNVL 5F70A 4NLAA 3TIDA 1PCXA 2CO6B 4F33B 3FCBA 3ULVF 1HX0A 1TLMA 3WTXA 3H4HA 2B1HH 3UJTL 4UZUA 2YD0A 4MJ5A 4AMWA 5CN3A 1I7RA 5JIDA 4OZIB 1QP1A 4I3RH 3BQUB 1WUNT 2EH7H 2C34A 4LASH 5IEKB 5DHYB 2LW3A 3GXFA 4F2FA 1TXKA 1MCNA 2H3NB 4B41A 1PNCA 3LNHA 5LBVA 2EEBA 1D5ZB 2YLHA 4IOSA 3OKDB 1Q1PA 2J57A 3G6JB 1QRNB 1ZTXL 2F58H 3L9YA 2UWEE 1LK2A 1UM4H 2AV7A 2CNZA 4N0FA 1G4MA 2HA1A 1KXTB 2V7NB 3DIVA 1TEGA 1NGWA 2ED6A 5HHPA 4WSGA 1Q0XL 1USQA 1CF1A 3M07A 2FK9A 4OLUH 3ESNA 4XN5A 3EG9B 3ROOA 2VE6B 4ZFZA 3QWRD 3ZYOA 4MDJB 4QO1A 2VWEC 1BPLB 3C8HA 1AO7D 2Z35A 1XF3A 4NM8H 3I6LD 3QCVH 3LKRA 4HIJA 3ZU8A 2VQ1B 4JO3L 1DZBA 5JUEL 5ITBL 3DHJA 4WY7H 3DIDA 9CGTA 1RU9L 3H7BA 5SWZA 1PY9A 2V2WB 3DRQA 4YSRA 5E2WH 2C3VA 4TVUA 5D7KD 5E9DA 4Y19A 5E1IA 5HHOE 1V3JA 3WKMH 1RUAH 2W9DL 4JDZB 1MFMA 3IM1A 4PGDB 1XF4B 4PS7A 2E5EA 5ABZA 2DW5A 4JHWL 1G1KA 2R59A 3RBSA 3GHPA 1OD9A 5M95B 2FBJL 5D1ZD 1OP3K 1I1CA 3U2SA 3QHFL 3HE7A 4CU8A 3F12A 3MO1B 2OMWB 1X5IA 3FU7A 3LCYA 1NBVL 3GBMH 4IOFD 2BNQD 1ND0A 5D1QC 1F02I 3VFSA 3AT0A 1SJHB 4XVTL 2R2HB 3FQRA 2KC0A 1C5DB 4HJIA 5DZOA 4HS6B 4LGSB 4NKDB 4EEEA 4X7TB 5LDUA 4MS6A 3OC8A 1EJ6A 4B9CA 2XTSA 3TGXA 2Z93B 3TBVA 1HIML 1CT8B 2P24A 4TNEA 4E9LA 4UQEA 4EOWL 3Q5YA 4W9EC 3QZLA 3IPBA 4DCQB 4YSOA 4YDZA 2AGJL 3BUTA 1U3JA 4WFFE 4D2NA 1NGPH 3U7WH 2Y5EA 5F9JA 4JZOB 1WT5C 1PDKA 2WSPA 3O0RL 1M1XA 4B9ZA 2DBLH 2NY0D 4B7IA 3RDTB 1UXWB 5L4IA 5C07B 3T0EB 3MGTA 1K8IA 4RGNE 4H88L 4E68A 2NY5H 2CJUL 3KYMB 1Q0YH 3ATFA 1OCCB 4K23L 4MB1A 1QNZL 1PNDA 1BQUA 1MJ7L 1IQWH 1DSWA 4JVPA 2ZOLA 4AW7A 4EN3C 1JUFB 1RJLA 1UD2A 5IT2H 1D9KA 1BP3B 1WIUA 4JRWA 1NCCL 4J6IA 1XGRB 1MCSA 5CD5D 1ET5A 2OSYA 2V2TA 2P43B 3O9WD 1RUML 1O9ZA 1I7TA 2B3IA 1JERA 3WUWG 4KXCA 4OSUH 1JHLL 2CBPA 4QY8B 3T8VA 1BOYA 3EBHA 4O2FB 3GPEA 4XRCA 3JWNC 4KQ4H 3O3BA 4B9PA 1EGJL 5JW4R 2C9AA 1KJMA 5I1IL 5KVFH 4Y4HC 2K6ZA 5I8OH 3D4YA 5JHDD 5A2AA 4JFEE 3NJHA 1V27A 4R4FH 2CJSA 3WNKA 3SBWC 2MQ3A 2QGEA 1JGLH 1DE4B 3GRBA 1CDHA 1OSEA 3GBEA 4YSEA 2XIIA 5FDWA 1DO6A 4XCCL 5LBSA 5DVKA 4M7LH 1JTOA 3WIIH 5FR3A 3DVNB 1DLFH 1XIWA 2W0KA 4MA8H 3SDDA 3T4YA 3K3QA 2ENPA 3LD8B 1BOGB 5J1SC 4Y89A 5AWNH 3B3IB 4YSAA 2Q76B 2XV6B 4OW6A 3VXQB 3VXRB 5AVWB 3IRCA 4BXSV 2AJXH 1KNOB 1D5IH 1AGDB 4XOAA 3SBRA 4NRXB 4ODXB 4HGWB 2CCWA 5C6PB 4HKBB 5I30L 5JIHA 5TE7H 2WTRA 5GGVY 3UROR 4FXGA 3UFIA 2JSFA 4W9KC 4XP6L 5C0BB 1TJMA 4J6RH 4E5XG 3QCTL 2W65A 3A47A 3F12B 3MO1A 3NA9L 3QARA 1G5AA 5A2CA 3S7GA 2D3JA 4KTDH 3NEEA 4E5XB 1UM4L 5G4MA 2AXHA 1DJWA 4G6MH 4NQSA 2WBWB 3HN3A 1LYQA 3TT1H 2XVGA 3BOVA 4G3YH 4X7CC 2K4AA 3D39B 1MFAL 4G7SB 3U6RB 5EU3A 3T77A 1HINL 4CVWA 4IQHA 4M9OA 32C2A 3VFRA 2NY3B 5FCUL 3SDDC 3EBIA 2JB5H 1AMXA 1B4LA 3MCLH 4F9LA 1SXAA 3AWFA 1E4XI 2J4WL 3BW9B 2EDEA 1P1ZA 3STZA 4UNUA 4HUKB 3ZHNA 2B9BA 2X4RB 1JNHA 2WKGA 4YVNA 3COOA 3TA3D 2J1ZA 2EYRB 3G6DH 4N2EA 2WXLA 3VYPA 3HG1D 3VVWA 1DL7H 3DV4B 1E9OA 1TO5A 5F8RC 2APWA 2BCKB 4LLWA 2P5PA 2ZSVA 3D30A 3AUVA 2JQZA 3EF7A 4KI5F 2B16A 4UU9A 1TJIL 1W0WB 2G2RA 5D7JC 1SXCA 2XPYA 4ISVA 3QFDB 5CJXC 1JUFA 4PRHD 4TLTA 4M5ZL 3STLA 3NIDF 4PJHF 1QPXA 2VXTL 5MEOA 1HSAB 2XTJE 5DJ2A 1TZIB 3C9NB 1ANUA 2WZ5A 4P2OC 4E41D 2WUCH 5I6XC 4Y9BA 1A21A 3OPZH 4UQ9A 4EAEA 1F4XH 3FRUB 3ZXAC 1PL3A 3O3BB 1I8LA 2QFPA 1HH9A 3AU0A 4HJGA 2ITCA 3OKNA 1I53A 4OLXL 3HHMA 2D3LA 1DEDA 3RWDB 3S5YA 4MQ7A 5IWLC 1VKXA 4AQ8A 4ZAKA 1L6ZA 4JFHD 4I0PD 5HGAA 3GJEA 1ZV9A 5DFVD 3QC5X 4LCIH 1RHFA 5FHBH 2D7TH 4N2MA 3U30B 4AM0B 1SJXA 3HRZB 1QACA 4YNYB 3VNYA 3FQXB 1YAIA 2XG4A 3OHMB 3RIAF 3UZVA 4JFFB 4P3WA 2VXQL 5HI5D 4RMWA 5DQDH 3QJFB 1G9EA 4RA3A 3L9EA 3KVPA 4KKPA 4FFTA 4XODA 4IDLA 2WVTA 4BGLA 5ICUA 2ZXGA 4FQ1H 1NCDH 4HUUB 2KPNA 4X8XA 4LRNH 5AW1B 3CVCA 4R2GD 4YJZL 4UF7C 1EWHA 2VLRD 2QVMA 4XCEA 5KBMA 3DX1A 4CVXA 4F37F 2QMKA 4JO4H 4P46C 4K3JH 1EFQA 1VEMA 2ZPKH 3OKEB 4JREB 1UVQB 4K8RH 2AMUA 1JFHA 4HBQA 4HHAB 3P3UA 3OAZK 3D69A 3GRWA 1SOQA 1RXLA 1DANT 1TCMA 4JM2A 5TK2A 4U1MA 4GEIA 5HDRA 4OCXL 3QBTB 2VMEA 4LDLB 3ARVA 3D25A 4TTGA 4XO5A 3VI3E 3C5SA 4RAUB 4UT9H 5AVXB 1HU8A 3GI9L 2YGNA 3WBDA 4YAQB 4A6YB 5F7FA 1RZJH 4RLDA 4HQQL 4B3VA 3VM5A 4IKJA 1XCXA 2PXYC 5DD5L 4YVUA 4E2OA 2VL5B 2A9NL 2XZQL 3FUFA 4HKXA 1NFDE 3BX7C 4EIUA 1JPSL 4J8QA 4KQ4L 3HFMH 2CIKA 4H0GA 4ORGB 3DO4A 4NZRL 4PJIE 4UIMB 2ZYRA 4XP4L 4XC3H 4JM0A 3FAXA 3L1FA 4S0SD 4F8OA 3NIFB 4HUCA 4KTGA 4EKXA 3T2NL 3MGTB 3IXTA 1W8EA 3VXSA 2NNRA 4NQDA 5TFSH 3WFBL 1Q9LA 2WK2A 3ZHLA 1BD2A 2J25A 2HTLD 1ZVYA 4XO9A 3TZVD 3JTSA 2VRAA 1FN4A 2YR3A 2Y3NA 2AKRB 4K23H 4PP1D 1RVFH 4TUJB 4PGZA 2JLPA 3LKPA 1RJLB 4LCCA 3VSUA 4PJEE 3ZL4L 3U9PH 4JGMA 4ZX4A 2UZXA 2C3WA 4ONOA 4ZMZA 4D0CA 4JO8A 3IU3B 4W68A 1LMIA 5E8NB 1OGPA 3G08A 3MNVB 4MNGA 1A4JA 4HS6A 5ANHA 4WWNA 4E9VA 4HIPA 2AGJH 5AYTA 1TSHA 1RPUA 5JDSA 1YEEL 5ABAA 2XBTA 4MJ4A 5EBWB 3IT8D 5ES4B 3QFJE 2AJVH 4HHWA 1KLFA 4YSCA 2QVTA 1S78D 4NJ9L 4WWID 2EXTA 3MOQA 4HMEA 2V2XB 3FOMB 3W9EB 1DQIA 2ZYIA 4G9DA 3SN6N 4FQXA 3MUY1 5CZXC 4ZUVB 3VYOA 1I3RB 1RI8A 1F90H 1NBYB 3MXVH 4EI5C 1L3WA 1PG7W 2L7QA 1H0DA 5D2LA 1WLHA 2D03L 1VZGA 1GKEA 1AY1L 1FFNA 3P2DA 1DCLA 1UKTA 4DP1X 4ZQKB 3FT4B 5EF1A 1JHTA 3AROA 3HUJF 3DX2A 5B1JA 3TZVB 1VADA 3PP4H 5SWQA 1Y1DA 1FL6B 3NOIA 1B0WA 3C5XA 5IROD 5T1KB 4M02A 1EDQA 5CP7A 2Y22A 4YXKH 2ICWB 5ACMA 4XMXA 3DX9B 4HSCX 3F01A 4FJYA 4R7NA 5F2FA 2NY7L 4OIAA 3L5JA 1Y0LB 1PS3A 3JZYA 1KJMB 1RZ8B 4X83A 4F5CE 1A8JH 5DD3L 3T0VA 3TBSA 3W9DA 4H8PA 2FQEA 5DD1H 3QCVL 4KKZA 4EF3A 5MEPB 1NIAA 3F8UB 3E0GA 5CSGA 1SXBA 3K0YA 4JPKL 3QT2A 4W9FC 3WDIA 3U4BH 3GEWB 4FHKA 4QHNB 5DJZB 5HHQA 4FQXC 3P30L 5C3IA 2YAPA 4HLZG 5KS9E 4NWTL 5EN3A 5IB3A 1KCRL 1X7QB 4C56B 1IM9B 1HNFA 2BSRA 2Q76A 4MD5A 1BZQK 1NMAL 2YGPA 3N40P 4DEPB 3JV0A 2EDHA 4OZFH 1AHMA 1USZA 1Q0EA 1D7BA 3OKDA 3Q43A 2H32A 4XNAA 1F4YH 4UCFA 4Z6AT 2C9SA 4ZW6A 1HAUA 1XSJA 2VN4A 5CXPA 5E5MB 4NBYB 5IEKA 2OJZL 3L5WB 1TTBA 3RX9A 2Y7QA 2OYPA 1J8SA 2R9HC 1FYTE 5IVNA 4JFYB 3EG9A 3SKNA 2GIMA 1AXIB 1QAWA 4Y4HB 5SX5K 4D8PA 3MNZB 3KZ8A 4W6XB 3UTPD 3H42L 1QR4A 1AZVA 3HN5A 5C09E 5EORH 4OFQA 1U0QA 1TUPA 1G7MB 1I1AB 1E5CA 4C83A 2Q7YB 3WY1A 1LGVA 1SLUA 1UURA 3QAQA 3BWUC 1HSAA 5MHSE 1EXGA 4NQSB 1HN1A 4LEOB 1DBJL 2R1XB 1ZWIB 1DQKA 4GW5A 1MCFA 1JYNA 2BCMA 2NUTA 1JWUA 3D4CA 4H2CA 3EKCA 4YLQT 4HC1L 2Y1AA 5FDYA 1SY6A 4CMHC 1ZANH 2FUTA 3IGFA 3W39B 5C7XH 5I8CB 1IGFL 3D7PA 3LHPH 3L45A 4OF8A 3EH5B 2KL6A 2WVSA 3NH7H 5ILTL 2WQ8A 4XVSL 4XNYL 2VL4A 4GQQA 4JDZA 2X44D 3ASOB 4Q8BA 5F7DB 5FYKU 2V2XA 3FOMA 1SDDA 3MOBH 3T5WA 3ZDXF 4KVPA 2CLVA 3OKLA 1DQJA 5DO8A 4DZ8B 4ZTOL 3H3KA 3BDXA 3I9GL 2BZ7A 1ERNA 3EYUL 3GRWL 5TPWH 2HG0A 5CCHE 3WDJA 4P2RA 2QKIC 3OJ2C 1GW6A 4MDIA 4JG5A 3RBGA 3SGKA 1T21B 4Q0XL 4URKA 1FRGH 1OARL 2I26N 3KEDA 4GBXD 4X6DF 3ARUA 4N24A 5DMKA 4GQ9H 1YDPA 4LLMA 5EZJA 3JWDL 5E6YA 1JZFA 4O4YL 3I6LE 5C0BE 2D4DA 4DEPC 4L5FH 4MAZA 4Y5XC 3KXFD 1X5FA 4Q6IC 4Y4FB 4PB0H 3B1TA 5D8JL 7FABH 2GFBA 2PCFA 3GSWA 5I5IA 4HF5H 3LIZA 4KHTL 5T1KA 2DQJL 1QKZL 4WV1A 3IDNA 4PVBA 1SQMA 3QA3A 2ATKA 3SKJH 1IGYA 1YNTB 4HOWA 5KYXB 4U6YB 3LRLA 3GYRA 3CHXA 1LEGB 3NSYA 3KDMB 3QZWA 5DEZA 4IGBC 5TQ0H 1K8DB 5IHBA 3EYSH 3K2KA 1X6LA 1JDCA 3U4EA 4K2UH 4PCSA 1P7QB 4YWGH 4OI8A 3UAJA 5JW3L 4TSCH 1UGKA 2MNJB 3MV01 3NZHL 5DZLA 4G8EB 3INUH 1PEZA 4PGEA 5BZDB 4U7SA 5EEZA 3FQ2A 2IGFH 3UDWC 3IFNL 3L54A 3H7LA 1RZFL 1I3RA 2JWYA 2VN3A 1IKFL 3DXAA 2YD3A 3VQMA 3FSVA 1GS8A 2C1OA 3QO0B 5E6IA 4LMQE 5PCYA 5C9KA 1S9XB 1VEOA 3NCCB 3RKPA 3EIFA 3SDXB 4G1EB 3MRQB 4K8RL 1H8SA 1JV5B 5C7ZA 2A4CA 4JS7A 2G9KA 4ZRGA 1W72L 4TF4A 4KVNL 4DKAA 2JJWA 4PJ7E 4JRXB 1UD8A 1RMFL 4CA4A 1F3JA 3V95A 4L5FE 4Y4KA 3SDAA 4MKTA 4XT1C 1S9VB 3F65A 4N0UA 4OD3L 5C0BD 5CGYC 2DQGH 4AUUA 3BPLC 1VZIA 1KG0B 3BFOA 5IVXE 2QLVB 2QADB 1BZ9B 4OCSH 3C8KA 1AXTL 1D2OA 1K9TA 4Z18A 4FFYH 1UM6H 2DIEA 3HAEG 3KWWA 4NZUL 5G55A 4NQED 4YX2H 4DAGL 3PDOA 3KVQA 5AKTA 5GS0C 3BQUC 4U6VL 1JV2B 4GI6A 4JDEA 5F89A 3EF4A 4J2XA 1JGIA 1MW2A 2D7TL 2Z31C 3VE0A 4KKCD 2NNXA 4CC4A 2HT3C 4OGQC 3IETB 4OZFA 3NCYS 5T3XE 4PGBA 5DJ6A 5JIIA 1MFCH 1JVLA 2IVFC 1WCBB 5I0WA 1A5FL 3LS5H 4G6FD 1DVFC 5IM7A 2BW5A 3IJHB 2H2SD 3GSUB 4HUNB 4FXKA 1D5XB 1KFAH 2R1YB 3I75B 4OLZL 1W72B 2BH0A 2ZSWB 3GMLA 1LK3H 5DA0B 3O81A 5GSRA 5D96C 3E3QE 1DQJB 1EAPB 1MVUB 2DZEA 3WEXA 1R24B 3WIHH 4ALAC 2OX5A 3C6LD 4D9QE 5CFHA 3CFEB 2QQKL 4I5BB 4ONFL 3JZ7A 1MDAA 1UGNA 4NENA 4AV5A 3QI9C 4YDKH 2AMGA 2HP4A 2M83A 1BD2B 4OZGF 3UAFA 4UQCA 1GVIA 1J0JA 5JHDB 3CLEH 3CHOA 3T3PE 5JA8B 1KEMH 4PG2A 5KSVB 4U1NA 1TNMA 1CR9H 5F88B 1ZIAA 5T5NG 5IMLB 2E27L 3CVHL 4HG4J 4Z7UF 3GMNB 2XZCL 1DBML 2ZX8A 4ZD3H 3J07A 1CZ8H 2MKWA 3KLKA 1RZ7H 2A6JB 3X1FA 4BFGA 3QA3B 4LHQB 4WUUA 3U36A 3WLWD 5I5MA 1E40A 4DVBA 2XWBB 3EFDL 5DC2A 3TPUA 3UCRA 3FT1A 5B38A 5E08H 2HX9A 3WHE1 3VI3B 3RAJH 3LRHA 3RFZC 3HZVA 5C0IA 4YDVB 5GS1B 1UYWL 2BMKB 3VRJB 4IHOB 2WBXA 5F7HA 2WXGA 3N43F 1O7DE 3CCHB 3SDCC 3TT3L 4XZUB 5F72S 1CICC 4GOSA 3HI5H 3VFGL 1DBBL 3VFVA 4A67A 1UB5B 4PBDA 3JBG7 3MYZA 3JT0A 3OR7B 1FNSL 2Q3AA 1AJ7H 4MQSB 5CM1A 1F11A 4YXLL 3BXNA 4YC2B 5GZOD 1K4CB 1JV5A 2WLMA 3BWAA 4P05A 5B7FA 5JIKA 4M62L 1IARB 1FFNB 1BJ1H 1BZDA 1OW0C 4GS7C 2A6DA 3N55A 4OGYH 4KO9A 5AYUL 1TJGL 1SPDA 3H2WA 3VH8B 1ZCRA 5CUSL 4EUPA 3L7FB 3N44F 4EKJA 3C60B 4YHIA 3GIVB 4Z3EA 2F19H 4CC1A 1YEHL 3UTQA 3HC2A 3TCXA 1PSKH 3RUGF 2C5DC 2D0GA 4JR9L 2NR6D 4XWGL 4ZTPL 2DICA 3PXHA 4AGNA 5DMIL 5KYYA 5EWIL 3GBLA 1YN6A 3UP1A 1ZHNB 4DW2H 3BKJL 4NGHH 1T5WB 2YUXA 3KWWB 4PRHE 3OTTA 1F13A 1GH7A 2DJMA 2VLME 4PJBF 4ZUUA 3MV8A 2E9BA 1DZ0A 3UJJL 3GBNH 3MTXA 3WJLC 5LXGL 3QWQB 4Q6YA 5I23A 2C7FA 1AZZC 1IGCL 5MEPA 4MMXC 4XCCH 4KBPA 1RD6A 4ZUVA 2F53D 2CDEA 3FQTA 3EJRA 1FVDA 2BJML 4EUPG 2P45B 4QYOB 4Y5XA 1MLCA 4NS0A 2HKAA 5C0NC 3QUYD 4BBWA 1T22A 3DHUA 3GM0A 5D7SH 3JV6B 4IRZL 2DKMA 2P8MB 1IQDB 7CGTA 3QPKA 1ID5I 2ZUSA 1P2CA 4HWUA 4ZMXA 1ZKAA 3O3EB 2DQUL 5DTFB 4WDIA 4UM9B 4YDJB 1KT2A 4G43B 2F1BA 2X70B 5DUPL 4XNXH 5L6YL 4FAAB 3PGFL 1T2JA 5EFIA 1G9NL 4XMWA 1AO7B 4BA8A 1EAPA 1Z9PA 4MAUL 3R06B 4U7KA 3MV7E 4L8BA 5JXAL 3WO4B 3RWGB 3CLWA 1MY7A 2DWEB 2WAHA 4XTRD 2Y06L 3SE8L 3FNKA 4IRZH 2BXYA 3TFKD 2WWOA 1T1WA 4XP5L 1DBJH 2NYKA 4HV8A 4X98B 4YLCA 2I60L 4ZSOB 3MRIB 4GO9A 4JJ5A 3UBXB 3ULUL 1IKNC 3S3SA 5HYJA 2BIHA 2X0WA 1CICD 4I2XA 1KFGA 2PO6C 3QJUB 3TZVC 1A6VH 1UQSA 4TQEH 5J1AB 1U8MA 3WJJC 4UIKL 4K3DH 3L4CA 4G6AD 4OVVA 2HVKB 1I7UB 4W9DC 3TNMA 4RISL 4YHZH 5CP3A 2K78A 4Q9QL 2E56A 3ZRFC 2OXHB 1FLRL 5EF3A 2HLAB 3B37A 5EWIH 1NCAH 4YGVB 2H9GA 3OV6A 3W2DL 4GKNB 5EO1A 5FYLH 2BDNH 5FW8A 1Y6KR 2G4EA 5C97A 3APCA 3BUQA 1E8XA 1TZGH 1A64A 4PRAB 4XVTH 1MVUA 1TJGH 1MVFA 1C7SA 1PSKL 3KW8A 5KYWB 2CGZA 4N2HA 3GSNH 5FO7B 3QQ4B 2W1NA 3RI5F 3S9DB 1SXZA 3PQYA 2NNAB 3HUJA 1XF5B 1FZKB 3QDAA 1MG2C 4GS7B 4LVOC 4G8IB 1ZJBA 4YLBA 1F5WA 1J1PL 2Q7NA 3Q2LA 1Q72H 4ODSL 5FYLD 4GI9A 4KK9D 1NCBL 2CO3A 5GS1C 1R4XA 3VI4F 3BHBA 2DBJA 1ND0B 1AS7A 4NNPL 1XTLA 4EI5D 3DPDA 1ZWIA 3LEVL 2BRRL 2J8UA 3IFOA 4U49A 3TC9A 1KYDA 5I75B 3PUCA 5EEXA 2EC9U 2BO0A 1J1OL 2BOLA 5K9QG 4JN1L 4MB4A 1VCBC 2DI9A 5ID0B 5C08E 1GYUA 1M71B 3N1PC 3IDNB 4KKQA 4MGXA 4LMQI 1WZLA 2V7HA 1KGCD 5DFTA 5FOBA 1X5XA 1ET7A 1KN4L 2OCFD 2PWEA 2YBGA 3S3DB 4OZGE 3HAEH 1FCGA 3QCUH 2R4SL 3PWVB 1ZLDA 2ZXDA 4M48L 3IJ7A 1Z32X 2B4CC 5CMAA 2PW1B 1I1YA 5HYSG 4XB7A 4W9IC 3QJQB 1TQSA 1MHEB 1NJ9B 2AZAA 2CUIA 3G5VB 5F9DC 4EMZA 2KZKA 4HIHA 3APFA 1NC2B 4MDIB 5EBGA 1KTDA 1VADB 4GY4A 1KB9J 1M7IB 2EIDA 4OFKA 1QLEH 3KPMB 5F6IC 1X9RA 4J4PD 3O9WC 4R0LB 5FA3A 1D9KB 4MJ2A 1VB9A 3ARGA 3SQRA 3P9LA 1IC7L 2HJFA 4JFPB 4JVUA 2Q86B 1BQSA 2HG5B 3HI1B 2QQKH 5CR1A 4NO0D 4LP4A 3UTQB 1G6RA 3S2CA 4BZ2A 3BUYA 3QIBB 3S37H 4G42B 3ZRSA 3PCYA 1A4CA 2R0LL 5ICZB 4QRBA 1CBJA 4G1MB 2R9HD 3VXNB 2EADA 5C0AD 2Y7NA 2XPGA 4QOKB 4X0NA 2OSWA 5I2IA 1JYVA 4KK6C 4WNQB 1K8DA 3UTTA 3VG0H 1VHPA 1PMYA 2JCCE 3RL2A 4QNPF 1DVXA 1K85A 4Z7OE 1OZTG 1DLHB 1UWFA 1IC7H 4A7VA 1JWMB 2VB5A 3OKKA 2IAMB 2A0LD 4X9FA 3G6JF 3AVEA 4M7JH 4Y7OC 4MD4B 3T3ME 3PXJA 4QT5A 4QXVA 3QK0A 4HWBA 5EUOE 2CMRL 4DAGH 1G9ML 3TNMB 4GSUA 1YYMH 3CBRA 5I76A 1ETZB 3JWDC 3HVNA 3LX9A 3TPUB 3ABKB 1KTLA 4P5MA 2WKLA 1BVNP 3EYOB 5E9DB 4O2EA 3CFKB 3M8OH 3ATDA 5K33A 3EGDA 3O3DA 3PP3K 3QCUL 4GG6E 3TL5A 4NRXA 4ODXA 4F7EB 4YH6A 4PJ7A 4K5LA 1UD4A 5D93B 1D5MB 2ERJB 4NFCA 3FFDA 2MOQA 2LT9A 1E2WA 3TBTB 5E8DL 3U2SB 1HHKA 4L1LA 4XX1G 3Q13A 4N2BA 4R26L 3TBWA 4P49A 4N8CH 1Z3RA 1DBKH 3QISA 1O9VA 5HD8C 2EIBA 2OR9H 1AQDA 3KXFB 3O6FA 3K72A 3WI9A 3QUMH 1XO8A 5KJ7E 2BVEA 5GRYA 1L5GB 2IGFL 4AYID 1Q9KB 4OF7A 5JZ7D 2YMTA 1QBAA 5TE4H 4J3BA 3VWKB 1EZVY 3EYFA 1SDYA 5EU5A 3LNGA 4Z8FH 3UTSA 3VWJB 3IWUA 5TDNA 4FNUA 4ORZC 3MR9B 3QYCA 2R0ZL 1KELH 1A7QH 4Z23A 4LP8A 1I3GL 4L18A 1G1CA 1IEBA 1BCIA 3HW7A 2WWKT 2WO4A 1GR7A 4MNQD 5LN8A 2E86A 3LIUA 1JXGA 2YXFA 3MAWA 5EIIB 5D7JD 5BCAA 5JPNB 1NBZB 4PS3A 4Y16A 5CAYB 4DGIL 1GHFL 2Y1YA 2LU4A 4NN7B 2FGWH 2VLKE 1NCGA 3FFCE 4NQXB 5E4OA 4FYRA 4Y1TA 3TFBA 5TDPA 1UCBL 3QS3A 2ZSVB 5AZEH 3GLDA 4XO4A 2AITA 2BNRA 3L1GA 1JGVH 5B4MD 4JW3A 3U6RA 1CGXA 1QZNA 5EBMA 4P5TC 5A7BA 2E7LA 1FRGL 1BQLL 1OARH 2XJLA 3K46A 5F88A 4UB0H 5IB4A 4A7TA 4DO4A 5IHHA 1OD7A 3IBOA 5DVPA 4DGWC 1H6EA 3ARFB 4M3KB 4Y1AA 2HVJB 3BEVA 4KX7A 3ZT5A 3V6OE 1YLBB 4KRMB 4RIRB 6PCYA 5DS1A 1OAYH 3I6GB 2F54A 3WTUA 1J9SA 2CDGB 2QKSA 4FKEA 4KRPB 4I0PC 4MAUH 1BECA 2E59A 3RJOA 1XGQA 1KC5H 3UTZA 4MBRA 3WXVH 5EZIH 1J5OH 2IH9A 3GTTA 4XVSH 3LOWA 4Y4FD 3BP5A 1A2YB 2N1KA 1MCLA 3MFFA 4XNXL 2G2PA 1GGBH 1WWBX 4GUOA 2VW4A 4H8WC 2NZ9D 3I9IA 1JK8B 4K55A 1QATA 1LILA 4KQ3L 1JTTA 1RK1A 3E6HA 2BNUB 3VXMA 4F58L 4IBLT 3K1DA 3G5VA 4QJ5B 1DVSA 1TKWA 2N56A 3QUZC 3LSOA 3W38A 3IMTA 2AJUL 2HKHH 4FHBD 5I8EB 4WEBH 3D51A 4XPGH 1C1EH 5D7IA 5JHLH 5AZ2L 3VXUE 2WZPA 3F58L 2XNAB 1F86A 4QJ4B 5C0FB 1MRFH 1RAMA 3DX6B 4Q97A 4C55A 1V7ML 2FH6A 3TX4A 3M45A 4ETYA 2A9BA 2WQRA 3BVNB 4IMKA 1IAIH 3K71B 2PLTA 2HUHA 5CILH 5EN2A 3EOBB 3T3PF 5BUPA 4UQAA 3MZTA 1T80A 4I85A 2B4CL 3KNBA 1KN4H 3MLTB 4NB7A 2VDNL 3R8QA 3VA6A 3QQ4A 4L8BB 3U2IA 4LLVA 3RGVD 4MWFB 4Z77A 4KFZC 5I18H 1BWMA 3TJEH 3S97C 1T1XA 3EZJB 4HXBH 2IDCA 2VJ8A 4IU2A 4UUJA 4KUZH 4NPYA 4NO3A 3QXAA 5HVWA 4K7PX 4J12A 1OO2A 1YMHB 3KJ6L 2FD6L 2WJ7A 4P5KB 2ITEA 1IILE 3NJKA 4WEEA 3QHZH 1OSZB 1SLWA 1R6VA 1HHGA 4GAYA 5I1EH 2EXWD 5I1EL 1SEQL 4KU1A 1O7DC 2VDOB 2V5MA 4BUQA 3HG2A 2AV7B 1P0SE 3AM8C 3WDHA 4HXBL 4EDWH 2PWFA 3NABL 1ZIBA 3IAGC 3IJSA 4QNPE 4FMVA 3GHEH 3PY9A 3VXUD 4Z76B 3T1WA 2DV6A 5TQ2L 1NLBH 4NPKA 1GIGL 1Q9OB 2Y5TA 1OP4A 3VTTA 2Z35B 3LN5A 2OYLA 2VDNH 1EUUA 4R5VA 4FG2A 4NQCA 3R06A 4DH2A 5BOJA 4IRSC 3OG6B 3VWKC 1A4KA 1HYSD 1PFOA 2OSLB 1B0GA 4U4BA 1GCYA 4TLSA 1NM9A 4P3CH 4MA8L 3QO1A 3ZW3A 1KOAA 5IJKA 1IGML 1HHKB 3NJJA 1L6XA 2AAAA 2ICCA 4Y2NA 1BXAA 1O9WA 1T4KA 3H4FA 1A7BA 3GIZL 2NZ9C 2UZXB 2A73B 1H3XA 1ZS8B 2VQ4A 4PIBA 1I9EA 1Z9MA 4N8VA 5AW9B 1PU0A 5BZWB 5INDB 3IAQA 3IAPA 4NN7C 1NFIB 1FL5A 3BZEA 1UCTA 4IS6B 4GFXA 4WO4D 4DP7X 5DGQA 5F21B 2WZAA 1WF5A 1KGUA 2CKBL 3I6SA 3X14B 2ITDB 1AP2B 2X9WA 4JPVH 4UILH 4DN4L 5BMFL 4O51B 3FQRB 4OCLC 2B5IC 1Z3GH 1CK0L 3L08A 5DURB 4OLZH 1KGCE 5L6YH 1NGYB 4FADA 2Z92B 4LP5A 4UAOC 4B5EA 1W9XA 3WNNA 1YAZA 1IC1A 5LBGA 4KVCH 1YQVH 2FHCA 3HRZA 1CYXA 3P73A 2NNCA 1LDPL 3MRLA 3HNSL 4Q7DA 4CN6A 2IPTH 2YA2A 4P46B 3PP3H 2ZKHH 2XIBA 4KRPC 2R69A 2PTTB 2Z7WA 2CJUH 4X0KA 2CR6A 3TNNA 1HDMA 3A21A 4Z95H 4JFDA 3KH3A 2LTQC 2GK0A 2C9QA 3CQFA 2WVVA 4EUPB 4GSDL 1YN7B 4AKPA 4X2UA 3MA7A 1JF1A 3MHZA 4QRTA 2M26A 3A6BH 1F4WL 2A4EA 4AH2B 2G0KA 3QUYC 3RWJA 5CD3A 2HG5A 3I6KB 4ES8A 1MIMH 4OJEH 3DRTA 4FFYL 3VWJD 1P5UB 1QWHA 1SM3H 1MOEA 2EC8A 3MBWB 5DJYB 3BP7A 1CVRA 3CK0H 4JR9H 1QSED 2XZZA 4KKAC 1BYOA 1E8WA 3B4NA 5T3ZD 4LLVB 3H2QA 1DQVA 1H3PL 1LO3H 3UH8A 3BP5B 1J9CT 3L3JA 4Q14A 4Z0XA 2IQ9L 5C0AE 2DLIA 2YPVL 1MWOA 3KXFA 4H8QA 5AYUH 3QJOA 4MZRA 2QTVA 4PJXA 1EH9A 1U8JB 4GUPB 2OP4L 2CDEB 3AB0C 5HSFA 4GINA 4XVJH 1WP6A 2MCPH 4XCFH 2AHIA 5DK2A 1JGUH 1LE5B 1PZ5B 4UT9A 1D5ZA 2G3XA 1F3DH 1QEWA 1ACYL 3T2OA 1E6OL 3FUNA 2YPLE 3HC0B 4XXDA 2ICWI 2D0HA 2BNQA 3BKYH 1KPUB 3L48A 5D1XA 5LXVA 1WEJL 4K94C 3QDMD 4PHXA 4RRPA 4L4VD 3RB7A 1ZV5A 1S9YB 4OV5B 2HRPH 2XYCA 3EYVB 5DR5H 1X7SA 4M9PA 3WN5A 4KOBA 1H8LA 1NGXB 2DQIH 1I8KB 2P80A 2WJ5A 1P53A 3L9RB 1GW0A 5FW6A 3T6VA 3AT9A 2W91A 1E43A 3QR2A 3VXQA 2Z7UA 3MQIA 4JN2B 4X6EA 2MPVA 3OKOB 1KB9K 3QUXC 4OFYA 1N6VA 1QMUA 2E27H 4XAKE 2VWEE 4JG9A 3SDAD 1JWMA 1MJJB 3MRDB 4IJ3B 1T4KB 4BK5A 3K72B 4JX0A 4XMPH 1FO0L 4MNHB 3V9EA 1E4HA 4YSSA 3KPPB 3VGGA 3KJ4B 3HC4H 2W8CA 3BPNB 3L4WA 2YLKA 2NY6C 3SYCA 2YGQA 4N8VB 5BZWA 3JUYA 4AQ1A 5HJ3B 5MEQB 1IIIA 2XA8H 5LQBL 2F1AA 2V3DA 5JXED 5EC2B 1YEJH 2QVIA 3GRWH 1ASOA 3PL6D 4N5EC 4XPFH 3NCJL 2Y7OA 4LAQL 3ZTDC 4X6FB 4E5XA 3X1EA 3GJFH 4I3RL 2VDML 3FONA 5E03A 2NZ1A 4I18A 1XT5A 4L29A 4Z76A 1TQVA 1CFTA 2W65B 1I1FA 1Z9OA 3DV6A 2PYEE 4N9GA 3ZRCC 1G4RA 1F4XL 1ZANL 2X4PB 3PWJA 3UYRL 1I8IA 4LIQH 2ENYA 3QEQE 3BHBB 4XN4A 3QWOB 4OZHE 2ID5A 2VSDA 4G9FE 5MP6L 1CXIA 3EO0B 3GMRB 1WFIA 4DKFL 5DUBB 5EMYA 4JKMA 1UEYA 1FZJB 4MA7H 4L23A 5GGRA 1P4IH 3CG8A 1PJWA 4S2SA 5IB1A 4C56E 4YX2L 2CK2A 2IBGA 5J4MA 4JKPH 1G9MC 5GGTH 1CGTA 3GTVA 1Q90A 5GXBB 4N2IA 3FF8A 3LNFA 1M71A 5EA0H 3BRFA 3EJZC 2EO7A 1NJ9A 3DHPA 1FNEB 2R27A 4GKSA 2BP3A 3W11C 5C86A 3CSPA 1TQCC 1N59A 2JIXB 2OL3H 3QPXH 5E8EB 4IMKC 1XR8A 3QHTC 4APQC 1AR2A 1WGOA 3NJNA 3D4ZA 3LEXA 1MCRA 3QWRA 3S5LA 4G59C 2ADYA 3QFDA 2X6CA 1D7FA 1KENH 5I17A 3CSYA 4WGVB 1KJVA 2WWNA 3ZTCC 3RIFF 1U3ZA 2J44A 3CFJA 5DK2B 3LSOB 5DUMH 3D0VA 3W82A 3MRLB 3AAZA 2Q5BA 5E9DD 4A2DA 5MERA 2IQAA 4RETB 4XXWA 4MD0A 4OLYL 1WK0A 5E4IA 5T3XH 4G9FD 4JKLA 1BVOA 4BK4A 4GAJL 4PJ6A 1J1PH 5TGBA 1GOGA 5I75C 5I15L 4NKQB 3WHXB 3RTQA 1YEKH 4TSAH 5FKPA 4ODUB 3QZBA 4ZZFA 4KROC 1QEXA 1J11A 4P99A 5GJTH 3LMJL 4XB8A 3S34H 3ILPA 2CGRL 1HKLH 4WCYH 3S35H 3I6GA 5DZPA 4PQXA 1OCWH 4QAWA 4TRPL 2CUAA 4U1HB 2AJ3B 1JZHA 5KSAB 1XEDA 1U41A 4QGYA 4WNQA 3HB3C 3V6OA 1WISA 3QUHA 2ZCLL 2BIIA 4BD4A 2XKUA 2DQTL 2E76C 2GPZA 1COBA 2IG2H 3EZ8A 1XDTT 4IW4C 1N18A 2WXOA 3QJFA 4IEFB 3VQ2C 1ZT4B 2CCLA 1T04B 2X4QB 3OJDB 2IADA 1ZS2A 5HHOD 4N3UA 3QFJA 1ED3B 2VDRH 1X9LA 3GI8L 4NUJB 4CMMA 4PFEA 1QRNE 4E42B 4A2LA 2ZYSA 2JJTA 1IC4H 4WU7B 3WIIL 1L3NA 4JNXA 3MUJA 1JWUB 4KRNA 1X7TA 3QZWG 3H9SE 1YY8A 2XNAA 1MFUA 2X4UB 5KYUA 1BXUA 4R4FL 1YEGL 2VIRA 1AC6A 4JANA 3W39A 2BC4B 5I8CA 3OG4B 1GGYA 1WWCA 2ZOUA 3FXIC 4FJZA 3MN8A 4TTDC 5SX4I 1TQCB 4JPIA 1O7SA 5GZND 3CVBA 2MEJB 3L3HA 4HCRA 4LCCC 5DFAA 3IDYC 3CK0L 3RTQC 1Z5LA 3C5SB 3QI9D 4RAUA 2F5BH 1OL0A 2YMXL 3P0YL 4R90H 3BH8B 4HH9B 5D9SA 3O6MH 3ZOAA 5C6WH 4GO6B 5IT2L 2A9AA 4OCYH 3TWCH 4P23B 3PFUA 1GGUA 2WTPA 4RGMC 3QXAB 3O9WA 3ME0A 3MRDA 4H88H 2ESVD 1QNZH 3VXPB 2XKNA 1J48A 1E3ZA 4ZMNA 4PGCB 1Q9KA 1Q0YL 4QRTB 3IXTB 4PS4H 2NDFA 4RH4A 2QKIA 5GJSL 2DH3A 1OB1A 4WHCA 2XY1A 3BO8B 2G2RB 4QHPA 2E6QA 2NTFB 2YD4A 1NGZB 2ZYHA 5F7WC 1ROWA 1XXDC 3QDHA 4J4PC 4AYGA 3D3VB 4JJOA 4X9GA 3O6ML 1QVOB 2OZNA 4XP4H 2X3BA 3CU7A 4S1DC 2XTJC 2YMXH 1CICA 5DMYA 3LH9A 1HWGB 5D7IF 1S7SA 5B7EA 2XZQH 2A9NH 1YHPA 3KPNA 1PZCA 3QJHB 3WMPA 2EDRA 5T1LB 5TK4A 3M46A 1LE9B 1ZGLA 3BVTA 1G7LB 3QB7C 2IV9A 2P5EA 3K7UA 1MCIA 1TTUA 2APBA 3O45B 1MFDH 2OXGA 3MXWL 3ZX1A 1VGEH 3UZQB 1KYUA 3G08B 4MNGB 1ADQA 4TNVF 4V1DA 1VKXB 2MRYA 2V9QA 3ZQXA 2IPKB 5B1KA 4U2YA 2Q2LA 4OKDA 4XAWH 5INDA 2X4SB 4BFJA 3FU9A 1MWAB 3V52L 3Q05A 2I5YH 3H6AA 1RUAL 2I27N 1DSYA 5E1GA 5BV7H 5HVHC 1EHLH 1CURA 5KYYB 3BP7B 1T5XB 1NFDA 1CFSA 3E8VA 3ESUF 4FA6A 1NIBA 2FIKB 1KTRL 3AZUA 3RGVC 3U0PA 4D9RE 1LDSA 4PJIA 5F3HA 2QZQA 4RMBA 1KB5B 1RUKH 1BGXH 1TVHB 5CU5A 4LSTL 1XBRA 4WWKD 3MJ6A 2QR0A 3B7RL 3LQMA 2JKWA 1S8DA 4P06A 3GJFK 5CCKL 5DWPA 3SE9H 4CMMB 4GW4B 2VDQH 1M05A 5JOFB 2V0AA 2XN0A 2OYMA 1BQHB 3ARSA 5CWSA 4TM9A 1URZA 4HDIA 2HPTA 2DI8A 3EH4B 4OGAD 3TBSB 1FI8C 3UPRA 2P8MA 2WIIA 2E9JA 3F84A 2XG5B 3MBEB 3VFOB 1ITCA 4CSTA 2D8KA 1MZZA 3DX9A 1E28A 5HYQA 1JK9A 3D5OF 3GMOB 3QAZB 4FXKB 4XCYB 3SY6A 4B3EA 2YSSA 2Z91A 3H9HA 4AVHA 1EHXA 2KUTA 1ZVSB 3LH2H 1LNUA 2FUQA 4OJFH 3CZEA 3RDTD 4L3AA 3PWJB 4IU2B 1GJUA 2FSDA 4PVMA 1C8QA 4ILDA 4PREB 3V5HB 3I84A 4FQHB 1OKEA 3GEFA 5D71L 3T4AC 2F7RA 2IOIA 3IDIB 1KYOK 5AVZB 3FTUA 1NAMH 1DUZA 3QORA 3GWJA 4XPGL 3RVVD 1N5YL 4HPHA 1EGJA 4NZTH 5K39B 4N9OB 4EQ2A 4J3OH 2QKIB 4C47A 2VCOA 4NP4L 5JR1L 4MXWH 3CSGA 3BO8A 2VZTA 1MFEL 2NW2B 1G87A 4FQJL 4ZSOE 4YFEA 5HVHB 2IANB 4MA1C 3HZMA 3KPSD 4NQCB 3O6KH 3ARQA 5MEND 1HK6A 4F7CA 4X9IA 4NDMB 2VLJE 3HNTH 3HHSA 2UY7A 1T7WA 1XGYH 3FULA 1RUPH 3IJ9A 2H0EA 4X6CF 4B9JA 5K9JH 3UG5A 4Z7QB 1KGJA 3B9KD 1GKOA 5HHME 1A3RL 2HH0L 2J20A 4JFSA 4MCZB 2FT8A 3CFIC 3GSVA 4ZI8A 4GXUM 4OM0H 4NN6C 4XOBA 1LE9A 2Q7YA 1O7VA 3LRKA 5HGBB 3E6FB 1FAIL 2YEQA 2DI7A 4QF1B 1JZ8A 2ETWA 3T4AB 5T3ZL 2E7LC 1AI1L 2GYSA 3BKMH 4P57B 4WW2B 2Z8RA 5B3SB 3L5XH 2XWJA 3FUKA 1AE6L 2W88A 1YSOA 5AOKA 4OQTH 3W5NA 4N6QA 1CI5A 4PWFA 1ASPA 4KC3B 4BKLB 3IGLA 1Z0MA 4KMTH 5LCVL 5C0DB 5DJCB 5L88H 1FO0H 4Z7OB 2IDFA 1BIIB 5GSVB 3IDGA 4MTMA 1RZFH 5EOTB 2OMYA 4QKXB 2RHEA 3KL5A 5KSBB 1DYZA 2NYZA 1HH6A 2QVKA 2UXGA 2EXYD 2NCMA 4PJHE 4U6HA 4X6FA 5HDQL 1AO7E 3BAYA 4PR5A 3O6FD 4KH2A 4ZS6C 4FLSA 3NIFE 3P4MB 4JLRB 3TA3B 3VQ1C 4F2MB 2Y7SA 3MV7A 5CEZL 3RFZB 3SGDI 1BBDL 1PIGA 3VFPB 5L2KD 1AKJB 1VGKA 1XB6A 2CG9X 4P2RE 3MLRL 4LDOB 4MS8D 5GPRA 4PJ9D 1A9EB 4PRBA 3SKJL 4DQOL 5FUZH 2BPBA 4EI6A 4L3ED 4TSAL 4HF5L 4KHTH 3V7AG 3FQUB 4LZKA 1X5AA 1MLCB 2PYEA 1V3KA 2Q3XA 3BD5A 2PCFB 4L0ZA 3HG3A 4BFNA 5IMMA 2AK4B 4B6ZA 2IFGA 4TVPD 5AVQB 1JZGA 2H0PA 4ZFFB 1E28B 4HIQA 5E8DH 4HULB 3QXVA 5J12B 4TQPA 3EH2A 3BKML 3GXNA 4QRFA 4EZKA 1HHIA 3CDZA 4IRSB 1EPFA 1SHWA 4NQDD 5DRNB 3HLAA 5BVPH 3MBWA 5DJYA 3QIBA 4DP5X 2WCGA 5AVSB 1FNHA 2W95A 1E5ZA 1DQDL 3NP4A 4XTRC 1XGYL 4OSUL 5CEZE 4PLKC 5DJ0B 4HSAC 1DVQA 4YFLI 3OL2A 1A14H 4XXCA 3QEHB 2LAGB 5FYJD 3LEXB 1R5WB 3PQYE 4AVJA 2CDFB 4MVBC 2CPUA 4L3CB 5HI4D 1CQYA 1N5AA 1GC1C 2JI1A 1EZLA 2PO6D 1ZLVK 2DM2A 1OAZH 2VITA 4WU5A 5CJQL 5AOLA 3BT0A 2QQNL 1GAFH 1KIUA 5JNYA 3S8FB 1D5BA 5LBSH 4JG1L 3FUJA 2HFEB 1ETZA 3RKDD 1U8NB 3GLEA 3SYQA 1OAJA 2WC7A 3OKMB 1KMGA 1HTYA 3PIQA 1CF8H 3EO9L 1OAQL 2XXMB 4PU2A 1M7XA 5GIRB 3M7FB 3NEOA 4TYUA 3U46B 3EYVA 1Q38A 3CUPB 4ES9A 1KLGA 2R0LH 1EXUB 3FO9B 3TM6A 1UWYA 2O6FA 3SD2A 3UAEA 3QR1A 2AXJA 2DKUA 5MI0B 5T1LA 5CZVH 2MKLC 4P2QE 1HINH 4IIZA 1KIRB 3KPSB 4WHDA 2FDBP 1BFVL 3ELQA 4LT7A 5T33H 2YUZA 3QNXA 3JWOL 4HJUA 4NFDA 4N20A 1YY9D 3OZKA 5E95B 4PY8J 3WFEH 3O4LA 1L0PA 3IKCB 3KL0A 4ODTL 2WKOA 4WEMB 2J88H 4FQCH 4NQTA 4LNRA 2ADGA 5CEYB 4DOHE 2BOBB 3R4DA 4HFUL 4RZCB 1A6PA 4NO5A 3GUTA 1KJ2B 1G7PB 3BE1H 3DXAD 3F7YA 5DHYA 5CJBA 4I5BA 2X4SA 3D12B 5HJ3A 5MEQA 1R3IH 1GGIL 3ESMA 3FUDA 5JHLA 3RGVA 4X5RA 3VFTA 1KBVA 4GKZA 3IDJA 4HKZA 1IFHL 1QW9A 5TE7L 3WFDH 1GOFA 3OF6D 4YHOH 2NSXA 1U42A 4Z7VB 1EAOA 1XMWA 2QSTA 3AXLB 5DD3H 4JLRA 2R29L 4ZO8A 1IE4A 4F7CB 4LSTH 2AJXL 4JDVB 1CD8A 1ODAA 2K8QA 3VA2C 4FQQB 4DKTA 5IB2A 2VR6A 5K9QI 2F5AH 5KVGL 1RUKL 1U8QB 1F56A 2V17L 1RJYB 4XOCA 4LHUD 2PW1A 4IBTA 1K6QL 1IEAA 1T4WA 5HYFA 2R4RH 5DRWA 1CIDA 2Z93A 3D8MA 4QHLA 1JD9A 3PP4L 4BSWA 3FTGA 1MREH 4XXCC 3X3GH 5BUGA 1Q1JH 5GGRY 1WBXB 2GJ6E 2A9DA 2ZNWA 2YIHA 1KPRB 2E7HA 2ZCKH 2D31B 3NMEA 3TU6A 5C0JA 3SDXE 3HIZA 4LKXA 3K4DA 4Z7UB 3ARGB 2GTWA 4JKNA 4Q2ZA 4NQCD 2HMIC 5HHVL 3S4SA 4ZX5A 2JMRA 4XP1L 3GSNA 5IW6A 2EE9A 1D3CA 1HEZB 5CLZA 4F9PC 1RV6X 2KHAA 1XR8B 5D93C 4PP1C 3TO4A 4WNJA 4ELMA 1U8KA 2N0MA 2XWDA 3AWGA 3DIFA 1TU2A 4KK6D 2MTPA 5I17B 3PWNB 2C9RA 4HUXA 2GSIA 3N9GL 5C0GB 2A6DB 4F2EA 2V8LA 4YE4H 1FLRH 2VZ3A 4GRLA 5E00A 3HBQA 4POZC 3PU7A 5D7LE 1RJZB 3GKZA 3LDBC 4HJSA 2DD8L 2O5YH 1DLHA 3BXNB 4MFHA 1A9EA 4PRBB 1BM7A 1ZJAA 3ZE0E 1EA9C 4MD4A 4XI5D 1A6VL 4TQEL 4KMQA 1MJ7H 4GW4A 4WU5B 1OTUC 1V3LA 1J5HA 3MZGB 4KPHH 2DB8A 4YXHL 2GCYB 5FUOL 1OOAA 4OZHF 3TYFB 1P4BL 2VISB 3MROA 5SV3A 1ZGLP 4D8OA 4RZKA 4Y4HD 3QC6X 4HPOL 1QFHA 5ICXA 1OOWA 2P8LB 5F0JB 1M2VB 2MNUA 5HHPB 3WKYA 1KF9B 3JTBA 5FO2A 3RTQB 1WAAA 4KJWC 2CWRA 1I8AA 3FTYA 3ILEA 1IBYA 4WEUD 3ZDXB 2ICEA 3P0GB 1VZHA 2QQQA 4LARL 3QRGH 4L8CB 5E5RB 4ZT1A 4M5SA 2AQ1A 1SBSH 4XO3A 4K9EL 3KVDD 2NQCA 1SNRA 2HXAA 1NBCA 4AK1A 1T04A 2QMJA 3P11L 1UTDA 2ZOKB 1BQHG 4CW1B 4YE4L 4G2AA 4GBXA 4NKOB 4Y19D 1N64L 5A16B 1XGRA 1EO8L 3HBZA 1ZHKB 2DQUH 1CLZL 2EEXA 5DGRA 2X05A 4F33A 4PJ7F 4HS8L 2XN9B 4MMYA 1JDDA 2C9UA 4EN3A 4X6CB 1NH6A 4P5KA 5T1KD 5EIIG 1CGWA 2WANA 1OSZA 4ANKA 2QPDB 3QZPA 2B9AA 2R39A 1A6TA 1OV8A 3SPCA 1O6SA 1E5BA 4JQXA 1U8OA 5MI0C 2PXYB 2ZX7A 2HT2C 3NA4A 2WIIB 3MBEA 5CBAA 1TQUA 4FLRA 2YQ3A 1XF2A 5ADOL 4NT6A 5IVXB 3AXIA 4XPHH 1WA2X 1IGIH 4J3OG 1XH0A 5JHMA 3RFZA 3L3HB 5BS0E 2A9CA 3FCUB 2Y25A 1XF3B 4ZTPH 1CB4A 4NKDA 4WAFA 1NLBL 1UJ3A 3ZK0A 3FC8A 1HKLL 2X40A 3PV6A 3ZDYE 2NW3A 3PABB 2XKNB 2Q7AA 1LXMA 4FEIA 2R83A 1U58B 4O2CB 4HIXL 5KBKA 5I74C 2L7EA 4L4TA 2D31A 1YEIL 4NBXB 1IGJB 3BDBA 4PD4K 1SEQH 1WV7T 4OLUL 3N85L 3QEQA 4WHTA 1FL3A 3S3PA 2WB7A 3GHBH 5E8OA 4KV5E 1AH1A 2BSSB 3OGCB 2X1OA 4DGVL 5AOIA 4DTGL 2D9QB 4RFOL 1PKQE 1OB1B 2J73A 2PETA 4WTZG 3UDWA 5IQNA 2BOCA 4DZBA 4RFNC 2RA1A 4IU3A 1DN0B 1KGYE 1M9SA 3LKSA 4FZEL 1K4CA 3BWAB 3CSBA 4NKMB 1F1AA 5ID1A 3K8LA 3QQ9D 2OTWB 1P4LA 1FFOA 2L7UA 3UL4A 5DJ2B 4F7PA 5CZVL 2I9TB 3BGFC 3BJ91 1C5BL 3ULUE 1X9QA 3T0BA 3FO1B 2BZCA 2CDFA 4H1LH 2FX9L 3QNFA 4L3CA 5K9JL 3OAYK 4GXFA 4ODWB 1HQRB 4UT6A 5CHNB 2F61A 3NPSC 4X80L 5JHDE 4ABQA 5D2NA 5JPMA 5BRZD 4N6RB 2Q3ZA 2DM7A 2GIXA 3HB3D 4QHMA 4OIIL 4QGTA 1CIUA 2NX5D 2X4RA 2P42B 5FX3A 4NX0A 4YDKL 2XI9A 5DJCA 2GUYA 4OIIH 4F7MB 3SDDD 3HZ3A 4PWIA 3RDTC 5DWUL 2BY3A 1UD5A 1HAWA 1JZEA 2O61B 3ZGHA 1NL0L 5CFAA 4HK3J 1KLUB 2RCSH 1IM3B 4XMVA 2HJFB 1T3FA 3RY6A 4BFEA 1INQA 2V6HA 1A02N 1JCVA 1W16A 2CRMA 1KIPA 1OAYL 2NSMA 4PJAA 3S88H 1AS8A 1MFCL 5D70H 3AG4B 5J11B 4PY7B 2VDMH 3Q7JA 1G6RH 5AW8B 4BZ2H 4FG4A 1A6AA 3QZMA 3LVEA 4RAHA 4Y2DB 3RURA 4WUUD 2YN5A 1FWXA 4FXGB 2Z31B 2LU5A 3SGEI 3VXSB 1BQHA 3N0PB 4ZFGH 5BW7C 5MENB 1NAMA 3DX7A 4MJIE 2X0VA 3RL2B 2Q8BL 4AVKA 4RFOH 4X4ZA 1E27B 1JGVL 3ULVD 4U3CA 3ZDWA 2DWYA 4F7TB 4BQBA 2XRAL 3CFUA 3A5VA 5DURD 3AREB 3O11B 1KDIA 1UCBH 3IFPB 3MGOB 3Q9QA 1T1YA 3ARDD 3QNYB 4EI5A 4ZFFA 1J0IA 1NEPA 1UM6L 2Z9TA 3AS2A 1KPVB 2YWZA 4XE0A 3VTAA 4BKTC 5BQ7B 2WNXA 1CQKA 2XQ0A 4Y9EA 1GSKA 3C08H 3AFLA 1BGXL 5D96B 4B27A 4UV4L 4FTVA 1H3UA 5F7NC 1S4IA 3JSSA 4OCNC 4L8SA 4UM8A 2CLZA 2JF1A 4N85A 4NC2B 1FIGH 1R47A 2BX5A 3C60C 3DOIA 3DO7A 2XLLA 1OGAA 4TOYH 4Z8FL 3R4RA 3M1CA 3NAAH 5DFWH 1JNJA 1VFAA 3W0WE 4KY2A 3TCLA 3U9UA 1HCVA 5HP5A 3G04A 1OPOA 1R3LA 3MLUH 1UXSB 3F2LA 1OIOA 4X6CA 2XACC 1XIWC 5HVFB 3MOAH 1IKFH 3MYJA 2HFFB 1XL4A 1HEZA 2E75C 3P02A 5I5JA 1A9BA 1GMIA 1RZQA 1ZA6B 4TUOB 2EDLA 1FL5B 35C8L 4QO1B 5D5MB 5FWQA 4YSDA 1U6AH 2VDLL 4HMDA 3VD9A 4FI7A 5L4MA 2JKRM 3FU0A 4TUJA 3SBWA 3DTDA 3STLB 4GMTL 1AQHA 3FONB 4Q4IA 4NDMA 1XAUA 1IBZA 3CH8A 4ESKA 3G5ZA 3SPVA 2V9UA 4LESA 2X89D 2J8UB 4S1RH 1CXEA 3I02B 1OANA 4WFGD 1HCZA 3LY6A 3TBWB 1H3PH 3DSFL 1NPNA 1HQRA 3O6FC 1I8IB 3SBPA 2H2SC 3HR6A 4Q9QH 3SE3A 3O6KL 3JTTA 1VDGA 2BP5M 4PRDA 4Q58C 4M5TA 3MLSL 3RILA 2IBZY 3MROB 4RISH 3L1OH 5KJRH 3EJUA 4PVLA 1S78C 3GJEB 4IJTA 4P2QA 5KTEH 4LEXL 5B39G 2FX8L 5EOCL 1MHEA 1CLOL 3QUKA 4KX8A 4PJGA 4XBGB 5CJOL 2Q10A 5IB5B 2ZWZA 1A1NA 3KGTA 4JFQA 1VFMA 3R1GH 4AYEC 3VMPA 2ZKXA 4X50A 5CO1A 3WE1A 1P9MC 3G9AB 3JVGC 4Q9RH 1HXYB 2H7WA 3GT6A 5SX4H 4B9FA 3DI2B 3CFNA 1A1MB 3RA7L 1RZKL 4WO4B 4GBXB 4PLKD 1MSPA 4A2FA 1D6EB 5EG6C 2K3TA 2ZXAA 5MEOB 4OQTA 3LQAL 1EXHA 2KLTA 2VLKA 3FFCA 2VMJA 2H6PA 4YO0B 4HC1H 2NY0C 4OZIA 1UACL 5KS9A 4FFWD 3L4ZA 4OJAA 5DUPH 2VERA 5DQ9B 3C09B 5E6RB 5GGSA 1NMCB 3Q5OA 1T2QH 2YAMA 5E0QA 4P5TB 1OW0A 2VISA 4FTDA 3WIAA 4Z7VF 4OB5L 4KKNA 4FQLH 4K9EC 1TEYA 3DC0A 4HGKC 4P9ML 2YAFA 5D1XB 2BJMH 4RAVB 1CXKA 4NT6B 3CSTA 2ZICA 1URLA 5J57B 1MNUL 4JGJA 4WZ9A 1J9QA 3FB7B 1NMCC 4OLWL 2CHDA 3FQXA 4LEOA 1U8HA 3Q0HA 5GZOC 1BIHA 4UNIA 5KANI 5DQJA 2PPDA 2X4NA 5AB9A 1S3KL 3MBEC 2AJ3A 5E2UH 2Q6WA 5J13B 3HEIB 3PWNA 2BNUA 3VXMB 1RK7A 4KNUA 1IAKB 1RL1A 5IK3A 3ASWA 4HMCA 2GABA 2EINB 4I3GA 3LRSB 4JFTA 3QEHA 1PLAA 1INQB 3FQNA 5E2JA 3ULVL 2R56H 3T8XA 4PJAB 4N1EA 3KW7A 2XETA 1X9UA 1MF2H 4JZJC 1NUFA 2NR6C 4L0PB 1JZ5A 4LB8A 3LMJH 3BWSA 4FNSA 3NABH 1EJOL 5C2UB 1I31A 1KY7A 2KLSA 4YGAB 4BGDA 1ILUA 1F58L 1KIUB 2YFOA 5JNYB 1GTNA 5D1QA 5JXEC 2ZG2A 3MRJB 1XB3A 2BFVL 2DQEH 4LQFL 4K7PH 4KUZL 5ISZB 3T0EC 2GAZA 1AC0A 2RTTA 3PWLA 4Q4EA 2ARWA 4YBLC 1X5MA 3RWIA 2CKNA 3QHZL 5I18L 3C5ZA 4QUOA 1MRCH 1P5VA 3SQBB 3MGOA 3P3TA 3QNYA 3VVVA 1YJDC 4ODVL 4BWWA 3CUPA 3R0MA 3FO1A 4CJ0A 1LWRA 3WFEL 2EYSA 2GFBB 3RTLA 4YHPB 4OCWL 5C3TA 2GT9B 3D85B 2LTQB 5J13C 2VKXA 3LXBA 3GK8H 5GS3A 4TMPA 3RX8A 2W07B 3C09C 4NO2A 3ARBD 3RNQA 2N7SA 2F1EA 2F68X 3VG9B 1BZ8A 4HH8A 4NAJA 1CE6A 4LVHC 4YOKA 4AZUA 4JO1L 4YSPA 3ZLQC 5ACZB 2R15A 3DK2A 1DQQA 4FS0A 3OBAA 1XQ4A 4JVWA 3S5LG 1N3NB 2AJUH 2H26B 2HKHL 3IJEA 4A1RA 4AL8H 4AMKL 4ANUA 5LGHL 3IGAA 5LNGA 4PJGF 5KAQG 5AW5B 4OAWA 5C0AA 3SKNB 3ZKXC 1L7TH 5KSAC 4ZW7A 1AQKH 4AY0A 5C8JA 2O6PA 1IO4C 1OTTD 3I3BA 1TMCB 1JPST 4YIQB 5EULV 1J86A 1PZAA 5LNDA 1J5OL 1B88A 2J7LA 3PPEA 4BSWB 2ESVE 3P0YH 5JOPD 3ARFD 4AC2A 3WS6C 3UBGA 4M43H 5IBUG 1Y18A 2FZ3A 2DEWX 3PV6B 2IH3B 1KG0A 2PR9A 1S7XB 4LLDB 3K5SA 2R69L 3TYGL 3W57A 2PW2A 1SJEA 2K7QA 4HW6A 1LEIA 1ZS8A 5EBWA 4BCZA 2PYFA 4L8DA 3IF1A 5CJOH 2XJKA 1T5KA 4HKJB 5B39A 4N2GA 4XI5C 4W4OC 4KJWD 1T66D 5AAMC 2OMVB 1W0VA 1U3HB 3QE5A 3UAJC 6FABH 1LD9A 4IBZA 2VE6A 4ZMAT 4MASA 1P6WA 1AQ8A 3F62A 2CO7A 4FXLA 3RGHA 1Z2KA 2JB6A 3CZJA 3HCVB 3OKYA 4FTVB 1QI4A 2N1TE 3BKJH 4NGHL 2E4FA 2AJZB 2B0SH 1I3GH 3IJHA 2N7AA 4HP5A 3DO7B 4F27A 4K8RD 2Q9OA 4NQCE 5ADPL 3FO0H 3CBKB 2BSCA 1ZE3C 3TNNB 2EICA 1AGDA 1VLXA 4U1IA 5LWYL 1YCSA 1U6AL 2VDLH 1KBBA 5TE4L 3L3OB 2FE0A 5C09D 3S3JA 4Z7QE 1SN2A 1VJSA 3HB3B 1N12A 3GXMA 5FEBA 3NVQA 5DVMA 1IZJA 1D9KC 1X5KA 4AJVA 2WXPA 2KKQA 5SWSE 3ZYJA 5BRQA 3L3JB 3HJ0A 1IKOP 4Z0XB 3PDDA 1UUSA 3D33A 4RWHA 1I82A 4KZEL 4R26H 4A37A 3CDGA 4PJDB 5IMKB 4XCFL 2G0LA 1MW1A 1S3RA 3LAFA 4A2GA 3WFHB 1BBJA 3VFGH 4NFBA 1E4KC 5FYJL 3K4AA 4UWQB 1PG7L 3TCTA 2NY3D 5GS2D 1WGVA 2ATPB 1TZOA 3QJXA 3VXSD 5J8OA 3NSFA 5E6IB 3BP6B 2X2IA 3BAXA 4XWOC 5J7CC 1KCSL 2CGYA 1RPQA 3MRNA 4G8GD 4HIJB 5L2JB 2ZJSH 4PJ5B 1T89A 5ADPH 3A23A 1G94A 2HJLA 2ZKMX 5IM7B 4BQ6A 2VYRE 2BVYA 5KSBF 5BVJB 3BKCL 1H8OA 1RLBA 5IQ9A 3X1NA 5IBUB 3OKEA 4DCQA 3HMXA 1JXDA 2PP7A 2GJPA 3BPOC 3MJWA 1RUPL 4MSWA 1E7VA 2D7OA 4IHOA 3HNTL 2NDGA 5D4QA 3V2AR 3MA9L 5J11C 3WSQH 2O5ZL 5ECJE 1X6NA 4WW2F 1I3VA 1RULL 4WRLA 3CC5B 4PV1C 1IJNA 3MRKB 4HX1A 2YEZA 3QQ3B 1FVEA 2ZOLB 3AREA 4Y9CA 1T1YB 1H5BC 4GW1A 5C2BL 2NW3B 3UJIL 2ZCHL 4DUWA 4X8CA 2OQJB 3I9GH 1JNNH 3WIHL 1FVCB 5ALBH 5IBTL 2WIMA 4TSBL 1WS7A 1EJFA 2FWSA 3CPLB 4AQEB 3KGSA 2VAAB 4AM0Q 4AI7A 4DWHA 3WU1A 4AW4A 2CU9A 4TNWF 4KY1L 2VQUA 1R1CA 5EBLB 5ESAA 4HWEH 1OPGL 2YUVA 2A1WL 4PJ8C 2FQDA 4P23C 4Y19B 1RIUH 3C6SB 3QRBA 2DDQL 4KROB 1FG2A 4Z78A 3Q1SH 3WV0A 3WFCL 2B1OA 4M56A 2KH2B 1CE1H 4W81A 2NT1A 4WHTB 3LN4A 4EVNA 3NSXA 2FB4H 2X4OA 1T0NA 4U0QB 1CGSH 2WOBA 1AZUA 4XMUA 1E9QB 3WAJA 2H2PC 3KS0J 4X0KB 1IB5A 4RMVA 1T5XA 4I4WB 2YZ8A 3QIUD 5TH2B 3VXOA 5CEXA 5CZRA 2V5SA 2DM3A 5KSVA 1JXFA 2O72A 3PAYA 1FGNH 1PZ3A 1X4YA 25C8H 2H1PL 2A4ZA 2WN3A 1R3KA 2X70A 4N0UE 5K5YA 5F97E 1NFDF 1RZPA 1IT9H 3U30C 4MAYC 2YKLH 4OD2A 3QW9A 1FA4A 1NKOA 3LQZA 1TOXA 1QR1A 1ZLUH 1PG7H 4MXQD 5KBDA 1WUZA 3JYBA 4NNPH 3FHQA 2IBZX 1HJBC 3LHAA 3FN0H 1QLRB 3D69B 3LEVH 4AUYA 3V4PA 3TEYA 1NC2D 4RMQA 5B39B 1INEH 1HOCA 4P9HC 1WFJA 4RAVA 4XVJL 4F8PA 5I0DA 1F4AA 1CDYA 1F00I 1JG9A 3SPJA 1R3JB 4CKVX 5B4MC 1KIPB 3GZPA 3ULVC 2XWTB 2H1LM 1IE5A 2WP3O 1KTJA 2IQAB 5GISL 4K2UL 3LZNA 4NJAH 4BQCA 3FO0L 4WUKH 1MF2L 1ECYA 4MXVE 1L9PA 2VC2L 3BPOB 4PTTB 4HWNA 2AEWA 3O2WH 1YUHA 2EEFA 3BVDB 1DQML 4M6NL 2VSMB 4G7YL 1EZSA 1NGQL 2OJEA 5MERB 3H54A 4F7KA 1N68A 1CBVL 5DCCA 1E27A 1NDGA 3BQUA 4XH2B 1KNOA 3D52A 4HEPA 4PBVC 3WS6A 2AJYL 1TZHB 5E56A 1CDUA 1F42A 2MOGA 4RNRA 2Z31A 4AJ0A 4PWHA 1JGDA 4F24A 4DPCX 4IGBA 2QTEA 1BM3L 2VDKL 3PQYB 5HDBB 5KVEE 4IRJC 2P5WE 4XBPA 3CNKA 2PR4H 1SF5A 1SRDA 1Z9SB 3F7PC 3LKOB 4U1NB 1KCVH 2MCMA 2C7UB 2XUWA 5E2VH 4PRIB 4GNKB 3CIQA 4HA1A 2AEQH 3GSXB 3B9KC 4LSUH 4OGZA 5KVDL 1B6UA 4QYOA 3ULSA 5JXAH 4CKQA 3TYGH 5K59E 4OI7A 2ADJB 4M6OL 4F2ME 4A04A 4NOFA 2OJ1A 1CLYH 1MFNA 1CLYL 3WJJA 2X4UA 4P4KB 5KYUB 4TVPH 1MI5D 1RLWA 4FXTA 3WHE0 5KN5B 4TVPL 1LEIB 5G5DA 4HWBL 3QQ9C 1MAJA 2MSPA 4TPRH 2BMKA 1W72A 2OBGA 1JFQH 5E0FA 1P1ZB 4LL9A 3STZB 4RZCA 1WD8A 3ZO0A 4XP9H 1DCEA 4PRPA 1HHJB 1AQKL 1LWHA 2K6WA 2AEQL 3SOTA 3GB7B 1ZXQA 4XVUD 1WS8A 5FK9B 1EFXD 1E3FA 1BQLH 2JJSA 2X28A 3HKZA 3KG5A 3ZYZA 3ZE2B 5DEFA 4L4TE 4TUOA 1RZGA 1VCAA 2CO7B 3QQ3A 3E1F1 2PPFA 3NPZB 2P49B 3WNOA 3GI8H 1MUJA 2BSEA 3RFRA 5AW3B 1RIHH 2RB8A 5K1JA 3D0LA 4B53A 1OWRM 4ALAH 5EZOL 4UI2A 3G5ZB 3SPVB 2WXIA 4FQQA 3IVKB 1JPFA 1A1OB 3D39A 2A6IB 5DRWB 4CVXB 4JZOA 4FD0A 5GISH 4UDUA 2PW2B 3WS3B 2W07A 4NO2B 4OJYA 3ABGA 3QUKB 4XBGA 5D1XD 2R0WH 3MV8D 4KJPC 3SO3B 4GBXC 1P4UA 1MI5E 2QZ5A 1JZ3A 3EAKA 3T04D 1FLTX 3P30H 4L4VE 3ZE0F 3F7VA 3QFJD 5D2NE 3G5XB 3OR6A 3MNWA 3A6CL 4FC3E 4OZHA 5KJ4A 5HHXH 4CN1A 4M62H 2JKIS 2NYYC 4XX5A 4K71C 2EZ0C 3BAEL 4KFMA 1JRHL 4OLYH 4DKEL 1HHHB 3CXDL 3IMVA 3TBYA 3H9SA 1E9QA 2RFXA 4FKKA 4ANXA 1WAAF 5IEHB 4I0KA 1JYXA 2ADFH 1DBBH 3LPPA 1Y6MR 1ETB1 5B8CB 3DETD 1QHOA 2GJ6D 3EFFA 4JZJB 4HKXB 3N6YA 4YC2C 1PZUB 4P5MB 2FIRT 2F5AL 1JXKA 4YXKL 3V5KB 1T20B 3NDZE 1JZIA 3CFKA 2C9XA 2ZIDA 4UNVA 4FNQA 3A4AA 3BYYA 4WJG3 3RAJL 1ZAGA 2RBLA 3TIEA 1DJSA 5D6CA 4YHOL 4LVNC 1JXJA 1DBMH 4ZD3L 4P2OA 4V1DE 1OSYA 3LRMA 4Y0GA 3KPQA 3FRPA 2UZYA 2BP0B 2YRZA 5IHUH 1AG0A 1R3IL 1BYNA 1S7QB 4IGBB 3QYNA 1OCRB 4OF6A 4ZBJA 1C1EL 1RZIA 1YYML 2QEJA 1D2PA 4ZUUB 4J3SA 5HGAB 2BP8B 1NLDL 2EDMA 3MLWL 3ALXA 2AK1L 2WLNA 4LVNB 1P7QD 4OB5H 2Q8BH 2PPCA 2E47A 3OGOE 1FFTB 2OA9A 4PRIA 2XA3A 4F58H 4LPVA 2EDDA 1AGFA 2FX7H 1WZ1H 4I3SL 1J8HA 2JIXD 4ZO9A 4NUQA 3SGJC 5CBEB 4TS6A 2QR0B 1N2RB 3MRCA 5DMGC 4NQVB 3L3DA 2JE8A 4JPWL 3GUFA 1FNGA 2D3VA 3V8CA 4LU5L 3KYNB 4PLNC 4JRYD 3BCDA 2H41A 2NCEA 4AVIA 4CN4A 2VDPB 2OJEB 1CGVA 4N2DA 15C8H 1AO7A 2ZAHA 4G8FA 3S36X 3MRMB 4A7GF 4N28A 1JNNL 2I7SA 2VNCA 4ZS7L 4LSVH 3ULUC 1UH2A 5C2BH 2CLRB 3J2PA 4LEXH 4P23A 4V1DD 4LSPL 1THCA 4C58B 2X9ZA 4PCKA 2E9WA 1L0XA 3VFTB 4DP6X 2B77A 4X6CE 1TZAA 1ONQA 4ENED 2H1XA 2ZD0A 5KBLA 3G6AA 1KBGL 3VG9C 1L5GA 1UWGL 4YQXH 2CXGA 5LG6A 2EUXA 5KSAD 3ARFC 5EU4A 3JWNH 1OK0A 1WZKA 3AG1B 2UV3A 3WJMB 4ACTA 4B0MM 3OZ9L 4B9GA 4CADB 4YUEH 2E9IA 2YAHA 2BNRE 4MKMA 4TVSa 4Q89A 4UMGA 1IMHC 3Q06A 4RFEA 4O9HL 5F7LB 1SJMA 1SEBA 1JPSH 4K7PY 2JLLA 4JKWA 3CZNA 4J27A 4FQ2L 1ES0B 5DD5H 4KVNH 4KUCD 1QVOA 4PI2A 5C0AB 1WSST 2OSXA 1FGVL 4UU9B 2KBGA 5I0XA 2E9GA 3P3YA 4IBQA 4WO0A 1NMBH 3QEQB 3HG1A 5ACZA 1KXTA 1NEZB 2V7NA 4JHAH 2EYRA 3MNWB 4JRYE 4N4YB 3MODH 4G9DB 4OZHB 3RA7H 3S48A 4NNXB 3DV4A 5IKCA 5FO7A 2AQPA 5TDPB 4XN7A 1D5MA 4O5LL 5ANMB 5JQ6L 4XR8C 1RJCA 3OD3A 4DPBX 2CKBB 43CAB 2R2EA 4JHAL 1AVAA 3INUL 4ANVA 3RWFA 1U3HD 5H8DA 3OHXA 4L1DA 3EO1B 4YHKL 2JI3A 3V0DA 3WFZA 4RX4D 4ZMLA 5FFLA 5L4FA 5SWZB 5TQ0L 2GVYA 3V5DB 3HE6A 5GGQH 3GMPA 4H20L 4Y5YA 3EDDA 4M1CD 4Y4KB 1R3KB 3RLSA 1A66A 1FO0A 4M93B 2Z7ZA 1N0XH 5SWQB 3QQDA 1RHHB 4JFOA 1QKZH 2GUOA 1HWHB 5EU5B 3EYQC 3H56A 3BIBX 1BVZA 4U7MA 2BVQA 2DAVA 3L5WA 1PZSA 4B9YA 3CN4A 4WFFD 4H26B 4HU8A 4OZFG 5DMGD 2K9UA 5KSUA 3Q3GB 2DMKA 1H3GA 2OMZB 3NJIA 1M6OB 5DI8B 3VFPA 4P3DB 3EJSA 3QORD 4QRRA 1F4WH 4ZJ9A 1QNIA 2COVD 3LN4B 4O4YH 5F96L 1YMMD 3SZKC 4EVNB 1BF8A 2I07B 4E9TA 4M8QA 4M3HA 2G9HA 4PJIF 5DMJB 3VH8A 3DWTA 3QXWA 2EUVA 2X1XR 3MI6A 5HHQB 2D73A 3L7EB 1SYVB 4KUCF 3UZEC 3BAIA 1GZHA 1ZT7A 4M1GL 3UBFA 2Y06H 4MHHI 1WFUA 4R8WH 4YHYC 3F00A 4TPRL 4ACPA 5F9AC 1A9VA 3DVIA 4O2EB 1LP9B 3GSOA 2R51A 2X42A 3IJSB 2RCSL 4GG6A 4PD4J 3B9KA 3NDYE 4HOMA 3FCSA 3HC3L 3LS4L 4KK8D 4MMYB 4ABWA 2WLHA 2VM4A 2YPVA 4U6XB 5D6CB 5TD4A 4M6OH 5EZLB 2ICWA 2JKXA 4C4KT 3F6LA 4R7NB 1WE5A 3CZLA 3HE7C 4UV7H 1JPEA 1XGQB 1A6TB 2CO2A 4W6YB 3SZ6A 3APDA 2WQAA 1ILSA 1JGDB 2J1WA 4P5TD 2CLRA 4M29A 5CZKA 5DHXB 1S7QA 4XMKL 4JGUA 3NN8A 4MCMA 4HEPG 3WNLA 2VDNB 3MFFB 1K5NB 1PY4A 1T1XB 2N3JA 5F9OL 3L17A 1MUJB 4P5RA 1DVYA 3TV3L 2NY5L 2OV0A 3NSCA 2V5RA 3D85D 4Z3IA 4LCYB 4WNSA 2A73A 5CSBA 4E9QA 5DJDA 1YMME 1YPZF 1FYTA 1NICA 1ACCA 3GM8A 3GSWB 3SODB 3ZKQD 5LAPA 3ENEA 4GSQA 1E5YA 2VL5A 3MCLL 1QFWI 4EOWH 1JD7A 4MX7B 4XBEH 1BW8A 2X4TB 1MW3A 4OD1H 5T3XD 1IFGA 4YDNA 2R7EB 4KXZI 4UIMA 3U4EB 1J5DA 5CJ5A 1S5HB 1PEWA 5I1AB 2KT6A 4YEFA 5J9PB 1ZRUA 5FGBA 3G5XA 4W4OA 2QVFB 5F9WB 5FS5A 3MV11 1KEGH 2WINA 1U95A 5SWSD 3VFVB 4J3UA 3BAEH 1NCWL 3TASA 1HYSC 3LQAC 3T6XA 3MV9D 3KDPB 5LG1A 3RY5A 5E8NA 4DGYL 2EO1A 3ELAT 5I6XB 2VAAA 5EB9A 4DN3H 3FYEB 3QORC 4JFDB 4LCCB 5J3HC 5C92A 4FFZL 1FJ1B 3F7YB 3HE6B 2NY1C 1F2QA 4H13C 4G8GE 1E65A 4FERA 4DEUA 1NQBA 2XFXB 3TVMD 4W93A 3VWKA 4L4JA 3THMH 3W81A 5E9AA 3VJ6A 3K1KC 2H3KA 1H15A 1FH2A 4JE0A 3VFMB 1R46A 3AG3B 3UG3A 2LHAA 4L05A 3RWEA 5G5DB 3BGFB 3V52H 3MREA 1I9IH 4O51A 3RU8L 3X2QB 4ZK8A 2KZWA 3O0LA 3Q1EA 4HIIA 3UZVB 5ABDE 1NCUA 4P46D 2E7MA 3WOVA 4I8DA 3AM8A 2NNFA 3RDTA 3OR6B 5HYIA 4KITB 4Z7VA 2Y0SA 3T2PA 1TF4A 2YPKA 2FB4L 1NOAA 5JW4N 1VACA 2OCJA 3BIAX 1T22B 1U8QA 1N6QH 4CBZA 3Q6GL 1L9NA 4KRPD 5B38G 2SEBB 1XCWA 3MRQA 4FJ6A 4J1UB 2VLLA 3MV9E 4KTEH 2UUDK 4FL4B 3JWOH 4FFWC 1KBWA 3K6DA 1BXVA 1DQLH 1MQKH 3N40F 1IBHA 3IVKA 1IFRA 3I75A 1GGBL 2ZE0A 2JJVA 5F7BA 3KWTA 3RWJB 5AVTB 3LZQA 5EO9A 4HT1L 1XSKA 3P0VH 2ILLA 3K6IA 2X1WL 5EZLA 2ZT9C 2O93L 3TONA 3W0WB 1EHKB 3L95A 2XQBH 3BDYL 2IXQB 5MENA 5E2VL 1QRNA 3MBXL 3RRQA 4H1LG 1M6OA 1K5NA 2JKJA 1A22B 2VXUH 4UQIM 4LOFA 3MRIA 4FLQA 4PJXB 4UB0L 4A6YA 3G6AB 5A6IA 1IM9A 2FWLB 4YXHH 4U2ZA 4LVOB 4DF9A 3B8SA 1GGTA 2OM5A 2NY1B 3MKGA 1PZ5A 4ANWA 2J21A 4IRJD 3QG6A 4NC1C 1CDBA 1QEWB