3FFDA

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
210
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWIRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMFYCARQTTMTYFAYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hormone
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
total genus 44
structure length 210
sequence length 218
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA01
3BKJL 4WU7B 4G9DB 5EOCL 4V1DB 1RUPH 1MCPH 2B1AH 3D18B 3NA4A 2WBKA 3SKMB 4OUOA 5H35B 3LKSA 5ISZA 1I8IB 4Z5RB 3RWFA 4PJGA 1RZGA 4EIGB 1FNEB 4TSCL 2AV1B 3OJDA 3S4SA 5F9JB 4R7DA 4GAGL 5E6ZA 4OLVH 3KYMB 5J1SC 5JHLL 1LEIA 2O61A 2FB4L 5DC9B 5J06A 2G2RA 2I5YH 4TSAH 3WUWG 5D7JC 1G9NC 3U48A 4P2QA 1A3QA 4PV8B 1W0WB 5F1NA 4BFEA 1VDGA 3GSNH 1OGTA 1CLCA 2OBGA 1FFPA 5A1AA 3QO1B 5FO7A 1UB6B 4XBEL 4I5BA 2R0WH 1FORH 5C6TL 2XTJC 3E8UH 2JB5L 3KGRA 3VFWA 3HFMH 4OZFG 1P2CA 3TC9A 3L3OB 2LTQB 4D9LL 4NP4H 4LHUA 3BW9B 1H3GA 2ZUSA 4Y5YA 2GCYB 1QLEH 1JTPA 1TDQA 3VXPA 5GJTH 3JV6A 3IDGA 5KSAC 4QCIB 3V79C 1FAIH 1HHHA 3RNKA 5GGQH 1E28B 3V0WH 1W8OA 5DQDL 1MWAL 5HI4D 4H26A 1Q0XL 2NY2D 5GGSB 1KYOJ 5IVXB 1J9CT 4JVUA 4O4YH 4WFED 3IAQA 5BRZD 5E6ID 5BMFL 3BGAA 1DQJA 1TQBC 3R06B 4PJ9D 3VI3E 3VXQB 1NFKA 4OF0A 2P5WB 3N9GL 3TO4A 5CUSL 3ARWA 2PR4H 1RMFL 1YEFL 2DWDA 3O2DL 4RGNC 1MCSA 1QLFA 5KVMC 3RVTD 4FFZL 3KYKL 4XTRD 1GHFH 4FXGB 3VMPA 1LK3H 5AYUH 1T5WA 5H94A 4M1GH 1OD9A 2WINA 1JZ6A 2EC8A 1ZMYA 3BPNC 5GS0D 1OGAB 2DQHH 2XTJD 3VXRB 3IU4L 2CSPA 3KPPA 1WIUA 2Z92B 2EZ0D 1I9JL 4XXDB 5FGBA 4ODTL 3STBA 3VFWB 1JGLL 3BSZL 1RJZA 1CFTA 1JGUL 3R8QA 3QXAB 1HXYB 3L6FA 5KAQF 4ETQA 3TZVA 2J1KA 2X4QB 5IB2B 1HQRA 4QXTA 2OTUB 5BZDB 1K8IA 1QSEE 4M7LT 4Y4FB 5F1IB 1B0GA 1NSNL 3M1BA 3CVHH 5T3ZE 4GS7C 1KXVC 3TT3H 1YNKH 1KN4H 4WHTB 2ZUWA 3W39B 5F9JA 5EBMB 2F54E 4NZTH 3QCUL 4LEXL 1RIHL 5IVXA 1F42A 1F5WA 2LTQC 3IXTA 1ZAGA 4KRPB 4P3WA 3BDBA 4K23H 3TVMB 5KW9H 1FGNL 2YA1A 1NBYB 1GC1L 3QFJA 1I7TB 4QHUB 1B4JL 3D85B 1QLRB 3S8WA 2M1KA 4ZDHB 4FZ8L 5CD3B 5HHMB 5E8PA 1PX3A 2PXYA 3RZCB 3U82B 3L3IB 1FYTD 3T8XB 4HKBB 5T3XE 1UM6H 5L88H 3SDXA 3EGSA 3O41A 2VDLH 4UILH 5I6XC 2X4SB 4JM2A 4UBDC 1AGBA 4LF3A 4DVRH 3FB7B 3QDME 1IC7H 2X1XR 4JHZA 2AJ3A 3KJ4C 1FVEA 3KWWA 1CWVA 2WLZA 4P9MH 3D48R 1I85C 4JKPH 2DQJH 1BQHG 2PN5A 4XNXL 4HAGA 1QKZH 3L3HA 1RHHB 2FX9H 4JFPB 4QRRB 5FGCB 2Z31B 4JGJA 4KJWC 2QQNL 4KAQL 4LLVA 3DO7A 4S1DC 4IMKC 1S5HA 3T77B 5DQJB 4S1SH 3QQ4B 1WSST 4PJ5A 4PRHA 4M6OL 1VADA 4PJDB 3VD3A 1UH3A 1MCOL 4WEMB 4Z0BL 5KVEH 5TDPA 3HNVL 4JFYA 5I1HL 1WJ3A 4PJ7F 4WU5B 3BOVA 3P0VL 2PXYB 3RZCA 4WV1B 5FO8B 5IMOB 1B90A 4WV1A 3UTPD 4OGYH 4HUXB 6FABH 1GGCH 3T08A 4N8CH 4X4ME 4YGAB 4Z7VF 1UWGL 5C71A 1KBGL 2AJUL 2YD4A 1PSKL 4G8FA 4WENB 5FV1L 3RY4A 1JK8B 4ZO8A 4OZGE 2BMKB 1FFNA 1TZIA 4V2BA 2LAAA 3IDMB 1V7MH 1BQLH 4AIZA 4R0LB 1L7IH 2JIXB 4Y2DD 3UP1A 4WUKH 1IC4L 5AD0B 4F57L 2A73B 2NY2B 2VXSL 1P84K 1FG2B 4RFNB 2ESVB 3NACL 4MJID 1KACB 3CLFH 4RGNE 3U6RB 3I6GA 4H8WC 3ULUF 4N0FB 1G0YR 1FNLA 1YMME 3VJ6A 1BZ9B 4J4PA 4MCZB 5D5MF 1ZLVK 2EZ0C 2VO5A 2G9HA 4OSUH 3FQRB 4KUCD 4R97B 2YD8A 1PY9A 1QOKA 3CFDB 3QUXA 4NN6C 1EVUA 4NQCB 1YPZF 3HAEG 3FAWA 3RVWC 4WFGD 1L0YA 2WLYA 4UAOC 1FRGH 4Y5VC 2WBJD 3O41B 3LQAC 1LO0H 4GJTB 3VXRA 4Q0XH 3IETA 1CR9H 5KVGH 4HFUH 2J4WH 3TNNA 1KLUA 4MXQD 2EXWC 1FAKT 3PGCB 4P57A 3WFHA 4NRXB 1AO7D 2HKFH 2DN7A 3BP7A 3VD9A 4LNRA 3W9EB 2ZG3A 4S2SA 1UGNA 4KJPC 1BVZA 5FKPB 4MNQB 4RMTA 1CICC 4YO0A 3TV3H 4GSDL 3V5DB 4X9GA 3AB0C 1UCBH 1TPXB 1U8MB 2VLJB 2F5BL 4CBPA 5F7LB 1OY3B 4EOWH 3I6KA 1T1WB 4FTVE 3MRQA 4XAWH 1LO3H 3CJJA 3GO1L 4W4OA 4QY8A 3MBXH 3IFPB 2GQHA 2F58H 1PVHA 4NNPH 4PTTA 3HC0A 4XC3H 3DUUB 5GRUL 5DVOA 4XX1G 3I84A 5HGAA 3B9KA 2XXCB 1MJ8H 1YNTA 2BVPA 3MUZ1 3QEQB 2HLFD 2HYMA 4QRPB 4PGBB 3EYVB 4HC1L 4YPGA 2EH8H 2Z9TA 3BGMB 1B6DA 1FL6A 2VDML 4IOFD 4KXZH 4RMUA 1ODAA 4NQDE 1FH5L 4WI6A 1I8MB 1Q1JH 5F7WC 5GSRA 4QHNB 4F33A 3P11H 1N5AB 4HEME 1H3WM 1MHHB 3U6RA 5BVPL 4EBQH 1XZ0B 2FIKA 3BT2L 4IRSA 2P5EB 4W81A 4MHHI 4ZOCA 2YMXH 1EEYA 2ICEB 4Y2OA 1DJSA 4WHDA 4OCWL 1CG9A 3WN5C 5DVMA 1PZ5B 3TH2T 3LEVH 4P2OA 2OQJB 4Z7VE 3QI9A 4HHAA 1C5BL 2YR3A 4M1DL 3VFGL 1R5IA 5IF0A 1FV1B 1PKQA 3U1SH 1F4WH 3GSRA 4F7EB 5KS9A 5ETUA 2AEIT 4QRUA 3EYSL 4OFYD 4ZUWB 2GT9B 4LSDA 4NWUL 4KK8D 4XBPA 3UZEA 1NC4D 2C3VB 1A0QH 3IDYB 3GSVB 4RDQG 5JPNB 2QHRH 1KB5B 2BNQE 1NUFA 4JKPL 4Q6IC 3FTGA 4PRBB 1T4KB 4ZAKA 1BQHA 1YN7B 3MXWL 4W6XB 1DEEB 1URLA 2GJJA 4K2UL 4M6MH 3KLAA 1EK3A 5T1DH 2EO1A 1KG0B 3PWNA 3QI9C 2WZPD 4KHXH 1W72H 2HFEA 2Z8WC 1J1XL 1JHLL 5EUKA 5F7DA 5C0AA 2EICA 3TBYB 2H2PD 4OFKA 4PJAB 5LQBH 3KPOB 3LEYH 2FR4A 3C8DA 5IGXL 1U3HB 4ZOBA 3DRQA 1MCJA 4YBLC 3VXUD 3MBEA 1IGJB 2B4CH 5FYLD 2H41A 4HBQA 4M6NH 4L8SC 4IDLA 4JFXB 3VGBA 3TWCH 2DLHA 1A5FH 4HCRA 4I2XB 4TNVK 4WTZA 5TDNA 2UV3A 1RVFL 1PKQB 4GXUM 3OBAA 5HVGB 2XWTB 2BJMH 4NUJA 5H37G 3O81A 3MJ7B 1PSKH 4WHYH 3FO0L 2VSDA 1IAOB 1TVBA 4X6CF 3S37L 3IGAB 5DSCB 5H35A 1QSFE 3NFPB 1T7XA 4P4KD 4L4VD 5IW6B 1XGQB 3UPRB 4U1KB 1LD9B 1YNLH 1UH4A 4LRNL 1NC4A 2NPLX 5JW4Q 3FQNA 4XP6L 3IDNA 2FECL 2OR7A 4HFWA 1MCNA 2EXYD 3ZZ1A 2UUDK 3WLWC 2DICA 1VB9A 2OTWA 3IYLW 1OF2B 3DROA 3GJEA 1UB5B 4LLDB 4LSQL 4X4YA 2A38A 2FBJH 3B3IB 1PLGL 3HMXA 4YFDB 4AG4H 1I3GL 4X9IA 5L9DH 3D25A 3MRMB 3K0WA 2AERT 4BK5A 4CVXB 2LABA 3GRWA 5HHOB 4RX4A 1CICA 3CMOH 3L7EB 3T0DA 1W8NA 4DK3A 3G08A 1U8IB 1XF2A 2A1WH 3T0BA 4WFGE 5J8OA 5EIIA 3HAEB 5DJ0B 3TYFB 3ARYA 2W38A 5KTEL 1JYXA 5K33A 2BNUA 3MJ8A 5D70H 2JCCB 1ED3B 2OLDA 5D93B 1KBGH 4OD1L 5HPMA 2A0LC 4A6YL 1R5IB 3MCG1 4JO4L 4S1QH 4Z0XB 1H3TA 3NH7H 2DYPD 4NQDB 2NZ9D 4XH2A 2H9GA 2WINB 5A2JH 3SPVA 2A2QT 2I07B 2PO6C 4OM1H 5HJ3B 2B2XH 5IB4B 3MROB 1NAMB 3FO1A 3CZFA 3LH2H 5F96H 8FABB 3QEQE 5CHNB 2NMSA 2VDQL 3MLZH 3B2VL 1IARB 1FO0L 3PWLA 4I3RH 2HT2C 4R3SA 2OL3A 2DM3A 1SYSB 3QA3B 2V7NA 2VXUL 3K80A 2EEDA 1LDPH 1HSBB 4NBXB 4JCMA 3WJLC 2AS5M 4CU8A 3DGGB 1MLCB 1UM4H 1N8ZA 4Y4KC 2ICES 4QTIL 1FL6B 1S3KL 2H45A 1X6LA 4ZXBA 3UMTA 4G8GE 1HYSD 3O6KH 3AGVA 3QNYB 1EMTL 4OI9A 5DO2D 5DD5L 4FQXC 3QJFA 4XCEA 1P7QB 1XF5A 4X98A 4LSRL 2IAMA 4O5LL 1P6AB 3BN3B 5HHNA 3FQWB 1KJ2B 5I15H 1CGSL 1KULA 3ZDYF 5H94B 4HULB 3VGHA 1NBZB 4LPWA 3OB0K 2P5ED 3OAYK 4AK1A 1PQZA 3ZHLA 1D5ZA 4D2NA 4H1LG 1Z9SA 3J8F7 3MRIA 1N26A 2B0SL 3DJ9A 4D9QD 4H8WH 2X7LA 4WV1C 4ZYKB 1AGFA 5BRZA 2HVKA 2XQYK 4X7TA 2NTFB 3GKWH 4D0CA 2XFXA 5IHZB 2X4QA 5D4QA 3H9SE 4GKZB 2X05A 3VA2C 4Q58C 4C59B 5D5MA 1BOYA 1KSRA 1NLDL 1UVQB 1S7RB 3MA7B 5HI4C 5I1GL 4EUPG 3GBML 1I1AB 5LAXA 1D5XA 3O6MH 5C0FA 3W0WA 5FA4B 3RVVC 4GXUN 2GUOB 2ATKA 4PJFE 5TH2B 1SQ2N 1WBYA 3SDAB 1CFNA 4WI7A 4N5EC 4EVNA 2HWZH 5D7LA 5EU7C 3VFNA 3KPRE 5FFLA 1HIML 5BXFA 3TJEH 3FB8A 3U4BH 2CRYA 4C56D 1T66C 3N1QC 1ACYH 2YXFA 5DJYA 3ARDA 4I2XA 3C8KA 1ZV5A 4KI5D 1R3KB 5IB3A 5ISZB 1L0QA 1U8KA 4M6ML 5JW5A 1OQXA 3MROA 5ILTH 2AJVH 1L9NA 3KDMA 5DVLA 4X8XA 3QZWG 5ALCH 2A6IB 3ZTJH 4U3CA 4F3FA 4NQDA 1KELH 4FFVC 5KVDL 2M26A 4NKMB 2H6PB 1NCAH 1MUJA 1ZTXL 5C7XL 3ULVE 3P77A 4M7ZC 4WEUD 5EA0H 2NW2A 3ARSA 1GIGH 2AK1L 4JRXB 4LSUH 4L4VB 4Z7NE 5C0CA 3VXSB 4MQXC 2Z35B 3QQ3A 4PJ5D 5SWZB 3VRIA 1A3RL 1FO0B 3RWEB 3L5IA 3UDWA 4X4YB 2OJEA 1FFNB 1TZIB 2GTZA 3ULSB 1NMCB 4H5SA 5EO1A 5I17B 3AXLB 4XPTL 1AXSB 1ZLSH 2PW1A 4JG1H 1AY1H 4JO2L 1ZANL 2XY1A 3HR6A 3S37H 1T7ZA 1UH2A 2BHZA 4OLVL 5HYJD 3OKMB 3VWKB 1YEKL 1K3ZA 5CILL 4KVCL 2C3HA 3C60C 3ZKMC 5F8QC 3SY0B 1X5LA 4OZ4B 3SKJH 1J88A 2HRPL 3RI5K 3CIQA 5EFIB 3TGXA 3GIZL 5JW5B 3CLEL 4JG0L 4NQSA 5FO9B 3FFCB 4MXWH 3IGAA 5DMIL 4HK0A 3SE9L 1SJEA 3CD4A 5E6IC 4HK0B 3GRWL 4JE4B 2XG5A 3M1BB 3GNMH 4F7CB 4C56A 4Y8DC 3LN5A 3RL2A 2WANA 3OR7A 3WFCH 2I9LB 3BKJH 5DEFA 1CBVH 1UKQA 3SDCB 2AJYH 4GRMB 3GHEH 3ARGA 5DFVD 5FGRA 4ZUUA 2VLRB 2Y06L 1DL7H 3L7FB 3HZYA 4IOSD 3EIFA 2O5YL 4P3DB 4U0RC 4R6UA 4HPYH 3B9EA 1RUQH 3U2SB 1XH3B 3LN9A 4GKSB 3KXFA 3RHWK 1I1AA 1IGML 3WFBL 5LWYL 2BJML 4A6YH 1BZ7B 5GS0C 5HVHC 5J6HA 4UQ3A 4WJ5B 5CJOH 4IS6A 2Q6WB 3VG9C 3WFDH 4YHML 3VXRD 4X7DC 3VI4E 1WITA 4X80L 4WY7H 2IPTH 1HDMB 4I8DA 5E4IA 1BAFL 3BDXA 3GMRB 4LAQH 4IRSD 2O5ZH 2HT4C 3TIDB 2IF7A 3S5LG 4C55A 2DTSA 2M2DA 2IALA 4XWOD 3TA3D 1DN2A 4LCCC 2Y23A 3PV7A 1ZVSB 1RIUH 1F3DH 5JDSA 2YD7A 3RVVD 3T4AB 3GBNH 5F89B 5E08L 3BX7C 4J6RL 4JVWA 4NUGH 4RQQB 1AR1D 1E4XH 3CXDH 4E41D 4TSBL 4L8BB 3V5DA 4JN2A 2Z4QB 2ZUVA 3VA6A 3U0TB 2E8YA 3TH4T 3BO8B 5F8RC 5IB1B 3S96B 4GMTL 5F9OL 5EN2B 1MHHA 4NQEE 5JDJA 5J9PB 5C3TA 1BM3L 3QDJA 1QVOA 2B1HH 4IS6B 4V2CB 5IBLC 2VAAA 3VFRA 2XZCH 1Z9MA 3GK8L 1XGRA 3GKWL 3TT1L 1Q72H 1NCDL 2PYFB 4L3EB 4NKDA 5J6HB 1S7UB 4NKDB 3L3JA 4LEXH 1XR9B 3O2DH 2E9BA 1AQKH 5DMJB 3WHE1 1A9BA 5JORA 1B0RA 5F9AC 3SKUD 1HXMA 3ILPA 3VXOA 1KC5L 4EUPB 4QWWC 3O6KL 3FHQA 4X5WA 1KGCD 5DMKB 1A3LH 4XWOC 5C8JA 4HWZA 3NIFE 4NYLB 3IDMA 2VXVL 2FATL 2F9BT 4IOIA 5CZVL 5EOTB 2V2XB 4NQVB 5I1LB 2IPKB 3EBAA 2A73A 4F9PA 1JGLH 3MQIA 2UUDH 4JRYA 1QFOA 3MRBA 4MB5A 4RGOH 3HE6B 5I0DA 4APQC 1G9NH 3NTCL 3PQYD 5D7IE 4HKJA 2V9TA 3UTQB 1ZSDB 3HZKB 3QXDB 5FM4A 1DUZB 3FT3A 1BPVA 1CS6A 1ZS8A 3ULUL 4PJBE 1HILB 4NGHL 4NCC1 5BS0D 3QQNA 4I2XE 3GMRA 1ZEAL 1AXSA 2ITDB 3M17A 4GFTB 1MQKL 1MAMH 5E8EB 2VWEE 5EU6D 4K3EH 1S9VA 4JZJC 3TJHC 4IIQC 4KK6D 4RDQF 2R4RH 2JJTA 2ZG2A 2VABA 5EA0L 4PJAE 1T6VN 4KZDH 1BFSA 5GJSL 3NFSL 5C08D 3LSOA 1IT9H 2AXJA 3TLRA 4GMSH 2R4SL 5DRNB 2X1WL 1KFAH 2QSTA 5DD3L 4NHUB 3FFDB 5I1HH 1J1PH 3MRHB 5F7EL 4U7MA 4RAUB 3G5ZA 3O2WL 4P5KB 3ARRA 3MBED 1YEIH 4NO5B 4YHZH 3OR7B 3FFCD 2XNAB 5E8OA 5D7LE 4DOHB 3BPNB 4GRLD 2FR4B 3VJ6B 4HLJA 4AIZB 1T21A 4WO4C 1YEKH 4YBQD 3QH3B 4PLJD 5GZND 3FN0H 5E1HB 5CGYC 2GJZA 3ZDZF 5FCUH 4GBXB 2HT4D 1GGUA 4NRZB 3PDOA 4QNPF 1JYWA 4WWID 2WBJC 3EYUH 1CYGA 3K1DA 4MDIA 3D69B 5SWQB 5A16B 1YN6A 2R2CA 1ZK9A 3V0VA 2HFTA 1LNUA 1MCRA 3SDYH 4HUVB 5JO5B 5JPMB 1UM5L 5JNYA 4X6DF 4L3CB 1OTUC 2Q20A 3QIUB 5EBLB 1PDKA 4LLMB 3QUMB 4XWGL 3X14A 2RFXB 4HIXH 1WIOA 5C08A 3KPNB 5DGQA 3VI3F 2VABB 2MWCA 4CMMB 3DBXA 1XIWA 1R3JB 4JO2H 3QZWA 3TA3B 3NPSC 3DVNB 1XR8A 1MFDL 4ZS6D 2W07A 4WUUD 4NQVA 2VLJD 1G7HA 3LEXA 3QG6B 3LRSB 2Y7QB 4KKAC 1IRAY 3HUJA 1ZT4A 2FEDC 2XNAA 3G6JB 4PLJC 1O7SA 4FTVB 3OAZK 5LKNA 2A6DA 1YC7A 2DI9A 4EI5B 1LE5B 1I1FB 1OB1A 3B9KB 35C8L 3CLFL 3F58L 2ITDA 1Q9OB 1T1ZA 4WW2F 2VZ1A 5E8PB 1E4XL 3CXDL 2O5YH 1AKJB 4P5MB 3FZUC 4P9HH 3C8HA 1DDHB 1YY9C 3HC4H 4J3XA 1VFAA 1N5AA 4PGBA 3QEGH 3WFEH 3BIKA 3T2NH 3VRLE 5E1AA 1NFDE 3HE7B 4DCQB 2VJXA 1VGEH 4NHCL 1KCSL 3UZQA 3LVEA 5SX5K 1KJ3H 3BDYH 4KJQD 1EEZB 2IFFL 2QADB 5D2LB 4IRJC 3TT1H 5IQ7H 4YNYA 1BAFH 5KN5A 1TJGH 4LPVA 5SWSB 2FZ3B 3D2UA 3GDBA 4RFOH 1JIBA 4NM8H 1K8IB 4Q7DA 4AEHH 2XKNB 4OB5H 1OLZA 4UUJA 4OF7A 3DXAA 4AL8L 3V52L 1D6EA 4Y19E 5DURD 1CTOA 3KAAA 5F6HI 3ULVL 4Z76A 1KCRH 4JVPA 2BVOA 1VHPA 3H9SD 4GAYB 5FXCH 4NUGL 2X9YA 3T2QA 3ZE0F 4LSPH 3IB4A 1RUAH 1DCLA 2A0LD 2ZOLA 5EZOH 1WBZA 4DZ8B 1EZVX 3IVKB 5HYIA 4OCNC 2EH7H 4I77H 2YD3A 1UB5A 3MLWH 1MI5A 3S3PA 1OP3K 3VFPB 4DKEH 1RHFA 4BFBD 4E42A 5KS9E 4YDIL 1LK2A 12E8L 3NCCB 2AEWA 3T1WA 5HDQL 3IETB 1KXTB 3HRZA 4OV6F 1QRNE 1B6UA 2Q8BH 3VXUB 1QFPA 4XT1C 4NCC2 3HMWL 1VPOH 2BSTB 4WGVB 2I24N 4BA8A 1C7SA 4HF5L 3B8YA 2VLJA 3OPZH 1WZ1H 1J8KA 1SEQH 3MOBL 3QIBC 4OGAD 1MIMH 2LE9A 4KPHL 4NSKB 1ZT4B 3RA7L 5JIIA 1DQLH 3RL1B 3C2SA 4KZDL 2NYYD 1MY5A 4P4KC 1WK0A 3OKOB 3BZEA 4Z76B 2FX7L 4GBXD 5C09E 1N2RA 2ADFH 3OKMA 3VWKA 1AGEB 3PIQB 1T5XB 5HYQB 5ERWB 4MQTB 1YEIL 5C0RH 5DEGB 1HH6A 3F12B 4I1NB 1BREA 3ZKND 2D3VA 3LZFH 4ISVB 2ZCLH 1D9KB 4LCWB 5M7QA 2BOCA 1BF2A 2ZCKH 3B3IA 1OTSC 1DE4B 2D0GA 3MV9A 1Y6NR 1A1NA 3VDAA 4H25B 3P30H 4Z7UB 5C6PB 4OD2B 2GITB 1JI2A 2YWZA 1H3PH 3OF6D 3EYOB 1JNNH 4NQTA 5EU3B 3CK0H 2VDNL 4ZFZA 3HPLA 1CDJA 4R7DB 4UT7H 1I9IL 5IROA 1N7MH 3KPRA 4XCNB 2FDBP 3MLUL 4RRPA 3QR2A 4UB0L 3THML 1NL0H 4OKVA 1K2DB 1KLGA 1RUKH 4HX1A 3OGCA 1RU9L 3QG7L 4U33A 1JRHL 3HHRB 3ZSTA 2DYPB 4NQDD 4Z7WA 4PG9B 2R23A 5TF0A 4Y16A 1E4KA 4KV5F 5IHUL 1L6ZA 3UJIL 5I1AB 4KK8C 4YHZL 2PYEE 3OXSA 4YHYB 4MD4A 3TWCL 3QWQB 4BFIA 4JR9H 5C09D 3V0VB 3SN6N 1T7VA 3BEVB 4XI5C 2ZKHH 2Q7YA 3FB7A 3TBTB 1A1NB 2ZG1A 4ODUA 3P0YL 3GHBL 2P1YA 2DQEL 3WUWB 1I1YB 3QZWB 4XVJL 1BD2D 2DIJA 3TA3A 1JHKL 5F21B 5LGKA 3MA9L 1BECA 2NZIA 2EKSB 2YKLL 1WBXA 3FB6B 1G7MB 4APQB 4L5FH 3NFNB 4HW6A 4XPGH 3VXRE 3CH1B 1Y0LA 3QHZH 2R0KH 2IBZY 3HS0A 3L5XL 1T1YB 5HYJA 3IDJB 2J6EL 1UM4L 3GKZA 4OCXH 2BC4B 1R3KA 1MPAH 1CIUA 3QXTA 1ZWIA 2FJFA 4FS0A 3OQ3B 2YBRA 2F54D 1NKRA 1BX2A 1NDMA 1T3FA 4JRXE 1NGZA 4UTAL 5IW1A 3BWUC 1OGAA 1TZGL 1U3HC 3VXUE 3EO9H 3ARED 1QRNB 3MLYH 5T3ZL 5FHBL 2X1QA 4OLUH 1I1AD 4XNYL 2F74A 1IGFL 3EO0A 1KCVH 2B5IC 1MIEH 1N8ZB 2DDQH 4LQ1A 1FE8H 3CSGA 4NDMB 5JIPA 5A40E 3BGMA 1UVQA 3MA7A 3D3VD 4OLEA 3H8NA 5IFAL 2OR8A 2GSGB 3VCLB 1T03L 1TITA 3QEQA 1ZHNA 1N0XH 2VXTH 1PW3A 1KCRL 4JRYB 3BAEH 5D1ZA 2HKHL 3F7VA 1M05B 4NT6B 1FNSH 5L2JB 4TVPL 1I9JH 4MJ4A 3GBMH 3C60A 5HI3C 4LBEB 1Y18B 1EHLH 5BV7L 1I1CA 2YD5A 4P46D 4OM0L 4XMKH 3EW3B 3MLWL 4KRPD 1E6OH 2W0LA 3WFEL 5FYLL 2BNUB 4YDIH 5HGHB 2R0LH 1GPOL 4YXKH 4TNVF 3MV01 3GJFB 3TYGL 1HIMH 4KHTL 3KR3H 4J1UA 5EOCJ 1QSEA 3DX6A 5T1KD 1G6RA 1V7NL 4J23A 2QR0B 4FQIH 4JRXD 2R15A 1EEQA 3VFVB 2B0SH 2MHAA 3OPZL 5CUSH 1QBLH 2DQFA 4ZMAT 1F4XL 2WP3O 1MLCA 2MTPA 3Q1SH 2WM0A 2PW1B 3GMPA 1IEAA 5K9KB 5F88A 1CE1L 1G6VK 4NRXA 2AGJL 4JDTH 1S7TB 3OHXA 3JSSA 4UDUA 1PG7X 3GMNA 3HNSH 4FQLL 1HDMA 4R7NA 5FKAB 2K3TA 3T77A 2NY1D 2BXZA 5MENA 4XGZA 5ACLA 2VSCA 3O9WD 3QQ4A 4K55A 3OWEA 1CD1A 1UADC 3K74B 4GAFB 5AAMA 3RPKA 4GO6B 4KKCD 4FZEL 3BN9D 1DBML 2FECI 4PY7A 1KJVA 4H0IA 1B4RA 3C5ZB 4OV5B 5T3XD 4AYFA 5I1AA 1U95B 5F3BA 2YUWA 3NPZB 3NFPA 3ARUA 4P5TA 2LVEA 2P7TA 2YD1A 1I9IH 1XF4B 3QEHA 2JE8A 5EU4B 4H25A 4L3AA 4G43A 3K2UH 5JW3L 4AEIL 3GIZH 2Y5TA 3TPKA 5ALCL 1UWXH 1BZ7A 5KW9L 4HUXA 1CL7I 1YYML 3RAJH 1CD0A 3BE1L 2CDEB 2DBLL 2MKLC 4KRNA 4ORZC 2EDQA 1K8DA 1YY8A 3Q6FA 4ONHA 4G3YH 5GQBA 5B22A 1D6VH 5FYKU 4OT1H 5C07E 4OBRA 5FIEA 4JB9H 5T1MB 2QSVA 5CBAA 4WFEE 4B7IA 4NN5C 5I8KH 1KJMB 1FFQA 4N8CL 3V7AG 3OKNB 3PWPE 1U93A 2KDGA 1K2DA 1KLGB 3ZYOA 1U92B 3EFDH 1BGXL 1MJUL 2CRIA 5IJVB 1C1EH 2IAMC 4JM4H 3HN3A 3WLBA 3X3GL 1K4CA 2R29H 4YE4H 1JNNL 2BFVL 4JFHE 1WC7A 3UYRL 5CILH 1LE9A 3VH8G 2P7TB 4HQQH 1BWWA 1EBPA 3I2CL 3K4DA 2C3VA 3L5WA 4GUPA 3TIEB 3WJLA 5K9OB 5JW4R 5D1XB 5K9QG 1CFTB 2BP3A 4ZXBD 4MQXD 3WMSA 5DZOA 3EGSB 5CJQH 2VZOA 4K7PH 3BPOC 4PJAF 2KKQA 1F4YH 3CGTA 1RIUL 1CF8H 2DLEA 2PO6A 3GSXB 3ARBB 3UAJD 4KRPC 3DHMA 5E6YA 2NXZD 3VGAC 4DAGL 3BRGC 1E4WH 2JELH 3L3KA 5DJYB 4UNUA 3OKEA 5C0JB 4JR9L 4N1HB 1JGVH 3MACH 1J0KA 3AMKA 5CBAB 5EUOA 4N0RA 3Q48A 3I6KB 5I8OH 1BVLB 3CFJB 5C0AD 5D9SB 3UTSA 1NAKH 1JPSL 1EGJH 4F3FB 5INDA 5DLML 4BSJA 4I18B 2NLJA 1NBYA 1ZGLB 4WUUA 4PGDB 4ELMB 5EZJB 3MMEB 3RP1A 5I6XB 2YWYA 4KK9D 1ZGLP 3I3EA 2VXTL 2Y5TB 2XQYG 1QYGL 4NYLA 4WCYL 5T33L 4NKOB 1IQWL 3MFFA 2GW5A 5EOTA 3EOBB 1AQKL 5C9JA 3PQYB 1FIEA 5TE4H 1IKFH 3QRFM 5T1KB 3P73A 1N64L 4HT1H 4U6YA 3D2UB 2EEBA 2FZ3A 3V4VL 1AD9A 5HGGS 1AQDA 3DSNA 2W59A 2OXGA 5C0FB 4XAKD 5FYKH 4UQ3B 1GGIL 3VXMA 3F7YB 5CAYB 1FNFA 3BP5A 5D72H 3QWRD 1RZKC 4UTAH 1QR4A 2G5BA 2FLBT 3ZTNL 1V05A 4HWEH 5EU6B 1VFBA 3VFMA 2P5EE 2PYFA 3ARXA 5D1QC 1QFWM 3BISA 3WJJA 5ICZA 1FL3B 3Q6GL 1UEMA 2VL5B 3IFLH 5KZCB 1AHWC 4L8SA 2VITB 3T3MF 1BP3B 5C0NC 3ULVF 4GG6A 3MBEC 2HJFB 3KJ4B 1YEJL 4PJXE 3MRJA 4PJEB 1EO8L 3LKRA 3O45B 4K9EC 4GAJL 1NEUA 5D2NC 4NUJB 1UWEL 1HK6A 1SJEB 5J3HD 4HDIB 1MAML 1UCBL 3GSOA 3LKSB 4RQQA 5BRZE 3D0LB 4LSTH 1G1YA 1P69B 1RZGB 2MHAB 5DC0A 4JAMB 4ZUSB 4N68A 4AQOA 3KPQB 2ZSVB 2OZ4H 3KPQA 5IEHA 4ZAKC 5JW4N 1OAYH 2NXYB 5DD6B 4OF8A 5ESAB 4X9FA 2FX8L 3MV8A 4FTVA 2DOCA 4XBGA 3KPOA 3SJVB 4NJAH 4YFEA 3FQUB 1CLOL 4OZIA 4YDJA 1HN1A 3JUZA 4JY6A 2ED7A 3HPJA 3QCTH 3B43A 5D2NE 2Y07H 3UO1L 4R97C 5EO0B 1F3DJ 5I1KL 4LMQE 1T1ZB 3QO1A 5FO7B 5F3HA 1QPPA 4KZEH 4GG8A 1RZ8B 1C08A 2FHBA 3H42H 2RCSH 3GEWB 1NAML 5D1QD 1NBZA 5I9QB 1S9YA 2J8UB 3HI6H 4TVPD 4W6WB 5T1DL 1YPZA 2DTML 2X89A 5DI8B 2IH1B 3BZFB 4PY7B 4JLRB 1W72L 3VMOA 2VLRE 4F7PB 3MV9E 2RHEA 3ILQD 5I8EB 4Z7WF 1YYMH 2L0DA 3GI8L 3RAJL 4PY8J 5INCB 2P45B 4UT6H 1RZFH 2DBLH 3MLVH 25C8L 3X12A 5A43C 2AJSH 2H32B 2YMXL 3I9GL 3TBSA 3CUPB 1AGDB 1AHWA 3EYQD 4PJXF 2NW3A 5DHYA 4FQLH 1MFBH 4QHKJ 4OD3H 1OAXH 3QPXH 2PYEB 1F8TH 3DVNA 1AP2A 3MLRL 3WJJC 1M7IB 3O6LL 5ID0A 4R3SB 1FDLH 3HE7C 5GGTA 3ETBF 5IVXF 1A4KB 2PF6A 4OKVB 1I7ZA 3T0AA 3O2VL 5D1XD 1T2QH 1QO3A 2NY0C 3OG6B 4HPOH 3MYJA 1JMZA 4FZEH 1A9EB 1T83A 5GSRB 1BGXH 1MJUH 3E3QC 4DKDC 1OF2A 3DROB 3GJEB 1G7JA 4LSSL 1MRDH 3IU3B 4DZBA 5D8JH 2XRAL 3QWRA 4NO2A 2CDEA 4UIKL 4NC1E 4OQ1A 4M02A 3GSQA 4MDJB 1A6UL 4P4RB 5HHOD 1RIVH 1TETL 2C1OA 4N90E 1YY8B 4EKXA 3UX9B 3BH8B 3QUZD 5D7JD 5DK0A 3QULB 4PUBL 3TYFA 3BZFA 5F3HB 3TCXA 4L4VE 1ZHKB 2A74A 1JL8A 4P3CH 4O58H 1CGVA 4PJDF 1HHIB 3H3BC 1AXIB 4L8DA 4POZD 5BRZB 3RWDB 1CCZA 2DKMA 3O4LB 2XTLA 5DUPL 1UT9A 1MHPH 5T5FH 4PJ9B 1E4WL 1BJ8A 1C5DB 5SWSD 5DD0L 5IEKB 1RHHA 3PHQA 4O00A 4JZJB 5FUOL 3AUVA 3CDYA 4ZNCD 2ZSVA 1JN6B 4CGTA 2V9RA 1F11A 5IBUB 1CTNA 3QEGL 3NCJH 3UTTD 3CX2A 4Y5VA 5GS2H 5I9QC 4JO4H 4S1QL 3UTSE 2CR6A 4FFYL 4OTXH 5CEYB 5JHDA 5A2KH 3BUYA 2LFGA 1E27B 3SGKA 3VFNB 4X99B 2C1PA 1PZ5A 5DJ6A 1HYSC 1X5ZA 2K1MA 4GQ9H 3IKKA 5CMAA 4DEPC 3F5WB 5GS1C 1INDH 4NO0D 4XPAL 3IDYC 3VFPA 2VXUH 1CU4H 4JQIH 2OS7A 2ZWLT 3QXAA 4UMGA 5I18H 4ODWA 3A6BL 4Q6IB 2KUTA 1S3KH 3QUZA 4Z7NF 4HT1L 3RTQD 2NY7H 1I3VA 4TNWK 2Q3ZA 4O9HL 4D94A 4W6YB 43C9A 1JHTB 5KSBB 5E9DB 3PGDB 5EU5A 4TSCH 3JZ7A 4G9FB 2CK0L 4LLWB 2BX5A 1O0VA 5DJCB 4EUPA 3PNWA 4P9HL 1NGXB 2OJZH 4QOKD 5C2BH 2GAZB 3REVB 2APVA 2D03H 5BS0A 4NNXB 5DD6A 5JXEC 3RWGA 2DM7A 4O4YL 4MJ2A 4QXGL 4HWBA 4LGRB 4LBEA 1C8PA 3ZE1F 4P99A 5BMFH 1HINH 1QBMH 3VGGA 2BY2A 2XT1B 3ZTJG 2NY5C 1VCAA 5EBWA 4F7EA 1RI8A 4YX2L 4J3WA 4EN3A 4EDXA 2HN7A 4LCWD 4I3RL 3BVNA 1QBBA 3KPPB 1ZT1A 1LDPL 1MLBA 2R0ZL 4WW2A 5J57B 2J7LA 3K7UA 4N0UA 1WIPA 3JV4B 5DFTA 4CKVX 4HGWA 5GZOD 3BD5A 1C5CH 1RJLB 1GC1H 1Q9OA 4N8VB 3RWCB 3SO3B 4DKFL 5HTSA 4N8VA 3RWCA 4C83B 3P40A 3QUMH 2NY0D 1C12A 1DBKH 1BWMA 1KLUB 1DLHA 1JZ2A 1MCFA 1IEBB 5IB4A 3IDXL 1S7WB 1VSCA 4KJQC 1MAKA 3VG9B 1FNEA 1F4AA 5EB9A 5DO2C 3O9WA 2CKBL 5BVJB 3QFDB 2HLAB 3GSWA 4ZTPH 2ARJB 1IAII 5FKPA 2A6DB 4YHIB 3QG6A 3PF2A 3N9GH 1U58B 5J89A 5I1IH 3VXSD 5LG1A 2EDYA 3AREA 4UV4H 1A7NL 4CAGA 4AEFA 2NY4B 5EIIB 5J7CC 4W4NA 4NZTL 3GI8H 3VFTA 5CLWA 4M1GL 25C8H 1C16B 3B9VA 5E00B 4PRHD 1ZKAA 1DQDH 4CNIB 4TUJB 4ODUB 1CLYH 1H3XA 4HIHA 3MJ9H 1KTLB 3P4MB 1DP0A 4YHLL 4PYGA 2VZSA 5ECJE 4A6YA 3BEWB 5C70A 3QUMA 2IALB 1FG9C 3QUZB 1EERB 2JIXD 5AG9A 2EDKA 5DWUL 4F80A 3UROR 1WAAA 3S97C 2X5PA 3MODL 5FDWA 5HHQB 3HNTH 4IMLA 3OKYA 4O2FB 2VXQH 1CGTA 1IGCH 2DLTA 4ZQKB 2NX5B 5JOFB 4KZEL 3F7QA 5GIRA 3CFKB 4DUXA 4M00A 4P2OB 5D1ZC 5FGBC 2E27H 1CVRA 2F5AH 3B8SA 1NGWA 4LLVB 3DO7B 5DJAA 3WDJA 4OJFH 2CDGB 2HTLD 4RNRB 5ITFA 4LLAA 5T1LD 3GJFH 2DQJL 4M48H 4LGSB 1A4KA 1EBAA 4MB3A 4O58L 4P23A 5MERA 4EXPX 3SQBA 5T1LA 1J0HA 1VEOA 5MEOB 3BKYH 1WTLA 4HUKB 3T3PE 2D0FA 1QHOA 3TO4C 2AK4E 1SVZA 3LPWA 1KTLA 3P4MA 4KKCC 1N6UA 1OAZH 2HFGH 2L7UA 2IBGA 2HH0L 5HGAB 4I4WB 1NGQH 2ADJB 3U9UA 3R0MA 1F58H 3LSOB 1MJJA 1IEHA 1K5NA 5DK0B 2E6QA 3TBYA 1SY6A 2VZTA 4JM2B 1A6TA 4WUUE 3GSNA 1DEEA 1A2YA 3KPSA 1HHJB 4IMLB 2OMNA 3MLXL 5JOEA 1ADQH 4YHMH 4X83A 5FOBA 1QKZL 3STLB 2VDRL 4LASH 3DX7A 5I76A 1YDPA 1IGFH 2J5LC 4Y5YC 3BWAA 2ATPB 4P46B 5TF1L 5HHXL 1U58A 1RD6A 4QHMA 4MDIB 3SE9H 1BFVH 4JPVL 1ZSDA 3WYRA 3ZYJA 5GZOC 1KUMA 4QF1B 3GNML 1N3NA 3T09A 2ADIB 3SOBL 4ELMF 2AI0H 4O9HH 2GI7A 4JO1L 4XTRC 3P9LA 4LLUB 2YUZA 3QPQC 4UUJB 3ISWA 5B4MC 1WFNA 4TVPE 2VLMD 4K3DL 5B39B 5IBLD 1T04B 1YQVH 4L3ED 4LHUB 1HXMB 4IDJH 4M3KB 1V3MA 4TUKL 5LWYH 2UWEB 5LBSH 4QXTB 2IMMA 2CIKB 1E4KC 1KB5H 1FRGL 1EV2E 1MI5B 1BVKB 3CDFA 1A7OL 1W2KT 1BVKA 1P7KA 5F71A 2ADGA 3CNKA 1ERNA 1HINL 2X4TB 4LIQH 1KV3A 2VZUA 5M95B 3W39A 2XPGA 4H20H 4M7LL 5CCKL 1F45A 2WUBL 1G7HB 5D71L 2VDMH 4CU7A 1FG2A 4X6CA 4LLWA 4XBGB 3DMMA 1FH5H 2ZP0T 3IFOB 3VWJD 3T0EA 2O5XL 3MUHL 5EPMB 3MREB 4ZNEE 2X4RA 1QHPA 1NGPL 2BHUA 3DI3B 1IM9B 4HUUA 4GSDH 1C5CL 3VW3L 3M45A 3JBG7 3NIDE 4YR6B 1SYVB 4JQXA 3C08H 1G7IA 1HYRC 3F7RA 2MOVA 3ZE2F 2RB8A 4XZUB 4CADA 1UYWH 4CADB 1S7SA 2AXFA 2C7UB 3ORJA 2FJFB 4KKLD 4XCFL 3QNXB 3OAUL 3QNXA 1NCBL 4XAKE 3GSOB 1I7RA 1SM3H 3V0AC 4Q0XL 4NN7B 5C9KA 1GZQB 2CKBH 2ZUQC 1ONQA 3VXMD 5C2BL 2FHCA 4QEGA 3ZKXB 3V6ZB 1LO5B 4H1LB 4S2SB 3ET9F 5GRUH 1NCUA 4JDZA 3U30C 4NRYB 3WFHB 1LEGB 1P6FA 1QPXA 3EYFA 5E2TH 2QHRL 2Q87A 2GY7B 3M8OH 3CCHA 1QQDA 4TPRH 2D7MA 5C0JA 5DR5L 1T21B 4NQCE 3RGVB 3T2OA 3U4EB 1M05A 4NT6A 3VCLA 1OARL 5HVHB 1MCIA 3MJ9A 4QTHA 4LDEB 1U8IA 2CLRA 2I25N 2X4TA 3NA9L 3NIGE 1R3HA 1A7RL 4PJXA 4AMKL 4L9LA 1DN0B 3FQTB 4U1JA 3I50H 2BC4A 5FOJA 1B3JA 2G9HB 3QDGB 5J9PA 1KT2B 4WO4D 3QUXB 2F58L 4LL9A 4OCWH 2A6KB 5CEXB 4Z18A 5DSCA 1T04A 5T1LB 1NQBA 4N0FA 5KSBE 4OT1L 2F74B 4JJ5A 3U79A 4HGMA 1KEMH 3F62A 1FZOA 3PJSB 1D7FA 5HGDA 4NZDA 4Z7UE 3GI9L 2A74B 3BJLA 4ZFFA 5I2IB 1EXUB 1NC2A 4ZFOL 1CXEA 3RKPA 3MV7D 5LJYH 4TTDD 5J3HC 2QEJA 5ANMB 4RWHA 1JPGA 1Q1JL 1NJ9A 2NXZB 3DVFA 4O2FA 1BD2E 1YNLL 3N85H 4YAQA 3MYJB 5C0BE 4PJ7E 4U1MA 4OD2A 4BQ8A 3FB5B 4U6HB 2BNRB 5J13B 5JW3H 5C0AB 2R4RL 3ARGD 4I0PA 5HYSB 4IRJA 5CEZL 1I1YA 4RISL 4GRWH 2IQAA 1KB9K 2VLKB 1JRHI 5C0AE 4M7KH 1CL7H 4QRRE 2ZZUT 2X9XA 3ZKXC 4U1IA 5SWZE 1F97A 4KWUA 1QTYT 5HHPB 4F58L 4QXUL 5TDNB 3PE9A 4GH7B 3MRCA 3MNVA 1DQTA 3V4UL 1L6XA 2CRZA 4P23B 3Q2CA 1EJOH 5HYQA 3IJYB 4KMTL 3W2DL 2Q3AA 3WUZA 2E27L 1TVBB 2F5AL 4QKXB 2ORBH 3MXVL 1RK1A 4LQFH 4M4RA 3ZLQC 1BQHB 5JHDD 3DETC 3VE0A 4IHOB 3JWDC 4LF3B 4JY6B 4U4BA 4ZO9A 2V2XA 4R2GC 4PJGB 4OI8A 5CGYD 3TBWA 5FKAA 5IMLA 4HS6A 3HE7D 1Z9LA 3C60D 4XCYA 5LGHH 4I0PB 3ZKMD 2CO6B 3SDXF 2VITA 2HFGL 3UTQA 2DS4A 2P24A 3PL6B 4NZUL 3HB3D 3QI9B 3UTZB 3O11B 3P4OB 1N6QH 2JK5B 3FT4A 4R96A 2YN5A 4NSKA 3WS6A 5CD5C 4DAGH 2AXGA 5SWSE 4YXHH 1INEL 4OFPA 4O5LH 3UCRA 4CMHC 1L7TH 2A9ML 3VRJA 3MRGB 1QZ1A 1CD9B 2HA1A 1XF4A 5BW7C 5DS8B 5ICXA 1X4ZA 2OQJA 5FM5M 4L4TA 4ZAKD 2WQ8A 3PIQA 4OF3A 4K71B 4OGXH 3B2UD 2PYEA 3GSVA 3H9SB 1DQML 1PFCA 1TXKA 1R5VA 5DLMH 4YIQA 4XP4L 2GCYA 3UXFA 1LP9F 2FYYB 4AY0A 1MUJB 5K9QI 2FGWH 4Y1AD 1I8MA 4WTWA 4LKCA 4JO3L 4H1LH 1AO7A 5F96L 2WBJA 4YFLI 3E8UL 5EZLB 5AYUL 3B2VH 3FONA 1S7WA 2CKBB 1GRWA 1RSFA 3UTTA 1XF5B 2IG2H 1XCQA 3A6CH 4LSTL 2AP2A 4A2LA 5TE4L 1QQDB 1BFOB 2AEPL 2V17H 5DMGD 2YA0A 3MV8E 4OQTL 4J4PD 4BZ1H 5CGMA 4JFEE 4UINL 3TO4B 2F53E 4LARH 1WF5A 3MRPA 4WW2B 5LBSL 5E95B 4KXZI 2BVEA 2YZ1A 1JBJA 2GK0B 4L9LC 1NAMA 3FO1B 2XA3A 3QIBD 4ZUVA 2P8MB 1AC0A 1M6OB 5E5MB 1U91A 4JGUA 4L4TB 2HVJA 2RAMA 2V5SA 1T3FB 3DUSB 1G84A 1BIIA 4PD4J 4BQCA 5EBGA 2NYYC 4WO4B 2ERJC 3O3EA 5MP6H 1TJGL 3PWUA 2IWGA 3BP6B 4OCLC 4E41E 1JPST 3QQ9D 4NQCD 1CDHA 4JZJA 4P2QD 1FO0H 5DR5H 3TBVB 1K4DB 2VQ1B 3HUJF 2K7PA 4P2RA 2OL3H 4GG6E 3QDJD 2EDXA 5DUBA 2VLRA 3KYKH 4JGMA 3FRPA 3O8XB 3PQYA 3PGCA 4R9HA 3VXTA 1DBAL 1R3JA 3X13A 1U8JA 1EFXA 1AR2A 4GW1B 5C7XH 1RJYB 2G75A 3O0RL 1G7MA 4APQA 4XCFH 4E9LA 3HAEH 3E2HC 3SBWC 4KQ3L 3RBSA 4ZG1A 4R96B 4ZODA 3O6ML 1DBJL 2D7NA 3WO3B 2I60H 2Q6WA 5KN5B 4I5BB 4F9PC 1MWAA 4RMRA 5HHOE 5ADOH 4DVBB 2P24B 4OZGF 3O2VH 4ODXA 1PYWB 3Q3GB 5IB5B 4M61A 5FYJH 2FH6A 3Q6FB 2JK5A 3H3KA 2XWJB 1AY1L 4K9EL 2V5YA 1DUYA 3SE3A 3DMMC 4MVBD 1ZANH 4MCZA 2VLKD 4JY5L 4RFNC 5T5NG 3SE8H 5DVKA 3TM6A 3MYZA 4YZFF 4UIKH 1ACYL 2QTEA 1U2CA 5JUEL 1GYAA 1WAAE 4TUOB 4YEFA 2Y1VA 4K7FB 3TPUB 2W9DL 5HGDB 4MA1B 4UB0H 4PYHA 1OPGH 4G8IB 4LPCA 2UY6A 2XA8L 5EULV 4HKZB 3MNZA 1MFEH 5TE7L 1QBAA 4OZHE 2YUXA 4V1DE 3RX8A 3SDXB 2AK4B 2UWEE 5DMIH 1YYLH 3WIHL 5HYSG 1ITBB 1ZT7B 4JKWA 3U46B 1PG7L 4RAVA 3WFCL 1R3LA 3QFJE 4KJYB 4PJGF 4U1MB 3G6DL 3NABH 3C5SA 3PWPA 2BZDA 2E7MA 4TOYL 1F8TL 3DX7B 2VDPL 5MHSD 3LY6A 1U9KA 4LVOB 4NO0B 4ODHL 3FOLB 2GYSA 2ERJB 3K4AA 3LB6D 1V3LA 1YZZA 3X11A 5C08E 2GJ6A 3MXVH 5E4EC 1VFOA 2GJ6B 2CLZA 1IM3B 3DV4A 1U95A 5F3BB 2K7QA 4KKBD 4P9ML 5I1EH 4C57C 1QRKA 2ITCA 5E9DD 5J4MA 1G0DA 1JHKH 2ADJA 3EJZD 4LCCA 1S5IL 3QI9D 4GRLA 3CFEA 4PP2B 4FMKA 5ERWA 4PJCF 4BZ2H 2BNQB 4XP5H 5HXMA 1IAIL 2H6PA 1INDL 3FFDA 3N1GC 4R4ND 4JAMA 3IDUA 1NC4B 1LE9B 5F7KC 1WAAF 5DT1L 3O6FD 2CO7B 4GQPH 1QA9A 1MCKA 4XCCL 5E94B 5IT2H 1EX0A 1HHGA 3GB7B 4D0DB 2Y6SD 2C4FU 2OP4L 1CDBA 4JKMA 3UJIH 4J6RH 4MA7L 4RFEA 1I1AC 5F88B 1EFXD 4M8VA 3V6FB 4NFDA 2A9MH 1RPQA 3GM8A 3KYAA 4I13B 4R4FH 2ICEA 3QHFL 2CK0H 3OHXB 2VL4A 4QHNA 2RGSA 4FNLL 2HTLC 3OXRB 4NQEB 3FO2A 4MMZC 1A6ZB 1UWGH 2P42B 3GHBH 4FFYH 1EH9A 1PYWA 3Q3GA 4MLIA 5IB5A 3OZ9L 2XKUA 4NJ9H 4BYHA 3G04A 5E6IA 5C1MB 3GK8H 3EOAA 1FN4B 2IBZX 4M43L 1MCCA 5C0IA 2DLIA 2WWKT 2IH3B 5ACMA 2NY6C 4LCUA 3RVXC 3EFFB 1AJ7H 4XX1E 1D9KA 4XPAH 3UTSD 1CU4L 3W0WD 1JGDA 2WUCH 2DLFL 2R0ZH 1JGDB 3ROOB 3T0ED 2J6EH 3VFUB 3MO1A 4OCXL 3BKCH 1K4DA 1DTUA 2MSPA 4TVPH 3U36B 2PETA 1WICA 2JJSC 3U36A 3ZE2E 3REVA 1RUQL 1R5VB 2OL3B 4JDZB 4UINH 3CMGA 5T3XH 3GBNL 4HMDA 4Y0GA 2ARJA 3F6IA 3D39D 4R26H 3MV8B 2BXYA 2IAND 1HILA 3DYMA 1NC2D 4F8QA 3H7BA 3UDWC 1N59B 2HG5B 3ARZA 3WIHA 1T5WB 4X9BA 3S35X 3QJFB 4BUGA 5GGSY 3RU8H 3T1FB 1EAPB 3BPCB 1SYVA 4ALAL 5DD1H 5K9JL 4JPKL 1Q9LB 4OLXL 4KDTC 4Z7QE 5HI5C 3BI9X 3NTCH 4FQHB 4Z95H 2HMIC 1S7SB 1QVOB 1K9TA 5MP6L 1ZGLA 4YUEH 2O5ZL 4X6DB 1Z6JT 4FQ2H 2Z8RA 1BM3H 5IFHL 3ULUH 2VIRB 3AREC 2YD9A 4NQEA 1A7NH 1K85A 1QG3A 4X5WB 3BUTA 4OIIL 3S7GA 2IH3A 2BSSB 5FECA 4NQXB 4MJIA 5E08H 1KN2H 2H9GB 2HKHH 1BBDH 2YEZA 5E6IB 5KJRH 2CGRL 1HI6A 3HI5H 2V17L 5BJTB 5E94A 5IEKA 4M1DH 4FXKB 2GAZA 4OM0H 4LSVH 4D3CH 4G6JL 1FYTE 2VAAB 2Y7QA 4P9HC 3H0TA 1NGXA 5F9OH 2WIIA 1WBXB 4YXKL 3MV7A 1PAMA 2P47B 4PJCE 3S96A 3MTRA 2KZ1B 4JRYE 4PBVC 2XZCL 3HNTL 3GIVA 3PP4H 4HS3A 5DJ0A 1Q72L 4EN3C 2IQAB 4L29B 2H2SC 2V2WA 3KJ6L 2PNDA 1KJMA 2W92A 1F4XH 2D31B 4YWGL 5JNYB 3Q1SL 1FZMB 4NQSB 3GZKA 3DECA 3QDMA 5GGVY 3QULA 5I73C 3NGBB 1S7XA 3HKFA 1KC5H 1S7XB 2Q7YB 4KKLC 4X6FB 1ORSB 3GSRB 4JKKA 3V8CA 2UZIH 3O4LE 4Y4FD 4KFZC 1M4KA 2BDNH 3JTTA 1FFRA 1S8DB 4RZCA 5JR1H 5TQ2L 4WWKB 3N1PC 4OCMC 4U1HB 4TVSa 4G8IA 1U8NB 2IAMD 4XMLH 3MGOA 3VRIB 4I48A 2EE9A 3QA3A 1JUFA 5IVOA 3T2PA 1OTUD 3TPUA 1N6VA 3WIFB 2Z31A 4KTDH 5ISZE 2VYRE 4GKSA 3RWIB 1AHWB 2NW3B 4QF1A 4PTUA 3CVIH 3U0PA 2PO6B 4HJJH 5F1NB 4FQXA 5CJ8A 1K6QH 1Z5LB 1AP2B 3BRDA 3QH3A 2VXQL 4QRRA 4ZXBC 5B4MD 4Y4KA 4JM2F 4NFBA 4U1IB 2YPKB 5JIHA 4PS4H 3RL1A 2VERN 2ICWJ 1AKJD 4M3JA 1YECL 1FYTB 3UC0L 4X8JA 3SDAD 3MNWA 4KKAD 3X11B 1T0PB 3MR9B 2XA8H 3MRDB 4OFDA 1C08B 3EYUL 3GSUA 4N1CA 2EIZA 3FOLA 1J8HA 1BFVL 1PLGH 4JPVH 3X14B 2EIZB 4C56B 1T7YA 3VG0H 4G42B 4KRLB 3MC0A 1DQQB 5IGXH 3HFML 5GISH 3CAFA 4KH2A 3L9RA 4BSVB 3ARFA 2FH8A 1OM3H 1KPUB 4ENED 1A1MB 3CXHK 4QOKA 3RDTB 3S9DB 4ODHH 1EPFA 1YQVL 3ECBB 3OV6A 3QDGE 2GFBB 4NBYB 3ROLB 1YEHL 4HFWB 4QYOB 3P4NA 5L0QB 1AR1C 4UU9A 3W0WB 4Q9QH 2ED8A 5ITFB 5SWZA 1WV7T 2R23B 4MA8L 3KG5A 1S7RA 1KJ3L 3RVTC 2MKWA 4U3XA 3D2UD 4WFHE 5I73B 2OJEB 2A6KA 1IM9A 4HUUB 1PZUB 1JCKA 1M1SA 2PTTB 4M43H 1MCWM 1T1XB 2JB5H 3GIVB 5DJDA 2BERA 5IVNA 4HMCA 4K7PX 1GH7A 3C6SA 1WBZB 4DZ8A 1ORSA 4HS8H 1T22B 2YPKA 3ILPB 1CDUA 2D7QA 3NZ8A 1T83C 5E2WL 3V52H 4RBPK 5F7YC 1IVLA 5KZCD 5KVFH 1MFAL 2W65B 4PBWD 1U8PB 1V5JA 3ULVH 1INQB 3S34L 2HFFA 3BEWA 4JLRA 5EORL 3HE7A 3SGJA 1MCBA 3WSQH 1T6WA 1C12B 1DSFH 3JWDH 4ODTH 3ALWA 3MACL 2J88L 1QSFA 3TNMB 3RU8L 3LS4H 4X6BA 1IC5L 1ZHBB 3GUTA 4GLRH 2EDLA 4OLXH 2DQCH 2UZYB 3AAZB 1HHKA 3FL7A 3LRGA 2FWOA 12E8H 3NH7L 3O8XA 3VXTB 2E7BA 4RWYH 1A7QH 4H8WL 3SDCD 2DD8L 3QDGD 3O4OC 4AQ1B 3QUXD 4K8RD 4Q9RL 4S1RL 4P5TD 5SWSA 4FFZH 1IJ9A 5BCAA 1UWEH 1E0OB 2E9JA 1Q9LA 1MELA 3LHPH 1SEQL 1UWXK 2VC2H 5E4EB 4O2EA 1KN2L 1S9WB 3HCVB 4L29A 4Q6IA 3S6CA 1UXSA 3E6HB 3T0WA 5IIEB 2FLRT 3IAPA 1EMTH 4PRID 4HWZB 5GGQL 4PJHB 5L2KB 3HC3L 1U8OB 1B0GB 4MZ2A 4IHOA 4G42A 5GHWH 3VFSA 3L3OA 1A02N 4NKIL 4ZFGL 2PCPA 3AMLA 5EZOL 5IMLB 4HWEL 4MNQD 2ZUTA 5F9WC 1KCSH 1ZA3B 2EDWA 1UA6H 4J3TA 3WUWA 1QSFB 1BLNA 2W0FB 1KEML 3L3HB 1MF2H 1YQ2A 1OT1A 4M1CC 5D2NA 2QQLH 1PKQE 3WXVL 3P73B 3S35L 4F8TA 2YS4A 5FK9B 1GL4B 4NNXA 3NZHH 5KSBF 2O61B 3P9LB 4LLUA 2Q8AL 4OIIH 4JN1L 5BOPA 5MERB 2ZSWA 1I8LA 5DVNA 4HV8B 4YDKL 2H26A 2CD0A 4TRPL 4POUB 3BZ4A 1JWMA 1A8JH 3B9KC 4QRPD 4XMLL 3DARA 4ZDHA 4LHQB 4LVEA 4FHBD 1Z0MA 1WCBA 2QQQA 2R2HA 1X9QA 5HSFA 3GGWA 5ADPL 4PGDA 1O7VA 3KXFD 5IK3B 1SBBA 4APQD 4V1DA 4WFFE 3EYOA 4HLZH 4W4OC 5IQ9A 3V4UH 3CVHL 3ULUC 4PJAA 1IL1A 1S7VA 3GSNB 1H8NA 5FB8B 6FABL 1YNKL 4Z7UA 1KPUA 3ARBA 5CLTA 3U9UB 2IPUG 2NY1C 4DVRL 5EC2B 1MJJB 3QCUH 1IKNC 4GXVL 1QFUL 3QIWA 1AE6L 1TQBB 4X6EB 1NPUA 4NO0A 3TEUA 4JG0H 2PUQT 3D87B 1U8QB 1N2RB 1T80A 4HSQA 1TLKA 4Z77B 4HH8A 3MJ6A 3KPMA 1RZFL 1IC4H 5DEGA 3AREB 5GRXG 4NOBA 1CLZH 2YPLE 3BZEB 2R0KL 4KAQH 2FEEL 4OD3L 2V5RA 3JUYA 3BP6A 3PWUB 4LRIA 1LDSA 4PG9A 1MRCL 3QO0B 3FQNB 1QNZL 2VDLL 4JPIB 2VLME 3DSFL 2BSRB 1T2JA 3D3VB 3EYQC 2A77L 3P0VH 4P59L 4LDOB 1CDGA 4QRPE 1IC7L 3ELAT 4OZHB 1A64A 3HTLX 4U3HA 1H9VA 4YPJA 1TZGH 1EHXA 3QUXC 1OAUL 3C6LB 3X12B 1K8DB 4KV5E 4J4PC 2YOCA 4M5ZL 2WK2A 2ATKB 2XQBL 4OLUL 4ONHB 4RX4D 1DQMH 2IPTL 5EUOE 1P4IL 4PB0H 2HRPH 4F57H 2YRPA 4S11A 1Q94A 3NACH 1JNLH 4NC1C 5ESAA 4KROB 5I1JH 4P0DA 3FT3B 1DUZA 2CLVA 5GRZA 3P0GB 3DX9A 4Z7WE 2JLLA 4M61B 4P3CL 4YGVA 1RZ7H 1XIWD 1SJVA 1JRHH 4WHTA 1UC6A 4KQ4L 2CDFB 4HUWA 5GRVK 3ZT7A 1SY6L 5J56B 3ZT5A 1HSAB 3HUJE 5JQ6H 4PJDA 4ZPVB 2AJYL 5GS2D 4ZO6A 2E7LC 4MX7B 3TVMC 3ULVC 4MNGB 2XN9B 2AKRA 5HY9B 3IJSB 1P1ZB 3BRFA 3QUYB 5I30L 3LS4L 5KBNC 4NKMA 3JWOL 3RZCC 5C0DB 4MHHG 3SDDD 2DQCL 3F7PC 3HZMB 4LKXA 1B2WL 2Z92A 3IKCA 5BV7C 4F7PA 4GMTH 1D5IH 4WDIB 1TTFA 4MD0B 3EO9L 1DLHB 3KPRD 1CZ8L 1FVCA 4OGXL 1MJ7H 1CR9L 2EDOA 1QBML 4R2GD 1P7QA 4R4NC 4L1DA 5BJTA 1L0XA 4ZD3L 1OP5K 4TQEH 5HHNB 1H5BC 1MIEL 3TZVD 3KYMA 4RMWA 1VERA 3INUH 1CG9B 4F15B 3MOAL 2CIIA 4PV9A 4HBCH 4XCEB 1P53A 5IFAH 43CAA 3L3KB 4FQHA 5D7IB 3P11L 2VUYA 4UNVA 3BO8A 2OYPA 3EUUA 2R69L 3LQZA 4XAWL 4MD5B 3LN4A 3DYOA 1TQCB 3FZUD 4MA3A 3K8LA 1ZVYA 3EZ8A 3QUML 1RULL 4DKAA 2YBRB 4JM2C 4G9FE 4N8VG 4O2EB 1FP5A 1WGOA 3KLHD 1BIIB 3ULUD 1ULVA 1LE5A 1LWRA 1ETZA 2J88H 5IW1B 4OZGB 3B2UC 1UA6L 2QR0A 5SV3A 2DKUA 4RGOL 2PXYC 3BD3A 1F4WL 1ACZA 3GJFA 4MX7A 2V6HA 5E2JA 3ZKNC 5B39A 1F3JB 2X4NB 1E28A 4NM4H 1CDCA 3IJSA 4LDLB 4M93C 3DTXB 4P49A 4OZIF 2BMKA 4YC2C 4QT5A 1MQKH 1NEZB 1KCLA 5AZEH 1ITCA 4JHWL 3BT2H 4G8GD 4K3EL 1G7PA 3BXNA 1RZJC 4Z7VA 4MWFA 1Q8MA 3QHTC 4CRPA 1TJHH 4HUWB 2CDFA 2CJUH 1G7QA 2YD6A 3IS0X 2NY2C 4QRQA 1YDPB 5DHVH 1TCMA 2Z91B 1GOHA 3QUYC 3KPLB 3GO1H 3MV11 4DGIL 5DMYA 1JNHA 1WCQA 2RJMA 4LLYA 5HGBA 2DMCA 4PJ7B 43CAB 2R0LL 5BS0E 2A83A 3WHXB 3H9SA 2SEBB 3DWTA 1DFBL 4FQXD 3PWVA 3H3PL 1WEJL 1WC7B 5MENE 1U6AL 2DWDB 1D5MB 1HKLL 3VFGH 4UQ2A 4DQOH 3DURA 2YD2A 3DXAD 2VQTA 1RVFH 1G6RH 2OX5A 5CHNA 1BD2A 3RX7A 3PXJA 3EFDL 4JFFB 4NWUH 1QBLL 1VENA 4EDWH 4JPIA 2F53D 1NGZB 1FPTH 1M7DB 4ZFZB 3D18A 1J05B 4WDIA 4Q6YA 2AEQH 5GGVH 3LMJH 5DUMH 4JJHA 3G9VA 5LQBL 4ORGA 4BQ9A 3CXHJ 1TQCC 4LAJH 3S98A 4NO5A 4HS6B 4XGZB 3OKEB 3S88H 1U3HA 1X5FA 3C6LD 1A2YB 3KPSB 5EOCH 3AXLA 5GRWA 4PGEB 5ESVA 5AD0A 5CBEB 5CKGA 2BY0A 1PG7H 1QFWI 2BNRA 3D9AL 2APBA 3G6DH 3UPCA 2OP4H 4O2CA 4X5XB 2B4CL 5BOZG 4P59H 1HEZA 1MAJA 4QHUA 5DWUH 3P9MA 4JB9L 5KSAA 4S0SD 2UZXB 4Z7OF 3BEVA 3L9RB 4GUPB 3WS3B 3D85D 1J12A 1MCDA 3RI5F 2H3NA 5HHVL 1G6RB 5GSVB 4HKZA 1JPTL 2X41A 1UKTA 2IPKA 4LCWE 4QRUB 3WNKA 5D7IF 5HHXH 1S5IH 5DHYB 4QT5B 3MRBB 4XP9H 3EDEA 4Y4KD 2QBWA 3UBXI 4KQ4H 4XVTL 2NY5L 4QHLA 3C5ZC 3SDAA 3T0XA 3HZVA 3OJMB 4HJGB 4KK9C 5D7JA 4ETYA 1A6PA 2KQMA 2VDOL 1P4BL 3DLQR 3LS5L 2WUCL 3VWKD 3GMOB 2YPLA 4M6NL 3V5HB 5DT1H 5ALBL 5KTEH 2XWJA 3BQUC 4Y16C 4FABH 4GG8B 2P5WE 4QRQB 4DVBA 1MWAH 4LPUA 2JELL 4WNQB 5HYJE 4OI7A 1I4FB 3GMNB 1YEEL 4E41A 4RIRA 3EJZC 1WFTA 2E9WA 3C09B 3MPCA 1ADQL 1X4XA 2AKRB 5HY9A 2B2XL 4ONOA 2VKWA 4LASL 4NQXA 3VDBA 2OR9H 1NFDA 3MOQA 5K93A 3DUUA 3WNMA 3EOBA 3R4DA 4NM8L 3VFUA 4M7ZB 5LXGL 3MOAH 1ROWA 3U0TA 1V8HA 4KUCF 4K7PL 3GMPB 3SCMA 1OW0C 3ESVF 4AH2B 2OM5A 1HOCB 1W0VA 4QTIH 3FAXA 4XC1H 4OGZA 3V6BR 4EN3D 4OLZH 3SKNA 1TTGA 1FL5B 1KJ2A 3QEQD 5DTFA 5EU6E 2DQHL 4ZTOL 3RQ3A 3T1FA 3IU4H 5IP4A 5EH1A 2WWMD 4HKXB 3IXAA 1AFVL 5FOBB 4X98B 3P2TA 3G5XB 4YO0B 3GFUA 1UZ6F 3OMZA 4YBLB 5INDB 4XCYB 1AO7E 3VWKC 3RJDA 2VL5A 1XZ0A 1NUNB 2FIKB 4EQ2A 1E27A 3CFJA 3V6OC 4UTBL 5L2JA 3TN0A 2X42A 4P4KA 1NDGA 3G08B 1DBBH 1OAKL 1CGSH 3AVEA 5IM7B 4NM4L 1FN4A 1CXHA 5C0IB 3V5KA 1QR1B 1W72A 1CZ8H 3ES6A 5I1KH 4U1JB 1NMAL 1MCEA 3D1MC 1I8KA 1S9XA 3QIBA 3WL9B 4ODVH 4KDVA 2JF1A 3O3UN 1U8HB 4RFOL 3KJ6H 1ED3A 1NEZG 3EOAB 3GJFK 1X5JA 5GGSA 3E3QE 2XG4A 5B3NA 4MNGE 2WBJB 1NFIB 3IJHA 1LK3L 3HZVB 1YPZE 4XNUH 1N0LA 5I8CB 5T1KA 4HH9B 3BQUB 3EAKA 4GW5A 3L5WB 3M07A 4JFFD 5JMOC 3MRMA 3SCMD 5FCSH 2V7HA 5DTFB 5TQ2H 4P46C 4M7JH 3HI5L 4KROC 4PR5B 1K3IA 4CVZB 2VZVA 2EXWD 3ZDXF 3V6FA 4MJ6B 1WZMA 4Y5XC 3TJEL 4I3GA 4J7RA 3JVGA 4WNQA 3H6JA 2G60L 4XRCB 3OXRA 3SY0A 1MRFL 1T2QL 1BVLA 4F7TA 3RVUD 2B7DT 1ZLWK 2LAGB 3VD5A 5CP7A 3DVIA 4P2YA 3UO1H 5HPOA 1MRDL 5DJXB 5DK3A 1WCBB 1AKJA 7FABH 2RBLA 4UT9L 3I3DA 5E5UB 1A1MA 4Y7MA 2WP3T 3HMXH 1AC6A 3IF1B 3C2AH 1K5NB 4JY4B 2R8SH 4J12A 3D3VE 3SKJL 1U36A 3VXSA 1D3CA 2DTMH 1J8HE 5C0BA 3A0OA 4K23L 5TDOB 3S88L 4GW4A 2B39A 2L4OA 4BM7A 5EU4A 4HIEB 5JTWA 3VG0L 3LKPB 5FA3A 4L4VA 5FHAL 5HDBE 1F11B 2FX7H 5ELIA 5KG9A 2XN9E 5EWIL 4DW2H 4U6TA 4N9GA 3IRPX 2X4PA 3MRNA 3K8MA 5MHSE 3GMLA 1KIPB 4YDLC 4AZ8A 3U7YH 3GMLB 1AXTH 1MHEA 4Y4HD 5DD0H 1MHEB 1ES0B 4LNVA 5T3ZD 4HXAH 3UAJC 3MJGX 4OGYL 2Z93A 2EYSA 3MRKB 2AQ3A 2ZKHL 2QHLA 3OB0H 5IBUG 5FUCE 3OAYH 3P30L 1TZHA 2R1YB 3OGCB 4U31A 3GBLA 5T1MA 4LQFL 4PJHF 3TCLA 3QIUA 1TFHA 4KGJA 5EBLA 5CJXA 5JIKA 3G6JE 5ILTL 2FD6H 2Y36H 4FQCH 3ARDB 2DL9A 5D7LB 2RFXA 2C1OB 5I1CH 3PL6D 5DZNA 4K3JH 5DRXA 1J0IA 2NY3B 4HUVA 2ZCHH 3N85L 3IF1A 1KGCE 3BH8A 4Y4FC 5JO5A 5JPMA 1UJ3C 1X7QA 1PG7W 1YUHA 2Z8VC 1X7QB 1UXWA 4FXLA 5I8EA 5IF0B 5L6YL 2XXMB 3RNQB 4BFIB 3L5XH 5D1ZD 3U30B 1CBVL 2GT9A 1NCWL 1KJ2L 1I7ZB 3GHEL 2DQFB 1DL7L 1FFOA 3S36L 5F1OB 1KG0A 1EXUA 3PWNB 3HNVH 4G43B 2CDGA 3TFKC 1J0ZA 2P5WD 4P2QE 3NGBC 4H0HB 4MLSA 1EVTC 1A4JA 1B9ZA 1XEDA 2BVTA 3RWEA 4MJ6A 5AWNL 3H0TB 4C4KT 4K94H 1RURL 1IFHL 2E8ZA 5CJOL 1D5BB 1XF3B 2NW2B 4PR5A 1TTUA 3ALPA 1YEHH 2FJHA 4Z7UF 3U7WH 3OKKB 4KVCH 1IILE 1VACA 1F6FB 4OZFH 1IGMH 3KYOA 3O3BB 2ORBL 4NKQB 1XF1A 2BRRL 1AGEA 32C2A 4MA1C 4V1DD 1P7HL 4LLQA 3FQWA 4XXDA 4G6AD 4YBQC 1NBVL 1IGYA 2NY0B 1NANH 1EHAA 2AJZA 5C0ND 3GRWH 3TP4A 2ZJSH 5I66A 4J3VA 5CZXD 1U8OA 1LO2L 4WO4A 3UBXB 4P5MA 1S9XB 3QIBB 4Z7QF 3W11C 2IADA 3DETD 4PJ8B 4BH7A 1WT5C 5I74B 5EC2A 2XICA 2XZQL 4AJ0A 4XMPL 2NXZC 4EEEA 4U1HA 5TE6L 1NGYA 2NY7L 5F6HJ 1XT5A 2MNUA 3MGTB 3PWLB 1N4XH 3EJJX 3R06A 1CD8A 3PV6A 1OWRM 4BUHA 4X6CE 2UVFA 3WFBH 4GRWF 2NQCA 3VXQA 2Q86A 2P5WA 4U7KA 4F9LA 4JANB 2X09A 4G8EA 5J0BA 1NMAH 3CFDA 2O93L 2J4WL 3CPLB 3IFNH 2FL5B 5DYOB 3DX8A 2DQUH 5HVFB 4JFDB 1LEKB 2WMPA 2DD8H 1MCQA 4HUMB 2FGWL 4B41A 1J0JA 2AJXL 1LQSR 4WIQA 3MUJA 2VN7A 1RZKL 3TV3L 1TIUA 1H8OA 4MB4A 5JORB 4XNUL 3PDDA 3L6FB 1LILA 5CWSB 3QP3A 1JPFB 5DQ9B 1FFOB 3KS0J 1UZ8B 2FO1A 2KL6A 2QADD 5D1XA 1I8KB 2QSCL 5E9DE 3W9EA 1JWUB 4ZPTB 4LCIH 5GS1B 4D9QE 4PJHE 4YIQB 5L2KE 2I60L 3G6AA 1NBQA 4LGPB 3MBXL 4NO3B 1EGJA 3U1SL 2OK0H 5D2LF 5IG7B 2G2RB 3FCTA 4KTEL 1YA5A 4PTUB 5T5NF 3OJVC 4EI6B 5DJDB 3EDFA 4UV7L 1BIHA 1V7NH 4YHOH 3W0WE 2XTJB 1DZBA 5JUEH 4N0UB 1UACL 4B7LA 2W9DH 3MXWH 1YEGL 2ADIA 5FYKD 1NUDA 4IRJD 4NC2B 1MY7A 3MNWB 4UV4L 2R2BA 4JFXA 3FT4B 1A6VH 4Y2DA 5H2BB 4JM2D 1CE1H 3IDGB 2X1OA 1W0YT 3U83A 4U0QB 3QQ9C 4ONFL 2YN3A 3RNKB 5DI8A 5D96B 1CLZL 1DQQA 2VXVH 4MMXC 3NMEA 1J1OH 4Y2DC 3VE0B 3ALXA 1HHJA 3AAZA 3FQXA 3MV9B 5D93C 4YHLH 1T20A 4KQ3H 3B5GA 1SEBB 2B1AL 4KRMB 1MFCL 2HH0H 3FOMB 4ZTPL 4U05A 2QADC 1B88A 4NRZA 5GS0H 4FN0A 1OAQL 1MRFH 4M1CD 4K7PY 3CDCA 3WD5H 3WIIL 2XZAL 2P8LB 5LCVH 4N1EA 5I0ZA 4LP4A 4PGEA 3FO0H 4RGNB 1WZKA 3O6FB 2D9QB 4NO2B 4CN6A 3HG1E 3ULVD 1YN6B 4Y19D 3CZJA 3ZL4H 2ZCHL 5I19L 5HHMD 2R8SL 3RZCD 1N5YH 1VFMA 3SDDC 2CR3A 5GRJL 3HG1B 3QUYD 3F5WA 4OJFL 1QP1A 1FJ1B 4D9RE 4UOW1 2R2BB 1MH5B 4HKBA 3FRUB 1QFWL 4OGAC 5IB3B 3L95B 5BXFB 2EYSB 2BHYA 2H3NB 2R4SH 1I3GH 5TGBA 3LKRB 3BZ4B 5DMKA 3SDYL 2NR6C 3PJSA 1JV5A 3BKYL 5E8EA 2VDKH 1OTTD 1U8NA 2D0HA 3F8UB 4X6FA 1I9EA 1OCWL 2CXGA 3EJYD 3G6AB 3QNZA 3JV4A 4WU7A 3ARGC 3QHFH 1QNZH 3QPQD 2H32A 1FVEB 4MNHA 5D6CA 3SQOH 2W9LA 4Z6AT 4XNMA 1NJ9B 3VWJB 5FK9A 1R5WB 1YJDC 4QGYA 4ZO7A 1F2QA 4BSVA 2X10A 5FCUL 4MAYB 3RGVA 4NHUA 4XNQB 2WBWB 5FGCE 3KLHC 3MLXH 4H5SB 5EO1B 1CQKA 4AT6B 3HA0A 3HPJB 2V5MA 3DVGB 3QQ3B 1D6EB 2GTWA 4PJ5B 5SWZD 1FLTX 4HQQL 4N0UE 3G5VB 2G75B 4PB0L 1O5DT 5JOPD 4TQEL 3MRDA 4PTTB 2XKNA 4GG6F 1BEYH 1QLRA 1LO2H 35C8H 1IAIH 2PKDA 3CX5J 4FQ1H 3VFTB 4X6DA 2AXHA 3EHBC 4GLRI 4QY8B 1MCLA 2KZWA 3UBXG 1NCTA 4ZNEA 3VGDA 5C0GB 1KTKE 5SV4A 5TE6H 2IH1A 4PGZA 5L9DL 1LO5A 1CGUA 3V5KB 4D9LH 1QR1A 2BCKB 2EDBA 4DK6A 5FECB 1S9WA 4YBHA 2HP4A 3DRTA 4ODWB 1CXKA 4NRYA 4PD4K 2EDTA 5D6DC 5EOQH 3BIKB 1YC8A 2BSTA 2ZPKH 3A67L 1JF5A 3KLSA 1FSKB 4P2RE 4IOIB 5GXBB 3WLWD 4ODSH 3NIFF 4HZAA 4PJXB 2A6JB 2Z4QA 2FRGP 4NJ9L 1T0NB 1AGCA 1R24A 1T2XA 2Q8BL 2VLRD 4AEEA 1MJ7L 4AIOA 2F54B 4Y88A 4BELD 3E6FB 1JI1A 5FA4A 4GAYA 5IQ7L 3MLZL 3F7YA 2QKIB 3ARDC 3L3GB 2PTUA 1VEPA 3PDGA 4NQCA 3RUGA 3WBDA 4PJCB 3MREA 1QRND 3VU2A 4AM0B 1QSEB 4KPHH 2O5XH 1P1ZA 5GJTL 5JOPE 1QLFB 3V4VH 2CIKA 2R56L 1OSPL 3HRPA 5F9DC 3V6ZA 1OTSD 1T22A 3E0GA 4QCIA 1P2CB 4OFVA 4MNGA 3LV3A 1EJ6A 4K94C 4LSRH 4UOJA 2H2SD 1GJIA 3EOTH 2NZ9C 3DBXB 4P48A 5E8NA 1HH9A 3OAUH 4ETQB 2Y07L 5CJXC 4EZMA 3QIUC 1JGUH 4CUCA 3O3DB 2KH2B 4LCUB 4BQ6A 3LKQB 3RY6C 1ZLVH 4N9OB 3KPSD 4XPBL 2D7TH 4YGVB 4H26B 3PWPB 5DA4A 3UZVB 3CVHA 5F89A 5J12B 2IAMB 4TTDC 3I3BA 5C07B 3IDIB 4ZFOB 5TDPB 2J5LB 4PJ9C 1RIHH 15C8H 2GTZB 3ULSA 3BUYB 5JW4M 3MJ7A 1CFSB 2YRZA 4PJEF 4U0RB 1J11A 5JR1L 3PDOB 4PG2C 2CGRH 4UAOB 2VQUA 3AS3A 1J1OL 3MR9A 2AK1H 2DQTH 3JWNC 4DUVA 3PG2A 4CJ1A 3BPOB 4EI5A 4M6OH 1MFCH 1B4JH 1J8HB 3DRTB 4NCDA 4XI5D 2O26U 1RK1B 5ENWA 2H8PA 3OAZH 3BHBA 2H8PB 5C09A 5C0RL 1DFBH 3T4YA 3BMWA 4XVUD 4DN3L 3S5LA 2OSLA 4HIEA 2ZCLL 4JZNB 4JDVA 1FYHB 3ARFB 3LAFA 5DRNA 2VRAA 4U6YB 5E2TL 1WVZA 4F7CA 2DF3A 1CICB 1KTRL 3KPNA 3L7EA 3FOMA 1RIVL 1TETH 3NCYP 1JK8A 3CU1A 4MS8C 4Y5XA 4EDWL 1F6AB 3THMH 2JIXA 1MIML 1AGBB 3AB0B 4PRIE 1CE6B 5CBEA 5GIRB 3EHBD 4LVHB 4ENEC 4LHJB 3ECBA 1YJDH 3IDIA 3FB5A 5GS3A 2EIEA 3MZTA 1KPVA 5EIVA 4OCSL 5ACZB 3QFJB 1LO4L 3OXSB 1ZTXH 4XP1L 7CGTA 5ETUB 2Z91A 1BOGA 5DRXB 1ORQA 4YC2B 1OAXL 3QPXL 3FN3A 1JNJA 1XGTB 1ORQB 2ED9A 1OM3L 2W91A 1KYOK 3KPTA 5E56A 5FM8A 3SGDH 3FMGL 5I2IA 2V2WB 5M94B 4JHAL 3S3JA 3ESUF 5TGBB 4FFWC 3CVIL 4XXCA 1H15A 1FJ1A 1DANT 2AK4A 2P46B 4K7FA 1HQ4B 4XPFL 1SBSH 4RA3A 5I8CA 2C9AA 2DMKA 2X70A 2XRAH 3H9HA 2ZUQB 4LFHG 2YK1L 1LO0L 4RAUA 3TN0C 3FT2A 2MFNA 3VDCA 2YKLH 1IGTA 1CXIA 5KVGL 5KSVA 5HHVH 3P0YH 1J05A 4PP1C 1HNFA 4PRDA 2E9IA 4DGVH 3MBEB 1FE8L 3MRHA 2GJ6E 4PJBB 1IBGH 5A3IC 4WFHD 4MXWL 4PLOB 4PLKC 2ZOKB 3QWOB 5I18L 4PRHE 5DHXB 5A2LH 1CL7L 3HR5A 1RQ5A 4XC1L 4Y4HC 3BMVA 4CDHA 1AGCB 1MWAB 1R24B 4KKNA 4UZGA 4OLZL 5KS9F 3BYYA 4S0TD 4GKOA 3LQZB 4P2OD 2VDOH 5JLZA 4ZUVB 3LS5H 4S1DD 4P4KB 3HI1B 2VZ3A 1KIRB 4H88L 2MPAL 4X7SL 4TSBH 5D96C 5TPWL 4PJFF 1IZKA 3REWB 4OQTH 1NLBL 1RZIB 3ULUE 4NKOA 3GMQA 2DI8A 1M71B 8FABA 4OCYL 4NNPL 4UTBH 3MMEA 1A22B 3LD8C 2D03L 4WI9A 1TJIL 4XC3L 1MHCB 3OX8B 1A7QL 4AH2A 1NKOA 5JMRA 2P48B 4OZGA 1GOFA 3MA9H 4C54A 4U6VL 4S1RH 4IIQB 5E8DH 1IAMA 1FL5A 3NCBB 4L5FL 2P5EA 5C8JB 3WV0A 3HZMA 3BQUA 3QYCA 4OAWB 5J1TC 3BYTA 2BSED 1RFDH 4UDUB 3ARTA 2Y9RT 4F33B 2LU7A 2VISB 5I1LA 1KIUA 1PX4A 3KHOA 2LU4A 2PTVA 3BH9B 2D7OA 4G80A 1FCGA 1MPAL 3F7VB 4JKLA 4NN5B 3PXHA 3PWPD 2DM4A 3KPLA 5ICXB 1GSMA 3MX0A 1P5UA 4JPWL 5ID1B 5ISZD 2L7JA 1INEH 4WWKC 1W72B 3NAAL 1MQ8A 2F15A 4XVUC 2AXGB 4AM0A 2F54A 4P2OC 1C5BH 4JFHD 1CD1B 5K59E 3WN5A 1LO3L 5EBWB 2R1WB 4XH2B 4G6AC 4MD5A 1Z0NA 2D2OA 2OJZL 3RWHA 4XPHH 5GGRA 4IRSC 4ZUTA 2V2TA 2A9NH 3V6OE 4XNYH 4Z78B 1S9KC 3AS2A 2BRQA 2EE3A 3NN8B 1SMOA 3NZ8B 1SYSA 3U0WH 2IC2A 1C5DA 3Q5OA 1IGTB 4Q9CA 2ZNWA 5F7MC 4H1LA 3DGGA 3H9HB 4YX2H 2YPVH 5HVWA 2Z8SA 4PJIA 5ESQA 1ND0B 4U1LA 3BAEL 1EEZA 1R0AL 3PWJA 3STZB 4LVNB 1X5HA 2WSKA 4AIXA 4K07A 2WAHA 4TRPH 3LEVL 5HYJB 1N59A 1CICD 2BK8A 2EDNA 4DKFH 2DQDL 4JFEB 4PRPA 1ZWIB 3RIAK 1A6ZA 4I3SH 3KPMB 1E6OL 5D7IA 2AAVA 4NKIH 4ZFGH 1G1CA 3K3QA 4O2CB 5FGSA 1D6VL 2BNQD 5IW6A 3B5HA 1Q9WA 1UQSB 4W70A 3VRLF 3RDTC 5ESVB 2OZ4A 4C58B 3NIGF 5JZ7C 1FZOB 1IM9D 1KCUL 1G9NL 4ODBD 4RAHA 3OL2A 4JFFE 4U1NA 4XPBH 3EYSH 2JCCF 3FRUA 3RRQA 2H1PH 4YDVA 3LB6C 3JV5A 3QB7C 4MAUL 4WHCA 4K71C 3VD4A 1U8PA 2E6JA 3QO0A 4K3JL 1AGDA 1XH3A 3HMXL 3IKCB 5DEFB 1KTDB 2ICWI 5ITBL 3U46A 4GRMA 4JDTL 5K9OA 4FRWA 1U3JA 2DQIL 4JFZH 3LEYL 2FJHB 3BHBB 4MSWB 5C09B 1LO4H 3C5SB 4IOFC 1OPGL 2ILLA 2IGFH 3O6FA 4YJZL 1M7DA 2BVYA 4RBPH 1KJ2H 1NCWH 3FB6A 3MUY1 3CCHB 3WIHH 2DQGL 3V7AE 4D9RD 5D1QB 1A9EA 4XWGH 3FB8B 1DVFB 1CF8L 5IMMB 5EO9B 5EU7E 4IRSB 4PJ7A 1NGWB 5CSGA 3RVUC 3JTSA 1S7TA 1TPXC 5E2UH 1MOEA