3FFDA

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
210
Chain Sequence
b'EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWIRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMFYCARQTTMTYFAYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hormone
total genus 44
structure length 210
sequence length 218
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA01
2I9TA 3MV9E 3D39A 5H35B 3EOAB 4XPGH 5FGCB 3BKMH 4OUOA 1ZLSH 5CJ5A 3P4NB 4FQCL 1YPZE 3UDWC 1B88A 1G7HA 5SV4A 1T03L 1HSBB 3QQNA 1FZJB 1YN6B 4M43L 1IEBA 1SMAA 4RMRA 3RA7L 1N0LA 1CE1L 3MV9B 5I73B 1KB9J 4GFTB 1QHPA 3L3HB 1WJ3A 4EXKA 1BEYH 4MNQA 3MREB 2RB8A 2DLTA 4PRAB 2O5ZL 3A67L 5HD8D 3HC0B 1CGTA 1DQMH 5C08B 3TNNB 5EU7C 4K7FB 2GTWA 1U3HB 4FQXD 3GSVB 1R0AL 5C0GA 1T5XA 4XNYH 3TCXA 1NBYB 2OJEB 3QHTC 4PJEE 4WV1B 1L7IL 3RDTD 5BMFH 4PIRF 1X5HA 1A3LL 1BZ7A 5GGUB 3UBXI 5CJXA 1VEMA 3V6FB 4QOKA 4DCQA 1P84J 1NFDF 3QNZB 1LP9B 3WDHA 1YC8A 4E5XB 2NY1C 3OGOE 5TQ0H 2AK1L 4LPYA 1PAMA 3UP1A 2K3TA 3G9AB 3BVNB 5BCAA 3KNBB 1RZ8A 4D8PA 5EZLB 2ICCA 4CJ0A 5EIVA 1P1ZA 4J3WA 2QEJA 4O2FA 1MFAL 1P53A 3ZKQD 3IXTA 3UPRB 4HKZB 2D7NA 4OF8A 1HEZB 5HDLA 4YDKH 2BVTA 1HILA 1KJ2H 2XPGB 3IJSB 1ITBB 2DOCA 1JHKL 2N7AA 4OF0A 3U9UB 2DQTL 1JZ3A 3ULUL 4XHJD 2BOBB 5DLMH 1U93A 3QZWG 2OJZL 5BRZA 1U8OB 1P7QA 1T66C 1FRGL 3PP4L 2QSTA 4LQFL 3QA3B 4XP9L 3ARQA 1OGAD 2AVGA 1E4XH 3NABL 2JELL 2GSIB 1UWGH 1DUYB 5HJ3B 2VDLL 4YHNB 1JWSB 3C09B 5KSAB 1I4FB 1Y0LA 1NCWH 3QDJB 2HJFB 4C58B 1A7RL 5GGQH 3QZWA 3CXHJ 1VADB 1ZV5A 1GYAA 3K74B 3HMWH 4J6RL 5C8JB 3OKNA 1CD9B 1QTYT 5J13C 4M5ZH 3PIQB 1K4CA 4HWZB 4AIZB 4Z7OF 3RZCB 4S2SA 1HXYB 1WBXA 4X5XB 1HIML 1D5IH 4NQUA 1TTFA 4EUPB 3H42H 3CVHL 4WHDA 4WW2A 5EWIL 5KSBF 1CF8L 2ZG2A 3MA7A 4IHOB 1NAMH 2Q20A 4KKLD 4FQJL 3MRCA 1JGDA 3TJEH 1MCQA 1JI2A 3VH8B 1FJ1B 3RU8L 3ZKNC 3VXQB 5A2IH 1XF4A 1DQJA 3L3IB 4RISL 4ZYKB 1CS6A 1FORL 3O8XA 3HS0B 1TZIA 2VDMH 4LCIH 4DKFL 4DGIL 3LZFL 1U8LA 4NUGL 3OG4B 2H6PB 3V0VB 4P57A 5CEZD 4NBZB 2OI9B 1R3HA 1F4YH 3DX8A 4KTYA 5MERB 1T20B 5KVFH 4WJ5B 4Z77B 1RPQA 4PGDB 3QH3B 5ISZE 4F7MB 4OCXL 4U1KA 4P4RA 4ZS6C 5AG9A 3S3PA 5JA8B 2WV3A 5IF0B 1F8TL 4CVXA 5L8JB 1WBZB 1XGUA 4TSBH 4XCNA 4N9GA 3OHXA 1AXSB 3KJ6H 3FQRA 1CGXA 3QB7C 1RULL 5JR1H 5AG8A 4LAQL 4MQSB 4LASH 4ZUUB 1FNGA 5IG7B 5J11C 4DQOL 1CICB 5CIPH 4XXCC 4HKJB 3DURA 4M00A 3SE8L 4P2QB 3C2AH 4U2ZA 2R1WA 4APQB 3IXAA 3LQAC 2XWJA 3KVQA 3S34L 1IC5H 1C12B 1I1AB 1IVLA 3FO2A 1S9XB 1F4HA 4WHCA 1S5IH 3EO9H 5CWSA 3MV7B 1MQKL 4Z6AT 1QPXA 4PY7B 1ZT7A 4R6UA 4G3YL 3VRJA 3WFDL 4EJ1C 5ICYA 4JB9L 4PJBF 1T7ZA 5FYLH 2XXMB 2AK4E 4Q74A 1TVHB 5FB8A 2XA3A 3CFDA 3OKMA 3TO2B 4U1IB 4KTEH 5ANMA 1V3LA 5L6YH 4OBSA 3ZL4H 2VZVA 1IARB 2VITA 4L4VE 1OAUL 5JXED 4P9HH 3RUGA 4PGBA 5IHZA 3HI5L 2FB4L 3MSPA 3C8DA 4R9HA 1IM9D 2EYRA 4A6YH 5E8EB 3A6CL 4U1MA 1IE5A 3VXTA 5DJ6B 3V5KA 4ONFH 3T8XA 4RSVA 5ESQA 2NY2D 1UWXK 1F4XL 2AABH 3UC0L 1MHPL 3NTCH 3T77A 2KZ1B 4FZEH 1KG0A 2R4RL 5E95B 3KLAB 1OARL 2PW2A 5DGQA 2H2SC 5JW3L 4X98A 5DTFA 1A6PA 2NW2A 5D2NC 5GSRA 4MJIA 1AKJA 3V8CA 4Y5YB 5I17A 1Z9OA 4YE4H 4HKXA 1C08B 1W72L 4X9FA 2AEQH 3BRDA 5CJQH 2OZ4H 1A7OL 3V5HB 3ZSSA 4ZSOB 4AYFA 5JIIA 4WUUD 1JHTB 2KZWA 3EO1A 3KPPB 3C8HA 4FA8A 1IGTA 3IFLL 1Q9KA 5HYSB 1HHKA 2LAGB 1P6FA 1DQDH 2XV6B 4D0BA 1GCFA 5DURB 2V17L 4Z7QE 4OQTL 1KC5L 4Q9RL 1CE6B 2F53D 3BSZL 4PJHE 1HKLL 3U7YL 1UWEH 2ZUVA 1E4KA 4HGWA 4BFEA 3RBGA 4JANA 1G6VK 2R1XB 4YGVA 3KJ4C 4NKQB 4BQCA 5E70A 5KAQF 1EJOH 4DGVL 3FMGL 3IF1A 1IGYB 3TJHC 3GHEL 3DGGA 4BM7A 5IR1A 2J8OA 4X80H 1AGEB 3BXNB 4IOIA 2QJDA 3LOWA 4PR5B 4ZAKC 3W39A 2EEAA 1UGNA 5E99H 4FG6C 2GFBB 3J7HA 4DGYL 2XZCL 3U9PL 2JCCB 3OBAA 3K2UH 4Q2ZA 4PJGE 1A6WL 3D87B 4L3ED 5EO1B 5IKCA 5JQ6H 1X5LA 3FFCD 4Z7VA 1HHGA 2J8UB 4P9MH 2WW8A 3B9KA 3HUJA 3H7BA 3WEXB 4XCEB 1AY1H 5SWZE 4ZNCD 1X7QA 2DQJH 4O58L 3D2UB 2X1OA 1NCCL 4WI3A 1H15A 2A6IA 5I9QC 4OGXH 3SQOH 1QSFB 3G5ZA 3C6LD 1YECH 5FHBL 4LCWD 4I13B 4BK4A 2WINB 4WWKD 2HTKD 1FFRA 1ZA3B 4G5ZH 4XPBH 5H2BA 3RWDA 5MENB 1HSAA 1TCRA 3LEXB 5E8OB 1P6AB 2F19H 4PLKD 3MBED 4D0CA 1BJ1J 1R5IA 3QIUD 1LEIA 3TO4D 2DMCA 1CZ8H 4WFGE 2DLIA 2WBJB 5F7WC 5H35A 1BFVH 3EOAA 1CL7I 1Q0YL 2ESVD 2WMPA 3NVQA 2F8OA 4XGZB 4G6ML 1I9EA 2E5EA 3P4NA 2VJXA 4XI5C 4GXUM 5C0CA 1HSBA 5GISL 3TBSB 1FZJA 1YN6A 1YEJL 1KTKE 4IOFC 1H3PL 1PKQB 1TJGH 3QQ9C 5LQBH 3KPRE 2R56L 4Q97A 3L3HA 3QPQD 3MREA 1HWHB 4YXHH 2CKBB 2F8XC 4PRAA 3HC0A 4GKOA 5C08A 3TNNA 2CXGA 3MYZA 4K7FA 1U3HA 3GSVA 4FQLL 1I3GH 3UBXG 5EOTB 1NBYA 1KBGH 2OJEA 3LPFA 4WV1A 1S7XB 4JM2A 1UVQB 5F9AC 5DVLA 1TZHB 3REVB 1A3RL 4OLUH 4NQCB 5EIQA 5LKNA 1T4KB 1KCVL 4J23A 5GGUA 1C8PA 2OR8A 1EVTC 4OF7A 1YQ2A 1IBGL 2VDKL 2W65B 3IU3A 3M8OL 4L29A 5FYJD 3V6FA 4DZ8B 4HMDA 1LP9A 4Q6IC 4AMKH 5DSCB 4MAUL 2FEDD 3RY5A 3TVMD 4E5XA 1A1NB 4U0QB 5C0EB 1A4JB 2H9GA 3L95B 4GS7C 5C07D 3BVNA 4L9LC 3QQ3B 3KNBA 2ZUUA 3ILQC 4MQXC 5DJ2B 5EZLA 4YUEL 2XN9B 4HAFA 3Q5TA 4EDXB 1OAYL 5CEZH 5BS0D 3RIFF 4PBXA 4H20H 4GG6F 3N9GL 3Q6GH 4HKZA 3ISWA 4Y2OA 1HEZA 2J88H 2XPGA 4WEMB 3IJSA 4OFYD 3U9UA 3IAGC 4X99B 2ED9A 4PLNC 1CK0H 2BOBA 3U46B 3KPSE 1W0WB 4P9HC 3JWDH 4CNIA 4PRPD 2MPAH 5LXGH 1TJIH 1U8OA 3QHFH 2ORBH 2X1PA 5E2WH 4PJCB 4HT1H 1WZLA 3MRGB 3KXFE 2W9EH 3CK0H 1M71B 4HWBA 5E2VH 4EUPG 3RL1B 2GSIA 5GJSH 3B83A 3VWJC 1DUYA 1MREL 5HJ3A 5C1MB 4KGLA 2EDKA 1GL4B 4HXBL 1RIUL 1JWSA 3VXUD 4M48L 1G0DA 5KSAA 1E6OL 1I4FA 2NY3D 2HJFA 3QDJA 2VLME 3WMSA 4JKPH 1T0PB 4FNLH 1VADA 2HJLA 3JWOH 1FO0H 4JRXB 5C8JA 4L8CB 2EDBA 4S0SD 3TF7C 2KKQA 3PHSA 3PIQA 4HWZA 4AIZA 5KW9H 1YNLH 3RZCA 1HXYA 2F74B 3QUMH 4X5XA 1KULA 4NJ9L 1W0YT 5AYUH 2YS4A 4LLWB 3VFSB 5GJTH 4P5TB 5EPMB 4IHOA 5I16B 1R5WB 3NMEA 1GGBH 4D3CL 3VH8A 1FJ1A 1NC4D 3VXQA 3Q1SH 2P49B 5F1SA 3L3IA 1TZGL 4OLYH 2P47B 4ZYKA 5F7HA 4R96B 1BQSA 3DMMB 3BD4A 4Y88A 5F9WC 3HS0A 4FQ2H 2H32H 5TDPA 2YD6A 4RMVA 3VXRB 3HAEB 1UCBL 3VFGH 1P5UA 2H6PA 1U8PB 4NWTL 3V0VA 2HFGH 3TA3B 1T89C 4HIXL 1T20A 4MMXC 2IALB 4WJ5A 3SE9L 4Z77A 5I76B 1EERB 4PGDA 4U6VH 3QH3A 1U0QA 4F7MA 2PYFB 3U6RB 4MNHB 3UAJD 4JFXB 4PP1D 3TC9A 1OP3K 1DSFH 1CT8B 1CU4H 5GS2D 5I0ZA 4ODVL 5IBUB 5IF0A 1INQB 2E27L 2BOCA 2DLHA 5IW3A 1MWAB 1AXSA 3QUZD 4RX4A 2EO1A 3QAZC 3SDCD 3SDYL 4FQXC 4QHKI 4ZS7L 1X44A 2MCG1 4ZUUA 5F96H 1EHAA 3AREC 3RDTC 1VGEH 1CICA 2Q8AH 3FN3A 5GGSY 4NM4L 3V4VL 4MQTB 3MUGB 5BQ7B 4P2QA 1E6JL 1G7PB 4APQA 5I1JL 4J3UA 1C12A 1I1AA 3UTSB 1S9XA 2GJJA 4NZTL 2Z31D 1J88A 1HQRB 3E0GA 2VE6B 3MV7A 3G6JB 4Y1AA 2H1PH 3S98A 2X7LB 4PY7A 5DO2D 1OAXL 3HI1B 5L2KB 4DOHE 3MOAH 1JNLL 4KY1H 1EGJA 2BNUB 2W60B 2X4PB 1TVHA 5LWYH 4RWHA 1XGRB 3TO2A 1NLDH 4U1IA 2UVFA 4PRBB 5F7LB 2YPLE 5I8KH 1FL3B 1VFOA 2NXZD 3GO1H 5ERWB 2NY5L 3GEWB 4LGPB 4XHJC 5FYKH 3BWAB 5IUSA 1KELL 4O00A 8FABB 5J12B 1EHNA 4JKWA 1TPXB 4OIIH 5E8EA 1MRCL 1RIHL 5DJ6A 1HKFA 5IJKA 1T0MB 3I9GL 1RUKH 2R0WL 3KYKL 4B53A 4TNWF 3KLAA 1HCFX 1TJHL 4U1NB 3HE7D 4QRUB 1WF5A 2HH0H 3CXDH 3T2QA 3M07A 3T0WA 4Y5YA 4R3SB 2OL3L 1JFQL 3NCYP 3D39D 1C08A 4NQDE 5EU5A 5IB4B 1N6UA 1CDIA 1J1PL 3V5HA 1GIGH 5F7YC 4ZSOA 3HCVA 3LEVH 1DUZB 1YN7B 2MHAB 1UKSA 3E2HB 5I8EB 1JHTA 3KPPA 3UTPE 1MJ7H 4JQVC 4NNPH 4LCUB 4KKLC 5HYSA 5GRXG 2CRIA 2VQUA 1XGPB 4BUGA 4ZTPL 1D5XB 1YJDL 4P4KB 3CCHB 1EA9C 3MRMB 1NGXB 4WFHD 5AEAA 4OCSH 2VLJE 2DKMA 5HVFB 1OF2B 5GRJL 2A0LD 3ETBF 1XIWC 1CE6A 2V2XB 4F33A 3SE3C 1U8NB 3DXAE 1QSZA 2PO6C 5CZXC 2QQQA 3EW3B 5HYJE 3ZKSD 1ZXQA 1T2XA 4QXTB 3WHE1 3WNPA 2R1XA 4ZD3H 2DN7A 3BQUA 1EHLH 1ORSB 3R06B 1IGYA 4YEEA 12E8H 4QOKD 1AGEA 2DJ4A 3BXNA 3U79A 2DQCL 4FN0A 4WCYL 3JWDC 1Y18B 4PR5A 1FH5H 3DUSA 1Z0NA 4PJ7E 5MP6L 2GFBA 2JCCA 3PQYD 4YDIH 5EZOL 5EO1A 3X3FH 1J10A 2EH8H 1FQ9C 3ARVA 4NKMB 1TITA 3ZT6A 2J8UA 4YFLI 1P69B 1J12A 1NDGB 4KQ3H 5JUEH 3PDDA 3QXWA 5MEOB 3WEXA 5IVXB 4JPKL 3CNKA 4XCEA 3SE4C 3GNML 1D5ZB 4HGMA 1KSRA 3D2UA 4ZMAT 3CFBA 1QSFA 3JWOC 1MCOL 1K6QH 4WTZG 3SN6N 4J8RB 5IW1B 5BRZD 3VFPA 5DJDB 2UY7A 5DDHB 2WINA 1BJ1H 4OGZA 2P5WB 5IROC 1ZA3A 4HJJL 5MENA 3MA9H 4JAMB 3FO0L 1XGYH 5E8OA 1YNKL 3FHQA 5K59F 2Y07H 3NCEB 5I74B 4HLJA 4G6KH 4ELMF 5E08L 3HNTL 2WBJA 4KJQC 2DJUA 3QEHB 4WTZA 2HN7B 4OLZL 5GGTA 5JXEC 1FL6B 1MCDA 3CLFL 1LO3H 3B43A 2WWMD 4XGZA 5IB3B 2WUBH 2YUXA 3GI8H 3WJJA 1UM6L 5T3XE 2IH3B 1X5XA 2FH6A 2NY2C 4UT6H 3TBSA 3MV8D 5JW4R 4JN1L 1NANH 3DUHA 4JFFB 3WIHH 4FMKA 3MRKA 1G9MH 1QFWL 1PKQA 4NZUL 5E00B 3LV3B 1RFDH 3NIFE 3GMRA 3A6BL 1AP2B 2CKBA 3V6OA 3BKYH 3SKJL 4XPHH 4X6CB 4A2MA 4OZ4B 1U2CA 3O8XD 5GS1B 3VDCA 1A6VH 3P40A 4ELKB 2FGWH 3LD8B 1BMGA 4YC2B 2XTJB 5DVOA 5EOTA 25C8H 2ZCLL 4MS8D 1S7XA 1FV1A 2HVKB 2W59A 4K3JL 1UVQA 1TZHA 1WCQA 3REVA 4DN4H 1FVEB 3KHOA 3PHOB 1R3KB 5AAWA 3RI5K 1AGBB 1KPVB 4XP1L 2W65A 4LLYB 4DZ8A 4YDJB 5DSCA 4NJAL 4PG2A 1A1NA 5C0EA 1A4JA 4YBHA 1SY6A 2PXYB 3QQ3A 2Z0BA 3BWUC 1EGJL 4QGTA 2RJMA 5DJ2A 3ZYZA 2VZUA 2XN9A 4XXDA 5L8LB 2BX5A 4EDXA 1T7XA 1RHHB 5DUPL 1AXTL 3VW3H 3FOLB 4F37K 4M93B 2DKUA 5IWLA 1KLGB 1UG9A 1LDPL 3I6KB 2HFEB 4X99A 1CVSC 4Y5XA 2OCFD 5GS2H 4S1RH 1BM3L 3OKEB 4EN3D 1I7UB 4NQSA 3U46A 2IG2H 1W0WA 3MLSH 5F1IB 1TVDA 4HQQH 4PJCA 2EXWD 3MRGA 4H1LB 3V0WL 1TQBB 4N0UE 2GTZB 1M71A 2X4QA 3MFFB 1ACYL 2GAZB 3RL1A 4YHZL 5DMYA 1YEKL 4ZDHB 4JO4H 3C2SA 1JF6A 4G42B 5K9OB 2YHGA 3LS4H 2AQ3A 3TBWB 3RX7A 3HNVL 3FN0L 3AS2A 5I2IB 5EOCJ 1PG7X 1AO7E 2B0SH 3HZVB 5JZ7D 3GRWH 3MJ6A 4JRXA 3NA9H 2ICES 4G6JH 3C6LC 4R2GD 3AM8C 1NLBH 2F74A 3HAEG 4K9EH 4WWKC 2HTKC 3RVUD 4LLWA 3VFSA 4P5TA 4YZFF 1AJ7H 4GLRH 4PJIF 5EPMA 4UV7L 5I16A 1PQZB 1R5WA 3NACH 4D9LH 4MJ6B 3VXME 4PLKC 2BVOB 3MBEC 1U3JA 3BIAX 3QIUC 1I1FB 3TO4C 2Y06H 2ATKB 4D9RD 1QSEB 1BAFH 1SM3L 4ZG1A 3OQ3B 3P77B 5IBUG 2EDDA 4AENB 2VABB 3DX9A 1MCPL 3GMOB 4R96A 3DMMA 1RUMH 1KYOJ 4YLQT 2AJYH 4KJYB 4G43B 3MLXL 3HAEA 1YQVH 1KXQE 2I5YH 4P46C 1CXFA 3G08B 1U8PA 3BRFA 3BE1L 3PWPE 1J0KA 2IALA 1UA6H 5I76A 3PDOB 2AV7B 1VESA 2PYFA 2NXYB 3U6RA 2Y9RT 3JSSA 4JFXA 3ZDZF 1CT8A 2CK2A 1KXTB 1INQA 5DJZB 3LQZB 1ZTXL 3LKRB 3QDMB 4PJDF 4XZUA 1N8ZB 1FNLA 2VZTA 1MWAA 5F6IC 4JFYB 4ZXBA 1LEGB 1IT9H 3HC4L 5HI4D 5INCB 5FA3B 3RJDA 1H3XA 5ADOH 4F7EB 4N8PA 4WFED 5M95B 1I7RB 1RURH 2VR4A 1DBJL 1QUNA 5DRNB 3T0EE 5FUZH 4P2OC 1D5MB 3MUGA 5BQ7A 3NAAL 2DM2A 5C0AB 3MRPB 4OUUA 1G7PA 4F80A 2P8LB 2PNDA 2FEDC 3TVMC 4X4YB 1JPSH 4WY7H 1L6ZA 2V2WB 3UTSA 5A40E 1HQRA 2VE6A 3ZTJH 3G6JA 1CLZH 3PWVB 4JHWH 2X7LA 1G9NL 3HI1A 5L2KA 2CIIB 1LK3L 2E3VA 5F7MC 2X1WL 2YD8A 2WP3T 2BNUA 2W60A 1EZVX 2X4PA 4AEEA 5JIHA 1A7QL 1XGRA 3JTTB 1QP1A 3ULUF 4LK4A 3GJEB 2R29H 1IEHA 4OT1H 1FL3A 5ERWA 2RHEA 5DUML 1MCWM 1UYWL 1H3WM 3GK8L 3BWAA 8FABA 2XNAB 4W4OA 1SYSB 2APVA 2FBOJ 2C3GA 3KPOB 1F3DJ 4EOWH 1CL7L 2JJWA 2XQBL 1EUUA 5IT2H 4AG4L 4N5UA 3MRRB 1G9MC 1Z9LA 1CFSB 3OAYH 5DZNA 3WIIL 1I7ZB 4U1NA 3PUCA 4WW1B 1H8NA 4QRUA 3BX7C 4MJ4A 1RZFH 2NY3C 2ZG3A 3CMOH 5DFWH 4R3SA 1NUDA 4X6DB 1T1YA 3VMNA 4NCC1 5F8QC 3VXSB 4JVPA 5IB4A 1NGYB 4N0YL 5CD5C 3V52H 1BHGA 5TE6H 1YN7A 3ZTNL 3ME0A 5I8EA 1JHLH 4LCYB 5C0CD 3DROB 3D9AH 3D3VD 2WIMA 2CK0H 4LCUA 3L3OA 4X0KB 1YEEL 3MCKB 3LCYA 1UZ6F 1D5XA 4P4KA 3CCHA 3IU4H 5DF0A 1NGXA 3RWIB 4OZGE 1OF2A 5JDSB 4Y4HD 2OBGA 3BAEL 4QXWA 5C08D 2V2XA 4OCMC 4FQ1H 1INEH 4LGSB 1U3HD 3MFGB 4FP8H 1EFXB 1EK3A 3DO7B 2CUIA 1FLRL 1A7PL 5BV7B 2N56A 4NCDA 3MJGX 3NN8B 4JM2D 4JY4B 3O0RL 4QWWD 3EYSL 4S1DD 3T0AA 1X6NA 3R06A 2BNRD 3O6FC 3ZE2E 3SDXF 3UAJC 1A0QL 4PP1C 2EE9A 1CVRA 2VDQL 5DK0B 2FX9H 5JOFB 2GY7B 3LEYL 1Y18A 4QHUB 2ZPKL 1BQLL 1TQCC 3QUZC 1NBVH 4DEPC 3I3DA 2P46B 3SDCC 2APWA 4LSVL 2NY7L 1MPAL 1BD2B 3EUUA 2Q3ZA 4NQEB 4EQ2A 4G7VH 5EZJB 1ZT1B 1ZLWK 4NKMA 4KPHH 1NDGA 4IEFB 5MEOA 3ECBB 4JFPB 4LFHG 5IVXA 4LRNL 3WFCL 4PJXF 1D5ZA 3OJMB 4HW6A 4GMSL 3NFNB 4F7CB 1QFUL 3VCLB 2VKXA 4J8RA 2APXA 5IW1A 1XF2B 2W38A 5DJDA 5J7CC 1L6XA 4BZ2L 4JQXA 1T83C 5DDHA 5DO2C 5JOEA 4K9EC 1FHGA 5HI3D 3T1FB 2P5WA 5E94B 4JAMA 2ZJSL 1FYTD 3O3DB 4MGXA 3VXOB 5B21A 3BKJL 1MUJB 2G60L 3P9WB 4MAYD 5KSAD 2MSPA 2NXZC 2FHBA 4GRMB 2YC1B 4O2EB 1DBAL 3IAPA 1NL0H 4Z7OE 5ALBH 2ARJQ 3S9DB 1YEHL 3QEHA 2HN7A 1FL6A 1I9IH 4HUNB 1A14H 3DV4B 1UH3A 2Y36H 5IB3A 2DRUA 2OTWB 3RZCD 4DUVA 2IH3A 2CR3A 3B5TA 1ZT4B 5TH2A 4QXGH 4JFFA 3X12A 1B4JH 1XGTA 2B20A 3HE7C 5E00A 3LV3A 5L0QC 1L7TL 4GT7A 4QKXB 2D0GA 1FGNH 2RIKA 1WTLA 1AP2A 4N8VB 2FECI 5E4EC 5KVEL 2WBKA 4X6CA 4ZNEE 4OZ4A 3RZWA 3WKMH 5GS1A 4G8GB 4ELKA 4M8VA 3I2CH 3NH7H 4PGEB 1AGCB 4M4PA 5J11B 2HVKA 5JIKA 1FVEA 5KZCD 3PHOA 1R3KA 2CJUH 1AGBA 5GHWL 1KPVA 5EUOB 3NZHH 3VFNA 4MA8H 4LLYA 4ODHH 3H9SB 2EC9T 4RQQB 1PLGL 3MTRA 4LLMB 5AYQA 2A0LC 4IDJH 3WFEL 1JNNH 2PXYA 4PREA 4RX4D 1F58H 1OOAA 3H3KA 2YXMA 4GKSB 1HDMB 5AZEL 4XVTH 1RHHA 1INDL 4MNGB 5DD5H 1BX2B 5ENWB 3FOLA 3GSNL 4S1QL 5DZOA 4QCIB 4C54A 5IGXH 4KMQA 4M7KH 5DJ0B 3QG7H 1VFBB 4N8CH 5GZOD 4K71C 5IBTH 3F7RA 4BFIB 2DTSA 3K1DA 4C56E 3I6KA 2HFEA 4HS6B 4YHLH 4P2QD 4G9FB 3EGSB 5IMKB 3OKEA 3W0WE 5D7JB 1CLOL 1I7UA 2FLRT 4APQD 4OSUH 4OZIB 5F1IA 4BZ1L 4UINL 3O2VH 4JVWA 1JL8A 1FE8L 2CDGB 1KTLA 4F2MB 3V0AC 3MV7D 1EMTL 4Y1AD 3IJHB 4H1LA 5TF0A 1KCRL 1ED3B 4WEUD 2GTZA 5EOCH 3UJJL 2RFXB 3MFFA 2GAZA 4ZDHA 1MSPA 4R8WL 2UZYB 4G42A 3P11L 5K9OA 3F8UB 1QBBA 3ZLQC 2OX5A 3TBWA 5E8DL 5D2NB 2XG4A 5I2IA 5ITBL 1G84A 2VL5B 1KTRL 3OWEA 3HZVA 2C3VB 1KEML 4CW1B 1S3KL 2BY1A 2Z8SA 1A5FH 4DTGH 3V8OA 3B2VL 4I77L 3SKOB 1F4WH 4NKIL 1NCTA 4OI7A 4WU5B 5IB2A 2E9IA 1EO8L 5D7SL 1PQZA 4MJ6A 3TNMB 2GSGB 2BVOA 5F7FA 5IFAH 2QV2A 3SDAD 1I1FA 2ATKA 3H9ZA 4YHYC 4RFOL 1QSEA 2JK5B 3P77A 4LSQL 3ELAT 4AENA 1WZ1H 2VABA 4LP4A 4RAVB 3GMOA 4KJYA 4WTXA 3QEGL 4G43A 4X9IA 2WWMC 3OB0K 4R4FL 3EDFA 3G08A 4E41B 4DN3L 4K94H 3MACL 5IJVB 1BFOB 3KJ4B 4PB0H 2V5YA 3H9YA 1KJ2B 3PDOA 4XC1H 3ULVD 2AV7A 4TUKH 2ADIB 3GM0A 4LSTH 1U42A 2WSKA 1YY9D 3OZ9H 3DVNB 1EXUB 1V05A 5TE7L 4EIZC 4JDVB 2OK0L 3H9HB 3QDAA 1KIRB 4L4TB 4URTB 43CAB 4LARL 5DJZA 1II4E 3LKRA 3LQZA 3QDMA 1E4XI 2BY0A 1N8ZA 4ZAKB 3CX5K 2ZZUT 4KRMB 3O8XC 4JFYA 1AGDB 4MD0A 1LEGA 3BO8B 5ELIA 3D85B 4NZDA 5INCA 3QFDB 4N68A 1P9MC 3RVXD 4J4PA 5FA3A 2IAMD 4YK4C 2QHRL 2ZCHL 3QUXB 1PKOA 3LMJH 1DBMH 2VLKD 3QCVL 4FMFA 1I7RA 4MS8C 4F7EA 4JKLA 3C60C 1QYGH 1S7SB 5I1KL 5DRNA 3BQUD 1U92A 1D5MA 3QIWD 1UH4A 2IMMA 1A7NL 1A3QA 5C09B 5C0AA 3MRPA 3AAZB 3LHPL 4KDTC 3BP4B 2YXFA 2P8LA 4H0IA 2GK0B 4QRRD 4IM8A 3HG1B 1VHPA 2V2WA 4CUCA 3S88H 4KK9D 3QXUA 1QRNB 3PWVA 4AL8L 4M1DL 4LLQB 1U8JB 1Y6MR 2CIIA 4NWUH 3TIDA 5HHME 2BRQA 5SX4I 2CH8A 1NAMB 1ETZB 1N7ML 4OLWL 2CRMA 3TYFB 4G8EB 4XMLH 1QLRB 3KYMB 4OGAD 4ONHB 3RUGF 4JVUA 3JTTA 4LHQB 4JFOB 2DQEL 5I8CB 3GJEA 5FO7B 3FL7A 2W92A 2AJXH 1F3DH 4EN3C 4Z7WF 2B8OT 4JRYE 4ONGH 4IDLA 1PEWA 2PYEE 1FC2D 4I9WD 2XNAA 1I9JL 1QSFD 2IANB 1SYSA 4C57C 1S7RA 3KPOA 2YKLL 3UDWA 3BGMB 2QSCL 4RMUA 4DZBB 4KWUA 4YNYB 4K2UH 5FV2A 1ADQA 4HK0B 1EZVY 3BZFB 3MRRA 5C2BH 1AE6L 1CFSA 2VXTL 2B1HL 1I7ZA 4QT5B 1KCSL 4WW1A 4LHUG 5D7KD 4RWYH 1FAKT 3DYMA 5E9DE 1FZKB 2ZKHH 2WBJD 4LSSH 4QXUH 5JZ7C 1XGQB 3VXSA 4X4MA 5GRUL 1G7LB 3U2SB 2JIXB 2JE8A 1NGYA 1DQLL 3VG0H 4R2GC 3OSKA 2R0KH 4WI4A 5E5RB 5KS9F 3LH2L 4ZFOB 5HHOD 3RVUC 4TQEH 5T5FH 3MXVH 5I30H 5CIPB 3B3IB 1IAMA 4HWBH 2CMRL 4LGRB 1U8HB 5ILTH 4X0KA 3MCKA 3EOTL 1OT2A 1NC2B 4Q6IB 2I60H 1S9YB 1QNZH 3RWFB 3RWIA 3UJIL 2VZ1A 5CUSH 5JDSA 5KVDH 4GS7B 4XNXH 2DM3A 1I3VA 4L9LB 1WLHA 1K8DB 3QEQD 5BZWA 1CTOA 1EFXA 3DO7A 5D70L 4JFQB 1I9RH 3NN8A 5D6CA 4IRZH 4JY4A 4X6BB 5FHAH 5T1KB 3L6FB 5IFJB 1ZHKB 3O2DL 5TFSH 3Q2CA 1RJYB 3MO1B 3QO1B 5SWSE 3I6LE 6FABH 2D7PA 2EDNA 3T09A 1SYVB 2DQGL 1ES0B 5DK0A 1P4IL 2YZ1A 4HJGB 5JOFA 2DQHH 1ODAA 1T1XB 4QHUA 1IAIL 4GG6E 2QLVB 3AY4C 2ZNWA 2APBA 4A6YB 3HUJF 5HI4C 2XN9D 5EDXA 2BJML 1TDQA 4JR9L 2DBLH 4NQEA 2J3SA 5EZJA 4GMTL 1ZT1A 3VWJB 2F15A 1X5AA 2QQKH 1U8QA 3KWWB 3BFOA 2ZCKL 1AGFB 2VZ3A 4FTVB 2A6KB 3ECBA 4JFPA 1K9TA 4DKDC 4H5SB 2X44D 1IGML 1KACB 1FZMB 1URLA 5ESVB 15C8H 3X17A 5IFHH 3NFNA 1EEQA 2YPVH 3VCLA 4QTHB 4WFFE 1XF2A 2OTUB 2VWEC 4OI8A 3NCBB 2J7LA 4NCC2 5I1DB 2JJTC 5F9OL 3STBA 1VEOA 2PN5A 4XAWH 3T1FA 3N0PB 1J1OL 1JCKA 1MFBL 5E94A 1KFAL 4PTUA 3RIAF 5FCSH 1AFVH 4KROD 3O3DA 3VXOA 3C6SB 1DP0A 5ALCH 1LO4L 5JORB 4PLOB 2M1KA 4GRMA 1C5CH 4O2EA 1HOCB 4N8VG 1IAOB 5F9WB 3HMXL 3QFJD 1F2XK 4JRXD 3DV4A 5HHVH 5CINH 2OTWA 3WD5H 5I1EH 4K94C 3T1WA 1ZT4A 4HKBB 1AC6A 3QCTL 1IQWH 2W9DL 4XBEH 2G9HB 2VUYA 3MC0A 5K33A 1QZ1A 3GBNH 4JDTH 4JHAH 5DVNA 2A9ML 1S7QB 3EYUH 2FCBA 2R4SH 1SEQH 4G8IB 2FBJH 4KXZH 5I8OL 4N8VA 3LRHA 1JNJA 2VDOL 4CBPA 2J12B 4L8SC 1MRFL 3QCUL 5DQDL 3GSQB 3TPKA 3DMMD 3QAZB 4G8GA 4FQXB 4JLRB 4O4YL 4QY8B 1W2KT 4U6YB 1AH1A 3FKUS 4PGEA 1FNSL 1AGCA 1T0NB 1WWCA 1P4BL 2IMNA 2X9YA 3AREB 3RDTB 3SY0B 5JMOC 5KJRL 4OB5L 4P2RE 5L7XL 4PJEF 5EUOA 1NCAH 1JE6A 2HKHL 5HDQH 3H9SA 3GSWB 4RQQA 1MFNA 1SHMA 2DJSA 2BSED 4LLMA 4Y4HC 5I1AB 5IBLC 43C9B 2FDBP 3HNSH 3V4UL 4PRHE 4ZXBD 4GKSA 1HDMA 2IPTH 4MNGA 1QLFB 1BX2A 2IH1B 3O4OC 2UV3A 5ENWA 4QCIA 5DJ0A 4ZQKB 1VFBA 4JM2C 4HC1A 4QWWC 4S1DC 4BFIA 3ULVH 4HS6A 4KVCH 4OM1L 3WSQH 3QWOB 1I1CA 3EGSA 1N0XL 3UYRH 2AERT 5IMKA 4EDWL 5CCKL 2X41A 5D7JA 2F58H 4OZIA 1QFWM 2X42A 5CBEB 3UTSD 4F2MA 2AP2A 4H25B 3IJHA 4HS8L 1D6VH 1KIPB 3CDYA 1ED3A 1OGAB 2AI0H 5L2KD 4OJFL 2CDEB 3OJVC 2XFXB 4NO2A 4NFBA 4HUVB 2NX5E 2JB5H 1XR8B 4Y19E 5CJOH 5D2NA 4F57L 1X6LA 2VL5A 5CSBA 4X4ZA 1W8NA 4CW1A 1BIIB 1N5YH 1OQOA 1OW0C 5HGDB 1HYRC 4Z8FL 5JDJA 5SWQB 3UPAA 3SKOA 3N85H 3MRQB 1ZE3C 5J57B 5HI3C 2P5EE 4WU5A 1KGCD 5I19L 1MCBA 4PS4L 2VYRE 4PUBH 3TNMA 2GSGA 2FIRT 4MAYC 4UU9A 2FD6L 1IKFL 1OP3H 4H88L 1PEZA 4YX2L 2JK5A 3RHWK 5DRWB 4RAVA 3MMEB 1XIWB 3SGEH 3O6LL 2ED8A 2OTPA 1NMAH 2PO6B 4E41A 2BVYA 1MLCB 2IBGA 5IJVA 4Q58C 4QHMA 1BFOA 4K8RL 1YEIH 1CBVL 1KJ2A 2ADIA 3MJ9H 3DVNA 3ARWA 1EXUA 3MCLL 3H9HA 1KIRA 1NMBH 43CAA 4P4KD 4RBPK 5K9JH 4CRPA 4ZAKA 4OCWH 1NGQH 5B3JE 1AGDA 3BO8A 2MOVA 3D85A 4EIGB 2ZOKB 1R3IL 3QFDA 5DRZB 2DQUL 3ZE1E 1X5KA 1UXWB 3QUXA 1TTUA 3DOSA 4AZ8A 1S7SA 3S35H 3BRGC 4PPTA 3P4MA 3E1F1 1YYML 3IFNL 3PG2A 5C09A 2UWEB 3AAZA 2CLZA 3BP4A 4AJ0A 4FQCH 2GK0A 4CGTA 4JJ5B 3HG1A 1T03H 1FO0B 2D31B 4KKBD 1N6QL 2YEZB 1QRNA 5C0BB 3WUZA 3QUMB 3RA7H 4HG4K 4O02L 4U1JB 5C6PB 1U8JA 4PJGA 1RK0A 4OKVA 1G9EA 1OTTD 3DTXB 3VFTB 3QRGH 1Q1JL 1NAMA 1ETZA 4KUCF 3TYFA 1BF2A 5GZOC 5I6XC 3MRLB 2O5ZH 1QLRA 3KYMA 1VERA 4I3RL 4ONHA 3RJQB 4YGAB 4M6ML 1JUFB 4JFOA 5I8CA 1UM5H 4HK3N 1VFUA 5FO7A 1R0AH 5I1LB 1EEZB 1OAZL 5DMGD 4UTAL 3BDBA 2VN4A 4TUJB 3PE9A 4APQC 3V2AR 1L7IH 2IANA 1EV2E 1VDGA 1QKZH 1IM9B 4ODUB 4LMQE 5D5ME 3MXWL 3BGMA 5K59E 2NY2B 3H6JA 4I0KA 3EOBB 1Z2KA 1PFCA 4HK0A 2P5WD 1E4WL 4NN5C 4LMQI 4WUUE 4HIHB 2AK1H 4QT5A 1J8HE 1LVEA 5LJYH 2OLDA 3RAJH 3DNKA 4F8TA 1QFOA 2VLRD 1NCDH 1GGTA 3W9DA 4P2CG 4Z76B 1MFAH 1XGQA 1WFUA 5FM5M 1G7LA 3U2SA 2JIXA 3T2NH 3MRHB 4R26L 5ITFB 4RGOH 2WLYA 5LBSL 4P99A 2BNQD 4PJAB 4ZFOA 2DQTH 3ULUH 5CIPA 3B3IA 2EDOA 3NFPB 1U8HA 1UFUA 2Q1EA 2OJZH 1RUAL 3KPRA 2R0ZH 4U2YA 1FG2B 3SDAC 4Q6IA 1FRGH 1S9YA 4X5WB 4LQFH 3RWFA 3RGHA 5I1CL 3AC0A 3ARTA 3QULB 2F53B 4L9LA 3NABH 3EJZD 2JELH 1Z9SA 4YAQB 1V3MA 5F70A 3UEZA 4WNQB 2XTJD 4Z7QF 5CILL 1WFTA 5BVPL 1KB9K 4I0PD 2XACC 4YXKL 4C83B 4JFQA 5EBMB 1S7VB 4XMKH 5T1KA 5HYFA 5GZND 3L6FA 5E7BA 1ZHKA 5IFJA 3ULVC 3F62A 1RJYA 3MO1A 3QO1A 2LV4A 4J6RH 1YY9C 4XPGL 3WLWD 5KBNC 5MEQB 1MFDH 3MJ7B 4Z7UE 3A0OA 4OZHE 1SYVA 1ES0A 5IHUL 3F58H 1HIMH 4HJGA 3P4OB 3OMZA 1QHOA 1T1XA 4GAGL 3CVHH 5EWIH 1M7IB 5KVMC 1CF8H 1ZANL 1DN0B 2J8UF 3FB8A 4FQJH 4A6YA 1S8DB 3RVXC 2IAMC 2V2TB 1QLEL 2DL2A 3CFIC 4L3EB 3FFCB 3QSKB 3QXAB 3RU8H 4HWNA 3VWJA 5DJXB 1UADC 1XCTB 3KWWA 4RISH 3BQUC 1AGFA 1FORH 4FTVA 2A6KA 4RGND 3QIWC 1DQML 2PW1A 4DKFH 3OXRB 4DGIH 3LZFH 4H5SA 4NUGH 1FZMA 1U8IB 2YK1L 3IDJB 1T7WA 1LK2B 1VSCA 1KPUB 3C6LB 2OZ4A 4QTHA 5FM5O 1OTSD 2OTUA 4LCWB 1BZ9B 1YDPA 4OCXH 4V1DD 2QTEA 5I1DA 3UYPA 4WWKB 4POYA 3RX8A 1F8TH 2SEBA 3Q6FB 1NQBA 1YMMB 5HVHB 2XRAL 1C16B 1CG9B 3MBEB 1ZGLB 4OGAC 1B2WH 2V7NB 4N0RA 3QIUB 3TO4B 1RULH 5JORA 2VUOA 1RI8A 5T3ZD 4G8FB 1HOCA 2CIKB 5JXAL 1S9WB 4LAQH 4ODTL 4W70A 2ESVB 4DQOH 3IKKA 4UTBL 4YZFE 4P46B 1LO5A 4PJIE 3CZJA 1KJ2L 4UBDC 1NJ9A 2XYCA 5E7FA 3SE8H 1T89A 4HKBA 2EDLA 5FV1L 3UTTE 2YSSB 4RAUB 1MIEL 2G9HA 4G9DB 3S34H 4MA7H 1MCIA 1P7HL 2F9BT 4GKZB 1MQKH 1S7QA 3T4YB 3MLZL 4G8IA 1K2DA 4S11A 4NRXB 3WFDH 3P9MB 5FYJE 4JB9H 1DLFL 3S96B 5F6IB 4NBXB 4JLRA 4QY8A 1T0NA 2QSVA 4QHLB 4YBQD 3SY0A 3AREA 4W6XB 3RDTA 4GBXB 3ZDZE 2HT4D 2CGRL 5BS0E 4P2OB 3KGRA 3MLYL 1OAUH 5EZIL 3UZQA 3VA2C 3RPIB 3AS3A 4FFYH 3HI5H 5CBAB 2HRPL 2BDNL 3TVMB 3A6CH 4HX1B 4QRPE 1RQ5A 3GSWA 2D7QA 4Z0BL 3QDMD 1F4XH 4R97C 5I1AA 5C07B 1D5IL 3UC0H 43C9A 3H42L 5CAYB 2R4RH 4TNVF 4FABL 1JRHH 3EYVB 4J4PD 5JW3H 1QLFA 3TIEB 2IH1A 3MYJB 4ZUWB 2Y5TB 3DVIA 3MBXL 5F6HJ 1V3KA 2J4WH 3L3KB 1ITCA 3G6DL 4MQ7B 3RWCB 3AFLA 1J0ZA 1W72H 2Q8BL 2J6EA 3QWOA 2XOTA 2VDML 1A7OH 4LCIL 5ID1B 2Y25A 4MJ5B 1DQTA 3VXUE 1NANI 2E8ZA 3O41B 4OCYH 4PRPB 5CBEA 3SJVE 3OKYA 1PDKA 5D7IB 4AEIL 1TFHA 5KVFL 4MMZC 5ID0B 5E1AB 3IFLH 4H25A 3MRFB 4PV8B 1OGAA 4JG0H 4I48A 2CDEA 3P0VH 1YEFL 5BJTB 1A6TB 5L8KB 4OBRA 2XFXA 2V17H 3P0GB 4OQTH 1XR8A 4Q9RH 1MI5E 2ITCB 3BSZH 1FGVL 3P0YL 1HKLH 3U7YH 2NY3B 1XF1A 3O4LE 3VE0B 3UCRA 5JR1L 4Y5XC 5A3IC 3V9FA 4OKDA 5CP3H 1BIIA 1RK1B 5DZLA 2GJ6D 4KRLB 1J5OL 2A73B 4ETQB 2FYYB 5AD0B 3BUYB 4NDMB 3FMGH 1N64L 4WRLA 3MRQA 2FHFA 2OMBA 4PRNB 4KC3B 3C2AL 4JQVA 3ULUC 2AGJH 4JM4L 4KROC 3K8LA 3HI6L 5GS3A 2P8PB 2NYYD 4WDIB 2PTUA 3WE6B 1A9EB 4ODSL 3EO9L 4PRIA 2LTQC 5C0RH 3U9PH 1HYSD 2OP4L 5DRWA 3CSGA 3I6GB 3MMEA 1FPTL 1XIWA 2ADGB 2M26A 2WP3O 2L0DA 2XQYK 1LEKB 5KVGH 2PO6A 3D0LB 4KTEL 1ND0B 4PBVC 1UCTA 4WU7B 1KIUA 3DGCR 3ZL4L 3J8F7 1RIVH 1GGIL 3O6FB 5F7DB 3D18B 4J3XA 4DAGL 2EKSB 5FHBH 2PTVA 1L4IA 4I18C 4FQQB 4L4JA 4A6YL 5HPMB 2J2ZA 4UOJA 4ONFL 4YO0B 1TQCB 3QUZB 5CGYD 4DEPB 2AQ1A 1WK0A 3SDCB 2Q87A 3NTCL 4Q6YA 2C1PB 4FZEL 2ZOKA 5DRZA 2AJ3B 4LPCA 1I85C 4FHBD 1UXWA 4RA3A 5FDYA 5DVMA 5E8PB 1LE9B 1A6UH 1NFDB 3OKKB 4RDQG 3BZEB 4B7LA 3FN9A 4XAKE 3VGBA 5JHDB 3G6JF 1Q0YH 3SE4A 1ZMYA 1ZK9A 2GUOB 2UWEA 2OZ4L 4G6MH 5CJQL 4JJ5A 1GAFH 1CXEA 5T1DL 4NOFA 1FO0A 4GLRI 1ZA6B 4OLXL 5DJCB 2D31A 5EU6E 1V3JA 4I4WB 1CFBA 2YEZA 4LKXB 5C0BA 3ZDXF 4ZXBC 3QUMA 1MCFA 1H3PH 4U1JA 2R56H 1UC6A 3OAZK 4NQED 3DTXA 2VR5A 3VFTA 3ZHKA 1RJLB 3MRLA 4LVOC 1AI1H 1U95B 1JUFA 5I1LA 4FQLH 2O5XH 1EEZA 5HHQB 4HWEL 1G1CA 4BK5A 5I1GH 4TUJA 4EI6A 3IETB 1P4LB 5JXEA 4TOYL 2VH5H 5HDBE 3WS3B 1IM9A 3D39E 4ODUA 4KUZL 3RNKB 1EJOL 3RPKA 1NUNB 2VDKH 1IBGH 3BPNC 4QRQB 3EOBA 1RU9L 1V7NL 3BPCB 4CU6A 4X80L 4HAGA 3ET9F 4HIHA 4NZRL 3PGCB 3HE7B 5L0QB 2UZXB 2YD5A 3GZKA 2IQ9L 4O5LL 3E8UL 5E99L 3GHBL 3CC5B 1OAYH 4R7NB 4U6XB 5E4EB 1TNMA 1MHCB 3OV6A 3PL6A 4OD1H 3N9GH 5JQ6L 2H45A 3MRHA 4MNQE 2GCYB 3MGOB 5ITFA 5KSBB 3FAXA 2Z4QB 1DTUA 4Q9QL 5KN5B 4PJAA 5IEKB 1N26A 1MH5B 1TVBB 4HUMB 5D6DA 2AAVA 3NFPA 1RZIB 3HE6D 4LRIC 1N5AB 2AXHA 4OGXL 3SQOL 4CL7A 1FG2A 4ZS6D 4ZFFB 4X5WA 5T3ZH 1KT2B 3MZGB 2LU4A 1HINL 3QULA 1GH7A 5F7NC 3RKPA 2F53A 2NNAA 4G5ZL 2XQYG 4YAQA 1WEJL 1MREH 4WNQA 4GW1A 4P3CL 4HXBH 1RIUH 4GRWE 1E6OH 2YOCA 4KRPD 4C83A 4HUUB 5EBMA 4K71B 5D7LB 1S7VA 1ZLWH 1ZGLP 2ZUXA 4RMSA 4LSPH 4QOKB 5MEQA 1KOAA 1ZS8A 1HI6B 3MJ7A 4NJ9H 2YD4A 3P4OA 2BRRH 2IGFL 1T6VN 1M7IA 3CFEA 2WZPD 3VXPB 1DN0A 4GG8B 1MCRA 5KG9B 2B4CL 1S8DA 1WC7B 3PQYB 3VG9C 5LQBL 4M4RA 4L3EA 5BRZE 1NGPH 4IJ3C 4O2FB 3FFCA 3D25A 3QXAA 4F7TB 1TZGH 2DDQL 5DJXA 1XCTA 2BERA 4YFLF 1HILB 3BGFC 3VMPA 2EDQA 2A77L 4G6AD 1SJEB 2X89D 1HNGA 2VISB 4NWTH 4PGZA 5D7JD 1KBGL 3IDJA 5D1ZD 1U93B 1LK2A 4HIXH 4KKBC 1ZWIB 3O81A 1KPUA 3C6LA 3SE9H 4LCWA 4KUCD 5C86A 4H0HB 5DEFB 1OTTC 1RSFA 4ODVH 3Q6FA 4JY6B 5T1MB 4AMKL 1SJVA 1YMMA 5ESAB 2AK4D 1C16A 1CG9A 3WN5C 5H37H 4XVJL 3MBEA 1X5GA 4ODWB 1EJ6A 2V7NA 3BDYL 3QIUA 1QVOB 3TO4A 2V9QA 4YHYB 3SDYH 4MLSA 4G8FA 4DKEL 4ZS7H 5DMGC 1ONQB 3BH8B 1S9WA 5E4IA 3KDMA 2ESVA 2ZSVB 3Q6GL 1OGTA 2R1YB 4KV5E 4P46A 4TSCL 1OSPL 3KS0J 4S2SB 4NM4H 3V4VH 3EYQD 1ZEAL 2HG5B 3MV8B 2YSSA 2P24B 4RAUA 4ORZC 1IAIM 2ERJC 4G9DA 3NPZB 1WTGT 2YUVA 2IQAB 3FZUD 2B5IC 1CK0L 4F58H 2KQNA 4NZTH 5DD0L 3CDGB 4QO1A 2BSTA 1RAMA 2MPAL 1G6RL 3F7VB 1I3UA 2ORBL 3T4YA 5IHBA 3VGGA 1FZOB 4Z7NE 1OAXH 4NRXA 2IJ0C 3P9MA 1JNLH 1IJ9A 2D4FA 3S96A 3O8XB 2W9EL 3KLDA 3CK0L 3D1MC 5GJSL 1OLLA 1B0GA 4YK4B 3EDKA 3TZVD 4E41D 3QHZH 3C60B 4X9HA 4QHLA 3HRPA 1MJJB 1ACZA 4GBXA 5HXMA 4JKPL 4P2OA 1KELH 2IBZX 3QNXB 3RPIA 2XZQL 5FUCC 4U05A 4X7SL 1AR2A 3DETD 4UDUB 4XP4H 5CBAA 3TVMA 4HX1A 1MRCH 1MF2L 1IGJB 5C07A 3S4SG 3EJZC 5GJTL 2R0WH 1J86A 1TJHH 2XTJC 3EYVA 4Y7MA 3TIEA 3MYJA 3QUXD 4I0PC 2Y5TA 2C4FT 1BBJB 5EU3B 3ZT7A 3Q1SL 2OL3H 3T65B 4MQ7A 3RWCA 4OLYL 4OFYA 2F54B 3QXVA 4OD3L 3WLWC 1J1PH 3CVIL 3E6HB 5ID1A 5JW4Q 4EN3B 2R1WB 3O41A 2HFGL 4PRPA 5ANME 5D7IA 3R0NA 4PV9B 4H8WL 1EH9A 5ID0A 5E1AA 2BP3A 3MRFA 4U6VL 5DJ8B 4LEOB 3RUGE 5ICYB 5BJTA 1YJDH 1A6TA 5BV7H 1CU4L 5HHXL 1A22B 3IRPX 2NZIA 5GRJH 4MD5B 4MA1C 2ITCA 4RGNC 3VE0A 5SWZD 2R15A 1B4RA 2AKRB 3U36B 2Y6SD 4TYUA 1I8LC 1RK1A 2A73A 5LG1A 4KZDL 4LDOB 3RX5A 4ETQA 6CGTA 1M1SA 2FYYA 3BUYA 1XF3B 2UZIL 1OTSC 4FFWD 1VGEL 4MJIE 1MOEA 4NDMA 4R2GB 2Q8AL 3ILPB 4OZFG 4XI5D 4PRNA 4NO5B 1CD1B 4X4XA 2X70B 1CGSL 1EFQA 2DQCH 3Q3GB 1SBSL 2P8PA 1UACL 3QQ9D 4WDIA 4RMTA 3WE6A 1A9EA 2HP4A 2FX7L 2CD0A 4HF5L 4FQIL 5MP6H 4ORGB 5FM8A 4WFGD 5I17B 5EZOH 3I6GA 2A9NH 2ADGA 3MOAL 1B6UA 2VNCA 1LEKA 2FJFB 1PD6A 3D0LA 5CS7A 5JPNB 4G7YL 4IBLT 4JPKH 2DLFH 1ND0A 1NMCC 1BGXL 3GNMH 3JV0A 4WU7A 5K9KB 2XZZA 5DHVH 3C87A 3W5MA 1IGTB 3OAYK 4XPAL 1F45A 1MCOH 5H8DA 3O6FA 5F7DA 3KPRD 1CYGA 1U3ZA 4FQQA 5HPMA 3FCTB 4YO0A 5EO9B 3DV6B 4HJJH 5J1AB 3FO0H 3SDCA 2C1PA 1YNKH 4LDEB 2AJ3A 2DQFB 4UNUA 1EEYB 5A2KH 5E8PA 3ZZ1A 4NO3B 4OV5B 5B38B 1LE9A 3CGTA 3CXDL 1NFDA 5E08H 3HNTH 2HT4C 4HFWB 3OKKA 4HCRA 4R4BB 3W11D 4HG4J 5BVJB 3BZEA 4OLZH 3MPCA 5JHDA 1MRDH 3DGGB 4Z7VE 2GUOA 3GSRB 3MJ8B 5JMRA 4IOIB 3GRWA 3HUJE 4ZFGL 4EXPX 1UZ8B 5DJCA 1X5ZA 3NCCB 4JN1H 2CLRB 4LKXA 1MJ7L 4NNPL 1QFWH 2FRGP 1MFEL 4J4PC 4NZUH 4UQ3B 1VA9A 4HV8A 3PGDA 1FYHB 4N90E 4N0FB 1RJLA 3VWJD 3SKJH 3MRJB 5IB5B 4FTVD 1U95A 2C9AA 3GMMB 1JK8B 4NC1E 5HHQA 5J6HB 3K4DA 1EEUA 2ZCLH 3CPLB 3MLPA 3IETA 1P4LA 4DWHA 3BZDA 3KPSD 1C5BH 3WS3A 1LQSR 3RNKA 1QFPA 4XP1H 5FGCE 2GQHA 3KXFD 5GGRA 12E8L 1JPFB 2AJUL 3AXLB 4NJAH 4XNUL 4X6DF 2V5TA 5FGBC 5DQ9B 1DL7H 5SX5H 1WZMA 3HE7A 3PGCA 1SJXA 5F44A 1MCSA 3VA6A 4D0CB 2VDPL 1R5IB 1FH5L 2FEEL 1FFNB 4OGYL 4LF3B 3CC5A 4L8SB 1GZPB 1JPGB 1Q0XL 4R7NA 3QEUB 4U6XA 5DUPH 1MHCA 1V5JA 5JA9A 5FYKU 3K80A 3ZTJG 2GCYA 3MGOA 5KSBA 1PSKL 1JPTL 1HK6A 2Z4QA 5GRVL 1LDPH 2ZP0T 5KN5A 5C08E 5C0CB 5IEKA 1MH5A 3D3VB 1TVBA 5FYJL 1BM3H 4M03A 3RNQB 2ADFH 1RZIA 1D9KA 1N5AA 2NYYC 3KPQB 1UKTA 1ZLUK 4ZFFA 1FCCA 2D7TH 3NFSL 4HWUA 4ZPTB 3V0WH 1HYSC 1OPGL 1KT2A 1DEEB 4Y4HB 1KCLA 5CSZA 5J4MA 1LP9E 4X8XA 1YEKH 3MA9L 2P7TB 4OZGF 2YD3A 3CH8A 2W9LA 4PB9L 2Y07L 2E7LC 3O4OB 3FN0H 3QO0B 1OSZB 3I75B 1CFVH 2E7BA 4HUUA 4JM2B 5D7LA 3ARED 5DT1L 3KR3L 1TENA 4ESKA 2Y1VA 4PRDB 3L5HA 1PG7W 2BNRB 3HZYB 3TLRA 4JFDB 1CFQB 3IU3B 4L29B 1BBDL 4KI5D 1HI6A 1LO3L 5KANI 1JMXA 2H9GB 3VXPA 5CGYC 3ZE2F 1O5DT 3STZA 4GG8A 5KG9A 4UV7H 4BA8A 3WIHL 1ULVA 1FFOA 1KB5L 1WC7A 3PQYA 2I07B 2BFVL 1OVZA 4GW5B 4F7TA 1YJDC 5BV7C 4TVPD 2YRPA 4YPJA 3OJ2C 4GQ9L 3QUYD 4MXWL 4XPHL 3M1BB 1SJEA 3TH2T 3MLXH 1A6VL 2VISA 3O9WD 3BE1H 4DKAA 4M5YL 1ZWIA 4CNIB 4PJBA 2YZ8A 3QDJE 5TF1H 2A2QT 4DN4L 2QKIB 2AS5M 1T1WB 1BQUA 5DEFA 1NAKL 4JY6A 4OCRL 5T1MA 5ESAA 1FYTB 5E6ID 4ODWA 1J1XL 1XH3B 4MAYB 1QVOA 3RKDD 3QIBA 3HC4H 1J8KA 4HULB 3KS0H 1ONQA 3BH8A 4AH2B 1UQSB 2W0FA 4JFHE 2HJLB 1VPOH 3UJTL 1DBJH 2ZSVA 3VXNB 2R1YA 1FNAA 1PY4A 1A47A 4R4ND 3S36L 1XR9B 3CLEL 3NAAH 2HG5A 3NPSC 2EECA 2P24A 3MV8A 2ICWB 5CJBA 1JZ2A 3DLQR 4JQIH 4MXVF 5GIRB 2IQAA 4WEBL 3CDGA 3D0VA 5E1HB 3MR9B 3BGAA 3BIBX 3F7VA 4HQQL 4PRID 1FZOA 1G9NH 3WNOA 1Z6JT 1LK3H 1WCBA 1XIWD 1JGUL 3ARDC 1I3RB 4NQDD 5TDPB 3RIFK 1WWAX 1P9MA 1A7QH 2PO6D 5CZXD 1NFKA 3RFZC 3C60A 1MJJA 4ALAH 1FIGH 4OFDA 2DM7A 1UYWH 5KZCB 3GK8H 4U3CA 1FBIL 2BZDA 3HE6C 3GRWL 5ECJE 4LDLB 3QNXA 1KYOK 1NCBL 2C3HA 1MVUB 2DICA 3AS0A 4UDUA 4G6JL 4KDTA 2Z9TA 3DYOA 2BOCB 1ROWA 1IGJA 2RAMA 4P2QE 4AG4H 1R3JB 5TDOB 3MV01 5AUMB 4OIBA 1DLHB 2DTML 5DUBB 4D9LL 3DXAD 3RWEB 5HGHB 5HYJD 3H0TB 3MV7E 5EU3A 1BBJA 4KRPC 4QTIL 5I6XB 4XCCL 1GOHA 2E9BA 2Y06L 4U1SA 3T08A 1I8MA 3T65A 3V7AE 2IBZY 3ZE0E 2F54A 4N0YH 4F9LC 3NCMA 3E6HA 1KN2L 4EN3A 1MAML 1UM4L 1G0YR 4NC2B 4NQXB 4PV9A 3IKCB 4JKKA 3W9EB 3OKOB 4Y1AB 4HLZG 5GGVL 5C0BD 3S36X 4EBQH 2X4OB 5DI8B 1YEEH 5DJ8A 1QO3B 4LEOA 3OR7A 4KXZI 2YR3A 3WO3B 3T2OA 1HH9B 3NCJH 4UDTB 2D03L 1CDHA 4BSWB 4JEGB 1WSST 4NN5B 4DVBB 4UV4L 4XVSL 3W2DL 2IWGA 4MD5A 3E3QE 1GGYA 4G6AC 3DI2B 2DD8L 4M7LL 4XCFH 4KJQD 2AKRA 3U36A 5D7JC 5F93C 1A7PH 5D1ZC 1I7TB 3OB8A 3HPJB 3JUYA 1TLKA 3O0RH 1XF3A 4NIKB 4ZOCA 4HH9B 2VXSL 1NEZB 3ILPA 1G0XA 1G1YA 1A0QH 4NO5A 1CD1A 2X70A 5BXFB 3K46A 4ZSOE 4CJ1A 3Q3GA 4NP4H 4ELMB 1FDLL 1LHZA 4W6YB 1JPSL 5GXBB 2GK2A 1IC7L 2ZPKH 1BQLH 3SDAB 2VC2L 4XHQA 4LSVH 3LDBC 2EEBA 4ORGA 3QDGB 4JHWL 2YD7A 4ZUVB 4RBPH 3WHXB 1SVCP 3PL6D 2CR6A 3L1OH 2VMFA 5D2LB 5EU5B 1DBKL 2FJFA 3DUUA 4PG9B 5B39B 3EYQC 3HCVB 4WO4D 5JPNA 4U1GB 1FAIL 5T3XD 1MELA 3ZO0A 2R29L 1J18A 3WFCH 2EKJA 4OT1L 5K9KA 5B38G 3R8QA 3FZUC 3IS1X 4GMSH 2NQCA 1JF1B 3U7WL 3IT8D 2EIZA 1M7DB 4BZ2H 1LNUB 4X7DC 3FCTA 5EO9A 3DV6A 5IHLB 1S9VB 3AY4A 2A1WL 5IT2L 2EDRA 1H3TA 1HHJB 2ZJSH 5J1AA 4YHKH 1OT1A 4F33B 4DW2L 2IAMB 2DQFA 2VLKB 3RQ3A 3TZVC 1EEYA 1MJUH 4NO3A 4OV5A 4NRYB 5B38A 1DBAH 3MX0A 4HFWA 2JCCE 4BJLA 3CMOL 1CLYL 4R4BA 3BQUB 4CVUA 5BVJA 4UT9H 3U4AA 4F15C 3QIWB 4D0DB 4JG1H 3DETC 4JO2L 3GSRA 3GBML 4WENB 3MJ8A 2DWDB 2J8UE 1A1OB 4QRRB 2B2XL 5FYKD 4N1HB 3T04D 1UZ8A 2ID5A 4MWFA 2CLRA 1JHLL 1RVFL 3DUSB 4GG6A 2MTPA 3PV6B 3MGAA 3JTSB 2JJTA 3BZ4B 5D9SB 2OS7A 1QSFE 3NOIA 4OFIA 4UQ3A 4TNWK 1L7TH 5F7KC 1MEXH 3QUXC 4N0FA 3SGEI 1KCUH 3IU4L 2C3XA 2YA0A 5KVEH 4JPIB 3EDDA 4FS0A 5HPOA 3D69B 3MRJA 3WO4B 5IB5A 4MVBD 2CUHA 5MENE 3GMMA 1JK8A 3AMLA 5J6HA 4FQ1L 4KK6D 1INEL 2Z8WC 1CFNB 3D6GA 2W0PA 4QNPF 3OKLB 3CPLA 3CFBB 2PR4L 4HK3J 2V7HB 5EC2B 2G2RB 4PJ5A 3L5IA 5DMIL 3GI9L 3VFPB 1FNEB 1NBZB 5GHWH 4LLDB 4KMLB 3LB6D 1JPFA 3AXLA 4TVPH 3MRDB 1PLGH 5DQ9A 2ENSA 1YMMD 5E2JA 2FHCA 1WITA 5IIEB 1JZ4A 4X6EB 3L7EB 2ED7A 4K23L 2J6EH 1FFNA 4LF3A 5AZEH 2O26U 1G9NC 1PKQE 4L8SA 1GZPA 1JPGA 2Y6SC 4Z5RB 3QEUA 5CZVL 1AO7D 3GSNH 3HKFA 4YHIB 2Q6WB 1CCZA 3VGAC 1JWUB 4KQ4L 3V6OE 4FFWC 4P46D 4CKVX 1RUPH 2CUMA 5HHOB 4YHOL 3SBWA 5B22A 3EAKA 3D3VA 5J8OA 3RNQA 1CLOH 3WKNA 3MRKB 3PDGA 3MNWB 4BZ1H 4UINH 4X7TB 3VXMD 3KPQA 3G04B 3GMRB 2W91A 1EMTH 4NQCE 4P5KB 4ZPTA 1DEEA 2HKFL 4R97B 1F00I 4Y4HA 1G7QA 2ILLA 2J1KA 3UJJH 5T1LA 3TWCL 3RP1A 3QEQB 2P7TA 4R8WH 3P11H 5FCUL 4B50A 3UXFA 5E8DH 3QR2A 3QO0A 5KANG 1OSZA 1H3GA 1EAJA 3I75A 3PWPD 5JHLL 2BC4B 1FV1B 4GBXD 4KVNL 2XN9E 3P4LA 4LSUL 2UY6A 1KEMH 4PRDA 3N1QC 1S3KH 2BNRA 3HZYA 4P2OD 5HI5D 2Y5EA 4PJDB 3L3GB 4JFDA 5DR5L 4YHML 1CFQA 1I9IL 5D72L 1GPOL 3B2VH 3EIFA 1D3CA 3N1PC 4NKIH 5GPRA 1EO8H 4X6FB 5D7SH 2K9UA 4PRHA 4XXDB 4XT1C 2I07A 1UXSB 2VDRL 4GW5A 4RFOH 2ZSWA 4PJCE 4MZ2A 4JPVH 3WNNA 5HYEA 4JHZA 4XNMB 3W11C 3T0ED 2VRAA 3M1BA 3QEGH 3B9AA 5D4QA 4R4FH 4Y5XB 2AJVH 4DN3H 3I2CL 2CRZA 3MUZ1 5I71C 1IMHC 1OW0A 3MACH 2EH7H 4NQSB 1NBQA 3QUKB 7CGTA 5CGTA 3P30L 2QKIA 1IKNC 2CJUL 2EIBA 1T1WA 2CQVA 3OXSB 4JRXE 3DI3B 5GGSB 5TE7H 2OK0H 2X4QB 4LARH 4KROB 2HLAB 1FYTA 2NX5A 1XH3A 4IDJL 4MAYA 2DL9A 3JV6A 3AB0C 2LTQB 3VH8G 3VDBA 1F58L 3PWJB 2QHRH 2ZCHH 4XVTL 3QCVH 4AH2A 1UQSA 3QFJB 4JHBA 4PY8J 5DD5L 4Z9KB 5F9DC 5CHNB 3O45B 3GKWL 1KLUB 4W6WB 3VXNA 4M7KL 4BZYA 5CD5D 4N8CL 5EBLB 1XR9A 1YC7A 5E5UB 1A7NH 4L1DA 7FABL 2EIDA 4ZTOL 4NHCH 1IZKA 3LHPH 2ICWA 3RVTD 3VXRE 4M6NL 5GIRA 4MZ3A 3LIZL 4OSUL 3CFKA 3MR9A 2IBBA 4AL8H 4I18B 4M1DH 3QYCA 2O61B 1Q94B 4GH7B 5AZ2H 3DX9B 3CVHB 4LNVA 3MLWL 5D8JL 4MB5A 4OLWH 5EOCL 1N7MH 3RL2B 3WUWB 1I3RA 2DI7A 1NSNH 1CQKA 1LO0H 2ATPB 5FF6B 3V5DB 3I85A 1KENH 2FL5B 3F6IA 5MI0C 2AJSL 5KOVC 1MIML 3CAFA 2M2DA 4XVUD 3LKQA 1U8MB 3GJFK 1QOKA 2RQ8A 1MVUA 3O6FD 1A5FL 4DTGL 3X3GH 2QSCH 4XZUB 3ALXA 4K8RD 4S1SL 1A64A 1X5YA 5AAMA 1R3JA 5TDOA 4I1NB 5AUMA 1AE6H 4ZXBB 1DLHA 1AR1D 4RAHA 5IMLB 3QQ4B 4HSQA 5DUBA 3GIZL 1G7IB 3RWEA 3UTSE 1KCSH 1A7BA 4H26B 5HGHA 3H0TA 3TT3L 3UTZB 5T3XH 5IFAL 3G6JE 3V7AG 3SDXB 4LVOB 5L2KE 3EJYD 1RZJH 1OD7A 3K8KA 1DQLH 3TH3T 5JHDD 1T04B 4KI5C 2WM0A 2DQIL 1JZ7A 4OUUB 5BOZG 3ZDXE 1LD9A 3LH2H 5M7QA 4WHYH 2XKNB 4NQXA 3NBNA 3IKCA 5GRWA 5FO9B 4PB0L 2CMRH 4U7MA 3W9EA 3OKOA 2AXFB 3CFCL 2R23B 4XC1L 2X4OA 5I0DA 5DI8A 3BPNB 4CMHC 1QO3A 1NEZG 2ZOLB 1HH9A 1KJVB 4UDTA 1J7VR 4BSWA 1G7MB 4DVBA 4IIQC 1WBYB 3UJIH 4PJXB 1Q72L 3QUYC 4XBGA 3H3PH 2R2EB 1P5VA 3FO1B 3PJSB 1J87A 3OKDB 1CQYA 3O9WC 4XWOD 3DYPA 4NPYB 5D70H 5F21B 1DBML 1I7TA 3HPJA 1E28B 5AWNL 1REIA 2CO6B 3O2DH 1QYGL 5BO1L 3TYGL 5E6ZA 4HH9A 4AEHL 1GXEA 1NEZA 2IFFL 3LRSB 2CDFB 5B39G 1LMKA 3OR6B 1T5WB 1FIEA 2XY1A 2P44B 5BXFA 1MCHA 4PJFB 1P4IH 1KLFA 1UENA 4ELMA 5E6IC 3MLVL 1IAIH 3SDAA 5HYSG 1JRHI 5EA0L 3RKDC 3UO1L 5E0QA 3QDGA 3U1SL 4ZUVA 3WHXA 1T1YB 5A2FA 2B1AL 4NWUL 2YPKA 4PD4K 4GMTH 5D2LA 3CU7A 1IM3B 1EVUA 2C7UB 2ZCKH 4PG9A 4R4NC 1T2QH 4XP5L 5B39A 1F13A 3GSXB 1L0XA 3T2PA 1BREA 1E27B 3VMOA 3ZKMD 2CO7B 2H3NB 1VFMA 1IGMH 3WV0A 4TPRL 3L3OB 1W72B 4ONGL 1D9KD 4JZJC 1JF1A 4K3GA 2QQNL 4OF3A 5J06A 1MCKA 1M7DA 5IP4A 1LNUA 3NCYS 2WUCL 4K2UL 1S9VA 4J12A 4RFNC 1KFAH 1S7TB 2O5YH 1HHJA 1F11B 2G75B 2IAMA 3VG9B 2V5MA 2VLKA 4IJ3B 4Y5VC 2DS4A 1RHFA 1LO4H 3OAZH 2GKIA 5FK9B 1CTNA 4NRYA 3SGDH 5B3JF 5JTWA 4GUPB 4G80B 5D7LD 3U0WH 2ARJB 1EO7A 4UB0L 3ZE1F 3BGFB 3IDGB 1IGCL 3HMXH 4QXUL 3QIWA 4Z18A 4D0DA 1GJIA 1NKOA 3O3AB 2DWDA 1A1OA 4QRRA 2NY0D 2V9TA 4O9HL 5I1HL 2EICA 1D5BB 5IVXE 5GGVY 2W9DH 4RDQF 2JF1A 5T33L 3MXVL 4HBQA 5I30L 2RR3A 4LLUB 3PV6A 4HWBL 4D9QD 3JTSA 3BZ4A 5D9SA 5ILTL 5H94B 5GS0L 2LFGA 1EO5A 1GOGA 1H5BA 5A43C 2VDOH 3WN5B 4JPIA 5DQDH 3D69A 2P5WE 4ZO8A 3QNYB 2YRZA 4QHNA 4I2XB 3GM8A 2D7OA 1KN4L 1CFNA 1FNSH 3CH1A 3OKLA 1O7VA 4NM8H 1P4BH 4F8QA 2QADD 2V7HA 4LPUA 5EC2A 2G2RA 5KJRH 2R0LH 3IYLW 3KYOB 4OB5H 3V6BR 5TDNB 4IRZL 5FHAL 4NYLB 3OF6A 5TFSL 1FNEA 1NBZA 5L7XH 4LLDA 4XB7A 3O2WL 2F5BH 4F3FB 2HKHH 5F7EL 2HTLD 4GW4B 3U30C 1GHFL 2ERJB 3MRDA 2B5IB 5D5MF 3MJ9A 3IRZA 5IIEA 5E2TL 1HQ4B 5LGHL 4HH8A 4X6EA 4KDWA 3L7EA 4LIQE 3V4UH 4GRLD 3FQNA 4JFFE 2VLRB 1R3LB 3QIBD 4RMWA 4Y16B 4Z5RA 5KSUB 4PJAF 3FB6B 4GXUN 2AXGB 3IDXL 5DFVD 4HEME 4XNZC 4YHIA 2Q6WA 2FX8L 1JWUA 3PF2A 2IPUK 2QQKL 5C3TA 1DCLA 2DIBA 5C7XL 4X6CE 2BNQB 4OM1H 2IF7A 3PNWB 5HHOA 3JWNC 4ZO9A 3NA4A 2EO9A 5TH2B 4EDWH 1N0XH 2FO4B 2NCMA 1BJ8A 2XTJE 4FQHB 2FNBA 3NIGE 3X12B 3MNWA 4OLVL 3V79C 3WNLA 1XGTB 4X7TA 3G04A 4TRPH 3ZKXB 3ZYOA 4HS8H 4P5KA 1KNOA 1JP5A 4DUWA 1PG7L 3PL6C 3KHQA 4RRPG 3QEQA 4ZPVB 2YWZA 4JCLA 5E5MA 5K93A 3QJFA 4WO4C 4I0PB 2KPNA 4GSDH 4F57H 5ALCL 3C60D 2BC4A 1C5CL 5D6DC 1CLCA 1RZJC 4PJDA 3L3GA 2Z93B 5J3HD 3QBTB 4IOSD 2XIDA 3VFNB 4Z8FH 3RVVD 1AQKL 4QRPA 1H8SA 3WD5L 4FOMA 4RRPA 4XP6H 2F8VA 4X6FA 5I19H 4PREB 3F7PC 4Z7UF 1JIBA 4OZHF 5IVZB 1UXSA 4MCZB 2FD6H 4KHTL 1X4YA 1DANT 4FXGA 4YX2H 2BSRB 2FBJL 4XNMA 5HSFA 1OAKH 4MA1B 2EIEA 2AW2A 4RGNB 3O6LH 3WNKA 2X5PA 3S37H 2F54D 1IC4L 3BP5A 4UIKL 4JJHA 3QUKA 2GYSA 5J1TC 4K8RH 5T3ZE 1CBVH 4OAWB 1KTLB 4WHTB 1CXIA 3X11B 5FOBB 4V1DB 1QQDB 3BPLC 3U0PB 3OXSA 3R1GL 5GGSA 3VFWB 5BOPA 4HPYH 1PY9A 5HDQL 5HHMD 1UH2A 3BMWA 2HLAA 2QL1A 4HCRH 4Z7WB 3LRGA 5KTEH 4MVBC 4GAYB 2OQJB 4PJ9D 4Y4KD 3BDXA 5DK2B 3HNSL 3KYAA 1R3IH 2EE3A 4KK6C 1Q9WA 2DQUH 3PWJA 1S78D 2BVUA 1P7KB 2W1NA 4YJZL 3QFJA 2MQ3A 4JGMA 4JRYD 5CHNA 3O45A 2PYED 4IS6B 3QI9D 1KLUA 1T1ZA 5DC0A 1QSEE 5C6TH 1YYMH 3R8BB 3ULVL 1YEGH 3IFNH 5EBLA 4CVZB 4UAOC 1NMCB 1OY3B 2HYMA 3HB3D 5IB2B 3LB6C 2FO1A 2X4SB 3MV11 5HVHC 4PYGA 3LKSB 1N6QH 1F90L 4I18A 2O61A 1IGFL 2GITB 3DO3A 5E9DD 1Q94A 3VFOB 4P0DA 1NKRA 3CVHA 4KHXL 1DBBH 5KS9B 1GC1H 1Q1JH 3ABZA 3WUWA 3RL2A 1ZLVK 3QDME 2IPUG 5FKAB 4I3RH 1I85A 2JB5L 3V5DA 4JFZL 2ATPA 5FF6A 2EYTA 2R2CA 4HS3B 2FL5A 1BF8A 4QF1B 4UTAH 3GUTB 2D0FA 1U8MA 1MFCL 1J0HA 3MXWH 1UB5B 2D4DA 4NBYB 4HUWB 5C0AE 3ZYIA 1E4WH 2XWBB 5FECB 2R69H 4MD0B 4YDVB 5IMLA 3QQ4A 5F1OB 1OP5K 3FTGB 1G7IA 4NGHL 4XX1G 4WI2A 4H26A 1JYXA 1N2RB 1X3DA 3SCMB 3UTZA 4KZEL 4GAJL 1FFQA 4EI5C 1FVDB 4JFEB 2ZUWA 4GBXC 3SDXA 4BH8A 1T3FB 5D7IF 1U92B 5HI5C 4GOSA 3GFUA 5SWSD 3I6LD 1T04A 4R26H 1NMAL 3MRNB 1BQHB 5LBSH 3O3UN 3RTQC 2JJSA 4YIQB 5EU6A 2XKNA 4HHAB 1YEIL 5FO9A 4CN4A 1JTPA 2AXFA 4XH2B 1VGKB 3I50H 2R23A 3SKMB 2CXKA 5M94B 2ZOLA 3WFBH 3TIDB 1KJVA 1G7MA 1S7WB 1WBYA 3B2UD 4PJXA 5I1CH 4ERSL 3NCFB 3AVEA 1EHXA 3T0EC 5CGMA 4U1HB 5L9DL 1NGQL 3V6ZB 2R2EA 1CDBA 5GGTL 3FO1A 3PJSA 2R9HD 3OKDA 3IDMB 4I3SH 5CILH 3WXVH 3KYNB 2GJ6B 3QWQB 1VENA 4NPYA 3SOBL 4YXKH 1E28A 1HHIB 2Y7QB 4PJ5D 3JV5A 5HY9B 1S7RB 1A21A 2VIRA 1NCNA 4WFFD 5TE4H 4X6DE 3S35L 3VGDA 3VXSE 4X4ME 3LRSA 2CDFA 4YHPB 3VD7A 4FZ8L 5EU7E 3OR6A 1T5WA 3S3JA 1TTGA 3O6ML 5GQBA 3TBVB 4P59H 4PJFA 3SDDD 4LRIA 5F6HI 2VDNL 5IHUH 5CD3B 1RZKH 5ACLA 2CKBL 4GAGH 4B41A 1ZANH 5ETUB 4W4NA 1OB1B 1J11A 5F9JA 5IV2B 1QLEH 5FEBA 1F4AA 1JGLH 3QRGL 1IM3A 2VERN 3INUL 2C7UA 4J3TA 4M9PA 5IESH 3THML 3BEVB 1YPZB 3GSXA 3FONB 3HZKB 1E27A 4QRSB 3F65A 3ZMRA 3TGXA 1UM5L 2H3NA 2ITDB 3RVTC 1QBMH 2OL3B 2CPCA 5C0DA 2YK1H 1W72A 2BY3A 3NZ8A 1WICA 3L5XL 1QKZL 1SY6L 4L8BB 2FJGB 1TCMA 4BQ8A 5IVOA 2UUDK 5I1IH 5E2UL 5IBLD 1CIDA 1S7TA 5T1LD 3WS6A 3LS5H 1F11A 2G75A 2XRAH 4XMPH 4ZOEA 2C4FU 5BZWB 4PJEB 2WQ8A 3FB7B 5FK9A 3RAJL 4P23D 3UBXB 4GUPA 2AEPL 5D6CB 4G80A 3TN0C 1NCDL 2ARJA 4P2RD 5JXAH 4OQTA 3IDGA 1BD2E 4ODTH 4XVUC 4NQEE 1IFHL 1XT5A 4UTBH 4JFDD 4M02A 4M1GH 3T2NL 3O3AA 1RV6X 4RGOL 2ICWJ 5CP3A 1QEWB 1C7SA 1D5BA 4PBWD 1MIEH 4K8RC 1WAAA 2DB8A 2MWCA 4MSWA 3S35X 4Q0XL 1IEAB 2WWKO 4LLUA 4F9PC 1WT5C 1AR1C 3TT1H 4PRHD 5H94A 1HHHB 2BHYA 2R0ZL 1ZKAA 2I27N 3MLZH 3EZ8A 3PGFL 4IRJD 4NSKB 3WN5A 1U8QB 3EJYC 2ZUQC 1DLFH 1C1EH 4OD2B 3EHBD 3MQIA 2PF6A 3QNYA 5FUOL 1MCCA 1XCQB 4I2XA 5CP7B 3DVFA 1CXHA 2N4IA 1BWWA 4OTXH 4YEFA 1SMOA 3KYOA 3OX8B 3WFZA 2CGRH 5TDNA 4XMKL 5FYJU 2XI9A 3LPWA 4NYLA 5I18L 3MLYH 1N4XH 5EZIH 2LAAA 3NPSB 4F3FA 4GW4A 2EZ0D 1H9VA 5HDBF 2HRPH 2BDNH 1MFDL 5DHVB 1A8JH 4PTUB 4Z0BH 3EFDL 5DJAB 4UMGA 3F58L 1HQ4A 2NX5D 3LN4B 1DQQB 3AS1A 3DVGB 4Y19D 1ZLUH 4DJMA 5MHSE 2VLRA 2VOTA 3LN5B 1R3LA 4FABH 4Y16A 1NFIB 5KSUA 1BFSA 3ARXA 4XWOC 3FB6A 2AXGA 4HD9A 3LY6A 3MBXH 1CDYA 1GC1C 3ARDB 4YR6B 2JKXA 3ZDYE 4R90L 3G6DH 4MXVE 2X9XA 5SX4H 2Q8BH 2BNQA 4KKAD 3PNWA 4G8GE 3MRBB 3NGBC 2FO4A 2P5ED 4FQHA 2OR7A 3HE6B 4LU5L 5TJWK 1QFWI 4AEIH 2AJZB 3C5ZD 1MWAL 3DARA 1DJSA 1I8IB 2E7CA 1LILA 4FFZH 5EORL 5EUOE 1WUNT 2LQRA 1YEFH 3H9SE 3B9DA 4ZPVA 2OYPA 1B2WL 1FGVH 1Z3GL 1WIUA 3P0YH 4GKNB 4I0PA 4KRPB 4NN7B 4Y4FD 3ZKMC 1YYLL 1J5OH 4PLJD 4MNGE 5ISZB 4ZODA 1RMFL 4GRWF 1D9KC 2Z93A 5EG6C 5JNYB 3VRLE 1N64H 4IRSA 4OIAA 3PV7A 1FFPB 4G9FE 3VGFA 4TULL 1ORQB 4JM4H 3MLRH 5IVZA 4OZIE 3HI6H 5F97E 5JQHC 3RIAK 4M62L 4H1LG 2BXYA 4MA7L 4MCZA 4ODSH 4WWID 2BVQB 2OP4H 2BSRA 4CDGC 3ESVF 4NNYB 2P43B 1FPTH 4HUXB 3EZJB 4L8DB 3BP6B 1H0DB 3C08L 4YQXH 4PP2B 5LCVL 2NY0C 5C92A 1J9CT 1ZHLB 1I8LA 5D1XD 2Q3AA 3HC3L 3CUPB 5D1ZB 1W8OA 5D96C 5D2NE 4DUXA 4OAWA 4Q9CA 3OG6B 4WHTA 5FOBA 4Y2DC 5HGGS 4V1DA 3X11A 1QQDA 1GGIH 3U0PA 2CLVB 2Z8VC 3PXJA 3DSFL 3IFPB 3VFWA 4DAGH 4DVRL 4FFYL 3B8YA 2BMKB 2ZUTA 1EAPB 2AK4B 3SGKA 3IDYC 4NO2B 1RZKC 1X5FA 4Z7WA 3F7YB 4HZLA 4GAYA 2OQJA 5DK2A 3LDBB 1JJUA 2YN5A 3GB7B 4L4VB 1EX0A 1F02I 3BT2L 1JRHL 1P7KA 1X9QA 1KCKA 4HFUL 3VI3E 2QADC 4JPWL 4QRTA 4WW2F 3JBG7 5F3HB 1RUQH 4IS6A 2J4WL 3DJ9A 1A1MB 3S6CA 3IVKB 4BQBA 2IC2A 3BN9D 4CVZA 1MJ8L 3V4PH 2HTLC 5BZDB 4AM0B 4KV5F 3C8KB 5T1DH 3K4AA 4E41E 1Q38A 2HMIC 2X4SA 4OLXH 4YPGB 1T80A 4OCYL 5E56A 1JZ6A 3LKSA 1J8HD 1WGOA 3SEPA 4UU9B 4GRLC 1A2YB 1IZJA 4U0RB 1QA9B 3QIBC 2GITA 3QDGD 3VFOA 5ICZB 5DFVC 4JG0L 3JVGC 5KS9A 1DFBH 3ARBD 3P0VL 3QPXH 4L5FH 3VI4E 4L4TE 4U3XA 4Z7NF 5FKAA 4MB4A 3TZVB 4YFEA 1AD9B 4HS3A 2X4UA 3TBYA 4QF1A 3O6KH 4QHMB 4HWEH 4NKDB 2YRLA 1HE7A 1K3IA 1U8KB 4KAQL 2YD2A 4B5EA 3GUTA 2A38A 5H37G 4F15B 4TOYH 4HIIB 4XPFH 4LBEB 2R39A 4YBLC 2QBWA 4KUZH 4JRWA 2UVEA 1K85A 3MOQA 2EC8A 1UB5A 1BQHG 4HUWA 1RU9H 3BEWB 1CR9H 5EBGA 1V7NH 5C09E 4JZNA 2XWBA 1MLBB 5FECA 4JZOB 4PJHB 4U33A 4YDVA 4NZRH 3HG1E 4NZJA 2AGJL 3FTGA 2XA8H 1N2RA 3BP7B 3SCMA 5DEGB 2IQ9H 2X9WA 4O5LH 1QRNE 3B9VA 3E8UH 3GHBH 5IOPB 1FVDA 4JFEA 5D71L 5C0RL 3VD9A 1FNHA 1T3FA 3P4MB 9CGTA 3WL9B 2XZAH 3BMVA 3Q48A 5J3HC 2DWEB 4FQPA 1L0QA 3MRNA 3RVVC 2CLZB 5KVGL 1BQHA 4Q9QH 2IADA 4UQ2B 4YIQA 2DYPA 1UT9A 5J6GB 4HHAA 1DEDA 4XH2A 1VGKA 5EUKB 1RIVL 3SKMA 2VXUL 4JKMA 3OPZL 3EFFB 2IANE 4PJGB 1AXIB 1JF5A 1RK0B 4OKVB 4XC3H 1S7WA 1UJ3C 5FGBA 3GBLA 1HINH 5HHPB 4QNPE 3W82A 2R2HB 4JY5L 4U1HA 3V6ZA 3ZHDA 1WEJH 5SWZB 1RJZB 4P3CH 5IM7B 3IDMA 1OTUC 3KYNA 2GJ6A 4RIRB 4LVEA 1JYVA 3VGAB 5JOPD 1HHIA 2DQDL 4JREC 5TQ2L 2Y7QA 2FATL 1A6UL 5HY9A 1U6AL 3BOVA 4LIQL 1CGYA 3WJLC 3OF6D 4UBDD 4YHPA 2D9CA 3ESUF 4LSDA 4PD4J 2NY4B 3TBVA 4LQ1A 1I1YB 1AD0B 5CD3A 1GAFL 2ZUSA 2IGFH 4PJ9C 4Y4KC 5ETUA 2B4CH