3FFDA

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
210
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWIRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMFYCARQTTMTYFAYWGQGTLVTVSAAKTTPPSVYPLAPMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hormone
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 210
sequence length 218
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdA01
2D7PA 5DRXB 5C0AB 4QEGA 3EOAB 4ZUTA 3RGVC 1XMWA 3MMEB 3BXNA 4WFEE 4XC3L 3NTCH 4F58H 2NY0D 4XBGB 3NCBB 2DQFB 3LD8C 4P2RA 1LO4L 4DN3L 1OL0A 1OQXA 1Z6JT 4NQSA 4Q7DA 3RGVB 1MRCL 4PV8A 2LU4A 5I74C 3OKKA 3LD8B 5CEXA 4PUBL 1WK0A 4K7FB 2P46B 3UYOD 4E5XB 1A0QL 5GGTA 2RCSH 5IW1A 5CILH 2ADJB 4FQIH 4XC1H 4F8QA 2BNUB 1RJYB 1ACZA 4ONHB 5EO9A 2HTKC 1G9ML 3MBED 4NWUL 3RVVD 3DV4A 1FG9C 1A14H 5I74B 4DUXA 5D5ME 4M61A 4UILH 5FDWA 3WIHA 1KIQA 2GSGA 1I4FA 5GS1C 2X44D 2XPGB 3MRLB 5IBUB 5FUCE 4EI5D 3GSQA 1YEKH 3QNZA 1UXSA 1ORSA 4AIZB 5C2BH 4POUB 4JKLA 4N0UA 1MY5A 1Z9OA 1FV1B 2OR9H 1YJDC 3E8UH 1K4DA 1QRNB 5FM8A 4YIQA 5GS1B 1U42A 1WBXB 3AAZB 5T3XE 3QULA 4PGZA 4S1SL 2X4SB 1MJUH 2ESVD 2VLJA 2DIBA 5JHDD 3GI9H 3QIUD 2X10A 1XAUA 1NMAL 4NRZB 3JTSB 1RURL 4LNRB 4ISVA 4PR5A 4JPVH 4PRPB 1NLBH 3I6GA 1CFBA 4IHOA 4AZ8A 1D5IL 1QFWM 2IPUK 3TN0A 3MJ7A 5T33H 1UJ3A 4EN3D 3O2VH 3WKNA 1I3GH 2QQKL 2XY1A 5GGVH 2HAZA 5HHNA 4ODUA 4CW1A 4MQXC 3TYFB 1DEEB 3UTTD 1JBJA 2R0KL 3GDBA 5IG7B 1DQLL 3RVWC 3MCKB 4HZLA 1NCDL 4M8QB 4P2CG 1MPAL 4GMTH 4MA3B 3OR7A 3B2VL 3DUHA 4HK3J 1UZ8B 4KZEH 2ITCB 1U36A 2LABA 2Q3AA 1T21B 3HC3H 4XB8A 3LV3B 1U8MA 1WCQA 4N0FB 4PJDE 3ALPA 4M1DL 3JWNC 3V52L 5I8CB 3KYNB 3SKUD 3R06A 5GRZA 2OSLA 3VXUB 2Z4QB 4OUOA 2C1OA 1X9QA 2ED9A 4L3AA 4S1RL 1BFTA 1VENA 1OGTA 5EOTA 5A43C 1HHKB 4NZRL 2HN7A 1RUAH 3DHMA 3HE7C 2DMCA 3QUMB 4G5ZL 1DVFB 3MRFB 3ULUD 1T03L 4ZPVA 4X5XB 4U0QB 2J88H 4LSSH 3G08A 1IAII 1OARL 3QH3A 4PRIE 3V5HB 4NUJB 1CTNA 2HMID 4FQ1L 1CIUA 1DJSA 3HE7B 5F1OB 3WNMA 5I1EH 4QGYA 2VDRH 3CFBA 1T20A 4G9DB 4OLUL 4X99A 4RISH 2NNAB 4PJDF 1RZ8B 5C0ND 3EDFA 1JYNA 2VISA 1WZ1H 1QEWA 4YHML 1NEZA 5TE4H 2H3NA 4MQTB 3LKRB 1WC7B 5CJ5A 1JGUL 4NGHL 5AYQA 1U3HD 5HYQA 3Q6FA 4TSCH 2Q8BH 3OKDA 4IRJD 1IQDB 4JRYB 5DRZB 4I3GA 2DJUA 4K2UH 4MD4A 5A1AA 1FZJB 4DKFH 2BK8A 3R0MA 1IGYB 4Z0BL 3C5SB 1EHXA 3VRIB 4NUGH 4CJ1A 1KN4L 1OAYH 1QSFB 2APTA 2H6PB 5D1XD 1P84J 1CICA 4FA8A 3HI6H 2BMKB 3WHXA 3HMWH 3ULVC 4P99A 4ZFOA 2E6PA 2EKSA 5GISH 2H32A 3IFPB 4HIXH 5IMLA 5DSCB 1N59A 1JI1A 2VLRB 4F2MA 2FBJL 1CQKA 3FQWA 1ZT4B 1ZLWK 4U1HA 3PGFH 4QWWD 1JHLH 4KK6C 4OI7A 4JQVA 3O6FD 2VDLH 4KFZC 2NCMA 1FBIL 1RUMH 4OFKA 3VXSD 4KUZH 2V9RA 3OXSA 5CKAA 1AJ7L 7FABH 1UA6L 3VU2A 3WN5A 2CQVA 2ZOKB 1U8LA 4ERSL 4G9FB 1HHJB 1YNKL 1F4HA 1QFUL 4JPIA 2NPLX 4ODWA 1CR9L 1DQTA 2XFXB 1KTRL 1SY6L 1K2DA 3AXLB 4U1NA 1HHGB 4YDLC 4EDWH 2JJWA 3QDGA 2GTZA 2D7QA 1C5DA 3T0EA 3EJZD 3PJSB 2IFGA 3ARDD 1AHWC 5HPOA 4X9HA 1GGBL 1OPGL 1MHHA 4XNXH 1MFEH 1AGEA 5E8EA 3PABB 3UCRA 4DKAA 3WFZA 4YDLB 3UZVB 1PG7L 4YBLC 1MI5A 1X5FA 5KOMC 4FQCH 2W0KA 3WE6B 1A6TA 4ZO9A 1KC5H 1SBSH 5TQ0H 5DC4B 1AHWB 3GK8H 1U8IB 2AQ3A 4N0CC 1BQUA 3BKCH 4LOUD 4YBLB 1A1NA 1F97A 4K07A 2BERA 4G42A 2F74B 1II4E 1ZT7A 4GW5B 4PJAA 3SE9H 1CFNA 3LPWA 1Y6MR 4N68A 1DQDL 2X4NB 4QXUH 5L9DH 1F3JA 4C83A 3C60C 3VFGL 3UTQB 1JWUA 4AEFA 1CL7L 1QFPA 3LCYA 3RL1A 1KSRA 4NKMA 5JIKA 5HSFA 2OK0L 1S9WB 1U92B 3HNTL 4F33A 5CZXC 1JGVL 3K74B 2J4WL 3C60B 1ZGLM 1GPOH 2EDWA 3FN3A 1FZKA 2EIZB 4Z78A 1BVZA 4XPAH 5FFLA 3MLXL 3ULUL 2DQJL 3D69B 2BNRD 3E6HB 4YHPA 1Z9LA 5DUML 1IRAY 1KNOA 1P6FA 3QB7C 2XWJB 2RFXB 2P49B 5EPMA 2C1PA 1P1ZA 2QSCH 3TBWA 3S5LA 4YGAB 4RAHA 1MFBH 2YPLE 3BPOC 5DJXA 1S7XA 4O2FA 3UJIH 4PGJA 3RY5A 3FRUA 1FG2B 2J6EA 5FEBA 5IMMB 2VDPH 1NUGA 1B2WL 2CKNA 4F8TA 3TIDA 2PO6D 3TBTA 4YWGL 1INQB 1J1PL 3BPOB 4MJ6B 1I7UA 4XPGL 1IEBB 43CAA 1S7SA 4YXHH 1A6ZB 4OD1H 1FYTB 3PHQA 1UXWB 4KQ4L 1OP3K 5HGBB 5K9JL 3IJHB 4JO1H 1UYWH 3G6JE 3O9WD 5EBMB 4DGIL 1KPRB 3FZUC 2GI7A 2V17H 3MODH 3B9AA 4GQPH 4UIKH 2ZUTA 3VA2C 1G9EA 3QUYD 3SKMB 2B4CC 1MWAB 1RZKC 4ORGA 2ENYA 3VG0L 1KULA 1MCIA 1WEJH 4GFTB 1MCRA 1QUNA 3BKJH 4AENB 2FEEI 4Z76B 4R90H 1NL0L 1MWAH 2PNDA 2P43B 1UVQA 2HH0L 2AEIT 1UKTA 2CR3A 3MV8E 4ZTPL 2VABB 1G7PA 4NQVB 3TA3A 3AMKA 5KOVC 4NC0B 4DGYL 1I1YB 4XVUC 2J8UB 3RY4A 5C08D 1BAFL 2R2CA 3IJSA 3MFFB 1MFAL 3BPLC 2A6IB 3H0TA 1BIIA 1RZKH 1V7ML 5HDQH 3REWA 4NQUA 2ADIA 3WFHB 1MCPL 4OFDA 1GJIA 5IEHB 2RQ8A 1FO0L 5D9SB 3DECA 2C3HA 4JFEB 3MUY1 5E0QA 5C0JB 2HP4A 5GRWA 5DS8A 4P2RD 3BPLB 4QYOB 4YBHA 4M7LH 4HMEA 5DURB 5E08L 2HA1A 2VDKL 3SY0B 5C0GA 3GMPA 3S36X 5CINH 1FJ1B 1OTUC 5HPMB 1ZTXH 5KS9E 2BVOA 2R8SL 3MGOB 1WBYB 3L3KA 1DQJB 4NRYA 1X5JA 5CCKL 3QIBA 5HI4C 1D5MA 3UTSA 4NZJA 5BJTB 3FO9A 1FDLL 4LLAA 2HVKA 5IEKB 5TDPA 2OTWB 4XXCC 4HJ0D 3R4DA 5IQ7H 1MJ8L 1LHZA 1YC7A 1HH9A 3PQYE 5JR1H 3IDMB 5FYJE 4PP2A 4P2OC 4PB9L 3HPLB 4G6MH 3CMGA 4H25B 1W2KT 4X5WB 1YMMB 2KZWA 3BISA 3IJYA 3H8NA 4HF5H 4U1LA 4EJ1C 1KJMB 4Z7OF 4P2OB 4Z7NE 4G9FE 5EU4A 2IGFL 4JO4H 2VLJD 3FFCA 1T0MA 1WAAF 1Q9WB 3D18B 4Y4KA 5C6TH 2BP3A 3QJFA 4FQQA 4NJAH 3MXWH 3HI5L 3BESR 2GITB 1A3RL 1U58B 2FJFB 4RRPG 5HYSB 1YMHA 3LS4H 4MNGE 3DX6B 1XGYL 2KUTA 5B3JE 1W0VA 3ARBC 3ULVF 2YWZA 2GFBB 1YEIL 1G84A 3KPOB 1K6QH 3TN0D 4PJGB 1C08B 4PV9B 5DXWA 1T22A 3FB8B 1RUPL 4L8CA 2W0FA 5FM5O 2DTSA 3SOBL 4IMLA 1QYGH 4YQXH 4OV5B 3DV6B 3ARBB 3RQ3A 4HIJB 3PNWB 5DDHB 3GBNL 1BBJA 2X9XA 43C9B 4JFQA 2GT9A 4LLUB 3D2UB 2R2BA 4PY7B 3CGTA 4Q58C 2A6KA 1V3JA 1YECL 3VW3L 4OTXH 2R69H 1D5XB 1AO7B 1GCFA 2DQGL 1QNZH 5GIRA 1KCRL 1E28A 3QO0B 2DYPB 5GS2D 4JR9L 4A2LA 3WJJA 2X6MA 5C0BE 4LCWA 2X1WL 1Q9KB 1T83C 4DTGL 4Q9RH 5HDBE 3NABL 1LO0L 3EYOB 5F88B 3L5JA 2CDGA 1KN2H 4TVPD 5EA0H 2HJKB 1Q9LA 4YHIB 3HCVB 3GNML 1OSZA 1TTFA 4M7LT 5BS0A 1Y6KR 4LHUB 4XP9L 2DQCL 3UTPD 2WLZA 4U1SB 1FNGA 2MCG1 5JW4M 4LHUG 1MFNA 1J0JA 1KIUA 1EGJH 2YSSB 1A6AA 3HNVL 4UQ2B 5DJ0B 2DQDH 5LGHL 3O6ML 4HFWB 4JANA 3O6LL 1ZAGA 3UO1L 1KCVH 2AK4E 2J12B 3PWJA 4PJCB 1FLRH 4NOFA 5HDBF 2IJ0C 4I0KA 2RIKA 1ZLVK 5GGUA 1MAKA 1MOEA 2GYSA 5AEAA 2HT4C 3P77B 4ETYA 1FYTE 4XNUH 3EO1B 1LE5B 3O8XD 4JZOB 1DLHB 4JRWA 4BKLB 3L6FA 5GXBB 5EULV 5EB9A 5FXCH 3EW3B 5EBWA 3PDGA 2QKIA 4HUVB 3EDKA 4IIQA 4LKXA 4P23C 4HMCA 2UVEA 2X4RA 3P30H 2QADC 3TV3H 1CICD 2PN5A 3MRBB 4N5UA 1NBZB 2AJVL 3GSXB 1W72L 3SN6N 1GL4B 2W65B 3JVGA 4P23B 4NNPL 1KT2B 3AM8C 4ZUVB 2QADB 3WIHL 1J9CT 5KVFH 3IF1A 2D0GA 1CF8H 4CU6A 2CMRL 2C4FU 4RGNC 5ITBL 4HH8A 1AIFB 1BFVH 3L3GB 4KROD 4G8FB 4PJ7A 4NQEB 4J23A 2YN5A 1KLGB 3VFPB 4LCUA 2OJZL 1NC2B 2P45B 4QHKJ 1MLBA 4J3WA 5I1HL 4NN6C 3DXAE 1EEUA 3NIDE 4RGNB 4MS8D 3D3VE 3U0PB 5HD8C 5C07B 5E7FA 2WINB 1U8OB 2X1XR 3QDGD 5KSVA 1UH4A 1V7NL 5E2VH 3T0ED 2G75B 4D2NA 5E99L 4P46C 4UT7L 5HHQB 2NTSP 3BPCB 4TUOA 4NN6B 3C08H 2X4OB 2I25N 1U8NB 1W8OA 4ZQKB 4Z5RB 4FTVB 4UUJA 4FABH 5M95B 5LAXB 1MI5D 3UTOA 5DK0A 3P73A 1AKJA 4P46B 3TEUA 2F8VA 4PRHB 1CT8A 3SE8H 5EOCJ 2VXSL 4OCLC 4JAMB 4WU7A 4MA8H 3E3QC 3IAQA 2FSEB 4NP4L 4HT1L 1YMME 3NIDF 4P4KC 4P57B 2XTJC 3V95A 2W07A 5I8OL 5KVGL 1VSCA 2FL5A 1KELL 4IOFC 2IBZX 2CXGA 2MOVA 3QBTB 2QEJA 5DVKA 4XAWL 4PYGA 4TNWF 2YPKB 4R4ND 2ARJQ 4X8JA 2DQEH 1LK3L 4P4KB 2UZIH 2XTJB 3B2UD 3KPSB 2NY2C 3OF6A 2CH8A 3SGDH 5IOPB 1DEDA 2D2OA 4HS8H 2MCPH 3NA4A 3UC0L 1GGTA 4HWZB 2B1AH 4OCRH 5E9DA 2Q6WB 1T66D 2D7TH 3NCMA 1QOKA 4MNQB 3FHQA 4TVPL 1EJOL 3FB5B 2FO4B 1R5WB 4IRSA 3T1FB 3EJYD 2O5ZH 2NY2B 4QRTB 5IHZB 1ZHLB 1I9JH 1D5BB 2V9TA 1O5DT 5JQ6L 3F5WB 4UIMA 4PJGE 1VGKA 1PG7W 1BQLH 3JV0A 3OX8B 1C5BL 1HKLL 5C9JB 2H8PA 3WFEL 5HGHA 5IVZA 5EUKA 3I6LE 1C8PA 4OI9A 2EDQA 3QA3A 4TNWK 4UOW1 2HWZL 1JFQH 3QXAA 3ZDZE 4J6RH 4CADA 1WICA 2XKSA 1P69B 1B4JH 5ABDE 3ZTNL 2F5AH 3BMVA 4TUKH 5CD3B 1A7RL 1OP9A 4YHZH 3T0BA 1A9BA 4OZFH 3VFUA 3N85H 5DRNB 4HWBA 4UTBL 2W9LA 4U3CA 5GS3A 1A7BA 4PJGF 1J11A 4LK4A 1FFNB 2NTFB 1NDGA 1EO7A 5JO5B 4WUKH 5F7WC 4PJ5B 5ACZA 4ZFOL 5ADOH 4KK8C 4NQDD 4AJ0A 1YC8A 2JELL 3ZDZF 3JBG7 2Y6SC 1KB9K 3VFSB 5E2WH 4WUUB 1NAKH 4PREA 2NZIA 3TA3D 1LDPH 1C5CH 2WQ8A 4NN7C 3D87B 4B7LA 3GMLA 3RL2A 1S9YA 1BMGA 5AZEH 2DLTA 4LLYA 1I3RA 2XWBB 5DD0L 4AQOA 2ZWLT 3HFML 3SJVA 2A6DB 2A83B 1OWWA 1KBGH 5CZVH 1ZA6A 4OZ4A 1T80A 2VLKD 5FKPA 5L8KB 1SJEB 5HGAB 4PJXB 1R3HA 2NX5B 2BOCA 3IU3B 3LSOA 3O2DA 5DHYA 4NN7B 3VFOA 5DJDA 4ONFH 4X83A 3OKEB 2CUHA 4OLWH 1YNLH 3RVUD 1WLHA 2IQAA 4NFBA 5DQJA 4FQXA 4XPHL 3BDYH 4ZOCA 3WSQL 1BZ7A 1NGXA 3CSGA 5BZDB 4LGRB 2DBLL 1Q1JH 2EYSA 2P8MB 5FK9A 4YPGB 2BVPB 2ARWA 2VZ3A 1FGVL 1WSST 4P9HL 1IL1A 4JLRB 3KS0J 2XNAB 3MNWA 4P49A 4KJPC 2CIIA 1JNJA 1YYML 3PWVB 3VGAC 1B9ZA 3QWOA 3RUGB 3AUVA 1TXKA 3I2CL 3QIBD 2ZSVA 1FE8L 4LPCA 3RWGA 3LPFA 2B20A 3EOBA 1KYOK 1NSNH 1Y18A 1CFTB 2EH7H 4PJCF 4GT7A 3VGAB 2IPKB 3NIGE 1P6AB 3QPQD 4DKEL 2GTWB 3ZKMD 4AT6B 4E41A 4YHOL 5IROA 1UM6L 1NC4B 1RY7B 5D6CB 3CXHJ 4G6FD 3OKNB 5BMFH 4UINL 5IFJA 4KKBD 4NQEE 1S5IH 1LEKB 3BE1H 2W38A 3IXAB 3RJQB 3QCTH 3TBVA 2WMPA 4ODHL 3FFCD 3PV6B 4Y4KD 5C07E 1MCSA 1N0XL 3MV01 3G5YB 4JFFB 1B0RB 1S7UA 5LBSL 3MRHA 2I5YL 1CZ8L 4Y88A 3RY6C 2FNBA 1JWSA 2Z35A 1F6AB 2EE3A 3U9UB 3QPXL 1LD9A 5C0EB 1CD1A 5JPNB 4WDIA 4LAQH 3RX8A 4I48A 1H15A 3HNSL 4D3CL 5L2JA 5IVXB 1J5OL 3O11B 4RAUB 4RMWA 2AJ3A 3QQNA 3UYRH 5CBAA 5E5MA 1ZGLA 4JN2A 3HRZB 4HK0B 4HUUA 4YHLH 2AERT 1YNTB 2VH5H 2X4QA 3O0RH 4KKAD 4FFWD 5EU6A 4NCDA 2ED8A 3TC9A 5EU3A 1CLCA 4ODVH 2HG5A 4XCCH 3MRCA 2XRAH 1TETL 5LXGH 3PUCA 2V7HB 2WK2A 4M5ZL 5BW7C 1CXIA 5EO1B 4XBPA 3KLHD 4DCQA 5LQBL 2XTJE 1DBAH 3EIFA 4XHJC 1Y6NR 3GSRA 4LCWD 5K9OA 5E2UH 4PRDA 1C12B 4U49A 5BRZE 5DA0B 1N64H 4WV1A 2DLHA 4M3KB 3ZDXE 4XMKL 2P8LA 3FOLA 1WT5A 4YO0B 4R96A 1JZ7A 3ULSB 5LWYH 5FGCB 1U91B 1QLRB 4H5SB 4OT1L 3DX9A 4N0YH 1F3DH 1RZFL 4LBEA 3KPMA 5IB5B 3KYMA 1MEXL 5JORB 4NHCH 2GCYA 5I1DA 1A7NH 1S78D 3T3MF 3BP6B 4G3YH 3VJ6A 5CAYB 2Y07L 4J1UA 5F7KC 1D6EB 3RWIB 1S3KL 3MLYL 4Q6IA 3S36L 4UNVA 3VDBA 4B7IA 3VFNB 1N6QH 1FNSH 4PG2A 2DBJA 2WWKT 1G7MB 4WW1A 3BKMH 5IVOA 2V2WA 3MA7A 2JJTC 4Q9BA 3T65B 3ZDXF 3EO0A 2F15A 4HFUL 4GKZA 4R7DB 4EKXA 4O2EA 4XVJL 4APQC 2GY5A 3WUWB 2WBJA 2FEDC 4K94C 5DMIH 4OZGB 3TYGL 3U4EA 3NN8B 3WUWG 2G5BB 3CPLB 1JMXA 2GIYA 4LSRH 5HHMB 5I76B 5KSAD 3INUL 2XN9A 4APQB 3OJVC 3OWEA 1AH1A 4KTEH 1YPZB 3HE6C 4JFHE 1ED3B 1T0NB 4KKLC 1MUJA 4M00A 4R3SB 1ZHNA 3RX5A 4F57H 1HHIA 4XVSL 1SHMA 5AYUH 1HSBB 2DMKA 3C5ZC 4KMTL 4ZO6A 3I02A 2MTPA 1ZVSB 5ISZA 1A4JA 5DMGC 5F7FA 1H0DB 2WANA 2BSTA 4U3HA 3HE6B 1XR8B 4ZUUA 4P5MB 4OGAD 3CSYB 4L3EA 1YDPA 4OM1H 5KVEH 3P4OA 1V5JA 4YDJB 3DROB 3C5ZB 5JUEL 4M1GH 1G7HA 1WCBB 4HIEA 3P11H 2UUDH 4HBCL 4GXUN 1EO5A 4L9LC 5D7LA 1DBKH 1HH6B 3QEQA 1DE4B 4HXBH 4GQ9H 4OAWA 1AXTL 3EYVB 4OD3H 4FP8H 4YDIH 1VHPA 4LSPH 3GBML 4AK1A 3MREB 2QR0A 4L9LB 3SGDI 2EIEA 1NMBL 4HIHA 5CJOL 5LJYH 4DKDC 4HKBB 2D03L 4JHBA 2PXYC 5ACMA 3TNNA 4ZNEE 1JPSL 2QQNL 4RZCB 5D2LB 4JFPA 1M71A 5CJQH 1AKJD 2BRQA 2VXVH 3D39B 5I1KH 1M7XA 3RP1A 3GSNA 4ODTL 4ZDHA 2D7MA 5BV7C 6FABH 5J6HA 3MRRB 4M8VA 1WITA 1F8TH 1EUUA 1N7MH 3OAYH 2PXYB 3D0LB 4L29A 3ECBB 2NXZD 2OL3H 1J1OH 4PJ9A 3VXPA 4LU5H 3R0NA 4K9EC 2Z8RA 3H9YA 4L4VE 5BV7B 4Q9QH 3L3IA 3D85B 3F7PC 5C3LD 2OX5A 3VXRA 5FUOL 5ETUB 1R3IL 3E0GA 2MQ3A 1PZ5A 3FT4A 3RUGF 3OF6D 4X6CE 3M45A 2XKNB 5BCAA 3T4YB 4HSQA 2XQBH 4QRPA 5BV7H 4HKXB 4JFZH 2IAMC 4LEOB 3UJTH 5E9DD 1L7IH 6CGTA 3OAZK 5EZOH 2PCPB 5DGQA 5IMKB 4IRSD 2FR4A 1JGEA 5JLZA 1TJGL 4MWFB 3QUZC 4FQ2L 3QXDA 4J3UA 5EFIA 1FNEA 2IAMB 5DC9B 4OLZL 5JOFB 5I8EA 3LHPL 2D4DA 5ID0B 1T1YA 2R1XB 3RPIB 1PQZA 3QUZB 1JTOA 2YC1A 3OG4B 4MDJA 4WWKD 4MAYC 1IGFL 1H3PH 3FO1A 2WWMC 3K7UA 4H1LB 4PBXA 2FJHB 2CJUH 3VFMB 2EXYD 4DOHB 3C6LD 5IB3A 1I9EA 1T2QH 4H1LG 4OFPA 1OAXH 2IF7A 4Z7UE 1A6UH 1E4KA 2EIDA 4Y4FA 3OJ2C 1ZHKB 4MAYB 4H1LH 3BH9A 2RAMA 4WO4C 3DYPA 2UYLB 2QQLH 4NM4L 4XCYA 5IVXF 4UT6H 4OF8A 3IDIB 4U6VH 4M7JH 2FX8L 3I50H 3MZGB 2P5EA 4AEHH 2W9DL 2Y7QA 4U1IA 4XMPH 3Q5OA 2HKFH 1P4IH 4WO4B 3L5WB 3UPCA 5ANMB 3JV4B 3V0VA 4JDTH 2BNQA 2B1HH 4X6BA 3DPBA 1ZANL 4EIZC 8FABB 1SMOA 4KC3B 3QSKB 3A6OA 3OG6B 5EO0A 4OSUH 5ERWB 2Y23A 3IDGB 3LQAC 5DZNA 3SJVD 4DK6A 1MCFA 3MXVL 5I19H 3QG7H 1SEQH 3P0GB 4JHZA 1NLDL 2CIKA 1GC1L 3BEWA 2CKBL 5FIEA 1CGUA 1IBGL 2DQTH 3NAAL 3PDDA 2YD5A 1JPFB 1TCRA 1XR9B 2BVUA 1U8QA 4FQXD 5EORH 2XV6B 5TDOA 2MQCA 1JGLH 3X11B 4HJGB 1K8DB 3FN9A 3GM8A 2X9YA 3LQAH 4ELMA 1K4CB 1RZIA 4XI5C 4JE4B 3S7GA 2AGJH 1QSEB 1UM4L 2C3XA 4K7PX 4MJIA 4AM0A 2ICWA 3C2AL 1LMKA 4HIIB 1WTGT 5JDSB 3KHOA 3H9HA 4QHUB 3QWRA 5IB2B 2DF3A 4BUHA 2MNUA 2NY4D 1MAML 5E00B 5FCSH 5B39A 2PTTB 5IV2A 1MF2L 5T3ZD 5C86A 5CSZB 5GSRA 4YBQD 4XP6L 5KW9H 1CDHA 4I5BB 1M7IB 4YXLH 3P4NB 4TSAH 3LN5A 3ZYZA 3C87A 1QFWL 3RKDC 2GJ6A 4Z0XA 1E4JA 4YDVA 3L5XL 4E41D 3EFDL 4G6AC 1YJDL 4MB5A 4YR6A 1CWVA 3EYUH 4F9LA 1MHPH 2CLZB 1MREH 2PYFA 3QDJA 4OZGF 1YEHL 2HT2D 3OR6A 2FDBP 3MNZB 3QJHA 3WS6C 2Z93B 5CJXA 4D0BB 4WGWB 5EZIH 1YPZF 4M4RA 1BX2B 3KPPA 2YRPA 2PYEA 4BH8A 2H2SC 3JWOL 2K3TA 1H3XA 3FAWA 5C0CB 5B8CA 3T0VA 2BHZA 2L7UA 3IKKA 1H3VA 3DJ9A 3GJFB 1FC1A 2BSRA 4HXAH 2AVGA 5IB1A 4BSWA 3VXMB 4WJ5B 1EMTH 2A38A 1CLZL 1PYWB 2BSSA 3BX7C 4O00A 1FN4B 3TVMC 1NCAH 5DEZA 1G0DA 1UWGL 2NR6C 2ZNXA 5JNYA 1I9IH 4MXWH 5HXMA 4J7RA 4AL8H 2CDEA 1NGPL 2F19L 5GPRA 1XGUB 4HG4K 1RIUH 5ICXA 1KTLB 3IRZA 4EXPX 3TVMB 2J8HA 4HWBL 3SDYL 5E2TL 4ZAKC 1CVSC 2FWOA 3NZHH 5INDB 3VRJB 3WXWL 2CDFA 3SBWC 3BQUC 5D2LF 1FPTL 2UUDK 1ZS8A 5IMOB 3CD4A 1T3FB 4BSJA 3DVNB 4ZAKB 2CRMA 4XP5L 1J8HA 3H9SB 3AS0A 1VFBB 2ZUXA 3HZMA 4KK5D 1RVFL 3BQUB 3B43A 1U0QA 1D5ZA 4G6KL 4JFDE 25C8H 1CFVL 1NUNB 3QXVA 3ABZA 1T5WB 3B5TA 5ADPL 2MHAB 4IOIB 4DZ8A 1FFRA 3G5ZB 4QHLB 4HMDA 3BIKA 3O2DL 4HQQL 5EIIA 4NZUL 3VMNA 1QR1B 1S7QA 3F6IA 2W1NA 2ZNWA 1OAUH 1MQKH 2ICCA 4KKCD 3OAYK 4WGVB 2YOCA 1E4XH 4JQIL 1I1FA 3A0OA 1CGVA 5BQ7B 5IJVA 4R4BA 5D96C 2MQ0A 2WBJD 3GZKA 5L2KB 4OGYL 3R1GH 5E6IC 5DLML 2XIDA 3O4LA 3QUXB 4HLJA 2JCCB 3Q1SL 1XCTB 1A7PH 1JI2A 5IP4A 4AG4L 2XN9D 3BW9B 4N8VA 4E0RA 1NAML 1BHGA 5D96B 2VSDA 4PLKD 5BVJA 1YUHB 2OTUA 4PRBB 5E6IB 5T3ZL 4PP1D 2IANA 5DEFB 5C09B 1YN7B 4PY8J 1IGIL 5J3HD 2QTEA 3GO1H 5FCUH 3BT2L 5ISZD 4Y16C 5GS0L 3BZEA 2VZUA 4A6YA 2FB4H 4L8SC 3FQUA 1R0AL 4Y1AB 4U1MA 4L3ED 4DZBA 2VITA 4X6FA 3MRKB 1N0LA 4LLQA 1EXUB 4GW1A 3U0TA 4Y8AA 1XGQB 1CE1L 5L8JB 4Y16B 3ESVF 5JMOC 4J8RB 2BY3A 4I3SL 4C59B 3QEQD 4L8SB 4QRRE 4NFCA 4I18C 2VB5A 3HC0A 4M7KH 4PRNB 2V2TB 5FF6A 2VDQH 5B4MC 2NY5C 1MIMH 4XCEB 1HYSD 5J1AB 4YEFA 1FNAA 1ZV5A 3OAUL 4I18B 4RFEB 3S96B 1JHKL 1L6ZA 3FO0H 3U36A 4N1HB 3OQ3B 5F7DA 2M2DA 3T4AB 1OSPH 3BVNA 3I85A 4S1DC 4XGZA 2E9JA 3VE0B 2NLJB 3VXOA 5IT2L 3TIEB 1P7KA 2F54E 2ZOLB 3QIWA 5CIPB 1D6VL 1X7QA 1IEHA 1HXYB 1FFQA 1G6RB 2NY5H 1MJJA 5FO8A 4PJ9D 3I9GH 2VZSA 1VACA 3MX0A 5GJSL 3CVHB 3GKWH 4BYHA 5CIPH 2D9QB 3S34H 2JJSC 3RDTA 2N56A 3TBYB 2JE8A 3OKOA 2V5TA 3VXRD 4GSDL 1G6RH 1PGRB 3MGTB 1YYLH 3P9WB 4YX2L 2B7DT 2F53E 4QRPD 2R0LL 3ISWA 4MQ7B 4OJFL 4BUGA 5F96L 4NQTA 1G7LB 2OXGA 3ZDYE 3VXQB 3JWDL 1U8PB 3RAJH 3UX9B 4F15B 3WDHA 1OCWL 1EAPA 5EN2B 4BELD 1YEEL 3QEUB 3QEGH 3TFKD 3I75A 3K46A 3FKUS 4WHTB 3KAAA 5FGBA 1SJXA 3V5KB 1I9RH 3QQ9D 4JG1H 3W9EB 5C0IB 4GRWB 3FQTB 2A73B 4ZYKA 2EDYA 3CUPA 4N0RA 4BFBD 4JVWA 4WHDA 2IBGA 5D7IB 4O51A 2XICA 1LP9E 5D8JH 1KCUL 1P2CB 2R2HB 3NCFB 5J1SC 1T4KB 3KPTA 5MENA 3WFDL 1WV7T 1IC4L 4GRWH 1QHOA 4LIQE 3L9RB 2CLRB 2HRLA 3MR9A 3WFBH 4BFIB 1FHGA 3TO4A 3ZDYF 3TBSA 1GHFL 1VA9A 4NKDB 3W39A 1SJHB 3B3IA 4Y4FD 2VIRB 1XF2B 3C5JB 3L3DB 4L5FL 4KXZH 4XC3H 5HHOB 4BH7B 1BJMA 1G9MC 1QKZL 3W0WB 3MTRA 4XRCB 4EUPB 3MRPA 1QFOA 1TZGH 2KH2B 3PG2A 4OKVA 4F7MB 2EYTA 3GGWA 1J0ZA 1TFHA 1JUFB 5DK2B 4Y19E 2P5ED 2R2EA 4L4TE 4KDWA 3NMEA 5HI3C 3STLA 5A2IH 3FJTA 1TVBA 5FHBL 1NFIA 3SGKC 2A0LC 4X4YA 1WJ3A 4PJDA 4ALAL 4PUBH 2X42A 2BNQD 5HYJB 4Y2DC 1A0QH 4F3FB 3HMXA 1BQSA 1JGDA 2FJGB 4V1DB 4JM2A 2X4TA 1G9MH 1KCSH 4NWUH 4NPYA 2H1PL 1KJVA 4FFYL 3S35H 3GJFK 4Y2DB 5FECA 3IFOB 2ZKHH 3S88L 3C6SB 3CH1B 3FOMB 5T1DL 5C70A 1N6UA 3H7BB 4PRIA 2R1YA 3QXWA 4YXKH 1IZJA 5JPMB 2NZ9C 3IU4L 3SDCA 3BN9C 2DQHL 3GHBL 4JPKH 1GSMA 1QACA 3HR5B 4K8RD 3W82A 3TCLA 3N1PC 1NMAH 1A3LL 2JCCE 2UWEB 2VE6B 4MJID 1LE9A 1L7TL 5BZWA 2D7NA 3MO1A 4HK3N 3QWRD 4Z7VB 1RUQL 1WFUA 1BQHA 3QFJB 1QPPA 5CMAB 1HQ4B 2P5WB 1NGYA 5IW6B 3NH7L 4XX1G 2GJZB 3GSNL 3OPZL 5DJ2A 4YFEA 4K23H 1D5IH 2ATPA 2C4XA 5HYFA 2GJ6D 2XZAL 1SJVA 2QQKH 4X98A 5E1AA 4U6HA 2BOBB 4HULB 2DB8A 3MRGB 3T2OA 1EFXB 2GSIA 2R0KH 3RTQC 1DQLH 2Q20A 1JN6A 2VXQH 4PJ8C 3LQMA 1MPAH 4YEEA 2IH1B 1F00I 4C57C 2EDNA 3B2VH 2JCCF 1ETZB 3LS5H 3PP4H 3IDNA 2C7UB 3WDIA 1ONQA 5ILTL 3RTQB 1ADQL 3HZVA 4P3DB 4DQOL 2VXTL 1CG9A 4PJ8B 3GUTA 2PYED 3V52H 3VDAA 1GZQA 5GRYA 3FQXA 4YE4L 2VOTA 4HGWB 4GAJH 3EYQD 1C16B 3GKZA 2VDNL 4S1RH 5FM5M 3MMEA 4ZTOH 4RGMC 3MJ9H 3WNPA 3KNBB 2WP3O 3BGAA 4S10A 3RNKB 5D6DA 4IJ3C 5DI8B 1EEYA 3UTSE 1OGAB 3MRMB 2NY0C 1IJ9A 1T03H 3QNYB 4RGMB 4U33A 5I73B 2JK5A 2YD3A 4E5XA 4IJ3B 1FC2D 4OCYL 1EA9C 1E4WL 2IBZY 5FV1L 4RX4A 2NY0B 4NN5C 1RJYA 3JZ7A 3T09A 2B8OT 4ONHA 5GJTL 5J06A 3MNVB 1OF2B 4WEUD 4YHMH 3THMH 3BPNC 1LILA 3HG1E 5IFAH 5J57B 3MBEC 1JGUH 4NGHH 3MRLA 4JHWH 3RVVC 3TLRA 1Z9SA 4NN5B 5JTWA 4AIZA 2P7TA 2PW2A 2XKUA 3CC5B 1E4XI 1FV1A 2KQNA 4OB5H 4QTIH 4WHYG 1TCMA 1QRNA 3BPNB 4EI5C 2ADFH 1J8HD 5IBTH 5GS1A 1KN4H 3MBEB 4WHYH 4PTTB 1FORH 2X4SA 3UP1A 1ZT1B 1FL3B 3DRQB 4NRZA 4NHUA 3OZ9L 4EI5B 2YD6A 4LSUL 5KSBB 5D7KE 1BM3H 4ENEC 1MNUH 3QIUC 4P48A 4PGBA 2FBJH 2V2XB 1PSKL 4ELKA 3U79A 4IRZL 1XIWA 1IGJA 4N5ED 4K7PL 4KV5E 4QTHB 5FO9B 5HGDA 4KI5D 5IBLD 4QRQA 1YY8B 3B9DA 1OY3B 2ZZUT 1NANH 1KB5H 1QP1A 1FBIH 3MRJB 5HYIA 3ARRA 2ESVB 5JXAL 4JN1L 5JHDB 3GRWL 3QIUB 3LQZB 2AABL 4I2XB 4JFOA 5C8JA 3T0DA 2YPLA 3MA9H 3TYFA 2XWTB 3P0VH 4ERSH 3MCKA 1YNKH 1A6WL 5CFHA 3CFKA 4LQFH 5IIEA 1MFDL 4QY8B 3O4LD 4RQQA 1SY6H 1P4BH 4GRWF 3ZE0E 4A2MA 1JNNH 3DRTB 1GGIL 5FHAH 2AJSL 4EN3B 4PLNC 3UJJL 3LV3A 3RZWA 1GGBH 3KYNA 5CEZD 1OPGH 3G6JA 3U30C 3UTTB 2IAND 3MRQA 5CP7B 1PG7H 1Z0NA 5BS0E 4I4WA 3VFRB 1HHKA 3CZFA 3DSFH 3N9GH 1TIUA 3U30B 4F7CB 5T1KA 4CN4A 2YK1L 5DQDH 2Y06H 1FZMB 1X44A 1KPUB 1IT9L 2X05A 3U4BL 5CHNB 4OLEA 3MV8A 2OP4L 1PKQE 2GK0B 1AE6H 4NUJA 1OAQL 4HGKC 3ZE0F 3BUYA 2LTQC 1R5IA 4L8BA 3ULUC 1RJLB 4KDTC 2P4AB 3EFFB 3FONB 4G8EB 1DQDH 2A74B 3LKQB 1RK1A 5T5NF 4R7NB 2OQJB 3WHE1 2HMIC 5DEGA 1CL7H 4HCRH 2VLLB 2QHRL 2JB5L 2LTQB 1FVDB 5C0NC 4LKCA 4B53A 4LPWA 4WFED 5C6PB 5IKCA 3NCYS 2W0LA 1JGVH 3FTGA 3IB4A 5HI5C 2HFEA 2J4WH 4H0IA 4XX1E 3RWDB 4YUEH 5D7JC 1XGRA 4CMMA 2ZSWA 1Q94B 4PS4H 4XNYL 2DQJH 1A6PA 4QHMA 1OW0A 1U3HC 3DETC 5DUMH 3VRIA 4O2CA 3BD3A 3QIWD 5I1AA 5KS9A 5GGSA 3IFLH 4HS6B 5DJ6B 3MLRL 4WIQA 5E8DL 2BMKA 4O9HL 4H88L 1U3HB 4GXUM 1AR1D 5D1XC 5F93C 1CGSL 1K3IA 4RIRA 3RDTD 1PZUB 1R24B 2PR4L 1IGMH 4NO5A 5JW4Q 2UWEF 3PQYA 1GZPA 4HDIB 1CQYA 4YWGH 2DM4A 2WM0A 5ID1A 1UH2A 4WCYL 4Z7VF 3BP5A 1TJIH 4XPGH 1FIGL 2ZPKL 3ZYIA 1K85A 3UBXI 1CDJA 1WGOA 2NYYD 4GKNA 5D1XB 4QWWC 5EZJB 4UMGA 1CGTA 1JRHH 3ZMRA 5CWSB 4XT1C 3RZCC 4DGIH 2VKXA 4KXZI 4G9FA 1KB9J 5T3XD 1XFPA 5ICZB 3QG6B 3VG0H 4MA1C 4GG6B 4JREC 3QXTA 5DJYB 1LVEA 3TWCL 3GMNB 1T89C 2VAAA 3AXLA 4FXGA 4NJ9H 1HHGA 5HHXH 4XPTL 3RZCB 2AJUH 5J0BA 1NL0H 3VXSB 2HH0H 3GM0A 4GJTB 4MA1B 4JREB 1P5VA 4U6TA 1QSVA 3EJZC 5IF0A 3CU7A 4MZ2A 4TTDD 3MJ8B 1N8ZA 3ARDC 1UCBH 3NA9L 3KPQA 3TO4D 3FFDB 1MFAH 3WE6A 4GMSL 4F7PB 4Y5XC 3IGAB 3CVIH 1FO0H 4R0LA 1A9EB 5EOCH 3MLWH 4YGVA 5HVWA 3ARDB 3STZB 5AWNH 4MJ5A 3O2WL 3IXTA 3TJEH 1FL6B 4KJWC 4Y5XB 2CK2A 2XG5A 2F74A 32C2B 4JQXA 1IC7L 4LOUC 2VDKH 4FN0A 4M6ML 3HUJE 1KYOJ 1LNUB 2X4NA 4BQ9A 3GJEB 1LDSA 1OQOA 2PTVA 5C0FB 2R8SH 5CEZL 1CDYA 1KXQE 3ILQD 5C0BA 3S6CA 3O3AB 3U9PL 4CVZA 1FFOA 5CCKH 3MLPA 5EUOB 1ZEAH 1FDLH 1DLFL 3ZHKA 4JM2D 5CEYA 5J7CC 1MJ8H 4A6YL 3C60A 3HZKB 4OIBA 2EIZA 2FGWL 3MRIA 5E8OA 3D69A 4KJQC 2E27L 4X7SL 1VGEL 2XWJA 2HT3D 1ITBB 2R1WB 2WLYA 3T08A 4N1EA 4PRID 1BECA 4LAJH 2PTUA 1BEYL 5EU5B 1SEBB 3DTXB 3RJDA 3SDCD 3KJ6L 2R4RL 2C3VB 3OTTA 2CD0A 2IMMA 4ZUSA 3KXFE 5TE6H 2ORBL 1VPOL 3ZKNC 5KSBF 3TESA 1IEBA 1T1XA 3L95B 3PWPB 4FQJL 1IAIL 1A6ZA 1ND0A 3QISA 1FYTA 2PO6C 2KPNA 3BZ4A 5HGBA 4K3JL 3X3GH 1A7QL 1YEIH 2NY3D 2OZ4H 1AP2A 4P9MH 1BVLA 2NW2B 4I8DA 5B38G 2GAZB 1RUPH 1QG3A 1S7WA 3LH2L 4NKIL 3O9WC 2PO6B 3RNQA 3SOBH 5I66A 1V05A 4QRUB 5JMRA 1JF1A 4YHKL 4AENA 1IKNA 3QUYC 4NWTL 4S0SD 4Z76A 3V0WL 5D2NE 3RFZC 1A1MB 4QRSB 1CS6A 1DTUA 4NNYA 3FB7B 3GBNH 1H3WM 2AXGB 3O9WB 5FB8A 1I1YA 4L8DA 4XP4L 4JGUA 2BX5A 3VW3H 3PDOA 1CGXA 1LEGA 2DQGH 3Q48A 3U0WL 3V4VL 3QUYB 5I2IB 4IS6B 3TNMB 3MFFA 4JR9H 4ONGH 1BWWA 2I24N 1P53A 3IDYC 5IEHA 1AGDB 5D9SA 3EYSH 1S9VA 1NCTA 5T3XL 2YBRA 1A5FL 4OZIB 3VCLA 2G60H 4MLSA 3DXAA 5EIQA 4U6YB 1KTDB 4IM8A 4P2QE 4E42A 3D3VA 3ARFD 3QUKB 1QA9A 3H3BC 3IDYB 1XF4B 5LGKA 1MHEB 2VL5B 1FFPA 4NSKA 2WZPD 2MJWA 5B22A 2DQCH 1AXIB 1UQSB 4WW2A 4ZUTB 3LB6D 4LLVA 5BJTA 5LGHH 3RBGA 2D0FA 4P2RB 3MV7E 3O6LH 4OCXL 5E6ZA 1AI1L 3UO1H 5DFWH 2P24B 3L3OB 2CK0L 2I60L 1T1WB 4ZXBC 3IDMA 4MA7L 4HJ0C 1HEZA 3GMMB 2XXCB 1W0WA 1NANI 4PV8B 1OD9A 3IFNL 1YMMA 3MGAA 4GXVL 3T8XB 4XXCA 3OKKB 4OZHE 4P5KA 5CEXB 1JHTA 3MOAL 1QBLH 1IAKA 3CX5K 4X8XA 1N4XL 1I1AA 5IW1B 5F3HA 4D9QE 4ZXBB 3V6OC 1AY1L 1W72B 5EO9B 4LSVL 5JZ7D 1I7ZA 4PBVC 1KCLA 4BQ8A 4GG6E 2ZCHL 2NXYD 4M61B 1J1XL 1LGVA 3HMXL 2GSGB 1I4FB 4RRPA 1CLYH 2AJVH 5KN5B 1W72H 4G8IA 5C0DA 2Q8AL 3GSQB 3QNZB 1U58A 5T5FL 2FJFA 4XBEL 3X3FH 5J13C 1CBVH 3BYYA 1XIWD 5T1LB 5IHUL 1K4DB 5E8NA 2IEPA 3NIFF 4YIQB 2GFBA 5C7XL 3KPOA 5EU6E 3QULB 1CXKA 1C08A 4PJGA 4CJ0A 1IGTA 3ZHLA 2VLJB 3OGCA 4H8WL 4QOKE 5CBEA 4LRNL 1ES0B 1JYVA 5J13B 3FN0L 3TN0C 4OV5A 2YPLD 4NO2A 1UJ3C 1WFNA 5HVGB 1V8HA 2OJZH 5GSVA 3PNWA 4JVUA 4GG6F 5I1HH 3I6GB 1ZVHA 4LLUA 5KVDH 3TN0B 3MJ7B 5I18H 1AO7A 3LRHA 3QDME 1UJ3B 1P5UA 4RFNC 5TE7L 3A6CL 5E99H 4UT7H 5TJWK 4R26L 4MCYB 3S37X 4WFHE 1ZWIB 4Y5VA 4CW1B 1MCLA 1YQ2A 3CCHB 5L6YL 3KYOA 3EYOA 4RFNB 5F88A 4ZOBA 3OR7B 2Z92B 1GXEA 3QHTC 1FLTX 5GZND 1T6VN 2VXSH 5F89A 3UPRA 1EGJA 5I8KL 5T1KD 5ESAA 1KEML 2H45A 4NP4H 4NO0A 3C9NA 4HT1H 1DANU 3U7YL 4LHUA 1EUTA 3MV8D 1AD0A 3R06B 5KVGH 2OSLB 5D7SL 4X7DC 2C1OB 3EO9L 5KAQG 1JNHA 1OGTB 4XAWH 5EOTB 1RI8A 3PIQB 4L4JA 1OM3H 5JXED 4K7PY 3UC0H 1HHHA 2FEEL 2QHLA 4PJCA 1XZ0B 4ZPVB 2Z8SA 5A3ID 3PWPE 3G08B 4DFHA 3QH3B 3UMTA 3BAEH 1DUYB 3EO1A 1UM5L 2VZTA 1ULVA 1JRHI 4U2YA 3CFBB 1T20B 2RCSL 5GRUH 4X99B 4CN6A 4CMHC 5JQ6H 3RPKA 4HUVA 5I0ZA 2E7LA 3O8XC 5TDNB 3N1FC 1TQCC 1C5BH 4QHKI 1QEWB 3WFEH 1NEZB 2H3NB 2DD8H 4GKSB 3WLWD 3OKDB 4CMHB 1CICC 3O8XB 5ACLA 2PF6A 4D8PA 2W65A 5C2BL 4P23A 5EC2A 2C3WA 4DAGH 1TQCB 1VCAA 1IARB 2QSTA 3PQYD 3V6ZB 1I7TA 4MD4B 5DMYA 3E8UL 1NBVL 3ZTNH 2OS7A 5FYJD 4H0HB 3U7WL 1JL8A 1A7RH 3HI1B 2HRPL 1MJUL 4XNZC 4LPTA 5D7LE 5D93C 1CICB 4CRPA 4UTBH 4JQVC 4ZFOB 4IBLT 1JPGA 1EDQA 1VFAB 2H32B 4NQEA 1KG0B 3WEXA 5IMLB 3IDJA 1N59B 4G9FD 3U2SB 4JPVL 3MRNA 1NLBL 4KROC 4O5LL 2YZ1A 4XNZB 2DDQL 4U1HB 5D93B 3VXNB 3WNNA 3U0PA 5C07A 1F45A 2JELH 3NFPA 1FRGH 2G75A 1U2CA 2JJVA 4MS8C 3ARQA 3PGCA 3BKYH 3OXSB 4P3CL 1TPXC 1S5HA 4KROB 2X4OA 5CLTA 1M4KA 4B5EA 3T0EC 4FTVA 5I30L 1MELA 3HFMH 3TZVC 4P9HC 4JPIB 4TULH 4U1GC 2BSED 5SWZD 5DJZB 3TGXA 1WIPA 3SDDA 1K2DB 3CH8A 2P42B 4P46A 4U1NB 3QNXB 1CDGA 1G6VK 2AEQH 1TPXB 4KZEL 3QDGB 4UU9A 4HV8B 2GTZB 4JAMA 3LRSA 3WNKA 1O0VA 3T0EB 4OZIF 3HC3L 4U1GB 2X70B 3X14B 3WSQH 1MHHB 5FDYA 1PJ9A 2F8XC 2DBLH 3C8DA 1MI5B 4DFIA 3PWNA 2GHWB 2MKLC 1A6TB 4DVBA 1MCNA 1RMFL 5C0BD 1YYMH 4B41A 3G04A 5DTFA 5IOPA 3BYTA 4ZOAA 2OXHA 4R4NC 4KTYA 3I2CH 3EHBD 4WI6A 1HZHL 4Y4HA 2X7LA 2X5PA 5BRZA 4LPYA 1FE8H 3NACL 1BZQK 4BA8A 1A1NB 2HLFD 3B2UC 5EU7C 2APVA 2Q6WA 5I15L 4HKZA 3C60D 4MNQA 4D94A 4G42B 2FO4A 5I1EL 3T1FA 1ZT7B 4PJAB 1LO5A 1SM3L 1KIPA 4QRTA 3VH8G 1T66C 4RISL 1D5BA 4DKEH 1F3JB 4C83B 1AXSB 1V3LA 1JWUB 3F5WA 3EJYC 2RJMA 4RMUA 3OX8A 1WZ1L 4Y7MA 3N50A 3MROA 4GLRH 5C9JA 2AW2A 4UINH 1ZSDA 4F33B 2HKHL 4XNQA 4EVNA 4TSCL 5I1GL 1X4ZA 2HVJA 2CRYA 1KJ2L 4ODHH 1FZKB 2AK4D 2UV3A 4OZFA 4Z78B 2DWEA 4K2UL 3WMSA 4C56E 1KNOB 5CD3A 1N0XH 1NCCH 4NUGL 5TH2A 3CFEA 1BLNA 5DVLA 2I5YH 3KYKH 1OAYL 2ZUYA 1P1ZB 5EPMB 5DMJB 1FYTD 3QEHA 3CXHK 3RWEA 3QPXH 4N8PA 5ALCH 4ZSOB 4OF5A 5DJXB 4AEIH 1S8DB 5GISL 4O2FB 4YFLI 3FRUB 2X41A 2NTFA 4JZJC 4DEPC 4D3CH 1J5OH 1FZOA 3O3DA 3OSKA 3TIDB 2Z8VC 3PGFL 1Z0MA 1QFHA 2IFFL 1OHQA 1BVKA 1I7UB 1HQRB 43CAB 1S7SB 4HG4J 5F9OL 3PHQB 1RUML 3QP3A 4PJFB 2Q76A 3ARXA 4KUZL 4JZJB 4DEPB 3GB7A 5FOBB 1T04B 4MX7B 7FABL 5INCA 5FYJL 1TETH 35C8H 3PGDB 4M5ZH 5HDOA 3WD5L 4ORGB 2A83A 1RHHB 3TA3C 1B88A 1Z9MA 3UPAA 4KVCH 5LQBH 1H8NA 1SJEA 2UZYB 4RWHA 4JKMA 3IU3A 2FD6H 4NQDB 4UV7H 4EDWL 3OJDB 3RIAF 3FCTB 4NQCB 3ROOA 1RZ7H 1UVQB 4PJIE 1MY7A 1D7FA 3RWCA 1G7PB 3TA3B 3DXAD 1QD0A 1MCCA 5F1KC 5DJ8A 5DRWA 1PLGL 2VWEC 1X4XA 2ILLA 5ENWB 4XNXL 1BGXH 3UAJC 3D3VD 4N9GB 3RVUC 2P8MA 4YPGA 3M8OH 4JB9H 4OT1H 3IJSB 1FNLA 3H0TB 2VLKB 5KAQF 1RZFH 2IPUG 3ARTA 1SBSL 3GK8L 1TJHL 3ORJA 2QLVB 4Z95L 5DD5L 2Y07H 3BKCL 1E0OB 2A9NL 1OVZA 1S3KH 3P4LA 4X7EC 3MLYH 3S36H 2YA2A 3MACH 5DS8B 3TP4A 2R4SH 4MMZC 4HUKB 3QIBC 3MBXL 3RIAK 3SE9L 2H2PC 3SKJL 3QDJE 3STBA 5C0GB 3GMPB 5L7XH 5FM4A 1OLLA 4AT6A 2BVOB 1YMMD 1ZHBB 4KRMB 3NFNA 3TH2T 5D6CA 1T2JA 2CRZA 3L3KB 4NRYB 3RIFF 3VG9C 3QPQC 3QIBB 1I1AD 3ZKMC 4L4VA 2HVKB 5TDPB 1HIML 3IXAA 3VRLF 3PWLA 3O3BA 4JKPL 2BRRL 1GPOL 4OGXL 4KKBC 4JFYA 3VG9B 3INUH 4P5TA 3KPLB 1MSPA 4GAFB 4PBWD 3IVKA 1B0RA 1KF9B 2AV1A 4JHAL 1G9NL 4G6FB 4PG9A 4Y4KC 4U1LB 4XVSH 1P9MA 1R3LA 1UWXK 4QHNA 1F4YL 2XOTA 1QHPA 3UJIL 4NKOA 4R6UA 3QI9A 5IVXA 3FFCB 4FQLL 1CE6A 3RIFK 5F71A 2HFGL 4Y4KB 3QJFB 4FQQB 4M43H 1S7TA 3HRZA 3I6LD 4HK0A 4MXVF 1YNTA 2OLDA 1MCDA 1YMHB 4S1QH 3S97C 3FB6A 1YEFL 1W0VB 1F58H 4JO1L 1UYWL 4KAQL 4KKAC 4FFWC 1AXTH 2KDGA 4P4RB 1T22B 4UIKL 1DBJL 3MV11 4L8CB 2W0FB 4RNRA 3GBMH 4IMLB 5FYKD 1YEJL 1J88A 1NMBH 3P0YL 4R90L 2D03H 5SWSE 1NKRA 1C12A 3KLHC 3H7LA 1JPSH 1BBJB 5BO1L 2R2BB 4GRMA 1CDIA 2XTLA 4G80A 1M7DA 2A6KB 2EYRA 4UTAL 3KDMA 1B90A 4V2BA 4LLMA 2YMXL 5GIRB 4OIIH 3CDGB 1E28B 1U91A 3F58H 4NO0D 1KFAL 3EYFA 4KMQA 4HW6A 1RJZA 4LCWB 4RSVA 1EERB 4CVXA 1QLFA 2M1KA 1TMCB 1D6EA 3RWIA 2CDGB 1XF3A 5FUOH 5HVFB 3VFTB 1S78C 4M7LL 2FYYA 2H9GB 1DDHB 2QL1A 4M93C 3FT3B 1UZ6F 2XY2A 1OSZB 1X5GA 5CINL 5DFTA 1ZTXL 4PGDA 1FNGB 4KGLA 3MV9E 1KPVB 2XYCA 4FQ2H 4U2ZA 4BQCA 2EO1A 2X9WA 4KQ3L 3WUWA 3NGBC 3L3HB 4M93B 3ZYJA 4YJZL 3ZKXC 4JANB 1UG9A 1RPQA 2JJTA 5I76A 2YEZA 1U95A 4OFIA 3J7HA 2QV2A 4KZDL 4G6ML 3EOYG 2VC2H 5GGUB 3NGBB 3ZKXB 4WTZA 5KSAC 4PJFE 4RGOH 3ARSA 1UADC 4P23D 3L6FB 1HDMA 3LAFA 1OTSD 3NFSL 4UDTA 5EBWB 1NBYB 2QKIB 4LKXB 1NCWL 3JUZA 4G8GB 3JVGC 4JO4L 2V5SA 2X4RB 3P2TA 5KSAB 1XR8A 4NQDE 3EGSA 3X12A 4NQCE 4NQED 3DROA 4OGAC 1WCBA 1L4IA 2B0SH 1TDQA 1GC1C 2R39A 1HH6A 2Q7NA 1DE4A 2YD9A 3LKOA 3IF1B 5C07D 2AJYH 1HE7A 3F12B 2IPTH 3MLSL 1K6QL 5DD3L 4PJFF 2CLVA 2VLKE 4NYLA 2LU3A 3V6BR 1QYGL 2CKBB 1FVCA 4PJ7B 2VWEE 1DUZB 2OI9C 1X5LA 4DN4H 4ZD3H 4LCUB 1MLBB 2WUBL 3AB0C 3CZJA 3MXVH 4RZCA 4TOYH 4DVRL 3SDDD 2OL3A 4P46D 1NLDH 4M3JA 3S37L 1GC1H 4GAYA 5F7EL 3V6FB 2CKBH 1ACYL 1IBGH 4M5YH 4OTXL 2R69L 1PAMA 4DW2L 5JW3L 5KSVB 3BUTA 2OI9B 1DQQA 3OB0K 3WJLC 5D4QA 3UTZB 1CU4L 4LSQL 3D0LA 3ECBA 3AB0B 4GLRI 3HPJB 2DLIA 5IESH 3P9LB 4UUJB 9CGTA 2NXZC 3K1KC 3Q3GA 1AC0A 3D85A 4LPUA 5DK0B 5IBUG 1UM4H 3OKLA 5FYKL 1OP3H 4K55A 1CT8B 4URTB 2XTJD 1BFSA 5EA0L 2RGSA 3C2AH 2XKNA 3QDHA 4WU7B 4Y4HD 3K4DA 2VR9A 4WEBH 2Q3ZA 5KANG 5BRZD 1MAMH 4LEOA 5ELIA 1S9XB 2NXZB 1DN0A 4JEGB 1FL5A 1MF2H 2FL5B 15C8L 4JY5L 8CGTA 4JJ5B 3TJHD 5FYLL 1U8JB 5I17A 4LPXA 4X8JB 1S7RA 5AZ2L 2YS4A 3EFDH 1JZ8A 1UGNA 3JWOC 4HX1A 1KCVL 5MENE 3QCVL 4JFDA 5SWQA 1YJDH 1AGFB 5FV2A 5D1ZC 1FLRL 3RPIA 5HTSA 5LG1A 4ZS7L 5C3TA 5E9DB 1T2XA 1WZKA 4XNUL 4WNQA 3S3PA 2ATKA 1DZBA 5GGVY 3VI3F 4MGXA 4H1LA 3EOTL 5D1ZB 4WWKC 2HJFB 3NCCB 1UACL 3GSWB 5E4IA 1QZ1A 3P30L 2H8PB 4PJBB 5CP3H 2EXYC 1FYHB 3C6LC 3TV3L 5HGHB 3W5MA 5IVZB 2RHEA 3DX7A 1KLUA 2Y1VA 2YUXA 3L5HA 3L7EB 4WFFE 4ODXB 2UYLA 1FCCA 4NNXB 4WWKB 4LARH 5AUMB 3IDIA 1DVFC 2K7PA 4BZ1H 5J11C 3C6LB 2WUCH 2X4PA 1CF8L 4JFHD 4XB7A 1A9BB 3T0AA 3G6AB 4UBDC 4WU5A 2NY1C 8FABA 5J11B 1XF5A 2F19H 5ECJE 4BM7A 2EXWD 1B6UA 3BZFA 1QLEH 3SDXB 4FMFA 3QUMH 3C8KB 1CK0H 3SDYH 4ZFGL 5E2TH 2Y6SD 4OLVL 2EDOA 1HINH 4IDJL 2Q7YA 1LO3H 1FIEA 2NY1B 2RBLA 2X40A 3T0WA 4R8WL 3KR3L 5E2VL 3U1SL 1JNLL 5F72S 2NW3B 3TO2A 2A9MH 1PX3A 4PREB 1J18A 3DMMA 5GGRY 4JY6A 3RL2B 4QRRA 1S9YB 3ARUA 2Q86B 4LLYB 2GK2A 3SJVB 1BJ1H 4HJGA 5KJRL 1N6VA 4FQXC 1RVFH 1ZA6B 3I6KB 4HLZG 3VD9A 1K4CA 1VEMA 5FKPB 3R8BB 3LN9A 2DI7A 1R3HB 3G9AB 2BOCB 5DHYB 1CFVH 3MPCA 3SE8L 4HLZH 3VFOB 5DJDB 3BP4B 2YD8A 4GH7B 4HIIA 4O4YH 4KDVA 5JDSA 4QHUA 4U1KB 3T0XA 2IQAB 5IB2A 2VMFA 4OCWH 1NMCB 3BD4A 3EZ8A 1SVCP 5E00A 4FQXB 2HFFA 3QQ4B 1NGXB 1QBMH 1U9KA 4HQQH 5EOQL 2AV7B 2EYSB 3M17A 2NY4C 2F54A 5CSGA 2I07B 4LDOB 1EZVX 1NFDB 4TUJA 3AU1A 3P4NA 4G8GE 1JMZA 3SQBA 3MNWB 5GGSY 2DQEL 2UZIL 5HHPB 4YBQC 4JQIH 4NC2B 2MCPL 5E03A 4L4VD 1OB1B 2NY4B 2CLZA 1RIHH 1NAMB 5IROC 3IYLW 3RWGB 5DLMH 5MI0C 5GS0C 3EOBB 1RZGB 1Y18B 3JUYA 5C0AE 2K7QA 4K3GA 1T7VA 3ULVH 2MMXA 1JK8A 4P5TD 2ADGA 4ZPTB 2F53A 4D0BA 1NAMH 2HT2C 5KVMC 5F1SA 3ALXA 1QVOA 5MI0B 1BQLL 3WFCL 4CVUA 1LEIB 5CGTA 1BWMA 1KEGL 2YUZA 4RDQG 1IGIH 3B6SB 5H2BB 4ODBD 3WS3B 1JFQL 4Q0XL 4J6RL 5GS0H 2IMNA 3QI9D 2R0WH 3KWWA 5DJCA 3SGJA 3LRGA 2KL6A 1A8JH 1S7UB 1LP9A 3MRHB 1M1SA 5D72H 4PLOB 1FP5A 1JWSB 2Z35B 5AAMA 4EBQL 1LD9B 3N85L 4I3SH 1DN2A 2K1MA 1M6OA 4WDIB 4AMKH 1ZLVH 4HC1H 1H15B 3AREC 2OMNA 5L2JB 4U31A 2DI9A 1G7IA 3GI8H 5CBAB 1QRNE 5E5MB 4PJ7F 4JN2B 4YHYC 5ADOL 3FO2A 4POZD 4X7FC 2X4QB 4MZ3A 5INDA 1JHKH 4J12A 3LKSB 2DL9A 1R3KA 3B5GA 4WTXA 3AREB 5EU3B 5DFVD 2HG5B 1NAKL 1LDPL 4Y19A 5IT2H 4L4TA 3DVNA 4ZAKA 4YHYB 1E6JH 3SCMC 4N90E 4WV1C 1D6VH 4PRPE 3JWDC 2BHYA 3JV6A 3DO7B 3BQUA 3LKPA 4DCQB 1ZKAA 4G43A 2YR3A 3FT2B 4M48L 3GSRB 3BO8B 4TQEL 5IM7A 4ONFL 4PRDB 1T5WA 2KKQA 3SCMB 2YA1A 2I27N 4WV1B 5AG8A 4XNMB 3I3DA 4GSDH 4IOIA 2JJUA 5J4MA 2NY7H 2P8LB 3FOLB 3BDYL 3G5ZA 4MDIB 4R96B 4UQ3A 5JIHA 4YX2H 2APFA 3M1BB 4Q6IC 1QR1A 4OJFH 4ZODA 3V7AG 4PY8I 3DX9B 3JWDH 5DQ9A 4LBEB 3KYMB 1X6NA 2GCYB 4U6XA 4GBXC 1U3JA 2C4FT 4J1UB 3MLVH 1FAIH 4Q6IB 2FIKB 1NSNL 3V4UH 1MAJA 1XGPB 3VXUE 2JCCA 5TPWH 4FG6C 4F9PA 2WBJC 4GBXB 4NC1C 4XPFL 1MQ8A 1NGZB 2V2WB 4GOSA 3SDAA 1JZ2A 4YNYB 1R6VA 1YUHA 1DR9A 3EO0B 3JXAA 3LKNA 5D71H 4D9RE 1BIHA 4GKZB 3AY4C 4FZEH 4I1NB 1YN7A 5BMFL 4PLKC 2WBJB 1OD7A 3NVQA 3V0AC 1EFQA 2DKMA 1S5IL 3BWAB 4HUXA 4PP1C 4PJBF 3QCTL 4IOSD 3SDXE 2FRGP 3MLZL 4KKLD 5J3HC 4L5FH 3TT1H 2IQ9H 2XN9B 2R23B 3UXFA 3MRKA 1QKZH 2B4CH 3TPUA 5I75C 1MUJB 4K3EL 2AK1H 1ZHNB 1IM9A 5DMGD 1G7JA 4J8RA 3RU8L 2IADA 3ZTJG 3K0WA 3DOSA 5SX5H 3I02B 4LAQL 3IAPA 3LZFH 5ISZB 4W4OA 5FHBH 4D0CA 4JRYE 2V2TA 4ALAH 4ZUUB 5I75B 2HLAA 5B3NA 3DVGB 4L3EB 3P4OB 2VXUH 4TN9A 4YHLL 4Z7OE 5MEPA 5GZOD 3O0RL 3BEVB 4D0DA 1G7HB 1QSFE 4HIEB 4X4XB 5ALBH 3SDXF 3T4AA 2Z0BA 4M62L 5IFHL 1WAAE 4FFYH 3VE0A 2NLJA 4J3TA 2O26U 2XRAL 1GOFA 1ROWA 1WF5A 5CIPA 2VLRE 5T1DH 5HVHC 2JKXA 3QHFL 5TF0A 1AFVL 1D9KA 4PRAA 2QR0B 1EEZB 1RULL 5J8OA 1I8LC 3ULVE 4HIHB 1CFSB 5E2UL 3GHBH 4PLJD 3ZT7A 4RMVA 4JFPB 3D85D 1M71B 3S98A 5HVHB 1A3LH 1FSKC 3DGGA 3GSNB 4ZDHB 3NZ8A 5J6HB 3HG1A 1OWRM 3LMJL 3VWJA 4NO3A 1ZXQA 2R56L 4K3DL 1RUQH 4MQ7A 3PP3K 1IILE 3KPRB 4R9HA 4L29B 2JJSA 4MD0A 2OBGA 4P59L 1FVEA 3U46A 5AD0A 3OPZH 1QO3A 3BIAX 1FSKB 4PJHB 3ZE1F 1BZ9A 1NFDF 1VEOA 3WO4C 3VXRB 4WHTA 2GJJA 5HYSG 1HNFA 1PZ5B 3FT4B 3HHRB 4JFDD 4M9PA 3W11D 2Z91B 4QNPE 3TFKC 4QRPB 1FNSL 1A2YA 3F6LA 3PWUA 4Z7QF 4U1JA 2W0PA 3QQ9C 3UBXA 1OP5H 3WO4B 1DBMH 2R2HA 2HTLD 3GIVB 4HH9B 2FR4B 1JGEB 2Y5TB 3QXDB 3L9RA 5EFIB 5F7HA 1ADQH 2VXTH 3OXRB 5DMIL 5E5UB 4RDQF 3AGVA 4NKDA 1VEPA 5I8EB 2Q87A 4HHAB 4YE4H 1AQKL 1BF2A 4ZFZB 2VDNH 1F11A 1OAZL 4XH2A 1PQZB 1E4KC 1H9VA 3QDAA 4KTEL 4C54A 1ZA3A 4MDJB 3MLTB 3O3EA 3FO1B 2XZZA 4QNPF 1JUFA 1U41A 5DK2A 1IQWH 1H5BA 5AYUL 4LP5A 1X3DA 2EH8H 4I3RL 5KBNC 1VADB 3NCYP 2D4FA 1DL7H 2R0ZL 2DQUL 5TQ2H 4LLWB 4MAUL 4WI3A 3DI3B 4OCYH 4F3FA 1GVIA 4OM1L 5KVEL 4LEXH 1RIVL 4LFHG 2ZG2A 5GJTH 3NOIA 3SGKA 3CX5J 5M7QA 2P5EB 1DBKL 4U1IB 3QHZL 3V7AE 3ALWA 3IETA 4HXBL 5IK3A 5SX4H 1JTTA 4H20L 2JIXB 3VFVB 4OD3L 3CH1A 4L3CA 3V0VB 3FOMA 2AXFA 3VD5A 5ICYA 1PKQA 1UKQA 2BNQB 3SE4C 3DMMD 3S35X 2YPVL 3MCLL 4QRRD 5EO0B 1Q0XH 4JY4A 4I9WE 2IH3A 5DO2C 2DTML 3DYMA 2OCFD 2CIKB 5DT1L 3BEWB 5I1KL 1IC5H 2FGZA 1PFCA 1WIUA 1A47A 3D48R 3SEPA 4JDZA 5FO7A 5JOEA 4LSUH 2VSCA 1BF8A 1F8TL 1PSKH 4PGCA 1U8QB 4PFEA 2OL3L 1J1OL 4Z7WB 4KPHH 5GGTL 2GJZA 5TDOB 3SKOB 4LVEA 2F54D 1IM3B 4Q9QL 4ELMB 3H42H 5JXAH 4JN1H 3GRWH 4MJIB 4J4PC 1ODAA 4X5LA 2ICWB 3WIFA 3MRGA 1EFXA 2J8UE 2XQBL 3H9HB 5J56B 4JFZL 4N8CL 4F7EA 1A6WH 5M94B 3REVA 5B39B 5IV2B 1EEQA 2LFGA 5IGXH 4F9LC 4JRXB 1GGIH 1T1ZA 5B39G 4JFEE 2AJSH 5DVMA 1UENA 2F53D 3LN5B 2ICES 2GJ6B 3MJ9A 4Z0XB 2VDML 4P3DA 4YDVB 1KTKE 1G7QB 4MCZB 3CK0H 3DNKA 3C8HA 4PPTA 4YR6B 5J12C 4CDGC 4HGWA 3LEXA 3QAZC 2PYFB 4OFYA 1QBBA 3KNBA 1TZHB 1IGCL 3OR6B 4U7MA 4JO2L 4GW4A 3QO1A 2X1OA 1X5YA 3EYQC 1J05A 2J8UF 2H2SD 2C9AA 4GAGH 1VESA 2CJUL 2YK1H 1A3QA 5J12B 1T2QL 1IT9H 3QAZB 3KPPB 5IUSA 1RZJL 5E2JA 2D31A 4BH8B 1OAQH 2GUOA 5DD6B 1CTOA 1F90L 2BFVL 2BSRB 4BSWB 4LF3B 3Q6GH 4U6VL 5E95B 3I50L 4FQHB 3J8F7 4AEHL 4AY0A 1HILB 5GRVL 2HKFL 3QRGL 2VLME 1HYRC 2UY6A 4YDKH 3ZL4L 2A1WH 5MHSE 1DBBH 3KPRE 5CGMA 1MFCL 5DR5H 5JNYB 3CC5A 4ODSL 2B1HL 4XNYH 1X5AA 4Y19D 5SX5K 2FX9L 4L4TD 2CDEB 4ZAKD 4PJHE 1K5NA 3HUJA 1AGBA 5ICXB 1X5HA 3QG7L 3A6BH 3MLRH 3HB3D 5E8DH 1L9NA 4O9HH 4H88H 2CDFB 4BSVA 1FNHA 1KB5A 1RU9L 1ZS8B 4U7KA 3JTTA 4JO3H 4OCSL 1T6WA 1PY4A 1PEWA 2EEDA 4CNIB 4I13B 4RWYL 4QTHA 5FO9A 2CO6B 1J8HB 1UEYA 1JGLL 4KHTL 1MCWW 4LVOC 1FIGH 3L3JA 2ZPKH 1JV5A 3MRJA 2ESVA 4N5EC 2AGJL 4HD9A 3E6FB 5L88H 1SY6A 2W91A 4KI5C 5IBLC 1U2HA 4HZAA 3RWHA 4Q6YA 4PJHF 5D1QC 1AO7E 1HCFX 5DC0A 1CN4A 4LVOB 1UB6A 4NCC1 3CLFL 4DZ8B 2FECI 5JW5B 4Y0GA 3HS0A 3TWCH 3RA7L 4XPTH 3KXFA 1MJ7H 5EIIB 5D1QB 4TSAL 3I84A 3SDAD 3SO5A 2APBA 5F8QC 3DYOA 4M6AA 5IJVB 4R4BB 5CP7A 3DIFB 1MREL 4I0CC 4KI1A 3O4LB 1AQDB 2AJXL 3AS2A 2EC9U 1UKSA 3BIBX 1WVZA 3BP7B 2XQYG 4N8VB 4F7CA 5D2NA 1FZMA 2OTUB 1OP5K 4HUWA 5CUSL 2F58H 2FLBT 1IM9D 4HCRA 4PJCE 1IC7H 1N3NB 2AEWA 4OBSA 3LKQA 1EX0A 3OAZH 4LASL 1U93B 2OQJA 3BZEB 5CEZH 4A6YB 3FQUB 3MYJA 1EMTL 4U1MB 2P47B 4DZBB 5KTEL 3NPZB 5I71C 4X6FB 4KDTA 4RAVB 4LLQB 1TENA 4GW1B 5EWIH 3U0TB 1CCZA 5CGYD 3PHOA 5I6XC 1EHLH 3LPGA 4P2QA 4Z7WE 1PY9A 1I9IL 1MLCA 2FGWH 3B9KC 1J10A 3UTSD 1RD6A 4AL8L 4MD5A 4X7SH 2E27H 4U3XA 5I71B 3HC0B 1VGEH 4LLDB 1PX4A 3W2DH 1RIUL 1U8KA 4OKDA 3IT8D 4RFOH 3VWKA 4S2SA 2G9HB 5DJ6A 5D7JA 4HWUA 5I6XB 1D9KD 3ELAT 5F6IC 4LIQL 1BEYH 4S1DD 3B9KB 3QIWC 4ETQA 3CLEH 3V5DB 1RK0B 4JPWL 3U36B 1UH3A 2EDFA 3KJ6H 3MV7A 4XCFL 3I3BA 3BVNB 4XGZB 3VXOB 3LIZL 3LEYL 4JRXE 1P7KB 5F6IB 5I9QC 1AR1C 1VPOH 3HG1D 3RDTC 3BWUC 3QIWB 3VWJD 4FQJH 5F3BA 3UZEA 3F7YA 1IAIH 2WBKA 4RGNE 4OZHA 4EXKA 4WVRA 4Z7WF 1MJJB 1QQDA 1XF1A 4LCYB 4K3JH 1A6VH 4WY7L 3UDWA 1A7QH 5FA3A 5F6HJ 5FUCC 4O02L 5I9QB 3KLSA 2NYYC 4ELMF 3RDTB 3OKOB 4HKJB 1A22B 3QG6A 4KVNH 2AJZB 4GG6A 5D5MB 3CIQA 3GMNA 4FTVE 1I8IA 4YHKH 3V0WH 1INDL 3RZCA 2B2XL 3ZSSA 3VXTB 2R29L 1OAUL 3P4MB 3VXSA 5D7KD 4XWGH 5K9QG 4LRIA 2VNCA 3VFWA 1WZLA 4PRHE 1E4XL 1EAPB 3RGHA 1N2RB 3ILPA 1FO0A 4XWOC 3V4VH 5EH1A 2J6EL 2EE9A 3I75B 2DWDB 4K71C 3R1GL 3GSVB 3FQNB 4QOKA 4F7PA 3VI4F 4TTDC 1NDMB 1JWMA 2NMSA 5DWUL 3T3ME 3TO4C 4PTUA 5SX4I 4I77L 1A5FH 3E3QE 3IKCA 5E24E 4K71B 5J6GA 3KPSE 3B83A 1GGCL 4EI6B 1FL6A 2MWCA 3P9MA 4Y5XA 2VJXA 2V7NB 32C2A 3RI5K 3TO4B 3QDMA 3GMQA 1WBZA 4QF1A 3TBSB 2AKRA 1HXMA 3QFDA 3B3IB 5DUPL 4MNQE 2VRAA 1MRFH 3TT3H 2V9QA 3O3AA 5ITFB 2KBGA 1YEDA 2Z31C 4WFGE 1BOGB 2GQHA 5BS0D 1NGWA 4B0MM 2YD1A 3ILQC 3MRPB 2BVQB 1AI1H 3ARYA 4OKVB 1N5AA 3T77A 2A0LD 3GGWB 4GRLA 4LCCC 1CDUA 4XMLL 2CK0H 2I60H 2R2EB 3MUGA 4JM2C 3STLB 4MA7H 5GHWL 3KLAA 4YAQA 1TVBB 2Z31B 1NFIB 4X4YB 2WBWB 4PJDB 4GXVH 1JTPA 3MOBH 2AEPH 1QR4A 3G5VB 1MIML 4LCCB 1JGDB 3FMGH 4JM2B 2HT3C 3DTXA 1AY1H 2X4TB 2RB8A 4H8WC 3WIIH 1MCHA 2C3VA 4MB4A 1KJVB 1OSPL 2VERN 1EHNA 3EUUA 1J1XH 3HMXH 4RCAA 5FECB 1UCTA 3D25A 2CGRL 2OZ4A 5T5FH 3Q2CA 1OAKH 3BH8B 3PWPA 5JHLH 2AQ2A 3BN9D 3G5XA 1OTTD 2R1YB 4PRIB 4WI8A 4PJ5E 4XBEH 3I9GL 2YD4A 5DD1L 5E8PA 5B38A 4TPRH 3GKWL 5C7XH 2EDRA 4WUUE 2GAZA 4LRNH 3BSZL 4KRPD 1X6LA 3TCLB 4D9LL 2PO6A 1KGCE 2NY3C 1LE9B 3FN0H 4QRUA 4UT9L 3L7FA 1Y0LB 2EDDA 3SQOL 4N9OB 1EFXD 3MO1B 3VMOA 1DSFH 2FHBA 4K94H 1OT1A 3VGFA 3DUUA 5JIPA 5I1JH 3RAJL 4PJXE 4AQ1B 1NGYB 2NX5E 3QRFM 2AXGA 1ERNA 1Z5LB 4KI5F 5DJ2B 2NY3B 2ATPB 4X7TB 1F3RB 3VGBA 4IMKC 3SPVB 3A6CH 3TNMA 2LU7A 3W9DB 1IAMA 1U6AH 3D0VA 5E1AB 1BFOB 3LOWA 4JG1L 1TVDA 3CFJA 4WEMB 4Z18A 2GSIB 1KUMA 1JN6B 3O6KL 4FFVD 3L1OL 3CJJA 4NM8H 4OFYD 4BFGA 5L6YH 2V5MA 5D8JL 1Q9OA 3RX7A 4CKVX 4MSWB 2E9BA 1KENL 3RUGE 3IDNB 3BI9X 1RAMA 3L5IA 3WFBL 1ONQB 1XF4A 1MHEA 1KEMH 3G9VA 1S7VB 3MRDA 4KY1H 3B8YA 1NH6A 1CG9B 3B8SA 4PJXF 5D6DC 2A6JA 1JE6A 3ARFC 4NIKB 1UQSA 1GZQB 3D9AL 5D7SH 3FQXB 3EO9H 4EZMA 4NOBA 1O7SA 5AG9A 5BXFB 3LB6C 1TZGL 2P24A 3ARFB 1UB5A 3F65A 3L3OA 2JB6A 5FAAA 1C1EH 3CAFA 1EEYB 3BHBA 1T1WA 3GMMA 3OKMB 1F2QA 4Q2ZA 2XQYK 3T8XA 2JK5B 1UM5H 1PW3A 2XZQH 4MXQD 3WKML 5IHLB 4ZXBA 1U3ZA 4JFFE 1W72A 4AEEA 1KCSL 1KOAA 1F4WL 5A2FA 4JDVA 5L8LB 5F9WC 4K9EH 3S35L 4HEPG 5JZ7C 2BJMH 2ICEA 2E6QA 5KN5A 2ZKHL 1IEAB 4Y5YA 2CRIA 3V6OA 2NXYC 5IVXE 2P7TB 2PW2B 1WWCA 4W68A 3QQ3A 3U4AA 1F5WA 5F9WB 5T1LA 1NBVH 4YXKL 2OR8A 3EZJB 3O41A 3U7WH 4JPKL 1CD9B 3K3QA 3D5OF 2HRPH 4Z77B 4XZUA 1XIWC 2NXYB 4X6DB 4ENED 2P8PA 2D7OA 1CFQB 1ES0A 4W6YB 3T2NH 2AS5M 5H94B 4NHUB 5FUZL 4R4FL 3LEVH 3NBNA 4PGBB 3RVTD 1KJ3H 4ELKB 1ORQA 5D5MF 4O5LH 2DDQH 1XIWB 1IGJB 3K8KA 4Q97A 1HKFA 4XXDB 5HGDB 4K23L 3KXFD 4QRQB 4C56A 4UDUB 4RMQA 4HJJH 3PHSA 4JG0L 1HSAA 5EG6C 4LCIH 1HWHB 5KZCD 4P3CH 1GAFH 4MCYA 1ZWIA 1IKFL 4JFOB 5C8JB 2YPLB 5I30H 3O81A 5FGCE 1PVHA 3CCHA 3HAEB 2VXQL 3CFKB 5IIEB 1TZIA 2DOCA 4RQQB 3HAEG 2Z92A 2BHUA 4ZNCD 3LS5L 3PP4L 3QXUA 3HAEH 1A64A 1H3TA 5GZNC 3QYCA 1DP0A 4I0PA 2Z9TA 3ROLA 1FH5H 3G6JB 2VAJA 3MRQB 1G0YR 5IJKA 1SYVA 4GAJL 1JYXA 4ZTOL 4I4WB 2DS4A 3F7VB 3MJ9L 1E27B 5K9KA 3CZFB 4H26A 2DM7A 2Y36H 1RMFH 3PIQA 2YA0A 3HRPA 4UOW0 5T1KB 3CNKA 1HZHH 1XZ0A 3NACH 1D3CA 4OZGE 4PJIA 5JXEC 3MV8B 2FATH 4HPOL 5I15H 5HHME 1DUYA 3BUYB 1R5IB 4L8BB 4V2CB 5GGRB 4P2QD 2VUYA 5A3IC 1M05A 3K8MA 1SM3H 5CLWA 1YPZE 1BBDL 1RK1B 1TNMA 1EZVY 5DEGB 5TDNA 1B3JA 1KJ2B 1CLOH 2ZJSL 5HI5D 1MCOL 3VWKD 1GRWA 1OW0C 5C1MB 3THML 5D7JD 5MEQA 3ZKQD 4JM2F 2VQ1A 4LKCB 5IFAL 5IKCB 2HKHH 1MVUB 4JHWL 4GKSA 3FTGB 5I1GH 2HFEB 3DETD 3MV7D 1KJ2H 1XGRB 4CMMB 3O8XA 2ZSWB 5A2KH 1VKXA 1F02I 3CFDA 4LPVA 3V6ZA 2R15A 1FGNH 4OB5L 4QHMB 4QTIL 5DZLA 2I9TB 4NBYB 1PKOA 3WLWC 5K9QI 2YWYA 2ADFL 4O2CB 5IBTL 3QR2A 3SE3A 4QXGL 5I1AB 5IWLC 5KS9B 3HI1A 1FORL 5GGSB 4FMKA 3KGRA 1AGCB 5BOZG 1N26A 4OM0H 1UJTA 3OJMB 4NDMA 1DFBH 1VFAA 4D9QD 5J1TC 1KG0A 1YZZA 2DIAA 1EO8H 1BM3L 4RIRB 4TVSa 1MNUL 3U2SA 2F5BL 4NO5B 3PF2A 3PQYB 4EDXA 3HC4H 5I1LA 1GZPB 4MNHA 4X80H 3VXNA 5ID1B 1I8MA 2DJSA 2IFFH 2EO9A 3SGEH 3SKNA 2VZOA 3BP5B 5I1CL 1I85C 3RZCD 5DA4A 1KB5L 5F9OH 1KV3A 5D2LE 5EDXA 4GKNB 3KPNB 3D39E 1NCUA 5FYJH 4QT5A 3GJFH 3MA9L 2E7BA 4LMQE 5EC1A 3P0VL 5F1IB 3WD5H 1XCQA 5EU6D 5CZKA 4LQFL 1LK2A 5DJZA 5FA4B 4QOKD 2VO5A 3KHQA 4FXGB 1P4BL 2VAAB 3QNXA 4X6EA 1JNNL 5FHAL 4HV8A 2LAGB 1UWEL 2OMBA 3K2UH 3FHAA 3TZVA 4MNGB 4KRLB 2X70A 3IDXL 3X14A 1PLGH 4R0LC 5IF0B 3AMLA 3MUHL 1N8ZB 1JYWA 3LN4A 4M6NL 5SWZB 3KPQB 3QDMD 5A16A 5H8DA 5KSUB 3DSFL 4QGTA 1REIA 2Y9RT 4JQXC 4WFHD 1TJHH 3DURB 1ZE3C 2JLLA 3N9GL 4XVTH 4ZFFA 1A7OL 4R0LB 4Z95H 4KJWD 5DD5H 5DQDL 2Y06L 3WUZA 2A9NH 4YGVB 5SWSA 4L1HA 3DI2B 2XA8H 4TSBH 1IC1A 4MJ5B 3IXTB 1AE6L 1MVFA 3HZYA 4GRLD 3VH8A 3EHBC 4M6OL 3MBXH 4PJEB 5H37G 2HLFC 3T1WA 4M7ZC 3SKJH 1NGQL 3HLAA 2UY7A 1AXSA 1R5VA 5GRXG 5H37H 5D70H 2CO7B 1G9NC 3M07A 4HCRL 5C0BB 4X6DE 4JFXB 3DX8B 1K8IA 4HWEL 4CVZB 1FFOB 4DOHE 4LVNC 2BXZA 1HIMH 4O58H 4X0KA 5CEYB 4M7ZB 3QUXC 1URLA 4KJQD 2L7JA 12E8L 2DLEA 1T7ZA 2BRRH 4JKPH 4YUEL 4OGXH 3MRIB 4PS4L 2BC4B 5E8OB 5E1HB 4LVNB 4F80A 3PWPD 2XZCL 4JHAH 3WXVL 3IFLL 1G9NH 3MV9A 1YY9D 5DZOA 5E94A 3A67L 1F4YH 4ZSOA 1AC6A 1S8DA 2SEBB 5CJ8A 5ANME 5J9PA 3AS3A 4QCIB 5FKAA 2E3VA 3ZKND 4X6DF 1WWWX 1IGML 2AK4B 4FQLH 2I9LA 2HFGH 1HNGA 4TRPL 1I8KB 1Q0YL 3FRPA 4ZUSB 4JM4L 1YN6B 3BRGC 1TJIL 1HQRA 1T1XB 5F1NA 1ND0B 4PJFA 3GMRA 4PGEB 4JZJA 4OLYL 3BZ4B 5FOBA 1YEFH 1T04A 4NRXA 4MX7A 3IS1X 1IKNC 1JRHL 4KAQH 1B6DA 4WI5A 1AP2B 3PGDA 1BVLB 1DBJH 1BD2B 1RHHA 1TTUA 3TH3T 1S7WB 2EDLA 3PL6A 3RNQB 5I66B 5D7LD 5EBLB 1YEJH 1A21A 1JF1B 4OUUB 4NJ9L 5HHXL 3U6RB 1N5YL 4NQDA 4G7VH 3OJDA 3NPSC 3P0YH 4LMQI 1P4LA 4E9LA 3FCTA 2AJUL 4NQCA 3DVIA 5GGQH 4NNYB 4EOWH 1H3GA 4QXTA 5HGGS 1QSEE 1XGTA 5BO1H 5FB8B 4L8DB 5ENWA 1C7TA 1GIGL 3PDOB 4N9GA 4UTAH 1LEGB 2YMXH 4KRNA 3NPSB 1UCBL 1KFAH 1BJ8A 2ZCKH 4HS3B 2VLKA 5H35A 2Q1EA 3G6JF 4NBXB 1X5ZA 2H26A 3CVIL 4PB0H 1S9VB 5EOCL 1HI6A 1VERA 2YBRB 3MLWL