4KOBA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kobA00
2EILB 3OD3A 4BXSV 5I6KA 3NP3A 5TK2A 4UANA 1NPNA 2QPDB 1SDDA 5I5MA 1MZZA 1PF3A 1W6WA 1JXDA 1ASOA 1M57B 4E9VA 1J5CA 3WIAA 2VN3A 2GC7C 1N70A 2AANA 4E9SA 2CCWA 1SDDB 4QKTA 2HLEB 2PPFA 4GP8B 2BW5A 1GS7A 1GSKA 1PMYA 2JKWA 2AZAA 4G71B 2AVFA 3MBWB 1OE3A 1PNCA 3NP4A 4AZUA 4QLWA 2IAAC 5A7EA 3QJQB 4EF3A 1X9RA 1A4BA 3TASA 1GS6X 4A67A 1OE1A 1BAWA 2VW4A 2GI0A 2DWTA 2XWZA 1RKRA 1JERA 1IUZA 4YSEA 1V55B 1AS7A 4A2FA 1XMEB 3V9EA 1ZPUA 3PLYA 2QDWA 4YSQA 3PPSA 3OQRA 3X1BA 2W88A 3SQRA 4DP1X 5D4JA 2QPEB 3PXLA 2GB2A 3WNJA 5AKRA 3FQYA 3QPKA 1SF5A 1F56A 1ZV2A 2R7EA 1ET8A 3S3CB 3QJSB 4G72B 3NJHA 1T5KA 2EIJB 2PP9A 3UACA 2H5UA 4DP4X 2TSBA 2YQBA 2IDFA 4DPCX 3NSYA 2HRHA 4FA7B 3NJMA 3FQ1A 2XX0A 2YAMA 1WA1X 5IY5B 1HFUA 1ILSA 2Y69B 5PCYA 3FQ2A 2HZHA 1SNRA 1ILUA 1NIDA 2IDSA 3OMNB 1ADWA 3CDZA 4G7SB 3FSZA 1AZBA 1BYOA 2A3TA 2OV0A 4P5SA 4NERA 2WSDA 5B1JC 1PZBA 4A2GA 1ZIAA 2PCYA 4YSUA 4GXFA 3CVCA 1KV7A 2YARA 1AANA 2I7OA 2J55A 2VSKB 3QJRB 2Q9OA 1AACA 1KDJA 1JZIA 3IN2A 2VW7A 5I28A 1TEFA 3UAAA 3D12B 3X2QB 2W8CA 2GIMA 3T6XA 3NJNA 2IWKA 3ABKB 2DYRB 3UADA 3PAVA 4KNUA 4A2EA 1GR7A 1KYAA 3WKQA 2XV3A 2X87A 4KNSA 1SFHA 3FU9A 3T6VA 2TSAA 1KGYE 2FWLB 4UF7C 3FU7B 1WS8A 1PNDA 3NJJA 1L9RA 1AOZA 3FS9A 1NZRA 3TA4D 4G70B 5B1KA 2YAQA 1IBZA 2VM4A 1SJMA 2IH9A 7PAZA 4DP9X 1W6LA 2B3IA 3OMAB 3UGEA 4YSRA 2BP0B 1I53A 4A66A 4BDVA 4YSTA 4AKPA 3ZBMA 1W8EA 2YXVA 2BW4A 2PP8A 4E9RA 3ABLB 2N0MA 2YAHA 4GY4A 1XB8A 1L9OA 3DIVA 4HCIA 1NINA 1RZPA 3BQVA 1MZYA 3ZX1A 1KBVA 4HCGA 4MFHA 3EF4A 2ZOOA 2IDUA 3WKPA 2PLTA 2YAFA 2VM3A 1AZRA 2FT6A 3FU8A 4HZ1A 3TBCA 1SHWA 1E67A 1GW0A 2IDQA 4YL4A 1BXVA 1L9QA 1AS8A 6PAZA 4WTQA 2IWFA 2VMJA 4YSCA 4PCYA 8PAZA 4DP8X 1PZCA 1A3ZA 2PPDA 3JTBA 1X9UA 3TBBA 4A2HA 1SF3A 1L9SA 3NJIA 1JVLA 2IDTA 1GY2A 2XXGA 2R7EB 3JT2A 4YSSA 2QDVA 4GP4B 4YSAA 3HB3B 5ANHA 4KO7A 2EIKB 2X88A 2I7SA 1HAUA 1CUOA 1OCZB 1JZJA 2I85A 1J9QA 1FWXA 1OCCB 1RCYA 1GYCA 1SFDA 1ETJA 3S8FB 2VSMB 2XYBA 2ZONA 1QLEB 1TEGA 1QHQA 5B3SB 3GYRA 3ERXA 3TU6A 1CURA 2E86A 1BQRA 3GXUB 2UX6A 9PCYA 4KOBA 4A68A 3ZIYA 1ET5A 4DP2X 1ET7A 2H3XC 3FT0A 1JZHA 3T6ZA 3T71A 1PLCA 1AS6A 1JZGA 2FQFA 1PZAA 1KDIA 2RACA 1AZNA 2BHFA 1NIEA 2DYSB 4YSPA 2OCCB 3IE9A 1MDAA 5B7MA 3QQXA 1BXAA 3NJGA 2HXAA 3NSDA 3CZUB 2GBAA 4L0PB 1BQKA 3AG4B 1KCWA 5I6NA 3DTUB 5F7BA 3EHBB 4JHUA 2GC4C 2MRYA 3N2JA 2BP8B 4E9TA 1J9RA 2BO0A 4YVNA 1NICA 4KO6A 2B08A 1WAEA 1FA4A 2EINB 3L45A 1ASPA 2HX8A 5PAZA 2AZUA 4X4KA 2XVBA 5FC9A 1V54B 5I6LA 2YXWA 1OCOB 3BVDB 3X1FA 3WG7B 2MTAA 3KW7A 1NTDA 4HAKA 2PPCA 2J56A 3FSWA 1PLAA 2PPAA 5B7EA 3IEAA 3IN0A 2YAOA 3NJLA 1NIBA 1J9TA 4BXVA 5I5JA 2IWEA 1NIAA 2WO3B 4G7RB 6PCYA 3AG2B 1E30A 1JXFA 4TXVB 1V10A 2LLNA 3AY2A 3SBQA 1SHXA 3WI9A 1UATA 1BEXA 4YVUA 1KBWA 2VW6A 4YSOA 4DPAX 3ABGA 2BZCA 2CALA 3QJVB 1L9TA 2CBPA 2FJSA 5I26A 1PLBA 4HHGA 3PAZA 1GY1A 1HAWA 2FTAA 1JZEA 3G5WA 1OF0A 2XX1A 3UAEA 1NWOA 4N8UA 2BP8A 2IH8A 5AFAA 2J5WA 3FU7A 3CVDA 1BQ5A 4E9XA 1ZDSA 1QNIA 2GHZA 3AG3B 3PCYA 4GYBA 1E5YA 3OM3B 4AX3A 1JXGA 3C75A 3NSCA 2XXFA 1NIFA 3NSFA 2UXGA 5I6MA 4E9YA 1CC3A 3EH5B 3QJTB 1N68A 4BWTA 4PAZA 4AI7A 1NPJA 1CYWA 5LDUA 1EHKB 1PAZA 2XV0A 1ASQA 2QT6A 1A65A 2ZWNA 3FSAA 5I6PA 3FPYA 4P5RA 5TK4A 1XB3A 3GDCA 2GSMB 4K9JA 3CVBA 4BDVB 3ASNB 2FQDA 3NJKA 1JOIA 3NYKA 1DYZA 4HHWA 1PCSA 2JFCA 2UXVA 3SBPA 2UX7A 1AG6A 7PCYA 5B1BB 4AKOA 5E9NA 2YAPA 3AG1B 1ZIBA 3X1NA 1L9PA 4HALA 1RZQA 3CDZB 3HEIB 4DPBX 2YAEA 3WNIA 4YSDA 2NRDA 3S8GB 2J57A 4W1TA 1MG3C 1AG0A 4RH4A 4Q89A 1XB6A 2P80D 4KNTA 1OE2A 2BWDA 1OV8A 4JHVA 4M3HA 4F2EA 1IC0A 5B7FA 1IBYA 4WKXA 4DP6X 1E5ZA 2FT8A 2PCFA 3T6WA 3T9WA 2FQEA 3H4HA 2UXTA 1EZLA 1VLXA 3EH4B 1MG2C 3ASOB 3FYEB 4F2FA 5EHFA 4AKQA 3H4FA 4DP5X 1IKOP 1TU2A 3V9CA 2PPEA 2EIMB 1KCBA 3AZUA 5B1JA 3ABMB 1OOWA 1BYPA 4NAJA 1OCRB 1TKWA 3CG8A 1PY0A 1M9WA 3KW8A 2H47C 3UABA 3X1EA 2DY2A 2DV6A 1AZUA 4HIPA 1CYXA 1A4AA 1WA0X 4G7QB 2HRGA 1A4CA 5F7AA 3FYIB 1J5DA 3N55A 4FAAB 2Q5BA 2CAKA 4GP5B 3U25A 1DZ0A 1NWPA 1AR1B 2OJ1A 3PAUA 2BP0A 2FT7A 3FSVA 1WS7A 3SBRA 4ZK8A 1FFTB 2FQGA 2UXFA 1JZFA 3DKHA 4CSZA 3X1GA 2Y1AA 1AZCA 1R1CA 2FNWA 3OMIB 1AAJA 1ID2A 4KOCA 1BXUA 4E9QA 4BWWA 3S3BB 4DP0X 4N4YB 5AZUA 2XU9A 1ZDQA 3IBOA 2ZXWB 3QJUB 5D4HA 3EH3B 3H56A 2PP7A 2P80A 5D4IA 2XLLA 1E65A 1AIZA 2HX9A 4CSPA 4JKNA 1WA2X 1URIA 2DWSA 1B3IA 4A2DA 4M4RB 3FPXA 2WO2B 5I6OA 3MX0B 4E9WA 1M56B 4W9ZA 2XV2A 1GS8A 2AFNA 1YLBB 4ENZA 4BK5C 5I5IA 2CUAA 2BZ7A 3NJFA 4BWUA 3S3DB 4DP7X 4F7KA 2HX7A 3AW5A 3NT0A 4NB7A 4Q8BA 3RYMA 3ZDWA 1JVOA 4HCFA 1AQ8A 1NDTA 2JXMA 2XUWA 2BWIA 1J9SA 4KO9A 5B1AB 1A8ZA 4UAHA 4KO5A 2CJ3A
chains in the Genus database with same CATH superfamily
3OHMB 1MXGA 2JVUA 2KZWA 4JZJB 4KX7A 2AC0A 4BFOA 1H3XA 1QBLL 4I9WE 2V2TB 1LE5A 2FL5A 1KB5H 1BD2D 3HW7A 2AF2A 3INOA 5ECGA 3IPEA 4HKBA 1GPOH 2NY1D 4A38A 4LHQB 5CJXA 5L9DL 4XNZC 5FKPA 3FRPG 1KB5B 2Z8WC 5ISZD 5F3HA 3M45A 4BV1A 1MIEL 4H5SA 4WWPA 1YQVL 3P3RA 5AB2A 5IJKC 4X8CA 4X5RA 4YE4L 1UB6A 3IMTA 4PHXA 4MXVE 1HX0A 1HH9B 1U6AH 3C08H 3LV3B 3O4LD 3I3DA 3LRGA 3OC5A 3T2OA 4MJJA 3QQ3B 4K23H 2XQ0A 5D2NA 4FABL 3QH3A 2YPVL 2DWTA 3BVNB 4BKTC 1VA9A 4TVSa 3QQ9C 4JRXE 2JCWA 4PJ6A 1HHIA 5F44A 1KIPB 3RJQB 4YSEA 5F7NC 1HL8A 2X2JA 4ANKA 3CLEL 3P0VL 3MUUA 4E2OA 4F8LA 5MI0B 3RVXD 2FWOB 2BNRB 5K69A 5KOMC 2YMXH 2VSCA 4C4UA 4U1GB 4XI5C 4ZX4A 4W9FC 4BZ1L 4R90L 4HH9A 4PP2A 3GPEA 4FOMA 1UZ6F 5IT2H 5JHLL 5J11B 3PDGA 1Y18A 1KOAA 1WEJL 1F2QA 2ZE0A 3ARGD 1D9KB 3QA3B 2PTUA 1NCHA 2ORBL 2F54B 1RULL 3DJTA 4Q4EA 5AVSB 1TYEB 4MNGA 1QR4A 2IDFA 3RU8L 4AYGA 1VZHA 1J0YA 3CFUA 3QUMH 2ICWJ 3O6FB 4H88H 2F15A 4NKOB 1F4XL 2E7DA 2VC2L 4G8GD 4P99A 4KITB 3WEBA 2E4FA 2CKBB 3MRHB 4DESA 1AGBA 3CFBA 3KWWA 4OY9A 1SNRA 3QQ3A 5SX5H 4GBXC 3IGAA 2ZJSH 3BKYH 5JLZA 4OCWH 1FC1A 1AZBA 3FSZA 1AY1H 3VFOA 3LB6C 4W93A 2BIMA 5DUPH 4KHTH 4LHUB 1HHIB 3RWHA 2HFEB 4YSUA 4I5BB 2VN4A 1KZQA 1Q1JH 2CJTA 5DUML 5FK9B 3G5VA 4CVZB 4KKAD 8FABA 3FFCA 4F7EB 3LEYL 4PJ8C 5E8DL 4U6VH 1GKEA 3UZQA 4I18A 3VFSB 3FF7A 4BFBD 3OR6B 1KDJA 2UUDK 2AK1H 3IDGB 4AM0Q 2HA1A 1U92A 5FF6B 1UB6B 3HMXL 3NA9H 1U8IA 4W81A 2Z91B 4JDTL 3IJHA 1ZLSH 3BDXA 4FXGA 1EAOA 4XXDA 2R2EA 3L4CA 2CK0H 2ZWKA 4XP6H 1URLA 1I9IH 1HI6A 3BAJA 3RRQA 5D7KD 3VAEA 4BA0A 1UD5A 2A9DA 3WKQA 4UB0L 2WN2A 5DC4B 2OZ4L 5EUOB 3K2MC 3MGAA 1OGSA 3WTSA 2BMKB 2EEBA 2BY2A 1G0DA 4LEEA 4HIJA 5GGUA 2W0LA 5C2UB 2QR0B 1KIUB 2FGWL 1SQ2N 1YDPA 1NZRA 2ITCB 35C8L 5A6MA 2VITA 4PJ5B 2BSEA 2CO7A 2VXUH 3GDBA 1SJMA 5AOJA 1PX8A 3PRZA 5E0FA 1VAHA 3WMPA 1CT8A 1KPUB 2QGDA 3SDXB 3UGEA 3RIFF 1TTGA 4DQOL 2W65B 5DFVD 5BXFA 5J6HB 4W6WB 1JL8A 3GZQA 7FABL 1D7BA 5BMFL 1OVZA 1R75A 1OAXL 5IROC 3H9SA 1UFGA 2OJZL 4OM0L 3GSVB 5F3BA 4RMRA 1WZLA 1IMHC 4FFZH 3D5OF 5HYSB 1Q4NX 4IBQA 1LWJA 4AUJA 1U2HA 3DV6B 2VDNL 4M4PA 1WBYA 4NQED 4NAQA 3I75B 3WXWH 3VD4A 3MJ9H 4M1GH 1P6FA 3MV11 1G94A 4HZ1A 2J5LB 1IEBB 3DUSB 1HESA 4WI2A 1OTSD 3BPNB 1MEXH 2VUKA 2NUPA 4JLRB 2ZZUT 3IJ8A 5DJ0B 2N3JA 4QRPA 1O9WA 4XPAH 3KLLA 1S3RA 4KZ0A 1QX1A 1KBPA 1PZCA 1OCWH 3ESMA 5EC1B 2JLLA 1NCDL 4GO6B 1YEJL 3CSFA 1L9SA 4K7FB 2IDTA 3LPWA 3V6OA 4HT1H 5I9QB 3Q6GL 2ADIB 5DQ9A 2BOLA 2IV9A 3BGAA 4GLRH 5C09A 2MTPA 1S7TB 3ILEA 3ZGHA 3QIBB 3ILDA 2WNGA 4LBAA 1ZMYA 3U9UA 1HAUA 4APXA 3KR3H 3UH8A 2NYZA 3IDYC 2HFFA 3BQUA 3K2UL 5IBTL 3VI3B 3O2VH 4K0OA 1FPTL 3LKOB 2LLGA 4YS4A 3FQUB 4A63A 5F1IA 5J57B 3TNMB 1N8OE 3S34L 1IGJB 43CAB 2ZF9A 1XH1A 5IQMA 2IANB 1HIMH 3QIWC 1ETA1 5DZNA 1NC4B 5FECB 3RFZA 3NPSB 1QHPA 3ALPA 3QZWB 5KVEH 3MLTB 4B60A 5HYSG 1ET5A 2AQTA 4OLVL 3SE3C 3U48A 2Y6SD 4OLZL 4B9KC 2CLZB 5BUAA 1NC2D 2ZXCA 1Q94B 3B83A 1LE9A 1CDBA 3ZZQA 1PLCA 2VQ4A 1XSIA 3OKEA 2ZKMX 4ZUWA 1FL3A 1PZAA 3L7EB 4MQ7B 4QRRE 2A77H 3IS1X 2A2QT 3TCTA 1DBJH 2B4CH 2P46B 3GS4A 3Q1SH 3T65B 1URZA 3WIHL 3LKPB 4OSUL 4P3DA 4XXDB 4BFFA 4GSXA 3CZUB 3ZKXC 3E2HC 4PJ8B 3NACH 4HJTA 2Y5EA 5F9JA 3VJ6A 4P3DB 5FK9A 4I9WD 1NBZB 2AK4E 2JTDA 2P7TB 4JVWA 4R7DA 4DCQB 1WGVA 2EDTA 4B41A 1TCMA 4N28A 1UQSA 4XNBA 1HXMA 1I7RB 2E5EA 5CNHA 3ZQWA 1PKQE 3N1MC 4PWFA 5DJDB 4DKDC 2ESVD 1J8RA 2VC2H 4XB7A 4QJ4B 4U1KB 2X4PA 1ZS8B 3CMOL 3CSGA 3GI8L 1TTBA 2AGJL 1SQMA 3VWJC 1BM3H 1OCOB 1A25A 2AQ3A 5EOCH 1L0QA 1GZQA 3SPVB 4HAKA 1NGZA 3CCHB 3FUDA 5AB1A 4LSRH 1A2YA 2W9DH 4YMPA 5J89A 5C71A 1MCRA 5SWSD 3N85L 3IN0A 1CZ8H 4X9FA 2V3DA 5AD0A 5I75C 5KBNC 3QUML 4H88L 1A7QL 1OK8A 2HFFB 3BQUB 3ZDZF 3ECBA 5CILL 1G7LA 4AH2B 3C6EA 2X4TA 4TXVB 3UG4A 5LN4A 4KC3B 1UC6A 3AY2A 5GS0H 2NTFB 3QB7C 1NOAA 1UATA 1S7WB 1UD6A 2VW6A 1S3KH 3HS9A 4DPAX 4HPHA 3QZLA 3NFNB 3QUYA 1DSFL 1MCPH 2AAAA 1UWFA 3WFHA 2K70A 2OW6A 2X6VA 1WBZA 5C0RH 4PLJC 2RFXB 5GZNA 5IZ7A 2BP8A 2ERJB 2WQWA 2BVQA 5F7EL 4PCSA 4FLQA 3V52H 4FTVB 4P3WA 3OM3B 5C0GB 1LO2H 2X3CA 2PYEA 4RETB 3HE6C 3WELA 3T2QA 3N04A 2VN6A 3GMMB 2X5PA 1LNUB 3QJTB 4H2AA 4YC2C 1TNNA 3WKNA 4AVHA 1BFSA 3GXMA 3L95B 3UBXB 1NPJA 3BH9A 4NAMA 4PY7B 3B2XA 3MROB 2R4SH 2A5UA 2AQ2A 3OKKB 2QBWA 4IRZA 3ML9A 4G6KL 3TOPA 2A1WH 3GDCA 1JXJA 5CINH 4ACPA 1WUNT 1UWXH 2MFNA 2WLIB 1QBLH 3CU7A 5HYQA 1K72A 1M1XB 3S98A 1GIGH 3LH9A 2I5YH 3O81A 1WLHA 2B3RA 1YMMA 4M4RA 3QEQE 5L9DH 4D9LH 1NCWH 4YXLH 4KRPB 3HEIB 4L37A 3WNIA 3MJ9L 4M1GL 4DWHA 3SE4C 5KAQF 3TP4A 5JW4M 1TCRA 3DJ9A 5C0BB 2NXZC 2XPGA 4PJ9A 2ADFH 5T33L 2EVFA 4LGSB 4RVBA 2NNRA 1IC7L 1JV5B 3GGWB 3WIIH 1EAQA 1MI5A 3ME0A 2C9RA 3BFWA 4NUPA 2NOYA 3DX6B 2XG5B 4W4OC 2XWJA 3VFUA 5GHWH 2F5AL 5HHOD 4O2CA 4OFYD 3UTTB 4UYQA 4R7DB 4JANA 4JY4B 1TTUA 4ZUWB 3DECA 5EEWA 4ZUVA 1JK8A 3NFNA 4KTGA 4O02L 2VXUL 1WITA 4KK5D 2P5ED 4LSQL 5JR1H 1M7DB 1X5KA 2AJZB 2HRPH 4JW3A 4TF4A 4ONOA 1FL6A 3V9CA 4XGZA 4QHMA 1KCBA 1YEFH 5EZIL 3VFRB 3VI4E 2FX8L 5FWQA 1JGUH 1UHVA 3CUPB 4AL8L 2VDQH 2OZNA 3MLZL 1VADB 3T8VA 2DY2A 3QZNA 1KXVC 2VXTH 5T5FH 2CHXA 3DSFL 1GAFH 1P5VA 3E8VA 4KVNL 2XQYA 4Y5YB 3ECUA 1NM4A 5KS9F 3ZE1F 2JB6A 1MCKA 4GEIA 4MRCA 5JXEA 1FVDA 3AY4C 5D6DC 2MH4A 1V7MH 4N2KA 4PRAA 2R27A 1OP5H 4TNVF 3KVDD 5KS9A 3ZLQC 4G9DA 3F00A 4MVBC 1GGTA 2DI9A 2UVFA 3PYCA 4MSWB 4J3OH 4OCMC 5I24A 3NN8A 4HJ1A 1IJNA 4DP0X 1Q72L 5JIIA 4P07A 5HHVL 2M83A 2YIHA 5AAWC 4DOHE 3L1OH 5TF0A 4Q9CA 2VO8A 2YKLH 3EH3B 5I18H 5CJQL 4J3UA 3HS0C 1JV2A 2A74A 2FBOJ 1PG7W 2XTSA 1AIZA 2C3XA 4LLYA 4TUKL 3NDZE 3P2DA 4JKNA 1WA2X 1QBBA 5E5MB 5EU7E 4F5CE 1L7IL 1BM3L 3Q8CA 3QRFM 4I1PA 1YAIA 3BWUC 4TKWA 2QMKA 4PM1A 3LEYH 4FQCL 1BIHA 1UWEH 3QHTC 2IPKB 4GG8A 4N1CA 1E4XI 3F58L 3U4BH 2R69L 1XH2A 3I50H 3QCUH 3QFDA 1GOFA 1KWGA 1MVUB 3AW5A 2BHZA 3PJSB 1C7SA 4BBWA 2R29L 2HLFC 3TN0C 3OR7B 2JQAA 2XUWA 4NDMA 4S1DD 4KO9A 4U0RB 5TDNB 1M2VB 3UTTA 4KO5A 2CJ3A 2WINA 1WZKA 5MI0C 5D93B 4QNPF 4U1NB 2E4TA 3QAZB 3FB6A 5GRJH 5HYSA 2J8UA 3B2DC 4FQXB 5GGSB 4NZDA 4KI5E 3O4LA 4W9JC 4EZKA 1FI8C 5F89A 3MV7D 1KN4H 3RPBA 2GC7C 2XPGB 3EHBD 3D2TA 1KJVB 1CXEA 2P1YA 3P3YA 5IHZA 4JVPA 4LP5A 4JHAL 3U79A 4EAEA 5CSGA 3KZ8A 1JWUA 3KYMB 5EIIG 4MBOA 5EC1A 1IAOA 5HHOB 3KPNB 1DL7H 2X2UA 2COVD 3EXLA 5E2VH 1H3WM 4F20A 3VGBA 1KLFA 5D55A 4JO8A 1SJHB 5I82A 3QDGA 4GEJA 2BVOA 3VTTA 2A6DB 5DA4A 2WCSA 5C0AD 3TPUB 3RKPA 1U8QA 5I6XC 2EDJA 4PJ9C 5IHWA 4Z3IA 1QTPA 3GIZH 1AS7A 2BSRA 3D18B 3LKRA 3U30C 1JGEB 4HK0A 2NW2A 3V9EA 4C56D 3T1WA 3PLYA 1FDLH 4UUJB 5I1DA 1TFPA 4ZMPA 4NQDD 4GQPH 4UV4H 4XB3A 1ITBB 4X6DB 3EGXB 2EP6A 1QLFB 3P2TA 5D1QD 2YS4A 3PGDA 2Z1KA 5INDA 2WM0A 1S7SB 1C12A 4AMWA 4RRPM 1R19A 3VDAA 2GIYA 3ZDXB 1MEXL 4OKVA 4ZPVB 2EIZB 3LKNA 3OPZH 1VFAB 1OQXA 2OTPA 5L2KB 3IFNH 3G5YA 5HVHC 3S96B 3O2VL 3NJMA 3KCPB 5CINL 1E6JH 3GO1H 1M6OA 2Z92B 1WA1X 1NDMB 2F7IA 5EOTB 1KGXA 1YECH 2LFEA 1IGTB 1KJ2H 2LGNA 3I2CH 1P6WA 4KV5E 2CO4A 1MELA 1QFWM 2AV1B 5DEJA 3R18A 1P6AB 2ICES 3EYSH 3J7HA 3OMNB 3CDZA 3MODH 1DDTA 4JFWA 5E8OB 2X4OB 5FM5O 2DZEA 2NY6C 4UIMA 4P2YA 2EDQA 4FXGB 4JO3H 1DVZA 5CWSA 4APQA 1TQCC 4A2GA 3WFZA 5C6PB 1AIFA 1DSYA 4GXFA 2XZAL 4ZRGA 1F18A 2IH3A 2Y0SA 3KPQA 3Q13A 4ZAKB 2WIIB 5C0EB 1W80A 4UZGA 3EGXA 1JZIA 2JH2A 1TEFA 5TDPA 1IKNC 1GVIA 5EPMB 1AHWB 4WIQA 5DWPA 1MHHA 1SEQL 3WIHA 1JHLH 5DEFA 4DIXA 4OZFB 3K72B 5EULV 2GEEA 1A6UL 1FRGL 4JCMA 4PJEE 5HY9A 4N2OA 1KULA 3GD1C 2IGFH 3ATBA 1S4IA 5TDOA 4RBPH 4A2EA 1YEIH 1VHPA 4ONGL 5TDPB 1QATA 4G1MB 1BW8A 1F42A 5EBMB 2OTWA 5E8EA 3R06B 4UT9L 5CP7B 5MEND 5D5MF 1PNDA 3L81A 3E3QC 3K1DA 4JO4H 3VGFA 4F7CB 3S36L 4DVRH 1U8HA 3M17A 2F1EA 3FUKA 3O3EB 1UXWA 2V7NB 2VM4A 4U6YA 1WFUA 5GJSL 7PAZA 2XQBH 3EOAB 2P3YA 3JSSA 2YD3A 1I8IA 2JJVA 1ZRUA 1A14L 2JKLA 4DVBA 5GS2D 4WU5B 4XPHL 1SDAB 4L3EB 3HN3A 5I74B 2ENYA 3ZDXE 4TOYH 4N3TA 2X9WA 1G5AA 1SOXA 1JGUL 5IV2A 4XH2B 1EHLL 1KELL 3KJ6H 3FO2B 1MJUL 2IG2L 2JSFA 4MCMA 4RAUB 5IIEB 2WCPA 2VDPL 3P4OB 4XOCA 1AZRA 3E9UA 4UQ3A 1O5PA 2IAMB 4OCXL 3DNKA 3NEEA 3P11H 2A6JA 3ECQA 4PJHE 4M7ZC 5DZOA 2MOQA 4L8DA 1SRDA 3V6FA 2GIXA 2VWEE 5JZ7D 3H42L 5GS1B 1J8KA 1BAFL 4NM4H 3NJIA 5CCGE 25C8H 2VO5A 1CGUA 2IANE 4XMKL 4JL1A 4Y4KB 1CO1A 3P02A 5FW8A 2I27N 1UOLA 4IBYA 4ZD3H 3MUGB 2C8NA 5FO9B 1OCZB 3PWVB 1JZJA 4HIQA 5SV3A 1P4LB 3ZKSD 1RCYA 1OCCB 1SBSH 4E41B 43C9B 3EYUH 1KG0A 4HS6B 4JRWA 2HN7B 4P57B 2P8PA 2JKRM 3EFOA 1WG3A 2WYIA 1EFXA 1G4MA 3T8XB 1SOKA 4Y2NA 5A16B 5EC2B 4JN2A 4DAGH 2H0PA 3VUAA 2JJWA 4I13B 3MFGB 4KZDH 3C8KB 5C07E 2JQMA 3KDMA 4Y2OB 3E1F1 1UXWB 5DJAA 3BKCH 1M71A 5EEUA 3BZFB 4NBXB 5E2JA 3F05A 1HYSC 2C4FT 2CGZA 4B3EA 3UBXA 2FK9A 1BQLH 5G4MA 2OK0H 1MDAA 4CGTA 2GTQA 5F7KC 2JI3A 1ITCA 2YWZA 2FO1A 2R23A 4Q9BA 2ATPB 2CO3A 1TETH 5IQNA 4D9LL 4WQOA 4DN3L 4XBEL 4LSUL 4HHAB 2B5IB 4M1DL 4JHUA 4KUCF 3TBVB 3PGFL 1JGVH 1MFCL 4Y2LA 5D72L 3FUMA 4JQXA 3VXMB 2WNKA 3LZQA 1C08A 4NUGH 4P5MA 5JR1L 4UTCA 1FCGA 3A4FA 1FVDB 2DQHH 1JAEA 1G9HA 4PS8A 3MV8A 2OS7A 4HBCL 5EH1A 1T2QL 1T7XA 1QOKA 1BVNT 3BHBA 3RX5A 8FABB 3FFCD 3V5KB 2VB5A 4WAFA 1KN2H 1XZ0B 2ZXQA 3QUYC 3WG7B 3Q7JA 1VENA 3M1BB 2GJ6E 2DDQH 3S88L 1CFTB 3LIZH 2D7NA 3VU1A 1QO3A 2J56A 5CCJA 1AQKH 3DYMA 5HBBA 3CLFH 3HZKA 1RD6A 4BXVA 1E2ZA 5K59F 2OMVA 2XT1B 3BZFA 5A3IC 3IE4A 3CFCL 3V0EA 2QHRH 3DX8B 3V0FA 5A6LA 4PJAA 5IOKA 4MD0A 2YMTA 3BWAA 3RWDA 4Z6AT 1WZ1H 1S7TA 3W2DL 4HLJA 3D7PA 4KJQC 4HH9B 4PP2B 1JMXA 4P23B 4BFIB 4LHJB 4MNQB 4Z7NF 1TSRA 2NR6D 3NGBB 4RFOL 1NCCL 4LEXL 4U6YB 3UDWC 4DGYH 3BQUD 4FMKA 1IVLA 3E6FA 4MXQC 3LZLA 5I26A 3QJFB 2KLSA 3MREA 1PZ3A 5SWZB 2FTAA 1J8SA 1UURA 3MRBB 1K8IB 5DMGC 3FUHA 2DWXA 1AHMA 5FLUA 3OF6D 5FHAL 4L5FH 4MDJA 4QHKJ 2XQYK 5I6MA 1YJDC 4WW2F 2CPCA 4E9YA 2UZYB 5C9JB 5EU5B 1YUKB 5AVVB 3WJJC 4JFZL 5E51A 1IFRA 3FAXA 4WRLA 1BZ9A 1SYSB 1MKFA 3CFMA 1RPKA 1E28A 4GKLA 4JFOB 4OUOA 2KERA 3MLWH 4X4YA 5C0CA 2BERA 4X8JA 2ZWNA 3BESR 2ZXEB 2YA2A 4Y4KC 4LVEA 3IFOB 5CLYA 2DQTH 5TPWH 2YD5A 2Z4QB 2YAPA 3BRGC 1E8XA 1S8DB 4JHBA 5A2AA 3IAQA 2W9EL 2DQMA 5GRVK 1TENA 3VXSD 1P7BA 4XC3H 2GPZA 4X6DF 3CFDA 3I2CL 4KQ4H 3FRUA 1SJXA 4L29A 1EO5A 2VN5A 1KCUL 4RGOL 3JWOH 3MRMB 3ZTEA 2NY2B 5ES4B 2OMYA 5I76A 4OH2A 2VLRE 1NBVH 3GSXA 4TNFA 1U8PA 1QEWB 4R7NB 4EVNA 4D0DA 3L6FB 1RUQL 3UTPD 1P0SE 2VITB 3TT1H 3UAJC 2CZNA 2N7AA 2K6WA 2OMZA 1MHEB 4N87A 4JG5A 1TTFA 5JA8B 4QYOB 1N7MH 1CDJA 4M9OA 4P5KA 4PG2A 1U8MB 4U6XA 5CJOL 3H2QA 5D8JH 4NQXB 5I1LA 5J3HD 3RZCA 2B5IC 4XI5D 5B1JA 5E56A 1V27A 3X14B 3ZYOA 1BYPA 5I8CA 3K6DA 2OMXA 4P5TB 4DUWA 1E3ZA 4MAYB 4YDKL 2IC2A 2JB5H 1QFWL 5CHNA 4CDHA 3QCVH 1BP3B 3VCLA 2ZUQC 1UEYA 1A4CA 7FABH 1MFDH 3FU0A 4G5AA 1RIUL 3GIVA 2A9NL 2XTJC 1BQLL 3N55A 2OSLB 2HG5B 3QR1A 4NWUL 2O5XL 3SJVE 1TIUA 5HI5C 3H6JA 1PLGL 4PS4L 2CMRL 4HOZA 5HJGA 1KFAL 4ZPTA 2W0FB 4R26L 3ZDYF 3RJDA 2WLKA 2EYSB 3OKOB 4M56A 3QARA 2P7TA 4QPEA 1QQDA 1LEGA 3HJ0A 4IRZH 1H9DA 2FNWA 1AAJA 1T21B 2ZQKA 1SN2A 4N4YB 4Z7VA 1C1EL 1ZDQA 4OI7A 4WNSA 3ZT6A 1MIML 3OHXB 3DROA 4QLRA 2ZD0A 1NOLA 3BSGA 3D0VA 2JJUA 4OLWH 1OPOA 4EIBA 2AEIT 3HOGA 5T3ZH 5H94B 1GKOA 3VG0L 3NFPA 1X5JA 1PYWB 2OJZH 3KPRE 2B0SH 4OZIE 1T83C 4IIQA 3VXNA 3AT0A 4PJ7A 3W0WA 3VE0B 4HZAA 2EDNA 3E3QE 3T4AB 4NB7A 4G1EB 3H55A 1A4KA 2X2HA 4PCTA 2FGWH 4HULB 4E0RA 1R34A 4JBSA 4IRSD 2UWEA 3MJ6A 5LWYH 2WBJB 4HWEH 2HFGH 3ZW3A 4OF6A 1TQSA 3MU3A 1ZPLA 1GZHC 2EILB 2WGNB 3MLRL 4GFXA 3JQOB 2BCKA 3O41B 3QC6X 3VRLF 4XPGL 3JWDC 2BSSB 1YZZA 4UV7L 5DMKA 4JO5A 3QWQB 2ZKWA 3BKJH 4HPYL 3II3A 3SBWA 1RU9L 2EDDA 3RVXC 3U0WL 4WWOA 3AAZA 4Z8FH 2Q6WB 5BJTA 2BVOB 2NY6D 4AV5A 4F5CA 2J72A 4TV3A 1KCVL 1GGCL 4QHUB 3QEUA 3TO4C 4V2CB 15C8H 2J6EH 2RA1A 3DMMD 4FYRA 5KANI 1GSKA 4X5XA 2AZAA 5ICUA 2AVFA 4GXVL 2VZTA 3NP4A 2Q76A 4PJBA 2DQCH 4I87A 5AZ2L 3KXFA 1A1OA 2HKHL 3JTTA 1A66A 3H8NA 3B6SB 4ZUTB 2B9AA 3AS1A 3GLDA 1J0ZA 3FZUC 5D1XE 3ZN6A 2LAAA 3VI3A 5D1QA 1AGEB 2B77A 1O7SA 1QWUA 1U3JA 2FO4B 3B7TA 4FQLL 3PPEA 1CF8L 3BIBX 4PP1D 4A2FA 5T3ZD 1KG0B 4HS6A 1SVZA 2BJML 5GQBA 1YMMD 4KKBD 3IMUA 1ZLSL 1QEXA 3IXTB 3PHOB 5C0IB 1G1CA 3HIZA 4YSQA 1I7ZA 4OF8A 3GRWL 4K5NA 2L4OA 2EQDA 2R8SH 1ND0A 4OI8A 2C9XA 4WU7A 2ZX9A 3H3KA 4HCRA 3GJFK 5DD0L 3SPJA 4WK4B 3FB5A 4LSDA 1KPVB 2Q3ZA 4YK4C 1LK3L 1CI3M 3F7LA 4PTUB 1T5KA 2VJ8A 3MOQA 2EIJB 3OKMA 5D6DA 4G6JL 1U91B 5D2LB 4DP4X 4A7SA 4APQC 5AQ0A 3RB5A 2R1YA 5IFJA 4DPCX 4KZEH 4M8RA 2BSRB 5MEQA 1EWHA 4MAYA 1WHPA 4DFHA 2D31B 1VPOH 2IVFC 1BVKA 3EGSA 3Q9QA 5FYJH 2VYRE 3ROLA 4PLNC 4IJ3C 4M48L 3T0EE 3CMOH 1F4XH 2XICA 3D2UA 3LIZL 2XZCH 3TEXA 2GJPA 3PXJA 1QI4A 4FL4C 5C0DB 3A4EA 3BGMB 2V5TA 3IJSB 2YGOA 4HMDA 4NQCD 3V4PH 5A2JH 3MOAH 3SDDD 3WXVH 2F53A 5EDSA 2CDGA 3AQDA 5ID1A 2PCYA 3FN3A 3ELQA 4XMUA 1OAUL 4FF9A 4QHUA 3BIAX 1FNLA 1Z5YD 5JUEL 4BZ2A 4U3HA 5IR1A 1CBVL 2NY2D 2BSTA 1DEDA 4K3EH 1IGYB 1XGUA 4X0KB 3UZVB 4XP4L 4IBUA 1QFWH 1FFPA 3HE6B 4PRHB 4Q56A 4MD4B 4Y4KD 2HJLB 3L48A 2IFGA 3A4DA 1MFDL 5J6SA 4N0FB 2VDOL 5GGQL 3WEMA 3AS2A 3FCUB 1HXYA 1GR7A 4WI0A 4HLEA 5SX5K 1X4YA 1JNHB 4XOAA 3T3MB 2EDKA 2QTEA 3OR6A 1WC7A 3Q6FA 3SQBB 2TSAA 3TJPA 2H4EA 3ETTA 1WO2A 2HJLA 5F72S 3MSPA 4PWGA 3SN6N 1A47A 3UTOA 4JQXC 1LO3H 5IVOA 2DTML 4XRCA 1QRKA 4GUCA 3QJFA 4X6CA 3TJHC 4UT6A 2G9HB 4KUZL 4PWEA 2WLNA 4MA3A 1WAAF 2IH3B 1FZJB 3GMPA 3ULSB 3MNZA 3DX7A 4NJAH 3MXWL 2BW4A 1CFMA 3DXAE 4KGLA 2F54E 1RFDH 3HI1A 5J11C 5IQLA 1LE5B 3VRJB 1Y0LA 3ZHNA 1JE6A 3RY6A 1NGYA 4ELME 3HE6A 4PRHA 3ULVH 3O3BB 3D2UB 1U93A 5IK3A 5DA0B 4KRMB 4PTTB 1KJ2A 2NQCA 4JY6A 3FCBA 2DQJL 3NTCH 4XZ4A 5E5RB 4Z9KB 1BXVA 5BNXD 2EXWD 2IV8A 5KEZA 1PQZB 2VMJA 3KM2A 4WGWB 2NMSA 2VJ0A 5EU6E 1OP3K 4FFWD 3TC9A 3HUJB 3MN8A 2WLYA 3G6JF 4YQXH 4EN2A 1JNLL 1DLFH 4MMXB 2HT3D 4EO5A 3AREA 4X83A 1SY6H 3T8MA 1JCKA 1NCUA 5LO7A 5E23A 3F7PC 3H9HB 4OZHA 2ADJA 2NT1A 2UY6A 2XI9A 1IARB 2V7HA 3SDXF 4ZMOA 1OAXH 3N1FC 3RIAK 3V79C 2AHIA 2DL2A 2K8QA 4PW3A 1A7RL 1GYVA 5FR3A 4AYFB 3MBED 5IHBA 1KYUA 4W9DC 5GGSY 5IVXE 4ICXA 1N5YL 5ENWB 1CICA 3VI4F 2NY4C 2LTQB 2CLVB 12E8L 3NZ8B 1BJ1H 3L1OL 1BQRA 3IK2A 3KWUA 4G6AC 4O5LH 3OKEB 3IPBA 2NNFA 1SMOA 1U95B 4CSTA 5EB9A 3FT0A 3REVA 1EJOL 4PJHA 4XWGL 5C8JA 3CU1A 5TF1H 4U6XB 3L5XH 1E9QB 2A38A 4HHAA 3GRWH 1JZGA 4M3KB 4JO2L 2X89A 1FGNL 3I3BA 2OXGB 5KVDH 4HGWB 4YNYA 4KY1H 3D85B 2FL5B 4ZNEE 1G1YA 1CLOL 1DBML 2VLLA 3ZR6A 5KVFL 2DQCL 4YSPA 1M7IA 3F65A 5B7MA 3D0LA 2QQLH 4JMXA 4LKCA 3R8BB 3VRIB 3SQOH 1OARH 2MWCA 2HXAA 3MV8D 3M1OA 2DLHA 4PWJA 1U8OB 1UZ6E 2FIKB 5IBTH 2RTTA 1DSWA 3MUGA 4ZOCA 2YEZB 3MLZH 3GSNA 4LCCB 2YC1B 4K73A 5KAQG 3BFQG 1MFAH 1R3JA 4MQSB 2CR0A 4ZX5A 5J1AB 4LCWE 3QQ4A 4LDCA 2EE2A 4NKMA 4H8QA 4WJG3 3UJTH 5F6IB 2CHNA 2R9HC 1WAEA 4FQJL 1CGTA 1UD4A 5J5EA 5C07A 4FX5A 3QAZC 4M43H 3SDCB 3U0TA 3VFPB 3RHWF 1R5VA 4ANXA 2IAMA 1D5IH 1UWGL 4N8PA 3Q2WA 4F7MA 1DO5A 2R56L 4F33A 1KJMB 4X9IA 3LH2H 1EVTC 5IB3A 1FNEB 2H8PB 5IB1A 2WTPA 5AENA 5IB4B 3QORC 1NIBA 5DEFB 1Q0EA 2W0PA 4ODSH 3ARDB 5FA3A 5DJ2B 1HHJB 1KENL 3TBSB 4MQ7A 1SHSA 2GK2A 1O7DE 4M5YH 2PWEA 2XBZA 3ISYA 4LHUG 4NDMB 3WI9A 5CLTA 3QPXL 2O5NA 3IXAA 1IAKA 1KCLA 3G5VB 3O8XA 2BZCA 2W5PA 4RMVA 2R0ZH 2FATL 1TO4A 1ED3A 4NO0A 4HJ0C 2F74B 4MMXC 2AITA 3I9GL 3HUJA 3V6OE 2E7LA 1NWOA 1T0PB 1BQ5A 3PWNA 2D4DA 1JPST 5TE7L 1FZMB 3FK3A 3QULA 5DJ6B 1T4KB 2CD0A 5I71B 1L7TL 3F2LA 1EVUA 1D2PA 5EIQA 1IGTA 5DMYA 5F7WC 5F7HA 4JR9L 1QSZA 1IC4L 4LSQH 4NUJB 1NBCA 4TSAH 1U3YA 1E0OB 1UH2A 2C5DC 2O5ZH 1QD0A 3IU4L 4NXSA 4B9PA 5CP3A 4GMSH 1KJMA 2HT4D 4A37A 4UILL 1WJ3A 4LLUA 3B5TA 3TVMC 4DEPB 4F9PC 3GQFA 5D7IA 2ICEB 2QVTA 5J06A 4HWBL 3CVBA 2GFBA 3ASNB 3NJKA 4OM1H 2CJUH 2EDXA 3PWJA 2G5BB 4OZHF 2WJ7A 4JZNB 2XA8L 2H0JA 4LPVA 3QZWA 4HX1A 1XR8A 2NZ1A 3SBPA 1QYGH 4Z3JA 4JFUA 1CDCA 1WTGT 2A9BA 2VDPB 3IKCB 3THML 1JPEA 1R6VA 1T1XA 1U8PB 3D85D 3SCMC 4YUEH 1Z0MA 1NCIA 3K72A 4FLRA 3ZKNC 4JM2C 4K07A 4Y16A 3M07A 5LNDA 4EUPH 4L8CA 1TXKA 2GITB 4BQCA 1HWHB 5F6HI 4ZMWA 3DK0A 1N8ZB 2NY4B 2PCPB 2ZUUA 5ISZE 1DN2A 4FEMA 2VNCA 4NPJA 5DVMA 4ZPVA 4CC1A 5FECA 4E42B 1WV7T 3T8XA 2AMUA 4KFZC 3GRGA 4LEBA 5CLXA 1O6TA 1P53A 1FCCA 2HLFD 3TN0D 3RDTD 5EBLB 1XF4B 5MEPA 1UWEL 4UNUA 3C8KA 2MIZA 2ROYA 4HC1H 4LCYB 3SO3B 3WUZA 4X5WB 1CFBA 2HMID 4V1DD 3ABMB 3IMRA 4Z7VF 3SCMD 5E1AA 1VKXB 3QNXB 2HJKB 2RHEA 2NR6A 2PMZA 1CFQB 1CDGA 4P2QE 2ATKB 3KNBB 4F8PA 3QDAA 4UM9B 3QUKA 3QJXA 1PJWA 3DVGA 4L8SC 1WA0X 4NRXA 1L5GA 2HVBA 1AE6L 1KTLA 3D3VB 1A6UH 1FRGH 1W72B 2EDEA 4FAAB 2G75B 1U92B 4KHXL 1IQWH 3GLEA 3CFNA 1KV3A 5DHYB 3RPKA 4WWNA 4J2QA 1PZ5B 3F04A 4YZFE 1WS7A 2AJYH 4OLXH 1LO3L 3FFDA 4P3CH 5DD6B 4NENA 1FFTB 5C7ZA 4HEMA 1QI5A 2P24B 3DKHA 3X1GA 3EW3B 4BD4A 3KPRB 1U36A 2ZWYA 1CLVA 1DJSA 1EPFA 4UZUA 2COQA 4MAUL 3PABB 3EO9L 3HAEB 1KXQE 1PZ5A 4H26B 2KLTA 2WAQA 4BELD 2BIOA 1U8NA 3GUFA 4PJGF 3EO0B 1IBHA 3TZVB 2YZ1A 3TEZA 3CFQA 4G8AC 1E9PA 3RQ3A 1SYVB 5D7SH 1SEQH 4X9HA 1PY9A 1QW8A 4K94C 4NCDA 1FORH 4B9ZA 3AADB 4HD5A 4GAYA 1JWMA 2D3NA 5EIVA 1URIA 1I7UA 2EKJA 3QS2A 4WCYL 4TS6A 3O9WC 1FP5A 3ULUF 2Z4QA 2V7NA 4DEPC 2JI1A 4XPTL 1VFMA 3WFCL 4JB9L 1TZGH 4C54A 1YEEL 4M61B 1CE1L 1ZE3C 1AMXA 1B90A 4YGAB 4FYTA 3G9AB 5F7MC 4BWUA 1SZNA 1BV8A 4FRWA 4F7KA 1E27B 3MBEC 2GT9B 4Q6IA 4HMCA 5IWLC 3FRUB 2ZOKB 3ULUH 4K8RL 2F8XC 4YAQB 5A7BA 5I23A 3WN6A 2Z1PA 1YEHH 2VMDA 4NBYB 3G7TA 4Q97A 1YMHB 1UOKA 2EDRA 5ESVB 4U7SA 1PF3A 1JXDA 3AXLA 5I8KH 3FQXB 3FQTA 2X4SB 5E9DD 1CQKA 1N19A 4FNPA 2DJMA 4NNXB 4A2MA 1MAML 3AT9A 3DBXA 2NPLX 3RZCD 5IW1B 3SDDC 2CLZA 3BH4A 1AC6A 4KJWD 3DO7A 1TZOA 2VT0A 2OA9A 3CC5A 1UQSB 1XH3A 1HZHH 4ZTEA 4Z76B 1FFPB 1PAMA 3V7MA 3L7EA 1KC5H 3V5HA 3VXNB 1CDIA 4QRRB 2H3NA 3QJQB 1A1MB 2XG5A 4JFSA 5E5MA 4M1DH 1GOHA 4OAWB 2DWDA 3QXVA 1RLWA 4PJIB 1ZTXH 5HDBE 4WGVB 2WWNA 1KEGH 5B3JF 4HV8B 1JERA 5C7XH 5CEZE 5D5MB 2ROXA 2K9UA 1T0NB 5HHMD 1K5WA 4YLBA 5CEZH 1J0IA 1M05B 2PO6D 5D2LE 4ZW8A 2Z7WA 1AP2A 1CGWA 3AXIA 3BP7A 4OIFA 1ETB1 1EEYA 4IOSD 4DP1X 2Z65C 2D31A 4G83A 5E6IA 4ZX6A 4RQQB 2GB2A 2VABA 4P23A 4XO9A 5AKRA 4UTBL 2OAAA 1MW3A 5AOIA 1J0JA 5TQ0L 1ET8A 3CVHL 3O0LA 5DURB 2BNRE 3BPLC 4M61A 1DJZA 4WK0B 3TYFB 5IW6B 4AMKH 1ZLWH 2P24A 5AVXB 4L8SB 1PSKH 4H20L 4RGNE 3ARQA 2G4EA 5GGTA 4E41D 5I9QC 2NSXA 4E5XG 1JGDB 5FHBH 3EJRA 2HYMA 3MRGB 5EIIB 2XX0A 3BD4A 3B7YA 2WUBL 3S5ZA 5ACLA 1U8OA 3AB0C 3AFLA 3EJTA 4QYAA 2ZTBA 3WO4C 1ICTA 4KWUA 4G7SB 1KLFB 5SWSB 4NT6A 1XIWD 2A3TA 4N20A 4PVNA 1QTSA 1JTOA 4NQSA 2J1KA 1DVFD 3JWNC 3ZT5A 2CIKA 1WBZB 1YY8A 1GYAA 5KVGL 1KELH 1KV7A 4NENB 2WLIA 5ISZB 3QUHA 4RWYL 3OLEA 3D69A 4WHYG 3LOWA 4PV8B 1ACYH 1FG2B 2Q9OA 4N5UA 3X3FL 3PQYD 5KVFH 3ILPB 3KPSE 3IN2A 4JO4L 5JDJA 2Y1VA 2CIKB 5JHDE 5CF3A 4QXGL 5LGJB 5HHOE 3LSOA 4C56E 2XQBL 1JHTA 1QBAA 3GKWH 3TURA 4Q52A 5DS8A 5IQ7H 2ENQA 3MJ8B 3PAVA 4KNUA 3RTQA 3SKNB 1K6QL 1KACB 1FFQA 5E9DB 1C5BL 4IDJH 4XPFH 3VQLA 1CVRA 3PU7A 5IGXL 5EIIA 5IB5A 1MRCH 2J8UB 3T6VA 5LVEA 4KAQL 2W65A 1UZ8A 1S7XB 3N06B 5T1KA 4LT7A 1MHHB 2F53E 4BK8A 2VAJA 4CW1B 4GG6A 3F84A 2IH9A 1T6BX 3ZKXB 1IKFL 2ZWZA 1NFAA 2HCZX 4XAKE 1R46A 1Z9SB 2CU9A 1C9SA 1WFOA 4GRWF 2EIDA 1TVHB 3ZBMA 2UZYA 3NCJL 3FB7A 4JFEE 2J8UF 3Q8AA 4NPYA 1H19A 2PTTA 4F2MB 1B88A 4BH8B 5J56B 1XB8A 1JGDA 4J23A 4J6RH 5ICYB 3FHQA 1MZYA 4PRPA 2AABH 3SGEH 4K2UL 5JMOC 2BVUA 5BZDB 4HXBH 2Y5QA 3MV9D 4LLQB 4KPHH 5EO9B 1YRKA 3QDMB 4G9FE 3TH3T 3V6FB 3SPGA 3DXAD 2DBLL 3N1QC 4YBLC 2V7HB 3VX0A 3VU2A 3LQAH 2V9UA 4J3OD 3APCA 5FGBC 3QIUB 3MBXL 5E6IB 1BD2B 2NDFA 2IPTL 3BD3A 3V4PA 2FB4L 2HTKD 1A3ZA 3D2UD 3F6LA 1F13A 3MKGA 4MSWA 4NUQA 5FUCC 1KPRA 2FR4A 1NBVL 4G8EA 5E1IA 4ZFGH 5CWSB 35C8H 3FO2A 1CMOA 1XMWA 4O2FB 1S7SA 1F6AB 1Y0LB 4BZ2H 5BO1H 2E7LC 1AMYA 4WENB 2QVMA 3K6OA 1REIA 4NO5A 2BCMA 4ALAL 1CTNA 1DJYA 1T2QH 4JY6B 2LTQC 3MNZB 3TWCL 1KCSL 2Q3AA 4HK3J 2E9WA 2ISDA 1FWXA 2CSPA 2NXYC 3K0YA 3KCPA 4PIBA 3D18A 3LKRB 2GEQA 5E4IA 4F1SA 2Y7NA 1JGLH 1JK8B 4RISH 3W9EB 1MSPA 2GSIA 4XMWA 2ZNXA 4UOZA 2F74A 1OTSC 3J8F7 3UP6A 3CBKB 2JXMB 2H6PA 2WXNA 3EYVB 4Z7UB 4G1EA 4GSDH 3ESPA 4KK8D 5EBMA 3DLQR 4XT1C 3RPIB 2OMTB 2QVIA 1H9VA 1WZAA 2N0KA 4BZYA 3RURA 1Q9LA 2ATPA 2QVFB 2QLVB 5J1AA 5CJOH 2C4XA 2KKQA 1H5BA 4PJEA 4UB0H 3QPQD 3NAAL 4UM8A 3IE9A 3K6FA 2WBJC 2VOTA 3GMLA 1LWRA 3NSDA 5EPMA 5D5ME 4A7GF 1BQKA 3VM7A 3D6GA 1OD9A 4J1UA 1OTUC 3KDMB 2G3MA 2V4LA 4WI7A 1ZVSA 1J11A 4J8RB 3FULA 3RVVC 5HHMB 4ATTA 1DVXA 2AQSA 1MH5A 2Z9TA 3IMVA 3Q0HA 5DQJB 1BVNP 1QQDB 4XPTH 5DR5H 3UYOD 4LEXH 4ZMZA 4A04A 2VXQH 4OGAD 1NICA 1B4JL 2ZSVB 3B3BA 5DJ8B 3FTUA 4CGUB 4GT0A 3IFPB 1QWNA 1OM3L 3KMDA 2OMNA 3VXUE 1JUFB 4TL4A 4Y5YC 4PJHB 1MFUA 4J3VA 3K4ZA 1HEZB 5DI8A 2WK2A 1F41A 2GAZB 2MTAA 1I3UA 4HUXB 3T2NL 1M6OB 3S3SA 1PKQB 5IM7A 3SOTA 2PPAA 4LGRB 2P28B 1FH5H 1A6PA 4KFMA 5BOPA 4NUMA 2Q1EA 4OLXL 4P3CL 5AVYB 3SDCA 3MQIA 4NIKB 1E5BA 5CGYC 4K71C 3CDGB 2WD0A 5J13C 2X12A 4ACTA 3AM8A 2RBLA 4M7KH 1OXYA 4OLZH 2E6PA 4RMUA 4UM9A 5ACZB 2AV7A 2G2PA 4PVBA 1VEOA 3MO1B 3GRWA 2HKHH 4GYBA 1R3KA 5GIRB 3OXSB 4J2XA 4JFXA 4TNVK 5BXFB 3CFIC 1RZ7H 4PJCE 4BWTA 4MHHI 4PJGA 4XHJC 3S9DB 2DMBA 3LQAC 2AJSH 2WWMD 3D85A 4KNQA 5IQ7L 3CCHA 2YD7A 2V3EA 4GRMA 5E94B 5B21A 2UVEA 3RGBA 5I6PA 2WXLA 4MTMA 3C87A 1B0RA 2AP2A 4MX7A 5HYFA 2ZX7A 3VFVB 1G6RB 1XCXA 5CUSH 4KPHL 1D5MB 2FX8H 3EOAA 3H9SE 5DEGB 3MTRA 1ZVHA 3NQKA 4TTDC 4RDBA 1E8YA 1RK1A 1KIQA 2AEPH 4AKOA 2WTRA 1ZIBA 4PJDF 1AQHA 3X1NA 2Y5TA 3QHZL 3FONB 3DX6A 5BVPL 4FNTA 1NCNA 5CIPB 3ARED 3PGCA 1D6EB 4ZFFA 4YO0A 4BH7A 4RH4A 4Q89A 1XB6A 2FGZA 5HDLA 2XWEA 1YN7B 3MBXH 3P54A 1EGJA 4YPGB 4B9GA 5I8KL 3FONA 4P2OA 4PGCB 4BINA 1OGAD 4K5PA 4CU6A 1XTMA 2PCFA 1JK9B 4JFQA 1B9ZA 2B59A 4P2QB 1PEWA 1OAYH 1BMWA 4MD5A 4OCSH 3T0AA 2B0SL 2UXTA 2ZICA 1I1FB 2APBA 2JI2A 3MCYA 2Z31C 4YHNA 5AKSA 3CQFA 4Y4FC 4TSCL 2N1TE 5DD3L 5LGHL 2CR6A 4OD2A 4MMZA 4OZGA 3GZKA 4LB8A 5G4NA 4KTEL 2AJUH 4XWOD 4TL5A 4P49A 1CB4A 1II4E 2GQHA 2VLLB 1BQUA 1A4AA 1NSNL 1I9JH 2E7CA 4I9XA 4Z0XB 5F7AA 5FM8A 3MRNB 1RIHH 2GVYA 3NFSH 4NQVB 4PRIB 5EF0A 3RZCB 5HP5A 1NWPA 2X41A 5L6YH 5ILTH 2YBGA 1UD8A 2VMCA 4Y7OC 3FSVA 4OJFL 3F7YA 5LXVA 1B0RB 4IGBB 3RGVB 3WY4A 5EWIL 4NKMB 5IJCC 5C08E 3BEWA 3SDAB 4G9FD 2BP5M 1ZAGA 4BWWA 5J6GA 2E27L 3ATFA 3BGFC 3LXBA 4X7TB 2BC4A 2BDNH 4GAJL 3VXQB 3OKLA 4FERA 1DBKL 3X3GH 3MFFA 3O6ML 4MXWH 1JZDC 3RTQB 1L4IA 2ZYHA 1E65A 1JNLH 4Y9EA 2CR3A 4IS6A 2EC8A 3S5LA 3E6HA 1U8MA 1B3IA 3F7RA 4WV1A 4WWID 2JCCE 3BRDA 1WUZA 1HNGA 1CCZA 3UYPB 3R4RA 3UTZA 1FH2A 4Q8BA 2JMRA 4JQVC 3G6AA 5DHVH 3VMPA 4EQ3A 1TITA 2FB4H 4QTHA 2A9MH 4W70A 3FN0L 4XNAA 3MR9A 4L1BA 2NLJB 3ZKMC 3LMJH 1P4BH 3O8XD 1OAZL 5IIEA 3U0PA 4I3RH 4OCLC 5IMKB 5SWSA 2AXHA 1KEMH 2HWZL 1MZZA 4JM2A 4DPRA 1LQBC 1UGNA 3K4AA 3SE8L 2XN9E 4H44C 4DKAA 4E9VA 4MMZB 1NUNB 1MJ7H 2ITDA 2WZ5A 3SJVD 5IJBC 3HMWL 1P7HL 4OGQC 2NY3D 3WNPA 4CVXB 1AD9B 4JDEB 5DZVA 2Y7OA 2XVGA 3H2WA 4A6YA 5KBDA 2O6FA 2DM3A 2J6WA 3U6XS 1IGMH 2P26A 5FO7A 1YEWA 3MBWB 1I4FA 2PCFB 4LLWA 4QLWA 5E08L 4BA8A 3DHJA 4CMHC 3MJ7A 1XF5B 1NH6A 4G6MH 4A67A 2A4ZA 2DQUH 4ZUSB 2XTJB 1BAWA 3ZKMD 2EUWA 5DRNA 2VW4A 4MA7L 4URTB 3MODL 2EYTA 3P9LB 1LWHA 1MW0A 2Y2TA 3UMNA 1IUZA 4RAHA 3VXTA 2Y1ZA 3HZKB 1SY6L 3MOBH 4BCXA 3ILQD 4UDTA 5DHDA 3RNKB 3RB7A 3ZE2B 2YK1H 3FUJA 3TNMA 4W4NA 1KXHA 4MJ4A 1LEKA 2QDWA 1TJMA 1RZ8B 1BHGA 2G4GA 4QO1B 2G3NA 3DROB 4OFVA 4Y5XA 4ETYA 4DEWA 3ES6A 3RP1A 1LL1A 3S96A 3FQYA 2R7EA 4MQXC 5JQIB 3ARDC 2APVA 1J05A 5EDXA 3V4PL 4BUHA 3RILA 3LN5B 5JXEC 4LIQE 3BSHA 4X6DE 1NMCC 2YXMA 3AWFA 4LFHD 3RL2B 1GYWA 3NSYA 1HTYA 1S78C 2QELA 2HRHA 3KGSA 2YN5A 3WE1A 3RI5K 3W9DB 4U2YA 4E5XA 1HQ4B 3G6JE 4N2EA 2Z4TA 4N8CH 4AQAB 4XNQA 2LQRA 2Y4SA 3QP3A 1IEBA 3T3PB 4N9GB 3VO0A 4ZFOL 1VB9A 3IFLH 3O3UN 1BLIA 1J9CT 1M2OA 2ZP9A 4JJHA 5L7XL 1J5IA 1LK3H 5IEHA 3AS3A 3WU1A 1L0YA 4F7TB 3V6BR 3CUPA 1LYQA 1QBML 4IKIA 5AVUB 3BZEB 2C3WA 1G9NC 5DTFB 3MOAL 5D1QC 5DF0A 2OCJA 1JPGB 3D06A 4WKZA 4UOW0 1TJHH 3BGFB 4Y89A 4XP1H 3ZTCC 4P23D 4NNXA 5DJZA 1EERB 1KJ3H 4R4NC 1N64L 2VW7A 2G60L 3EYOA 3TCLA 2YBRA 5C92A 4M5SA 3DX9A 3LD8C 4S0TD 3QDJB 4TVUA 3BSZA 4JG1H 1C7TA 3V5DB 43CAA 4A7UA 2HTLD 3B7SA 3BMWA 2CXKA 4I1RA 4X2UA 1E6OH 2WXFA 1K5NA 5T3ZE 1R0AL 2C7FA 3S35X 3AXHA 3CDCA 2YN3A 2MPAL 4NI3A 5HYIA 4Z7OF 3D0VB 3L54A 4JRXB 4XZUA 2PYFB 4P9HC 3ZZ1A 3QG6B 2BSTB 1A3LH 5JUEH 3D69B 1WPCA 2ARWA 4KZDL 2DIBA 3PV6B 3V0DA 4L8BA 1WS8A 3SKOB 4B53A 2DOCA 4EZMA 4UOJA 1AOZA 3KEHA 3SO3C 1BM7A 1DVFA 2CH8A 5CZXC 4W9IC 3KYMA 4JFFA 5KN5B 1AKJA 5B1CA 4XP6L 4YSRA 4ZD3L 1OW0A 3BGMA 1RVFH 4J3XA 3UO1H 1JFQH 4PBXA 2WKOA 4RMWA 2WHVA 2XTJD 4ODVH 5D96C 1AY1L 3GF8A 3KH4A 3VNZA 3IDXH 3TA3D 1SXZA 2BIPA 2H32A 3TIEA 1Y6NR 4TUUA 4LRNL 5GGTH 1SXBA 1UD2A 3ECWA 4EDWH 3W5MA 5IFJB 2BH0A 3T0DA 3HI6L 2WQUA 3MA9H 3OLIA 5GS1A 2VM3A 3T0EB 4BUGA 2G5BA 4HBCH 4P5KB 4WTQA 5ESQA 2KMWA 1KYOJ 3KLAA 4PJFF 3WKML 1N6QH 4EI5C 2HVJB 4TVPH 1PG7L 4OW6A 1NGXB 4M6ML 1YAZA 1HCVA 2DQFB 4ODTH 2BHUA 3SKOA 3QIUD 4YSSA 2BVPA 4ZXBA 4LP4A 3WDHA 3G04A 3FCSB 1J88A 2DD8L 1I1AD 4U3SA 2EIKB 3QHFH 3BZ4A 3NTCL 3D4CA 4D2NA 4PJIA 1CPUA 3DJSA 1LILA 3D9AL 2QADC 5I0YA 4BZ1H 5BUGA 3MAWA 1T0NA 1CTMA 3SQOL 2G5UA 5T1MA 1WEJH 2H0EA 1A6VH 1JK9A 3NABL 1BX2A 4A68A 4AIEA 2E59A 3DSNA 3KBPA 4IU2B 1XXFC 4E41E 5J1SC 1NCTA 2GK0B 4Q58C 3T71A 2WVUA 5IJDC 1XO8A 3UAJA 5AYUL 2DPKA 4UT9A 4R83A 4DZBA 3HG1E 3O0RH 4WWKC 4YZFF 2CLVA 5HHME 4G82A 4BM7A 1A0QL 4R96A 1U3NA 1PYWA 1FNSH 1GGYA 5FV1L 3PG2A 3V5DA 4WLCA 2IADB 3NJGA 4FQIL 1F2XK 1QSEB 4L1HA 3H3PH 1EXUB 2FJFB 4JK0D 4L0PB 5FF6A 2FSDA 3AG4B 4JFTA 2E7HA 4TTGA 1TVHA 1N18A 4H40A 1EGJL 4S0SD 3S3PA 1J5OL 4R96B 3U7AA 3KPSD 4LPTA 3OKYA 4XR8C 5DC0A 5K9QI 5ANMA 3ARZA 4OGYL 4IBTA 2KQNA 4OCRL 2VDRB 4UIMB 3L45A 3DIFB 4HCRH 4QF1A 4CN1A 4NN6B 1PJ9A 1XGTA 2HX8A 1WH0A 2V2WA 2NY3C 2XVBA 5IROA 1CL7L 1XGZA 3DXAA 2MHAB 4EUPG 2A9AA 3DPBA 5EOTA 3QSKB 3X1FA 3DVIA 4PGEB 3IDIB 3O45A 1G7QB 5C3TA 1L9NA 4IMLA 3STLA 3L3OA 4UT7L 3NVQA 3NBNA 3L2NA 1PLAA 4WTZG 2X4OA 3VGAC 3E6HB 2HVKA 2Q0ZX 5C0DA 5I0XA 3VI3F 1YC7A 1S6NA 3PAYA 4JKLA 5D6CA 1MJ8H 1SXNA 3VXPB 3W81A 3MJGX 2F7OA 1M7DA 3CGTA 1LMIA 1SVCP 3NCCB 3PFQA 2GCYB 3RUGA 4F8QA 1OP4A 2OX5A 4I0PA 3QJVB 2DWEB 5FIEA 4F9PA 3PAZA 1HAWA 5ETUB 1JZEA 3AT8A 5DT1H 3OC8A 3BLBA 2J5WA 2DEYX 1AXIB 1X9LA 2DQHL 4IK6A 1QA9B 5IUSA 5IREA 4Y4HA 4UYPA 2WVTA 1R33A 3V0IA 4KRNA 2KPWA 1E5YA 4QEGA 3IKKA 5C70A 4NQVA 1JXGA 4WNJA 4PJFB 4K7PY 1CG9B 1F3DJ 4R2GC 3I6LE 1I1YB 4ICWA 3QIWA 2NSMA 2DQGL 1RJLA 2AK1L 3O6KL 3K6SB 2DH2A 3WD5H 2IQ9H 5C0RL 1VJSA 1WAAE 2BNUA 4TLSA 3K46A 1FH5L 3FO9B 4AZ8A 1UUNA 4Z3FA 1MY5A 2EE3A 3FN0H 3DOSB 4LGPB 1K8DB 4AMXA 2GSMB 1JXKA 1MOEA 4R0LB 3RWFB 2YC1A 3CVIL 1QFWI 2ITFA 4J1UB 1A1NB 4GIPD 5ADOL 1KGCD 4PJAB 4S1QH 5KJ7E 5F96L 3CX2A 1LEIA 1F5WA 3LRSB 4AJVA 5J8OA 1AO7D 3EYSL 3WLWD 2F18A 1MH5B 2UZXB 4WW2A 2A9ML 1JHTB 3MLSL 3KBEA 4XH2A 3UGUA 1DJXA 2X9ZA 3Q43A 3FOLB 2VLMD 1E3FA 3IJEA 4HGWA 4YNYB 2MCAA 2VRKA 3NCEB 4PGEA 3WDIA 1ZT7A 3NH7H 3JVFC 4YXKL 1X6NA 2BNQB 4TM9A 4MGXA 3FU6A 4PBVC 1AC0A 4NN5C 3RGVC 3G6AB 4HXAH 4LAQH 3NZUA 2O61A 2IALA 4Z7UF 1T1XB 2FT8A 3MTXA 3MLWL 2C34A 4ORGB 3CFTA 4P5MB 1G1KA 4NM4L 1FG9C 2PXYB 3ARWA 5B39B 1TJXA 2VLRB 1FVEA 4AKQA 1Q72H 4Y5YA 5DMJB 2ZG3A 4DP5X 1JBJA 1AGBB 4G5ZL 3CLEH 3P0VH 3FO1A 1IC1A 4M7LL 1R5IA 3PWPB 5DC2A 5KSBA 1YPZE 2GABA 5I30L 2F7PA 5IMMA 1LD9A 3E1ZA 3ZSSA 1AZVA 4OR1A 3S35L 1QSEA 5SWZE 3ENEA 1OAJA 1CDUA 1SY6A 3DETC 3EH2A 2WWOA 1LLAA 1MLCB 4NQEE 4JJOA 4OM0H 4IMLB 2Y5TB 1CFTA 4XXWC 1OAKL 1HN1A 2P5EE 3STLB 1DBBL 4R90H 4FZEL 5LCVL 4CADB 1FN4A 1M71B 1E43A 3F7QA 3A3YB 1PU0A 1TLMA 4GQZA 3ULUC 5ABDE 1NCCH 5E2TL 1IGYA 4GP5B 4HIHA 4ELMF 1ZHLA 2EDFA 3VXUD 4YHNB 2YQ2A 2FT7A 2GBTA 1J8HB 3KPQB 4ZAKA 4Q9QL 2P5EB 4KX9A 1SUHA 2UXFA 4XPAL 1J86A 2FWOA 1T3FB 4Z0BL 2R2HB 2IALB 3G9VA 4NN6C 2X42A 2O5YL 4HFUL 2Z35B 3CXDL 2OYMA 1V8HA 4HISA 1EBPA 1MUJB 3IBOA 2CMRH 1MWAL 2WXMA 4Z7IA 4AEHL 4RGMC 4YN3A 5L7XH 2RCSH 4HFWB 4ONHB 4M93B 1QBMH 1UM4H 4AQOA 5DJ6A 4AEIH 1N0XL 2H8PA 5IB4A 5IB1B 3ARVA 5SWQA 3SGJA 2YD8A 5I6OA 5AAMC 1BIIA 4OKVB 3SCMB 1TQWA 2GJZB 3VGHA 3GSNH 3WAJA 1FAIL 5IBLD 2VRQA 4WY7H 5F3HB 1XHHA 1K8DA 4JPWL 3DGGB 5FOJA 3WE6B 2VQ1A 4OIBA 3FRPB 4FA8A 3ZL4L 1RP8A 1NCAH 3F12B 1ZGLB 3KYKH 4FN0A 4PGZA 3FUIA 1QZ1A 4NRZA 5I5MA 4WW2B 5GGVY 3HG4A 3C5ZB 4OUUA 1RY7B 2GJ6B 3INUL 4BFJA 1CE1H 5HYQB 3NDYE 4JFED 1TJGL 2VN3A 4WSJA 1EZVY 4L4TE 4A55A 4J6RL 2A6DA 1AZZC 3D50A 5K9KA 5I1AB 2QFRA 5KG9B 3SDXA 1X5ZA 5DRZA 2JK5A 1XF3A 4TNGA 4WFED 1GS7A 2ZSVA 5DJ8A 4Z7NB 3JZ7A 1NA8A 3L6FA 4ORZC 2VLJB 1A1NA 2B1HH 4AYID 4AZUA 2EYRB 3AU0A 1AI1L 3N91A 3QRLA 4O4YL 4RMBA 1A4BA 5AYTA 7TAAA 1RERA 4R26H 2F9BT 4ADIA 1EEZA 4ZW3A 2X0UA 4DO5A 3KEDA 3KWTA 2FIKA 5L88L 5C08B 4UOW1 1IZJA 1A9EB 2D3JA 3LCYA 3PY9A 4PPTA 5GISH 1USZA 1U3HC 3L3DA 4N3UA 3WD5L 4KROB 1GGUA 3DO4A 3CN4A 4N22A 1B9KA 2R1XB 4TPRL 2QPUA 3O3DB 4O58H 3DX2A 3OGCA 1OALA 2CKBA 2XC8A 3IPFA 2QPEB 4M5ZL 3UJJL 1HHKB 4DJMA 3HC2A 5DLMH 1DEEA 1SF5A 3VVWA 1IRAY 2ZG2A 4AIZA 5HHQB 4UQIM 3X12B 1N0LB 1RZFH 2G75A 1CXIA 3UACA 3Q5TA 3Q5YA 1MREL 2P42B 2R2BA 1EBAA 4OF5A 1IO4C 4FFZA 5JOEA 5DHVA 5JQHC 4FA7B 2ZKYA 1W91A 1I1CA 1P7QA 4JPVH 3QFJD 1X7QA 4JHAH 4Y5XB 1IIIA 1EXUA 2ZCHH 2DF3A 4WEUD 3OHXA 4Y16B 3STBA 4F15B 4RCAA 1I8LC 3S0PA 1MJJA 1IT9L 5JORA 4KKBC 2CGRL 3V7AE 3NN8B 2QGBA 2Z0UA 4Y9CA 3U9PL 1OZUA 3QDJA 4L1TA 3QO1B 1ZE3H 4FD0A 5I2IA 2XWBB 2VDMH 4KKLD 3D4ZA 1ZIAA 3K1KC 1VCAA 4ZOEA 4NC0B 1HHHA 3PREA 1CXLA 4AW7A 3ES6B 4IBZA 4J3BA 2EVJA 3J2PA 1TR7A 2OSLA 2WW8A 4IBVA 2BVEA 5DJXB 4Z76A 2F1AA 2XIIA 4PUBH 1MCDA 1N5AB 2W8CA 5HHXL 5F9OH 1CGYA 5DVKA 3O41A 1C8PA 1YO4A 1I85A 3W39B 3V0GA 5HDBB 2QQQA 1N6VA 3CXDH 3MUJA 2SODB 1CD8A 3MCKB 4KK5C 3H7LA 4ZUSA 4Z7VB 5I73C 4PI2A 4UQ2B 3OSKA 3KCWA 4MA3B 3ZMRA 7CGTA 3QAQA 4HIIB 3VB8A 3QFGA 1TQBC 3T65A 3ZUCA 1PL3A 3N42F 5BS0E 5I5RA 4QRUA 5AKVA 5DVPA 4D0DB 3RG1C 3IJSA 1J7VR 1OWWA 4OV5B 2ERJC 1ZLUH 3WJMA 1IU1A 5F21B 3DGDA 1FYTA 1CBVH 2VGLM 4JFXB 4BFRA 1IAMA 1J0KA 1UWYA 5L8KB 4EOWL 2E3VA 1N0XH 1AR1D 4F8OA 1U8NB 3ALWA 1MDTA 2DQIH 1TCRB 2D73A 3LEXB 2ZKXA 4UTAL 4RGNB 1VADA 2CM5A 3ZX1A 1SXSA 3EDEA 3LNFA 3EF4A 5E1QA 3CFJA 4NHUA 3TT1L 4NSKA 5HJ3B 1P7KA 4WJ5B 2XZCL 2W59A 4UT7H 1O6SB 3LN9A 4EI5B 3QE5A 2Y2WA 4RMQA 2WBXA 4U7KA 2J21A 3BHBB 5GGVL 4H7VA 2XIDA 3WFEH 3V9FA 4JFPA 3O2WL 2VLJA 4JANB 5GRXG 5JHMA 3S37L 4DUVA 4FP8H 4PJXF 25C8L 4QJ5B 3WTXA 2VLKA 4J3OF 5I1DB 4ODWB 4UT6L 4HIEB 5LAXB 3B9AA 1HWGB 2ATKA 4Q4IA 4HAFA 4XNUH 2EIBA 1QRNE 1RLBA 2OMUA 4MB4A 1A9EA 5EFIA 4RLDA 3TA3C 5HHVH 4GKOA 5D6CB 2QKSA 5D70L 5GZOD 1BVKB 1ERNA 3EGSB 3T77A 2RCSL 3MRGA 1VERA 3ZR5A 4GG6F 1JDDA 3EFDH 1SFDA 5KBKA 5CCHE 1BCIA 3FC8A 4U6HB 1QLEB 4OFDA 1JYWA 2P8MB 3SDYL 3DMMA 5ETUA 2L8AA 5JQ6L 5B8CA 4HJJL 3IDMA 4XMXA 3OVUB 4I4WA 1D5ZB 1ET7A 1QLEH 2NR6C 4NZUL 3VI3E 2XBTA 1OARL 2TRHA 1INQA 5FUOH 3QG6A 1NM9A 1OGAE 1TQVA 2CK0L 4P9ML 1HEJC 4O2EA 4FNLL 3AQXA 1L3WA 4OJAA 2N1KA 4N2HA 3LZPA 2LHAA 5D1ZD 3FH7A 5AOKA 1KY7A 4JDTH 5D7LE 1JV2B 1NEZA 3WNKA 1A7BA 1YNLL 2DN7A 2VRAA 1FZOB 3DBXB 4JFFD 5E6YA 4OFIA 5ITFA 1M3JA 5CU9A 4R4ND 4WI5A 4JL2A 3RPIA 3H9HA 4KY1L 4OZHB 5FFGA 1ZLVK 2GJRA 3SJVB 5C0JB 3RL1B 3VG9C 4OZFA 3GSRA 1UWXK 2CE6A 5TJWK 4NZRL 4Y7MA 5B39G 3T2PA 4FHJA 4LHUD 3S7GA 3FT1A 4IU3B 3MLRH 4ZT1A 2IQAB 4F7TA 3B8SA 4KU1A 4HXAL 4LAQL 1Q9WB 3D34A 4M7KL 1HHGB 2NZ9C 1KLGA 1RHHA 4UINH 3RNQB 2OW7A 2Z93B 1WFNA 2KHAA 2VDQL 2PABA 4N8VB 3BWAB 5T1JA 2J5LC 5I6LA 1MFAL 2DM7A 5BZZA 2YXWA 4I0KA 4W9CC 5B38A 4FMFA 3FU3A 3W39A 1TQBB 1D5XB 3VW3L 2IMMA 3VXSA 1UD3A 5DZ9A 1E5UI 2A99A 1WE5A 2ENJA 4G7RB 4JO1H 2FHBA 3PNRB 1DQQA 2XN9D 2WYZA 1BVZA 1BBDH 3TYGL 3KPPB 5DQDH 4AXWB 3IU3A 3L4WA 3QDGE 4KJPD 4QOKA 1GJWA 4AQ1A 4BZ1A 3K4DA 4QJ3B 4YSOA 5IVNA 1DVQA 1PDKB 4FULA 4WFHE 4IRSA 5FYKE 1GOGA 3DHUA 2WQXA 5AW4B 1INEL 4NN7C 3GSRB 3C60D 5AFAA 3K6SA 3OZ9H 4S1SL 5E7FA 4OQTA 3MCLL 5KSVB 4AC4A 3KG5A 2GHZA 3Q44A 4NKDB 3L4XA 1R3LA 3REWA 4DW2H 1N5YH 4MA8L 4MWFA 4GI6A 1UGKA 2NCMA 2CA3A 4N8VA 4AE0A 3BVVA 1JS4A 2ZOLB 4PAZA 4QWWC 2H3NB 2J4WH 3TH4T 3APFA 1ZHKA 4GUQA 4G8FB 4XRCB 3KDPB 3O4LE 3K8LA 1ZJAA 4V1DE 2O4EA 1C12B 5TK4A 1E2WA 3CZFB 4TSBL 4Z77B 3HUJF 1CGXA 4GRLC 1B0GB 2ESVB 4HHWA 4AG4L 4XMTA 4B6ZA 1LGVA 4L29B 3QZWG 2IPUG 4QCIB 2ICWI 4RZKA 5DUPL 1B2WH 4PU2A 3B56A 2VZ3A 4IIZA 5IUCA 1RZKC 5AOZA 2X6AA 1FHGA 5E9AA 4EVNB 1S7VB 5KBLA 2A4EA 5IFHH 3C2AH 3QIWB 3C6LA 4K15A 3CTTA 3HRPA 4YSDA 3T77B 3B9KD 4B95C 4HOXA 1H6UA 1TPXC 4L3EA 5BVPH 3SGKA 3HRZB 3MDJA 1P9MC 4U3SB 5KYWB 3RBGA 4JB9H 3OAWA 1VIWA 5B8CC 3H7BA 1JDCA 1RULH 4DN4L 4HUKB 3QEQB 5BOZG 3PP4H 3LDBC 4PRBB 4X5PA 4FFYA 5JNYB 3FRPA 1NMAH 2FQEA 3H4HA 5JYMA 5IJKA 4HUUA 4ZMVA 3EUUA 1I31A 2Y7QA 2IH1A 2V5MA 4LSRL 1FLRL 5ERWB 1I85C 1ZT1A 2Y22A 3FB8B 3H9ZA 1WSST 1OTTC 2Y36H 3W57A 3V4VL 2QQNH 1THAA 3RFZC 1W72A 1OOWA 3LN4B 4Z0XA 4JPIA 4HP5A 4O58L 4Z7WB 3KW8A 4DN3H 3UTSE 5IEHB 3SE9H 2Z8RA 1CL7I 5IV2B 1CICD 3D1MC 4HIPA 1R4XA 1VSCA 4IK7A 2Y9RT 4PI0A 1CE6A 1TTRA 4N86A 3F6JA 3BUQA 3SPVA 1F11B 4PJFE 5HGBB 2C9VA 1DJIA 1Q90A 2LU3A 1TTCA 1U9KA 2NNAB 3QUYD 4KDVA 5EO1A 4HG4K 2FJHB 2R39A 2XHNA 3ARXA 4X6FA 5KSAA 1F3JA 3SBRA 4ERSH 5BMFH 2FAUA 2WKLA 1O5DT 4XMLL 1EXGA 1S5IH 1ULVA 1GGBH 4X4XB 3SE4A 4TQIA 2WXJA 5L4MA 1AZCA 4Y19D 3CV5A 5KANG 2IWGA 5SWQB 4KHXH 3OB0K 1H0DA 4KOCA 1UXLA 1J8HD 3VFOB 4NX0A 3GHEL 1OGAB 5F88B 1Z3GH 3N44F 3P4LA 3QZOA 4HIXH 4KJQD 4PRDA 1XFPA 4KH2A 2GY7B 2BFVL 3II2A 4P9MH 5A2BA 4NP4H 4BSJA 3CFCH 4DHLA 2P47B 4L1DA 4MDRA 4YPJA 1CFVL 3WO4B 4ZS6C 5D7LB 1WZ1L 1CJYA 1H15B 1A6TB 4N0CD 5D1ZB 3SYQA 3W2DH 4NLHA 4M7ZB 1GGCH 3F12A 3CAFA 4QRTB 1ZGLA 1YY9C 2VH5H 3MC0A 1M56B 1GA2A 4HD9A 3M46A 5DD5L 3WNNA 3ARBB 1NBZA 3NJFA 1ZA6B 3LNDA 3VXMA 4BKSC 4GO8A 3QYNA 2E27H 2NXYD 1F45A 4OLUL 1WAPA 3EJJX 5BJTB 1J9SA 1VGEH 3DDFA 4R8WH 5AW0B 5TE6H 3VWKD 2VXQA 1QASA 2XXMB 2X6BA 3PFUA 3QQNA 4JG0H 4JFQB 4NQUA 5TDOB 4CSSA 4XBMA 3KYNB 4XE0A 3LZNA 1WF5A 5JHLH 1ZK5A 4G7YH 2QADB 3IDUA 5IB3B 3FQUA 3IGAB 4GAJH 2R0WH 4XO8A 1XIWB 2WTRB 2I9TA 1QTYT 3GMNB 2N59A 1P84K 1NKOA 4H8HA 1RL1A 1J10A 4QMEA 1QP1A 4LSVH 5CIPA 3WSQH 4E9SA 2RJMA 5GSRB 1OSYA 1N26A 1UCTA 4O2FA 4Z95L 3FTGB 3MXVH 1FNSL 1Y6KR 2IBGA 4LLVB 4WJKB 4F9LC 1NGXA 4KV5F 2E76C 2BW5A 4NOBA 3ARFB 4G71B 5AZ2H 4Y1AD 4C55A 2L7JA 3DI3B 5JNYA 3CLWA 3PJLA 4Y2OA 1OT1A 5IJVA 4P4RA 2PR9A 1X9RA 1MCNA 1CF1A 1BDYA 4UBDC 3QYCA 1I75A 5AW8B 2VXVL 4L48A 1MFBH 1OT2A 3PWVA 4PB0L 3N43F 2Y07H 2QGEA 4WEBH 1RKRA 2JIXA 3R0MA 3UYRL 1QNZH 3SODB 4CNIA 5IBUB 4YLQT 5GSVA 3OGOE 3DSFH 3DTDA 3RWCA 5A2FA 1CK0H 2EDMA 3ARYA 4YGVA 3HMXH 4WFFD 4YXHH 4YH6A 3U7YL 3BISA 2R2BB 4BSVA 3QWOA 1JZ7A 5FCUH 2W88A 2NY5L 3LPFA 4PYGA 3CH1A 5C7XL 1K4DA 4YBLB 2CDFB 1A6AB 5B22A 1YEDA 4PJDE 2N7SA 1E5AA 4G72B 4LLDA 4P2RB 3TJHD 4PYHA 5FCSH 2R1WA 3BUTA 4Y19E 3LPPA 4DGWC 1T03L 4H8WL 3CHRA 1HCYA 3B7RL 1EMTL 2YQBA 2NY4D 4B0MB 2RD0A 4HLZH 4ODSL 1ZD6A 3GBLA 3L4VA 4K2UH 5AVTB 5E4EB 1O6SA 2GUOB 5GS0L 2X4QB 2GTWB 5BVJA 5ID0A 3MV7B 2YKKA 4N2GA 5HHNB 4JHWH 1NIDA 1IC7H 2CRIA 2B39A 3EDJA 2C9AA 1FL5B 1QHOA 4O51A 2OV0A 3D39A 3JV6A 3NMEA 4OF3A 4IGBD 1T83A 3E8UL 2EE9A 4WUKL 4E42A 1RK0A 1KYDA 5DI8B 4KZEL 2G0KA 1EGJH 3K2KA 2DKSA 3QISA 4L23A 5EO0B 5I76B 4R0LA 2VN7A 2OTWB 1XF4A 4FQLH 5MEPB 3GKZA 1RJZA 2FYYB 3WS6C 2NXYB 4Q7DA 4UTBA 3B9DA 1T4WA 1HXMB 1I7RA 3D3VD 3O6KH 1U8CA 2AQ1A 4QXUH 2ED7A 4F58H 3U46A 3BVTA 1MRCL 2OL3B 3X2QB 5EF2A 4MHHG 3WFDH 1OLLA 4W9EC 4XMPH 3RVUD 1QUNA 4N2LA 2DYRB 2CIIB 5BRPA 4LQFL 4IOIA 3A23A 4YHML 1IEHA 1XEUA 1NCBL 2BY0A 2WBJA 4IRSC 3EJSA 4ZMAT 3FQXA 3O6FA 3JWNE 3V0JA 3L9RB 1ZS8A 4XMLH 4HWZB 3JBG7 4DGVL 2F5AH 3CX5J 1JPFB 1H8OA 3U1SL 4ZMNA 5D93C 1FO0B 5JTWA 3TA4D 1FVCB 4Y1AE 4P5TD 2Q7NA 1BIIB 1IBZA 2VMEA 4IIQB 5FGSA 1DLHB 1W6LA 2XN1A 2Q86B 1PZUB 3MBEB 3N1PC 4A66A 5EEVA 4HJUA 4PB9H 4RBPK 3PL6D 2XPZA 3T4AA 4C57C 1KIRA 3MUY1 4B9YA 2X4TB 2DLFL 2Y1YA 4IM8A 4I77L 1I1AC 4PJ9B 3RDJA 4P46D 1DQLL 3VTMA 3VXRA 2H1XA 2WQSA 1KTDA 1OO2A 1RZPA 3RL2A 5C2BL 4FG6D 1KBVA 4LIQH 3ZRFC 2OL3A 5BVJB 5ID0B 2VLME 2EDWA 2Y23A 4MYPA 1MFMA 3T3PE 3V5KA 2EJ1A 5BRZB 2IDQA 4UOQA 4AYDC 1ODUA 4XCFL 4QRPE 5C09D 3P1VA 3ELAT 5F9WB 1NBYB 1X9UA 2WWKT 4JRXD 4X6DA 2AK4A 3BH8A 3DIDA 2AVGA 4LL1A 3R1GL 1ACXA 1JPFA 2H9GB 3VXSB 4L4JA 3HG0A 1C5DA 3ETBJ 3AS0A 2HT4C 4B9FA 2WAHA