4KOBA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kobA00
2FT6A 2I7SA 1TU2A 3ZDWA 1PLCA 3PLYA 5B3SB 1NPJA 3IN2A 2R7EA 2R7EB 1MG3C 3X1EA 2HX7A 2DV6A 1WAEA 3AZUA 2IH9A 4DP5X 2YARA 4L0PB 2ZONA 3QJRB 4F7KA 1BXUA 3X2QB 3WG7B 3SBQA 4PCYA 1CURA 1L9QA 1SDDB 1NPNA 2VMJA 1J9RA 4E9QA 3JT2A 2GB2A 1BYOA 1OCRB 3PCYA 4N8UA 1QNIA 2YAFA 3AG4B 1PNCA 1CUOA 4A2FA 3DIVA 1OCZB 1OV8A 1J5DA 1AOZA 4HAKA 2RACA 1NIBA 2TSBA 2BP8A 3UAAA 2BZCA 4FA7B 4P5SA 4WTQA 1NDTA 1BYPA 4WKXA 3ZX1A 3DTUB 1L9SA 1GS7A 1PLBA 2PPFA 4QLWA 1A4AA 4YL4A 2XV2A 5D4HA 3ZBMA 4YSPA 3EF4A 2BHFA 2HRHA 2BP0B 3AG3B 2BWIA 1AS6A 1ZV2A 4AKPA 2B08A 1KDJA 2HXAA 3T9WA 3UADA 4JHVA 2HLEB 5PCYA 1QHQA 5F7BA 4A2DA 1B3IA 2VW7A 2FTAA 3T6XA 4YSQA 4AI7A 2UXVA 1PNDA 2XVBA 1OCCB 4A2HA 1M9WA 1JXFA 3FS9A 3N2JA 2IDQA 3EH3B 2GBAA 4E9SA 1JZFA 1NWPA 4DP4X 1ASOA 1RZPA 2VN3A 3FU7B 4Q89A 5B1AB 4YVUA 1PAZA 1BEXA 3TBCA 2PPCA 2YAMA 2VW4A 3UABA 4UAHA 3NSCA 1JVOA 4K9JA 4KNTA 2FQFA 1GS8A 3FQ2A 2YAOA 3HB3B 1SFDA 3CG8A 2VM3A 3N55A 5I26A 3FSZA 4YSUA 2GHZA 2QDWA 1HAWA 1ADWA 1I53A 1RZQA 1XB6A 1ET7A 2VW6A 2XX0A 3OMAB 1X9UA 1XB8A 2OJ1A 1PY0A 3IBOA 1MZZA 2WSDA 4DP1X 1GYCA 2DWSA 2FQGA 2UXTA 1GY1A 1RCYA 1JVLA 4YSEA 2VM4A 2UXGA 2E86A 2FWLB 1DYZA 3X1FA 3T71A 2UX7A 2PP7A 1X9RA 5B7EA 1KCWA 4NAJA 3FSVA 3AG2B 1MDAA 5E9NA 1ILUA 4GP8B 1PZAA 1FWXA 4AKQA 1MG2C 3S8GB 4HHGA 3IE9A 3H4FA 1AS8A 1SFHA 3RYMA 1EHKB 1ID2A 3C75A 4BWUA 4NB7A 3AG1B 3FQYA 4DP2X 1W8EA 2OCCB 3FQ1A 1SF3A 1V54B 4KOBA 3SQRA 1GR7A 2XXGA 1JXDA 4YSAA 2DY2A 1E67A 2P80D 3GXUB 3NYKA 4HZ1A 1AZNA 1BXVA 2N0MA 3L45A 4GP4B 1NIDA 3S3CB 5I5IA 3WNIA 3NSFA 5B1JC 1IC0A 2CUAA 3NJNA 4MFHA 1ILSA 4P5RA 4KNSA 2YXWA 4GXFA 3EHBB 1SDDA 5A7EA 2HZHA 2PPEA 4TXVB 2PP9A 1PCSA 2AZUA 3T6WA 3FU9A 1WS8A 2DYRB 3ABGA 2EIJB 2FT7A 2CAKA 3EH5B 3NJFA 3WNJA 2IWEA 3ASOB 1IKOP 4CSZA 3PXLA 4GY4A 2DYSB 3AY2A 3WIAA 4JKNA 4BXSV 3FSWA 5IY5B 4YSOA 1AZCA 2CJ3A 4BXVA 1MZYA 1WA1X 4A66A 4E9YA 3V9CA 4KO7A 4YSSA 1PMYA 3CVDA 1AS7A 4JHUA 4BWWA 3FT0A 1WA2X 1ASQA 3NJLA 3TASA 4FAAB 7PCYA 3ABLB 2W88A 3FPXA 1ASPA 3OMIB 1QLEB 1AANA 4HIPA 4E9XA 2BP0A 1ZIBA 3NSYA 1A4BA 3PAVA 1V55B 4DPBX 2HX9A 1R1CA 2I85A 5D4IA 1J9SA 2X88A 3CVBA 5I6MA 4GYBA 3ERXA 4HHWA 4Q8BA 1IUZA 5I6OA 2H5UA 1KDIA 1KV7A 1W6LA 3OQRA 3NT0A 2HX8A 2BWDA 3NJIA 4G71B 5F7AA 5AFAA 1ET8A 2H3XC 3ASNB 2Q9OA 1OE2A 1J9QA 2YAPA 1ZIAA 3FU7A 4EF3A 3QJTB 1TEFA 3FPYA 4UF7C 1SHWA 2ZOOA 2XV0A 3WKPA 2AZAA 1FFTB 2IDTA 5EHFA 4BDVB 4KOCA 1RKRA 3NP3A 1PF3A 3SBPA 2IDFA 3QJQB 2J56A 3V9EA 3UACA 1JZHA 2NRDA 2W8CA 1JZGA 5TK4A 2I7OA 3TA4D 1E5YA 4YSTA 3BVDB 1AACA 1A3ZA 4HCFA 3SBRA 1W6WA 1OOWA 3EH4B 4DP8X 3QPKA 5FC9A 2EINB 2Y69B 1JZIA 3NJMA 1CC3A 1SHXA 1ZPUA 3QJVB 2FJSA 3PAZA 1N68A 2YAHA 7PAZA 3ABMB 2UX6A 5AZUA 3QJSB 2QPEB 1KBWA 1N70A 5I5JA 3KW7A 4M4RB 2AVFA 2HRGA 3OM3B 1A4CA 1AIZA 1WS7A 3S8FB 1YLBB 1JXGA 5I6PA 5B7FA 2XUWA 6PCYA 2CBPA 2EIKB 2XU9A 2YAQA 2YXVA 3GYRA 3T6VA 1BAWA 3NSDA 1KBVA 4G7RB 2GC4C 3T6ZA 3H4HA 2MTAA 1AZRA 3NJGA 1JZJA 1OE1A 1NIFA 1NIAA 4F2EA 1V10A 1KCBA 2QT6A 1J5CA 2PCFA 2VSMB 4G7SB 1J9TA 1PLAA 4E9VA 2PPDA 4A2GA 8PAZA 2WO3B 3X1NA 2QDVA 2MRYA 1L9PA 2XV3A 2XWZA 2PPAA 4DP9X 1IBYA 2J57A 4M3HA 1URIA 4A68A 1FA4A 2ZWNA 1NTDA 2VSKB 2Y1AA 1BQ5A 2BW4A 2EIMB 5I6KA 5I6LA 1XMEB 3KW8A 5B7MA 4DP0X 1E65A 2XX1A 3CZUB 3IN0A 3JTBA 5B1JA 3FU8A 2FNWA 1GS6X 5B1KA 1WA0X 4X4KA 1PZCA 2FT8A 1OE3A 2X87A 4BK5C 9PCYA 3HEIB 4W9ZA 5I6NA 3X1GA 4RH4A 2TSAA 2PP8A 4G70B 1GW0A 2P80A 4UANA 4ENZA 1L9TA 2IWKA 1IBZA 1AAJA 1UATA 1HFUA 1A65A 3D12B 1JZEA 1L9RA 2Q5BA 4HALA 2IDUA 4CSPA 4KO5A 4AKOA 3S3BB 1AR1B 1L9OA 2YAEA 1NWOA 2BW5A 1DZ0A 1XB3A 3QQXA 1F56A 2WO2B 3FSAA 2OV0A 4GP5B 4PAZA 4AZUA 3TU6A 2DWTA 2GC7C 2CALA 4ZK8A 2CCWA 6PAZA 1KGYE 5AKRA 3OD3A 2QPDB 1PZBA 2BP8B 4KO9A 4F2FA 2IAAC 5D4JA 4YVNA 3UAEA 1BXAA 3CDZA 3X1BA 2J55A 3CDZB 1M57B 4A67A 2A3TA 2AFNA 4KNUA 1ZDQA 4HCGA 4G72B 4BDVA 1JERA 2GI0A 3MBWB 3TBBA 2ZXWB 3WI9A 3FYIB 2IH8A 1JOIA 3AW5A 5PAZA 1GY2A 5I28A 4HCIA 3U25A 1HAUA 2BZ7A 4KO6A 1GSKA 1VLXA 4YSDA 1E5ZA 2GIMA 3NP4A 1BQKA 3ABKB 1ET5A 1BQRA 2IWFA 2AANA 2EILB 3NJKA 4YSCA 1E30A 2JKWA 1OCOB 4E9WA 2IDSA 3WKQA 1SF5A 3NJJA 4DP6X 2XYBA 4QKTA 1AG0A 4E9RA 1SNRA 5LDUA 3NJHA 2UXFA 1NZRA 4YSRA 4N4YB 2FQEA 1SJMA 4DP7X 1CYWA 2H47C 3BQVA 5I5MA 3H56A 3S3DB 1EZLA 3ZIYA 3QJUB 1ETJA 1NICA 1NINA 4G7QB 3MX0B 4AX3A 2JXMA 2LLNA 2FQDA 4E9TA 2XLLA 2PCYA 1AQ8A 3PPSA 2PLTA 4DPAX 4A2EA 1A8ZA 2XXFA 1KYAA 1AG6A 1M56B 4DPCX 4W1TA 3PAUA 3FYEB 2JFCA 3CVCA 1AZUA 1OF0A 1TKWA 1NIEA 1ZDSA 1CYXA 4NERA 5TK2A 3UGEA 1TEGA 3G5WA 1T5KA 2YQBA 3DKHA 3GDCA 2GSMB 5B1BB 2B3IA 3OMNB 4BWTA 2J5WA 2BO0A 3IEAA 5ANHA 1AZBA
chains in the Genus database with same CATH superfamily
3WL9B 4Y2LA 4J2QA 5B3SB 3BX7C 4KV5E 5CCJA 3C6SA 5D1ZD 4PJ7E 1MG3C 5SV3A 5C2UB 1GGUA 3LS4H 3BRGC 1XF2A 1HOEA 4HFWB 3I9IA 3T2NH 3BUTA 5KVFH 3OPZH 3PDGA 3PJLA 4P46A 2OMTB 2G9HA 1IFHL 1T1YA 5L2KE 4IEFA 2QKSA 5CP7B 2OL3A 4AMKL 2DF3A 3EBAA 3OMZA 5H4YA 3NDYE 4KZ0A 2BNRD 4HEMA 2WTPA 2AVGA 2Q76B 3L3JB 4ZUVB 3QIUA 4M43L 1TG8A 4MA7H 1YDPB 4UOJA 1EGJL 4ZPVA 2ZP0T 1PD0A 4NRYA 4I0KA 5DFVC 4CAGA 4N8UA 4A2FA 1XTMA 4NO0B 5DRZA 1R4XA 5HGGS 4CNIB 1U3HC 5F9OL 3MJGX 1LD9B 1P7QD 1T1XA 3CFTA 1G5AA 3VXSB 1M6OA 5TF0A 1IEHA 1C9SA 3CTTA 1TYEB 5J9PA 4N0YL 4WTQA 4WKXA 5K9OA 2YK1H 1M53A 3O6MH 3QA3B 3A67L 3ZBMA 2NXZD 4Y5YA 4IKJA 2Y1VA 1CT8A 1T2QL 2XWTB 4R8WH 3WE6A 3N91A 4JHAL 1EAOA 2EJ1A 4OQTL 4RBPH 5FA3B 4GPVA 2VR5A 1W0WA 2ESVD 1B0WA 1KLGA 2EDMA 5F7BA 3LKSB 3VE0B 3TIDB 4XPGL 1T5WA 2CNYA 4OZFA 1OCCB 2LTQC 4GW4B 5D7JD 2EC9T 5AVVB 3SDXE 3KL5A 4JR9L 2CHNA 2Z92A 3WN5C 5C0JA 4ZTPH 5HPMB 1EGJA 4H44C 1MXGA 1UD6A 1KTDB 1QRNB 1CG9B 2IXQB 2V5SA 2A2QT 4E9SA 2D4FA 3PPEA 1FNGA 2YEZB 4EZMA 4ZYKA 3FU7B 5CSBA 4Z18A 1S7VA 5B1AB 1OT1A 4F1ZA 1A9EB 1MELA 1A7NH 2Y1YA 4G43B 2NSXA 1XF4A 3TJEH 2O5ZH 2WKOA 4J3OD 2F8XC 2YGNA 4HHAB 2IANA 1UCBH 4X80H 1EFQA 4Q9RH 5IZ7A 2IH3A 3TFKC 3ULVF 3CHRA 4YOKA 3U9UA 2JLPA 1U33A 1D5XA 3NGBC 2NXZB 3P3UA 2OJEB 3F6IA 4FADA 3GZPA 4OT1L 5EEVA 3IBOA 4LCCB 4LLMB 2DMGA 1G1YA 4KKBD 2ESVB 2QKIC 4G8EA 3S34L 4FF9A 1PG7L 5D6DA 3LN5B 1MEXL 4QOKA 5D7JB 5GRVK 1W0VA 3V0IA 3ARBD 3FW6A 1DQTA 2WWKT 5I2IA 4K5NA 1WAAA 4OIBA 4QHKJ 5SX5H 1SXSA 2ALAA 4GOSA 5F89A 1J8HA 4AKQA 4YO0A 4ZMWA 4LU5H 5T1KD 1Q90A 1ZOXA 2G3NA 4HHGA 4WDIB 5F71A 1AS8A 5F9DC 1R5VA 3T09A 2V17L 4AIEA 2P24B 1RH8A 1UWGL 3NSXA 2MPAH 2YGPA 3FQ1A 5A1AA 4PV9B 5JXED 3NIGB 4D9RD 2W91A 3UBXA 1ORQA 1F11A 1THAA 2FHFA 3CU7A 1EZVX 3O2VL 4BZ2L 1A1MB 2AJYL 1GKOA 4XC3L 5LB1A 3PNRB 3QCVL 5CEZH 3PWNA 2NR6C 3EUUA 4KU1A 2L7JA 2P5ED 3GSUB 2VMFA 3G7TA 3RDTA 1YMME 4LLWA 3FOLB 3GHPA 5FOJA 2ADJA 3GMOA 4RGND 3VWKC 5CD5D 3NZHL 1S7RA 3TYGL 2CGRL 3PL6D 4QEGA 3WEXA 4AVKA 4OF8A 2HVBA 4WNSA 1FORL 4ABQA 1AI1H 4K3EL 2XTJC 3VX1A 2R0KL 4PJCF 4ODSH 4Q97A 2JCCB 3GBNH 3LZLA 4I9WD 3RLSA 1GIGL 3ALPA 1R24A 3LDBC 2CMRL 5C0FB 4YBLB 2A77L 4G5AA 1ZTXH 2QVKA 4I3GA 4LKXB 4Q6KA 4KITB 4R7VA 4WW2F 1QUPA 1WA1X 1EEYB 1Z0NA 3NFSL 4RIRA 4E9YA 1O5DT 5HYSG 1X6NA 3RVXC 2P42B 3MNDA 4U49A 4DERA 2IV9A 1DQDH 2BVPA 4K3HA 1FHNA 3BZ4B 4D3CH 3TLRA 2VB5A 2OKMA 3VFRA 12E8H 2CO3A 2IEPA 2X38A 1LO0L 3TCLA 4GBXA 3BLBA 2XZQL 3BH8B 5HBBA 2CCLA 5FUCE 5IVXE 4YDJA 2K8MA 2ZKYA 4O00A 3V7AG 4PWIA 5F93C 4LLAA 4RDQG 3RU8H 2EC9U 3PL6B 3K6OA 2J21A 4Z7WF 5CGYC 5GGRY 4HW6A 2H5UA 3NJVA 3UZQB 1A3RL 3L6FA 5F7AA 2UWEB 1OPGH 5L9DH 5GS1C 2KPWA 3C5JB 4P5TD 4P2RE 1J87A 3DSNB 4UF7C 1OO2A 2ZOOA 4W9DC 3ZZLA 5E5UB 4QRQA 1XGTB 2AEPH 3CFBB 5I9QB 4AUJA 4BDVB 4KOCA 3RVWD 4D9LL 2BC4A 3P40A 1OWWA 1YA5A 5CBAA 4MB3A 1BQLH 3ES6A 2PW1A 3O6FD 3FU5A 3NCXA 1MCLA 3ATDA 3VYPA 3K74B 5LBSH 2OSXA 5AALA 4K8RD 4CU6A 5F6IB 4FQPA 2KS0A 3SSGA 1DQJA 2L7QA 4MJ4A 1KEML 4MA8H 4DCQB 5CLWA 3T0WA 5CLTA 1HKLL 1JHLL 1RZIA 3ENEA 4B9GA 3BKMH 3JWNC 5DS8B 2BMKB 2VXSL 3RWGA 1XCTA 1ZS8A 2HJFA 4BA0A 2GABA 5FM4A 4YXLH 7PAZA 3VFTA 4QXWA 1TQSA 3E2HB 1BZ9A 4WHCA 2H6PA 5EZJA 1P5UB 4TUJA 2J20A 3DGDA 2XWBB 4JO3H 3IGLA 1T1WB 3D7PA 1J1OH 1WQVT 3QXVA 4DO6A 3NCYS 3ZTJG 1YNTA 2PTTA 1E50A 1OF2B 5FYKU 4RGMC 5KS9B 1N5YH 1U8QA 1DVQA 4RMUA 3EJSA 1OTSD 2WQRA 4MDIA 1DQML 5IGXH 4RX4D 3O6FB 5AB0A 2LW3A 4MXVF 2AEWA 5E5LA 1QA9A 4ZMOA 2MQCA 3WY1A 1E3ZA 3GO1H 4PJ9D 5CFAA 4XNQB 5CSGA 4HC1H 3VI4E 4WWKD 3DK2A 4LMQI 2L3BA 5C6WH 5FYJL 2CO1A 4E9VA 5KVGE 1E6JL 1UEMA 2DAVA 5JHDE 3U4EB 5I8KH 1FYTD 4HJIA 4P46C 2MRYA 4M5YH 3ATBA 4GRMB 4HBCH 4RMRA 5HSFA 1MXDA 3DV4A 1PX3A 5ILTH 2F54D 2WXNA 3MOQA 3GWJA 4I0PD 1DVFA 5B4MD 2CIIA 3I6KB 3LOWA 3QIUC 5I6LA 1NGPL 3P73A 3KPPB 5HP5A 2QEJA 1RJYA 2XX1A 4HPHA 5ICYA 3WFBH 1YN6B 1M05B 3VTMA 2B0SL 3VFVA 1HL5A 1UXWB 5J1SC 1QQDA 1KYOK 1WFOA 4XI5C 5C09B 2PP8A 4GAJL 4X9GA 3FT2A 2W94A 3SO5A 4MQTB 3SKMA 4XMKL 4ECNA 4PJ9B 2LFGA 2DQEL 5D1XE 4WWKB 2FO1A 4HALA 5EB9A 2VTFA 3H7BB 4Y5YC 4AKOA 3S3BB 4YGAB 4BZ1L 4MXWH 4JM2F 4LCYB 3QUGA 1EAPA 5HDQL 1BGXL 4N1CA 4LCWA 5CD3B 4GRWF 1FYTB 3N85L 5E8PB 2DLIA 1R47A 4XNBA 3VD1A 4FNLH 4LAQH 2B5IB 2I9TB 5DI8A 4G42A 4QTHA 5E2TL 3KWWB 4I0PB 4JRXD 1G9EA 1G1OA 3LKRB 3CFUA 1AFVL 2ENYA 3AUVA 3APDA 3CDZB 5KTEL 2W9EL 4PREB 2A3TA 4U6HB 1KFAL 3RIFK 3WTWA 3VH8A 3MBWA 4NNXB 3B2PA 4MAZA 4PJCA 5GISL 1AD9B 4NDMB 1OAUH 2ZIDA 2JJVA 1JK8A 4D9QD 1VHPA 4F92B 4PGCA 3UTPE 3IF1B 1WWWX 5KVDH 2VO8A 4Q4EA 2BZ7A 3AXIA 4PRAB 1MCSA 2EDYA 1UT9A 4OKDA 1FNEA 3PP4H 2LVEA 4WW2A 2VRKA 3OC5A 3GMMA 1NL0H 4JPWH 3NP4A 2PWDA 3IDXL 1PKQA 4QTFA 2CK0H 1ZLSH 1TJGL 3NA9H 3TTYA 3TBVB 5EPMB 3U2SA 5E9DE 1PLGL 3O4LE 5D6DC 3MMEB 4PHZA 2ITFA 1JGDA 1G7QA 3FC8A 1GYVA 2WXMA 4L3CA 5J6GB 4JRXB 1CLOH 3DK0A 1SF5A 5IW6B 1I1FA 5ELIA 4PJAE 1A4KA 1Z9PA 4JO2H 2P9RA 2YPKB 4NRZB 4Z7WA 4XVTL 5I8EB 1XGQA 2LQRA 1DSWA 4S0HA 1YECH 4YSRA 4BSWA 1HQ4A 2IGFH 4HG4J 1LVEA 4JDZA 4HJUA 3BT0A 4KY2A 3E1ZA 4UIMB 4G6JL 4ACPA 4BSJA 3LQAH 2JKIS 2YRPA 1IGJB 5C9JA 5FO7A 4XPAL 3L1FA 3E6HA 2V7NB 3L3OB 3LQMA 3OPUA 1XX9C 3HG5A 4W9GC 3DIDA 4AENB 3P0VL 3NUKA 4OLUL 5E99H 1QO3B 3BPOC 3GMRB 4CW1B 4Y5XB 3MLZH 4G83A 1I8AA 3HZVA 3CVCA 3PE9A 4QTIH 5JA8B 2JKNA 3RDTC 3RX5A 3STLA 4BV1A 2ZNXA 3HS8A 5TK2A 3LNIA 1EHLL 3V6ZB 4U7SA 2XZAL 3T77B 2J5WA 2NY5L 1NCCL 4YL9A 2A1WL 5SWZE 2ZD0A 3BUYB 3FFDA 1L5GB 4LHQB 5I73B 5IHUH 3ROLB 4PRPD 4MZRA 4E5XA 2XVGA 3U7YH 1FFPA 5F7DA 1BV8A 1UD4A 4NWUH 4NKQB 5BQ7B 1IVTA 1K8DB 2WNWA 1MHCB 5T3ZE 1FZJB 4LASH 2L4OA 1BREA 4OFVA 1WPCA 6CGTA 4GS7B 4S1RL 2XJKA 4PY8I 1C5BH 3D0LA 1CURA 3QR0A 4NM4H 4HJGB 4D7BA 1UM6H 4BJLA 3R7RA 1IC5L 2VLLB 5DD0L 5L8JB 5SWSA 2EH8H 1OCRB 4GBXC 4BCYA 4ONFL 4I3RL 3ZKQD 4BGLA 3GRWL 5K39B 9CGTA 2NY1C 2Q2EB 4J7RA 4L37B 3QIWD 3V0VA 4HAKA 2GFBA 1JPGA 1NIBA 2WLLA 5ETUB 3W3BA 4DW2H 1XF5B 5HGBA 4FQ1H 4BFFA 3DTUB 1WFMA 3RB5A 3FAWA 3SPVB 1USQA 4JFPB 4PRPB 4HJ0C 1HX0A 5JOEA 2JKLA 4KJQC 4G8GD 1PCXA 3SGDH 3DX0A 3CFMA 4GKZA 3BD4A 4WWOA 3KGRA 3K6SB 1X5HA 1A7QH 2R1WB 4FLHA 1EFXD 2F7RA 1BLIA 3TGXA 1C5DA 1KWGA 4XMLL 4S2SA 4NKDA 3BH9A 2XTJE 5C0AD 4X8GA 4TYUA 4RMQA 1NA8A 3BKJH 3UC0L 5I1GL 4UQ3B 3NA4A 3DBXA 2DMBA 2APVA 3CMOL 4HKJA 3US9A 5I1HH 3GRWA 2O5YH 1XDTT 1KOAA 3ZL4L 2SEBA 3ZDXB 3EDFA 4FFWC 4NKOB 2C3GA 3BZDA 3QIWB 2R0WH 4QRRB 4DN4L 1NBVH 3MFFA 1T22A 4JN1L 1YPZE 2VLME 4ODHH 3PWLA 4PS4L 2COQA 3LMJL 3CZLA 3VGBA 1AE6H 1YNKL 4FJZA 4UOW0 4K23L 3N55A 3SKOA 3UJJH 4X9IA 5KAQF 2ZUXA 5A2LH 1HSBA 1CL7H 5IFAL 1HAWA 5HVHB 4X83A 4Z3JA 3MLTA 2RTTA 3QXWA 4G8GB 4KY1L 4N5ED 1R5IB 3K4AA 1I9IL 2FZ3B 4PD4J 5GGVL 1F86A 3R8BB 3S0PA 3TBTB 1D2PA 1M71A 2G4EA 2WBJD 3QJXA 4HIXL 5FHAL 1MFEL 2YZ1A 4TNWF 2EUVA 2BZDA 2W60B 2V2TA 4NJ9H 5DJZB 5K1NA 1VAHA 2FWLB 3UTSD 1DYZA 4KMQA 3S3PA 1X9RA 5DHYA 3OKNA 3KYKH 5C0AB 2HKAA 2FGWH 1OM3H 5E9NA 4JNXA 1LDPL 4K8RH 5C6TH 1FWXA 3I50L 1YEEL 3N40F 5GGSB 4J1UB 3UZVB 1CLZH 3DVGB 4YS4A 4HJSA 3LNEA 4POUB 2AQNA 1ED3B 3L2MA 2H2SC 4AGQA 4P3CL 1FI8C 1USZA 5G2NA 1LQSR 4PJ8A 4FTVE 4KHXL 2AXHA 4KOBA 1YY9D 3EDDA 3FHQA 4KFZC 4PWEA 4P9HL 4JG9A 4YXKH 5JW5A 3IGAA 1DVFC 1IAMA 4N9GA 1S78C 4RFOL 5HYIA 5KSUB 2LU5A 1IKNA 1C1EH 4PCTA 2QSVA 5DLMH 3RUGE 2V9RA 3UH8A 4TVPE 4CN1A 3IPBA 1AKJD 2DWYA 2NYKA 5GS2H 4P2RD 5F7EL 3UTSB 3ZL1A 3PGCB 1KIRB 4F80A 5D70L 1MFDH 3BMVA 5ABDE 3SCMA 3HNTL 4OD3H 2PP9A 1A6WH 3K6FA 5DDHA 4AGPA 5CNHA 5MI0C 1FL5B 3FU9A 4FYTA 1XCXA 2OXHA 2V33A 1GAFL 2IWEA 3QDJD 4Z7OF 4OCNC 2FEJA 4BFIA 2X4QB 3LKPA 4FA6A 3ZE0E 2DYPA 2WAQA 1I1YA 2PWEA 1MRCH 3CHXA 3M88A 3TA3D 1FH2A 4OVVA 2NXYC 3VNZA 4A63A 3NJLA 7PCYA 4NZDA 1K4DB 1FRGH 1WTGT 3B1UA 2AK1H 3GB7A 5CKAA 3OMIB 1HN1A 2CPUA 3HR5A 2DQCH 1P6AB 3MCLH 3QDGD 1KLUB 3RG1C 2VRAA 2R69L 3CSFA 1E8XA 3UYPB 1HQRB 3SIKA 5KANG 2NUPB 3GSVB 3U36B 3IFOB 3HE6D 5EUKB 2BIQA 4LSTH 1CXIA 4JFXB 2O4EA 1UURA 1RUML 4ZMLA 2V2WB 1AVAA 4HEME 4XGZB 5FWQA 1R3IH 3E9UA 1IAOA 4WW2C 4I1NB 4HK3N 1N6QL 3FQ4A 1IBFA 3LJ3A 3NIDF 5EU6D 4UQ2A 4UIKL 5TGBB 1PY4A 1ZIAA 8CGTA 3QJTB 1UZGA 3QDJB 4LT7A 3RAJH 3QXAA 3WKPA 4W9HC 1FFTB 2BSTB 2ZG2A 5E23A 3Q5YA 4U2ZA 4LF3B 5K9KA 3TA3B 3FZUD 3V9EA 1F3DH 3S5ZA 3KDMA 3NH7H 4Z7QE 3RZCB 3ZYOA 5G4OA 1JZGA 4XE0A 5DJXB 1QR1A 1U8LA 1E28A 2R69A 3QDGB 2CGYA 5HHXL 2D03H 3VFWA 1E2VA 2F1BA 5AYQA 1CZ8L 2CXGA 1OOWA 4L9LA 3D06A 3FO0L 3HE6B 1DVSA 3N9GH 3HC3H 5FGCE 2MCG1 5E1AA 1ZPUA 5AW4B 3L3HB 4CSTA 3BWZA 3FQUB 2JWYA 3QAZB 1CF8L 4N0CC 2QPEB 2UZXB 5IB5A 2X28A 2Y5TB 1UA6L 3ELAT 2AVFA 4N2OA 5EU6B 4ZO6A 1NBZA 5HI3D 1JXKA 1YJDH 3C09C 4TQIA 3GMLA 4L8BB 2CO6B 2VQ1B 4MNGA 2E9GA 1REIA 1YEJL 5FIEA 4ZUWB 3SGEH 3ARQA 3NAAL 5HGAB 2Y7OA 3RWFB 1Q72L 1IU1A 1I7RB 3WUWA 1OP3K 1ZEAH 3DHUA 2IANE 4M8VA 1KB3A 4G7RB 2JJUA 4NZJA 4PJDF 2EVHA 4PVBA 2JE8A 4PW9A 2XNAA 3QPXL 1UQSA 3PJSB 2JXMB 4PJFB 2VE6A 3LEXB 5AEAA 1NIAA 4MGXA 3B3IA 4RFNB 2J25A 5IBLD 4TTDC 5C07A 3IFLH 2YGVA 4LOFA 5EUOB 3X12B 2CDGA 4OCYH 4WF7A 4FLRA 1FO0L 3N5AA 3LZQA 4QOKE 1UXMA 4EOWL 1L9PA 3LNDA 1F3JA 5G5DB 2BSEA 4MD0B 4RWYH 3B9VA 3M17A 4G1MA 3FAXA 1CLYH 1RIVH 4WWID 1OGAA 3TTSA 1FA4A 2GYSA 5EBMB 5TQ0H 1MVUB 4PRID 4GT0A 1J8HE 4ZUUB 3K0YA 1ACYL 4R7LA 4U1GB 3DOIA 3R4DA 2X6UA 3JTBA 2WSKA 1IKFL 5JQ6L 4LVHB 3RZWA 4X9HA 4WEBH 2MCPL 2X2HA 1I9EA 3LKQB 3MRHA 2YZ8A 3HI6L 4NNYA 2NY5C 3T2LA 4LOUC 1PS3A 3S4SB 5ALBH 2X0UA 3SDAC 2FEEI 5EO0B 3VRJA 2DQHL 3EYVA 3WEAA 5HD8C 3GGWA 3PWVB 4PRNA 4Z95L 3BVVA 3TJHD 5BXFB 1FO0A 1NWOA 3M07A 5FUZH 4FQQA 5A16B 4AQAA 2EACA 4YHML 4K9EL 2CALA 5IB3B 2F8IA 2NTFB 3EYOB 3PIQB 2QHRL 4JCWA 2RFXB 2HFEA 2QPDB 4C83B 1XCWA 1P4LB 4HT1L 4PRIB 5F9AC 1S6NA 1BAFH 1Y0LA 1GCYA 4KTYA 1BZEA 3C6LA 4HFUL 2J55A 4PWHA 3WO4C 3GUFA 3VU2A 5E4OA 32C2A 5CZXD 4JB9H 2Y23A 1ZT1B 2E59A 3S35X 5BUGA 1OLLA 1G7JA 3SDYL 1II4E 3IMSA 2QR0A 3D25A 4MQXC 1SXAA 4IBVA 2BHYA 5I28A 3FUIA 4XCCL 4GT7A 4RQQB 3LNHA 2DWEB 4HGKC 1Q1JH 2EUXA 3BPLB 1LO3L 2VZSA 3Q8EA 1QAWA 3TT3H 3EIFA 3DBSA 2AJVH 3OAWA 2J88H 2BS8A 3Q06A 1L7TH 1ZANL 3HIZA 3CJJA 1TJIH 2IWFA 5D8JH 1DBJL 5LKNA 4E0RA 3HUJF 2XDHA 1R34A 3MLSL 1ND0B 1KYFA 2XZCH 4Y2DD 1CXLA 3MROB 5JIQA 4OV5A 2DBLL 4O2CA 4NQCA 3WS6A 4UM9A 3D4GA 4JHZA 3FJTA 5J13C 4NN5B 5IQ9B 2YD5A 1OT4A 4N8CH 1YUKB 5I0VA 1FFOA 2ARWA 3Q9PA 3US0A 2WZ6A 5TTRA 4NUQA 5JW4M 3GSQB 4LKCB 2Z7YA 4QIRA 2VXQL 3V0GA 1E3FA 3CAFA 3WTYA 4EUPB 2BXZA 1LK3L 4ODUB 5JW4N 2GY5A 3M6DA 1YEIH 1O6SB 2Q7NA 2ZAGA 4PV1C 1NCJA 2LLNA 3CX2A 3C60D 2BIPA 4NQDA 4PGEB 2DLFH 2UZYA 3CCHB 3LPOA 3OB0K 4QY8A 4YIQB 5J56B 1J18A 3ESVF 4KKAD 2OYPA 5KSVB 1R5WA 3TT1H 4A2EA 1U8OA 1KYAA 2DICA 3EYUH 3GJEA 4QNPE 3PF2A 4NZTL 1GKEA 5LUMA 5IUSA 5GSRB 1OWRM 2G30A 5DLLA 5IW1A 2FUTA 4Y2DB 4R5TA 5INDA 1TLMA 2IOIA 2A99A 2EXSA 2YQBA 1VPOH 3ELQA 5B38B 1P7KA 1PZDA 2V8MA 2NY3D 2X3AA 4UQDA 3RGHA 1JIBA 5E51A 4M6NH 3ZT7A 1JL8A 2XA8L 2YBRA 1V8HA 1BD2E 2VXQA 3VXUB 1NGWB 3O4OC 4ZS6C 1O7VA 1KN2H 1ONQA 3B2VH 4FQJH 1DO5A 4IOIB 4JQXA 3QHFL 2X4NA 1QEXA 1E4XI 5BO0D 4N28A 3ECQA 1N0XL 4G1EB 5LQBL 2IF7A 5IMLA 3BYTA 3MGTA 3T0EA 1NBYA 5CP3A 2HFGL 2ADFL 5KZCD 3BSZL 1YQVL 4PJDA 4F33A 2A0LD 3OJVC 3ATAA 3OLGA 1KXTA 3ZRFC 4GSDL 1UFGA 3TO4D 4AT6A 5GZOA 2EEFA 4CMMA 1XGRB 1OK8A 5ALCH 4NT6B 1UFUA 4CVXA 4N90D 2NY3B 5E4EB 2ZCLL 2G5BA 1T1ZA 25C8H 4FXGA 4F7CB 2EDWA 2EXYC 2EXTA 3VFMB 3MUGB 2HA1A 3L1GA 3BPCB 5HDWA 5E5MA 4L18A 3EF4A 3R06B 1ADQL 3G6JF 3CK0L 3CV5A 3IDUA 1MPAL 2BCKA 2Z9TA 4PFEA 1ZPLA 3DX2A 1DN0A 3RIAF 5IEHA 2Q1EA 3VFSA 1QG3A 4OVUA 3T6XA 4Y19E 4WGVB 4NQEA 3O3EB 3ZTDC 3K5RA 5DK3A 2ED9A 3ML8A 4KZEH 2VDMB 1F58H 4FTVD 3BDBA 1KY6A 3FS9A 4J6RL 4HX1A 3ZTEA 3BSZA 4ICWA 1VFBA 4JO4L 4NHUB 4OF5A 4E41D 4GUQA 4ZOAA 2CLVA 3V0HA 4ATTA 5FYJE 2VABB 3W56A 1S9XB 2E56A 3B2UC 4FFYL 1INEH 4RRPA 3QUKB 4LCWE 3TO4B 1ORSA 3ZMNA 4BSVB 4HIJA 4L9LC 4CADA 4PI2A 2YAMA 4CVZB 4DAGH 3NSCA 3IMVA 4PN6A 5E94B 3CU1A 1A7PH 1S5IL 4M7ZC 3UXFA 5DJAA 4NSKB 1AQDA 4HIEA 3QI9A 1ZKAA 3P9LB 1GGIH 5JPNB 1JNHA 2H0EA 1EHAA 4NWTL 2VM3A 4X5PA 3L9RA 3F62A 1IGCL 1RZQA 1B4JH 2XN9A 2GK0B 2EDFA 2JI3A 3JTTB 1ADQA 5DHDA 4U1NB 3O41B 4PGDA 1RJZB 4QYOA 3T0DA 3WD5L 1TIUA 2IJ0C 4L1BA 1E27B 1H8NA 5I15H 3D2UD 2NZ9D 3QQ9D 3RNQB 1I9RL 1JVLA 3TC9A 2AP2A 3DO4A 1AQKL 2ZX9A 3MRIB 3JYCA 4D7PA 3BKCH 3AJ7A 4E41B 3C2AH 2OM5A 4ZFFB 3COOA 4ZMAT 5BCAA 3GS0A 2OZ4H 4FFYA 1PKQE 1MG2C 3BDYH 2YOAA 1PIFA 1R3KA 1K72A 1I8KB 1U8HB 1GHFL 1LO5B 3U6RB 1SFHA 5GQBA 3W2DH 1FC1A 1CXKA 3I6GB 4NB7A 3K80A 1XL6A 4OCMC 2AXGB 3OJDB 5FK9B 1P4BL 1G0XA 2CDFB 3ML9A 1HT6A 4NUGL 1VZIA 1FGNH 1RERA 5D7IF 3J7HA 1FH5H 5D5ME 2B1AL 2M26A 2P80D 3EUDA 4LRNL 3GIZH 4Z7WE 4Y1TA 5LNGA 5IESL 4FRWA 3FUHA 5D7KE 3S96B 4ANUA 4XMTA 2FUQA 5E2UL 1IQWL 1C08A 1OY3B 4Y4KD 4B9IA 1RIHH 4FQ2L 2OULB 5BOZG 3D2UB 2R29L 3K71B 2DB8A 4IKIA 4MFHA 4XBEH 3RX9A 2R2EB 3TX4A 5HYJE 4IRSA 1XSKA 2ENPA 1QPPA 2EDOA 4YQXH 3WFEH 4QWWD 2VLRA 2X44D 3RWCB 2OYKA 5A7EA 1IGMH 5AUMA 4GKOA 1KTBA 1NFIA 4ZO8A 3ATFA 5DHVH 1H3PL 4D2NA 3BFOA 3KNBB 3UTTD 1SHSA 1RMFL 1SGKA 2V3FA 2CO7A 2HWZH 2Y7QB 4FZ8L 1TFHA 4JG1L 5IT2L 3AMLA 4FQLH 5DMIL 1T03L 4WZ9A 3G3LA 3U30B 2YPLA 1JFQH 4PUBH 4OM0L 5EC2A 3NSJA 2H9GA 4XP9H 4R0LA 4UU9A 5F88B 3C6LC 3KMDA 3MJ8A 2ICEB 1RZKC 2XG5A 1U8CB 2Q10A 2F74B 5E8EA 2X1XR 1LEKB 5EWIH 2R29A 2FR4A 4U6VH 5HTSA 1TTRA 3G04A 5EZIH 1QPKA 4PP1C 1JGLH 5HHOE 1R1CA 4ZX4A 4LLDB 3QUXD 4GQZA 2BNQA 3IDIA 3MNWA 4K0OA 1KJ2L 4I0CC 4ZDHA 1PVHA 5DEJA 1JDAA 4Z3HA 1W6LA 3PV6B 3PGDA 4TQ8A 2BWDA 5D7SH 1K6QL 4FMKA 3BT2L 5SWSE 2ARJA 5I1DB 3ZPDA 3GQFA 1MI5A 2D73A 1TEFA 4WHYH 3UTTB 1XZ0A 4Q2ZB 5DMKB 4K9EC 1A47A 2W65B 3DMMA 3GMNB 3VO0A 4F57L 2FX7L 3VDCA 1S7UA 4H2CA 3VG9B 2MJWA 1E2ZA 2W8CA 4FJ6A 3WS6C 1OGTA 4ZS7H 4H0LC 2AJZB 3QORD 3RWDA 4NQSB 2OFQA 4YSTA 2R39A 2TAAA 1S5HA 1F90H 3IJ9A 4MNQD 1P1ZA 1WFUA 1I1CA 3BVNA 1KNOB 5H37H 1YG9A 3X11B 2VJ8A 3ARZA 4F91B 2XIIA 1KXQA 2E76C 3P2TA 3QUXB 4EUPH 1KJ2A 5AW2B 1CFVL 3F84A 3G6JA 3SPIA 1JMZA 3D39E 3SY6A 2Y07H 1F0LA 2WLIB 4P99A 2GY7B 3GXPA 4X6FA 5GJTH 1JZ7A 3EOTH 5JHLH 3P9MB 3CQPA 3MRPB 1ZWIA 1J1XH 1N18A 4LPWA 5I5JA 2W1NA 2GBUA 2A6KB 2HG5A 1VERA 1UA3A 1IGTB 3C8KA 4NQQA 5FHBL 2OJZH 3Q44A 2EE9A 4NO3A 1N2RB 3QUZA 3VGHA 4H25A 5MHSD 3E8UH 1GTNA 3CSBA 3QSKB 3ZJAA 1FPTH 2MTPA 3BP5B 1KBVA 1JG9A 3FB5B 1AQHA 2Z93B 3QORB 4FI6A 3RGBA 3GTTA 1FZOB 2DM4A 3TCXA 1AY1L 2CO2A 4U0QB 5ABAA 4ZZKA 5DYOB 3DWTA 4MNQB 2R4RL 4XOCA 4A38A 5A6LA 2NNXA 2C3HA 4EI6A 1KSRA 4QAWA 4ZQTA 1CFNA 4JQXC 4XCYB 1KTJA 3EGDB 3ZTNL 1YEGL 4S0SD 4JFDA 3MLVL 3RGVD 3O9WA 5IJCC 4HLZH 4ZTOH 4JKLA 3QJOA 4QRTB 3QEGL 4HGWA 3T0EC 3UP6A 4AITA 5F96H 1C8PA 1HILB 3IJHA 4JX0A 4OZ4A 1U8PA 4HSAC 2YD1A 4I89A 3L4WA 2GAZA 4P57B 3C08H 3ZIMA 4M1GL 2FNWA 4JE4B 2XETA 2QTEA 3L3DB 1DLFL 5GZOC 4WHDA 4YZFE 4X0KB 5TQ2L 4RH4A 2WINA 2PW2B 1JZ2A 4G70B 4NPKA 5BV7L 1MQKH 1K5NA 1QLRA 4EZLA 4K94L 4YAQA 1VEPA 4FXGC 3WFCH 4BKLA 1ZHNB 3EO0B 1QKZH 4GIPD 1VFMA 2DKUA 4RVBA 1NOAA 1OAYH 2NY0C 3FCTA 3Q6GL 4TOYH 1TZ8A 5DD6B 4R7NA 5HDBB 2NZ1A 5EH1A 4JVWA 3FSAA 2OV0A 4TF4A 1MW1A 1OP3H 3FCGA 5EULV 1UACL 5D71L 3RGVB 3X14B 3CDGB 3S37L 3VJ6B 2ITCB 4HJJL 1RPQA 4MAYB 3VFOB 3QRFM 3SQBB 2VDMH 1KENL 3VXMB 5H94B 3L3KA 3OTTA 4XXWA 1HOCA 1G9ML 4LQFH 2ZUQB 4PIBA 4XP6H 2CG9X 1ZHBA 5J12C 1AIFA 2C9PA 1J0JA 3G08A 1CFBA 3EXLA 3SYPA 2GI0A 4G5ZH 4JFUA 5E6UB 1JPSL 5AKSA 1F4AA 2GT9B 5H37G 2BFVL 4G6FD 4YLBA 4H26A 3GXMA 1VACB 4TLKA 3HTLX 4KXAA 1ZV5A 3I02A 4BQ9A 2A4CA 1E8ZA 1QBML 2G2NA 4AM0Q 2EDTA 2EECA 3OZLA 4JRYB 1TTCA 3O6KH 4CKQA 3UTQA 3DECA 4Q6IB 4Q9BA 1DBBL 4XPTH 1VCAA 5LG1A 4XPHL 5E03A 2I07A 2QSCH 1HDMB 4P4RB 5C08B 3MNZB 1U0QA 4KVCL 4R96A 5FAAA 2MNWA 3VWJA 4AJWA 3CZSA 3ALWA 5BQDA 1T21A 2G0KA 3BAJA 4G2AA 4S11A 4ZFZB 3HS0B 1R75A 3KR3L 4HUUA 4DP7X 2LU7A 4NO5A 5F1IA 2DQJH 1LL1A 5I1IH 4FA8A 4A04A 3AAZB 3GSRA 3N04A 4L1LA 3JV6B 4YDIL 3ZTCC 4ZSOB 1I9JL 4F9LA 4HZAA 4HS8H 4NCDA 3MX0B 1AKPA 1NFDE 4L5FH 1EBAA 4HYTB 1MCWM 2AKRB 3SDCD 1QACA 1HKFA 1U8MB 4CC4A 4ORGA 5T3XD 1S2EA 2DWDA 2EAEA 3L1OL 2KDYA 2R1YB 4GI8A 4H5SB 2JB6B 4U1HA 5D6CB 3WHE1 5IP4A 4H8WH 4JY6A 2OR9H 3K46A 5FB8A 1VGKA 3LIZL 4PRBA 4YLQT 3LB6D 1OZTG 2R0LH 4JO1L 4UWQB 3SOTA 3PDOA 5MEQB 3QHTC 3G5WA 2JI1A 3RKDC 3X3GL 4XWOD 5AOMA 4I9XA 3X13A 4XMVA 1PDKA 1SXBA 4QXUH 3BZ5A 3GLDA 2F58H 4Y19D 1B9KA 1DL7L 4AWJC 4CVWA 1HYRC 4PVNA 4GG8B 4HSCX 2AV1B 2P8LA 3KPSE 4V2CB 4I2XA 2VDLB 3T3ME 1L7IH 3NN8B 4MWFB 1JF1B 2H3NB 5CEYB 2VCOA 2Z91A 2GUYA 2VAAA 1IZKA 3ZYJA 3QO0A 3ISYA 4U6YA 2J6EH 3D0AA 2QPUA 5DEGB 2M83A 4HH9A 4XXDB 1EANA 1KEGH 2ZKMX 2AGJH 4JHWL 1YEFL 4U1IB 3RVTC 3SDCB 4R0LC 1NPNA 3ARED 2YD9A 4Z7AA 5IFHH 5T5FH 1GC1C 3QEUB 2ROYA 5J11C 2WUCL 3QFJE 3F58H 4OFKA 4L05A 2YRBA 2AK4E 3D3VD 4HWEL 1QNIA 3HZYA 3LIZA 3F01A 2CWRA 4AIXA 2EE3A 4HIHB 4NNPH 4NRXB 3DX1A 5K59E 4YHOH 1E9QA 1TZHA 2X4UB 1OGAE 3CD4A 4XNUH 3ZR5A 4HUCA 1HTYA 2I5YL 4FA7B 1FAIH 3IDNB 4OLVH 3E8VA 2VH5H 1UD2A 1GS7A 3OB0H 1I1AA 3DVFA 5DC9B 2K7PA 4ZFOB 4M9PA 4UV4H 4CJ0A 3BD3A 3DX6A 2BHFA 2A9CA 3AS0A 2BP0B 3QXDA 5E4IA 3Q8CA 2KQMA 4BUGA 2EIBA 5IUCA 3DMMC 4XMXA 3ARGA 3T9WA 5PCYA 4P8QA 4DKDC 3FCSB 1CF1A 3T8XA 3SD2A 3TBWB 5EZLB 3DXAD 2HT4C 4HUXB 2CZNA 3U4BL 3VXPA 4F8NA 1LP9A 3AREB 4EI5D 1AMYA 3KLQA 3N41B 5ICZB 3N2JA 4HPYL 4PJHF 5FECA 2IDQA 2J71A 1G5GA 1JGVH 3VGAB 5FO9B 4PGZA 3LRMA 3EYQC 4CBPA 3UYRL 1PTZA 1QFPA 1ASOA 3D3VB 5DJ6B 2A6IB 2CLZA 4P2QA 1G1KA 4GG6F 5DZLA 1D6VL 4AUYA 1FVEA 2A38A 2IADB 1V7ML 4G6MH 2JELH 4XC1H 1A9VA 4TSAL 3E0GA 4DNLA 4HDIA 3G5YB 3RA7L 1YEHH 5HYJD 5I17B 3PV7A 2DIJA 4Y9CA 5IQNA 5I1CL 2GHZA 1X5XA 2EKSA 2QDWA 4O2EB 4NHCH 2VUYA 2OMYA 3GHBH 3WLWC 3DC0A 3PFQA 4P2OD 5JMOC 2OSLB 1PEWA 2XX0A 5E8OA 1TVBA 2F7OA 4M1CD 4AJ0A 3QZWA 4BRVA 5KSAA 4JN2A 3KS0J 3QFGA 4X7DC 3VXRE 5ID1A 3OXRA 3KYNA 3STZA 4U3XA 1GYCA 2ICWA 4LIQH 1NPUA 3V5DB 3QUZC 4XOBA 5CINH 4ES8A 3DXAB 1OLZA 4X7CC 3VM7A 1QOKA 3N1FC 3CHSA 3VYNA 2ZXQA 3VRIB 1WAPA 2VDRB 2CBOA 2WANA 4J3UA 4F7PB 1I8MA 3ZE1E 2H1PH 1UH4A 2XQYG 3ZKMC 3SE8L 3SKJL 3MTRA 2ZKXA 2VLKA 4PJIE 1DBAH 1TNNA 2VZUA 2ZKHH 4YHZL 3B9KD 3O11B 1VB9A 3O9WC 1A0QH 3QNZA 4G8AC 1E67A 3BHBA 3A21A 2XKNB 4JDEA 1JPTL 4P2OB 1AZNA 4GSQA 3ZLQC 4KKPA 1ODUA 5FKAB 2PTVA 2YKKA 5GZNA 2Z7ZA 3BEWB 2BRQA 3CZGA 5CHNA 5BS0A 1RUKL 1Y18A 4C4KT 1T3FB 3P3SA 1MLCB 4PMFA 2OR7A 1RV6X 2KZBA 4NBZB 4BUHA 3OWEA 4LLUA 1V7NL 2XBTA 4YN3A 1FNFA 3FUJA 3U1PA 5EBWA 5TFSL 2C4XA 1U58B 1FIGH 1U8KB 3HG1E 1CVRA 4NQDE 2ENSA 1AR2A 1KIQA 4NCC1 1OPOA 3JWDH 5L4JA 1E4XH 1N7ML 3GBEA 2ZSWA 3I9AA 2OP4L 1MCEA 5IHZA 3A3YB 3GC3A 2HLFD 4XCNA 3RNKB 2FX8L 5ACZA 4UDUB 4MA1B 4X42A 1RJLA 3NCJL 5IROA 5F7MC 1UJ3A 4M5TA 4Y2OB 1LEGA 1UXSA 3B9KB 4A66A 3S35H 3V9CA 3GJFK 2XG4B 3CVDA 2NYYD 1HSAA 3HCVB 1A14H 2NNCA 4BWWA 1Q0YL 3FT4B 4QJ3B 2QQNH 4WGKA 4XXWC 2HT3D 5FEBA 3D39D 4X4YA 3UJTH 1ZJAA 5K1VA 3GI9H 3MLRL 4N2CA 3DV6B 4JQIA 3G6DL 4OSUH 2CK2A 3TWCH 1DHKA 3PUCA 4DPBX 3N43F 3DX9B 4OF6A 3OJ2C 5D4IA 2R2BB 3H54A 4GYBA 4K94C 4WI7A 4OI7A 4HHWA 5ACMA 4X9YA 4X98A 2C9SA 4PR5A 3F7YB 4QRSA 5IB2A 5HPOA 1J0KA 4LSRH 5EORH 4FFZL 5DFAA 2VDQB 4XNMB 3L5IA 3IKCA 4PJDE 4MJID 1I3GH 2BH0A 2G75B 4R4ND 4YDLC 2GTWA 5BMFL 1HE7A 3PQYA 3FPYA 4JDTH 3C8HA 2AZAA 2B4CH 2A5UA 3J27A 2E9JA 4NI6A 3K81A 2YKLL 2DTMH 2YN3A 4OZIE 3PHOA 1DP0A 4Z8FL 3ECUA 4ZAKD 2XWRA 4GQ9H 1B9ZA 1W72L 1G9MC 6FABH 3QRBA 1F5WA 4CKVX 2VDPB 1ZGLB 5CMAA 3VWJC 2VMEA 1SBSH 5IEKB 2BIOA 2J8UB 1A3ZA 5DVKA 3O3AB 3QK0A 3SPGA 5BZDA 4DP8X 3STBA 3VDBA 1RZJH 1G0YR 2QL1A 4XCEB 4M00A 3DGGA 3S36X 2G9KA 3NEOA 2OS7A 3QJVB 1D5ZA 3T0XA 3TL5A 4OLWL 4F9LC 1OB0A 4KKCD 3FTGA 4FFZA 5AZUA 4HIIA 3WKML 4LPUA 3U9WA 1X7QB 5HY9A 4HKBA 4HMCA 4MJIB 4ENEC 4AW7A 4NP4H 2KH2B 4Z7NB 1JXGA 3KXFA 5D1QB 3TM6A 4PJHA 5I19L 3CVIH 3T2NL 3GSOB 3LS5L 5KVFL 3OPZL 1X9QA 3F85A 3PU7A 4MZ3A 1TVHB 1A7OH 4ZAKB 4GG6A 4EE2A 1GMEA 1EQWA 2V5RA 5IJKC 2GC4C 1W72A 2GEEA 2VXVH 4MA3A 4HUNB 1L6PA 1P84K 3MRCB 3OKLA 2XN9E 1MHPL 2MTAA 5HHVH 3RRQA 1SHMA 1OTUD 4MA7L 3GM0A 5HVGB 2R23B 4GW1A 4AL8H 5IMMB 5T1MA 4HAFA 2XRAH 3MLXH 4P5KB 2VDLH 4OR1A 5DRWA 2IMNA 4X8CA 1AJ7H 1OTTC 3UFIA 2WXGA 3IETA 3PNWA 4C56A 1IBYA 1JRHI 1Y07A 2PR4H 1N6VA 3LD8B 2FJHB 3BGFC 1DSFH 1F3DJ 4Y16D 2YK1L 5I6KA 3LRKA 5GRWA 5T3XH 4PJBB 1BF8A 3MV9A 3BGAA 5M95B 1BX2B 4X50A 4WSJA 4YE4H 3WFDH 3C5SA 4UYPA 4B9JA 1EHNA 3NIFE 3VRLE 2VNCA 2CR6A 1QWHA 1RSFA 3IDMA 2KLSA 4G6AC 4MB1A 4F8OA 4XP4H 2KMWA 1EMTH 1MCOH 3B83A 3SD5A 3WHXA 5I16B 3QWNA 2FYVA 4HV8A 4BH8A 4L4VD 1A6UH 4FG2A 3BLKA 5HJ3B 4FYRA 4HS3B 1JZEA 5DZJA 3ECWA 3I3BA 1BZDA 5E1HB 1JZ6A 4KO5A 3BSHA 1KELL 3W9DA 1DUYB 1J8KA 3OXSA 1S7QA 4OF0A 4IBWA 1KPVA 4ANVA 4GP5B 3A22A 1A7NL 5KWYC 4XP5H 3ARGC 4PV8A 4YX2H 3ME0A 3TJEL 2O5ZL 3HE7D 1TYRA 5BJTB 2CCWA 2AAVA 2EH7H 4WEUD 3UAJD 4E9LA 4Q9RL 3RJOA 1JTOA 2WVVA 2N7BA 1ZVSB 1INQB 4LSDA 3BRFA 3GUTB 3BIKA 5E1QA 5JQIB 4ZMTA 4MDRA 4F2MB 4MMXA 2P3YA 1AO7E 4YPGB 4Z5RA 2ZE0A 2X7LA 3EO9H 4YWGH 1MIEL 4LEOB 4M48H 5A2JH 2QV2A 2QQLH 4D94A 1WD8A 2NYZA 4U1KA 3H2QA 1A1NB 3RWEA 2FWOA 4OLXH 2YPLE 3IT8D 5FLVA 5FF6A 4A55A 3V6BR 4ANXA 4OD2B 4L4VB 1B6DA 3AQDA 3LRGA 5GJSH 4WJG3 2FJFB 3KPMB 1SM3H 4B9KC 4Y1AA 4LU5L 3B6SA 3LZPA 5KSAC 2GTZB 2ATPB 4POYA 1Q9WA 3THMH 5IK3A 5IMOA 3DLQR 3RTQB 5CIPA 2BJMH 1QI4A 2AANA 2CJTA 4ZX6A 1P9MA 4YSCA 2BNQE 4AGNA 5JOFB 4AE1A 4E9WA 2MPAL 4MLIA 1KCUH 1BZ7A 5DJ0B 2WQUA 4LCUA 4V1DA 4P9ML 4J8RA 1A66A 5DQDL 5TH2B 5CEZL 5DA0B 2A9BA 4OCSL 2FSEB 1O7SA 1S3RA 2VDRH 3NFNA 1IJNA 4O02H 5CR8A 1F42A 1W91A 1CDJA 4OLZH 1IGIH 3VGFA 1EZLA 4NO2A 4GSRA 2KKQA 3RKPA 2GITA 3GJFB 2AK4D 4GKNA 1MAJA 3IJEB 5C9KA 1DVTA 4HWZB 4FQXA 4L4TE 4HUWB 4MAUL 1QTYT 3EHBD 4AX3A 4IU2A 1NBCA 5I30L 5ISZA 5IFJB 4WI0A 4FQIH 4ODSL 5A6MA 2P8PB 3H8NA 1D5IH 1V3KA 1QI3A 2X1QA 3IVKA 5FXCH 3D9AL 3FQTB 1P5VA 4APQD 2M1KA 4O2FB 1ZTXL 1EAQA 3VQ2C 3ZE2B 1WC7A 5AVUB 4EVNB 4YHKH 3CFKB 3G6JE 2E4TA 1TKWB 2J4WH 2PCPB 4J23A 3QNYB 1NC4B 3MLWL 4U33A 1QFWH 2KLTA 3B8YA 3QS3A 4EAEA 1HXMA 1DQDL 5C0CA 3CFJA 1Z3GH 4N2KA 4APXB 2EDLA 3GSXA 1BQHB 3NQIA 1TPXC 3IN2A 12E8L 3N1QC 1BLNA 1AQMA 1J1PH 2WCPA 4Z7UF 5EOCJ 5FLUA 2DV6A 1WAEA 4X6BA 2MSPA 5DZAA 3BLPX 1BQSA 1JVKA 3QQDA 3QW9A 3RWIB 5FO2A 5IROC 4KI5F 3RU8L 1UJ3C 1D7CA 4XB7A 1VADB 3QJRB 4F7KA 1CDBA 4E42A 5J06A 3SJVA 1N8OE 4FFVD 2NW3A 1SDDB 4NENA 4XCFH 1OPGL 4KUCF 5KYUB 1XR8A 3BKYL 5EF1A 3DI2B 4OD1H 4U4BA 5IVOA 5HYEA 2V3EA 3D18A 2X70B 5CS7A 5JPMB 3KD4A 4L29B 4MJ6B 4WEEA 3V4VB 2AEPL 5JR1H 3ULUD 4N0UA 4PRHD 1UZ6F 3TVMD 3VXRD 4JFDE 1BQLL 4PJGA 2JKSA 4PTTB 2OCJA 1TQBB 4HQQL 2OSWA 3S8WA 2TSBA 3UAAA 2BZCA 4FQHB 1M2VA 4OCWL 3H3KA 1B4RA 5DS2A 2CLRB 4FNPA 3WS3B 4DEPC 1JUFA 4LBAA 1JNNH 2VDQH 5DSCA 3TH2T 3MRFA 1B2YA 3QEHA 4OGXH 1WHPA 3NOIA 1S7SA 3QWRD 4Q0XL 1T0MB 4QD2E 4UUJA 2CBMA 4K4KA 1WRFA 5D7HA 3L4CA 4GW5B 4MX7B 5F2FA 4ELMF 2FYYA 2UXVA 2XZZA 3MRDA 3LKNB 3PHSA 3D52A 2Y25A 1JXFA 5I0DA 1M42A 5ID0A 2VQUA 4J3OF 1VDGA 2VDPH 4KTGA 4JO3L 3RHWK 1J1OL 1RZPA 1KZQA 3QDAA 1DEDA 4DO4A 2EE6A 2F1EA 4PRHB 1BEXA 1NMBH 4ONGL 1X5IA 5BZWA 4NPYB 1SEBA 4UAHA 4Y4HB 5FYKD 5DC0A 4G9DB 4KDTA 3O3BA 4LSVH 5CN3A 5IGXL 2X9WA 4XO9A 1AZVA 3DVIA 5I6XB 3TV3H 2PO6A 2Z31C 4M7LT 1EO8H 2JB5H 3CC5B 2HJKA 3SKNB 4TUOA 2QMJA 1U30A 1MZZA 4IRJB 3RVUD 2WYTA 4J4PD 1XBDA 3V0WH 1WDAA 3F5WB 1MWAB 1T2XA 2ZJSL 5FCSH 1JWMA 4M5YL 4PRDA 5MEND 3EOBA 3BSGA 4L3FA 5ILTL 2R51A 1CR9H 1QSFB 2E3VA 2YC1B 2F7PA 3CMGA 3KH4A 4XNDA 5DVMA 3APNA 5KSBF 5KG9A 4D0BB 1JYXA 5DK2B 2WXJA 3DX8B 4MZIA 4YDVA 2EO7A 3IDYC 3WFBL 1HHIA 3RYMA 2YPVH 4B5EA 4H7VA 3SY0A 2E9BA 4BWUA 2OW6A 3EJTA 3SE3A 5J1TC 2EUZA 1WICA 2ITDA 3OKOA 3KJ4B 1JWUA 3SYCA 4UNTA 2JVUA 3VI3B 2DY2A 4W68A 3EOAB 1F45A 3EGSB 2WIIB 1FLRH 2WBWB 3Q0HA 2QHLA 3L45A 3UDWA 4DKFH 5TDPB 3M1CA 3JWOH 1FCCA 2O5NA 4MXWL 4LL1A 3SB3A 2QJDA 4HFWA 1ES0A 3IAQA 4OZHE 5DFVD 1N9PA 2UWEF 4DJMA 5I18L 4H8PA 3UCQA 4O58L 3JV4A 1JF5A 3LEVH 4LAQL 5MENB 2W59A 1XGYH 1S7WB 4B0MB 3GSNB 4RDBA 1O5PA 1QVOA 3CFIC 1U3HD 3H55A 5CUSH 5E70A 5KJ7E 2IOOA 4P4KA 5LGHL 4NZRH 2W0LA 3K72B 4IIQB 2D2CC 1OB1A 5LAXB 2VSCA 2R56H 5L7XL 3A6BH 4NEHB 1WS8A 2DYRB 1CLVA 1E4KA 2AQ3A 4M8QB 3WENA 4BKSC 3A5VA 1O6TA 5FDWA 1PG7X 4NO0A 4O9HH 4CNIA 5D7LB 4RFEB 1OAUL 4YHYC 1HWGB 3OAZK 5IY5B 2CJ3A 4BXVA 4OV6F 3INOA 4M5ZH 2BXYA 5DR5H 3MRQA 3KPOB 4IBSA 35C8L 3FQNB 4WJ5B 5KVDL 5JYMA 1VFAB 1DQIA 2X4OB 3PP4L 3EJYC 3QA3A 4L8DB 1NL0L 3PUUA 3FU0A 5D1ZA 3RPIB 4F7MB 1QLEB 2XWTA 3WJMB 4HWNA 4Z0XA 2EYSB 4MMXC 1ZLSL 3FUKA 1OCWL 2YLKA 2J72A 3K5SA 3IDJB 4GRLD 3U0WH 2Z64C 1NCAL 3BD5A 5ANMB 3EBHA 3QNFA 3LHPH 3LKSA 4I1PA 1EZUA 2I85A 2F5BL 1RP8A 3VE0A 2X88A 1U3HB 2BNRA 5I74B 4CU8A 4GW4A 4KROC 5I6OA 2V5YA 3KH3A 3X17A 1P4IH 3MLPA 4D8OA 4B3VA 1BIHA 4OLEA 5HPMA 1KTDA 1Q1PA 4X2UA 4JO2L 3ASNB 3CXDH 5ICXA 2YEZA 3DROB 3FU7A 1S9VB 1PX4A 2XN0A 1YECL 2X2JA 3AWGA 4DQOH 3VFNB 1P7QA 4X99B 2DIBA 3BW9B 4X5QA 4ADIA 1QABA 2AJUH 3HKZA 5KW9H 4IBLT 4X0NA 2Q8AH 5FOBB 5BRZB 2LTQB 3REWB 3LKOB 5TK4A 4PP2A 2D3JA 1AHWB 5JZ7D 1E9OA 2CU9A 4UQBA 1CE6A 2EABA 4R97C 1FL6B 1XF3B 2IVFC 3MXWL 4CDGC 1U91B 5IF0B 4GRLB 5E99L 2WP3O 1HYSC 1IO4C 4PY8J 2IQAA 3MLZL 5D93C 2H2PD 5FC9A 2WNKA 3WBDA 2WBXA 2DQFA 3PS6A 3E38A 2FJSA 3GJFH 4YDZA 4UTBL 1D5MA 1LP9E 4K15A 2UX6A 4FQXC 1WJ3A 2HB0A 2HT2C 4DUWA 4ZPTB 1OHQA 2EO9A 2YHGA 3UIYA 1NGZA 2HRGA 4Q9QH 3NGBB 4WHTA 4WDIA 1WGVA 2YN5A 4P2QE 5IHUL 1IBGH 3OC8A 1KN4H 3TEYA 1KCRH 2NR6D 2E7LA 1K3IA 4NWUL 1U8JB 2VDNB 2CXKA 2CBPA 2HUHA 3ZDZF 3UBXI 2QKIB 4LASL 2GJZB 3MACL 1AHMA 3SO3C 3NSDA 1YC7A 3P54A 4F5CA 5FA4A 2E0PA 3QWQB 1A1MA 3VWKD 3TBYB 3EDKA 4NM4L 1YCSA 1BA9A 2GBVA 1UM6L 1F4WH 1MW2A 1SBBA 3EF7A 5I0YA 4HA1A 3AC0A 4FNUA 3MJ9H 2AV7A 2I26N 1FFNB 5AD0B 1Z7JA 3A6CH 4F2EA 1ZE3H 2EH8L 4BQCA 1J9CT 1YN7A 4JFFD 4BRJA 1AH1A 4G7SB 2BOLA 1NQBA 5E8NB 3X1NA 1AO7D 3TS8A 4UTBA 3U82B 3ARBA 3M1BA 2OR8A 3B4NA 1NGYB 2WIMA 2VUOA 4JFHE 3FTYA 2IFFH 1DLHB 3FH5A 5DD5H 1U8NA 4LVNB 1RFDH 4DW2L 3KGUA 4Z76A 3FDWA 2DLTA 4FQ1L 3WOVA 5EEXA 3UPRB 5T1KA 3N44F 5HYQA 1BIIB 5C0FA 2O6CA 4TRPH 4IMLA 1NKRA 3DIFB 3E6FB 4PLJD 5B3JE 5KSBA 4LKXA 4X6EB 3LQZB 3V4VH 3R8QA 4WNQB 4DGIH 4K3GA 4CU7A 3W37A 4J3WA 1KCLA 1A7QL 4EN3D 5JXEA 1S9WB 2J1WA 2QVTA 2R1XB 2CJUH 4XMWA 3X1GA 5JMRA 4B60A 3D87B 3VWKB 4X6CF 2A6DA 5GRXG 4AC2A 5D2NA 1L9TA 5CGYD 2GQHA 3BZ4A 3T2OA 1HFUA 2Z8RA 5AZ2H 5AVYB 1QSEE 2YAEA 2P5EA 2BVEA 1RZGB 4JFFB 5I1LA 5I1HL 3GPEA 3LDBB 3FXIC 2O5YL 4TNVK 4XMPH 1FYHB 1IEBB 3KWUA 4D0CB 1ROCA 2HVJB 1SY6H 5DXWA 4RZCB 4M6AA 3H3PH 3PL6A 4ODHL 4AGMA 3U1SH 1QASA 1AE6L 2RJMA 4ZNCD 4X7EC 4PJEB 3UJJL 2IV8A 2BP8B 2UWEA 1K4CB 3QDMB 1CL7L 2IAAC 2ZPKH 3FF8A 1IE5A 4PLKD 4ABUA 2NDFA 4L4TD 2X1OA 3GNMH 5JHAA 4F37F 1QHOA 3V2AR 5IG7B 2FO4B 3DSNA 3ZRCC 3CSPA 3HAEB 1WIUA 1XGTA 2NNAB 1JERA 1SJEB 4BDVA 1JZDC 4NKIH 3ULUH 1KCVH 4NJ9L 2A9AA 4OH2A 3TNMB 2IH8A 4KDTC 1HJBC 3HB3C 4H1LB 4KKLC 1GY2A 3BE1H 3KYKL 2PO6C 5H2BB 5JYLA 5F0LB 4OZGB 1OM3L 1AHKA 3LYRA 5ITBH 1KBPA 1FNSL 3MSPA 3QZNA 4HXBH 1T4WA 4K8RL 2AABH 4KV5F 4KRNA 4KO6A 1RUAL 2W9DH 2A9MH 4DCQA 4I4WB 4DZBA 2CKBB 2G3XA 1J05A 1L0PA 1A8JH 3LRSA 1A6TB 3HJEA 5DS8A 1FP5A 3FL7A 1LK2A 1M4KA 1MWAH 5BVJB 3H3BC 1LNUA 3RWJB 2VLJD 3GMPB 1KGJA 4GQQA 5G55A 3P02A 3FOMB 5MERB 2KDGA 2WPGA 3OAUL 1GRWA 1C5CH 4YXKL 2R0ZL 2XWBA 4P5TA 1UVQB 1C1EL 2VDKB 3ZXAC 4PJ5A 5DLML 1TSRA 2I24N 1IGYB 4YH6A 5FYKH 3SE3C 3VACA 1BHGA 3O6FA 5AVWB 4YUEH 2ORBH 1HESA 3MRRB 2Q8BH 1I82A 4OD3L 1N5AB 3U9PH 1QRKA 1WLHA 2XLLA 3UDWC 3T1FA 1NDGB 3KM2A 1H3UA 3PXHA 1MQ8A 3L5XH 3ET9F 4YGVB 3GIVA 2JFCA 4RGMB 3HN5A 2AQRA 3SDXF 3WNPA 4Z78B 1OF0A 4A39A 1MAMH 3N1PC 1A2YB 1ZDSA 2VLJB 3VCLA 3PP3K 4NQXA 5ESAB 1CXFA 5L2JB 1BPVA 1LJMA 1MRCL 4L8SA 5F21B 3GDCA 4P4KC 2GSMB 4XI5D 5B1BB 1HXYB 4IMKA 4O5LH 2QQKH 1DE4B 3I6KA 4UT6L 5D2LE 3FUDA 2X9XA 2LAAA 4QDGA 2AK1L 4WO4D 3VXTA 3KPPA 1VRSA 1RUPH 2DQCL 1JRHH 2IH1B 2WXHA 1E4KC 2I60H 1M05A 4UT9L 5EO1B 3IJ7A 4KX9A 3X1EA 2HX7A 1UXWA 3RURA 4DP5X 1XF2B 4LSTL 3TZVC 4P46B 1BOYA 1T1YB 4NX0A 4IEFB 5IREA 3EOYG 3QG7H 1FG2B 4OUUA 4PJ9A 3BVTA 1D7DA 4WWKA 3QRGL 1GOHA 2KLRA 5D1ZC 4E9QA 5H35A 1QLEH 2GB2A 2BWQA 4ZPVB 5CD3A 4NRYB 3TN0A 1FYTA 5E8PA 4BA8A 3MNVB 1BZQK 1RU9H 4EZKA 1OV8A 5DRZB 5G4NA 3GFUA 2I9TA 4JPSA 1QD0A 1QHPA 2F54A 2P43B 4PWJA 2JJTA 3EAKA 1T1XB 1UA7A 4EEEA 4UT6A 2VZ3A 3W39A 1GGBH 3HMXH 3LKRA 5AW7B 5J9PB 4KI5C 1KIUA 3CVHB 3DHMA 5FV2A 1XGZA 4PREA 4UT9A 3MV9E 3PWUA 4U6HA 1SOQA 2I27N 5KVFE 2HRHA 1A4JA 3BAEL 3MJWA 4Y5YB 1CT8B 3WE6B 1AD9A 3BZEB 1U6AH 4QO1B 1W0WB 1EAJA 3HC3L 3NVQA 5IB4A 1AC0A 3QC5X 5EEUA 5F9JA 5CEXA 1KPUA 3Q13A 1T5WB 4OZFB 3JUZA 5C0BE 5AW0B 2Z92B 5IBUG 2NXZC 5KOVC 5C0JB 1F6LL 4YR6B 3EH3B 5KYYA 3BP4A 4RMSA 1VSCA 3RFZC 5CN1A 1FNGB 4L3ED 5I66B 2NY6C 1MFBH 4AEFA 3VFUB 4DWHA 4ZI8A 4LSUL 5EU5A 4ODXB 3UIZA 1BMGA 1ZXKA 4JRXA 2J6WA 2K4AA 2E8YA 4PB0L 3J2PA 2X10A 3FQRA 3QZMA 4OGYH 2XIDA 5I26A 4Z3IA 1PZ5A 2YOCA 2IH3B 4HD5A 2PWFA 3CPLA 3IFLL 2GG1A 4OCYL 3ZDYB 2E7LC 3MBXH 4J3OC 4ODTH 4LEXL 2UXTA 4X5WA 1SLVA 2VDNH 1HNGA 5B22A 4G8EB 4YDNA 5IQOA 4RWYL 4JDVA 1KBGH 1RIVL 4NAJA 1CFQB 3WHE0 1IGJA 2WAHA 3RL1A 5TQ0L 1W0VB 3EJZD 1MJ8H 3Q2NA 5DT1H 3V7AE 5I2IB 2V7NA 5E7FA 3FONB 4Y1AE 4AENA 1BFVH 5IVXF 3MV7E 4L3EB 3QB7C 4ZW3A 4YO0B 2JIXA 4L9DA 1R19A 2PXYA 4FL4C 4X6DE 5B39G 1R5VB 4FNSA 4QHMB 2NCMA 1PQZA 3UC2A 3L7FA 4EIBA 3V6ZA 3ARBC 2DJ4A 1WV7T 4OFPA 1CGSH 4F8LA 1IV8A 1QTSA 4M02A 3UBXB 1ORQB 1F11B 5F1KC 5GRUH 4RA0C 3ISWA 1RLWA 4HZ1A 1BXVA 1L5GA 3BUYA 4O51B 3D0VB 4XZ4A 2O5XH 1NIDA 3F7VB 4NFBA 1CGYA 1WZMA 4NQVA 1QBLL 3HNVH 4RAUB 2D7MA 3PWNB 1AR1D 4XVJH 4WUUE 3APFA 2WLKA 3HHRB 4MS6A 3BPOB 4WFGD 4X4XB 5LVEA 1IX2A 5F0PB 2WWMC 2JKXA 4P5RA 2YXWA 3RDTB 1CS6A 2NY1D 4PBDA 5DUPH 5LNEA 1MJUH 2ADJB 4NC2B 1S7RB 2HZHA 5D2NC 4R2GD 3D51A 3QP3A 1BAFL 5K9JL 1AXTH 2AI0L 2KUTA 2VLLA 3L8QA 5KBNC 3ILEA 2NY7H 4JB9L 2VERA 1R24B 2BIIA 2IQ9H 3D69A 1IKOP 4UBDD 5AVZB 5K39A 4L37A 3HJ0A 4RGNC 3FUFA 2PYED 4RIRB 1TUPA 4P49A 1KYUA 5CEZE 1MHHB 3SDXA 5GGQH 1WA2X 2WM0A 4MRBA 3TASA 5LGJB 1RI8A 1JE6A 1BFSA 4PRPA 4KRPD 5F6HJ 2BVPB 2WXPA 1AANA 5GGVY 2AJVL 4FFTA 3S2AA 1LQBC 4P23D 1P69B 3HAEH 3K6SA 4GBXB 2DPKA 3DVNA 2EDKA 1UGKA 3P4LA 3ARFA 2HX9A 1VKXB 3T2PA 2NY1B 4FFWD 5F1NA 1XH3B 2XZCL 1YYMH 4LSQH 2ZX8A 1WCBA 3OKKB 4H1LH 1QFUL 4R2GB 1RK1A 3BGMA 3VI4F 1EVUA 1T04B 4G71B 3BAWA 3OWRA 4UQ3A 4N8CL 3GXTA 1HIML 1J9QA 5F3HA 1ZTXE 4CC0A 2CKBH 4IM8A 2ZUTA 4XPBH 3FB8B 3QIWA 3MR9B 4NFCA 4N0UE 5EHFA 5LXVA 3ARDD 4PJGE 2PYEB 4AJYV 4OGQC 5GRZA 3DGCR 3E2HC 5CBAB 4J12A 2E27L 4BINA 2PW1B 4XRCB 2X40A 4JFHD 1XWVA 5FKPB 4KRPB 4G8GA 4P5TC 1E5YA 4PJXE 1R5IA 2WMPA 4F8TA 2X05A 3TBTA 2VDKH 4P23B 1ZSDA 3TT1L 4G7YL 2RD0A 3OGCA 5GS0D 3RVWC 1HEZA 1GPOL 1KCSH 2NDGA 3HC4H 4FE9A 4EQ3A 3OAZH 1EFXA 1F8TH 3ULVD 1RZIB 1Z6JT 2Y69B 3EFDH 2H2SD 4QRPD 4BQ8A 1URLA 3RWGB 3C2SA 3JWNH 1XCTB 1N68A 5C0AA 1ZS8B 4Z7VE 1VPOL 3E3QE 5FS5A 1LO2H 4K8RC 5FW7A 3QJSB 1KBWA 1X4YA 1Y7VA 4JLRA 4TUJB 1AIZA 3UZVA 2AC0A 2DJMA 1ED3A 2D9CA 1IQDA 4UTAH 1RHHB 2PTTB 3ARDB 1GJWA 4JAMB 3EZ8A 4XX1E 1QSED 3FO9A 4LCIL 1U8QB 1E5AA 4FP8H 3REVB 5T5NF 4UINH 4M7JL 5LBGA 3U7WH 2N7AA 1BXXA 1XO8A 4L8SC 4MDIB 1IAII 2EE0A 4IMKC 1QA9B 2C7UB 3RY5A 5F7YC 3PRZA 3FMGH 2IPUK 1QX1A 3SGKA 2WBJA 5EDSA 4AMWA 2NT1A 5D72H 5D9SB 1OAKL 1V10A 1T0NA 3P1VA 4TM9A 1J9TA 1PLAA 4PVMA 3MV8D 1OTSC 3TH4T 3PGCA 1KIRA 4QRPB 4ABWA 4BFJA 2J1ZA 5ALCL 2JF1A 5EIQA 5GGRA 2XWZA 2PPAA 1KCKA 3UBGA 2J57A 3M46A 1JHTA 1BEYH 3FTXA 2EYTA 1CI5A 4PJ9C 1FG9C 5B8CB 2IWGA 1FL5A 2AJXH 5EC1A 4ICXA 5FUOH 2DD8H 5C92A 4PY7A 5B7MA 1UZ8A 4DP0X 5C86A 1TU2B 3P73B 5E1GA 3TN0C 1BBJB 1LXMA 3FN0L 5HVWA 5B1JA 3IU4H 3UERA 5ICYB 2X4QA 3I2CL 4U6XA 1F4XH 4U2YA 5IVXA 4KBPA 1UD3A 2OTPA 3VFVB 1XCQA 1CXEA 3HAEG 1OSYA 4PJAF 2JJTC 2CE6A 4J39A 5DK0A 4KZEL 3DETD 3EGXA 4ZMYA 1DJSA 5IQLA 3SKMB 5EF0A 1UATA 3CVHH 1WUZA 2GBTA 1IVLA 5IV2B 1QSVA 2FECI 1AKJA 1HQRA 2BY3A 1INEL 1KB9K 1M3JA 2NUPA 1PD1A 3OKYA 4IK6A 4P2RA 4JK0D 3MV8B 3GSVA 4G8IB 1XB3A 1EAPB 2DH3A 1OGPA 2F61A 3IFOA 4U7MA 3UTZB 2G3MA 1JTTA 4JBSA 2V2WA 3FT9A 1NCGA 4XGZA 5JHBA 3MYZA 4G6KH 2UYLA 1PZBA 2WTRA 2FD6H 4F2FA 2WKLA 3RP1A 2Y2WA 4OZFH 4JRFA 5EIIA 4X7TB 5FX3A 4G9FD 2CRIA 1B4JL 2V5MA 5TDOA 2BIHA 2AXFA 3BAKA 4M43H 1FGVH 4PLOB 4BKTC 3QDJA 4CDHA 1JZ5A 1X7SA 4JPIB 1S4IA 2LR4A 3MUHL 5IVNA 3KPQB 4HCGA 4S0TD 4HS6A 4BE6A 1NLBL 4H88H 3MBWB 3VXSE 4AEEA 2ZXWB 4LF3A 4PJCB 1TT6A 3TA3A 1JOIA 1U9KA 1JK8B 2R9HD 3PWJA 2VJXA 3TF7C 4PGCB 2FDBP 3BKCL 2IBZY 3C2AL 3RVVD 4N0YH 3MLUH 1NOFA 5AQ0A 1FNEB 2OZ4L 4WW2B 1YUHA 2A9DA 3W38A 3PABA 3BDYL 4JS7A 2XHNA 3A67H 3GMMB 4BK8A 5E0FA 1BQKA 3WU1A 1T2QH 3B7TA 3IFPB 5F9WC 4JHAH 4IJ3C 2FBJL 5DZVA 3W2DL 5J89A 1CJYA 3U2SB 2ZOTA 4XBPA 3DX3A 3S5LG 1ZGLP 4XPGH 1JGDB 4UI2A 3JUYA 1G7QB 1FH5L 1QRNE 1QEWA 1SEQH 4JR9H 2ZXGA 2Y5TA 2ZUSA 4G9FB 5IB1B 1H3VA 5EU6A 4L2YA 1I1FB 1A4KB 1CDIA 1H6UA 3J8F7 4L8BA 3FQXA 3SYAA 3VI4A 2VQ1A 3B3BA 3UGUA 1XGQB 2PXYC 3ESNA 1NUDA 2ILLA 3GSWA 5HGAA 1CYWA 2YS4A 1CLCA 1A3LL 3H56A 1I7RA 5DHEA 1HQ4B 2XC8A 5KVDE 1NGXA 2X4RB 5JHDA 3A0OA 2NSQA 4JDZB 3OQ3B 3AY4A 3WFEL 4XB3A 4YQXL 2ZSVA 1UZ6E 3FSOA 1ZLUK 4OCLC 4DSYA 1U2YA 2BOCB 1IGML 2OZ4A 2JXMA 4PJFA 3LEXA 5C9JB 4X4MA 1U3JA 2Z1KA 2NOYA 2DI7A 1S7XB 1IL1B 3E6HB 2EEAA 2WV3A 2ESVE 3LAFA 2W0FA 2L0DA 4QT5B 3X12A 1OXYA 3TEWA 2Z0UA 4OGAD 5GSVA 2GJJA 2HWZL 2B9BA 3S34H 2X5PA 5G5DA 3HZVB 1FCGA 4FQLL 4MD0A 5EA0H 1JFQL 5EBMA 3GTNA 4XP9L 3NEEA 1WEJL 2DLGA 5ANHA 4LOUD 3Q8AA 2PWHA 3SDAD 3WSQH 4FULA 4EXPX 3PLYA 2ZUUA 1NPJA 5KYWA 4Z77A 1YPZF 4E5XB 1CQYA 5JNYB 2ZZUT 1GCFA 1SRDA 2IH9A 1HXKA 1JGLL 2BVOA 2WGNB 1XBRA 2OAAA 4AQ8A 2ZXAA 5I23A 3NIGE 3Q2CA 4I5BB 2FEDD 3S4SA 5KVEH 2DEWX 3X2QB 3GF8A 1YMHA 5EO0A 3O2VH 1KJ3L 4KKNA 5D7SL 2VR4A 3D0LB 3OF6D 3IS1X 4XC3H 4XVUD 3MA9H 5DHVA 3QCVH 1J9RA 4OBRA 2EXWD 4R4BA 1T80A 5FO8A 4GAYA 3I3DA 4IQHA 3ARFC 5CJQH 4BK5A 5EU4A 3EYOA 3PIQA 3V0VB 2RACA 4Z23A 4J3BA 1JPGB 3NZHH 4MHHG 3TYGH 5B3NA 4PRIA 4MQXD 4JM2D 3BJLA 4P5SA 1FORH 2BSRA 4ZS7L 3ZX1A 2JCCE 2X0VA 5HDLA 3RWHB 4K3EH 3VFPA 1IIIA 1PLBA 5HGBB 3SDAB 4QLWA 1XHHA 2R0KH 1RUQL 3JZYA 1AGEA 4H13C 4L1SA 1UT1A 1F1GA 1GW6A 1F90L 2J2ZA 2CMRH 3LCYA 1ZT1A 3AG3B 1IT9H 3QIWC 4KUZH 4F3FA 3LY6A 4GKZB 4I88A 4EIZC 3KPNA 3PP3H 1DBKH 4HMDA 3BWUC 4R7DB 5E9DA 5H4ZA 1KFGA 2AQ2A 3LTVA 3M7FB 4YSQA 3SPJA 4RQQA 3PHAA 2EDHA 4XP1L 4HSQA 4DETA 1JJUA 4WFHE 5GJTL 2APFA 3OLIA 3EOTL 4NKDB 4S2SB 5AKTA 3RUGF 1J1XL 2P8MA 1BG9A 3JVGA 3IRZA 4KRLB 3B43A 4PJAA 5DUBB 3AS1A 5KJRL 4RAHA 4PTUB 3WO4B 2XWJB 4WEMB 8FABB 1LO0H 5AKVA 3E80A 2H26B 3EXJA 2SODB 5AYUH 4Z3FA 4UYQA 1ND0A 1A5FH 1IM3A 4KQ4H 1RK0A 3MROA 1T22B 5EBLB 1JZ4A 1SN0A 4JM2B 2UWEE 3TFBA 1JCVA 2Y5EA 2Z4QA 4I9WE 4GRWB 1R3JA 1A3RH 1EXGA 3SKOB 5IQ9A 1H6FA 5EIVA 2BSSA 1HSBB 4IBTA 4JZOB 2XPGB 3FO2A 2EUWA 2FCBA 4KZDH 1DCLA 1DQVA 5K9OB 4FLOA 3H2WA 5L4IA 3L4TA 3GSQA 1BOGA 3ZE0F 1IM9D 1J8SA 1K2DA 1M71B 1MJ7H 3IB4A 4EUPA 1D6EA 1BDYA 4XMZA 4UZUA 4YSEA 3VW3H 3MUZ1 2VM4A 2V2TB 2K45A 3T71A 1O6SA 2UX7A 3HOGA 4ETQB 2AEIT 4LL9A 3FSVA 4Y2NA 5DHYB 3V7MA 5E6ZA 4GSUA 4LSPH 1OAZL 4N5EC 4MD5A 4PGEA 1OQOA 4N2LA 4YIQA 1WUNT 5F1OB 1UWFA 1T5XA 3SGKC 1IRAY 1MCIA 2WBJC 5SWZA 5J13B 1WZ1H 5GS0H 1WSST 2FBOJ 3C08L 1FQ9C 1BVKB 4GXUN 5GSRA 4P07A 3ULVH 4Y2DA 4ZS6D 3AG1B 3CN3A 4JKKA 3H9ZA 2OCCB 1C16A 1MQKL 1SF3A 3QH3A 1DQLL 5B38A 4YSAA 4XB8A 5E2VH 3WFCL 4KDWA 3ZZSA 5C0NC 3Q2WA 4BELD 1U93B 4GP4B 4AIZA 2HTKD 3FB6B 3L16A 4ZD3H 5J6HB 5KS9E 3FNKA 4OJFH 5DJ2B 1MDTA 4LOEA 5B1JC 1A6ZA 2FJGA 4WY7H 3QJHA 4IOIA 3CIAA 1HNFA 4Z7QF 1X6LA 4ZOCA 1YY9C 2A6JB 2L7UA 5AW1B 1DQMH 2C9QA 3C60A 3VD5A 2E4FA 2VDML 2VN4A 1EJFA 3F65A 4OIFA 2AZUA 5LGYA 5DDHB 5K9QG 4O4YL 4QUOA 4Z9KB 4CGUB 2EIJB 4XP6L 4FG0A 2OXHB 5DQ9B 3H9HA 3WNJA 3MGOA 4ZW6A 2DQTH 4G5ZL 1E6JH 5E6ID 4ISVB 3O4OB 4JKNA 3AWEA 1TENA 5HHNA 4BFIB 4RRPM 1CU4H 4NT6A 3CZKA 3LKPB 5KN5A 4HZLA 4WUKH 2HKFH 4BCXA 4F7CA 1FVDB 2H8PB 4N85A 3MOAH 4FAAB 1CDUA 3QR1A 3BPCA 1CDCA 3BIBX 3GK8L 2WZ0A 3WMPA 3HR5B 4Q7DA 4LE8A 3BYYA 3NSYA 1BJ8A 4HKXB 3IXTA 3O6KL 1UD8A 3PAVA 3ZN6A 3B2UD 1UCTA 2JJWA 5C09E 4KK9D 3HVDA 4XPTL 3TA3C 4QKXB 3VFGH 3F00A 2D7PA 3LXCA 3O3EA 4WIQA 3MUY1 1KV3A 1YPZA 2QSCL 1NAKL 3P77A 4GAJH 5C0IB