4KOBA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kobA00
2H47C 2XX0A 3L45A 3WG7B 2J5WA 1NIFA 1ZDSA 3WIAA 1ILSA 2PPEA 3U25A 3DIVA 3X2QB 4AI7A 4KOCA 1HAWA 3GXUB 4GP4B 8PAZA 3FYEB 3CDZA 4Q8BA 5ANHA 3KW8A 2BW4A 4TXVB 1SHWA 2B3IA 7PCYA 5I28A 4DPCX 1GR7A 1R1CA 1E65A 2XV0A 2FTAA 1L9QA 1PLAA 1L9TA 2ZWNA 1T5KA 1SF5A 3NSDA 3OMNB 3T6VA 4N4YB 3EH5B 3FPYA 4A2FA 1OCRB 3GDCA 2IDFA 4DP6X 1A4CA 1PNDA 2R7EA 1BXAA 5A7EA 3OM3B 1NIEA 3ZX1A 1W6LA 1AZRA 1YLBB 1RCYA 1V10A 1TEFA 1SFDA 2UX6A 3NSCA 1OE2A 2DYSB 2GC7C 4Q89A 1OF0A 3ABMB 4HHGA 1PAZA 3NJFA 4G7QB 2RACA 5PAZA 1NIBA 2HLEB 2NRDA 1ADWA 5B1JA 2JFCA 4EF3A 4DPBX 1ET5A 3T6XA 2JXMA 3H4HA 1ASPA 1PCSA 4E9XA 3TA4D 4KO7A 3S3BB 2YXWA 1J5CA 2IAAC 3DKHA 4E9RA 2HX7A 3RYMA 1GW0A 4ZK8A 1PMYA 1L9PA 5B1BB 4W1TA 5B1KA 1AG0A 2YAOA 3PLYA 1ILUA 5AZUA 3FSVA 1ETJA 6PCYA 5B3SB 2PP8A 4HCFA 1KYAA 4CSPA 3FSWA 2BO0A 4WTQA 3NSFA 2DY2A 1FWXA 3NP3A 1AIZA 1QNIA 3CZUB 3PPSA 2EILB 2BP0A 2YAEA 1IBYA 3UAEA 3C75A 3HEIB 4YSSA 2OCCB 2IDQA 1ZV2A 4A2GA 2HRGA 3QJTB 2HX8A 4GXFA 2TSAA 1NPNA 2XXFA 4HHWA 1XB6A 2IDTA 2P80A 2MTAA 1JZJA 3NJKA 4KO6A 2HRHA 3TU6A 5AKRA 1GSKA 3FQ1A 4UAHA 3IBOA 1W6WA 2BHFA 3QJSB 1BQRA 2HX9A 3OQRA 4DP8X 4GY4A 1BYOA 1XB8A 2JKWA 4A68A 5B7FA 2YARA 1E5ZA 4KNTA 3MBWB 4E9SA 1A8ZA 1N68A 2YAHA 3UACA 3PXLA 5D4HA 2XV3A 1WS8A 2EIMB 1JVOA 5E9NA 3NJNA 1PF3A 4WKXA 1N70A 5I26A 3TBCA 2FQDA 4E9YA 1JXDA 3NSYA 1AZBA 4NAJA 1PLBA 1X9RA 1GS6X 3SBPA 1L9RA 1DZ0A 3WNIA 1B3IA 1PZCA 3UGEA 3T6ZA 3G5WA 3NT0A 1EZLA 4DP4X 3WNJA 2Y69B 5I5JA 1ET7A 3QQXA 1AG6A 1ASQA 1NDTA 3ERXA 4G7RB 1OE1A 4DPAX 4YSUA 4BK5C 3FYIB 2XYBA 3UAAA 3QJUB 1FFTB 3KW7A 2FQFA 5D4IA 2YAMA 5EHFA 4L0PB 1SFHA 1L9SA 3WKPA 4DP9X 2YQBA 3ZBMA 2X88A 2IWKA 4YSQA 1JZFA 1URIA 1ZIAA 4G7SB 3S3CB 4HIPA 2AVFA 1WA2X 4DP5X 2WO3B 2WSDA 3HB3B 4E9VA 5I6OA 4QLWA 3FU7A 1AS7A 2IDSA 4BWWA 4YSCA 3ASOB 4FA7B 1OCZB 2ZXWB 4F2FA 1NPJA 2UXGA 3EHBB 3FPXA 3SBQA 2TSBA 2FJSA 1KDJA 4E9TA 2FWLB 3QJVB 4JKNA 1VLXA 1AR1B 2BP0B 1KCWA 2CJ3A 1J9TA 3AZUA 1NIDA 2HXAA 2GC4C 1E30A 1JVLA 2IWEA 1RZPA 4F7KA 4BXVA 5I5MA 5F7AA 4ENZA 1I53A 1KBWA 1BYPA 3SBRA 3DTUB 1AS8A 1XB3A 1M56B 2CUAA 2UXFA 1AOZA 2CCWA 4KNSA 1A3ZA 4GP8B 1TEGA 2FT6A 1V55B 3IN0A 3JT2A 4KO5A 4GYBA 1DYZA 4P5SA 1A4BA 5B7MA 1TKWA 2DWSA 2DWTA 4DP2X 1BXVA 2XXGA 4UANA 7PAZA 1CURA 4YVNA 4NERA 2VW7A 4E9WA 3NJMA 4G71B 1PNCA 3FQ2A 3GYRA 4K9JA 2VMJA 1JXGA 3FSZA 2AZAA 3TBBA 3AG1B 1J5DA 2BWDA 3AW5A 1AZCA 1OV8A 1AZNA 4DP7X 1XMEB 4DP0X 4YSOA 2VM3A 3X1GA 4PAZA 4N8UA 1ASOA 2GHZA 5PCYA 2IH9A 2MRYA 3NJJA 2AZUA 4BXSV 2BZCA 3CVDA 2I85A 2VW6A 1NINA 2X87A 3PAZA 3NJLA 1M9WA 1QHQA 3CVBA 1MZZA 1IBZA 1SJMA 4KO9A 3X1NA 2GIMA 1SDDA 1AAJA 3FU8A 5B1JC 5LDUA 2PPAA 5I6NA 4YSPA 5B1AB 1JXFA 4CSZA 2B08A 2GBAA 4YVUA 1KBVA 2PCYA 3FU7B 2BP8A 3NP4A 4YSAA 1GY1A 2YAPA 4M3HA 1PZAA 3S3DB 2BWIA 1TU2A 1CYXA 2ZONA 3NYKA 1RKRA 1ET8A 2P80D 4JHVA 2UX7A 3QJRB 1SNRA 4G72B 1WA1X 1BQ5A 2YXVA 3JTBA 1BEXA 1JERA 2H3XC 4BDVA 4HCIA 3FQYA 3PAVA 3ABKB 3IEAA 4HZ1A 1GY2A 1SF3A 1GS7A 3EH4B 2XLLA 5AFAA 2J56A 6PAZA 1IUZA 3PCYA 3ZDWA 2QT6A 2XWZA 1WS7A 1NWPA 3AG3B 2FT8A 2YAFA 5FC9A 1KV7A 2CAKA 1W8EA 3FS9A 3AG2B 1CUOA 1PY0A 4BWUA 1ZPUA 3S8GB 2J55A 2FNWA 2AFNA 5I6LA 1IKOP 2FT7A 1IC0A 2W88A 3T71A 2EIKB 2FQGA 1WA0X 4E9QA 2PLTA 2YAQA 5TK2A 2H5UA 1AANA 2WO2B 1ZDQA 3D12B 3UABA 5I6MA 3TASA 4P5RA 1SHXA 1E5YA 1MZYA 1NIAA 2VN3A 4DP1X 4QKTA 1BXUA 3T9WA 2XX1A 2I7OA 5IY5B 1OCCB 3V9CA 4HAKA 1OOWA 2IDUA 4M4RB 4W9ZA 1HAUA 5B7EA 2IH8A 3WKQA 4YSTA 1GS8A 4A2EA 3NJHA 3OMIB 1M57B 2CALA 1JOIA 2EIJB 2Q5BA 3BVDB 1UATA 2DV6A 3OMAB 2J57A 3X1EA 1NWOA 2VSKB 1KCBA 3MX0B 2W8CA 4A66A 4A2HA 1SDDB 4AKQA 1CC3A 2XUWA 3H56A 2E86A 4JHUA 5TK4A 2PPDA 3WI9A 1JZIA 1MG2C 1A65A 1GYCA 2N0MA 2AANA 2BP8B 3EF4A 1X9UA 1J9RA 3H4FA 2QDWA 2HZHA 4AKOA 2UXVA 2UXTA 3AG4B 5F7BA 2CBPA 4A67A 4PCYA 1AQ8A 1NZRA 3AY2A 3BQVA 2XVBA 2XV2A 4AZUA 2VM4A 4YL4A 1ID2A 1JZHA 3N55A 4G70B 4X4KA 3FSAA 3X1BA 4BDVB 4MFHA 1RZQA 2I7SA 1BQKA 3IE9A 3OD3A 3CG8A 1AS6A 3CVCA 3ZIYA 9PCYA 1F56A 5I6PA 3T6WA 1AACA 3QJQB 1PZBA 4RH4A 2GI0A 2A3TA 4HCGA 3NJGA 1MG3C 3ABGA 1BAWA 1WAEA 1NTDA 4YSEA 1AZUA 1QLEB 1KGYE 2DYRB 4GP5B 3NJIA 4UF7C 4BWTA 1OCOB 4NB7A 2ZOOA 4FAAB 1A4AA 1EHKB 1MDAA 3CDZB 2QDVA 1CYWA 4YSRA 2OV0A 1PLCA 2PCFA 5I5IA 1ZIBA 4HALA 1HFUA 4A2DA 1E67A 1J9SA 4AX3A 3ASNB 4KOBA 2EINB 2PPFA 2VSMB 1JZGA 4F2EA 2OJ1A 1KDIA 3UADA 2QPEB 3ABLB 2LLNA 2XU9A 3X1FA 1OE3A 1V54B 5I6KA 2BW5A 3FT0A 3QPKA 2GSMB 2R7EB 2PPCA 3SQRA 1J9QA 2QPDB 2Y1AA 2PP7A 5D4JA 3EH3B 3N2JA 4YSDA 2BZ7A 2GB2A 1FA4A 1L9OA 2IWFA 4AKPA 2VW4A 4KNUA 2PP9A 2FQEA 3S8FB 1NICA 3FU9A 3PAUA 3V9EA 1JZEA 3IN2A 2Q9OA
chains in the Genus database with same CATH superfamily
3RIKA 5FUOL 4XN5A 3GIVA 5LUMA 1RZFH 3MA9H 4FP8L 3EO1B 3FT2A 4ATTA 4L4VA 5IB2A 3N9GH 1ZRUA 4OCNC 3IS0X 3KW8A 1HESA 3KBHE 4MNQB 4WU5A 5EIIB 5J6HB 1B0RA 5IVOA 4EI6B 5I28A 1KGXA 3D3VE 2Y25A 3HC0A 1QOKA 3V10A 3RY6C 3QHZL 2HKFL 4PRHE 1BDYA 3MUHL 3M1BB 3CFUA 4XMZA 1JV5B 1E4WL 2I07B 3LD8C 3VM7A 1UD2A 4PTTB 5FO9B 2WC7A 1KB5A 1SQ2N 2JE8A 4FERA 4Y2DB 2JIXD 3QAQA 4A7GA 3ESVF 2ZOLA 4ANXA 2XQBH 1CQKA 4FC3E 2DWEA 1C5DA 3V0HA 1E9QA 3MLSH 3NVQA 4PB0L 3ULSA 4D2NA 3BVNA 5LGHH 1UB6B 1TZ8A 4EBQH 3UGXA 4I5BA 5DUPH 3P3RA 4HUUA 4H44C 3ZTNL 1H3TA 4TULH 4KVCL 3HZMB 3DVNA 1JPST 1TFHA 4V33A 4U3XA 4H8QA 2QTVA 1HOCA 4YDKH 2CRYA 4JZNB 5MERB 2VDRB 4JG0H 2WZPD 4BZ1A 5EOTA 5FW8A 1TJMA 5TD4A 5DK3A 3V4LA 1X6NA 4OLXL 4WTZA 4KJQC 3RX5A 2WN2A 4FHJA 5HDQL 5CJQH 3OHXA 3WIHH 1I8KB 5F21B 5F1IB 2W0FB 3W57A 3VXRD 1OTUC 1IEAA 4XGZA 1J5OL 1S5IL 3TPUA 3F58L 4RNRA 1M42A 5DFAA 1RU9H 1N4XL 3ARBB 1YEIH 4HWNA 4U6XA 2P28B 1GGCH 4UI2A 5B1KA 5DD5L 5I1AB 2VE6B 1ILUA 4TQ8A 4DQAA 2A6JA 2WBWB 2SODB 4LGPB 4NRYA 3UAFA 1H3GA 3LDBC 5GISL 3MRKA 2WVTA 3TH4T 1M2VB 4XN2A 1YC7A 4K7PH 2NY3B 4M6OH 2VO5A 1TQUA 3LEVL 4L8DB 4ODHH 1JAEA 3UPCA 4Z78B 2EDLA 5D7EA 1IAMA 1A02N 1BZ7A 2QGBA 3FUIA 4QDGA 3PJLA 1XB6A 1MFDH 1UCBL 2ZOWA 3RVXC 1S2EA 3NJKA 3N40F 1ETZA 1D5MA 2XSKA 1F2QA 2CBTA 3FT2B 5IB2B 3Q1SL 5FA4A 1IGYA 1GC1L 1KB9K 5ANME 4L1TA 4WU5B 4ENEC 3PHOA 1XB8A 1I3RA 2CGYA 2E3VA 3OB0K 4XX5A 4GBXA 5DGQA 5EPMA 4KX7A 4AVJA 5E8PA 3RJOA 2KERA 3L4VA 1J1OL 2G9KA 5HHPA 4KNTA 1MFAL 4D8PB 4YOKA 2X2JA 3D30A 2WLHA 1KIRB 4M1GL 4JPIB 4GG8A 2SEBA 3OJVC 3BUIA 3DGCR 1JVOA 4HAGA 2QV2A 4BFIA 1FNHA 1KB9J 4KU1A 3HN3A 5AAWC 1RK1A 4DVRH 4GFXA 1FNFA 2ZOLB 4GUPA 1OSZB 2O5ZL 2R0LH 3T3PF 3W9DB 1OF2B 5DD1H 3ULSB 3BVNB 4L5FL 4KRPB 1DZ0A 1RIHL 1MQKL 3NK4A 4AL8L 1EHAA 3WTTA 3LQAH 3WNJA 1G0DA 4ECNA 3DVNB 3OL2A 2QSCH 3UROR 5HVWA 2DD8H 2F8VA 4B6ZA 2KC0A 4EUPB 1OE1A 1HJBC 4MNQE 1JV2B 3VFSA 5EOTB 5GJSL 5C3IA 2HT4C 2V5MA 4OJFL 1OW0C 1PL3A 2P43B 3BAJA 1LD9B 4L9LB 1K3ZA 3W38A 2J71A 1IE4A 3MBEB 4FZEL 4HLZH 4XAWL 5EU6A 3OHXB 5GGTH 1URIA 3BT2L 3PABA 5GJTL 5MI0C 4JQIA 2N7AA 4TSCH 4L8SC 1O7DE 1CR9H 1IEAB 2C3VA 4NKQB 4XGZB 1ZLSH 4JGJA 1FGNH 4WFEE 1FVCA 4U6XB 2IGTA 4F37K 5LLIC 1HSBA 3RFZA 3FU7A 2VT0A 5E5MB 2A6JB 4F2FA 1GPOL 2F54B 3X14A 3CXHK 4J3UA 3MRKB 5F8RC 4S1RH 3TVMC 4PGJA 2B4CC 5KVGH 5EEZA 2R0KH 4OZHA 3S2CA 4G7YH 1OT2A 3VI3A 2YD7A 2YR3A 1KCWA 1S3RA 4QNPF 3S37H 1J9TA 5D7JC 1BVKA 1MLBA 3MGTB 3BHBA 3GLZA 3RDTC 4OV5A 3P9MB 1T2JA 4CVXB 4ZNEE 4HUWB 5FKPA 2ARJQ 1E30A 5AW4B 1MI5E 5HJ3A 4P5MA 4N8CH 4L3EA 1J8KA 4MJHA 1ETZB 4UINH 3CXHJ 3ZKMC 4NBYB 1D5MB 1H3PL 2H26A 3ESPA 1YUKB 5FA4B 5E2WH 3HOGA 1TENA 3UC2A 3WGVB 5EPMB 4GP8B 3JT2A 5DEFB 4KROB 2AJXL 1DYZA 1TEYA 1A4BA 4NP4H 1DBML 4ZI8A 5B7MA 3ESOA 5I30H 4JREB 2WXOA 3KYOA 4N0FB 3GXIA 5EFIB 2VW7A 4FG2A 4GG8B 3ARQA 1R5VA 4M6MH 4RGMC 3WEXA 4ZFOB 4X4YA 5JW3L 1JXKA 4BFIB 4M00A 5ERWA 1AE6H 2EDJA 5AOIA 1DE4A 5IBLD 3A4AA 5IB1A 4K3EL 1DO6A 1OV8A 3UP1A 4A39A 4EXPX 5ICYA 3S36X 5AVSB 3ZE0B 4ELDA 2CUIA 1QLRA 4QRPA 1J0JA 3HZVA 4MA8L 4HBCH 3HS9A 1MAKA 1FCCA 3X1GA 4XNYH 1DO5A 3GBMH 5FYLL 3RNQB 4NKIH 1CFBA 3WHXA 3WN6A 4L4VE 4G6JL 1LO2L 4BQ9A 5LXGL 4YR6B 4Z7QB 1J8HD 3D0VA 3KJ4B 5I74C 1A4KA 5AW3B 2IFGA 4M8RA 1X7TA 1ANUA 1MZZA 3V0WL 3QUZC 3MLYL 1XH1A 4HW6A 4JCLA 5GIRA 5EU6B 3NEEA 1BP3B 5I6NA 4OLVL 3V55A 2AEWA 2C5DC 4J23A 4YSPA 1PG7L 4PBDA 2MCPH 2E76C 4OBRA 2C3VB 5DJCA 3VXOA 3RZCD 3L48A 4AEHH 1FVCB 4YDJB 5KYXA 3VE0A 3MJGX 1RI8A 3RFZB 2YA0A 3FU7B 2Z31D 2M2DA 1ETA1 4HFWB 5CEZL 1HYSC 3A0OA 1K2DB 2Q20A 4HT1H 3KPRD 3X14B 1F6AB 1KTCA 5CZRA 5BVPL 5B3NA 4AYFA 3MLTA 3I74A 2Z0UA 2A9ML 2PKDA 3CFBA 3KR3L 3MLWL 2VZSA 4OZHB 1SMDA 2WV3A 3FQWA 2EXTA 3NN8A 4WNSA 4XC3L 1FNSH 2RHEA 1ZWIA 5EBLA 1BVKB 1WA1X 1QVOB 4AH2B 4QXTA 5BV7C 2F5AL 4OV5B 4MASA 5FKPB 4P07A 5HJ3B 4P5MB 3SO5A 3WY4A 4NNPH 3NQKA 4RISH 3HAEA 3BYTA 2H26B 1FG9C 4KKRA 5MP6L 1AFVH 2D2OA 2ODHA 2XWZA 4JM4L 4NXKA 5DQDH 1O75A 1W80A 4HUMB 1UGKA 1JNNL 4BWUA 3LIUA 1I8LA 3A67H 4CL7A 3E6FA 1BFSA 4UBDD 4AXWA 5IUCA 4IU3A 5F44A 3ES6A 1HDMA 2CH8A 4I9XA 1ZJBA 1R5VB 3INOA 3WEXB 4X4YB 1U6AL 3GT6A 5K59E 2G5BB 2NR6C 1AD9A 1DE4B 4P2AA 3LKQA 5K9QI 3NG5A 3LHPL 2PMZA 3GUFA 5IB1B 1TTFA 3L2MA 3FBKA 4QRPB 2WWKO 5C7XL 2GPZA 2R1WB 3KYNA 3TBTA 2ICCA 2V37A 3ZY7A 1S7VA 2OMBA 4W9ZA 3F6JA 2YS4A 2ZUSA 4OBSA 4OLUH 4C54A 1I1FA 2EIJB 2ZF9A 3BVDB 2YRLA 1U8MB 3D0VB 1EANA 3Q48A 4JM2B 4G5ZL 4CJ0A 1IM3B 1A47A 2B0SL 3V52H 1IFGA 3CHRA 3WU1A 4EPSA 3E8UL 5DTFA 1KCRH 4N86A 2YPVH 2B4CL 5KAQG 2ZXGA 4FI6A 4OI9A 4XMVA 2O5XL 3VXOB 3RVVC 3H7BA 2BVEA 2WWNA 3CC5A 3JV4A 1ROCA 2VUYA 3VE0B 4IRZH 2Q3XA 2EQDA 5F2FA 2TAAA 1DDTA 5AVTB 2ZCHL 3FN0L 4NSKB 3ZE0E 3MOQA 3OLEA 3IAQA 4OB5L 3UO1L 3MLTB 4IS6A 5JW5B 2DQTH 4BFNA 1I8MB 1NBZA 3EJYC 5DVNA 4WI7A 2G75B 3RX8A 1ZWIB 5LNEA 2V5TA 3RPIB 2XBDA 2BWQA 3Q6FA 3BX7C 4QXTB 4YXLL 3CZJA 4DO6A 3GMQA 3BRFA 4OUUB 4WO4A 5E00A 3BVXA 3LYRA 1SEQL 1DBBH 2WYHA 3BUTA 2OXGB 2ZWYA 3OLGA 4WNJA 4WWNA 4Y2LA 3HAEB 5EU6E 1B0GA 5AWNL 1IGJA 1AACA 2LFEA 4LLMB 1P53A 3HZ3A 3JZ7A 1YAZA 1JWSA 2ED9A 3L7EA 4U1NA 4BE5A 1BF5A 1JRHL 4HCGA 1NBCA 2A4CA 2ORBL 4KKNA 4TVPH 5FYJU 4J6RH 3V7MA 1IBBA 5L2JA 4RMWA 4AJYV 2YD9A 2J7LA 4YPJA 3IGUA 4DEUA 1MDTA 3VFPA 5AB0A 4IU3B 4H7VA 3ES6B 3DGGA 3VTTA 3SDCC 4R7LA 1J1PH 1PBYA 3NCYP 5F9OH 1PDKB 4FKEA 4WW1A 5TE7L 1AD9B 2PW1A 3LKQB 4NAMA 3WBDA 3F05A 4PJFB 4L8CA 1X7QB 3MOAL 2EUXA 2WLMA 1E67A 3BPOB 3TBTB 4YHLL 4WW2F 4K8RC 4L3EE 5CEYA 5EEXA 4RFEB 1UXLA 3V8CA 4DAGH 4X9FA 1LLAA 2PTUA 4XHQA 2VQ1A 4X7SH 2ZX9A 1I1FB 1EFQA 2HWZH 1NCWL 1AIFA 2GSMB 1CFVH 2VIRA 3VXUD 4WW2C 3KEDA 2X0VA 1K5WA 3B2UD 2AQ3A 1ORQA 1I7UA 3H53A 3KYMA 3DHJA 1OZTG 3V7AE 4AKPA 1NDMA 1KC5H 5KVEE 3BVTA 1YQ2A 3H7BB 4ZMQA 4H8WC 1PVHA 3ATEA 3CC5B 3JV4B 4XMPL 4F9PC 4G8AC 1NGPH 5EU4A 1ZDSA 5BV7L 1FGVH 2PPEA 1H8NA 3SYPA 5KSVA 4Y9BA 1G1OA 4UT6A 4OD3H 1M6OB 3DURA 4IS6B 1AYRA 1FH5L 2M1KA 3HE6D 3LH2L 4NOFA 2EUZA 1NBZB 2LTQC 4GKZB 1SHWA 1BIIB 3N04A 4DPCX 1ADQA 3VXMB 1G4RA 4HWEL 3OAZK 2Y2YA 3Q6FB 1DBKH 3Q8CA 3VDBA 1OTSC 4X6EA 2FH6A 3CFKB 4WO4B 4FG6C 1T5KA 5E00B 3GK8H 5J4MA 3ATFA 1I1AD 4J6IA 1QUPA 4A2FA 3I6SA 3M7OA 3NOIA 4NN6B 5BRPA 1Q0YH 3RI5K 1B0GB 1IGJB 4OU3A 4U1NB 3FOLA 1JWSB 3L7EB 3T4AC 5I1JL 2C9QA 3UXFA 4MDIA 4HFUH 5L2JB 2IMMA 1WDAA 4HIEB 5DVLA 5HHMB 3BDBA 3LRLA 3CVIH 1HHGA 4P4RB 3DGGB 3LN4B 1QSEA 2HJFB 4GMTH 5CBAA 1IKNA 1SBSL 5FB8A 4JPQA 2WOBA 3G6DL 3VH8G 2YKLL 3BSZH 4WW1B 3WL9B 4MNHA 3TO4D 3MXWL 4M1DH 3MUY1 2H0PA 1U3HD 1MJJB 1CE1L 4L8CB 4KMLB 2H3NA 2JCCF 2EC8A 3V5KB 1CI5A 2O30A 5L0QB 1J5CA 1YRKA 2Q7AA 3DKHA 3ZDZB 2AJUL 1Z0MA 4N2NA 4C4KO 1GW0A 1SRDA 2X0UA 1NCJA 3CHSA 3FUNA 4JFHD 5DRZA 4O2FA 1KGUA 4R83A 4D3CL 2DM2A 1EHLL 4X6CA 4I77L 1PPIA 2VIRB 2PABA 1YEEH 2HKHL 3IETA 3FSWA 1CGXA 1IKFL 2DY2A 1ORQB 1OVZA 1QNIA 3OGCA 2EILB 4CA4A 3UAEA 3MYJB 1MRDH 3QUKB 2AQSA 2BNQA 3ILDA 4AQ1C 5LGKA 3P40A 4PJ7B 1FL3B 3QJTB 5AVWB 2R27A 3EKCA 1F6LL 5LWYL 3G6JE 1JZJA 1R4XA 1G9MH 4WV1A 1CL7L 3V6BR 4G6AC 4Z8FH 5DJXA 5J9PB 5DVPA 1MCSA 4JFXA 3L1OL 4GY4A 4CDGC 4MLIA 3X3FL 3PE9A 1T20A 3I6KA 2KZWA 2X4OB 1NMAH 4GIPD 2Z7WA 3VQLA 2PTTA 2WXGA 3W0WA 1UWEH 4KY1L 1NUDA 4JFWA 2EIMB 2Z34A 5FK9A 3QDJB 3HVNA 3GHEL 3E6HB 3UMNA 4NPYA 4ELMA 3PXJA 3EYQC 3NABH 5TGBA 1DQKA 4M5TA 3IGAA 4Y9EA 3FOLB 4AM0Q 4Y1AD 4XODA 4P5KA 4MDIB 4P4KC 3CH1A 4GRWF 5D2NA 4XO8A 2CKBA 5A3IC 3LKRB 4KRLB 1HHGB 1CDYA 4OCYH 5GRXG 4PJEA 3EOYG 1A3RH 3IJEA 5BJTB 4YLQT 1DJZA 2OMTA 5CBAB 4JJOA 4K8RL 3ARWA 3PRZA 5FB8B 5J0BA 1PZ5A 4RBPK 2X5PA 4YUEL 1MCFA 4K5PA 3MFFB 4MJID 2H3NB 4P06A 3ZBMA 3JWDH 5FGCB 3VI4F 4I0CC 4HGWB 1QD0A 1QZNA 3B3IA 4I3SH 5DUBA 4XBGB 1RSFA 1Z9PA 2JTDA 1JPSL 4UQBA 1QRNA 3RTQA 5DRZB 2YRBA 3EBAA 4YSCA 5ADPH 5DJ8B 3FPXA 1KLFB 5C0BA 4OLEA 4H8WL 4AYEC 4X6CB 1QPPA 1XIWC 2ALAA 4FFWC 4URKA 4N8VG 3IRPX 5F7YC 1CXKA 1MREL 4PJ9B 2FJSA 3Q0HA 3OGCB 2IH1B 4AW7A 2CJ3A 3MDJA 2BNQB 3TJPA 1OARL 4ONHB 3SYOA 4YDVA 4N9GA 1JUFB 4XI5C 5IFAH 4FFYH 1KTDA 5DJZA 4M6NL 4E0RA 3GSWA 4F7KA 5F7MC 5I5MA 4WV1B 2Y3NA 2WNWA 3MLZH 4G80A 2NNAA 5DJXB 5A16A 4AG4L 2WCPA 5FCUH 4RFNC 2W0LA 2Z93A 4JFXB 3ZDZE 4XCEA 2YPLA 2AXJA 2BIOA 2CUAA 1AHWB 1EAPA 3EDKA 2VDPH 4B9JA 4F80A 1P4BH 1T20B 3I6KB 3L3KA 4P5SA 1IAKA 5E8DL 5C0IA 1XL6A 3SDDD 4Y4KB 4LHUA 1TKWA 2F5BL 4W6XB 5TFSH 2PTTB 5C09D 3KPQB 3W0WB 1BZ9A 1CURA 2XXMB 4K5OA 4Y4FA 2P52A 1YDPA 1X5GA 4YGAB 2E7LC 5BRZD 4N25A 2BJMH 4NPYB 4V1DA 1U3ZA 1DFXA 5H4YA 3OKLA 5TGBB 5C0CA 1QBLL 3IGAB 4CC1A 1K85A 1DFBL 1NBVL 1XMEB 4P5KB 2W91A 5D2NB 1CICD 1XSOA 2WXRA 2P7TA 2ZD0A 4O9HL 2IVFC 1UXWA 2Y72A 1QR1B 2ADIA 3E2HB 1PX4A 2NY7H 3RPKA 2OCJA 1WV7T 2AEOA 2W60A 1N7MH 4LFHG 4ES8A 1JPFA 1A7RL 2VXTH 4X8XA 1XGQB 1SPDA 2BY2A 1EEYB 3IJYA 3S96A 3O9WD 2A6IA 2NY4C 4FQQA 1X4ZA 4M5SA 4KRMB 4B0MM 1VENA 1PY9A 2DL2A 3U1SL 4O02L 5FLUA 5GRJL 1IBZA 1L7TL 2AAVA 3W81A 1AAJA 3FU8A 3HS0A 4O58L 3KDMB 3FB6A 2N3JA 2HA1A 4UV7L 5FECA 4PJXF 1FZKA 3SGJC 2DYPB 1SYVB 2EYSA 4UOW1 3US1A 1PW3A 4GIAA 4HJSA 4ADJA 5DWPA 4FG0A 3RTQB 3ZXAC 1XTLA 4HKXB 3I75A 3HW7A 5K1VA 5JXEA 4M3HA 4HCRA 3O6LH 2JCWA 5HHXL 4IMLA 2ZYIA 1PZ2A 4HS8H 1E8YA 4RMRA 4H25B 1ZT7A 4P46A 3Q05A 3EHBC 2G3ZA 1QSEE 1VZHA 3C6LD 3F65A 3LPPA 3CLEH 4K7FB 2H8PA 4YDVB 2BRQA 2VLKA 4DQOL 4LRIA 3KHQA 2XN2A 4NUPA 1B4RA 5DJZB 3WFEH 3AM8A 3ZLQC 1C9SA 1MELA 4ADIA 4E0RB 3K0WA 1A5FL 4AJWA 1RUMH 4G80B 5EN3A 1H8LA 5DD0L 1AI1L 2CXKA 5FYKD 5IR1A 4NX0A 1RUKL 2Z93B 4OGZA 2LAAA 4XCEB 3U0TA 1EDYA 2FT8A 1VFUA 1EAPB 1BGXL 3L3KB 3SOTA 1IAKB 6FABL 5C0IB 3P2DA 1JHTA 1PY0A 1E42A 4PUBH 2J55A 2K70A 4I2XB 5AVQB 2WY3B 5EUOA 3WFCL 1JWMB 3MU3A 3SKJH 3TEZA 2IO5A 1NAMB 2ADJB 1BZ9B 3SIKA 4X6CE 4TN9A 1A66A 1J8RA 4RQQA 5IFHH 4Y4FB 2DQFA 4NO2A 3EDEA 5TQ0H 3QRGH 3CNKA 2NXYC 2L8AA 4V1DB 5DT1H 2WO2B 1R3LB 1WCBB 2BNQE 1E27B 5C0CB 5IJDC 4DHLA 2JLLA 3KPPA 1M2OA 4DP1X 1SJEA 4TQHA 3CK0H 3WTYA 2P7TB 1CGSL 4U6YB 3QO1A 1UXWB 5F3FA 3WN5C 2ADIB 2ERJB 1XH2A 5DQJA 3B7TA 1A1OA 2W60B 4PJIE 3SKNA 4L4TA 1JPFB 3FQUB 4LARH 4TTGA 1FYTD 1GS8A 2B5IB 2JLPA 4D7PA 1MRFH 3ZQWA 3TCTA 3S96B 2G5RA 2VXSH 3QIBA 4FQQB 4JX0A 4X99B 2K9UA 3MX0B 4O5LH 1QG3A 4P59H 1MF2H 1XR9B 3WS6A 1M7XA 7FABH 3D4YA 2AGJH 3KAAA 1CC3A 2IFFH 4HXAH 3WJJC 3FB6B 2Q8AH 4UQCA 3QI9C 4O51A 5FECB 2BVUA 1FZKB 3WI9A 4PWGA 5JDJA 4NYLB 2EYSB 3H85A 4ELME 2IF7A 2W5PA 2C9XA 1HH9B 3I75B 1A9BB 3VA6A 3T04D 4IMLB 5D2NE 1LDPH 5HI5D 3QISA 3MO1A 2ATPA 1KYUA 4UIKH 3GM8A 2Y5QA 3DRTA 5LBSL 4P46B 4PJEE 1NCAH 5D8JH 4DEPC 4ZFGH 5HSFA 3OLDA 2VJ0A 4JQXC 5AW2B 2H8PB 2VLKB 3ZT6A 3EH1A 4HH9A 3MV9A 4YGVA 1GIGH 2MQGA 1N19A 1GL4B 4HQQH 1RZ8A 2WBJC 3ZDXF 5L4FA 3HLAA 5IR1B 1WF5A 4P2OA 4R90H 5E6ID 1NDGA 1W91A 2GG1A 2HTLD 2VH5H 3CFJA 3U0TB 2EIDA 3ABGA 1QRNE 4CN6A 1IBDA 2E4FA 4CJ1A 5ALCL 2NT1A 3QVAA 2NY0D 4YO0A 5B4MD 3WTXA 1YEGH 2WLLA 3GZPA 4P8QA 3DJSA 5C0BE 4AQAA 1OK0A 1KELL 1Y18B 3FO0H 4YDLC 5IMMA 2B1OA 4S0HA 1DSFH 3T2NH 2H3KA 4RMBA 3KYKH 1T22A 4LEOA 5E95B 1IIKA 2R2CA 3P0VH 4PRID 1VZGA 1MCCA 3KPPB 4U49A 1VHPA 4PS7A 1NMBH 4KUCF 3RNKB 3QO1B 1FZOA 2OBGA 4UNIA 2PPFA 2VSMB 4EDWH 3H3PH 5IJKC 2X70A 4R5TA 1A1OB 1IQDA 3SKNB 1M7DA 1OPGH 4L4TB 1DBAH 3MJ9H 3PWLA 4UQDA 3X1FA 5I6KA 1WGOA 3NAAL 3L5JA 4LCUA 2F08A 3F04A 3WJLC 5BUGA 2YPLE 3TN0A 2RALA 1V3JA 4W4OC 2AJYL 1KCSL 2PPCA 4NQQA 3GSNL 1AP2A 4NJ9H 2GTWB 1NC4A 1NUFA 4KTGA 5GXBB 3HFFA 2FX7L 2HCZX 2O6CA 1IAIL 4CC4C 4PRPB 3KL3A 2FJGA 3ZE1B 2PP9A 2W0PA 2IPKA 3FC8A 4FQPA 1CK0H 2O5YL 5B22A 5JXAH 3V9EA 4V1DE 3CZSA 4I1PA 1T80A 2O26U 3N1PC 4JPKH 5JHDD 4KKBD 1NIFA 5D2LA 5C0CE 4FLQA 1TQSA 5BS0E 3PQYD 2X6CA 1ONQA 5DZNA 1AGDA 3VG0H 2BOBA 1WWAX 4R4NC 3C6EA 4FXKB 2DQHL 4NUGL 3DRTB 5CHNB 3JUYA 7PCYA 4DFHA 4Z18A 4XPFH 3IDXL 1R1CA 3QUMA 2PO6C 2IJ0C 4FQ2L 3WKML 4APQD 3EXLA 1P84K 4LF3B 1L0YA 5IROC 4M3JA 1R3JA 4XBMA 4HH9B 1IM9B 3O45A 4WFGE 4YGVB 3CN1A 4HWBL 4DGYH 1HL8A 4TRPH 1A4CA 2VDLL 5L9DL 3HNTH 1U8LB 1NDGB 2EEFA 3CFJB 1USQA 2K1MA 1V10A 4P04A 2Y0SA 5EBWA 1P84J 1SFDA 2UX6A 4PJHA 4YO0B 2EO1A 1U0QA 1QTYT 3ARGD 1LJMA 2WLLB 3NJFA 4JFQB 1WBZB 1R17A 3FTUA 5GSRA 2CA4A 4AQAB 5C97A 3OAUL 1A64A 4YNYA 1UOVA 5IMMB 4NUMA 2VDKB 1NUNB 3I50L 4K3GA 5IGXH 3PG2A 4LEOB 2ZXDA 3CD4A 4QT5B 3ESMA 4NO0B 2H45A 2VLKE 4KKCD 3VDAA 3CU7A 2WVSA 5M95B 2AXFA 3D87B 3DO3A 3DC0A 1FZOB 5DA4A 1BIHA 1XGUA 2VYRE 2X70B 1IQDB 4ZPVB 1DVTA 1DBJL 1M7DB 4XO9A 1UT9A 2BMKA 3V0DA 1HZHL 4N3TA 3PWLB 3EJUA 3BWSA 4JHAL 4OCSL 1SEBA 5A43C 4LCUB 1S8DB 4B9ZA 5GS0H 1KZQA 3MCG1 3TN0B 3JYCA 1PLGH 3VWKC 1WCQA 4ODTL 1FDLH 3GMPA 4HJ1A 4PV9A 1QBML 2HLAA 2IPTL 3HN5A 2BO0A 4D9LL 2OLDA 3T0ED 3V6FA 3NSJA 4Q7DA 5EUOE 1YSOA 5LB1A 1T21A 1NC4B 1Y6MR 3VGHA 3HEIB 1WP6A 2OCCB 1XEDA 1BM3L 2FJGB 4K94C 1BWMA 2TSAA 1NPNA 2IPKB 3UCQA 2YC1A 4OLWH 5FFOA 1LP9A 1XZWA 3CXDL 2P80A 2FSDA 3GZOA 4FQCL 5D2LB 5F1OB 1JPEA 5A40E 1ONQB 1JZDC 3FT4B 1WIUA 1AGDB 5GZOD 2BOBB 3FF7A 3HBGA 4QRSB 1S9KC 3TJHC 1FYHB 2ID5A 4LL9A 3FQXB 4KX8A 2OL3A 3AGVA 1FORL 2GBTA 2VLRD 3ZOAA 3FTSA 2X4QB 4H20L 3RU8H 3HKZA 3QUMB 3Q1EA 3ZTJH 2ZAHA 2J20A 1UACH 4JDZA 1R3JB 2CGRL 1E4KA 2YAHA 3O45B 3CMOH 3FUDA 4XWOC 2ZUYA 1LO0H 3QJFA 4M62H 5E9NA 1U33A 5GS1C 3MREB 2IBZY 2XHNA 4KHTH 2CLRA 4CADA 4AYSA 1F3RB 3UBXA 1DJXA 2QFRA 5JOPE 1INEH 3ZR5A 3INUL 1FL5A 4IRJC 1OGPA 5BZDB 1TTGA 1KTLA 1MJ8H 1FO0A 1CYGA 4PJHB 1YPZF 3AC0A 3F12A 3NGBB 1R3IL 3UTPE 5BRQA 3IVKB 3BKCL 2WGXA 3ERXA 5GSRB 4CVUA 2XKNA 2B2XL 2H6OA 3QJUB 4MXVF 5HTSA 1FCGA 1QX1A 2XTJD 1JYNA 2R2EA 2ICWJ 1E9OA 1OP9A 5FHAH 1H6FA 3QCUL 2AXFB 1Q72L 3MV9E 1GTFA 3JT0A 5DWUH 4FNLH 1GJUA 2VDNL 5DS1A 3BKJH 1XGUB 5E4AA 4ZTOL 3MV7D 4XCFH 4LVOC 1ROWA 3AABA 2BMKB 1ZLVH 3A21A 4GSDH 2KLTA 5F6HJ 5GGVY 2ZWKA 2UXGA 2GJ6D 4HP5A 4KZ0A 4XNUL 2HJLA 2UZIL 3LTVA 3GMPB 4PV9B 1CQYA 5I1CL 4ZZKA 1L3WA 4AC2A 2F58L 3QJVB 2ZAGA 4GS7C 1T21B 4FRWA 4OT1L 3QWOB 1SJHB 5E1HB 2VDRH 2CCVA 5JLZB 4LIQE 2CMRH 1SUHA 2XZZA 4LSPL 1U42A 1G0YR 4N1HB 3T77A 4B41A 4K5MA 1JN6A 2YC1B 4FTVA 2HXAA 5JPMC 1VEPA 5IB4A 5SWSE 3PIQB 1LP9B 2NXZB 1YN6B 4QLRA 3UDWC 3G5VA 3IDIB 1KGIA 4Y5XC 5KSAC 4ENZA 4LASH 3JBG7 3DETC 1DQLL 3LQZA 1Q9WA 2ZNXA 4BQCA 3GC3A 2Q2EB 3ELAT 1SVCP 2OL3B 2GAZA 2WQUA 3SY0A 4IGBC 3ZKSD 1CXHA 2HPOA 4KY2A 4X6FB 4EN3A 4I89A 3KPSD 3UZEA 5IM7A 3QDAA 2NY1B 2X09A 4DKTA 2P24B 4JDZB 1UA6L 4QOKD 4X9HA 3QXTA 4DKDC 4M29A 1UM4L 3QJFB 1JGEA 1S7UA 5HJDA 2VDMB 3Q2NA 4OIIL 2QSQA 3UAJC 5L7XH 4Q9RL 3G5XB 2CLRB 5EH1A 4CADB 2XWDA 1HL4A 1M4KA 4X42A 1AZNA 1FL5B 2KPNA 2MOVA 5JNYB 4KJWC 5AOJA 4F8TA 4JO5A 2KLSA 1KTLB 4X0KA 1U8KA 4WI3A 2GSGA 1WITA 3PL6D 4S1QH 1PX8A 2DDQH 3F12B 3BVVA 2IH9A 1ZEAL 4PVMA 1E4JA 3GBNL 2DAVA 2WVVA 1BJ8A 1RJLA 4JKMA 1U3JA 4XP6L 2L3BA 1GOFA 4O4YL 3F6IA 2R2EB 1R9FA 1TQCC 3T09A 1SJMA 1E9OB 5KVDE 3Q7JA 2VR4A 1WZAA 5K9OB 5J1SC 1NCCL 1ES0A 3N44F 3QXAB 3P11H 3B5HA 1AMYA 1KBPA 2CBMA 4WUKH 3ZVVA 3A6BL 2GW5A 3EYSH 4TL4A 3A47A 5HYJA 1SXSA 4K94L 2EDRA 3IKKA 2XG5A 1UQSB 1N2RA 1M05B 2HJLB 4LKCA 3HB3C 1CYXA 2J1XA 1JZ7A 4G8EA 2X3AA 2WLIA 4ZZFA 3T8VA 4Z7WA 4P2RB 3V0IA 2R2BA 5F9WB 1DANU 3S36H 4EUPH 3WSQH 1T0OA 1NGQH 4QIRA 5FLVA 3DVGA 4I9WE 1GKOA 5KOMC 4ZFZA 1DP0A 3T77B 3RAJH 2Q8BH 1JN6B 4FTVB 3IDUA 5IB4B 2MNWA 1PAMA 2XI9A 4RSVA 3KS0J 3U2IA 3W1ZA 3G5VB 4P49A 4PJDA 4PFEA 3WFDL 2FWOA 1W0VA 1D7CA 1Q9WB 4YEEA 2JB6A 4LSQL 2VRKA 3GF8A 4PG9B 2GAZB 1WT5A 3RVUC 4N2GA 3RVWC 1XSIA 2JIXA 3BQUD 5CP3A 3TZVB 2E46A 4EZLA 4WI0B 3QUXD 1OAZL 5MENE 3ETBJ 1CTMA 2BFVL 2H6UA 4XNQA 1S7UB 1UOLA 5IHWA 4PB9L 4Y5VA 2YAQA 4JNXA 1L6ZA 5CSZB 3C5ZD 4P5RA 3SE3C 2FEJA 3FT3B 4E41A 4OIFA 3NIGB 1LMKA 1WIPA 5JHLL 3LB6C 4M7JH 1LP9E 4POZC 1HH6A 1U8KB 3F2LA 1MW3A 2GSGB 3MN8A 2LVEA 2ZKWA 2IBBA 2HPTA 1F2XK 1G6RA 2WM0A 3PU7A 4F91B 4DEWA 1TCMA 5C1MB 4PJ5E 3NJHA 5KW9L 2WVVB 3CHPA 2Q5BA 1RJLB 4J2XA 1PZDA 3VXRA 1T7WA 3L95A 3HHMA 3NJXA 2V0AA 3NA9L 4FNUA 2C3GA 3IPBA 5HHOD 5IWLA 4U0RC 3BKYH 4CAGA 4WDIA 1XGYL 4QYOB 3P0YH 3KJ6H 5DC2A 5E6RB 1O6SB 1M71A 4UTAA 1OL0A 4F27A 4B9CA 4FQJL 4PLJD 3FONB 2AANA 2Y5TB 5C0NC 3AUVA 1CFTA 5AOZA 3KBEA 3BUBA 4ISVA 4KKAC 1N2RB 2ED6A 2EIZB 4B3VA 4LKCB 3ZKNC 4PEEA 1DVFD 1TXKA 5F7BA 5KEZA 2AK4D 2CO7A 4FQXD 2ZUVA 3BO8A 4IJ3B 4OR1A 4A67A 4DSYA 5EU3A 5HGBA 3OKDA 2R2BB 5I8EA 5I18L 3IPFA 4HUXB 1OD9A 1LILA 4AYMC 1GW6A 3DVGB 3ZYJA 3VI4B 4XXWC 4ZFZB 2ZAIA 3QZWG 1X4YA 2WYIA 3V0EA 3TBYA 4A6YA 2VO8A 4OLYH 2WW8A 1P7BA 3TF4A 1HIMH 1NLBH 1AS6A 1DJYA 3NZHH 2VN5A 3FB5B 2G30A 4PJDB 3VG9C 3ARDA 1W0VB 4PG2A 2DM7A 4NI3A 3P3TA 2DH2A 1GZHA 3MGOA 4RRPG 5JHMA 3Q2LA 4N2FA 4NS0A 1A1MA 3FTWA 4WKZB 5CBEA 5IVNA 3PWUA 2WKOF 4G6ML 1PSKH 1R5WA 4Q2ZA 5IQMA 2ZWSA 1J0IA 1NTDA 2D7MA 2JIXB 4KVNH 1AH1A 1NAKL 2DQCH 1AZUA 1DQVA 3B1UA 4KX9A 5EV7A 1EEQA 1OAJA 4HYTB 4GO9A 2R29H 4EVNA 4XNQB 3OKYA 3IXTA 3BP6A 1A4AA 4Y5VB 4BSVB 4PJBF 4JRXA 1UWGL 2P4AB 2AQ1A 4A2DA 1QO3B 4IK7A 3KGUA 5BO1H 1MH5A 1JZGA 1D7DA 1E6OL 1T89A 4BKSC 2YUXA 5HYIA 2BNRD 4ABQA 4KUZH 3VSQA 4F20A 4MNGE 2D31A 3CC1A 1ZSDB 3OGOE 4P9HH 4PRBB 5D7KD 2DS4A 5JR1L 3FMGH 3VXRB 4FZ8L 3L95B 3ZO9A 4JZJC 4GG6F 1QSZA 3AWFA 3ZUCA 2PP7A 3BEVB 3EH3B 4Z95L 3L2NA 1UH2A 2M83A 3OAYH 5ITFA 5KVEH 3BMVA 3C2AL 1B0IA 3EDFA 5CEXB 1EJOH 2VW4A 5D1ZA 1LDSA 1NM9A 3CLFH 3ETTA 4OKDA 5DMGD 1T83A 2PF6A 1VA9A 2CQVA 3IGKA 2WB7A 1RL1A 4RZKA 3WNNA 2H47C 4IU2A 1NLDH 2YUZA 3PP3K 4UQAA 2WXMA 4B50A 1CFTB 4ELKA 1VKXA 3NIGE 8PAZA 3OKKA 1ZV5A 4J12A 2JK5A 5ANHA 2UZYB 1NGYB 2CO7B 4Y9GA 1CLOL 5HGBB 2PWGA 5I8EB 1ZLWK 1E0OB 2R56L 3QGVA 2GHWB 4YDNA 4XMKL 1L9QA 3IF1B 1F13A 2FUQA 4W9EC 4YFLI 3TBYB 4A6YB 2APVA 3NSDA 1TMQA 4Q9CA 5IFJA 4MZ2A 4K9EH 3MJ8A 3OZ9H 4EMZA 2Y6SC 2WK2A 4XNBA 4OVVA 2XFGB 1GMIA 3D85D 3HC4L 2FEDD 3HKFA 4XXCA 5D7LA 5D72L 5ALBH 3MGOB 3QORA 2J6WA 3OG4B 1IFRA 3DOSA 3SE4A 4GQ9L 1UOKA 4JW3A 4EQ2A 4Q2ZB 1R5WB 2CJUH 4PJCA 4Q52A 3K91A 4XP5H 4KDTA 4BFBD 5J11C 1ZA6A 5HYJE 4QCIA 1BZDA 1QEWA 4OGXL 1FFQA 2YXMA 4XNZB 3AS2A 1HTYA 4IRSC 3AXLA 3RQ3A 4MS8D 3IXTB 4Z7WE 3UG5A 1MHEB 4EE2A 4A2LA 4Z7VF 4E9XA 3LRSB 3RY4A 3TA4D 3E7JA 3TV3H 4XT1C 5EEYA 1QFOA 2IAMC 4PD4K 4OZIA 3IFNH 2JKNA 2APFA 1MH5B 1CIUA 1J8HA 3PNWA 3HAEH 4J4PD 4D9QD 3EYUH 4PJDE 1CLYL 1CU4L 1P69B 5AG9A 1JZ8A 4GAFB 5I1GH 5HHNA 5LAPA 2D31B 4XPGH 1X7SA 5HYFA 1RZJL 2VM9A 4TUKL 3QNZA 1U8IA 2PP8A 3VXPA 2I26N 3BC9A 1GA2A 2HVBA 4PD4J 2W0KA 5CD5D 3LIZH 4JN1L 3QPQC 1UZ6E 1H3VA 1UWFA 2HRGA 3KPRA 2ZCKH 1U93A 2NQCA 3QT2A 4IU2B 4N28A 4ODVH 4E41E 4POYA 4ELKB 2YEZB 1VKXB 1GSKA 4KV5E 5DK0A 2D7TH 4H0HB 3QJSB 4OFKA 5E9DD 4CSSA 5C8JA 5FOBA 2Q3ZA 3FQRB 5E0FA 3LQAC 1FRGL 3AB0B 1E5ZA 2V9TA 4JR9L 4LPCA 3UJJL 1GOGA 3LOWA 4TV3A 5GS2H 4HULB 5I8OL 3LXCA 5JMOC 3PXLA 4CU6A 4HEMA 5IFJB 2I60H 2R1YB 2B14A 4OKVA 4FCHA 2COVD 3K2KA 1J9CT 3HIZA 5AVYB 3RUGF 1JNLL 5LQBL 3SDYL 1NEPA 3NZSA 3PP4H 1RZIA 3DOSB 1PD6A 4H2CA 4KTYA 4AZ8B 3MLRH 3QEGH 4PJCB 1CVRA 2VABB 1F90H 2L04A 1ZA6B 3M8OH 1UKSA 3IRZA 4QCIB 1QEWB 4IHOA 1VERA 1GGBL 1N26A 2CO3A 3IFOA 5D6CB 3BE1L 4R0LA 4M5ZH 2OR9H 4LLWA 1RZFL 2CIIB 2C1OB 5D4IA 3FBQA 3MA9L 1H3UA 1YZZA 3N9GL 5D5MA 3ZDXB 4X7DC 4HETA 1OT1A 1OB1A 1EXHA 4XP1H 4Y5YC 4OZIB 5EB9A 1J8HB 2XQYK 3WNLA 4LLDA 3ECUA 3ROLB 5I6OA 4KXDA 2EEDA 3C5JA 4U0QB 5HHNB 1FLRH 1ZLUH 1O9WA 5IREA 4QAMB 1A6UH 1N0LB 5ISZD 2Y3AA 5DXWA 3NIFF 1U8IB 3HRPA 3VXPB 3VMNA 1JFHA 3KLAA 4BRVA 5IHUH 3RZCB 2TSBA 4LOEA 1JIBA 2EDDA 2XQBL 3DUHA 4ILDA 4ZOCA 2Z31B 3MLSL 4K3DH 2CPCA 2JKLA 1PJWA 5LGHL 3N1MC 4EBQL 5J57B 2HT3C 3KPRB 2XNAA 5DUPL 2QKIA 1TIUA 3SJVA 4MMXA 3GJFB 3DV6A 4PU2A 1ZTXE 2X9ZA 3QAZC 4TULL 4JRXE 5JPNB 2B8OT 4YDKL 43C9B 4HS3B 1OM3H 4JG0L 1PZSA 3RWIA 1H3XA 3DTUB 2DBLH 3VXQA 3QUYD 3Q5YA 1KJVA 1HCYA 2GIYA 5CJQL 3WIHL 1KULA 1JMZA 1BZQK 2F8OA 2ZUQB 4JJ5A 2R2HA 3ILEA 3IJ9A 4KTEH 3AS3A 4ONOA 1FZJB 1FG2A 3GKWH 4JG9A 3D52A 1VDGA 3VJ6A 2XVLA 5D96C 3BH9A 3C9NA 2UUDH 1RU9L 1YEIL 3MCLH 3GYRA 3D2UD 1GGCL 4HDIB 4S2SA 3SD2A 1F1GA 3TBBA 1XSJA 3JZYA 5H2BA 2ZNWA 1P7HL 5CZKA 3L16A 4DP7X 3SKOA 4K7PL 4M6OL 1QW8A 1LEIB 4ODHL 2KDYA 4Y16D 4IHOB 3BPCA 4Q0XH 1E5UI 1JF5A 3IFOB 3LEXA 1D2OA 1KXQA 2XICA 3R18A 4WK2B 1MFDL 3B9EA 4G7VH 2E9IA 2J5LB 5C2UB 2RTTA 3PAZA 3KPTA 3DYMA 3T3ME 3KGSA 4LLWB 3K71A 1NCBH 2CDEA 3IM1A 3GHBH 4CBZA 1S9WA 4HIXH 2BSSB 3U7YH 1CCZA 3GMMB 3MRFB 1A6ZA 3ULVD 1OB1B 3EJZD 4FFVD 4LCWA 1J0ZA 2F1EA 4PJ6A 4BJLA 2F8IA 1O7VA 4B60A 3MRBA 5KTEL 4GAYA 2VDQB 2Y06H 3MVSA 4N0RA 1VCBC 3UTTD 3SYAA 3GMLA 3VXUA 5IP4A 4CGUB 4P99A 1KBVA 5LNDA 5IVXE 3C5JB 5EF3A 2EO9A 4WSJA 5D7LE 3G6AA 2A4EA 1GY1A 3MUUA 4FXGB 2NSQA 4KK8D 4GFTB 4QHKJ 3D3VD 4PJCE 3KLAB 4TOYH 3T08A 4DVRL 5HPMA 3TLRA 3BW9A 3S34H 3NFNA 2R0LL 2GVYA 1A1NB 5E7BA 1G43A 1T2XA 5DD1L 5LDSA 1SVZA 3E9UA 3DRQB 3HRZC 2EADA 2XNAB 1CXFA 2QKIB 2NOYA 1U91A 2ZZUT 3VCLA 3BN3B 2ZOKA 1EFXA 3RPIA 3LQAL 1Q38A 5T3XL 2QSCL 4Y8DC 4E68A 2AEPH 4OQTA 2DD8L 4PVNA 1IUZA 2KL6A 2PWDA 4XVOA 4YC2B 3WMPA 4BCYA 3AUWB 3QRLA 3N1GC 3G08A 2X12A 4OZIE 2K7PA 1GAFH 4HX1A 1B6DA 3L5HA 1J8HE 4G42A 4FE9A 3VXQB 2EC9U 3KNBA 5CGTA 1KV7A 1I1AA 2AJZA 4NNYB 5GGTL 4NQSA 1C16A 4M8VA 5HD8D 2LLGA 5D6DC 3W37A 2WMPA 4TSCL 3BZFA 1FG2B 2BERA 1CR9L 1ZLSL 3VJ6B 2BSRB 3EJPA 1MRCH 3OKOA 1FGNL 4LSTH 4WGKA 3QZNA 3BH9B 3C9NB 3SPVB 4E9QA 5A2BA 1LVEA 4FDWA 4S2SB 4ZMLA 5FM5O 4WFHD 5D1XA 2Z3FA 1D9KC 5DMYA 1XMWA 4I3GA 4KK9D 5C9KA 4AEIH 4S1RL 3RGVC 5AZEH 3NFPA 2ZX7A 2Y22A 5KVGL 5FW6A 2R0KL 4WWKD 4G7YL 3QIWC 4MCYA 5B8CC 1MCPH 3VU1A 3BMWA 3NRFA 3EOAA 4ZSOE 5KSBA 3TO4A 3S37L 3H9SE 2NYYC 1HAUA 2IH8A 3R7RA 3DUUB 4FYTA 3LEXB 4AJ0A 1KGJA 2WWOA 3BDYH 4GSQA 4MHHI 1MWAA 1UYWH 3BVWA 3OMIB 4U4BA 2CALA 1FE8H 4N8CL 3FQ4A 2J57A 3K71B 1F58H 4MTMA 4UINL 3WE6A 1O6VA 3BZEB 2JI2A 5JW4M 2WTOA 1CFQA 2ICWA 5E2WL 3NK3A 4H1LA 3U9PH 2NLJA 3RX7A 4AWJC 3AQDA 2EYTA 2QR0B 3I3BA 4HEME 3MRBB 4GAYB 4NP4L 5KUMA 3EBIA 3GMLB 3O8XC 3LKPA 4UU9A 1A65A 3VXUB 5I30L 2XZQH 4JFOB 1KJ3H 4ES9A 1HHKB 3E80A 1GYAA 4APXB 2HZHA 2AQTA 4M6ML 4BD4A 4XXDB 3ZT5A 5HPMB 1AE6L 3UPRA 3BW9B 5DFTA 1A2YA 1CDHA 2W07A 3NFNB 1XGRA 2KH2B 1R3HB 3IWVA 3GBLA 5T5FH 5JZ7C 1EO5A 3QARA 4PJ8D 4X6DA 4X4KA 1QSFE 4HBCL 1U91B 4K71B 3VCLB 2ZOKB 1WTLA 1NQBA 2ITDA 3CZGA 3GBML 4HZAA 3HE6B 4O2EA 4NKIL 4XNYL 4ZUTA 4XNXH 5D5ME 3NZ8B 1KJ2H 3G08B 3GTTA 2JI3A 4MZIA 4JFZH 2Y7SA 4AT6B 4HX1B 3BLBA 6TAAA 1PTZA 3KNBB 3C08H 1I1AB 1QI4A 3MLXH 4BM7A 1R3KA 5ESVA 1TLKA 3ZDYE 3GLEA 4UAOC 2MWCA 2VL5A 3P3UA 4MDJA 4YSEA 3UEQA 4Y4HC 1C16B 1E28A 2WMPB 2P42B 3BZFB 5IB3A 1E50A 4AQ8C 3OKOB 4Y1AA 4AEHL 2CUHA 3HUJF 1NFIA 4OCLC 2FHFA 5D1XB 2Q10A 4N3UA 1YC8A 4HT1L 2PCFA 1XDTT 1FVEA 3SJVE 3V0FA 3GSXB 3DIDA 3NFPB 4PIBA 3SDXA 2WINA 4WFED 4MCYB 1SLWA 5DC9B 1JGDA 1FNSL 5KSBB 1KDIA 3TO4B 2VKXA 2QPEB 1E7UA 2IQAA 2OJEA 2OMXA 1U3HB 1O9VA 2DLTA 4MJIA 3RX9A 3S35H 4GQZA 1MWAB 4HV8A 5J13C 2BW5A 2HG5A 2ZYHA 2EH7H 4YLCA 3EFFA 4NNPL 3WE6B 3ZZ1A 4RISL 1JCKA 2I5YH 4P5TD 1NAMH 1CFQB 1OGTA 2ICWB 1TPXB 4H1LB 1XL4A 5KBDA 1AFVL 1A6AB 2CLVA 5DQDL 1MI5D 2EYTB 3ZKXC 3ZYZA 1Z9SA 1QNZH 1QPXA 3II1A 3A67L 3BLKA 1SBBA 3TNMB 2GI7A 3UMTA 2QMKA 4GQRA 1U30A 4M3KB 1W2KT 2N01B 3EGSB 3TBVA 4FYRA 3ARBD 4JDEB 3UPRB 3VD5A 1A2YB 2R83A 2W07B 2V4LA 2B3IA 2H0JA 1A9EB 2JJVA 2AABH 2NNXA 1KXQE 2G9HA 3W2DH 4X6DB 4LOFA 2DQDH 1SGKA 4JUTA 4ACTA 5L88H 3N44B 1RZKC 2ZWNA 4AGNA 2ITDB 3D39D 1WFJA 4O2EB 4ZUTB 3LPWA 4J3OD 2V5RA 3FPYA 5T3ZH 1OCRB 3GDCA 2VZUA 5KG9A 3GIZH 1M6UA 3SDDA 4EN2A 2NY2B 4YBQD 1BXAA 4OLUL 4LCWE 2FO4A 1DJSA 1NIEA 4PI2A 2I9TA 4ODUB 1YLBB 1ZD6A 5JIIA 3D69A 3LKSA 4ZJ9A 1EZVY 1D6EB 1R3KB 3V52L 4ZO9A 5I73B 4L4VD 1ID5I 3GI8L 4FL4C 2VL5B 4MDJB 4UDTA 2BS9A 2PXYD 3ABMB 1KCRL 2ZG3A 1FQ9C 1E28B 2YPVL 5IB3B 3FUHA 4G7QB 3AAZA 4Y1AB 2VR3A 5JW4R 1CICA 2R39A 4IRZL 3UX9B 2JJTA 4IBYA 1D2PA 1HYRC 1NFIB 2VMFA 4PRNA 5DHYA 3DMMC 2FR4A 3WLWD 5GZND 4R7VA 3MRPA 5C71A 2A74C 3SDXB 3GWJA 2DQTL 3TYFA 1SLVA 5AAWA 5M94B 1KFGA 2VR8A 2X7LA 3N41F 2APXA 2G2RB 1NOLA 2OJEB 1HC1A 1G9MC 1XR8A 2OMXB 3DROA 3FU5A 4ZQKA 4W1TA 2V5SA 4MJIB 2VJ8A 4HV8B 2P8MA 4XZ4A 1MFNA 1BA9A 1DBBL 1E2ZA 1UB5B 5G5DA 3SCMD 3EFFB 5B3SB 4HCFA 1TJGL 1N3NB 1OGTB 3NP3A 4XP9H 5DI8A 5DD3H 2VQ4A 2F7IA 3LJ3A 2WUCH 2DWXA 3A6OA 1NFDA 4TVPL 4J6RL 4BHUA 4GXFA 3BIKA 4XBPB 1OW0A 4YHNA 1ERNA 4OV6F 4RX4A 5D1XE 2O61A 3QWQB 4FLHA 3AADB 4BFJA 1AO7E 4M1CD 4XH2B 4AMWA 3B9KC 1J1PL 1H15A 5F9OL 2ENPA 1ZTMA 3BPNC 4L4JA 5KSBE 3AT0A 5CKAA 2YARA 1PKOA 3TL5A 2JJWA 4E5XG 2LLLA 2G9HB 1I8UA 1N0XH 4FQLH 4RDQF 5TDNA 3TVMA 1N68A 3T2PA 3C60C 1A6PA 3ZE2F 4ZMVA 1MVYA 4DAGL 1F4AA 1RH8A 1NEZA 3Q9QA 3SDDB 1AQDA 3UP6A 5D7JA 4JFHE 1MCQA 4X7SL 2FO4B 3GS4A 3R19A 1EERB 1JXDA 2HWZL 5C09B 3JWDC 1MVUB 2XG4B 1NGZA 1CFVL 1WUNT 2G0LA 4YBHA 2EAEA 3D69B 4NM4H 4OZGF 3WNIA 3UGEA 1SUJA 4ZUSA 5BRZB 1U3YA 1EBAA 2VMEA 5I19H 4AGOA 4P23D 3DX9A 2WUBH 1KC5L 2CHNA 2WYTA 3U36B 1U8HA 4YSUA 4GBXD 3AAZB 3LXAA 1YO4A 4AC4A 2ZJSL 2UWEE 1CICB 5DZAA 1A7NH 1NGPL 3HMWH 4PRNB 5DHYB 2G60H 5LAXA 3AREC 2F7OA 3BWAA 4YK4C 3M86A 3DHPA 1KCVH 1B4JH 4X6DE 4B0MB 2YQBA 1Z1WA 2OCFD 4G2AA 4OD3L 2BIQA 5K9QG 3PWVA 4RMTA 3HNSH 4P3CH 1JZFA 2FYVA 2YOAA 4TUOA 4WEMB 3I9GH 4NIYE 5AYUH 1TMCB 4NO5A 1R0AH 4ABUA 3PJNA 1AC6A 5E5UB 3O9WB 1BF2A 2D4DA 1YEHH 4UTCA 1INDH 1DBKL 3DROB 4LSSH 2P8MB 2W81C 2X1PA 5TE6H 5CIPB 4FA7B 5JYMA 3GK8L 3J07A 5G5DB 5FYJD 4B95C 1Q0YL 3HNVH 3IMWA 4WI5A 4PJBB 1J1XH 1WZ1H 3EF7A 5DI8B 1JZ5A 1II4E 2FJFA 4KWUA 3QRBA 1UA3A 3B2DC 4Y1AE 4HFUL 5HVHB 2VDKH 3BIKB 2OI9B 2PWEA 3CVIL 4KI5C 1M7IA 4YHNB 5JIMA 5ID0A 4W70A 4TPRH 2O61B 2HVJA 4AVKA 3TEYA 1P9MA 4GMTL 2EXYC 3C6LB 3EYFA 3SDXE 3BRDA 1H15B 5E5RB 3BSZL 4LMQI 4M1DL 2OTUA 3US9A 4F7TA 4KO5A 1FIEA 5F6IC 1ZVYA 1IT9H 4MJIE 1EHXA 3GRWA 2JSFA 4IBQA 4LLYA 3RVTD 5TDNB 4UANA 5E6IA 4NERA 4NJAH 5IVZA 3GMRA 3DLQR 4JFDE 2OR7A 3SPCA 1NEZB 3I9IA 1AQDB 3IAGC 2WTRA 3AG1B 2BWDA 3RL2B 3GFUA 2CZNA 2J25A 2VN6A 2KZBA 2WQRA 4FKKA 1NGZB 4L3ED 3ZW3A 5E24E 1YEEL 3U4AA 2M8XA 4H2AA 4NN5C 3MJWA 3FCGA 4W9CC 4Z9KB 3TT1L 4ZUSB 5T3XD 3SYCA 1ZCRA 3FQTB 1MRDL 1QKZH 2WAHA 3VACA 4A2MA 3DX9B 1LMIA 1U8HB 4CMMA 1AMXA 1IRAY 2X9YA 4U1LA 4I48B 1BPLB 3HE7C 5IW6A 2WJ7A 3NJLA 4K3JH 1QTSA 1U4EA 7CGTA 1G9ML 4ESKA 3QUMH 5LAXB 4NCC1 1TDQA 5KVDH 4Z8FL 4BH8B 1NCNA 1FYTB 4S11A 3PWVB 3V79C 5EC2B 1BD2D 4KDWA 4NO5B 3GB7A 1KXVA 4KC3B 2NR6A 4YFDB 5AOKA 1JBJA 1TZIB 1NMAL 4JKLA 3JVGC 1FFNA 43CAB 4JL1A 1CD1A 1AC0A 2IXQB 5CEZE 4R7DB 4P57A 4FGMA 4JEGB 1BZOA 1UWEL 2JMRA 2K0RA 3ZTEA 2BWIA 1TU2A 2VGLM 2FWUA 3G7TA 1W8OA 3CBKB 5ID1B 1IVTA 3NABL 4HZLA 3QDGD 1RPKA 1Z3RA 5AVRB 2FJFB 3PQYA 1A0QH 1Y0LA 2IG2H 5C0EA 2OULB 3U0PB 2XZCH 2IPUG 1SMAA 5IOPA 4OCYL 3L3OC 3V0JA 5T1MB 1OPOA 1SF3A 5F93C 2J56A 1A3RL 2FX9H 2HVJB 2RD0A 3D9AH 4UQ3A 3AACA 2GTZB 4LEBA 4BQBA 4D0BA 5F7FA 1MCBA 2FD6H 3EYFB 4R8WH 3MLPA 3ZIMA 2YN5A 1P7KA 1GGYA 1IC5H 4DTGH 4HPOH 2K8MA 1FBIH 3LNGA 2P45B 1EUTA 1F45A 1RHHA 2J8UA 2ZF8A 3JWDL 1TTRA 3LZFH 4LLYB 2CHXA 4AYBA 1Z66A 5I6LA 4JHBA 5E6IB 4Z7UF 1N8ZB 2YQ2A 1MIMH 3L3HA 3TBSA 5CM1A 5TK2A 5ADPL 3UABA 2NY0B 3T0WA 3ARGA 1NFDE 2B59B 3NFSH 1Y6NR 3RWJB 3B56A 1HOEA 2D3NA 3BN9C 4GMSH 1S78D 3KLLA 1DN0A 4BIKA 2MQCA 4PH8A 2NTFA 5BVJA 2DB8A 3WNOA 4XOEA 1M3IA 4XNDA 1MCLA 2BDNH 4IMKC 3B8YA 4PRIB 4GXUN 4G11A 1J10A 2OL3H 4U1LB 5IFAL 5IW6B 3OQ3B 2F9BT 1UATA 2DV6A 4FFYL 4UIMA 1NWOA 2Y9RT 3MLZL 3W82A 2OW6A 2R0ZH 3KPNB 4NRZB 4X4ME 1RJYA 3S5LG 5FCUL 2FO1A 3SDCA 5E7FA 5ITBH 3DX3A 3F64A 3K74B 4MQTB 1I31A 5TK4A 2VDPL 2PPDA 2VDMH 5C2BH 4FKHA 3II3A 1MG2C 4M4PA 1WWCA 1HCFX 5TFSL 1FFNB 1XBDA 4UWQB 5CJ5A 4RAHA 1S3KH 1MJ7H 2QDWA 3QCTH 1CZ8H 1TU2B 2BIHA 5CN2A 5I0XA 1URZA 2W95A 2X2YA 4MXQC 5BOZG 4Q74A 4Q4EA 1P2CB 4PR5A 4HZLB 5JHDB 2TRYA 3AY2A 2GY7B 2XQYA 3PQYB 4E42A 1AOHA 1Y0LB 3ARRA 5GZOA 4NM8H 2DF3A 3U9WA 1RZQA 4BSWA 5IOPB 4YXHH 3OD3A 1OK8A 2NY7L 2E75C 2FECI 1N7ML 4HIJA 1KYFA 4UQ3B 2V7NA 5EA0H 2VXTL 4K5LA 1F56A 4WLCA 2AI0H 3HFMH 5I6PA 3T6WA 9PCYA 4KI1A 1J11A 1XGPA 2OXHA 1PU0A 4APQB 3G04A 2GI0A 3TEXA 3O3EA 4N6RA 2LGNA 2FATH 2H4EA 5LCVH 3QDHA 1WAEA 1RHHB 2J8UB 2WBXA 4HGMA 3W11D 1PD1A 3WIFA 1SDAB 4PCKA 1WIOA 3P77A 4X83A 5ESAA 3MNZB 3PYCA 3NJIA 4GPVA 1OALA 2CRIA 3L3HB 1BCIA 3F7LA 1EAJA 1S7XA 1TCRA 3B7UX 4I0PC 4F92B 4E5XB 4Z7NB 4AYDC 2OV0A 3ARGB 5L6YH 4F8NA 2X6MA 2ZXQA 3O6LL 4HS8L 4WI2A 1X5HA 4JMNA 3IFPA 1UC6A 2DJUA 2NTFB 1NM4A 2DKMA 2R1XB 5IIEA 2DEYX 3CLEL 2DPKA 3VFGH 1VEMA 4R5VA 3WFEL 2YD8A 2O72A 3SO3B 4L3CA 1JK8B 4JFSA 4P2QD 4NCC2 4LCYA 4UIMB 4UZGA 4EEEA 3X12A 3MV7A 1RUML 3QEHA 2PYEA 3X3GH 1VFBA 1JFQH 2V6HA 1RJYB 1L6PA 3X13A 3L54A 2K9FB 1YECH 4GOSA 2Y7NA 5CO1A 5HDBB 5F7LB 1ED3B 4L0YA 2GJ6A 3HMXH 5A2LH 3DBXA 3QXWA 4XP4L 3EGDA 4PUBL 4PP2A 4R4BA 3T0EB 3SKJL 2ADGA 3N6YA 5DHMC 5IHZA 3PDOA 1JD7A 1L7IH 3U25A 1JL8A 5IFHL 3PHAA 2JXMB 1HAWA 3OAZH 4FXLA 4ZAKC 1LWJA 3MCKA 5TQ0L 5KN5A 4F2MA 3QRGL 4L18A 5DT1L 1EXUA 1G4MA 5F89A 4EDXA 4CMHB 4MRBA 3F7VA 1FLTX 4PR5B 1VEOA 3SQBA 3VD0A 3L9RA 1LE9B 4WF7A 3CK0L 4JY6A 4J3BA 2QQQA 3MC0A 4BSWB 1L9TA 1UJ3C 1SF5A 1RLBA 2X4PA 3VGBA 3B9VA 3EH5B 3HHSA 4HIJB 3PNRB 4IIQC 4AENA 2V7NB 4LARL 3D2TA 3KPSA 2VRQA 1JF1B 1MRFL 2OXHB 4LAQH 3G04B 3QJHA 4S1DD 4YAQA 3BUDA 1QI3A 3PDGA 1E3ZA 3ZX1A 4RDQG 2VXSL 4NKDA 4N6RB 2VITA 4WWKC 4P59L 1OGSA 1MIEH 2BHYA 2PUQT 5E2JA 7FABL 2AGJL 4HXAL 2IFFL 2Q8AL 4Z3TA 3IJHB 1PAZA 2RMNA 4OLZH 5F9JA 1UASA 4WJG3 3P77B 4N90D 5ESAB 5GS0C 5D7IA 1W8NA 1ZT4B 2E7CA 1P5UC 5A6IA 3PL6A 3BP4B 3PQYE 5FS5A 3QCVH 1E6JH 4QMEA 4DKEH 1LDPL 3QA3A 1BFTA 1XZ0A 4IM8A 4DERA 4UIKL 1YMMA 3CSTA 3Q13A 1NCAL 3BCDA 5D8JL 1DTUA 4ZFGL 4H40A 2XTJB 5JQ6H 4MAUH 3HZYB 3P02A 2CK2A 3SDAD 3BESR 2YGOA 5E2UH 3ZMNA 2IIJA 1K8IA 4M8QA 4Y9CA 4HJ0C 3D5OF 4P4KA 1GIGL 5GGUB 4L3CB 4HQQL 1KYAA 2DLGA 4LCYB 2J2ZB 3MV7B 2J8UE 1QSED 2NX5D 4R90L 1CXLA 2CK0H 2VH5L 1RUAH 1A7BA 2GJ6B 5B38G 2NW2A 3DBXB 4FTDA 1ZPLA 4F8OA 4Z7NE 4PP2B 4R4BB 4DETA 2ADGB 4YHYC 1WWBX 1YEGL 5ACZB 5IHZB 3PDOB 1KN4L 4AQOA 2X9XA 3DX2A 1BSIA 2YQGA 3FO0L 2OTPA 4UAHA 3MCKB 4LESA 2HX9A 1DSFL 1ZE3H 3T2NL 5DJ2A 1EXUB 2JELH 2ZSWA 3KYKL 4EDXB 4A68A 2X6UA 3ZQ9A 3SQBB 1EA9C 3P0VL 3IBEA 1HEZA 4PWFA 3E38A 5H35A 3L9RB 3FB7A 1M1XA 5HI3C 1NMBL 4JY6B 4YWGH 4FFZA 4XVUC 1ITCA 4EDWL 1PGRB 3EJCA 3H3PL 5BZWA 4GAGH 4BSJA 1YNTA 3BEWA 1OPGL 5GS3A 1EUUA 4YN3A 1DBAL 2Z91A 3MJ9L 4AENB 1MUJA 3KPSB 4TLTA 4YAQB 3QUXA 4MMZA 4XMLH 3H2QA 4UTAH 4QOKB 5B39G 5I2IA 4NKDB 4Y2DC 4DZBA 1G0XA 4MSWA 4NJ9L 4H13C 3VO0A 4AE0A 2CSPA 4L29B 2R4RH 4Z3GA 5CU5A 4UQ9A 2ISDA 3R0MA 3C5ZA 5JXAL 1CK0L 5D7IB 2IMNA 1EGJH 4N26A 3CBJB 4JPKL 3MYZA 4CDHA 3PL6B 3V0VB 1GOHA 3VG0L 2GBUA 4IK6A 3WKPA 5IBUG 4A6YH 2X88A 3QA3B 4LCCB 2DIAA 4C83A 4KRNA 1P4UA 5AAPA 4JN2A 4LP4A 1YMMB 2DJSA 1XQ4A 3B3BA 1OAKH 1MXDA 4XPFL 4MJ2A 1JG9A 3MRRB 5TPWH 4F7PB 1E2WA 3BJ91 1C08B 3B4NA 4ZMPA 2E47A 3FULA 4LXFA 1T0MA 2WLZA 3VWJD 4F3FB 5ADOH 4DGYL 5EU5A 1SY6A 1B3JA 4TRPL 2WAQA 1R47A 4IBUA 2IOMA 2YSSB 3HNTL 5DK2B 5F7WC 1VLXA 3SGDH 3WS3B 5I82A 4ZW7A 4GUOA 2EVIA 4WEUD 4P3DB 1NIDA 1R33A 1Z0NA 2NY3C 3MV11 4U1SB 4FQXA 1OAUH 3P9LA 2X6VA 1E8XA 4BGLA 4MZRA 1KPRA 2QSVA 1YYLH 2K8QA 1QRND 3PUCA 4HUVA 5IGXL 2I24N 4OD2A 1T5XB 3GSNA 1UVQA 2QQKH 2FB4H 4Y19E 3NPSB 1HEZB 5C0BD 3Q43A 5H35B 1ZSHA 3FB7B 1WO2A 1UA7A 4BCZA 3FF8A 1K8DA 2FAUA 3C09B 5HHVH 5BZWB 3NTCH 1DVUA 4A7GF 1BVLB 3FTZA 2PYEE 3FQ2A 5TTRA 2XV6B 2Z91B 3SGDI 1MUJB 2EE3A 3BQUB 1KNOA 1BG9A 3QUXB 1PLGL 4MMZB 2GJ6E 1BXXA 2P5WD 1FDLL 5I2IB 1A9VA 1A7OH 4DP0X 4KZCA 1UZ8A 5E2VH 4MSWB 2O6DA 3TIDA 4KITB 1JGVH 3A5VA 4W9IC 2RA1A 2G0KA 3IDJB 3IE4A 3UYRH 3AY4A 2YPLD 3C5ZB 2AZUA 4KTDH 4KRPC 5EZJA 4QEGA 4F2ME 5IESL 3T2QA 4OLWL 3ZZQA 3K6FA 4LHUD 2FJHA 3UC0H 3GO1H 1C5CH 4HWBA 4LSUH 4PW9A 4G5AA 5F7EH 2N4IA 2ZXEB 2QPFA 3GLAA 1MHCA 1GKEA 5KYYA 1M9SA 3QJOA 3LKNB 3WD5H 3SPHA 5E6YA 4C83B 2PPAA 3SKUD 4JG5A 3V4PB 3I3DA 2H7WA 5C0JB 5L4IA 3CZKA 4L9LC 3RU8L 3MJ6A 5BS0D 3MBEC 3VNZA 2HFFA 3KPSE 4FNSA 3OHXC 2XWEA 1UACL 5HHOB 3Q06A 5I16B 1XF3A 2XDHA 3CMOL 1TQBB 1LO0L 1T0MB 5K59F 4M62L 1FC2D 5EU5B 2YIHA 3EH2A 4KHTL 1Z5LB 4QRTA 5F0MB 2ICEA 4JHVA 5ENWA 3ULUD 1SOQA 1INEL 2DLEA 4N2EA 4WFGD 2AITA 4TLSA 2YXVA 3C6SA 5ABAA 1MJ8L 2Y36H 3BUYB 4HCIA 1DVFB 2WXJA 4FQXB 1FSKB 4XTRD 4EZKA 2C9VA 3P9LB 2DI7A 3WJJA 4E9LA 1KIPB 4ZUWB 3RHWF 3P4LA 3FZUD 3HN8A 4ORZC 2MJWA 3SZKC 1BWWA 1YMME 4HUVB 5LG6A 1TTAA 2A4ZA 5B1CA 2XTLA 3SE8H 2V9QA 1UVQB 5E8NA 3MA7B 5JXED 4EXKA 5FHAL 1PIGA 5FWRA 1BEYH 3MRHA 3D85A 4FNLL 2YHGA 3BKJL 1IX2A 4NENA 4WZ9A 2IALA 2VNCA 4XCFL 4KROC 2Z4QA 1T1ZB 2WXFA 4GSDL 1BZEA 2BY3A 4JREC 3ZE0F 4AMKH 1KNOB 4ICWA 5EEVA 1KWGA 3P30H 3GJFH 4RGND 2HMID 4OFVA 4J39A 2PYFA 2DQJH 3LXUX 1BQUA 2VDRL 2YD1A 3FHEA 3WKQA 2CMRL 1VF5C 2WP3T 2X42A 4LNVA 1FN4A 4MD5A 5CUSL 4ZS7H 4EI5C 1BF8A 2NZ9C 3P54A 2LOEA 2FJHB 5EO1A 3O2VH 1CGUA 1V5JA 1HZLA 4J4PA 1W72A 4LPYA 1MHCB 2BNRB 4LASL 5KYYB 5IOKA 2J43A 4JFFD 4Q4IA 4WK0B 4F9LC 3WIIH 3KJ4C 4WEEA 3D08A 2ADYA 4OZGB 4M5YH 3REWA 4QGTA 3AU1B 2E5EA 2JI1A 1EEUA 1IGIL 1OOAA 4BQ6A 3GXFA 4OZHF 2AHIA 2UXVA 1X3DA 1U92A 2KZ1B 2YGPA 3VI3F 3VSVA 3BH4A 5L7XL 2A83A 5IJKA 1HILA 3RFZC 5DHEA 2ICEB 4IHBA 2MCG1 1NZRA 3WJLA 3EFOB 4AYGA 2HLFD 2DMBA 4U33A 3QIBD 1YY9D 5LKNA 4R84A 3TP4A 4TVUA 3RJQB 2NQDA 3RWGA 5E9DA 4S1QL 2DDQL 5F88A 1UZGA 3T65B 1WC7B 2C34A 5JOPD 3Q2CA 3PWJA 4CC4A 3WAKA 1VESA 4TNWF 4WJKB 3ARFD 2EEAA 4OCMC 2B9AA 4RH4A 1E3FA 4YFLF 3T5WA 4Y2NA 3HLKA 5LJYH 3UTPD 4N0CC 1V3LA 3S4SG 2CGZA 1ZT1B 3CQFA 1QLEB 1JPTH 3MRHB 3D85B 3CUPA 3P11L 4P9HC 1XX9C 4XHJC 1X5KA 2IALB 2VCOA 5D7HA 4BWTA 2Z4QB 3RGHA 4PVLA 1VGEH 3EYSL 4FG4A 5CZVH 5CN3A 4J3WA 1CYWA 4YHIA 3MV9D 4MQ7A 5DD6A 5I5IA 3TOPA 8FABA 3GTNA 4QR7A 3D18A 1UH3A 2DOCA 4KQ3H 3TFKC 1UWXH 3S36L 2Y1YA 3UYPA 3WSQL 4P2OD 1NGQL 3RJDA 4MD5B 1ZHKA 2VUOA 2WLJA 1WGVA 3RAJL 4JM2F 2Q8BL 1HXMB 5B39B 5I24A 1QUNB 1RHFA 2YFNA 4PWJA 2EDTA 3LNHA 1UD4A 5IW1A 2X38A 4OTXH 4C47A 1W72B 5DZPA 2QPDB 2I9LA 5AOMA 4MAYD 1BZ8A 2OSXA 4JM2C 3LKOB 2YMTA 4HJUA 5HGDA 5SWSD 5IKCA 3L4UA 5ISZA 4H4NA 3RIAF 3REWB 2ZE0A 4K9EC 3IN2A 4MQXC 2Q9OA 1U3NA 2J5WA 3OXSB 4X9YA 2FL5A 3SOBH 3LZOA 3ZZSA 1L3NA 3U4KA 1U92B 5FIEA 4NFDA 1KFAH 1XV8A 2A83B 5TDOA 1HILB 4HOXA 4WU7B 2EKSA 1MCOH 2CDGB 2UV3A 1BAGA 3L3IA 2W9DH 2E6JA 5JIPA 2XV0A 2CO1A 5EIIG 4M7JL 3VGAB 1CE6A 3RWGB 5E9DB 1WICA 1BJMA 2FHCA 1X4XA 5KBNC 3QUYA 5IQNA 4YDIH 1UTDA 2OZ4H 3M45A 1G84A 4PY8J 2R7EA 4MYPA 1TJXA 5JQIB 4PI0A 1JP5A 4MKTA 5E99H 2EDHA 3D4CA 2BM3A 4Z7OB 3ZTNH 1V3MA 4M48H 1QQDA 1IGTA 1YCSA 3D2UA 3ZHLA 1OE2A 3BKYL 1O5DT 1OF0A 3CIAA 4Y0GA 1N67A 4HHGA 5KYUB 3P0YL 4ZFOL 3KJ6L 5PAZA 1NIBA 5I71B 1Z9OA 1ET5A 1HKLH 1I8LC 2EYRB 4GH7B 1PCSA 1MCRA 3P3YA 1U2YA 3CZLA 4YHIB 1BECA 1ZVSB 1VFOA 2R23B 1RURH 3D18B 3GSVB 3K8KA 4OQTH 1KIUB 3ZHFA 2YD6A 3I9PA 5FKAA 1MCHA 1Y07A 3Q44A 4NT6A 1ZHKB 3AROA 3PLYA 3BPOC 3FSVA 4M61A 5INDA 4OLYL 4EAEA 4X4ZA 1HIML 6PCYA 3EADA 1NLBL 4GUCA 1KEGH 1LO5A 3CSBA 3NZHL 5CU9A 5IW1B 3UTTA 3TYGH 4FABH 2I9LB 2ETWA 4I9WD 3R4RA 3DX8A 4DKFH 4YQXH 5C3TA 5HGDB 3U4EA 3M1CA 2P8PA 4PHXA 3RG1C 4C56D 4C8XA 5ISZB 1OTTD 5JHLA 1PSKL 4HJEA 1LHZA 2C1PA 3LH8A 4KVNL 4MD0A 1NC2A 2DQCL 1YPZA 2MTAA 4AIZA 2EACA 5FGBA 4NP9A 4OCRH 2JB5L 1PEWA 2YEVB 3OSVA 4IEFA 2R29L 5C7ZA 1NKOA 3D51A 1L6XA 4AV5A 1W6WA 5TDOB 4FULA 1BYOA 4QTHB 1CD0A 4WTWA 1Q94B 1J1OH 2IPUK 2K6YA 3L3IB 3Q01A 1F4YH 1MWAH 5JA8B 5MEND 1BBJA 4HJJH 2J6EH 4UZUA 3MAWA 4HF5H 1A8ZA 1CE6B 5BO1L 3F01A 4ZRGA 3A6CH 3QUYB 1MW0A 2X2IA 4KUZL 2XY1A 2J1WA 4WVRA 2O6FA 2W1NA 2LU5A 2CHDA 3WMQA 4P9HL 5AL8A 4C57C 1UFGA 2VWEE 3FMGL 4TUJA 2QLYA 3NSYA 4JRLA 4WO4C 4F7EA 3JV6A 1EJ6A 3VD4A 2ZUTA 2MHAA 3BP7A 1LWRA 4GQQA 2UZPA 3SBPA 2VLLA 4NN6C 1QQDB 5KSAA 3D2UB 3NT0A 4GXVH 5KVEL 3N42B 4PJ5D 3F7KA 1EJOL 4IDJH 1DQJB 1AG6A 1NDTA 3CLFL 2QELA 4PYGA 4IGBA 3FFCA 1F4WH 3PWPA 1NLDL 5AD0A 4LSVH 3N43F 4Y16B 3NCMA 2W59A 4YJZL 3HPJA 2UY7A 5TQ2H 4EUPG 3DWTA 1S7WA 4N22A 1QWHA 3ZDZF 1KIQA 5J12B 5E9DE 2ICWI 4WTZG 3UAJA 3J27A 2HT2D 3CFCH 4ZS6C 1K72A 2OMZB 4NT6B 1N10A 5F96H 4YE4H 2IDSA 5L0QC 2D8KA 3L5XH 3KPLB 4M61B 3PHSA 2ZXWB 3EGXA 4LOUD 2VERA 4Z7OE 4K9EL 1I4FA 3Q5OA 3BYYA 3UTTB 2DTSA 3OZ9L 4LQFH 2K7QA 3V4VA 4GRLD 4PJ7F 1EEZA 4JDVA 4KQ4H 4FADA 5ALBL 1T66D 3DX8B 1NMCC 3D33A 1KUMA 3CJJA 3KVDD 2P8PB 1TNNA 3AZUA 4HJGB 3O2DH 2CJUL 1UKTA 4MD0B 1NKRA