4KOBA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kobA00
4G7RB 3X1BA 2EIKB 4NAJA 1M57B 5TK2A 1PF3A 4BXVA 1E5ZA 3S8FB 3JT2A 1IC0A 5B7MA 3RYMA 1AAJA 1E5YA 1VLXA 4UANA 1ID2A 2XWZA 4AX3A 3L45A 5B1JA 2TSBA 5I5IA 2PCYA 3U25A 4CSZA 1DZ0A 4G7QB 3ZIYA 1W8EA 3IBOA 4EF3A 4ENZA 7PCYA 2QPEB 1A3ZA 2XUWA 2IAAC 3NSFA 3NJNA 1JXGA 1OE2A 4YL4A 1HAWA 2B08A 4YSSA 4HCFA 2QPDB 2W88A 3QQXA 4N8UA 4P5RA 3QJUB 2YXVA 2QDWA 4UAHA 2AZAA 1HAUA 2FT7A 3FPXA 5I5JA 1TEGA 1TKWA 4FAAB 2YAEA 3FYIB 1ASPA 2HRGA 4YSRA 1GS8A 2ZOOA 1BQ5A 4KNUA 2E86A 2XLLA 4JHVA 1WA2X 1RZQA 5ANHA 1AS8A 2XX0A 3SBRA 3T71A 2NRDA 3FSVA 1N70A 4AI7A 2GBAA 4DPAX 4CSPA 4E9TA 1WA0X 4K9JA 3X1GA 2UXTA 1ZDQA 3SBQA 4GP4B 3CVCA 2UXVA 1JERA 2OJ1A 1KV7A 1GS6X 2N0MA 1JXDA 2Y1AA 1B3IA 1FWXA 1E65A 1OV8A 2DWSA 3UGEA 3ASNB 4Q89A 1GY1A 1L9TA 1UATA 1AQ8A 1FA4A 4NERA 4BDVA 5B1JC 1OCCB 2FQDA 4DP8X 3FU8A 3HB3B 1PLCA 3T6XA 1WS8A 2XXGA 1J9TA 1W6WA 5I26A 3ABKB 4FA7B 1PAZA 3HEIB 2H47C 4BWWA 2YAFA 2IDQA 4YSEA 3PXLA 2PLTA 1ZIBA 1TU2A 2JXMA 1SFDA 2BZ7A 2H5UA 2WSDA 3FSAA 1PCSA 2BW5A 1CURA 1SF3A 4A67A 4JKNA 2YAOA 1M9WA 1NINA 1OE3A 3CG8A 7PAZA 3TASA 4HZ1A 2BP0B 1JZHA 3GXUB 5B1BB 2OCCB 2FJSA 4WTQA 4YSQA 2DV6A 4HALA 3NP4A 1PMYA 2CCWA 2MTAA 2YQBA 2PPEA 4GP5B 4G72B 3AG1B 4YSPA 1MDAA 4JHUA 6PAZA 3G5WA 4F7KA 3TBCA 1PZCA 3OMNB 3BQVA 4KNTA 1ASQA 1BYOA 3SQRA 3X2QB 4HHWA 1AZRA 2XV2A 3V9CA 1R1CA 4A2HA 1A4AA 2H3XC 5I28A 3QJVB 2UXGA 3FSZA 2VW6A 2IDTA 3SBPA 2UXFA 2FNWA 3D12B 2A3TA 5IY5B 4UF7C 1PLAA 3N55A 3AG3B 3AG2B 4GY4A 4YVUA 2YAHA 5I6KA 4KO5A 4P5SA 2YAPA 1OCZB 1ET7A 5I6MA 1EZLA 3C75A 1ILUA 2CUAA 1NZRA 5AKRA 1URIA 2GB2A 2QDVA 2CAKA 1BAWA 3PLYA 4X4KA 2IDSA 3AW5A 5B3SB 1SDDA 4DP1X 2VM4A 2R7EB 1A4CA 1DYZA 1GR7A 2HXAA 1I53A 1GYCA 3KW7A 1QHQA 3NSCA 5B1KA 2PPCA 1CUOA 2X88A 3MX0B 1E30A 3MBWB 4BXSV 2BO0A 2XX1A 2AVFA 2MRYA 1IBYA 1CYXA 1BQRA 1NTDA 2HLEB 2FT6A 3FU7A 3NJLA 5AFAA 4KO6A 2P80A 2BZCA 1AZCA 1WS7A 2ZWNA 4E9SA 4YSCA 5LDUA 1KCWA 1GS7A 3DKHA 2PPFA 2GSMB 5F7BA 3UAAA 3PAUA 4YSAA 3NSDA 1N68A 5I6NA 3GDCA 3H56A 2EINB 3CDZB 1JZGA 3IE9A 4QKTA 4F2EA 3QJSB 3T9WA 9PCYA 2DWTA 4DP2X 2PCFA 4A2DA 3OQRA 1QNIA 2Q9OA 5I5MA 3WKPA 2XYBA 4A66A 2R7EA 2VSMB 3S3CB 5F7AA 3DTUB 2QT6A 3S3BB 1E67A 3NSYA 4E9XA 1KDIA 1AZNA 2J56A 2YARA 5AZUA 1SJMA 1NIAA 4BWTA 3NJHA 3BVDB 1KBVA 3FQ1A 4HIPA 1BXVA 3FU7B 3IN2A 1PZBA 4HHGA 2GC4C 4NB7A 2BP8A 1BEXA 2PP9A 4HAKA 1SF5A 1ASOA 1KBWA 4AKQA 4TXVB 2GIMA 1PZAA 5PCYA 4N4YB 4QLWA 2PPDA 1PNDA 1AG0A 1OE1A 1RKRA 2RACA 3X1FA 3CZUB 2IWEA 4YSUA 1W6LA 3OD3A 1NPJA 3QJQB 2GHZA 3ASOB 4HCGA 4ZK8A 3NT0A 3N2JA 2BWDA 2JKWA 2YAMA 3QPKA 4PCYA 4WKXA 1AS6A 1JOIA 1MZZA 4KO7A 3ZBMA 1OF0A 2UX6A 5I6PA 4YVNA 2XVBA 1NIBA 3TU6A 3TBBA 1L9QA 2X87A 2XU9A 1ET8A 4KNSA 1A8ZA 3FQYA 2VSKB 2VW4A 5A7EA 1BXAA 3WG7B 1J9QA 1QLEB 1CC3A 2FQEA 2JFCA 2UX7A 1ZDSA 1JZFA 1SFHA 3ERXA 4W9ZA 1KYAA 3S8GB 3X1EA 1MG3C 1JVOA 1YLBB 3QJTB 3FYEB 1GW0A 4YSTA 2BP0A 4DP0X 2WO3B 4DPBX 4A2EA 1AANA 2I85A 1ETJA 5D4HA 3CVDA 3FS9A 6PCYA 4YSOA 2HZHA 2J5WA 3PAVA 4BK5C 4AZUA 2XXFA 4G7SB 5E9NA 2J57A 2VM3A 3WIAA 3PCYA 1WA1X 1GSKA 2IWKA 2HRHA 2LLNA 2WO2B 4L0PB 1KCBA 3ABMB 4DP6X 3UADA 4M3HA 3OMIB 4GP8B 3ZDWA 2ZONA 4E9YA 2DY2A 1A4BA 1OOWA 3ZX1A 1JZJA 4DP7X 2B3IA 2W8CA 2BWIA 3H4HA 2XV3A 4PAZA 2PP7A 4KOCA 1OCRB 3NJGA 2CALA 1AS7A 3EHBB 1GY2A 2PP8A 3OMAB 4BDVB 2I7OA 3FPYA 3UABA 3UACA 3WI9A 4DP9X 1BQKA 3UAEA 1NICA 4DP5X 3PAZA 3WKQA 1HFUA 3OM3B 4BWUA 1IUZA 2IDFA 5FC9A 1J9SA 1X9UA 2DYSB 1NWOA 2DYRB 1TEFA 2AFNA 1XB6A 2FQGA 3NJJA 2GI0A 3NJIA 5B7EA 1RCYA 5EHFA 2FT8A 1NIDA 3FT0A 1AG6A 1J9RA 2HX7A 1ILSA 2CJ3A 1IKOP 2IH9A 2BW4A 3T6VA 1V10A 1L9RA 3NYKA 1AIZA 4KOBA 1BXUA 1L9SA 3IEAA 4E9VA 5B1AB 1MG2C 4E9RA 1ZPUA 1A65A 1BYPA 2YAQA 3AG4B 2ZXWB 2VMJA 4A2FA 1ADWA 3AZUA 1F56A 1JVLA 1L9OA 1CYWA 3AY2A 1X9RA 3WNJA 1J5DA 1AOZA 3TA4D 2I7SA 4E9WA 3NJMA 1AR1B 1XB3A 1J5CA 2Q5BA 1NIFA 1OCOB 2CBPA 1AZBA 3EH3B 1EHKB 1AACA 1PNCA 3CDZA 1JXFA 3DIVA 4AKOA 1ET5A 5B7FA 1AZUA 1JZEA 4YSDA 1SHXA 2EIJB 3JTBA 1V54B 2IWFA 1M56B 1NPNA 4DPCX 2VN3A 2AANA 2EIMB 2EILB 5I6OA 3EH4B 3S3DB 3CVBA 2IH8A 2VW7A 1XMEB 2OV0A 4GYBA 3QJRB 4AKPA 1SNRA 3T6ZA 1PY0A 4E9QA 4RH4A 3GYRA 3H4FA 2J55A 8PAZA 2PPAA 3ABLB 4MFHA 1T5KA 2TSAA 2Y69B 2FWLB 4M4RB 4A68A 2P80D 4DP4X 3T6WA 4W1TA 3FSWA 2FTAA 3WNIA 2BP8B 1IBZA 4GXFA 3EH5B 3ABGA 3FQ2A 2XV0A 1KDJA 1JZIA 2FQFA 4KO9A 3PPSA 4Q8BA 3EF4A 5D4IA 4G70B 1XB8A 1RZPA 1NWPA 5TK4A 1ZIAA 3NP3A 3X1NA 1NDTA 2BHFA 3NJKA 1KGYE 3V9EA 2AZUA 2HX9A 2GC7C 4G71B 1L9PA 1SDDB 3FU9A 3NJFA 1PLBA 1WAEA 5I6LA 4HCIA 2HX8A 5D4JA 2IDUA 1NIEA 2YXWA 1MZYA 1FFTB 4F2FA 5PAZA 1V55B 1ZV2A 4A2GA 1SHWA 3KW8A 3IN0A
chains in the Genus database with same CATH superfamily
4Z76B 3LPGA 4FQLL 3JV6B 3B7RL 2HKFH 1IM3D 2R39A 3AROA 1FYTE 3HI6L 2G60L 3VFSB 2BVOB 4P2OD 4X8JA 4HOZA 4OD1H 1WTLA 3PGFH 5B1JA 3ULVC 4WU5A 5EN2A 3RTQD 3ULUF 1E9QA 1HKFA 3I50L 4KI5C 4ZTOH 4Z3GA 7PCYA 3UZQA 1UA7A 4KI5F 3AM8C 3LKQB 4XMLH 2LW3A 4L9DA 3ULVF 4N8UA 4P5RA 3LQAL 2PYFB 4UAHA 3EFDL 2DB8A 3QUYB 4M6MH 2DDQL 3ATDA 4RFOL 4MHHI 3MJ9A 3PL6C 4OF6A 3G9VA 2IPUK 1DBKH 4HEME 4AG4H 3IDGB 2NY1C 2NY5C 2YUWA 3QJHB 2E7DA 2WO4A 4J3OF 2FSEB 3FOLA 4LCIH 4MAYA 1AC0A 1PZSA 1RSYA 4G1EB 3PHAA 4R84A 2BS8A 4GEIA 2Q3AA 5SWSE 3T71A 5ETUB 3KM2A 4KJQD 2Y23A 4PGBA 2VAAA 5G2NA 3TEWA 2ZWKA 2FWUA 1EEUA 2UXTA 3MI6A 3RU8L 3BGAA 2ZX6A 2GK0A 1XIWA 3DVGB 5GJSH 1P5UA 2JB5L 5CZXD 1U8PB 4JB9H 4R4BB 3VRJA 3WMQA 3N1MC 3IKCA 1E65A 5AAWC 3K2MC 5I74B 1DLHB 1QBLL 1AQ8A 4MQXD 2NY2C 4NERA 4LSRL 2HT4D 1EH9A 4N28A 1JNHB 1HNGA 1LE5B 5T3XD 5GZNC 4N90E 4R90H 3ARFD 2HFTA 1KLFB 5F3BB 1XGYH 4JHBA 1F0LA 1ZV5A 2CUIA 4KHTH 3MNZB 4QRUA 5HHOA 3CN3A 4QRAA 3BZ4B 4DERA 1NGYA 3A6OA 4X6DA 1TU2A 2GUOB 1M7IB 3QGVA 3L3JA 1NKRA 4M3JA 1U8LA 2ICEC 1KIRA 4PHZA 5DD3L 2EYTB 1RZIB 2DBLH 3O4LA 1IC7L 5BUPA 1F1DA 4HWZB 1TMCB 4JCMA 3K80A 1M9WA 4S1SL 2JNZA 5DQJB 3US1A 5H37A 4QRTA 2A9BA 2LU3A 3C2AL 4U0QB 3SD5A 3EF7A 4YDJA 5D7HA 1T03L 1QSVA 4PJIB 3LN5B 5TD4A 2BJML 1RL1A 5D72L 3WHXA 5EDXA 1PKQE 4NWTL 1KYDA 4PGJA 2P9RA 3DECA 5T5NG 4FXKA 3CDFA 3VGEA 1GHFH 1RZIA 3QZWG 4CGUB 3BSGA 2GITB 2DW5A 4K23L 1R1CA 2SEBB 3LYRA 1MLBA 3EFFA 1A4AA 2H3XC 2BRRL 1LO3L 1AQKL 1XO8A 3EYUH 3E80A 1GL4B 3K8LA 1L0PA 3FB6B 4PVLA 3D12B 5DJ0B 5IY5B 1YEGH 4UF7C 1MNNA 3OG6B 5KSAD 1KPRA 2E4FA 3OF6A 3L48A 4KH9A 5E6ID 3GS7A 3WFHA 5CF3A 2XIDA 4MJIB 3UO1L 5JPNA 4XBPB 4M62L 5HHQA 4RAUB 1DFBL 1OB1B 1AHWB 4AZ8A 3EYFA 1M3IA 4ZYKA 4P2RE 2IDSA 4TTDD 2ADIA 1SDDA 5EO0A 1EXHA 1YAIA 4JPVH 1DYZA 2FX7L 3ULAB 2X1XR 1ZHKA 2PPCA 2XNAB 3MRMB 2X88A 4KAQH 4PRAA 3FQ4A 5E8NA 3GO1H 5DHVA 4OKVB 1ETB1 2BO0A 3SO3C 3BIKA 1G9MC 5MEOB 4FFYH 5BMFH 1TQBC 2ADFH 3TO4C 4LBEA 2J6EA 3NJLA 4WJKB 4Z76A 5DD6B 4FOMA 3FQWB 4TSAL 4Y19E 1JGUL 4ZYKB 4LP4A 3NZ8B 4WHCA 4IK7A 3RWEB 2A83B 3PAUA 1PJWA 3X13A 1U42A 3NSJA 2AQRA 3DSNB 4MSWA 3VXSB 1H6FA 2D7TL 1EEYB 2X4UA 3BFOA 3Q7JA 1B90A 4IRZL 4FQ1H 4FFZA 2OTWB 4FTVE 3LZPA 4BQ8A 2WUCH 5F9JB 2J4WL 2CK0H 3J8F7 4TULL 1S8DA 4U1SA 2PR9A 3IJ9A 4ZFOB 2R7EA 3QS3A 1Z9SA 4XNBA 3CFUA 2J1WA 4ZMWA 1J5IA 3KYMA 1BP3B 4WHDA 3HE7A 4JZOB 4PCSA 3OZLA 2OI9B 3BVDB 1PPIA 4APQA 2V5SA 4J3OD 2AP2A 1CXIA 2C9PA 3CFKB 4XNZC 2X89A 4Z95L 3NIDB 3PV7A 5CEZL 4ZW3A 2MNJB 1K6QL 2W65B 5IJDC 2P3YA 2GIMA 3P3SA 4EUPB 1YYCA 1FL6B 4FJ6A 5DGRA 4XVSL 4JE0A 4I18B 5DA0B 3BVWA 2AABL 4WWKB 5IMOB 3UJJH 1PX3A 3QJQB 1B4JH 4W9DC 1N26A 2NNCA 4TM9A 5HPMB 2KZWA 2FD6H 2YMXH 5E23A 3WIHA 2YO3A 4YWGL 1YG9A 3HZKA 4XMVA 5FKPA 4UDTA 1J5CA 1QSZA 4TLSA 2Q3XA 3BC9A 2DQDL 3LZLA 3OKKB 3QDAA 5KSAB 4WSJA 1LWJA 2Z7YA 5CS7A 4DNLA 4Z7QE 5I6XB 1LP9E 4X5QA 3MLSH 3TBBA 3JWDL 5F7MC 4WWKA 5C2BL 1BFVH 3TBWB 4HD9A 3LQAH 4QRFA 3FQYA 4MDIB 4NNPL 3U6RB 4BE5A 4MMZC 3SBWC 1PBYA 4N8CL 5HPMA 4K23H 1J11A 3REVA 3W0WB 3KWTA 2BH0A 2E6JA 4KVPA 4XXCC 3MRDB 4HF5H 3TPUA 1A7BA 5JW5B 2DLFH 2YD5A 4OJCA 3V4VL 1HWHB 3QG6A 1ZDSA 3KE0A 3AGVA 3PGDA 1XGUA 5TFSL 1GJWA 3UIYA 3HFML 1YUHA 2A73B 4H2CA 4DHLA 4ZOBA 1MRFL 4ZX6A 2ZOLA 2OR9H 2ZOKA 1G9EA 2WXIA 1DUYA 5DJYB 1ZGLM 5JIIA 1UJ3A 4R6UA 4BEIA 3BLBA 4JFOA 4KKLC 1S7SB 4KJWC 3K81A 4AK2A 1F4AA 1BMZA 1PG7X 2A6IB 2VSCA 5D7JA 2EE3A 4L0PB 4AITA 2Q8AL 4MNGE 3UADA 4HW6A 4G80B 4KHTL 4N8CH 5JQ6H 1BD2D 1TT6A 2QV2A 1NC4B 4X7SL 1CFQB 3TBVA 4JPSA 3KWWA 3KGRA 1AP2A 2Y24A 2Z34A 1UH4A 1DN2A 4XMTA 3TZVB 3W5MA 1FGVH 2QGDA 3FH5A 4QO1A 3UABA 5AW5B 1BQKA 1JWMB 4DP5X 4YHOL 1WZLA 4O4YL 1XF3A 1YSOA 3T2NL 4LLAA 4JY5L 3OKNB 2RAMA 2NXZD 3F58L 2Z1PA 3RDTD 1IUZA 3V5HA 5KSUB 1YMMD 3KCPA 1UUNA 1FZOB 4EI5D 3P0GB 1TEFA 1UCBH 2EKJA 5EO0B 1AG6A 5HGDB 1XCQA 3NUKA 1WCBB 3LNIA 2NLJA 2NDFA 1CU4H 1ZHKB 5ELIA 4G8AC 3Q05A 1NCWL 1B4RA 2APWA 3PWJA 2BW4A 3QEQB 1KN4L 2EDWA 5CEZH 3ZTEA 1T1WA 2I24N 3MCKA 4E9VA 5IMLA 4Y1TA 3C08H 3GSXA 1A6TB 1ES0A 3ESNA 1DBJL 2ZXWB 3MLUL 3OAUH 4WGWB 2NTSP 3UBXG 3OKNA 4OI9A 4S0SD 2X40A 1CQYA 5AW0B 3MLWH 2BSCA 3WTXA 5HGAA 4LOEA 3K91A 1QG3A 1I1AD 3FDWA 5B39G 1ORQB 3PY9A 4Y2DA 2I9LA 2CSPA 5C6TH 3S3SA 3DXAE 3VD2A 4TS6A 4WW1A 2B20A 4PJ9B 4S10A 3SDXF 3T8VA 4WWOA 1OAXL 1X6LA 5I1JH 4YFDB 4GI9A 1MHEA 2WW8A 2BFGA 1IFRA 1MWAH 4OBRA 3RWDA 1MI5B 4GRLA 4LDOB 1THCA 4S0TD 2FZ3A 4NQDA 2VN3A 1J18A 4LHJB 4Z7WB 1I1FB 1YY8B 4XNYL 2PWGA 3FTGA 1UOWA 4KUZL 1FFPA 1AE6H 1DJIA 1DBBL 4XN5A 4N2KA 4PJFA 1PY0A 1JGEB 1KG0B 1B4LA 2BRQA 2I60H 3K72B 3UC2A 4L23A 2Y69B 1KENL 5IB3A 4EI5C 4ZMYA 4UV4H 3BDYH 2CMRH 4RWYL 2OMVA 3ULUD 5FFLA 5I0YA 2EE2A 1FF5A 1VZIA 4R2GC 4JFQB 1KDJA 5ICYB 3KH3A 2OKMA 4HS8H 4GINA 1E3FA 2VRAA 5A2LH 4JG0H 1N5YL 2BHUA 2P42B 3KL0A 4AENA 5JO5A 2J8UB 3WUWG 3WFBH 1U8IA 2HFEA 3CZNA 4NENB 1GCYA 1QZ1A 4NO0B 3ZE0B 4FHKA 3VGBA 3JV0A 3GHEL 1GGTA 3WS6C 4JFSA 4WTWA 4RMQA 3VH8A 1WAEA 2WPGA 1A6AB 4DZBB 4B0MM 3IF1B 3CLWA 1I4FA 3F83A 4P5TB 4P23D 3O3UN 4G2AA 4UT6A 2Y6TE 4F2FA 2DI8A 1AO7A 1J87A 2QADD 4XPBH 2ED8A 1AIFA 1S7RB 4ZXBC 3FU3A 3NZHH 3NDZE 4EAEA 4W4OC 1M57B 3T4YB 5CGMA 1CO1A 4URTB 3R0NA 1EFXB 3QXDA 3RYMA 1A4KA 3A4DA 4IIQC 2WN2A 3IGKA 1M9SA 3KLHC 3KCWA 4MS6A 1EBPA 5LAXB 4N6QA 2YD7A 2NXYC 1CD9B 4MNQD 1F6AA 4G7QB 4I0PA 1C5CL 3PQYE 2NY2B 3O2VL 3IBOA 4CN6A 1N2RA 1U8PA 1E4JA 1AIFB 1YNLH 4RLDA 1FH2A 1NGPL 1OE2A 3S2AA 2B08A 5GGTL 3V6FA 4K8RC 1F4XL 5IHZB 4G11A 4ELKA 3SPIA 1RZGB 1R34A 3MXWL 3IJEA 1JFQH 3ABZA 3KYAA 4C56D 2BIIA 3FPXA 2ZAHA 3TA3A 4E68A 4G7YL 3C6LD 5J1SC 1KCLA 4DGYL 4CMHB 4WLCA 2ZOUA 4X6FA 4AL8C 1HEZA 2HRGA 5F72S 1B4TA 4YSRA 1T83A 3O0RH 3DX7A 4WHTA 4PJFF 3BPLB 1BM3H 1N2RB 1TJMA 2B1AH 2H0JA 1JGDA 4ANKA 4L9LB 4DQOL 3BAEH 4ZAKD 4R7NA 3LZNA 4KAQL 3QDJE 3OJMB 1B88A 5E4EB 3BLKA 4ZJ9A 5EF3A 3D0VB 5IBTL 4Q74A 5KVGE 3NJXA 3KBPA 1D5ZA 5AD0B 1U8CB 5BPPA 1VFOA 1EHNA 2XIIA 3KJ4C 3GJFB 5F9WB 1W72L 1DCEA 3T3ME 2ORBH 4AGQA 4FXGB 1JHLL 3FO9B 3GMLA 3OAYK 1E6OL 3WHXB 1TPXC 3W2DL 4ZS6C 1RUPH 5IHHA 4K9EL 2LLGA 4HFWB 3UTZA 4K7PL 3U2SA 5DA4A 3RNQB 2XIBA 4HJUA 4FQHB 1Q72L 4EZJA 4X4YB 3D5OF 2Z8VC 5I26A 4B9GA 2P28B 5MI0C 4G1EA 2V7NB 3UTTA 1ZT1A 5DEJA 2R2EB 1I9JH 2X7LB 3L6FA 3AREB 5DC9B 1HDMA 3NQKA 2EDEA 1RHHA 4ODHH 4YHKL 3ZKXC 5JOFB 1MVFA 5E6UB 1CJYA 1D9KA 3NMEA 4X42A 2YLKA 2MHAB 2BJMH 1SFDA 4LLYB 3H9SB 2FATL 3NZSA 1TJHH 4EUPG 4U7KA 2YRPA 3ME0B 2BW5A 3TA3D 3O6KL 2H1LM 1SF3A 4IRSA 4YO0A 3DUUB 3NAAL 4HJGB 1ZCRA 3ARED 4KTYA 3LZQA 4L1BA 2FR4A 3BUQA 4N1CA 3FFCE 1JHTA 2Y2TA 4Z7WF 9CGTA 5L2KA 2LABA 3CU7A 1HH6A 3RURA 1P84J 1DBMH 2LE9A 4G72B 2H3KA 4YSPA 3G5WA 3MLTB 3HAEG 2ZNXA 5KZCD 3H9SA 3KNBA 4HHWA 2CRIA 1KJ2A 3QULB 2Y07L 1WFNA 3OB8A 3BP6B 4N0CC 5CO1A 3UTSB 2HVBA 2VC2L 2HWZL 1HE8A 1O7DC 3DXAD 4N0FA 5C0AD 3UZEC 4F15B 5DTFB 3D3VD 1QR1B 4KPHH 3G7TA 1OD9A 3PABA 3MV8B 3Q8EA 3UYRL 4RMVA 3N55A 1KGCE 3AG3B 1DQQB 4S1RL 3UG4A 1GZHC 3TJEL 1KZQA 1NQBA 4UMSA 3O6MH 3PL6D 3WAJA 2E7LA 1EVTC 2P43B 5DJZB 3ZPDA 2O1AA 1TVBB 4LOUD 1U8MB 3GEFA 3Q1SH 5C0CB 3T2QA 5I1IH 4OCRH 1YMHA 5IVNA 3L9BA 1IAOA 1WUNT 4PRHE 3RVTD 4G6KL 1MWAB 1QTPA 3NRQA 1F11A 3M17A 5EBWA 2F5BL 1C1EH 1OWWA 2IV9A 1FRGH 5LQBL 2WQWA 4ZFOA 1FL3B 4Z7VA 4HKJA 2IADA 1NUGA 2OSLB 1EZVY 2E75C 1YN6A 3KW7A 2BIQA 3TF7C 3FTVA 1CG9A 3D85D 4U3SA 2R1WA 4XC1H 3WS3A 1RZ7H 4L8BB 1M7DA 2ZYIA 3GI8L 2D03L 2AVFA 2OL3H 4GBXC 3CX5J 2RFXA 5BV7C 4KXZI 2MCG1 7TAAA 1HZLA 3P2TA 1F4HA 4XTRD 3WO3B 4Y1AE 2BZCA 4UOW0 1G9HA 4Z0BL 2DQFB 1UQSA 5GS0L 5CGYC 3RFRA 2VABB 3C8DA 3HRZC 3DKHA 4MJ4A 1N67A 3UAAA 4I88A 4S2SB 2WSKA 2L7EA 2EP6A 3KPQA 1LEKA 1D7BA 4HF5L 1UB6B 1ZTXL 3ISWA 1EFXD 4O2FB 1QI3A 4BSJA 3RZWA 3PJSB 1BAFL 4QKTA 1S9WB 4W6XB 1FP5A 2DWTA 4LOFA 4PVNA 4RAUA 3B2XA 4NKDA 4NKIH 3L3HA 2X1OA 3CZSA 4YEEA 4OD1L 2XYBA 5CJQL 4A66A 5A16B 3S3CB 5F7AA 3GM8A 5J3HD 1Y6NR 2QT6A 1A7PH 2Z31B 2OL3L 5IVXA 4K07A 3WU1A 4DTGH 4TVPH 2AI0H 1Q9WB 3GSNH 5ICZB 3LNEA 1MFAL 1YEEH 3VWKD 3APCA 1OPGL 3G6JB 2CU9A 4XMKL 4X6DF 4Z7OB 5GS2D 1TMQA 2WLHA 3O2VH 3EYOB 1B9KA 2Y7NA 4J3SA 4M8RA 4WHYH 1DVFD 1VFMA 2CQVA 5I71C 3D0VA 4G9FD 5F9OH 2P5WA 4DESA 1N5YH 2A83A 4ERSH 1RMFH 2HB0A 4AKQA 2BY2A 3I6KB 1OEZW 3ZKQD 1BM7A 1I8KB 3GSOA 4EUPH 1DJWA 4BGLA 3L8QA 2E56A 5EU7E 3VGAC 4XNUH 2IGFH 5GZND 4JG1H 4J3TA 1PW3A 3DMMC 4RWYH 1NLBH 1X3DA 4UTBA 4PWKA 1DJGA 1JGVL 3EGDB 1VA9A 4LASH 1FPTH 3R4DA 1D5IL 5E5LA 5L0QB 4XX5A 1HNFA 4JFOB 2YOCA 2DQGL 4JDZA 1HZKA 3J27A 5DJAB 1R3KA 4HFWA 3UTZB 4XCFH 3I9AA 1OF0A 1QSFD 1HOCB 4PS8A 1SMAA 4X4ME 1KC5L 4MVBC 1YMME 4I3RL 3NCYP 4P5TC 1N64L 3R7QA 1GJIA 3V0IA 1JUFA 4IBSA 1ZEAL 2R0LL 1GKEA 4I77H 2OMWB 2UX7A 4W9JC 3EGXA 3F3HA 5DJAA 2A6JB 4OLUH 1YLBB 3QJTB 4I18A 2WLJA 2XQYK 1QKZL 4MDRA 2Y2WA 5DRNA 5HI5D 3U0TA 1HYSD 1B2WL 2QSTA 4XNXH 4TUKH 4U6VH 1G7QA 1OF2B 1FORL 4FQXD 4LSTL 3C8KB 4IDJH 2XXFA 4NHCL 4UT7L 3WL9A 2UVEA 4PGBB 5CD5C 4HK0A 4AV5A 1EO5A 2E3VA 5CBAB 1NBYB 1GSKA 1KGIA 1I3RA 2LLNA 3VFOB 4PGEB 5DUML 3LIUA 3WHE1 1T1WB 4WAFA 3V4PB 1N0XH 5KVEE 1Z9PA 3IAQA 3KPSA 4AIZB 3GSQA 1CDGA 2C3VA 3EDJA 1OARL 1A6PA 3NIFB 4HT1H 1FO0H 4UTBL 3PHOB 4WWKD 3KHQA 3IXAA 2QQKH 1SVZA 4PY8J 2EIDA 4Y0GA 2A2QT 1CXLA 4NT6B 3E1F1 4GG6F 2IBBA 3CWGA 4HK0B 4YHPB 1FJ1A 1IEBB 3POHA 4DP9X 2YBRA 5K33A 1A6UH 2QTEA 2XN9E 1A5FH 4MXQD 3T4AA 1RUKH 4NQVA 3FRUB 4ZUUA 5AAPA 1DVXA 3K4AA 4L4JA 5F6HI 3O6FB 5IBTH 5FC9A 2H3NA 4P5MA 1FNEA 1X9UA 2XPZA 2XQBH 4JUTA 1OGPA 4MZ2A 1NWOA 3CVHB 4PJEF 5GGRY 2X6BA 1J10A 1B9ZA 5F6IB 3NJIA 1IGYA 3FJTA 1ZSDB 3HE6D 2JXMB 5DUMH 3KR3L 4L4TE 4HWUA 5ID1A 5LG6A 4IMKA 3P3RA 5AAMC 5HDWA 4L8BA 4ZMPA 4ZOAA 1JGEA 1UM4L 4XNZB 2EH8H 1G7JA 4P9MH 4BA8A 4ELME 5C08D 3H3PL 3JTTB 5ENWB 1O6VA 5CBEB 1BOYA 4QRTB 1XF1A 1G1YA 2XJKA 4KX7A 3ULSB 2FB4H 4ORZC 5EB9A 4CSTA 4HJJL 4Z9KB 1CYWA 1UQSB 5J0BA 4GAYA 2MFNA 1QPPA 3QQ9D 1ZGLA 2DBLL 1DVZA 4JQXA 5SWZE 4U1KB 3NIFE 3LV3B 4F93B 3VE0B 3U79A 4F24A 2C34A 5BS0D 2OJEA 2VR9A 2IMMA 3M45A 4PRBB 4GG6E 2EUWA 1SJXA 1X5MA 4NKDB 1NGWB 2WLNA 3L3OB 4FHJA 4NFBA 3ULSA 3F05A 1FZOA 4DPCX 5DZOA 3EUDA 4H2AA 1ROCA 3FB6A 4V1DB 3S5YA 3JWNC 3QI9B 1UCBL 3MUJA 4WEUD 1QRKA 5EWIH 1XMEB 4U1KA 5C0EA 3KDPB 4QLRA 3FFDB 4LL9A 3MRPB 1HL5A 2G9KA 4PJEE 2PCXA 3VFGH 3U7AA 2DQGH 5AQ0A 1P1ZA 4O51A 1J12A 4Z7OF 4MJIA 3NFPB 4PRBA 1MSPA 3FKUS 5ID0B 4HUXB 2WIMA 5D6DC 3V6BR 3L1EA 4M43H 3UYRH 4TUJA 2HJKB 4M7ZC 5GJSL 3IKKA 3BKMH 3HJ0A 3QXDB 4PJ5D 4XI5D 2GAZA 4K0OA 3FUNA 3UJTL 4G42A 1SQ2N 4P49A 4Z18A 3DX4A 5IP4A 3QCUH 1XZWA 1MW1A 2XVGA 3EKCA 1S46A 1IC1A 4NZFA 4TL5A 4UDUB 4JG0L 1HILA 2D3VA 2JF1A 2QSVA 4NKOA 4QXGL 1HXYA 3LPPA 2GBTA 4MB3A 2BWQA 4C47A 3EOTL 2GC7C 5DZNA 1CLYL 4JRXB 2WKLA 1SLWA 4IKJA 1S5HA 2V9QA 2ZCLH 1WWBX 3NZ8A 1RUQL 2BCKA 4R7DA 4CKQA 3M1BA 5F7HA 2DQDH 3F6LA 4B9FA 2ZCHL 5BRZE 2NX5D 2PUQT 4LSTH 4RDQF 2AS5M 3DSNA 4X6CF 3MLYH 3PRZA 5LGJA 3DK2A 1NCIA 3L7FA 4QOKE 3H2WA 4HJSA 1SHWA 2ZUQC 2EDDA 4PJEB 1MCEA 5ICUA 3EJQA 1XXFC 1G9MH 2YSSA 3V9FA 3WMPA 2PW2A 5AYQA 4Q9QL 5GGVH 2KBGA 3K4DA 2JCCB 3QYNA 2SODB 4U31A 1ID2A 4ZDHA 3SN6N 1DDHA 3IETA 2QSQA 4UQ3A 4HUUB 1RIHL 4GUPB 2WYHA 3CXDH 3P77B 2IPKB 3CXHK 2AV1B 3QZBA 1IARB 5EORH 2Z93A 2A9NL 8CGTA 2WHVA 3X3FH 2WSPA 3W57A 3NJNA 2I25N 4NENA 1NEZA 5FYLH 3SKUD 5ABZA 4KY2A 3RZCD 2D9CA 3D3VE 3QQXA 4NYLA 1ODUA 5I82A 3MQIA 4X8JB 3GI8H 1HAUA 4PBVC 3DDGA 5T3XH 1YPZB 3BRGC 5C0IA 1XGTA 1IQDB 1T1ZB 2F58H 4IBZA 3OX8B 4JY6A 1LJMA 1B2YA 1U8JA 1X4ZA 4NUQA 4F33A 4H1LA 12E8L 1JN6B 4NQXA 2X4PB 4NDMA 3BN9D 2E86A 2XRAH 2ITEA 3SPGA 3V0EA 4Z8FL 5ANHA 3NCWA 2UZPA 1AI1H 2XX0A 4PJDB 1KXQE 4TKWA 5DK2A 2KDYA 1L0QA 3VQ2C 1N70A 4P2RD 2LGNA 2DN7A 3CMGA 1Z5HA 4DPAX 2E4TA 1PKOA 2C7UA 1WA0X 4Y5VC 4OUOA 5D8JL 5E0QA 4A7GA 4HJJH 4WIQA 1FJ1B 1IEBA 4R8WL 5LAXA 3ME0A 3SE6A 4Y4FA 4YBHA 4ODBD 4QCIA 3IDNB 1T20B 3Q1EA 5JXEC 1JPEA 2XHNA 1WP6A 2X9XA 5CJBA 1S9VA 4M3KB 4GW4B 3UIZA 2Z6FA 4UU9B 3RGHA 2IOIA 3QDME 3VI4F 2WLIA 2Z7ZA 2XZCL 2FJHB 4I13B 1I7ZB 2FQDA 3AWGA 3KYNB 5K1NA 1XIWB 4LBAA 5HYSG 4CMMB 1YQVH 3FB8B 3FO2B 3SE9H 2W9EL 5C6PB 1KB5B 5D9SA 3ESUF 4F9LA 3QJOA 2G75A 3NZUA 2R27A 4K2UH 2PYEE 4RDBA 5D7LE 4S1SH 1QR1A 2WVSA 1IE4A 5B38B 1XD0A 2KZKA 4FQQA 4POYA 3CSFA 4XHJD 4NC0B 4GUCA 4DO5A 4QJ4B 1BF8A 1LO4L 4KKRA 2XKNA 4CC4C 1A3LH 4J3BA 2VGLM 4HZLA 5I17B 1RZJH 5E8EB 4YHMH 5H4YA 2ZXAA 1S7QA 3CVHH 4JM2D 1YZZA 4OM1L 4WWPA 1T0PB 4XNAA 5HBBA 5TF1H 1OE3A 2Z64C 3CG8A 3L4YA 5F3BA 5DT1H 3WOVA 1E3ZA 2DLFL 3QEUB 1SXBA 1PS3A 1VAHA 2NY4B 3VYNA 3EO1A 1IEAA 4X6DB 4KV5F 2M2DA 4Y5YC 3G04B 3GSWA 1AMXA 3GNMH 4IHOB 1CB4A 5GPRA 5DK0A 3QORC 4R5XA 3QDMB 2OTUB 5J12C 3U36A 3WEMA 4MBOA 5I1EH 5EEXA 1R47A 1SEBA 5GRJH 1JMZA 1WZKA 1RIVH 1T22B 1XH3A 1KJMA 1ZA6A 3KPRD 3MRIB 4IGBC 4WUUD 5FIEA 3VFPB 2RFXB 1Z3GL 2WZAA 4L4VD 5C07A 5TQ2H 5LKNA 2YGPA 1MIEL 1UT1A 2IDTA 2Y36H 4W9EC 3PQYB 4Y1AD 3INUH 2DMCA 3FUKA 2GAZB 1IEAB 3UC0L 2XWRA 2VABA 4LPCA 3U4EA 1CD0A 3LD8C 4LLYA 4JFWA 4S2SA 5M7QA 3BKCH 3QO1A 4P9ML 4PRNA 5IK3B 1TUPA 4WNQB 2K8QA 1BBJA 3QUYD 5A2CA 3MCKB 4KHXH 3EAKA 1H8OA 1SOQA 2WNGA 3GBLA 2J5LB 3FU0A 3WENA 4PD4J 3V0VB 3D9AH 3K6OA 1MCPL 3UL4A 1D5IH 5D1XD 4X0KA 1RPQA 4ODSL 2ICWA 1D6VL 4HVBA 3VXPA 5CIPA 4R4NC 3RJQB 1I1AB 1RLBA 2F7QA 1UEMA 2Y36L 3N40P 4N0FB 5E7BA 4UAOC 3DV6B 5EU6E 3FT3B 1UOKA 3EYOA 3ZRCC 4AC2A 2CK0L 1U0QA 4X4XB 3D05A 3IETB 2V17L 4G9DB 3V0WH 4U1IA 3QEQD 1N68A 4HEPG 3BAJA 3R7RA 4PTTA 2CHXA 4GS7B 2EDYA 3GSNL 4ZTEA 1Z9NA 4GIOA 2EO9A 3MGAA 5B21A 4ETQB 1N8OE 2AF2A 5FPIA 1EAPB 4M5TA 1YO4A 1FPTL 2JJWA 5DGQA 1ETA1 4P59H 2JB6A 1LWHA 1JF6A 1YEWA 5E9DE 1BWMA 3I3BA 4LLWA 1KT2A 5INCA 5DO2D 5LN4A 4H1LB 4HJ0C 3BT2L 3NJHA 2B59B 4XP6H 4Y5YA 3KVDD 4HIPA 1JHKH 5EC1A 2O6CA 5AL8A 4HULB 4NO0A 4ONHB 3ZSSA 3PWLA 5CM1A 2GC4C 2BP8A 3SE9L 3QUYA 1BEYH 4PY8I 2DYPD 1J86A 5EU6B 3OWEA 3WTUA 2Y06L 3CX5K 5C7ZA 4X9FA 3GBNL 2IOOA 4QLWA 2EXWD 1AJ7L 2MIZA 3DVGA 5AB9A 4QTIL 5J11C 2AI0L 2W60B 2WCGA 5DHMC 4L4VA 3FHQA 5C07D 2AV7B 4AJ0A 5J9PA 2AQ2A 1NGZA 1BPLB 3HRPA 2J71A 4HKBB 3CFMA 3N2JA 5GHWH 4MD4B 1VZGA 3HN3A 1H5BB 1E7UA 1HC1A 1NBZB 4PCYA 4PS3A 4RBPH 3T3PF 2J25A 3GIVA 2BP3A 5JXAL 3SDCC 3GTVA 4EDWH 1FL6A 3RB7A 5E9DB 2X87A 3RUGE 4JE4B 5EULV 1MXDA 3ZW3A 5IMMB 5ISZE 5EG6C 1QI4A 1MCNA 4FZ8H 1BVLB 4JQVA 4HC1H 1KTRL 1PGRB 4W68A 2IC2A 3L3JB 2XTLA 1D5MB 3SGKC 1BQHA 2HT3C 5B8CB 1ZE3H 2JFCA 5ICXB 5T1JA 2KI6A 3BZEA 1B0RB 4TPRH 4HWZA 3OR6A 1FNHA 1QEXA 2N7SA 4M5SA 2WNKA 2XWXA 2GT9A 1M71A 4XTRC 3AS0A 5FUCC 3U1PA 1JPSL 2GTZA 3BAWA 3FS9A 6PCYA 5HTSA 4WWKC 1DBML 1TJIL 4X5WB 4R8WH 4ZTPH 1R5WB 2EECA 2V5TA 1ZV9A 2CD0A 3GSWB 5DRZA 3B2PA 1DL7H 3QR0A 5D93C 5DJXB 3UJJL 1PZ5B 1D5RA 4OLWH 1SEBB 1OAZH 3OR6B 5EOTA 1G7JB 1EXGA 4RIRA 4EIBA 5E8DL 4Z23A 3OLGA 5IJKC 2IWGA 1S7UB 4LF3B 1UZ6F 2PXYA 4UOQA 1AZVA 1UB5A 2AK4A 2XV3A 1ZMYA 4HUMB 1A14H 2F58L 2BIPA 3MLYL 4N6RB 3EHBB 1T66C 2AEPL 5D2LA 1E9OB 1UASA 4XPTH 3ETSA 3SYPA 1NEUA 2B2XH 1I8AA 4MJ5B 5EBLB 3UACA 5LWYL 1BBJB 4IW4C 3U9UB 4B3VA 4OZHF 5AWNH 4UTAH 3QCVH 2F61A 3PAZA 2FECL 5F7EL 2V7NA 1CF8L 2FIKA 4K15A 3EYFB 3ZTJH 1CFQA 3TBVB 3ZTJG 1OAJA 4FQCH 5DJ0A 4JFEB 3V8OA 1UB5B 2AK4B 4D9QD 4URKA 1PY9A 3WN6A 1A64A 2K70A 3WMSA 5HHNA 1T5XB 3G6DL 2VDPB 4N1HB 1QSEA 4OKVA 5K9JL 3IEAA 1KB5L 4HMCA 4CJ0A 4XCCL 1PD0A 1ZPUA 1RD6A 3FSOA 3QIWA 2YKLH 3W5NA 5C08E 2Z92B 3RILA 1H3PL 1HU8A 4JM2A 2VQUA 3N44F 2ITDB 3MV9B 2DMHA 4F2ME 2CDFB 5DVLA 4XMLL 1TQVA 3LZFL 2XNAA 1H8LA 2FL5A 3DPDA 3MX0A 3ARBC 1Q94A 3APDA 2XFGB 3CCHB 3K0YA 3ZR6A 2ZJSL 3CNKA 4PTTB 4ZX4A 5KBKA 3CFBB 2WVVA 3TO4D 3VGFA 35C8L 1KIPA 3BDBA 3GJFH 3WO4B 5JW4Q 2J6EL 3T0BA 1E27B 2OYKA 1G7MB 2HFGL 1UC6A 2BCKB 3L9RB 4R7DB 1TETH 4X9YA 5DFAA 3WTYA 3CVBA 2DLGA 3C6LB 3ZKSD 3MCLL 3VXNA 2VLKD 4IU3B 4JFEE 4PWFA 3JYBA 4NQCD 1BV8A 3SKMB 4V1DD 3EJYC 5BOZG 2OS7A 3H4FA 1NCAL 4MFHA 4TUUA 5IWLA 2FWLB 2WGNB 1LLAA 3PWLB 3WNIA 4H0GA 3EH5B 5C08B 3NEOA 2YK1H 3CGTA 2NYYD 3WNPA 2CLRB 4GXVL 5CCKH 5HY9B 3OSKA 3HHRB 4LE8A 1BG1A 4P3CL 3L5XL 2Z93B 4M9OA 2DIBA 4IRJC 4PW4A 2IG2L 2UYLA 4K9EH 2VUOA 3SDDD 4L1SA 4MZIA 2QKIB 4J3OC 3UBGA 5ANME 1G1KA 5CU5A 4DJMA 4PJ6A 4ZQKA 3Q8FA 3VFWA 1WH0A 1KBPA 1PLGL 1CGSH 1W2KT 1SLXA 3WSQH 4X6BB 4MMXC 5LAPA 1AJ7H 4JFQA 3SJVE 2WZPD 4L8DB 1ZANL 5D4JA 4PQXA 3RWGB 4LAQH 4GJTB 1PU0A 2F7IA 4R97C 4LRIC 1V55B 3CH1B 5FV1L 1DVSA 2ZUXA 4M4RA 5D7JC 3A23A 4F58L 4ZMAT 2BPBA 5L0QC 5CLXA 1M2OA 1NC2B 3JUYA 2YRLA 1S7VB 3CIAA 5BS0A 4XVUC 2UZXA 2VXVH 2X4TA 3VH8B 5HYJD 5C7XH 3TNMA 3CN0A 4XCFL 1Q1PA 1NMAL 5FF6A 1XGUB 3QJFA 5CD3A 4HIJA 4EVNA 3VGAB 1PD1A 3H53A 2UWEE 1C8QA 3G5ZA 4JM4L 5D1QE 4ADIA 1Q9WA 3LH9A 4HOXA 1T20A 5I8KH 3MNMA 5ICZA 1EVUA 4KQ3L 4MWFA 4Y4KA 4YHML 1Z1WA 5J7CC 2YMOA 1NCHA 4B9PA 1HSAA 4JNXA 4DWHA 2OR9L 2OL3A 4MLIA 4N0UE 4ELMB 3NFNB 4BFIB 3GK8L 4X5WA 1X5AA 5GGTH 2HT2C 5CWSA 3CFEB 1DLFH 1MREL 2WQXA 3SGDI 2VQ1A 5CZVH 4QHPA 2W59A 5E6IC 4QRSB 5DHYA 2QKSA 1ZVNA 4PJAE 4TNFA 5JPMB 5CGBA 1BQ5A 4MTMA 2CO6B 4NOFA 5I1DB 4LGRB 5C2BH 5D70H 1F8TH 2D2OA 4QY8B 3FUDA 4G8EB 5E2VH 4AI7A 4RRPA 3ZGHA 4NQCA 3WIIL 3SYQA 2XV6B 5DVOA 2D73A 2HG0A 1GZPB 4DT2A 4BRJA 2W9LA 4QO1B 1MQKL 1S7QB 4BUGA 1KJ3H 3DX6A 1HCVA 1ZHLB 4HS6B 4JDVA 2QHRL 5D1QD 2EVFA 1L7TH 4E36A 1KGUA 4U6VL 2YQGA 1VPOL 1Q90A 4OGZA 2F19L 2UWEB 5KUKA 1V7ML 3TV3L 4HLEA 3ULUE 2QGCA 2BERA 3Q06A 3QCUL 2NW2B 1UATA 2K3HA 1AI1L 1JUFB 5JW3L 1RY7B 2ENJA 4FLSA 2R29A 3F62A 1KSRA 3HB3B 3P4NB 4APQC 4TYUA 4KZEL 1QSEB 1U8JB 4EZKA 4F33B 4G1MB 2H0FA 3AUVA 5IVXF 4WJ5A 1OY3B 2VLJE 4I3RH 2WP3O 3VD0A 5KSUA 1O6SA 5DEFB 1RJCA 4WGVB 2MKWA 3RHWF 3MC0A 4ZI8A 1JF1B 2ITDA 1HIMH 3BW9A 3MV9A 4I9XA 4KTDL 2LFGA 4KVCH 5IZ7A 1S78D 1QSED 1RZ8B 1XCQB 3WTSA 4G6MH 2LU7A 3BH9A 2BZ7A 4D0CA 2H9GB 4A2MA 4Y9GA 3FSAA 5F1NB 4F8TA 1ZT7A 5EIIG 3CZFB 5FO7B 2E8YA 5C3LD 1NM4A 1X4YA 4UI2A 2WQRA 4X80H 1WFMA 4ZOEA 4AM0A 4ESKA 1CK0L 2OCCB 3LNGA 2ZKHL 3WO4C 3ZDXB 5KYUA 3KBEA 1JZ5A 2DQEH 2W0FA 3IDIB 2WLIB 3FTGB 3FRPG 2EIEA 5CUSH 2WJ5A 1OTUD 3AG1B 2HMIC 1T2XA 5INDB 1FFPB 4AGLA 2K45A 4OAWB 3X2QB 2ZSWB 1XR8B 4HUKB 5ESQB 3SQRA 3V4UH 2WBXA 2XV2A 4YAQB 1YEJH 4LHUG 1ZA3B 4C59B 2H41A 4NQVB 5JHDA 3LPWA 1CMOA 2CO4A 1MI5A 2Z65C 4GRLB 4AM0B 5FYKU 3L3IB 2XWBA 3PL6B 2L7UA 3TT1H 2HWZH 3WEXB 1LYQA 2A3TA 2F9BT 4FQQB 1DO5A 1JK8B 3D4ZA 3LKNB 4MQSB 4BFGA 5I6KA 1K3ZA 4KITB 5ICYA 3K4ZA 3MV7D 2CLRA 2JJUA 4KUCD 1Z0MA 2DLEA 3U1SH 4FZEH 3MVSA 3HRZA 1UXWA 3D69A 2OMNA 3QC6X 3JTTA 5C0GB 1PCXA 2W38A 1J0KA 1G7IA 1KJ2H 3EXJA 3ZDYE 2CM5A 3TBSB 2CBQA 1ZPLA 2X4OA 2OP4L 3FULA 1A4CA 3E6FA 2H26B 4NPYB 2QQQA 3V52H 4KJQC 1A7RL 3B6SA 4Y8AA 4HDIB 5ADPH 4GW5B 3FUFA 4DAGL 1CUOA 3QORB 3FTYA 3I3EA 3BVNB 3V8CA 4P59L 5BUGA 4QXUL 3DHUA 1WUZA 3RTLA 1WVZA 1IAOB 5AVSB 3CQPA 2XT1B 1YEDB 4G6AC 5ALCL 4EN2A 5BVJB 5EPMA 5C0AB 1HKLH 4KKLD 2V3EA 4I18C 3RGBA 3FRPB 2G30A 4JDTL 1GHFL 3V55A 2EYSB 3QG7H 3U6XA 4B9ZA 2ZPKH 4PJGF 1RU9H 1QYGL 1G0XA 4MQ7A 3GMPB 1J0YA 3QJFB 3L9EA 4WNQA 2VR6A 2V17H 4F57H 5I2IA 3KM1A 1M7UA 3M7FB 4C4BA 3T9WA 1ETZA 5HHMB 1GA2A 4DK3A 2NTFA 1NGZB 1KMGA 1CXKA 1XGQA 2AXFB 4L2YA 1LO2L 1RZGA 3AXLA 4YZFF 3IGAA 3ZUNC 2DL2A 2VSMB 3D8MA 1KCVL 3UTOA 4WTXA 1NUDA 4H8WL 5EBGA 2HKHL 4P4KB 2VQ1B 4X98B 4HK3N 4JHWH 3IRPX 2RHEA 2AABH 5B3JE 1F6AB 1HQ4A 5KSBE 5LDSA 2N7BA 4U1HB 1EO8L 1KBVA 3BWUF 5GZNA 3DX9A 2NTFB 2K3TA 2LU4A 2BOCA 4LESA 3VRIB 1K6QH 1BVLA 3V10A 4AQ8A 2J8HA 5HSFA 1G7PA 3A4AA 3L4ZA 4JRXA 1AHMA 4ZPVB 4HCRH 1UWGH 4DH2A 2HYMA 3WBDA 1T1XB 3VXME 1KCSH 2R1XB 1FNGB 1NAKL 4DVBA 2FRGP 3Q43A 2RACA 3X1FA 3PF2A 3U2JA 3W39B 2X09A 3UC0H 4L9LA 1FG2A 1TR7A 2P8PA 3UBXB 3VWJA 1MJJA 1AYOA 2AJSH 2J1ZA 4GQQA 5J12B 2XZAL 1DFXA 2VXUL 1CI5A 1IC4L 4JRYE 4ZPVA 1GRWA 1F8TL 3F5WA 4LLWB 1PZ5A 4MXVF 3JWOL 4W9GC 3S36X 3VGDA 3ZBMA 4LT7A 5ES4B 1W0VA 4YVNA 4WF7A 1YCSA 2A99A 1ET8A 2XOTA 3IPEA 2JIXB 2EDTA 2BOBB 2C3HA 4EI0A 1CD1B 4N8VA 1Q72H 4ONHA 3UYOD 3V5KB 1BG9A 1T6VN 4NYLB 5E2WH 5JIMA 1C5BL 1EUTA 3WD5H 1G5AA 2OMXB 4TVPD 2E9WA 32C2B 1JZFA 3CVHL 2N4IA 3QZOA 4WU5B 3S6CA 4G7YH 4JAMA 3IMUA 3VXQB 1SPDA 3B7YA 1IVTA 3IDMA 4HAFA 2UZIH 1XGPA 4K3HA 3IDGA 4OV5A 1HI6B 2UV3A 1EJOL 3NTCH 4I0KA 1N6VA 1ORSA 1X5IA 1HH6B 2J5WA 2ZXDA 2J88L 4ACPA 1MIMH 3BDXA 4NBZB 5DVMA 5IGXH 3ZLQC 3IU4L 1FZJA 4ZNEA 4Y4FB 3OMIB 2HKFL 1NGXB 3MOBH 1MCIA 3CHQA 1PLGH 3MBEC 2D2CC 5AEAA 2H1PL 2YGQA 4KI5D 2WXNA 2EEFA 2GTWA 3IKCB 4N2OA 4MB5A 2HRPH 4H8QA 3ET9F 4DUWA 2ZQKA 3NJGA 4P23B 1ZXKA 2HT4C 5IJVB 1GY2A 3I2CL 3OR7B 5JHBA 3CV5A 3U7WL 2FL5B 2E9BA 1K9TA 1QFHA 4FNPA 1NLBL 4U1GB 4F91B 1ITCA 4MD0B 4J8RA 4IOSA 4B5ZA 5C0CA 3HC3H 1VGEL 3UAEA 4RCAA 1J8HE 3OZKA 2FECI 3P2DA 1JS4A 2IIJA 3FCSA 3VI3B 4HZAA 3TFBA 4X9BA 4YN3A 5KVGL 3VFMA 2GFBA 1ZSHA 4L3EE 3TVMB 2BX5A 4LARL 3GT6A 3QA3A 4XNQB 3ZKNC 3HPJA 3PABB 5C0BE 3TBSA 5I9QC 3LXBA 5C0BD 1RCYA 3BUTA 3B9VA 1BF2A 43C9A 3E6FB 4HGWB 1YN6B 4P5TD 1A5FL 3C6LA 4ZW8A 3RGVC 2RMNA 2BLFA 5E99L 4M6NH 2DL9A 5DR5L 2Y1VA 4YHPA 1AIZA 2OR8A 2YGNA 3QH3A 3T8MA 5IV2B 2AJXL 1IFHL 4BUQA 3PUUA 5EUKA 2OSXA 1MWAA 2BINA 2WXRA 4JPQA 2CMRL 3ZU8A 3AZUA 4XR8C 1DN0A 2H3NB 3JUZA 4P5MB 4XAWL 4HKJB 4GB9A 1VFUA 3L08A 4PJGB 4L2LA 3M46A 4ZMLA 4B5EA 2Q5BA 3GMMB 4YDLC 3G6AB 5J57B 1TSRA 3PS6A 3M8OH 1E9OA 5SWSA 1DCLA 3OLIA 5CEZD 4MA8L 1M7DB 2EADA 4Q7DA 4UYQA 4YGVA 1OZTG 3KH4A 3U7YL 4O2FA 1PZ2A 2F1BA 5IOPA 5IROC 3VXUD 2SEBA 3UMNA 4P46C 3WFEL 2WGXA 3VFUB 5TJWK 3F64A 2E7LC 3JTBA 2ID5A 4OQTL 5AW3B 5J6HA 3AXLB 4XPGL 4R9HA 4W81A 5DU7A 3VCLB 4MYPA 2VJ0A 4OCYL 4WTZA 4A37A 4DN3H 3Q3GA 5HHNB 1LDPL 3BD3A 3MODH 2V9RA 3UDWA 2Q0ZX 4JN2A 4LCWD 3VE0A 1W0WB 4OJEH 2W92A 3RRQA 3WFHB 2H4EA 4KZ0A 5JORB 3C87A 3THMH 3U0PB 4FI8A 4AQEA 4LLVB 2VDLB 4TTDC 4BK8A 1X5LA 3AAZA 1DJSA 2MPVA 5I0VA 1BZ8A 1EDYA 3PP4L 4LQFL 6TAAA 4GMTH 1JZIA 1WAAE 4AT6B 3HG4A 1U8KA 1RURH 3HE6C 4JN2B 1TQCC 4JQIL 4M7KL 4U3XA 1ZIAA 4XBPA 3X1NA 3PDGA 2WVVB 3H7BA 3BKJL 4LASL 4MB4A 3EGDA 3GB7A 3KLQA 1O75A 3NJFA 3GWJA 3KXFA 2YEVB 4XBEH 5HGHB 4X7CC 4K5OA 1G6VK 4NM8L 4POZC 4EKXA 1S4IA 3WFDL 2G0KA 4L3AA 4M93B 3A4FA 1UZ8A 2BNUA 2NCMA 3QNYA 4FFZL 4KTEL 4ZFQA 5KSAC 3X14B 1W0VB 5M95B 5T3ZE 3MLWL 4PIRF 5I75B 4B9YA 3PDOB 3LKQA 1ZV2A 2ZYSA 2OA9A 4U2YA 2NY4D 1YEIL 3QZWA 4W6YB 3KW8A 4F37F 2MOQA 3MRJA 2D3LA 1JYWA 5JR1L 4XMKH 1L4IA 3S8FB 4QY8A 3S7GA 5IW6B 4IYKA 3D48R 4L05A 3MV7A 5GGVY 5TTRA 1W8NA 4DEUA 1LXMA 3ARGD 3Q9QA 1FE8L 1PIGA 1R3KB 3S48A 3WGVB 4OR1A 3KYKH 4LEEA 3IDXH 1UYWL 4PS4H 1YYMH 1A7PL 2VITB 4O2CB 1KT2B 4YLQT 5INCB 3IDMB 2BNQB 3MOQA 4JX0A 2DMKA 1MJ7L 4IGBA 2R69L 1WAAF 3L7FB 4LCVA 4I3GA 4YL4A 5HGBB 2A74A 2OZ4L 3NG5A 3MGOB 4F7PB 1IL1B 4BIKA 2YXVA 5I0WA 3C8KA 3FU6A 4FABL 1GZQA 4B3EA 1KF9B 4UM9B 4FTVD 4ZW7A 1PAMA 4ZDHB 3CFDA 4P2RA 4MRBA 43CAA 1GW6A 2A6JA 3NIGE 2MNWA 1OT1A 2OQJA 3VM7A 4PGEA 5F7YC 3RKDD 1TSHA 4WJ5B 3MA9H 2X0UA 1I1YB 4L4VB 5J9PB 2XLLA 1O6SB 3KHOA 5DEFA 1WA2X 1RZQA 3QWOB 5C09A 5JQ6L 1G7QB 1OF2A 4ZPTA 2MQ3A 3EDKA 3PHOA 3FSVA 1EEZA 1QFWM 3LXUX 3R0MA 5A2AA 5FYKH 2F15A 1OWRM 3PGCB 1MFUA 2XVLA 1KOAA 2WB1A 5EEVA 1LE5A 5E8PA 1YPZA 1E5BA 5E6YA 3RZCA 3GBNH 4Z7NF 1P5VA 1L0YA 5LNEA 1A0QH 5FO7A 1Q9LA 2PABA 1I9EA 3SE3A 4MA7H 5E1AA 1P0SE 4RQQA 1UA3A 3BEVA 3VG0L 4QRUB 5HHOB 5HYJE 3JWNE 3SE8L 5IMMA 3TVMA 4Y2OB 1QABA 1MIML 1AH1A 3ULUC 3MLZL 2VH5L 3CFEA 4DP8X 5BXFA 1Z3RA 5E1HB 2FK9A 3EGSB 1HS6A 5KVDL 4B7IA 5DMYA 2IFFH 1FZKA 1NFAA 4U1LA 4A1RA 3MROB 2TRHA 3TCXA 1BZ7B 1UM5L 5F7NC 1W6WA 4Z95H 3LOWA 1S3KL 4FQIH 2ZF9A 2Q1EA 3ZHFA 4GUQA 2YAFA 4OVUA 4ZW6A 3WKNA 5DC4B 1FAKT 4TUKL 1S7XA 3PXLA 3ZYJA 2PLTA 1HHJA 3N0PB 1J5OH 3QFJE 2I69A 4OTXH 2AEQL 1DTUA 1W9XA 5K39B 2GCYB 3SBWA 3HE6A 5DJDB 3VWKC 3MCYA 3S5ZA 1CLOL 3HRZB 4RVBA 2ZOLB 1CS6A 7PAZA 1SDAB 3WE6A 2F8XC 4UB0H 4Z7NE 2AEOA 2F54A 4EIGB 4OZIB 2G75B 2J73A 4ABVA 1RAMA 3BOVA 2NT1A 5ALBH 3WFZA 1BCIA 1Y18B 5GZOD 3LV3A 3O6KH 1MHCA 3VYPA 4WO4A 1NCGA 1T4KB 4EI5A 3GTNA 3RAJH 1JCVA 5K39A 2CR0A 1UD5A 2E7HA 2JKTM 5KOMC 3LDBC 3MRFB 4N2HA 1OP5H 1DE4A 1QFWL 1FFNB 4ODHL 4EIUA 4AQEB 4BFJA 3SDDC 2LV4A 3Q6FA 5IUCA 4OZIA 3AB0B 3BW9B 4L3CA 4XBGA 2AJ3B 4FG2A 1JRHI 1G9NL 2DLIA 4MASA 2YAHA 1JNJA 2GJZB 3FFDA 1T4KA 4Z3JA 1OM3H 1OCZB 2F7PA 4FDWA 4N2CA 3QUMH 3S97C 4YDMA 5BZWA 2Q6WB 3RL1A 2VIRB 4HHAB 2Y1YA 4DKEH 3QNXA 1A6TA 1D7DA 2CXGA 3UX9B 2ZP9A 1R9FA 4GSUA 1YJDH 5D96C 5B3SB 4LVNC 4KGJA 1B0WA 3HN5A 1MFDH 3PWPE 2ZUYA 5DZVA 3EHBD 1T5WB 3P4LA 5HGDA 3H9YA 5BRPA 3ZOAA 3NSCA 5IB2A 3B2UC 3FT2B 3LSOA 4TVPL 2XFXB 4GO6B 3UO8B 5K9QG 3LVTA 4AYDC 1I9IL 4UOW1 4X7SH 4YQXL 3II3A 2MRYA 3WKML 2BY1A 5JMRA 4L4TD 3NIFF 4J7RA 3VRIA 4KO6A 2QQLH 3RI5F 1HINH 2O5ZL 3CSTA 3IJ7A 3HG1E 1SBSH 4LVNB 2ZYHA 1JK9B 3LKNA 3LHPH 2ITFA 2PPFA 4YSAA 4K3JL 3ES6A 4JPVL 5D7IF 3VXNB 3C2SA 5DRWB 1W72B 1FN4B 4F2EA 1KG0A 2QV4A 4WFFE 3AWFA 2DQJL 3LPFA 5MENE 4DP2X 1UACH 5GS0H 1AQMA 4JZNB 1C5DA 1SXSA 1Z7JA 1DFBH 2PCFA 2PXYD 3ARFB 3Q2VA 4O58H 5DLML 2A74B 1RZJL 5HJ3A 4U2ZA 2XG4A 4KKCC 4O5LL 5FS5A 3GRWA 2QFRA 2X4OB 5CLWA 1O5DT 3ARGA 4V33A 5C0IB 2Y5EA 3DJZA 1CN4A 3VRLF 1TENA 2OQJB 2VXQA 5JO5B 3CZGA 4EKJA 2VRQA 4XNMA 3T0XA 5H2BB 2YD6A 1CBVH 1EJ6A 1AHKA 4LSDA 4NQXB 1FRGL 5HYSA 4GW1B 1NEZB 5LQBH 3ZHKA 1KWKA 1C5DB 2PCFB 2RCSL 1ACXA 1D7FA 4B9JA 1I31A 4HHGA 2ZX5A 3FRPA 2NY0C 5F21B 4BKTC 4FCAA 4HA1A 3B2UD 4OCRL 1KBWA 3FT1A 3OSVA 5DYFA 5AZ2H 1T1ZA 3MXVH 5PCYA 5C3IA 3KXFD 2NQ3A 3X11A 2JLLA 3KPOA 3DJSA 2FEEI 3LMJL 1K8DA 2GKIA 3HS8A 3EH1A 5IQMA 3TBWA 2R2BA 2QKIC 3BEVB 3U9WA 1QSFB 3CFCL 5BV7B 3MYJB 4F7TB 4W9KC 4EEEA 5EEZA 2FBJH 4MCZA 3OJDB 1S7VA 4FTVB 3RJOA 5BS0B 1CICD 2ZKMX 2HLAA 3BVXA 3I6GB 4EBQH 4AK1A 4NQDE 3KLHD 5IB4B 3BPCB 3X11B 5CD3B 4KROB 1HQ4B 3BESR 4TLUA 1L9QA 3GLAA 5DC0A 2XU9A 5HD8C 1JMXA 1TQUA 1KLUA 1LHZA 4KDTC 3PP3H 1IV8A 2X5PA 2MCMA 1QSFA 3IJYB 2BOCB 2A7BA 2XY1A 3ZYZA 4PCTA 2DD8H 4MD4A 4OGAC 4PB9L 1MHPL 5I15L 3I6SA 4YNYA 1ODAA 2KT6A 3AS2A 5D55A 1EAQA 2V2XB 4Y88A 2GCYA 1A4JA 3HE6B 2UUDH 3NIDE 4J8RB 3CLEH 3FYEB 3F7KA 3MBED 3OJ2C 5D9SB 2H6PA 4F15C 3VFMB 1IM9D 3V6FB 4FNTA 3EBAA 3E8UH 3E2HB 2EDNA 2PKDA 2MOGA 5DUPH 2WLLB 3RU8H 4ALAH 1W8OA 1A3RL 3JZ7A 2J57A 2XTJC 1Q0XH 5DK0B 4IM8A 1WA1X 1XQ4A 1VDGA 5LGHL 4KJYA 4XP5L 4NP9A 4UCFA 3APNA 2JI1A 4OGYH 2XY2A 4AYFA 4PREB 1OQOA 2ZCKH 1HHKA 1AY1H 1XR9B 4DP7X 5I8EA 5EUOF 5HDBE 4G8GB 3UDWC 3WY3A 1QTYT 4LCWB 3OAUL 5F1IB 2AK1H 3S96A 2NW2A 4PJGA 1IKNA 3AUWB 1HSBB 1O7DE 4FQCL 2CA3A 2OMYB 3VXOA 3A47A 4JAMB 4FZEL 3VXQA 3ZHDA 3HLAB 4AQAB 2ZXQA 3VI4E 3I74A 3U48A 4K94L 3D07A 1K4DA 4H8UA 3WLWD 2A0LD 3NIDF 2OZ4A 1ZLWH 5J1AA 2IH1B 5CEXA 5JQHC 3MUZ1 4LLMB 3AREA 4JREB 1ORSB 5L6YH 3DURB 4FKHA 3AY4C 4ZAKC 1NIDA 2BSEA 3TF4A 1NGQH 1BVKB 4WW1B 3FT2A 2F5AL 1IKOP 1FNLA 1W15A 3D0LA 5LB1A 1MCKA 4HJ1A 5F1NA 1EHLL 5JIKA 5F6HJ 3TBYB 2FR4B 2E47A 1ZT1B 2GY5A 3Q9PA 4EO5A 1PX8A 1I1FA 1RHHB 1R17A 1X9RA 5KYUB 4BK4A 3TYFA 1TTAA 3UJIH 1D9KB 2X41A 4QWWD 2DYPA 5B4MD 1JV5A 1CICB 1IBBA 5E1IA 3KBHE 5A6IA 2Y2YA 4OZHA 1U3HC 4FNUA 4Y9FA 5E2TH 1NBVL 5EO1A 4HYTB 2F53D 3LQZB 2AQ3A 4X9IA 4TOYH 4JZNA 3SYCA 4I9WE 3DUHA 5FCSH 3VI4B 2IWFA 1U91B 2OMVB 3IGFA 4J2XA 3EUUA 5DD3H 1EAPA 2IANA 3LPOA 2EIMB 2WB7A 1A7QH 3A21A 3GBML 3MTXA 4RMUA 4A7SA 1A2YA 4XPGH 2AMGA 3N42F 1FI8C 1OAUL 3FT4A 5TH2A 4FFYL 5BMFL 5IQOA 3KNBB 4G9FB 3OAZK 1U8MA 1IGTA 2CIIA 2X10A 4CNIA 1OHZA 5ITBL 3WIHH 2PPAA 3ABLB 3FN0H 2F08A 3CFBA 3NK3A 3UBHA 4N5EC 1IIIA 4W1TA 1U8HB 1G9NH 3D4CA 1BJ1J 4E42A 5C0RL 3P9MA 3GDBA 1WWAX 4AEFA 4P4RA 8FABB 1G7MA 3IK2A 4NSKB 5TF0A 3ZQWA 3JV5A 1JPTL 4O02B 5DJZA 5L2KD 1CD8A 2UY7A 4KRNA 3JQOB 3IMSA 4LNVA 5DJCA 4BYHA 2EVHA 2DJ4A 1HHGA 3AT8A 4LVEA 3SE4A 2W60A 5EC2A 2AJYH 5LG1A 1NDTA 5D2NB 1F11B 5L2JB 4JFZL 1A1MA 1MFDL 2AZUA 2CGYA 1WFTA 4WW2B 5EIIA 1KENH 1YEDA 2GYSA 3MOAH 4NQED 1WCQA 3FFCA 3GIZH 3O9WD 1U92A 5CILH 2KKQA 1NBZA 2AXJA 4X5RA 3E6HA 5D7KD 1UENA 3BH8A 2W1NA 1MFAH 4NC2B 3EOBA 4JRXD 1MCOL 5F0JB 1P7QD 1IAII 2UY7B 3UTTD 2R56H 2NY3C 4M6OH 3PNRB 5ITBH 5EC2B 3U0PA 1R3JA 5J5EA 5D2NC 3IJYA 4UOZA 1IGFL 5FW8A 4BXVA 4LHUA 3BSZH 1B2WH 1P4IH 1IC0A 3QB7C 5JHMA 4AUUA 3VFWB 1QAWA 1CR9H 3BGMB 3C5XA 3VI3E 1OALA 4UANA 3HG3A 2N3JA 4HP5A 4YQXH 2F74B 3IGLA 5DD5H 1IAIM 3PYCA 3SB3A 2X1QA 1KBBA 1UXSB 3PWUA 1INEH 5D96B 2FWOA 4NO2B 1DZ0A 1MEXH 4HXBL 1PEWA 4ENZA 2H32H 2IXQA 4OLUL 4TULH 3W9EB 4ZUTB 3FCTB 2J8UE 1NL0H 3VVWA 2WWKO 1H9VA 2ICWJ 5I1KH 2P26A 1OW0C 1FSKB 4QHUB 4TVUA 1U4FA 2H8PA 5EH1A 2Q76B 1CXHA 4PRDA 2DIEA 5DRZB 3UTPD 2OXGA 3QQ9C 5IIEB 4ODTH 1U8CA 2Z31A 3PFUA 3VD9A 5FF6B 5I15H 5E56A 1F45A 5C0DA 1KLFA 3RTQC 2H6UA 4JJ5B 3GSUA 2YRBA 4AYFB 5KS9E 4KFZC 3N85L 4MS8C 4KRMB 4WNSA 3IBEA 4X6CE 3SDCB 2EUXA 1VPOH 3ZKND 4H1LH 2CBOA 3PDDA 4UQ2A 4XO3A 3MXVL 4ICWA 2VN4A 3N91A 4C56A 4P48A 5IM7B 1OSYA 4CVUA 3IWVA 3X1GA 4MJHA 3VX1A 4XCEB 4ATTA 4OSUL 1YVLA 3SCMB 5FUOL 4MNQE 1KFAH 3DX0A 4Y19B 1I1RA 3VI3F 4RIRB 1UT2A 2DQHL 3MBXH 1I7UB 2CWRA 1FWXA 2EDMA 5FYJU 4MXWL 5HGBA 1UADC 1UWXH 3CBKB 3V0HA 4PHXA 2XZAH 3UGXA 2J8UF 4PJ5B 2BVQB 32C2A 4H7VA 1NEZG 5SX4I 2Z9TA 4AGMA 5HHMD 2AEQH 1LQSR 3HVNA 2O93L 4PRID 2V2TB 5D5MF 3HEIB 4X5PA 3BLPX 1ZLSL 4MX7B 3GJEB 3HZMA 3GNML 2NY2D 4J6IA 5J89A 4AIXA 3FTZA 5KS9F 1JJUA 1JNNH 3QI9D 2ZSVB 1FBIL 5E8PB 2OXHA 3L1OH 4LLUB 4RA0C 1PSKL 1PCSA 3QRGH 5T8IA 3D39D 2BHYA 2QMJA 4HPYL 4FFVC 1E0OB 4FN0A 4ODWB 1P4LA 4RQQB 3QQ3B 1AHWA 3L17A 2FCBA 2C3VB 3E7JA 2BSDA 3SE8H 3TOPA 3C2AH 2E7MA 1A47A 1ZLSH 4WI5A 4L0YA 2Y7SA 4GAAA 5AZEH 5IB2B 2JK5A 1E2ZA 2R83A 1FZMA 3CCHA 5K93A 2H9GA 1OP3H 1QI5A 1IGTB 3V9CA 3WIFB 2DTSA 3R19A 2B0SL 1TITA 3EJPA 3U1SL 4HS3A 3IAPA 4JS7A 2GFBB 2WCPA 2VW6A 4LXFA 4E42B 2UXFA 1JRHL 4X4MA 1WBXB 3WN5A 1MVUB 3ECQA 4NSKA 3EXLA 1PLAA 1IGYB 1JK9A 2P8LA 1BX2A 5E2UH 5FWQA 2ZKYA 3HCVB 2EIBA 5INDA 4NQDD 2PCPB 4NFCA 5DUJA 2C4XA 1SXNA 4MSWB 3VXSA 1NCJA 3NN8B 4GRLD 3K2IA 4JKPH 1QUNB 4ODVH 3C75A 1MCWM 1NZRA 1UURA 5CJXC 5AKRA 2Q8BH 5CEYB 3A6BL 4LSSH 4YLBA 4LRNH 1XGZA 3BN9C 1J0JA 3KGTA 5T1LD 5CCGE 3SDDA 1AFVL 4XWOC 3WS6A 1ZSDA 1MHCB 3ARGB 4WO4B 3OPZL 1ZHNB 1HNYA 1ANUA 5SWSB 4M7KH 4NUPA 3NCMA 4KV5E 3CX2A 2XX1A 4LK4A 4ONFH 4UILH 5FHBL 3D08A 5IUSA 2DOCA 3APMA 4PG9B 3MCG1 4F92B 4HKXA 3FNKA 1U2CA 1LMIA 3FH7A 5L4JA 2JI2A 2MCPL 3P73B 4NRXA 3V0DA 2WAQA 4X6EB 1AR1C 4PJCA 4A7TA 4V1DA 2PNDA 5HHOE 5HYJB 2L04A 4OZIE 4GPVA 3Q3GB 1KTKE 3NSDA 4HDIA 5I6NA 3RWGA 3FFOA 4PGZA 3ARDA 5F6IC 3LKSA 3NFPA 2X53A 4J1UA 4QDGA 2Q8BL 1KN2L 2VDRL 2EUVA 1T80A 4KKQA 1QNIA 1VADA 4ZODA 4GRWB 2FGZA 4XVUD 3DRTA 5FKAA 4RX4D 1MREH 1Z9LA 1SBSL 1BGXL 5T3ZL 3S3BB 3NSYA 3FCGA 5T5FL 1IZJA 4HIJB 4GRLC 3O4OC 1CK0H 3QFDB 5DHYB 5T33L 3BJ91 4R0LC 4X7EC 1PKQA 1KCKA 2YD0A 3W2DH 3GSUB 5AKSA 5I1GH 4YXKL 3ELQA 4PJBB 1BD2A 4BFRA 4LBEB 3HI6H 4PJDF 5E4IA 4AJVA 4W9HC 1HXYB 2QHRH 3WNNA 1PZBA 2OL3B 4XWOD 1F58H 5DJ2B 4WEEA 1BEXA 4HV8B 3GZKA 1WEJH 3P4MA 4ZFOL 3HE7D 3L4CA 3MUUA 3MMEB 3BQUC 3N06B 4OCXH 1PNDA 1WIUA 1OO2A 1SOSA 3D4YA 3OZ9H 4YSUA 1YEGL 2I27N 3ASOB 3HI5L 4B96A 4KK9D 4Q4IA 2YQ2A 1T0MA 2YXMA 1VFBB 1S8DB 4U1SB 2B1AL 4RX4A 1UM6H 5FYLE 1IB5A 4IRJA 4JFDD 3UP6A 4YHYC 4PJ9D 4WKXA 4HQQH 3I84A 1EBAA 5FUOH 1ACZA 3B3IA 4GRWE 1AS6A 5DZAA 1JRHH 1M53A 3Q5OA 5CAYB 3P77A 3PG2A 1RK0A 1BM3L 4RRPG 4FL4B 1JDCA 1NMBH 15C8L 5I6PA 2R0WH 3UPRA 3VGHA 5H2BA 2KS0A 1CTOA 3PNWB 3BUDA 2OW6A 5E0FA 4MAZA 3MJ8B 3RZCC 2JKXA 3C8HA 1BVOA 4O2EA 3OL2A 1QEWB 4IU2B 1GZQB 2V33A 3NCCB 1MJ8H 2YWZA 2X70B 2ICEB 2CRYA 5D93B 2ESVB 3RA7L 4KXZH 4G1MA 3N1QC 2QEJA 4LSPL 4JFUA 5JHLL 1K8DB 2XJLA 1SN5A 2XA8H 2OZ4H 3BUYB 3H42L 4HC1L 3SSGA 1TZHB 4BZ2L 2LOEA 4A2EA 1AANA 1CT8B 4JGJA 1ETJA 4ZUVA 5LCVA 5EEYA 3IXAB 2B4CL 5I76B 5TQ0H 1G0YR 1GMEA 1YYML 4RMBA 1HJCA 2VDPL 2OMXA 3NGBC 4KMTL 1QACA 1BQHG 5KSAA 3ARBA 3TZVD 4AL8H 2C3WA 5BV7L 1KEGL 4M3HA 2JJVA 1DQDL 1S3KH 4EOWL 3H3PH 5JPMC 1HWGB 3VDAA 3CFTA 4UNVA 3BSZL 4P3DB 5JHDB 2JWYA 3EO9L 3QIWD 4OQTA 4UM8A 1FFQA 3HR5A 3OVUB 4PJDA 4XODA 3HS9A 4JO2L 3K71A 3PV6B 1OCRB 3GSNA 4ZO6A 4GKSB 1TCRA 2APSA 4HOMA 1CDJA 4X50A 4BDVB 3K7UA 4Q6IC 2J20A 2C9VA 2EIZA 3FOMB 5H4ZA 3TO4B 1F4WH 5ENWA 1RQ5A 2WC7A 3MTRA 5C0GA 3HUJE 5C71A 3OM3B 3EG9B 1S9VB 1J9SA 3HR5B 2FEDD 2JMRA 1OP9A 2X9YA 1RXLA 1XB6A 5F2FA 1EZVX 5IW3A 2WLLA 5TQ2L 3FT0A 2BM3A 3HC4H 5FHAH 2DM4A 4GW5A 2O6PA 5D7JB 3FO0H 4NGHH 1L9RA 3PP4H 4I7ZC 4LQFH 5FYLL 3VXTA 2X6VA 5FYJE 1EGJA 2NDGA 5GGUA 1BYPA 4JJHA 4QHLA 2OYMA 1V3KA 2ZX8A 2VMJA 2NZIA 4HKXB 3QIBC 5C0NC 1X5FA 2R56L 3KWWB 3UEZA 1SJVA 3P73A 4NRXB 3EO1B 3V5DB 3LZFH 4P4RB 8FABA 5HVWA 3C9NA 2DH2A 4AH2B 1AR1B 2K6ZA 5HDQL 1AD9A 1WV7T 4XXDA 2OPCA 1OCOB 5GGTA 1DVFA 1F00I 3C09B 3D33A 1BSIA 4QRRA 3T0AA 3SDCD 3S0PA 2BVYA 2A1WH 1HK6A 2C9UA 3MRFA 1VSCA 1MNUL 2OAAA 3R18A 2JKRM 4YSDA 5BVJA 2KERA 2XZZA 1MEXL 3QEUA 3VWKA 4RMRA 3OKOA 4I1NB 4BFEA 4L3CB 4XBGB 3KPLB 2W9DH 4JFED 5E70A 4X98A 2OTUA 4G8IA 3B2DC 1ZWIB 4QXGH 1DQMH 4BM7A 5CJXA 4LPXA 3ECUA 2EABA 4UNTA 1CFSA 3FK3A 4JQVC 3WIHL 4S0HA 2H2PC 4MD5B 1S5HB 1XSJA 1U41A 5EBMB 3CZEA 4Y2DB 5KVMC 3UPAA 1YC7A 1R4XA 4F9PA 3GI9H 2XQ0A 4N2LA 4YXHH 3GLDA 1CICC 1IGJB 2DWEB 2YA2A 3EJSA 4OCSL 4Z3EA 2LLLA 4X0KB 4Z78B 1UXSA 1QLRA 3PWUB 3HZVA 3ZDYF 2XG5B 1GPOL 1NLDH 1H3VA 1NCDH 5EUOB 3I9GL 1L0XA 2BY3A 4WCYL 1NMCC 4Q9RL 1G6RB 1UUSA 1FGVL 1L6ZA 1T0MB 2CIKA 4IBYA 3S3PA 3GUTA 3FT3A 1QBMH 1RHFA 2JCCA 3FU9A 4MMYB 4ERSL 3ZZLA 3GXPA 1Y0LA 3TA3B 5IHUH 3VUAA 5FO9B 4NN7B 2PWEA 2C9AA 2XN1A 4BFKA 1LILA 1WC7A 4NO0D 4EQ2A 2A0LC 3DX7B 3K3QA 1J8SA 4WHTB 3MR9A 5ESAA 2AW2A 2P8PB 2B2XL 3EADA 1JFHA 1NAML 1OSPL 2Z91A 1E5ZA 5HI4D 2IV8A 1OTUC 2C9QA 5H8DA 3MHZA 5T1MB 1S5IL 5C07E 2LR4A 1PG7W 1PDKA 3WD5L 3B8SA 2FHCA 3U25A 4Q0XH 3AWEA 1P9MC 3GJFA 3RI5K 4ODXB 3FQUB 1XGPB 2VL5B 3DXAA 3MV8E 2QADC 2JIXA 2YPVH 2XUWA 2IAAC 1TZHA 2PO6B 2D0GA 3QEQE 1CWVA 1JXGA 2V9TA 4OIAA 1ONQA 4FXGC 5B3JF 3IJ8A 1O0VA 1SXAA 2QPDB 2N59A 1FL5B 1OLZA 3Q8CA 3MV7B 4K3GA 1QRND 4N2EA 4GQZA 1TEGA 2OMUA 2VXUH 2X4QB 3RY6A 3ZDZF 2YD4A 3GRBA 4FKKA 4YXLL 2XZCH 3FYIB 1U33A 3EYSH 4P3DA 1E2WA 1AY1L 2V2TA 3SCMC 5EC1B 3UTTB 1IBDA 1AGCA 5SX4H 3WIIH 3OKDA 3E3QE 4C83B 1NCCH 4NZ8A 1OM9A 1QRNA 4MXWH 3ZUCA 4N2DA 3OR7A 4WHYG 4K9JA 3RWJA 1IM3B 2X4QA 1BJ8A 4Z7WE 4AUYA 3QXUA 4JRFA 1HL9A 3DUUA 4FLOA 3NEXA 4KQ4H 2NNFA 1BIIA 2E27L 3EJYD 5E9AA 3KPRB 4WUUB 2CE6A 3FCUB 3RTQA 4N9OB 3SGDH 2K4WA 3ALWA 4Q89A 3QDMD 1ZAGA 5DMIL 1DUZB 3SO5A 4P23A 1CDIA 4HGWA 3LMJH 1W0YT 4WI7A 2VAAB 3Q2CA 1TZ8A 4MJ6B 5KBMA 3HNTL 3VU2A 4U05A 3RY5A 2M1KA 3NCYS 4XNXL 3VO0A 4KVNL 1P5VB 2ZT9C 3G5YA 3OJVC 5CP3H 4Y2DC 4QHLB 5MI0B 1UGNA 1P6WA 3ABKB 4G5ZL 1HIML 4KTDH 3KJ6H 3KPRA 2IDQA 4WUUA 5DZLA 4UT6H 4F57L 5IMKB 2R2HA 1H3GA 3VQLA 3O8XC 4L1LA 3N43B 5F0PB 1YPZF 2AITA 1UH2A 2H5UA 5J3HC 2NY3D 2JJTC 3QDGE 4S1QH 1C8PA 4JPWH 3AQXA 2WUBH 1BZ7A 4BWTA 1LK2B 1FH5H 4HUVB 4XO9A 4G8GA 5J6HB 2DQJH 1S7XB 4NWUL 2CCWA 3KWXA 2IADB 1CCZA 2W95A 4Q97A 1X4XA 15C8H 4N6RA 1MCQA 4DVRL 1JGUH 3QO1B 4PRNB 2DKSA 1BREA 3RIFF 5MP6L 3LHPL 3DROB 1P1VA 4AQAA 4FQHA 4X4YA 4F8NA 3DIDA 3T8XA 1CE6B 1SHMA 4DGVH 3OGOE 2FIKB 3C09C 2WLZA 2CA4A 4L8SB 4F7MB 5JOFA 4NHUB 2VJXA 3AG2B 4DUVA 2L0DA 3Q2NA 1UEYA 1NCBH 1U3JA 3BAXA 4P5SA 5M94B 1S2EA 4RAVA 5LLIC 2CDGA 5EZPA 3W0WD 3VDCA 3IMBA 3HR6A 4N87A 1U93A 3CHXA 1U36A 1N3NA 4TMPA 4JO1H 4KZDH 2GB2A 5EF1A 4JO3L 4BFNA 3OKEB 1I7TA 4LLQA 2VMEA 2ED7A 3JWDC 2A77L 3Q6FB 4RNRA 2O6FA 3TCLA 5AOKA 5A16A 4G8FB 5JXEA 4EXKA 2ATAA 3L5HA 4XOAA 5FO9A 4X6DE 3QXVA 3MX0B 3MBWB 5AAMA 4JFFA 3TWYA 1NFDA 4LL1A 3VFNA 3SKJH 3MBEA 3GKWL 3L4UA 2IAMA 1U3HB 1BMGA 1U93B 2GSIA 4WK2B 2VLKE 4JM2B 1KEML 3ATEA 1MHHA 3ZTNL 4KX9A 1EJFA 3KXFB 3U2IA 1E5UI 3FC8A 2EDXA 4RNRB 2DQIH 3T3MB 1DQQA 2HTLC 4NRYA 3TJHD 3T4AC 2EINB 3FZUD 3MBWA 3MJ7B 5FLUA 2BNQA 4UV7L 3HOGA 1FO0B 3GMRB 1YMHB 5D2LE 3BIKB 3ARWA 3D2UD 2G3ZA 2VL5A 3FQUA 3MBEB 2PTTA 5GS0C 5EA0L 3VGGA 2R1YB 2J2ZB 4D8PB 1XH1A 1FL5A 3VMNA 4N0RA 3P1VA 1N6QL 3HHMA 2AC0A 4NNXA 2B77A 4JO4L 3ARGC 4P2AA 4P3CH 1OGAD 2GUYA 3GKWH 4AYID 4J3WA 4HWBA 1N8ZB 2R4SH 4KVCL 4M5YH 3N50A 4NN6C 2A4ZA 2C3GA 3MJ7A 4F20A 1W72A 1H8SA 2QHLA 3ROOB 1URLA 3KPPA 2AV7A 4MAYB 4FE9A 3H9SE 1SXCA 4HKBA 4KK9C 1EFQA 1PL3A 3O3DA 4LGSB 4ZPTB 5D5MB 4ZBJA 5HJ3B 1MH5B 4NI6A 3U0WH 5C08A 2WQAA 3AJ7A 2HFFA 1FGNH 2VLKB 3MNWB 4KTGA 3SPVB 2EEDA 4BELD 5E08L 5C2UB