4KOBA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I)
rcsb
source organism Pseudomonas aeruginosa
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kobA00
6PCYA 1WA2X 3NJMA 3JT2A 1FA4A 2Q5BA 3NP3A 2YQBA 1OCOB 2YXVA 4CSZA 3FU8A 1NIEA 3S8FB 3NJLA 4YL4A 3CVCA 3ZDWA 5ANHA 1AZCA 2WO3B 1KDJA 2OV0A 2BP0B 2FJSA 2QDWA 4JHVA 1GY2A 3T6WA 1TEFA 2XLLA 4BWUA 3T9WA 2PP9A 4F7KA 2FT8A 2VSMB 3ASOB 4FAAB 5I5IA 3D12B 5F7BA 4AI7A 4G7RB 4KOCA 4W9ZA 2PPAA 1AACA 2YAMA 3X2QB 2HXAA 1ZPUA 1M57B 2ZWNA 3FPYA 3AG1B 4A2GA 1ET7A 3AZUA 1GYCA 3H4FA 1V10A 4N4YB 1PNCA 1PZCA 1E30A 2H5UA 2IDSA 1SJMA 4M4RB 1A4AA 1BXVA 3FQ2A 2UXTA 4Q8BA 2ZXWB 6PAZA 1E5ZA 1L9TA 4AZUA 2CJ3A 4BWTA 3QJVB 2FT7A 2GSMB 2VMJA 2XV3A 2XWZA 4BK5C 4KOBA 1RZQA 4HCGA 5B3SB 4GP4B 2XVBA 2BWIA 3DTUB 2BZ7A 3ABKB 4AX3A 3OM3B 2JKWA 2UXFA 4YSCA 4WKXA 4E9RA 3X1NA 4N8UA 2YARA 2YAOA 4K9JA 1PF3A 1SF3A 1KGYE 3PLYA 5FC9A 4BXSV 4NAJA 5PCYA 1FWXA 2YAFA 4BWWA 2CAKA 2HZHA 1NWOA 1NWPA 4YVNA 4G71B 1EHKB 4FA7B 2GI0A 2GC4C 1SF5A 2PP8A 3IN2A 3NSDA 4KNTA 3TU6A 1AZNA 3WIAA 5E9NA 2XV2A 1L9QA 1JZJA 2GB2A 2VW7A 3AW5A 2PPCA 2WSDA 4BDVA 3T6VA 5D4JA 3UAAA 1ASPA 1L9OA 5I6LA 2WO2B 3NP4A 4E9SA 4PAZA 2R7EA 1AIZA 2HX7A 1IC0A 1CUOA 1RKRA 1T5KA 1ZDQA 5I26A 2IDQA 1I53A 2DWSA 9PCYA 1NIBA 1SFDA 2Y69B 1NPJA 1IUZA 1PAZA 2EIMB 3H56A 1J5DA 1ASOA 4NERA 4A68A 1KBWA 2BP8A 3CVBA 1GY1A 2J56A 3EH5B 2J57A 4RH4A 3FQYA 3FU9A 4YSTA 4A2EA 1JOIA 1BQ5A 3T6ZA 1L9RA 2GIMA 3KW7A 4YSSA 1JERA 1BYOA 1M56B 4L0PB 2A3TA 1QLEB 1SHWA 1A8ZA 3QJUB 3PPSA 2BZCA 4UF7C 1L9PA 1GS8A 2AVFA 1NPNA 5A7EA 3SQRA 1GS6X 7PCYA 1CC3A 2LLNA 1XB8A 3AG4B 4A67A 3CVDA 3NJFA 1PLCA 4JHUA 1JVLA 2FQFA 3FPXA 1NICA 2BW5A 2DY2A 1ETJA 3FQ1A 1GW0A 1BQKA 2CALA 3FYEB 4G7QB 4YSAA 2J55A 2MTAA 4YSPA 1IKOP 3S3DB 3CG8A 2QPEB 3UACA 4GYBA 1AG0A 1MZYA 4P5SA 3TA4D 3WI9A 4M3HA 4DP0X 4DP5X 3GDCA 1SFHA 2BWDA 2PCFA 3S8GB 2BP0A 4PCYA 3BVDB 1JZEA 2UXVA 1X9RA 3HB3B 3T6XA 1N68A 1NIAA 1R1CA 1JVOA 2E86A 1A4CA 2JXMA 2PPDA 3FT0A 1WS8A 2FNWA 1YLBB 3QJTB 4YSUA 4E9VA 4YSEA 1IBYA 3ABMB 1ZIBA 2VW4A 4DP7X 1M9WA 1AZRA 4ENZA 1E67A 2IH8A 4GXFA 2BHFA 4AKOA 1A65A 1VLXA 4HHWA 3N55A 1ASQA 5B7EA 3FSAA 3OD3A 1AS7A 5I5MA 4KNSA 1AS8A 3AG3B 3ABLB 3JTBA 3WNJA 1KV7A 2IDTA 1KBVA 4QLWA 1ET5A 4A2HA 2JFCA 4E9TA 5B7MA 3X1GA 2XX1A 3PAUA 5F7AA 2QDVA 1SDDB 3UADA 3TBCA 2PPFA 3NJGA 3NT0A 3N2JA 4A2DA 2N0MA 3ABGA 2BO0A 1OCCB 2DYSB 3UAEA 2QT6A 1OF0A 4HAKA 2AZAA 5B7FA 1BEXA 2BW4A 1ILUA 2GBAA 5AKRA 2XU9A 3ZIYA 4E9QA 2FTAA 1GS7A 3FU7B 1NTDA 3KW8A 1OE1A 1J9QA 3BQVA 1AQ8A 4QKTA 2VM3A 2XXGA 4DP6X 4YSDA 3V9CA 2XV0A 1BXAA 3GXUB 3X1BA 5B1JC 1EZLA 1OOWA 1WAEA 2NRDA 3AY2A 2X87A 2B08A 2EIKB 4JKNA 2PPEA 5AFAA 3X1FA 3NYKA 3FS9A 3FSVA 4KO9A 1SHXA 5I6PA 2RACA 3WG7B 1WA0X 3DIVA 5PAZA 1PY0A 2IH9A 1HAUA 4AKQA 1PZAA 1ZIAA 2YAPA 1KDIA 1AZUA 2AZUA 3EH4B 5AZUA 3NJIA 5I5JA 1PNDA 1J9RA 3FSZA 3IBOA 2FQEA 4F2FA 5IY5B 1GR7A 1NINA 1CYXA 2OJ1A 5TK2A 4HCIA 4G7SB 2HX8A 2Q9OA 1XB3A 2IAAC 3PAVA 1B3IA 1ADWA 3QJQB 4NB7A 1BXUA 2VSKB 3PCYA 4HIPA 1GSKA 1BYPA 1ET8A 1CURA 2FWLB 1AS6A 4E9WA 3NJKA 1V55B 3PAZA 4GY4A 2VN3A 2YAEA 4BXVA 4DP2X 8PAZA 1UATA 1XMEB 5I28A 1AOZA 1MG2C 4KO6A 1MG3C 3AG2B 4DPCX 1V54B 5B1AB 3FYIB 2YAHA 3PXLA 2IDUA 2FT6A 2QPDB 2X88A 3RYMA 3OMIB 1J9TA 4ZK8A 3S3CB 1X9UA 3NSFA 4A66A 3MBWB 4Q89A 3CZUB 3NSCA 2I7SA 1E5YA 3TBBA 3EHBB 1TU2A 2H3XC 2ZOOA 1OE2A 4GP5B 1N70A 2FQGA 3EF4A 3IEAA 1CYWA 1RZPA 1PLAA 3HEIB 4YSRA 4F2EA 2PCYA 1OCZB 1BQRA 1JZHA 4AKPA 1TEGA 2HLEB 2HRGA 2TSAA 1J9SA 1W6WA 2VW6A 3SBRA 1KCWA 5D4HA 3GYRA 1E65A 1AANA 4W1TA 3G5WA 4EF3A 7PAZA 2TSBA 1ZDSA 3NJHA 4E9XA 1AG6A 5D4IA 1MDAA 2XX0A 3V9EA 3WKPA 4CSPA 3OQRA 1KYAA 1QHQA 3MX0B 1NIDA 4HHGA 1BAWA 4HZ1A 1JXDA 1KCBA 3DKHA 3OMAB 3QPKA 1HAWA 1J5CA 2MRYA 3UGEA 4DP1X 1QNIA 2UX7A 2HX9A 1SDDA 4YVUA 2UX6A 3ZX1A 2AANA 2EINB 4YSQA 1WS7A 5B1BB 3CDZB 5I6MA 1ZV2A 3X1EA 3SBQA 2IWFA 2GC7C 3UABA 1A3ZA 2CCWA 3CDZA 2VM4A 3OMNB 2P80A 3IN0A 2DV6A 3S3BB 1OE3A 3FU7A 1MZZA 4DP4X 2P80D 3QQXA 1FFTB 2GHZA 1JXGA 2EILB 2HRHA 1AAJA 2CUAA 4BDVB 3NSYA 3L45A 1ILSA 1RCYA 1PMYA 3ASNB 1URIA 3QJRB 2DYRB 2XXFA 2OCCB 2IWKA 1PLBA 2Y1AA 3U25A 2R7EB 3NJJA 1NDTA 5EHFA 2W8CA 4P5RA 3ZBMA 1DYZA 2CBPA 1XB6A 4WTQA 1WA1X 2ZONA 1F56A 1ID2A 1TKWA 4HCFA 1NZRA 2XYBA 2IWEA 3ERXA 3SBPA 2XUWA 4HALA 3WNIA 5I6NA 4KO5A 4KO7A 4KNUA 4DP9X 2BP8B 1JZFA 2EIJB 3NJNA 1PZBA 5LDUA 4YSOA 4GP8B 1DZ0A 1IBZA 4MFHA 2H47C 4A2FA 2PP7A 3EH3B 3FSWA 5TK4A 1W8EA 2YAQA 1AR1B 1NIFA 1OCRB 3QJSB 1AZBA 2J5WA 3T71A 1PCSA 2I85A 2UXGA 4X4KA 4DP8X 2AFNA 1L9SA 1W6LA 1JZIA 5I6OA 2B3IA 2I7OA 2W88A 5B1KA 4DPAX 5B1JA 4E9YA 1OV8A 2YXWA 3IE9A 2FQDA 4G72B 3C75A 5I6KA 2DWTA 3TASA 1JXFA 2IDFA 4UANA 1JZGA 4G70B 4UAHA 4DPBX 1SNRA 2PLTA 1HFUA 1A4BA 3H4HA 3WKQA 4TXVB
chains in the Genus database with same CATH superfamily
1AZZC 1AQMA 3ESNA 3V5DA 3V79C 2J8UB 4I48A 4PD4J 4FXTA 4H13C 5DRZB 4L1HA 3QYMA 2CE6A 1GC1C 5FA3A 2VWEE 3CN2A 3L3HB 5CP7A 1BLNA 1XF4A 3EUUA 4UUJB 3P4NA 1KDJA 4JY5L 4ISVB 1ZLSH 1F18A 5JOPE 4XB3A 4YGVA 3MRNA 1UUNA 1QSZA 3HUJE 4X9HA 1ACYH 3U30B 3OKLB 3P0GB 1SYVA 1IFHH 3FUEA 3KR3H 1BVKB 4APXB 4JQVA 4W9CC 2VDRB 1V10A 2O5YH 3JV6A 3MRPB 1PDKB 1DO5A 4BZ2A 4HBCH 2JH2A 4NQXA 4HIIB 4BHUI 4KROC 2N59A 2VERN 2AEWA 3CDCA 1CIDA 4XBEL 1W80A 4RDQG 4XP5H 1DJXA 5DCCA 5I71C 4F7TB 4ZW8A 3CXHK 4I18B 2A1WH 3QJVB 1HCFX 1YAZA 5F6HI 4MA8L 1PU0A 4M7LT 1HILA 4GP4B 5EZIH 5KVFE 3D25A 2HB0A 1KXTB 3BVWA 3JWOL 4JLRB 1SVCP 4NO2B 3O6FD 2V2XA 4TUJA 5B39B 4PJXE 3G5ZA 3L1EA 3PWJA 4ZO7A 1D6VL 1SF3A 4M4PA 2HRPL 3BP7B 1KTDA 5PCYA 2AAAA 3BUBA 3DETD 3UBXA 5CBAA 5I8EA 4ZMWA 4S1SL 1JIBA 4KNTA 4KKCC 2CLRB 4YXHL 3HFMH 5DDHB 3WUZA 5DURD 5IQ7H 1OD9A 2YQ2A 4OI8A 1HNGA 1NJ9B 4QYAA 4BDVA 1AO7A 3B9AA 1OQOA 3QH3B 1IBDA 2GITB 4K2UL 4LEEA 3O2WH 1AXTL 3T4YB 5I6LA 1AO7D 1HHIB 3FCTB 3U4AA 2EVJA 1S5HA 2IPTH 2VUKA 4UQDA 3EYSL 3LVEA 4JRLA 3RG1C 3RKDD 4BQBA 1JNHB 3A23A 3KBEA 3CHPA 5DGRA 1T5KA 2Y5TA 4MAYA 1YNTF 3WY3A 3SGJC 4M1DL 4X0KB 3UJTL 1NIBA 1Z66A 1N8ZB 1XVSA 2ESVE 3DUHA 3MNWB 4NQCE 4OKVA 5EUOA 2G9HA 3PGDB 4QUOA 3H56A 3S6CA 1BZ9B 5F7EH 1ASOA 2MPAH 3FKUS 3TL5A 1W8NA 5BOZG 3EDKA 5IMLA 5ACMA 3KYKL 1SJEB 4Q52A 3W9DB 1J9CT 2OMWB 3FFCB 2V2TA 1TVHA 2EAEA 1WG3A 1QPPA 2DMCA 2V4LA 4JZNB 3RUGE 3OHXA 3QWRA 2X2JA 4NN6B 3MBXH 3U79A 5KAQG 4NO0D 1IEHA 3QWRD 2OYMA 3NH7L 2H3KA 2XHNA 4M7KL 2XDHA 1O5DT 2D7MA 2WXFA 3G5VA 4H26B 4YHNA 4PRHA 1J5HA 3EYQD 2OMXA 1T66C 3FB7A 3O4LE 4G11A 3AG4B 1MWAH 1DN2A 2X4OA 3CFBA 2H26B 2GFBB 4JRYA 2MSPA 1YDPB 4U6XA 4JHUA 1JVLA 3FPXA 4JRYD 2Q8AL 4CC0A 5LCVL 2RQ8A 4ZMZA 4IBLT 3JZ7A 5AW3B 5HYJA 2P46B 3FYEB 2BOCA 4JM4L 2K78A 5HYJD 1VHPA 5IB3B 1I8LC 1S2EA 1GZPB 5SX4H 2ZQKA 5T3XH 1M1XB 1AG0A 2XA8L 3TNMA 3GDCA 3NFNB 5EEWA 2QQKH 5K33A 2H9GB 5TQ0L 1VFBB 2JJSA 4N20A 3HE7B 2F74B 4GW4A 4X5RA 1C5BL 4XNQA 3MLXH 3NCBB 1FORH 5EH1A 5ADPL 5KYNA 3FZUC 4OCRL 5LHDA 3U0PA 1GGUA 1QTYT 3TV8A 3GSUA 3SD2A 2OKMA 2R0ZH 2EECA 2DH2A 3EYUL 3NEXA 4WV1A 3ETTA 2Y6SD 3U6XS 4LMQI 4QNPF 5HDBB 5J5EA 2GABA 4GT7A 5IFJB 2J5LB 5SWSD 1AXSB 4MLSA 4I9WE 3FN9A 5F9OH 5ALCH 3D08A 3U6RA 5I1IL 2AGJH 2EXYD 12E8H 4GSDL 4RFNB 4A39A 2IBBA 5SWZE 1MAJA 2FSDA 2BHFA 4PJ9A 1E6JL 4XBPB 4HHWA 1VKXB 2LAAA 1OGPA 2IQ9H 5ACZA 5D1QB 3O0RH 5KG9A 4WO4D 2OZ4A 4E9LA 1MLBA 2P48B 4HFWB 3WNJA 1N6QL 1CLOH 2IDTA 3Q1SH 2MMXA 4CDGC 3TN0A 3Q6FB 1BD2B 1TVBA 3PQYA 5I19L 4KZDH 5E9AA 3PHQB 3C60A 4PJDB 1KPVA 4I3SH 1C5CH 3PQYD 3QUZB 4Z3FA 1J8HE 3C60D 3MZGB 2DEYX 1CN4A 2PPFA 4HC1L 2R29L 3N2JA 2G3MA 3X3GL 5FS5A 1LEGA 4MX7B 3PHOB 3AXLA 3PGFL 4HEMA 3D0VB 3JZYA 4UZGA 3A4AA 2DMKA 1UXMA 4MMXB 4LASL 1HS6A 2ZCZA 4XXWA 1D9KA 1HKLH 2WZ6A 5DYFA 2Q86B 3V5HA 2PF6A 4F37K 1IBGL 1GS7A 1TENA 1NTDA 5F88A 3BVUA 3D50A 4GXVL 1VESA 3VD2A 1KELL 3VACA 5ETUA 5GGRY 1RUPL 3WO4C 1XSJA 2WXRA 3QW9A 3ZUCA 2ZNXA 3UG4A 2AI0H 3QCUL 4XAKE 4M61A 1MCLA 2CHDA 4HUMB 4JM0A 5SV3A 5C8JA 1LDSA 5FX3A 5D2LA 3DRTA 2O30A 5ENWB 3ZYZA 4HJIA 4NZTL 5T5NF 1X44A 3VFMA 2QPFA 3RVVD 3MKKA 5HVHB 1TSRA 3GBDA 3N1GC 3KVPA 3H3BC 5KSUB 2WW8A 2I07A 1IT9L 4RAVB 4BFNA 5BV7L 5DUPH 4P5KB 5JHLA 3G6AA 5D2NA 1TJGL 2JKRM 2QLVB 3GRWL 5DFVD 3LX9A 3UTOA 1YYCA 1RERA 3N44F 2EIZB 2SODB 2X4RB 4GRMA 4P07A 4WY7H 3MJ7B 3WNNA 4H44C 2X44D 3S96A 4J5VA 2E76C 4BFBD 1YEIH 4Z5RA 5CNHA 3HKZA 3M1BA 5KW9L 2DIJA 3MLTA 3RNKB 1KEML 1LWHA 2CLZB 2XTJC 3I3EA 2ZUTA 2HX8A 2QFPA 3EHBC 3ZT5A 4IRJB 4Z9KB 5INDB 4UINL 3VXME 3I6KA 1IEAB 1X5FA 3LDBB 4LRNL 4QRUB 4AITA 1I1AC 2AQTA 3CVHB 2FL5A 4B53A 2AK1L 3TTYA 2PXYA 2AQQA 3OBAA 3MV9A 1QZ1A 5DC0A 4M6NH 5AW2B 3ZE0F 5L2KD 5IQMA 4WLCA 2PXYD 4WW2F 2X7LB 5I28A 3MV9D 1TMQA 4FTVA 1A1NA 2RD0A 3V5DB 4A2LA 3D69A 4FTVD 5FW7A 4I48B 1WT5C 3RY5A 2XN9E 4RQQA 5C08A 2VN7A 3VGFA 9CGTA 3JV4A 5FA3B 2QEJA 3O3DA 5C08D 4ZK8A 1PLGL 3GHBL 3ZE2B 5CD3A 1S3RA 5ISZA 3CFTA 4P2CG 1BLNB 5CP7B 1XF4B 1XFPA 4A66A 3P4NB 3MV7E 2B1AH 2E7HA 5DQDH 3QRGH 1E5YA 4KTEL 3T3MB 4QRRD 3UCQA 4AQEA 4AOFA 1E27A 5A3IC 4N86A 3VW3L 1B3JA 1N5AA 1PX4A 5CP3H 4YGVB 3BFWA 1XGZA 3SJVE 2ADGA 4LT7A 1KLUA 3TA3A 4PVNA 2EDTA 1I4FB 4MZRA 1MRCH 2VXVL 1SYVB 5DS1A 4UOJA 2E9BA 1SXZA 2H8PA 4JFZH 3JV6B 1FBIH 4D3CH 1NCJA 5KSBE 4NQXB 1MIML 3RHWK 1C7SA 4HF5L 2I26N 2EACA 3Q43A 1F90L 1MDAA 2P1YA 3S36H 2Y7LA 1N19A 4GSRA 4P46C 4O02H 3E1ZA 4X5QA 1Y6KR 4LLAA 4H2AA 5MENE 4TL5A 3EDFA 1TZIA 4HZ1A 1OK8A 5GRUL 1HILB 5JHMA 1F4HA 3O6FB 3D25B 4DT2A 3CK0H 2HP4A 5DT1H 2BMKA 4JGMA 2V2XB 3HE6C 4IBWA 4B5ZA 4TUJB 4HXBL 1WS7A 3G5ZB 1CU4H 3PWJB 2IPKA 2W0LA 1ZV2A 4R26L 1F11A 4Z78A 2VSCA 1PX3A 1D7DA 1QFWH 1SEQL 4XOAA 1JXJA 3D0AA 3GXFA 1EXGA 2VC2H 3WKNA 5CBAB 3NFSL 1IGML 2G60H 2FX7L 1WE5A 4J6RH 4L8DA 5DURB 1CFVL 5I8EB 4EAEA 5DWPA 4ADIA 4NWUL 3PYCA 2ZF9A 3QUXC 1KGWA 2R51A 1DBJH 3U1SL 1PGRB 2GHZA 2WYIA 5EFIA 1JXGA 4YAQA 4BDVB 5FLVA 3NSYA 1AO7B 1CICA 3SKMA 4AIZA 3A6OA 3UGXA 1CICD 3S3JA 3QI9C 1Q0EA 1S7UA 2ZYHA 1WGOA 3BD5A 3OR7A 2Y5TB 4MAYB 5JW4N 4NO5A 1ZS2A 3IB4A 4WFED 2N1TE 2YPLE 3E2HC 5LB1A 4FC3E 4AGPA 2DS4A 2Y2WA 2QVKA 4JL2A 4OKVB 3DXAA 5EUOB 3WUWB 2G9HB 5C3TA 2XXCB 1UGNA 4X7TB 5C0EA 1KB5H 2FUTA 3B56A 3ZL2A 5IMLB 5GRYA 3K2UL 1UM5H 1CDYA 1EEYA 1M2OA 1TVHB 5GXBB 2HLFC 3IXTB 1TJIH 2V2TB 3RE0A 3C2AH 4NO0B 3OHXB 4R7XA 3FDWA 4QEGA 2A9BA 5CHNA 2J5WA 4N6RB 4IOFC 4WHTA 3ZZ1A 3QUMH 5D6DC 4TQPA 5HHQB 5JIQA 5IVXE 3G6DH 2NSXA 3BT2L 2YD1A 1ZLWK 3G5VB 3S0PA 4PRHB 3LN9A 1I8MA 3VGGA 2Q8BL 2OMXB 3FB7B 1OHZA 3VD7A 1AXIB 4C54A 2J1YA 1KCRL 1X5IA 2ADFL 2X4OB 1P4BH 3CFBB 5DJAA 3RY6C 4JRYB 4Q97A 3QC5X 4U6XB 2JB5H 2PLTA 1URZA 5FK9A 1PEZA 5DR5L 2WTPA 2Z8SA 3OPUA 3P9WB 5HYJB 2D3LA 4KKLD 3Q5YA 5IROC 5IUCA 1UADC 2BOCB 1RVFH 4JMNA 4G8FA 5ANME 3CGTA 3NZSA 1O7VA 2YQBA 2L4OA 1OCOB 1G0YR 3FHAA 3MLSH 4L8SA 1BVZA 4TNVK 3S8FB 1SY6A 4G5AA 3W11C 2HFGH 4JPWL 3FT4A 3WDIA 5ANHA 1G7JA 1XCTA 4RNRA 4LK4A 3MBWA 4KVNH 4YHIA 3TH2T 4GW4B 4XVUD 5EEUA 2JELH 4RISH 2FT8A 1UWYA 1I3VA 2FJGA 4M7ZC 4TTGA 4ODVL 4PLKD 5LAPA 2WP3O 3GSUB 5CD5C 3D12B 1VZIA 1T3FA 4MCZA 3I3DA 1XGYH 1HJBC 2R4SL 4UNIA 3AG1B 2CXKA 2PUQT 1GYCA 2NY4C 4EBQL 3VFWA 1KB9K 1ADQH 4PP1C 2K4WA 4V1DA 4JCLA 3DV4A 3QQ9C 3W38A 1PNCA 3FH5A 3U6RB 1EAQA 4X6BB 1LK2A 1HINH 3LN4A 3LRSA 2BXYA 1U93B 1IFRA 3CHOA 2FEEL 4B3VA 4UBDC 5KG9B 1TUPA 5D8JL 1JPGA 1MLBB 2WY3B 5KANG 3WD5L 5I0VA 2ATAA 1Q1JL 2C9SA 5B3SB 4JG1H 2ICES 2XVBA 4F20A 4H8WH 5EU3B 3TN0B 1N26A 1W91A 4PCSA 2IAMD 1TVBB 3PQYB 4M7LH 4YHOH 4F7MA 1PBYA 3C60B 1YAIA 1KPVB 3QEQE 5EDXA 4YHYC 3P11H 2VXUH 1WSST 1ZPLA 5DC9B 4YR6A 1JGLH 4K71B 4Q56A 1JPSL 3D48R 1JGUH 1CXHA 1LEGB 3A67H 3PJLA 5E94A 4YVNA 3NA4A 3AXLB 4RWHA 4A7TA 2BPBA 4UV7L 5D1XA 1ACXA 2LABA 1AZNA 4JG5A 1D9KB 3V5HB 4KDWA 3TYGH 2XQBH 4PLNC 5E9NA 4PW4A 5EEYA 1AR2A 1IC4H 2FH6A 3Q8EA 1FHNA 2XICA 4AIXA 2WQUA 5F88B 3MRJB 3RBSA 3ECUA 2MCAA 1DANT 2W91A 1N12A 4ECNA 3KJ6L 4LDLB 1FIEA 2L04A 3FW6A 4ORZC 5ETUB 4HWBA 5T5FH 5J56B 3GSWA 4RMTA 5DA4A 2IDQA 4M61B 4JKWA 4N85A 4OLYH 5HHVH 5C8JB 2K4AA 3IDYC 5D2LB 3DRTB 4F9LC 1NCDL 4KK9C 3VFMB 1UZGA 1KGCE 1U3JA 2EKJA 2PTVA 3P4OA 5LKNA 2I07B 1GY1A 4MA1B 3UOAB 4XTRD 3FTUA 3G6AB 4OF8A 5D2NB 4D8PA 3K4AA 1EJFA 4ELME 3KPOA 1MFMA 4KUZL 4GQ9H 3HMXL 3LIUA 1L9RA 2BIHA 3CN4A 5AB9A 2QPSA 4Z5RB 4L0PB 1AR1D 4K7PH 3MLTB 3IGFA 1PZ5A 2WGXA 1Q8MA 4RSYA 4H88L 3SGDI 4XNDA 3NVQA 3BD3A 5DWUH 4I1PA 4AEFA 4ZZFA 1GJUA 4TSAH 3I6KB 4HXAL 4ZS7L 4OD1H 1KJ2B 1AQKH 2E7BA 2QKIA 3MRCA 5GRXG 2FL5B 3GRBA 3NACH 1ACZA 1LO0L 2PXYB 1EZSA 3SO3B 3MV9B 4MB1A 3GKWL 4G7QB 4NQDA 4FTVB 4OF0A 4MAUL 3S4SA 1A1NB 4NQDD 3D69B 4LSVH 3EJUA 5EEXA 5DRXA 1QATA 4HIJA 5C08B 4XXCC 1SFHA 2O5ZL 1OAUH 3O3DB 3GMNA 3PJSA 3BYYA 1NCAL 5CD3B 5L88L 2JJTC 5ISZB 1RU9L 1KIPB 1G94A 1MCFA 1G1YA 4LLDB 5AYQA 3SGKC 4QRRB 3V6FA 4E36A 1J1OL 3J07A 1E27B 4UWQB 4AJ0A 3CZLA 4HUCA 3UZEA 1N5AB 1TTRA 3SSGA 2ADGB 1KLUB 2PPDA 3EZ8A 2ZSWA 1MHCA 3TA3B 1UEMA 7FABH 2VDRL 2WBJA 4XO9A 4YSEA 2JKNA 3DX8B 2IBGA 1OGTA 4FYRA 4J6IA 3IRPX 2YGNA 3GXIA 1T89C 4N2LA 1QKZH 3FO0H 2H8PB 4F57H 4JW3A 4QOKE 5CJQH 1O5PA 4MSWA 2IH8A 1J8SA 5FKAB 3RILA 1U30A 1R3HB 4HS6A 3T6QC 1TTBA 2TRHA 3IKCA 1MW1A 2DKUA 3B37A 3VG9C 3ZDYB 3T0EA 3EF7A 4KI5D 3S9DB 2QSTA 3C6LD 4J3WA 3VE0B 2HWZL 5J12C 1JDDA 3T0ED 1TZIB 2JFCA 5F0LB 3L9YA 1YEJH 2NZ1A 4AJVA 5B8CA 4GKSA 2WXHA 3WEXB 3LQAH 1E8ZA 1ZGLA 1GOHA 5FYLL 1PZSA 3TFBA 1NBCA 4POYA 5CJOH 3ZT7A 2BVQA 5CZKA 1XGUA 3BKJH 2IPKB 2F61A 4U1GC 3STZB 4KQ3H 1F11B 4XMVA 5F72S 4Z78B 2EDWA 3C12A 5D71L 2BNRD 3NCEB 4L8DB 1Y0LA 5E6IC 1IGIH 3HR5B 2FTAA 3TPUA 1D7BA 2BINA 2FEJA 1LWJA 4ATTA 4DEUA 5KJRL 5EFIB 4YAQB 5C0RL 3TCXA 1OGAE 4BK5A 1CICB 5D7LA 3SKMB 1ZA6A 4TVPH 4MJIA 4TNWK 3O3BA 3TXAA 5D7LD 5IW6A 5I30L 1KMGA 2VRQA 3B6SA 3BSGA 1CI5A 4XWOD 4DVRH 1S7UB 2DQHH 4LHJB 4O2EA 2WCPA 3OR7B 5HDLA 5KBNC 3NPSC 2EIEA 5JNYA 2F5BL 4NO5B 2PPEA 4Z76A 1MWOA 1RMFL 4FHJA 1JS4A 3R1GL 3K91A 4KITB 4ZT1A 1N4XL 1BZEA 5IBTH 2NY6C 4D9QE 5C0EB 1A7OL 5DHVA 4LEXH 2IG2L 5TE4L 4AKQA 3KPLB 2YAPA 2YPVH 4PBWD 2V5MA 1BMZA 1EEYB 4PI2A 4U6VH 4DKAA 3FSZA 2VZVA 1IC5H 4E41E 4Y19E 5FFGA 5CHNB 1H9VA 3Q05A 2CG9X 4TOYH 4WHTB 4XN8A 3QUYC 2RALA 4PGCA 5EOCJ 4DKEL 2E7MA 3C5XA 3KPMA 4WF7A 5IBUG 3ZHLA 1SHMA 1I8MB 5EO1B 3P3RA 4UT7L 1N8OE 1AS6A 1VEMA 3QR0A 2QZQA 4LP4A 4P2RE 3UTTA 2CBQA 1JV2A 2G4EA 5DJAB 3V4LA 4GG6E 1M71A 1D5ZA 3EGXA 3IGUA 4FOMA 2XZQH 3CLFL 5CMAA 3II2A 5FK9B 1MG3C 1II4E 2ZKMX 3BT0A 3ABZA 3K6IA 1EAPA 4MJ5A 2VDPB 5DK0A 4WHYG 2QPDB 1TF4A 3K1KC 1J87A 4X4MA 1OY3B 3B2VH 1OALA 4NQEA 3BH9A 3WS6C 4L8SB 3DDFA 5KVDE 4B7IA 4WW2C 1G7JB 1XCTB 2C34A 4RNRB 5EZPA 3MBWB 5A2CA 1ZOXA 4B9FA 3TURA 1JNNL 4QJ5B 3CX5K 4ZOAA 1FC1A 3OXSA 2FJGB 5AW0B 1RZ8A 3CXHJ 3VH8A 5C0BD 2YRBA 3UAJD 4MCZB 2LAGB 3RDTC 4FXKA 1LQBC 3ASWA 2VO8A 4FABL 5A2IH 1GPOL 1PY9A 3P4LA 2J72A 2A73A 3VFWB 4P9HH 4V1DB 4AJYV 3SE8L 4EDWH 3DV4B 5DS8A 2ED9A 3WS3A 1BQHG 1E4JA 1HU8A 2NY2C 5AVZB 3RA7L 4TQ8A 1LK2B 3BE1H 1DSFL 4OBRA 5FM5M 3NCWA 3LN4B 5DS2A 2AMGA 3MYZA 2XX0A 1A5FH 4KMTH 2FE0A 4DPRA 3THMH 2OYKA 1LO5A 1FLRH 4R4NC 4U6HA 1V5JA 2IAMB 4JPVH 3B1UA 2W81C 3A4EA 4F7MB 2ENPA 3WJJC 1TTGA 2C3WA 3QVAA 3GSQA 4PIBA 4KRLB 2Y5QA 3ISRA 4FFZH 1M2VB 4YR6B 3CLWA 1UJ3C 1WFOA 3CDZB 3PP3H 3SY0A 2NX5E 4RMRA 4M43L 4FFYL 4BH7A 1BF5A 2X42A 5E94B 1A3ZA 4P3CL 4KVCH 5D1XB 2AVGA 43C9A 3WHXA 4C4KO 2E75C 2MOGA 4FQXA 5L8LB 1FAKT 4FQXD 3OF6D 2AJXH 2PYEE 3T08A 5C0IA 1KUMA 1M1SA 2Z4QA 5IWLC 4YJZL 1JGDB 2A6JA 1MFDH 2CM5A 5AVTB 3GSWB 3V7MA 1JPFA 1OF2A 1OK0A 1BVLA 1XB6A 3MOBL 2ZONA 1U91A 4OGYL 4WTQA 4LQ1A 3ECWA 3K81A 2O4EA 1FH2A 3G9AB 3P4OB 4FJZA 3SBPA 3SPJA 3FNKA 1CCZA 4H8WC 2D0FA 4EN2A 4IHOA 4LLQA 1PZBA 2OMUA 4JM2D 5HGAB 2X28A 3TT1H 3I9GH 2ROYA 3MNDA 1H15A 4MFHA 1E6OL 4KJPC 5F6IC 1Z2KA 3K1DA 3KPOB 1U8OA 4U1KB 1QRKA 1JD9A 3RU8L 4BKLA 3P69A 3JV0A 1AR1B 1IAMA 3I9IA 3AWFA 3MV01 3VXRD 1GXEA 2JIXA 4GAGH 1JG9A 3MDJA 1ZLUK 3VD0A 2I32A 2XSKA 4PJHF 1PZ5B 1RZJH 4GMTL 4MB3A 4N25A 4QT5A 4YWGH 3CVHL 4ZD3H 5B1JA 1OL0A 5F3BA 3NZ8A 1L7TL 5F7UA 4OV5A 3E7JA 4IOSA 4G72B 2ZCKH 2QKIB 3MRCB 4PRID 5D96B 2E6JA 2MQGA 4IOSD 3FUJA 2QHRH 4MXWH 3KPQB 5JPMC 2CBTA 3VSQA 3H4HA 2IGLA 2MHAA 2WMPA 3H6JA 4EEEA 1UA6H 1YPZE 3FOLA 4YBLC 4CUCA 5JYLA 4NQDB 1UCBL 3ZZLA 3UZVA 3AQDA 2C4FT 3S4SB 4FQJH 3HS9A 1OAJA 5AW5B 1FAIL 3B5TA 2ZXDA 4HIJB 1UH2A 1N5YH 5GZOA 3H9YA 1USZA 3PJSB 4HFUH 3VD9A 2QQNH 4BSJA 5GZOD 1TEFA 2XLLA 3OZLA 3RWEA 3V6FB 4R83A 5HBBA 4XNYH 2VLJA 4ODHL 3ZQWA 4YN3A 1Y1UA 2IANE 2OL3H 2VLJD 3ECBA 3ZT6A 2ZKXA 5HVFB 3AC0A 1G6RH 3N0PB 5DZVA 3ML9A 4KXZI 5DD3L 5I73B 1RZ7H 2ZSWB 1MHCB 3L2NA 4U1JA 1A3RH 3HC3H 2WBJB 1DFXA 3U1QA 2F0CA 4BZ2L 4YHKL 1MCNA 1OGTB 3KLKA 5I2IA 3IDIA 4Y9FA 4Z7UF 3TLRA 1QRNE 1XGQA 4MSWB 3FQ2A 4ACTA 1T0PB 4MZIA 4CJ0A 4P5MA 3GUTB 4Y1AA 3O6LH 4JN1L 5GISH 5T1LA 2XY1A 3LRLA 4HS6B 3C6LB 1BJ1J 3IKCB 4Y1AD 5B4MD 2FB4L 3T0EB 5H37A 5T1LD 3OAZH 4I5BA 4MYPA 3LZLA 3H42L 2HTKC 5DHMC 3VB9A 1CBJA 1KENL 2K1MA 1F6LL 4NCC1 4WFGE 1CVSC 5B8CB 5BO1H 4NQSA 1ZGLB 2XTJE 5FGBA 3T77A 3AB0B 4R4FL 1PF3A 3WIFA 2BVQB 2D03L 1XGUB 2Q0ZX 5HHMB 1N6VA 4BWWA 1XL6A 4KKBD 4ZOBA 3ZO9A 3NCYP 4WGWB 1EHKB 1YEGH 2BNRB 1QYGL 2BSSA 4J3OH 1IIKA 1JK8A 2A7BA 2FRGP 3MLUL 1IKNA 1Y0LB 1YYLL 3ZY7A 5L4JA 4PR5A 5BS0D 1ZGLM 3TPUB 4CKVX 2W0KA 3ARYA 4LOFA 2NSMA 2K6ZA 3A6CH 2IFFL 1KG0A 5D7LB 4DGVL 5T1DH 1ZA6B 2EDBA 3EJJX 4QCIA 3T2NH 4MJIB 1AIZA 2HX7A 3O3BB 4BBWA 5IW6B 4G8AC 1OSEA 3B6SB 4MXVF 3ILPA 4HOZA 1X4ZA 4O2EB 4WI0A 2XQYA 3ZO0A 5JNYB 3S3SA 4YXKL 1M53A 3KLLA 4Z76B 2VDKL 3O41A 2JV6A 2DJUA 2Q7YA 4AENA 2ATPA 1F4XH 1JHLH 3EH5B 4X7SL 4IK6A 2FR4B 2X0WA 4YDKL 1JV5A 3LQAC 4YSTA 4KUCD 5JOPD 3R8BB 3K71A 3HUJA 1CQYA 1HOCA 1FL3A 1HEZA 4PYHA 3NCCB 4YHLL 3KW7A 5KUKA 3U2JA 4UF7C 1ROWA 4FN0A 1SN5A 4LP8A 4ENED 4U3SA 3OWRA 4A7QA 4PGCB 2DDQL 4F15C 3NIDE 2H6UA 4AVHA 3KPMB 2WGNB 2HMIC 5INCA 3ZZQA 5JIIA 3LS4L 1P4IH 5CSZA 3ALPA 4OB5L 5D1ZI 3UTTB 1JV2B 4ZFZA 1M71B 4HJGA 4OM0H 1D5ZB 3EGXB 2EDYA 1S9XA 5CMAB 3VUAA 3GK8H 4QRSA 3GB7B 4KZCA 1JPTH 1Z3GH 2J55A 4OFYD 4OIFA 4BQ6A 5GGVH 1EAPB 4MJ5B 5DK0B 1H5BA 1WVZA 3TEWA 1T2QL 2GJ6E 3NIFE 4M3HA 1CFQA 1R34A 5GRJH 2WZ5A 5BZZA 1NA8A 3BH9B 5D1ZA 3EO9L 3VXQA 1ZGLP 2YBGA 3CSPA 3VXOA 5D1ZD 5IQLA 1YECH 3IWVA 4XPAH 5C97A 3MRIA 3K2IA 3NJVA 3E3QC 3HB3B 3NPZB 3NN8A 1IGCL 3OXSB 5B38A 2ZYSA 3APMA 3VH8B 5DUML 5IREA 1GMIA 2WYTA 2JXMA 5TGBA 2N3JA 3FT0A 4FXKB 1QLEH 3CX2A 3ARFA 3Q1EA 2IGTA 1M6OA 4BK8A 2RHEA 5EB9A 3VXNA 5DUBA 2A73B 2VW4A 2V17L 3ARFD 3CFCH 5E6SB 4NZRH 2BDNH 5AVUB 5DS8B 3WS3B 1XZWA 2ESVA 3KM2A 3QG7H 3DI2B 4IHBA 15C8L 4GXFA 4ENZA 2HH0L 5I15H 4FXGC 3TJEH 2ESVD 2FSEA 4NQCD 3EXLA 2OZ4L 4TLSA 3ARGA 2VZOA 4KJQD 4YL9A 2ZAGA 4JANA 1SOKA 2HKFH 2EVIA 3ML8A 3W2DH 1LO5B 4JREB 4UI2A 2LVEA 5IV2B 5GGQH 5H4ZA 1C9SA 4U6HB 2VDNH 1PKQB 5TE6H 3RY4A 4QTIL 1ECYA 2PYFA 2QDVA 1U42A 1B0RA 3GSQB 1R3JA 1EERB 1VRSA 2IEPA 3LPWA 3MUZ1 4N5UA 3T3PB 4K0OA 4RAHA 1DQKA 2N0MA 5AZEH 3U2IA 1KF9B 2ZXQA 3PL6A 4HIHA 3UJJH 5DMGD 2GBTA 3SY0B 3OMZA 1T0MA 3PL6D 4BH7B 2X3BA 1U3HA 5K59F 1XR9A 3MLYH 5B7FA 3NBNA 3DSFH 1U3HD 4UTBH 1BEXA 4IRZA 1J05A 3O4LD 4OD3L 3WHXB 4OJEH 4PV8A 3C09B 3VI3E 5I1LA 4HW6A 5LAXA 4FQXB 3S4SG 1XH3A 3ZE1F 4IDJH 2VM3A 4JFWA 2EUVA 4P9HC 5C0IB 2Z4QB 4BJLA 3D33A 5C0CE 2A6JB 5GJTL 3HG1A 1JPFB 1B90A 4LKXB 5FLUA 1BVLB 2WB7A 1U91B 3OB0K 2YHGA 3VXUE 2OMNA 5D7SH 1OAQL 3NABL 5G4OA 1IC7L 2ZAHA 2CA4A 4JM2B 3EGDA 4R97C 2EC8A 3PV7A 3LZQA 1R19A 2NNAB 2OMUB 1QTSA 1PS3A 4IHOB 1A7NH 4LLQB 4CU6A 1PZAA 1H15B 1NOFA 4OZGF 3TO4C 4OLVH 4CVZA 4P99A 3GI9H 3NJIA 4L1TA 1U8OB 2V2WA 2XWJA 5IY5B 4BKLB 1TFPA 3NG5A 1X5ZA 2ZKYA 4I9WD 1BP3B 1RK1A 4NBYB 1T80A 2JIXB 5DD6A 2ZPKL 3DUUA 3JTTA 1R24A 2WXIA 5CWSA 1BMGA 5CINH 4O2CA 2ITEA 1ADWA 2NTFA 1OEZW 4O5LL 3GLZA 4HIPA 4LSTH 5SWZD 4PRDA 3BFOA 3SB3A 5F3BB 1ES0A 4OV5B 1PZ3A 1A7PL 4E9WA 4K94L 1IX2A 3EJYC 1U4FA 5D7IF 3AREC 2YGVA 3ILEA 4L9LC 4J3XA 4FGMA 3ZKNC 3SY6A 2MHAB 2WMPB 5HI5D 5T3XE 3FOLB 4XN7A 1RZKH 1RLWA 1NMAH 2EDKA 2XZCL 3H7BA 4YDMA 3KBPA 1J8HA 3UZVB 1F3DH 1W72A 3BVXA 3E0GA 4KXCA 3IFLL 3O8XC 1KB9J 3HVDA 4JHWH 4XPGH 2LQRA 2FHBA 3LEVL 3ZRCC 4BFIA 4F8OA 1CLVA 1EO7A 1GGBL 1R17A 1JK9A 3BPNB 1NC2A 4PJEE 4TTDC 3RWEB 4GS7B 4U3CA 1BG9A 4R0LC 5F0PB 1NC2D 2VLJB 4OCSH 5AB1A 4BFFA 1AGDB 1RUAL 3ECBB 2AXFA 4MRCA 2ADIA 2GUYA 4ABWA 4LIQL 1I85C 1JZHA 4JG9A 4NM8L 2VXTL 3ZZSA 1RZJC 3FT9A 4U1JB 2ITCA 4PGDA 3N3EA 4C4BA 3F83A 1DANU 3VWJA 3RVUC 5I2IB 5E1IA 3IDIB 4CADA 5F9AC 1ZWIA 4DQOH 1ZVNA 2Q3ZA 3ARXA 1XGQB 4XAKD 2GVYA 5H4YA 5I1HL 1AG6A 1GSMA 1FNEB 4P5MB 4ZX3A 4CMMA 3OQRA 5IB3A 4Y1AB 3CVIL 1W9XA 2BOBA 5T1LB 2DAVA 4A6YB 4Z0BL 5E9DA 4P59L 4H0GA 1A2YA 2YXFA 1K9TA 4I5BB 1DJYA 4P0DA 3FFDA 4DP1X 5DO8A 1DUYA 3BP6A 2X40A 3SKNA 4I85A 4NQSB 4BKSC 4XVJL 2YD5A 3QNFA 3T77B 3WIFB 4PS7A 1WTGT 2FATL 4CBZA 1DSWA 2PO6C 1E9QA 4OFKA 2AABL 2ZP9A 4JY5H 5CBEA 2BSSB 4HK0A 3VXMD 1JK8B 3RDJA 1RPKA 3KD4A 5BS0B 3HHRB 3FU7A 3L3OC 2C1OA 3QDHA 4KI1A 1FFTB 4PR5B 4WI8A 3DTXA 3EFDL 4IS6A 1NFDF 1R5IB 3VFGL 2K8QA 4E5XG 3O2VL 3P2DA 5CEYA 3U7WL 5H35A 1I1FA 1KG0B 2OCCB 3JSSA 1A25A 2XN9A 5IVZA 4JDEA 3TCTA 5EHFA 1GGYA 3ILPB 1G7IA 2XN9D 3GXMA 1BZ7A 3V9FA 4WI0B 2HJFA 3GZQA 4LDEB 4HA1A 1ID2A 1WAAF 4OLXH 2YUXA 3WIHA 1NM9A 4AE1A 5I75B 4BA0A 3O41B 4X4XB 3MV7A 4XBEH 1HWWA 4X8GA 2Q7YB 3VFVA 4AENB 2RR3A 2UYLA 3HHMA 3MV7D 2HSIA 4JAMA 1EJOH 2DM7A 1RSFA 3F04A 4MA8H 4ZTOL 2AJSH 1JV5B 3SJVA 3K71B 3MYJA 1ZY9A 4A2FA 2PP7A 1XX9C 3HUJB 1HOCB 3KPPA 3PGCA 1FL3B 1HEZB 3JWOH 4HS8L 4R2GD 2G2PA 4TRPL 1FO0A 3IJ9A 5AYTA 3SJVD 3B3IA 5T8IA 4YZWA 1GGIL 3PDOA 4CBPA 3ULUE 1JPST 1QSVA 4J7RA 4X6DE 1D6VH 2JB6A 2HRPH 4J3OC 4LCYB 2B3IA 5BRQA 3WUWG 1JZ3A 2W88A 2J4WH 4U3SB 3WSQL 3EJCA 1OV8A 1E28A 4GXUM 4GPVA 4XP9H 3R19A 4F8PA 4S1SH 2OYLA 2A74A 2J21A 5CSZB 4YXHH 2X1QA 4AQ1C 4ZFZB 3MXWL 2W9EL 5MENA 1I3GL 4H1LG 4AW7A 5E6ZA 4HJGB 4L4VE 5I8CA 1S9XB 5MEND 2VDPL 4K2UH 4QRSB 1AXTH 4N0RA 5DK3A 3GIZL 3JT2A 3WELA 3EYSH 3KPRE 1FA4A 3RWDA 1SY6L 1H5BB 2YS4A 3B9KA 1CFQB 3IJSA 4M1DH 3UJTH 4Y2OB 5D1ZB 4BSVA 3VXQB 1NLBH 4NC2B 2FJSA 3DMMD 4S0TD 3VXOB 3A47A 5HP5A 1T7YA 1MH5B 2HRLA 3LNEA 2AQ1A 3NN8B 5F7BA 1G7LA 2X4NA 2F8VA 3KYKH 4HCRA 4G7RB 5B38B 5FDYA 2BS8A 3MA9L 3BX7C 1A4KA 2JXMB 5K1JA 5TGBB 4ZMLA 3CUPA 4IBSA 2LW3A 1A1MA 4UAOB 3IMWA 1ET7A 4GUQA 3HZYA 5E5MA 3AM8C 3MREA 3ARFB 1M6OB 4FS0A 3VXNB 2M2DA 4RMVA 5DUBB 2IDSA 3NH7H 1ED3A 2YPLA 4M7KH 3E8UH 2ESVB 5FYJL 1HL4A 4XVTL 2YPLD 1BFTA 3CN3A 5D5MF 3HRPA 2FSEB 3ES6B 3ZDZF 2ZXEB 4KJYB 1JTOA 4UQIM 4JANB 2WJ5A 1CFTA 3BCFA 5DJ2B 4P9MH 2Q8AH 5BXFA 5LCVH 2XACC 2Z6FA 5CJXC 3BMWA 3IFNL 4JM4H 4H20L 4NOFA 5DXWA 4E9RA 3UEQA 1Z5LB 2PYFB 2YGPA 2BHZA 2YARA 1B0RB 3PIQA 1R3JB 3RUGB 1KGYE 2XA8H 3D2UA 4LRIC 3PL6B 4HIHB 4A2MA 2YMXL 3UL4A 5TQ0H 4NJ9L 5IVXA 1QASA 1T0MB 3NCMA 3WE1A 1U3HB 1S7WA 5E4EC 1C5BH 5CLZA 1XR9B 4ZFFA 4FA6A 4OZHF 4GIPD 1AY1L 5ADPH 2A5UA 4OCRH 3IMTA 5FR3A 1J05B 3DJTA 1U8IA 2PPCA 4PV8B 4M5YL 3EYUH 5I1LB 5LAXB 4OIIL 2COVD 1MEXL 1XH3B 3SDAA 4NXSA 2YD7A 4HWBL 1EGJL 2BSCA 4LVOC 4P23A 3SDAD 4EZJA 2R7EA 5ANMA 1JI1A 4G5ZL 4M29A 4P23D 3TPKA 4TM9A 1HI6B 5I1IH 4JY4A 4GSDH 3HG1B 2JKSA 4NI6A 2YD0A 4L1DA 2E6QA 3KH4A 1E6JH 1QI3A 1J5DA 2XPGA 4A68A 3UFIA 4JGUA 4PTTA 1NANH 1XF3B 3EGDB 1WZMA 3FQYA 3TFKD 4IDLA 3NA9L 3NSXA 4X7DC 1R3IH 5I19H 4CVZB 3WN5C 3QRBA 2V2WB 2V5RA 1I7ZA 2K6YA 2L8AA 2XWJB 3EOBA 1IQWL 4FRWA 3ZTNL 3UH8A 3L4XA 2AHIA 1YA5A 5DD6B 2R29H 1GS8A 3DUUB 4UMSA 3W81A 1R24B 2A6IA 3X3GH 1ZVHA 1PVHA 4K5OA 4O2CB 2H32A 1AGBA 2NTFB 3PGFH 4KHXL 3ULVL 4CN6A 1UB6A 1ES0B 4LASH 1TJXA 4P2QE 1CFSA 4JB9L 4OUUA 4Q58C 3F7LA 3CX5J 4Y4FA 3TBVA 5ID1A 1CGVA 3C8HA 4X6FA 1ETJA 4Y4FD 4PTUA 1GW0A 4R4BA 4GXVH 1DHKA 4PS3A 1KELH 1WDAA 3Q2NA 3H7BB 3LY6A 3M8OL 1UOVA 1RUPH 2CO3A 1J8HB 4PB9H 1QR1A 3QEQD 1NCOA 1W72B 3BO8A 3WI9A 3QCUH 2ALWA 3R7RA 4JZJC 5J13C 1SGKA 1UGKA 2FLBT 4BFGA 4BFIB 2DD8L 5DHEA 3ARSA 4M6AA 1JK9B 1P6AB 1NC2B 1ZLVK 2E59A 1IT9H 3D52A 3U0WL 5FB8A 1NIAA 2ZJSL 1MFNA 1TJGH 3GRWH 3CZFA 1JVOA 3G04B 1U8HB 2E86A 1MKFA 1HWGB 1OAKH 3H54A 1IJNA 2AXFB 5JW4R 2ADIB 1YLBB 1YSOA 3IS0X 5IFHH 4TLTA 3RL1B 3WTXA 5TH2A 5KW9H 1DVUA 2ITCB 1OTUC 3OGCA 4PGDB 3V6OA 1XGRB 3F00A 1KEMH 1HH6A 4U7MA 3VWJB 2LU3A 1BEYL 1D6EA 3ZRFC 4CADB 35C8L 1ZWIB 3BUYA 5KSVA 4UINH 2CIIA 1E5AA 3US9A 1KV3A 1SOQA 4AK2A 1OARL 4LRNH 3MBEA 4CVUA 5E51A 4CMMB 2PMZA 4LLVA 1YEEL 2AK1H 2X6BA 1KGCD 1C08A 3DPDA 3MBED 3B8YA 4BRVA 1ICTA 2KPWA 5LNEA 1JTTA 1RZKC 5E9DB 5HYSA 1HL9A 1KXVA 1KBVA 4LSDA 5G4MA 3ZMNA 4DO5A 1A2YB 1Z32X 5E00B 4X9GA 3FFDB 5B7MA 1A14L 1JZ2A 5M95B 1F02I 4RGMB 1DUYB 3CZSA 1NAKL 5BPPA 3DDGA 1ZVYA 1SXCA 2UWEA 4G7YL 3SKNB 4XP1L 1SXNA 2K3TA 4J3BA 5SX5K 2CNZA 1M7IA 3GSVB 4RX4D 2ZUUA 4HUXA 1VAHA 1AYOA 1B0WA 1V8HA 1PLGH 3GHBH 3MCKA 1E9QB 2QT6A 2B9BA 4PWGA 2C9VA 3SN6N 3B2DC 5CBEB 3MR9A 4HK0B 2BW4A 4KTEH 4JJ5A 4U49A 3OLDA 3A5VA 3VW3H 1QMUA 1AHWA 3FU7B 3DPBB 4XBMA 3EJZD 2C1OB 2HG0A 1V7NL 2RA1A 1L0QA 2DRUA 3BIAX 4XO4A 1NAML 1JF6A 1MNUL 2G3NA 4IS6B 1HESA 3ULSB 3WAJA 2VXVH 5CEYB 5H35B 4J2XA 1OPGL 3IDXL 1I1FB 3RKPA 3RPKA 2P49B 1I1CA 1NBYA 1FYHB 4K7FA 4D2NA 2XN9B 5IVZB 4JDEB 4ODBD 4J1UA 1G7IB 1BZ7B 1AHKA 2R15A 2VR4A 4RETB 1MIMH 2C4FU 2HJFB 4IGBC 3UG3A 4HF5H 4HWNA 4N0YL 1F90H 4ABUA 5JW5A 4X6CE 2WNXA 3HI6L 3MV7B 3B2MA 3O6ML 4CGTA 3VFVB 1BF8A 1EMTL 1RSYA 2UYLB 4YHZL 1P7QA 4JAMB 2VISA 4PJ5A 5EU6E 4CN1A 2IH9A 3UPAA 4QXGL 3V0AC 5GRUH 1ZIAA 3SJVB 2XV6B 4XAWL 2IXQA 1QQDA 3KPPB 3PGCB 3TVMC 1FO0B 1GR7A 1V3MA 3ARRA 4OR1A 3B3IB 1NINA 4Y5YA 2EABA 3L16A 4MAZA 3WJMA 2FWSA 3PDOB 2BSRA 3PY9A 4HXBH 2WQ8A 3WE6B 2JB6B 4QOKA 3S5LG 4JQXA 4R26H 2V5YA 2AC0A 4BGDA 2HT3D 1SEQH 3EZJB 1THAA 4QOKD 4LVEA 3UDWA 8CGTA 2R69A 1E28B 4PBXA 3NFSH 4Y16A 1IGMH 5F7NC 2FX7H 1UWXH 4FQ1H 3U9PH 5BJTA 1CFVH 2VOTA 4NWUH 2EIBA 3SZKC 4Y16D 2A74B 2AJ3A 5TD4A 3QO0A 3U1SH 5MENB 1M9SA 2VDOB 5I8CB 3VFOB 2NPLX 4PJAF 4FFWD 4U4IA 5LVEA 1QTPA 1JSYA 2E7LA 3B2UD 2CR6A 4KC3B 2RTTA 1I9IL 3IDJA 3IJSB 2W65A 3DMMB 2P28B 4FHKA 5AALA 5C2UB 4UIKL 1WCBA 3QNZA 3TBBA 1EEZA 4TPRH 5IVOA 1NGXA 1TZ8A 3QIBC 1PL3A 1PSKL 2VB5A 4OZFH 5I9QC 1EAJA 3JWOC 1P2CA 4WWID 1G7LB 1LWRA 2CLVA 5ESQA 4IBQA 4YPGA 3BGFC 5K39A 4AL8L 2EIDA 1D5XA 2PCYA 1VEPA 1A4KB 4ZG1A 4QRQA 3VSTA 1DN0A 1QP1A 3CUPB 1A1MB 1OGAD 4TQEL 5D4HA 5E5MB 3MREB 2NLJB 2J6EL 1AANA 3VWKC 4FQQA 4NUGL 4AK1A 2TSBA 4GI6A 5HHPB 1E4WL 1N64L 2BJML 3OKEA 1ED3B 2YPLB 1VCAA 2NTSP 5D4IA 3BT2H 2QADB 4NP4L 2Q8BH 4ZUTA 5HY9A 4JCWA 1IGYA 1KCRH 4ONHA 2ADFH 3BD4A 2P9RA 1VFUA 1CFTB 5E99L 2GIXA 4FF9A 2Z91A 3JYBA 4D9QD 1TCMA 5BXFB 3LNDA 3WDJA 5DR5H 4I3RL 1HHKA 2Z35A 2EEFA 4Z7OF 1JAEA 3NIGE 4FI7A 4UMGA 3BWSA 3QDMA 3QXUA 3WKML 2RFXA 3SODB 2NYZA 3PIQB 4E41D 4Y19D 4YEEA 5CKGA 2V7NA 4JPWH 4XP6H 4XO5A 2ICEC 1T1YB 4ICXA 2DQFA 5IVXB 3N06B 1DJHA 2ADYA 2VMCA 4XNXL 1BVOA 4P2RA 4MDRA 3S3BB 2YD3A 4ODVH 4GG6A 1KCVL 2MOVA 1MN4A 1WD9A 4P2RD 4TVPE 3RWFA 3S34L 5GS1C 1FUNA 3P1VA 3H8NA 1RCYA 3EH2A 3SDAB 2R4SH 1URIA 5CCKL 1RZGA 4P23B 2C9UA 3KLHC 2J8UF 2R7EB 5ANMB 3D4CA 5LNDA 4EBQH 2ZSVA 3APNA 3HNTH 5A43C 3HG2A 3U0TA 3FB6A 2KQMA 2GYSA 4JY4B 3T2PA 3L4YA 4R3SA 4V11A 5F7WC 4C47A 4XNZC 2VL5A 1NDGA 5E2VL 3L1FA 1MFEH 2XPGB 4BFRA 1W0VA 4Z7IA 3U4EA 3C9NA 4JFSA 2AV7A 4PTTB 5D8JH 3QBTB 4KMQA 1ZLSL 3WD5H 1Q1JH 4GKZA 2C4XA 3LD8B 3RWIA 4ANWA 1F5WA 1UOLA 4P2OC 4WI4A 3FRUA 1ZXQA 5CO1A 2RJMA 2OTUA 4YDNA 4B97A 4FCAA 3QULA 3TZVC 2W38A 2GCYA 1JPSH 2A6IB 5BVPH 3A24A 1JZDC 4GRWB 3SE4A 2H32B 1FGNL 1AP2B 4UV7H 3TASA 1UB6B 4UT6L 3ARDA 1CFSB 3SYQA 4OUUB 4Y4FB 3TBVB 2B59A 4PW3A 4X6FB 4F24A 1R33A 1FGVL 4PTUB 5A2JH 1NSNL 3KJ6H 4R4BB 4N8CH 4TXVB 3EJPA 4AV0A 5CFHA 2VDMH 2YEVB 1UD2A 1QR1B 3BO8B 1BBJA 4RESB 1G87A 2GUOA 4IJ3C 2HVKA 5CZXC 4ANUA 4FHBD 1VA9A 2EH8L 1NCDH 2NX5D 2QDWA 4GKOA 4UQ9A 3EDDA 1BQUA 1T66D 2N01B 3ASOB 1ZHBA 4G83A 4YDJA 4KOCA 2EE2A 3CZFB 1R5VA 3ZK0A 5IQ7L 4YDVA 4KUZH 2X6MA 3FPYA 2PYEA 3HMXH 4HWEL 4XPFL 3ZKQD 4Y4KC 4LQFL 2PYED 5TH2B 3OGCB 2Z92A 3BKCH 1HH6B 4OCYL 4LAJH 1D6EB 1MJUL 1QPXA 3HJ0A 3FQ4A 3BUYB 4G8GA 5KSVB 5L0QC 2YRLA 4HXAH 4ZS7H 3UBHA 3ZTJG 1K5NA 1OO2A 2CJ3A 2QBWA 3MBEB 1M7UA 4AG4L 4EPSA 3F85A 4LLVB 4U1IA 1RZQA 1LO0H 3U4BH 2GIYA 4UDTA 5MI0B 1WV7T 1LXMA 4YHML 3GXPA 4MAUH 3ZMEA 2C5DC 3VU1A 5FUZL 5IHLB 2J2ZB 3KGRA 4H8VA 4Q0XL 3FAXA 1P5UC 1RD6A 1YC8A 2UWEB 3NCYS 5DZ9A 4G9FE 4JPIA 1NLDL 3FUFA 1M7IB 2O5ZH 4HUXB 2X4TA 4PJFE 1NCAH 4FA7B 3MCKB 3OAYK 5IHHA 4YFLF 5BV7C 5F70A 3TU6A 3QQ4B 5ICUA 1D2OA 3MR9B 1J1OH 1XCWA 4JJ5B 5IW3A 3LRHA 3SHSA 1WFMA 5EA0L 4UYQA 2PCXA 2HUEA 1I82A 1HOEA 4PRAA 4LESA 4RBPH 5I8OL 2WO2B 3NP4A 2VDRH 4ZSOA 3UTSE 3BOVA 2NMSA 1NBYB 4K7FB 4RA3A 3II1A 4J1UB 2CZNA 3WMSA 3V0WL 1HKFA 2Z64C 3X3FL 4JKPH 1JGVL 2R2EB 5JW5B 2BSBA 4H25A 4GIAA 3R4RA 1P7QB 4F7CA 2VISB 4PJ5B 1JOIA 2HWZH 4U1LB 3WDHA 2IAND 3V0GA 4D0CA 5BVJA 5HDBF 1S7TA 1LO4H 4FERA 1IJ9A 5D93B 2IXQB 1QQDB 1E9OA 2FECI 2FWOA 3UYRL 5FYLH 4NOBA 2XZZA 4Y5YB 5I1JL 1NC4D 3WJMB 3MA7A 5J1TC 2BSRB 5F9OL 1SN2A 3SKJL 2AVFA 4QXUL 2WBKA 4LARL 3U36A 1QRNA 4QOKB 1NOAA 2YFOA 2X53A 3CMGA 4PU2A 2WUBL 1QRND 4HYTB 2VQ4A 3U1PA 4L1LA 2CR0A 5D71H 4Z23A 3H2QA 3CVDA 4NZDA 4Y16B 5BJTB 6CGTA 1C8PA 2FQFA 3LXAA 5HYEA 4XN4A 2WBWB 4IBUA 2Y7SA 2AJ3B 4YGAB 2F8XC 2E9GA 3GFUA 1YRKA 5KJRH 3QWQB 4JFDE 5C0RH 4M56A 3U83A 2OJEA 2OR9L 4PJDF 4YC2B 4Q6IA 5I30H 5AAMA 2HTLC 4WFGD 3UACA 4ZNEE 5JMRA 3U9WA 3JQOB 5B3NA 5JW3L 3ECQA 4ZFQA 2XTJD 3G08A 2F5BH 3IDJB 4ZMPA 3AJ7A 1GZHC 3L2LA 3NCXA 2W65B 3EHBD 1RMFH 3QG6A 3GLAA 1WCBB 4FQCL 5IJKA 3R1GH 1E9PA 1I1AD 1EEZB 2C3GA 1SOXA 1N4XH 1NGXB 4HH8A 5CN2A 2A4ZA 3PP4L 1A7OH 1GZQA 3ARBC 4HSCX 3BGAA 1DQLL 3KXFA 2CLVB 2IG2H 2ZWZA 5K39B 4YPGB 2VN5A 3QZWA 1D5XB 2DLTA 2FNWA 5J7CC 1EV2E 4QRQB 2Y2TA 1R47A 1DN0B 2JJWA 1QUNA 2WNKA 3HG0A 1DQQA 5G4NA 1PJWA 4FQQB 4LCIL 3WENA 2ZKHL 1ZLEA 3IMUA 4WHCA 3OKEB 1BX2A 4DKEH 4K5LA 2F6AA 2V5SA 3NK3A 4HJEA 1KPRB 1ASQA 5EO0B 5JW4Q 4ZUTB 3DHJA 4UT7H 1IGYB 1ZHNA 4ONHB 4WUUE 3TEZA 2E46A 5A3ID 1KV7A 2Y24A 3GHEL 3MCLL 4QLWA 2Z91B 3CLFH 1HHKB 2Z35B 3TJHC 1KIRA 3UADA 4CC4A 4M5ZL 3QDMB 4W9EC 3C5ZC 3KS0J 5MEQA 4HX1A 2RFXB 4XB7A 3SEPA 4E41B 4FG2A 2BO0A 4KRMB 1RZIB 5IB2A 1SQ2N 4GO8A 3BHBB 2V7NB 1T1ZA 5JMOC 4IRZL 4Z7WA 1MVUA 4EN3C 1EPFA 2NCEA 4HOXA 3UJIL 1JNNH 1S46A 4XT1C 1B4TA 1O7DE 5I71B 3S48A 2DM3A 1E3ZA 2GBAA 3HOGA 5E1AA 4P46D 5GIRA 3QXWA 2QMKA 4L3CA 4P2RB 3BEVA 2X4PA 1K85A 5BO0D 4GG6B 3PABA 4WWOA 4DKFL 3RWFB 2CO6A 2XXGA 2DI8A 1NOLA 2NCMA 5AAWA 4L29A 3G5YA 3HE6A 1NCWL 5MERA 1TTAA 1RZGB 4FABH 1GPOH 5A2AA 3HE6D 3H53A 1HL8A 3AY2A 1I3RA 2GJ6A 2FBJL 3SE8H 4DAGL 3U0TB 2WCGA 3FB6B 1A6ZB 2KYIA 3RTQC 4I13B 1QI4A 2GJ6D 2W5PA 3RA7H 5JXEC 3M1OA 1PAMA 4R3SB 4CN4A 1DSFH 4X4ZA 3ZE2F 2R0WL 2VL5B 4U0RC 5IQ9A 1KBKA 4HK3J 1NDGB 3HRZC 1P4LA 3PAYA 4IIZA 5IGXL 5BQDA 1W0VB 3T3MF 2QZ5A 4M8RA 3U4EB 3C9NB 1MXDA 4UQBA 4NLHA 2WZ0A 1BW8A 4RRPA 3QE5A 2IO5A 1UG9A 4GKZB 4G6JL 4I1RA 5I5JA 4RSVA 1J9RA 1EUTA 3RWIB 1G1OA 4EUPG 2KZ1B 1E90A 3QI9A 4XMZA 3DUSA 3FRUB 4DZBB 2NW2A 5FHBL 2OTUB 2QQLL 3QI9D 1G0DA 2BSDA 2R0KL 3N41B 2GCYB 4HKJA 2CU9A 3B9EA 4FFYH 2YRPA 4M43H 4S10A 3FT3A 2PN5A 1NGYA 3KCWA 4LSUL 4P3CH 1F2XK 4C58B 5L4FA 1PD1A 1WPCA 3ARDB 2YAEA 3FBKA 1MVYA 4ZDHB 4FA8A 2B59B 2WINB 3BPLB 2KT6A 4CL7A 2WXQA 1A7BA 2G2RA 2AQ2A 1W72L 2VZ1A 2HLFD 1BPLB 3RIAK 5IM7A 1TIUA 3PXLA 4L4JA 1NCCH 4JFXA 3UTPE 1HK6A 1MRDH 3ALXA 2ADJA 1ORSB 1N2RA 4OCMC 4WENB 5D7JA 3RYMA 3OMIB 1BBJB 3H9HA 2GUOB 4A7SA 2HKHL 2HVKB 2NX5B 1WIOA 3MOBH 3KH3A 4OGYH 4WTZA 4HS3A 4ABQA 4EZMA 4ALAL 4HPYL 4WI6A 2ZX6A 3PWNA 4FE9A 3FMGL 5LGJB 3PRZA 3RY6A 3JWNG 1ZHBB 4ZS6C 1X5GA 2VC2L 1EEQA 3UAFA 4JKLA 3VI3A 4J6RL 2DQ6A 5DZLA 4OJAA 4YDJB 4AJWA 1R5VB 1E6OH 3F7YA 4YDVB 1SRDA 3QEHB 4FYTA 4OZGA 3ZHKA 1J9SA 2PYEB 2EZ0C 2VW6A 3RU8H 2O5NA 1E65A 4ESKA 4BV1A 4RWYL 1ZMYA 5CKAA 1DBML 7PAZA 3QZLA 5C0CA 1VFAA 2Z92B 1TSHA 3P9MA 4GMTH 4KX7A 2C7FA 5C0CD 4KK8C 3CVHH 1G43A 3QWOB 5EUOF 4G8GB 4MLIA 4J28A 2WD0A 4KK5C 1K5NB 3VXUD 3DO4A 3TWYA 2IC2A 4U1IB 1FIGL 2IJ0C 3EYOA 3DO7A 4YIQA 3DKHA 5D7IA 4HLEA 1T2XA 4UDTB 2NY1B 3HHSA 2DW5A 3GT6A 1UCBH 3GZKA 1QSFE 1GMEA 1FAIH 4HBQA 2NY4D 3D5OF 5SX4I 3DGCR 2VL4A 4JPIB 4DIXA 3WTTA 4P8QA 3LKOA 5ITFA 4LCWA 2X4TB 3LPFA 4F80A 3QUML 1WUZA 4GMSL 2EO9A 4B9GA 5AW9B 4ODHH 3CBJB 4KDTA 4UBDD 2DEXX 4IRSC 3VD3A 4LL9A 2CUAA 1FVEA 5C3IA 2IGFL 3HAEG 4ODWB 1FSKB 1YPZB 4PRAB 5DD3H 1KN4L 2X10A 5T3XD 3KGSA 3S5YA 4AV4A 4BZ2H 4YHKH 2K70A 3NSJA 2NR6C 5TF1L 2AXGA 3WIHL 4LB8A 2EYSA 4N2AA 1TKWA 1YNLL 3QIWA 3RNQA 1J0JA 5IMOA 1PD0A 2CCVA 4PJEA 4LSQL 4JN1H 4L05A 1KCLA 5LDUA 4LL1A 4RISL 3RB7A 4F7CB 3H42H 1FO0L 2D9CA 3CHSA 3BDBA 1WZAA 1FNGA 4D0CB 5BVJB 3CE1A 1IM3D 1KENH 3H3PL 1IRAY 5ESVA 3WO4B 5LXGL 1E9OB 1NC4B 1A6TA 2CIKA 3DROA 3ISYA 1PCSA 4L4TE 4R4FH 3FQWA 3MA7B 2D03H 3I6SA 1FC2D 3VGEA 2YEZA 3U36B 1QRNB 4S1RL 2BC4A 2D8KA 3WGVB 3POHA 5IJBC 1SZNA 3ATEA 3IE9A 1QYGH 3UCRA 1YJDL 3U30C 3C75A 3UERA 1HINL 4LLYA 1JZGA 3MLUH 3IVKA 3NUKA 1YYLH 4FG6C 4WSKA 2VDOL 1FN4A 4U05A 1B2YA 4AMWA 3DO3A 4ES8A 5B21A 4JG1L 2IFFH 4UQEA 2OJEB 4DGVH 4M7LL 4X5XA 3IT8D 4H0HB 1NGPL 3VXSA 1BV8A 1CGUA 4XOCA 4I18C 3WTWA 5AG9A 2YN3A 3G08B 4Z8FL 2Z1PA 4ZUSA 1XV8A 3E6FA 2VDKH 3QG6B 1BQLL 1JGUL 1I1AB 2I9LB 2L7QA 2PP9A 4MJHA 3QT2A 2CH8A 2XI9A 5AVWB 3REWA 4ETQA 1E9PB 4HCRL 4IOIA 4X7SH 2EDHA 1YEKL 4YDKH 4WRLA 2KMWA 3KXFB 7CGTA 4OJFL 4AXWB 3MVSA 4FFTA 4YHLH 5K59E 3K5SA 2R39A 2WWMC 5E08L 2A9ML 3B4NA 1N9PA 1OD7A 1QUNB 1DQQB 3BIKA 2X89D 1Y7VA 1UD8A 3I75A 2DDQH 2V3FA 1BX2B 1WRFA 3HG3A 3SGKA 5D2LF 1A66A 3MGOA 4OLYL 3B3BA 1R3KA 3KDMA 5G5DA 3E8VA 3OKKB 1Q9WB 3LS4H 3KL3A 4BWTA 1DCLA 4J8QA 5CLWA 1DVFA 4OB5H 5EIQA 3HC2A 4LHUD 3VAEA 3UC0L 3ATFA 1TR7A 4FQPA 4Q4IA 4UT9A 5D70H 3U2SB 4FYQA 4YSCA 3EJSA 1KIRB 1KNOA 5MEQB 4LOUC 4HX1B 3D39E 3FAWA 1T2QH 3DX7A 1OAXL 1V3KA 4ZW5A 1MUJB 3ULUD 2VLRA 4UQCA 5IB2B 2Q3AA 3QZOA 1L7IL 3GTTA 3EO9H 3QRLA 1KYUA 1GJWA 2GI0A 1T1ZB 4AC4A 5FW6A 1QBBA 2UY6B 3NSDA 1MVUB 4Z7WB 5DEZA 4P46B 1FFRA 3ULAB 3CSBA 5E1AB 1IGCH 4L3CB 3BEVB 2OQJA 2X4PB 3PNWA 1KBBA 3PABB 1ASPA 5DUMH 1A47A 1YEFL 4L4VA 2CO6B 5AW6B 3BSHA 4L29B 2AQRA 2WXKA 4JE4B 4L4VD 1DVQA 3G5YB 4X5LA 4PUBL 5A6LA 3HE6B 4GNKB 4HETA 5MERB 5LO7A 1KGXA 2OXGB 2V17H 1I3RB 4NIKB 3KPRD 2GJ6B 3NIFB 4LSVL 1Z5HA 2AKRA 1IUZA 1YMME 1NEZA 15C8H 1QFOA 2HH0H 3OKMA 1E5BA 3QNXA 5IQ9B 1TQSA 2OZ4H 5MEPA 1P4LB 3KZ8A 1YN7A 5E6ID 3T8XB 2ICWJ 1TQWA 3OHMB 3EO1A 3IAGC 4A2EA 1MCBA 2EDQA 3O3UN 1T6WA 3HNVL 3EG9A 3TBSB 3AADB 3SPVA 2QGDA 4QTIH 3HE7C 3SDYL 4Z1PA 4QRPE 1RURL 1MCIA 3QI9B 3QJUB 3HN5A 1LP9E 5E8DH 5ITBL 2NW2B 1WFUA 2YXMA 3E2HB 1E8WA 4XN1A 2MTPA 4HKJB 4ZX4A 1P6WA 4XB8A 3FT3B 3CFQA 1QFWI 2J5LC 3FTWA 4GH7B 4K9EL 4RRPM 4LOVA 1NGYB 5FFLA 4L3AA 1PLCA 2VITA 4P04A 4OD3H 3WIIL 3MRMA 1B4JH 1PKOA 2NY6D 3ZDYF 5CGTA 2WXGA 1J5OL 1BZQK 2V33A 3LV3A 4RFNC 1VGEL 5IFAL 3RAJL 5JR1H 2G2RB 4GQPH 1NH6A 5AVQB 5IM7B 5CILL 4GYBA 4JFXB 4P5SA 4DP5X 2ADJB 2WLZA 1N2RB 2Q10A 5D7JB 4QAWA 1YY9D 4KKPA 5GJTH 2IBZX 3QUYA 3WU1A 2J7LA 3H9HB 1EJ6A 5IEHA 2RAMA 3QUYD 4FL4B 4HS3B 4U1NA 4N8VB 3H6AA 3MJ9L 3N50A 3PWNB 4TKWA 5JHLH 1OAQH 3NABH 1EFQA 1VIWA 1IC7H 1KBGH 3QUZC 5IJVA 1YO4A 1X4YA 3MFFA 3QCTL 4JVWA 3VI3B 3BRFA 4MVBC 2B1HL 4ZZKA 4GUOA 3BQUA 4PWEA 2XKNA 3WXWL 3F7YB 3BQUD 5CJ8A 5EUKA 3SGEI 1OP4A 3Q5TA 4OU3A 4MMXC 1ITCA 2ZPKH 1KFAL 3P40A 2EDOA 3GSNA 3PXHA 4HJSA 5C0CB 1VFAB 3P9MB 4IKIA 1JBJA 4AKOA 4WK0B 5D7EA 1X7QA 1QEWA 1KB5A 1MCWW 5B7EA 3VXUB 1JP5A 1A7PH 2E6PA 3AG3B 4KHTH 3P2BA 4K94H 1QLFA 1HCVA 1ET5A 4AYEC 3EYOB 3DO7B 4YIQB 4GQRA 1MI5A 5F7AA 3RDTD 3I84A 3M07A 2VMFA 4RGNB 1M7DA 2YPVL 3IFLH 1KACB 3LZFL 4AGLA 1JZ6A 2JCWA 5F1SA 3RL2A 2GSGA 3LKOB 3LEVH 5ITFB 4LCWB 3WFCL 1GGBH 2B0SH 4G8EA 3FO1A 1UUSA 1WUNT 1UQSA 1JHTA 4Y4HC 5I1DA 5JA8B 4AVJA 3PFUA 4P2QA 3ZIYA 1V7ML 3LRMA 3H3KA 1BBDL 1MHEA 1A3LH 4P2QD 1H6FA 1RUAH 4RDBA 1FRGH 3MJGX 3SYPA 4UIMA 1FVEB 4R4ND 1MY7A 4W4OC 3T2QA 4Z7QE 1BM7A 1BXAA 5EU5A 4NM8H 2VXTH 4XP4L 5TDOA 4WWKA 3LDBC 3PHSA 3GBNL 3BUIA 4CC1A 3K74B 4TL4A 1SXSA 3G7TA 2AXGB 3AABA 2CDFA 5EC2A 4P05A 4PWKA 5I1HH 2RMNA 4PWFA 1TKWB 4JKKA 3QIWB 3FF8A 4KO9A 4PQXA 1WCQA 3RNQB 1JZ8A 2Q2LA 5IMOB 4Q9CA 4G9DA 2DJMA 3GMRA 1T6BX 1QHOA 3P0VH 1WLHA 4PJEB 2PCPA 3MRQA 2F15A 4Z0BH 4NUMA 1H6UA 4P59H 3MZTA 4G43A 1KYFA 3F7KA 2F7RA 1IM3B 4K8RL 4TUOA 4U6YB 4L8CB 1HXMA 5E6UB 1FNGB 3IBOA 3E9TA 1HXYA 1JZ7A 2ERJB 5ESVB 2DH3A 2XT1B 4MHHI 2C3VA 1A6TB 3TJPA 2CIKB 3DROB 4R5TA 1T20B 1V27A 4XVJH 5SWQA 4NDMA 2W94A 3FQWB 3VGAC 5IHZA 2VABA 2FATH 4ODUA 3QCVL 5F96L 2YEZB 2R69L 3PCYA 4J8RB 4TSCL 2FBOJ 2BC4B 3M88A 2MPVA 2AABH 5EC1A 2FWLB 5C3LD 5I18L 1X6NA 1XH1A 3GLDA 4LLYB 2VAJA 4C4UA 3IVKB 5GRVK 8PAZA 2R4RL 1XMEB 1FN4B 4HH9A 4JQVC 3EFDH 4KO6A 3WLWC 4K5PA 4KJPD 5CEZL 3FYIB 4JUTA 3U7WH 5D5ME 3AQXA 2VMDA 4X5XB 3JWNH 3WN6A 3VXSB 2B7DT 5C9JA 1IE4A 3E6FB 1JVKA 2E9IA 1S6NA 4EZKA 1NUNB 4OF3A 1AE6L 1A6PA 4ZUVA 1BA9A 1TU2A 4MD5A 2WOBA 3REWB 4J2QA 5EU4A 4ETQB 1OE2A 4L3FA 3ESPA 3QFJE 3ARQA 4IOIB 4JMXA 4NT6A 3AU1A 4URTB 4ZTOH 1BGXL 4PJ6A 4L37A 1JMZA 3CZJA 1A0QH 4HS8H 4TRPH 1UEYA 4UNTA 4Y5VA 2E56A 1FHGA 5AW4B 2OYPA 2KH2B 5I5RA 1ZDSA 3SOBL 3BCDA 3BIKB 2VQTA 1ZRUA 4N2KA 3N1FC 3I75B 5KTEH 2X9ZA 3V9EA 1LK3L 3MGOB 4X6CA 1R3KB 4DNLA 5G5DB 3PXJA 5TPWL 5IUSA 2V6HA 1DVFB 2LTQC 3MXWH 2W9EH 1IARB 1J5CA 2UX7A 4MAYC 5EU6D 5GJSL 4CJ1A 1XBDA 5F21B 2GQHA 2VDPH 5GS0L 3WEOA 4ORGA 2CDGA 3D6GA 5EBLA 3LZRA 3GIZH 3W82A 1KNOB 1W0WA 2B15A 1SY6H 2XN1A 4EXPX 5EF1A 1GAFL 3DX7B 4X6DB 2XJLA 2OW6A 3S88L 1KCSL 2VM4A 5M94B 1TJMA 4DUWA 1T7XA 3OMNB 4YWGL 2D3VA 1L5GA 1MCRA 4UV4L 3OX8A 4F7EA 4LPUA 1B4LA 3K5RA 1DDHA 3OHXC 2P5WE 3V6BR 2OQJB 3PNWB 4U0QB 5T1JA 1U2CA 4MXWL 3QIUA 1QBLL 3MA9H 4L4VB 4NRZA 2HTKD 4NPKA 2IWKA 5A16A 4I2XA 2FGZA 3NJJA 1DL7L 1NDTA 3GJFA 4N2OA 5IZ7A 4AE0A 3GMPA 5DQJA 4FQJL 4KPHH 4KXAA 1IVLA 4JVPA 4N8VG 4EDXA 1F56A 5J11B 1CXLA 3GEFA 4HCFA 4X42A 3AT0A 4V33A 2H41A 3OKMB 3QNXB 5GZNA 4HFUL 1VEOA 1RQ5A 1CWVA 5FOBA 5MEPB 5GZND 3NJNA 2CPCA 5HHNA 4F9PA 1P7KA 4NSKA 1YN7B 4XNYL 3EO1B 4JFFE 5C0FA 2OL3L 3QXAA 5TK4A 3EG9B 3IJHA 3IFNH 5HDWA 4H20H 4NFDA 3HBPA 5HVWA 2JJSC 2X41A 2VN6A 4QO1A 4TUKL 1RZ7L 5EORL 1EFXA 4I7ZC 4F27A 3AROA 4NXKA 1I8KA 1PY4A 1JFQH 2YMXH 3B43A 4YH6A 2Y6SC 4NJ9H 2BY0A 5ABAA 4LLUB 4WV1C 3W57A 2DB8A 3Q2WA 3IAQA 1VPOL 1AY1H 3NTCL 1K3ZA 3LZNA 2FHCA 2NY6B 2VITB 3PWUA 4X5WA 3MRMB 4WEUD 3JTSA 4M5YH 2ZT9C 3DYOA 4B3EA 4OIIH 1MEXH 2QSQA 3LV3B 3QJOA 3X17A 3MACL 3QJHA 1UKSA 1VZGA 4HWBH 1EGJH 3ZIMA 3NJMA 2X09A 1VB9A 4PJ9C 5I1EL 4HJJH 4M48L 2NYKA 6TAAA 5FUOL 1WYJA 3QUYB 4WSJA 2CRMA 2F53E 5IEHB 4XWGL 4BGLA 1GGCH 2BSTA 3FC8A 4PJ8C 4P3WA 4U1NB 5C7XL 2X6CA 3TN0C 1YEGL 4P4RB 3TIDA 2VQ1A 2WAQA 4NBZB 4ISVA 3C60C 1PJ9A 4UTCA 1NCGA 5IJVB 3MPCA 3MFFB 1AACA 1VGKA 2HXAA 2MKLC 3NA9H 1QFWM 4TVPD 1E0OB 3BQUB 4U31A 5IIEA 5B3JE 1LNUA 3BSZA 4LGSB 4RA0C 5F0MB 3L5WA 4H8HA 3FO9A 3ZTNH 1IQWH 5EUKB 3A6CL 2OW7A 3G6JE 1SQMA 1F3JA 2KZKA 4N2IA 4LCCC 5E1GA 4XXWC 3RURA 3NEEA 4P4KA 1D9KC 2ZOUA 3GSNB 4APXA 4W6WB 2V0AA 2VUYA 1MCDA 1A64A 2R2CA 1JL8A 1EZVY 1L9TA 1KY7A 1UT1A 1X7QB 1QEWB 4I8DA 1KB5B 4KHXH 3ULVH 1SYSA 5EIIB 3EDEA 2OFQA 2CUHA 4AYDC 3MX0A 2J12B 4JB9H 4L5FL 3K2KA 1QLFB 4LDOB 4BCXA 4MA7L 5FKPB 2BIIA 2VDLB 3EKCA 5EPMA 1J10A 1DDTA 1W16A 4OLUL 3OJ2C 5DVMA 3UYOD 3M8OH 1KLFB 1M7DB 2EEBA 2J20A 5FC9A 3U48A 4ELKA 2R83A 5I6XB 5LGHL 3GTVA 3EO0A 5JLZA 1NWPA 4MA1C 2KDYA 3P9LA 3BWUF 4FP8L 2GSGB 4XCFL 2DD8H 3ENEA 2DYPD 4G8EB 4R7LA 4XVSL 3FO1B 4L1BA 1UQSB 8FABB 1JHTB 1MCPL 1WBZA 5I1DB 3D87B 4P2QB 5AOIA 5FGCB 3U0WH 1HSBA 1SDAB 2ZJSH 2WSDA 1AJ7H 4DN3L 3SE9L 5D4JA 3F01A 1TMCB 4XMTA 4UIMB 5KYUA 2H2PC 4PB0L 5EU5B 2GITA 2K9FB 2CO7B 2Z9TA 3FCTA 4WWKB 4YQXH 5I26A 1YCSA 2UZIL 4QXTA 2RIKA 1BEYH 2JCCE 1OT1A 1XCXA 4XH2A 35C8H 3PF2A 4GXUN 3VRLE 2CDFB 2PXYC 5EC2B 3SO3C 1ZHLB 4LVNB 4X0KA 2HN7A 4K94C 1H3UA 1ZANL 2VLLA 1OARH 4Z7VE 1D5MA 2J56A 4G9DB 4LFHG 3GMRB 1YEEH 4O2FA 1YECL 5DK2A 2PCPB 3MRQB 4I0PC 3K4ZA 4L0ZA 4DFIA 2XWTA 4G43B 4W9LC 4OGQC 4J12A 2MWCA 4TUOB 3W9DA 1A14H 1HXMB 3IU3A 4XPHH 2YMTA 3WLBA 1NAKH 5AVYB 1HXYB 4A38A 4G7YH 1AMYA 2X70B 3DNKA 1TNNA 1L9PA 2C3VB 2YFNA 4OQTA 4XP1H 5HVGB 1VSCA 2IBZY 3GNML 2EICA 4NDMB 3SQRA 2VIRB 5IHZB 1SMOA 3DX1A 2VABB 2C9PA 4LHUG 4WO0A 3B2PA 3TA3C 1TPXB 5BZDA 2X38A 3IK2A 3A3YB 4ZTPH 2H26A 2EDNA 4B0MB 3QEGL 1V7NH 4HH9B 3R0MA 3R8QA 2X1PA 1MNUH 4KVPA 3HTLX 4PIRF 3TO4D 1S9WA 5FHAH 3S3DB 3CHQA 2LU5A 2F19L 4LSPL 1OPGH 3IDXH 1EA9C 5TE6L 4N2HA 3AVEA 3TA4D 3T3PF 1H0DA 4NAQA 1GZPA 4PH8A 4FCHA 4JFEE 3LRGA 4G9FD 4QRBA 3UJJL 4PJFA 4B0MM 4N0YH 2PWDA 4FEMA 4G1EA 4TN9A 3HI6H 4ZUVB 3HG4A 3LCYA 3O6MH 1TU2B 3CTTA 1B9ZA 3DOIA 3HBZA 4MD5B 2YD4A 4LOEA 5DHVH 1J0HA 1EMTH 1QBML 4YHZH 4PCTA 3N85L 3EJYD 4NT6B 1G7QA 3AU1B 4R84A 1EJ8A 1U9KA 4QXGH 3ARED 1WWWX 1WK0A 4DN4L 2MIZA 4L37B 3VNZA 4Y5VB 3UTSA 1AXSA 1ZIBA 4GRLA 1Q9LA 3O8XA 3WNMA 1CXFA 5E0FA 4FKHA 3UTSD 5EWIH 2CGZA 2CO2A 3F5WA 3AY4A 3O8XD 3EXJA 4K7PY 1CO1A 2LOEA 5FWRA 5T3ZE 2WLYA 3MJ8A 5GS3A 4OV6F 4MQXC 4X6CB 1CICC 3GM8A 3P2TA