3DV4B

Crystal structure of sag506-01, tetragonal, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
119
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fv fragment SAG506-01
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 119
sequence length 121
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dv4B00
5IF0A 5BV7B 1TZIB 1UGNA 1XGQB 2B4CL 3OKDA 2XACC 3Q6FA 5JW4M 4OGYH 5HHOB 1E6OL 4O5LH 3B6SA 4HC1L 5C07B 4NO5B 2AJVH 5TFSH 3SQBA 2GFBA 1FVCA 4NSKA 4F33A 1T2QH 3HHRB 3ZE0F 1S7SB 5HGBA 1IAIL 2D7NA 3CAFA 4ZSOB 3VFSA 2YA2A 4TNVK 3BUYA 3IETB 1AHWB 1S7RA 1A4JB 4Y5YB 3WFHB 3STBA 2GJJA 2P8LB 2WNGA 4U6TA 2V2WA 2ZCKL 3ARWA 4GAJH 1HXMB 4HWUA 3NN8A 1AR2A 5IBLD 4OM1H 4OLZL 3B8YA 3DYPA 4KMTL 5I1DB 1NH6A 1N8ZB 4YWGL 1J05A 1QEWB 2XXCB 3OKLA 3KPSB 4JE4B 4BQCA 5CLTA 3FFDB 5A2IH 1JGDB 3L3KA 2XI9A 1IRAY 2PW1B 4LCYB 3TBVB 4IMLA 3TYGH 3BSZH 1W8OA 1A47A 4LLWA 5JXEC 4AMKH 1FDLL 1H3PH 1D3CA 3BPOC 3EAKA 5EO0A 3KS0J 1Z9SA 4UNUA 4OZFB 5EUOE 5ICYA 1UJ3C 4QKXB 2IJ0C 1AKJD 4BQ6A 3VCLB 2IAMB 3LN9A 1MCWW 1JPSL 3P0YH 2GSIB 3WJJA 4LGRB 3SDAC 1A3RH 4D9QD 4LHQB 4O9HL 4XHJD 4YHIB 3L95A 3AU1A 3IVKA 3MRBB 2OX5A 2F53A 4QOKE 4YX2L 1YEIH 4I5BA 2NR6D 4PJCA 4OF6A 5TE7L 2PN5A 4RIRB 2D0FA 4DTGH 5L8JB 2R56L 4RX4A 5KSVB 4X5WB 3IAQA 1QR4A 3GSVA 1YNLH 3O6KH 2DQCL 4FZ8L 4WWKC 2CLRB 1I1CA 2XKNB 3QEQE 3UC0L 5E5MA 1Y18A 5T1LA 3GIVA 2VZ1A 4EQ3A 3SDDD 2FX7H 3EJZD 3HE7D 1W0VA 3P0GB 4RGOH 3T3ME 4NRYA 5GXBB 1T3FA 3IS1X 2C3XA 3GSRB 1IZJA 4QRRD 3VFWA 3GKZA 4OCYL 3ZKNC 4N90D 3DXAD 4XRCA 5DHVA 5TE4H 1C5CH 3W5NA 3U9PL 5ANME 5BJTA 1JN6A 4O02H 2BNQA 3EYQD 2Z92A 4ODUA 3UTQA 1VDGA 5E08L 5KS9B 5ALCH 1I9JL 1RU9H 4FHBD 2F5BL 4U0RC 4U1NB 3A0OA 4Z7VA 4UT9H 3AAZB 3EO1A 4CNIA 1KIRA 4JHZA 4LU5H 3VWKD 2JELH 5SX4H 1HH6A 1S7TB 4MXQD 3SE8L 3QUKB 4JB9L 4LGPB 2DJUA 3SKMB 3CSBA 5JOEA 2GK2A 3QJHB 1U8OB 2BY1A 1VPOH 2F8VA 5GS0L 4WHTB 4IJ3B 4OFDA 4PV8A 3VH8G 3O8XC 4XP6H 5DD1L 1U2HA 4R0LA 2WV3A 3D39A 4OZHF 2D9CA 3WFBL 1H5BB 2R2BB 2VE6B 5JQHC 1MJJB 5LCVL 1YEJH 1MSPA 3HAEH 3LZFL 2FIKA 4HIXL 2DM7A 5IP4A 3CUPA 9CGTA 1JV5B 2ZSVA 5HJ3B 3ZKMD 2JIXB 4W70A 1MFDL 3T1WA 5SV4A 5KSBB 5B3JF 1WF5A 2ZUVA 4PJEE 2ICWI 3ILQD 1KJ2B 3NGBC 2YBRB 2KPNA 2X1QA 2YPVH 3CXHK 4PRBA 3GB7A 2Y07L 3GM0A 1E27A 1LVEA 4AYFA 1CE1L 1Z9MA 2AK1L 3BJ91 1MRFH 2DD8L 1MCHA 3SE4C 3QHFH 3REVA 1K5NA 1P7KA 3EYVB 4CADB 1JI1A 1EBPA 2NXZC 4N0FA 5FHBH 5ACZA 5F9JB 3RDTB 2Z8SA 3BN9C 3HMWH 4Q58C 5F71A 3HZMB 3NAAL 3AUVA 1HHGA 4HUKB 3D3VB 1F6FB 1ZTXL 4RA0C 5EBMB 2FRGP 2W0LA 2QLVB 4P5TC 1T0MB 3FT2B 5DJYB 2NXYC 3K8KA 1PBYA 3D2UA 4R4NC 5DS8A 4QHMA 1DVFC 3OHXB 2P47B 4KRNA 1KF9B 3MRCB 2A6DA 4UIMB 4F15B 2G60L 3R8QA 2W91A 3A6BH 3T0XA 4HUNB 1P84K 1KIPB 4G6AC 1E6JL 5GJTL 5KTEH 1ZGLB 2KZWA 4I4WA 2X10A 1B0RB 2RB8A 3TGXA 5JDSA 5FYLE 2I60H 4Y4KA 1RIUL 3S34L 1KIQA 3V4UL 1DDHA 2BY2A 3VWJD 3GRWH 3SBWA 5CSGA 1A2YB 4PTUB 3CH1A 1S9WB 1PD6A 3REWA 4YNYB 5FO9B 3TFKC 4M62H 3RZCB 1OSZA 1HZHH 1ZV5A 3DX9A 1OGTB 1YY9C 5EG6C 1I1RA 4HXAH 5EOQH 5JIKA 2VO5A 2FEDC 2F54B 3GKWH 3LCYA 4LDEB 4M7ZC 4ZYKB 3K1KC 3ZE2F 1J1XL 4ZO8A 2GEEA 4XVSL 4YDIL 4P46D 2XN9B 4WVRA 1PG7W 4YZFE 4PLNC 3DRQB 4QOKD 5FCUL 1ORSB 5EO9B 3T08A 2H26A 4NBZB 3S5LA 3AS3A 4P2RA 1P6FA 2VKXA 3U0WL 4NZUL 4KJWC 2R0WH 3HI1B 1TXKA 4KVNH 1NANH 2WAHA 3Q5OA 3P30L 5KSAC 3QEQD 4FFWD 5E2VL 3H9YA 1H3WM 3L7EB 3PV6B 4P59L 3D1MC 2OL3H 1BJ8A 3I9GL 4ENEC 1CFSA 4R7NB 2DKMA 1XF2A 4PRDA 4PREA 5HYQA 1QRNE 4UUJA 5FYKL 1HHHB 1URLA 3UJJL 1T4KA 1MJ7H 4Z8FH 5HVGB 5D7SL 1N6UA 4URTB 2HRLA 3KVQA 2EC8A 4XMPH 1U8PA 4PS4L 1FO0H 4YGVA 2PO6D 1WAAE 5ACLA 1CLYL 1N3NB 2DIJA 4R2GD 5DURB 5D5MB 4G7YL 2GK0B 5GGSB 3RIFF 3RKDC 3SCMB 3EO9L 1A3LH 3LKQB 3VXNB 3SGKA 1TDQA 1J87A 2IGFH 3RUGB 43C9A 4IRJD 1EJOH 2IMNA 4XPGL 4U6XA 1KTLB 4LSTL 1A1MB 4LQ1A 2VDKL 3DIFB 5CGMA 1OSPH 1YMME 3TIDA 1ZHBB 4NN7C 5B8CA 1NLBL 1B0WA 4YQXL 5L7XL 4KI5C 4Z7UA 3STZB 5CBEA 4PJDE 1XCTB 3RTQA 2NY5H 5C0AE 3SKUD 1QLEL 4XCEB 1T80A 4OBSA 2DQTL 3GSNH 4HWEH 2ADIB 4CKVX 4WI9A 2NY1C 3PQYA 1FNHA 4HX1B 2BY3A 3DBXB 4PJXE 3MRLA 3SDCD 1F13A 3BOVA 4K94C 2DOCA 2AEQL 3LPFA 2C5DC 2AJYL 1WK0A 1MREH 2DLTA 3HFML 3BQUC 4H26A 3UPRB 1JYNA 3LB6D 1MVUA 1IAOA 1F58H 3LRSA 4Y1AA 2BY0A 2C9AA 3D5OF 4GUPB 4QXTB 2Y6SD 4Q9QH 2NLJB 2EIZA 2G9HB 1DANU 5IEKA 2DQHH 1FSKC 3U9UA 5IESH 4OD1L 4RWYL 2XQYG 1FIEA 3MR9A 1IL1B 1N4XL 5ADPH 4LFHD 4RMRA 2D7QA 1MQ8A 5BOZG 1NKRA 5INCA 5FYLD 4JVUA 2CMRH 3ARXA 2AW2A 1A9EA 2GITB 3IDJA 1LP9E 1RHFA 5HHMD 4HULB 2V5MA 5HD8C 1ACYH 3FQRB 4ZNCD 5DEGB 2CIIA 3D69A 3I6KB 3BDYL 4PJ5D 3BH9A 4RGMB 3RWGB 2PNDA 3EYOB 1QRKA 5BO1H 2R2HA 1A8JH 3F5WA 4P9HL 3DX7A 2AXJA 2DTML 3FO2B 4R4FL 4KTYA 2AEPL 4OFYD 3B3IB 4K2UL 4UINL 4GSDL 1L0XA 4RDQF 4ZFFA 1CT8B 3MLSH 4KJPD 1RUAH 4YK4C 4JHWH 1D9KC 5J56B 5KSUB 4JKLA 1YDPA 4U6HA 1SEQL 3BD5A 3OF6D 2MPAL 2FH6A 3QAZC 3MUGA 4YDVA 2BDNH 1CICD 4EEEA 1FLRH 4WU5A 1E4KC 2IBGA 3DURA 2R2EB 3SDDB 2GAZA 2V5TA 1E28A 1H0DA 3HE7B 3W39A 4EBQH 3MA7B 2ZPKH 4G9DA 1OCWH 1JWUB 4QRRB 3CFEB 4HKJA 1RVFL 3KWWB 5F9OH 2YD3A 3RNKB 4KKNA 4RFNB 3DXAB 4LEXL 1CE6B 2NX5A 4S2SB 4UB0L 3OPZL 1K3ZA 1T04B 4HUVA 3LRHA 4J1UA 4KK8C 4JFXB 3UTZA 5CFHA 1YN7A 4GQ9H 1D6VL 4X8XA 4KGLA 2IPKA 3VWKB 3H0TA 1EFXA 1GC1L 3IU4L 3WXWH 4F57H 2BHYA 2EZ0C 3MJ9L 4XNUL 3H2WA 2R8SH 5DQ9B 2X41A 5T5FH 1YYMH 2E27H 4OGAD 3U2SA 4QEGA 1NGWB 3PF2A 2YA0A 4HWZA 1RUML 3NVQA 5DJZB 5GGSY 1GHFL 3H3KA 4XP1H 3K80A 4OZHA 1GGBL 4XT1C 2W1NA 4X8JA 4P2YA 2CKBH 2H2PC 5D7KD 4MXVF 1CF8H 3IJSA 3MRFA 4NC0B 2BRRH 1YUHB 4OCMC 3SPVA 3CU1A 5EZJB 1YMMD 3C2AL 4G7VL 2AQ2A 3HZKB 4YDLC 1YMHA 3O6LL 1CGVA 1NCDH 3QULB 1FNAA 4F9LC 4P3CH 5C0AD 1FZJB 1QUNA 3KYOB 3MOQA 2WQRA 4NHCL 5HI3D 3FN0L 2CR3A 3RIFK 5HGHB 2QHLA 4H0IA 3O6FC 3EHBD 4ZS6C 4V1DE 3F7QA 4R3SA 4Y4FA 4JANB 2HJLA 2W9DH 3U7WH 1MWAL 5HYSB 4LRIA 1A7QH 4JKPL 3PWJA 1VSCA 1Z3GL 1NC4A 1UKSA 3GGWA 5D2NC 4NQVA 1PKQE 3CGTA 4L8SB 4PGBA 4PR5B 1A1OA 3P4MB 4L9DA 4H25B 4M7JH 2GKIA 5SX5K 4JJ5B 3T0AA 3BHBB 3ES6A 4X6BA 3O11A 4E41D 2YEZA 4MAUL 3VMOA 5KVDH 4LKCB 2XICA 3SO3C 3IT8D 5JO5B 5F1NA 2VQ1A 3Q1SL 3UZEA 4FQ2H 3ZDZF 4MYWB 1QLFB 3K1DA 2FD6L 4TUOB 1CGYA 5E6ZA 2ITDA 1DBKL 3VWJB 3D25B 1S78C 1VENA 2NYYD 1QHOA 5IBTH 3QPXH 5FB8A 4AEFA 3BP5A 4XVUC 3HMXL 4XGZA 3LEYL 1Q9LA 1R3JA 2V5SA 4ZAKD 2H32A 3GSXA 4LLVA 4M61B 1NUDA 4LSSL 1FYTD 4DKEL 1DP0A 3QYCA 4GKZA 4NGHL 1UXWA 1V7MH 1LEKB 4GW1B 2KBGA 4F7TB 1N5AA 3WUZA 3VFPB 5HVFB 2WUCL 3L1OL 3O0RL 1GZPA 5C0JB 5SWZA 4JQXC 1HNGA 2ZUYA 4CN1A 4O58H 5E4EC 4P46B 5C9KA 2EDQA 4F7CB 1WGOA 5FIEA 4QOKB 4Q97A 4WU7B 4NC1C 4KAQH 5BV7C 3SJVA 1UH4A 1HXYA 3D0LB 1BBDH 3GMLA 1FFPB 1T21B 2I9TA 4K23L 3E6FB 1ND0B 1FZKB 5DK3A 2YD7A 5EN2B 5I1AB 2VDQH 5F3BA 1LDPH 3H3BC 5FKPA 2R1XA 3DHMA 1GZQA 3QEQB 3MC0A 4NKMA 5CBAA 1K4DB 1AHWC 4JCLA 2IBZX 4Y5YC 5I8KH 2BSTA 1IBGH 4JFEA 3FT4A 5JUEH 3VXRD 5T3XD 4MQXD 1SQ2N 2C1PB 3D18B 4J3VA 2PF6A 2P8MA 5I8OL 3LKPA 4M6MH 5HSFA 1S7UA 3T0EE 1GL4B 1UXSB 3MUY1 4HAFA 1GGIH 2XZQL 1V8HA 1HDMB 5LGHL 5TPWL 4MDIB 1MH5B 2PO6B 1HILB 3WFDL 1U95B 4U1KB 3NACL 4R2GB 1CLOL 3MJ8A 3GSWB 3WJLC 1ZT1A 3S35X 3G6AA 1MHHB 4FTVD 5DMKB 4IRJB 4ODTL 4XNZB 5ID1B 2IAMC 5F8QC 2YUWA 4X9FA 1G7IB 1GPOH 4LSDA 2Z9TA 1FNSH 1FC1A 4FP8L 2LU7A 3U0TB 3G6DH 2F53E 2PW2B 4NZRL 4PJCE 4KVCL 4QYOB 1M4KA 1RJYA 4AIZA 2EC9T 4PJEB 2WIIB 3P11L 1KTDB 5F7DA 2I07A 4P49A 5J6GB 2UWEE 5DD3H 5A16B 3DVGA 4AENA 4WUKH 1VFBB 2V2TB 1CFNB 4YAQB 5HI4C 5DVKA 1QR1A 3SDCB 2ERJB 3MCLH 1GOHA 5MEQB 1FH5H 4V1DD 3OG4B 1LK3L 4HUWB 1VADA 2H9GB 2J8UF 2BNRE 2ESVA 35C8L 4HIIB 2B1AH 3UTSA 3PXHA 4MMZC 2BFVH 5D7JD 3V95A 1PFCA 3R4DA 4HS3A 3GEWB 3ULUL 4FG6C 2X4RB 4IEFB 1HNFA 3CZJA 3QNXA 1PYWA 1RZJL 1FORL 1XGYL 4ODVH 2L7JA 2R1YA 3MGOB 4OCWH 2DQDH 1MIEL 5CIPB 4RMSA 4Z7VE 3QUZA 4DGVL 3V5HB 3VFGL 3NCJL 1YECL 1RJLB 3U36B 4PV9B 4XZUB 4XB7A 4I77L 1EZVY 4NQUA 3GZKA 1MFEH 3WLWC 3MA9L 2X4NA 4IJ3C 3BISA 1I8KA 5F93C 1CVSC 3QUMH 2JF1A 1V05A 1H5BC 1MQKH 1RZFH 3PDOB 4AH2B 4K9EL 4PG2C 1KPRB 3SQOH 3BGMA 2Y7QB 2BRQA 3I6LD 3W2DH 5GHWH 1C1EL 4JM4H 3MPCA 4HIHB 2R23A 4L8CB 3MBXH 2YRPA 3QWRD 2EDNA 3M17A 4WO4A 4NWTL 3QI9A 4FFZL 4PYGA 5B4MC 4OIIH 4Y5VB 2OK0L 4L4TD 4MMXC 2NW2B 4K7PY 4OUUB 1T5WA 2ZWLT 1YQVL 1MHCB 2P7TB 1F4XH 3ECBA 1U93A 4IRSD 5FGBC 4U1LA 1LO3H 3D9AH 1CICB 2BSRB 1RZGA 3RDTC 4M3KB 3WSQL 1UC6A 4G3YH 2HWZH 4UNVA 1G7LA 2FL5A 5LXGH 5DC0A 1G6RB 3TESA 3JWOC 4U1SA 3H42H 5EBWB 4X7TA 4XTRC 1F11A 1NCAL 1UWGL 5CSZA 1MCLA 4PB9H 4F8QA 5E6ID 2K9UA 1J5OH 43CAA 5KW9L 5CEZE 5E8PA 1BLNA 1WBXA 4Y16D 4KRLB 4LHJB 1WICA 3CXDL 1QRNB 2UV3A 1FG2B 5KVFH 1S7QA 4ZXBD 2Y1VA 4PRAA 5CD3B 3T0ED 1IQDA 4N9GA 1YEFL 3FRPG 3G6JA 1HHJB 3T2OA 2ZG3A 1FLTX 3LN4A 5FO7A 2OTWA 4L4VA 3PWNA 2A6JA 4POUB 2FWOA 5I30L 1JMXA 1JGEB 3KXFE 3U0PB 1LK2B 3HPJB 4OD2A 1OD9A 3MV11 4MB5A 1R0AL 3RZCC 4GG8A 4KUCD 4GMTL 3X3GL 1IAII 4R6UA 5HYJA 4LSVH 4UQ3B 1QLRA 4IOFC 4KHXL 3LHPL 5LGKA 4LBEA 5IJKC 2VZUA 3RWFA 4NWUH 1YMMB 5DO2D 3OR6B 1IGYA 3FOLA 3U7AA 4A6YA 1NC2A 1KNOA 1WWAX 3OKEA 2X2YA 4GMSL 3HZVB 5ITBL 3LQAL 3AC0A 4PJDB 2FIRT 2DJSA 5C0AB 4DQOL 5D2LE 1NUFA 1WBYB 1YC7A 2WM0A 3IDGB 4NNYB 5HVWA 5T1MB 3K4DA 3CVHH 3KYKL 5JXEA 1KB5H 5C86A 3EDDA 1MI5A 5CHNB 1HH9A 3OKMB 5DWUL 2H6PB 4RX4D 3P4OA 3JV6B 1YEGH 1ZGLP 1UJ3A 5GGUA 1I75A 4PJXB 1JCKA 3MJ6A 1H3GA 1I9IL 1BZ7B 1QFWL 2A6KA 5C0RH 5K93A 2DF3A 1NDGA 4RISL 5CS7A 5DVMA 3SDAA 5IGXH 3MMEB 3ULVH 3QUYD 3MBED 2BNRD 3EYUH 2IPTH 5GZOD 1JRHI 1LO4L 4Y7MA 1XT5A 2VWEC 1XF3A 3WHE0 4OLYH 2XG5A 4GKNB 3R1GH 1ED3B 2CK0H 1HWHB 1RUQH 5EU3A 2KZ1B 3QCUL 2K7PA 3N9GH 3PHOA 5CP7B 2BOBA 4HKXA 1OGAA 5D71H 4E41B 1PEWA 4XCFH 4X7SH 3BPCB 4NFCA 4WWKA 4TVPL 3T2NH 3N1FC 1F02I 3QUXD 4AL8H 4ODWB 3IJHB 4LHUA 5H8DA 4HJ0C 5JMOC 3B8SA 4FQPA 4GRWF 2VYRE 1Y6KR 3DX8A 3ULSA 2VISA 4GKSB 4WI7A 2X4SB 3B5HA 4ZAKB 2DLEA 1FYTB 3GBNH 5I1CH 1N26A 1UB6A 1ZLSL 4HUXA 4OB5H 2NZIA 3DWTA 4XC1H 1RHHB 3QH3A 3ZDXF 4ZFOB 4R7DB 4YHLL 2OSLB 2UYLA 3ZHDA 1L9MA 2HFEB 4LCWA 1FFNA 4JO2H 4O51B 5C0GB 2GTWA 4HUUB 5IJVA 3PQYE 3H7LA 1EO8L 2PYFA 3RU8H 1OP5H 4BQ8A 1KELH 4O2FB 4XMKL 2Z4QB 1X5FA 4FABL 1B2WH 1KPVA 3O8XA 3RVVD 3DV4A 5D8JL 3PIQA 3HI5H 3RAJL 3CFDB 5KOMC 1TVBB 2BCKA 1F3JA 1QBML 4KRPD 3RNQA 4TSAL 1X7QB 4ZO9A 3QNYB 3RY5A 3DMMD 1T20A 2QQKH 1AE6L 2WP3T 5DRXB 1EXUA 5BZDB 3VXRB 3HRZA 2EKSA 3BW9B 4TULH 5SV3A 3BXNA 4LCCB 4WDIB 4IRZL 3CFCH 2R29H 1EJ6A 2XKSA 1YJDC 5IBLC 5AWNL 2OXHA 3D2UD 1OPGH 5DMGD 4JQIL 3MCKA 5CZXD 4M8QA 3FCTA 4KQ4L 3SE4A 3GK8L 4WFEE 4XXDB 2V7NB 4MS8D 1ONQA 3FONB 1KJMB 3EZJB 1G7PA 1JE6A 1NAMA 3KPMA 2OJEB 4IOIB 4U4BA 4M1DL 3VW3H 4WENB 1TIUA 1I1YB 4Z7NE 4ZDHA 5C3TA 4LRNH 1FVDA 2ADFH 2CPCA 1Q0YH 4FTVB 4P5TA 4XPFL 3WD5L 4YHPA 1FL3A 5EA0L 3S3JA 2VIRA 3IDNA 3KXFD 1EV2E 2J6EA 5HI5D 1DVFA 2HFFB 1Q1JL 5FUCC 4LASH 4XHJC 4XCCH 1J0IA 5C2UB 4PRPA 3W9EA 1MCJA 4XWOD 2OZ4A 3T0WA 1YC8A 3OKKA 1I8MA 1DQLH 2D7TL 5T33L 4OV5A 1WTGT 1IGTB 2QSVA 3BEVA 1CFVH 2NR6C 1T1YA 2FO4A 4JFQA 4OZ4A 1ZHKA 5JPNA 3P77B 3IFLH 5F7HA 3WFCH 4NT6A 2QADD 2ICWJ 1S7WB 1W72A 5FK9A 4D9LL 3L5WB 4I18B 1I7UA 1RK1A 1K8DB 1U3JA 4ETQA 1AXSB 4S1RL 4C59B 2N1KA 1RAMA 2EXYD 3MXVL 4OCXL 4V1DB 3SDDC 1R3LA 3EJZC 1DQMH 2D0HA 4HEPG 1D5MA 2EEBA 2M1KA 4PG9B 5EZIH 2J8UA 1TJHL 5D7JB 1MRDL 4NIKB 4X9HA 2XZAL 4RFNC 3N85L 1PKQB 3Q48A 4KI1A 1I7TB 2OBGA 3EYQC 5E1AA 3S37L 2YK1L 3O2WH 4R90H 3GSQB 3FQWA 5D72L 1IM9A 1ZVSB 1R5IB 4ELKA 4GRMA 3UROR 2EYRA 3ISWA 2DIBA 3VE0B 3VWKC 3SO5A 4MXQC 4L1DA 1U92B 1WV7T 4OT1H 4OKDA 4GLRI 3LPGA 2NW3A 5KSAA 1U2CA 5GS0C 4E5XA 5F7EH 3MXWH 5C0EA 1IM3A 1B4RA 1F45A 2HMID 3ARQA 3CLFL 1BQUA 3FJTA 4FZEL 1BFSA 3QG7L 4BZ2L 1H3UA 2YN3A 3ZKMC 1PZUB 3TIEB 2X4PB 4KWUA 5L2KA 3RGHA 4NQTA 1U58A 4WNQB 2I5YH 1MHPL 3ILQC 4YHZH 1G1CA 2R1WB 1SJEA 1U6AH 2R69L 3KR3L 3WNKA 3ZMRA 4L4TB 5JLZA 1UH3A 1MNUH 2M26A 1Z6JT 1FBIL 1Z5LA 3L3OB 4YHNA 5ISZE 4IRSB 5IF0B 4YHOH 4KY1L 5J12C 3PQYD 2Z35A 4CVXB 4PP2A 3ZTNL 3Q6FB 4JRXA 1AQKL 3OX8A 3B6SB 1HINL 3HNTL 2G2RA 4NQCA 1R6VA 5HGAA 1RZ8B 2ATPB 4HPOL 3C09B 5JORB 4L8SC 5LWYL 3FQUB 2J7LA 2VLMD 4Y5XB 1A5FH 3EYSL 3EOAA 4TUJA 3ALXA 4UV4L 5E6IB 5ADOL 4LPTA 1M6OB 4QHLB 1TQCB 3X3FL 2YKLH 2YN5A 5I16A 4Y16B 4X6EB 4ZUSA 4PLJD 4H8WC 4H1LH 3FO9A 2XWJB 2A9MH 4ZXBB 1MCPH 25C8H 3T0EB 2WBKA 1QA9A 1J05B 3OKLB 1EMTL 4F7MB 3L3KB 4WFED 3LS5L 4JLRB 4IMLB 1UWXK 3VWJC 1U8KA 2VTFA 3BQUA 4X99B 1WSST 4LLWB 2Y72A 3V8CA 4DUWA 1AGBA 2NY3D 1P4BH 1TETL 4QHNB 2ENYA 4EUPG 2ED7A 4Q6YA 4QRSA 4NYLB 3X13B 3HR5B 2MTPA 5EC2A 5KS9F 4HF5H 4OUOA 1KLGB 5T1KD 5FO8B 4XAKE 2ED9A 3L95B 3MUHL 4JN1L 4P46C 3AU1B 3V8OA 3IVKB 1TCMA 3MRNB 1L0YA 4OM1L 2F53B 2O26U 4KPHH 5F1SA 4Y4HA 4I5BB 2AJSL 3HZYA 3E8UH 1UM5H 1KG0B 2UWEB 4C56A 2ARWA 1H15A 2OLDA 4BH7A 2FDBP 4FFWC 4QY8A 2EE3A 3KYNA 3WCYA 2CRMA 3MLYL 4M00A 3QDJE 5KSBF 3QUYB 1MCOL 3MBEB 1OTSD 1JTPA 5ACMA 4LF3B 2BNRB 1T3FB 1P4IL 5L9DH 1SMAA 4IMKC 3QEUA 3LKOA 4U6VH 4IHOA 2C4XA 1G9NH 3RIAF 4OCSH 3RHWF 4ZMAT 2GT9A 2QSCH 4PPTA 1D9KA 3RRQA 3BEWA 5BCAA 1QG3A 4ZUUA 5BJTB 5J1SC 3UTQB 3K46A 5EOCH 3RI5F 4HS6B 1E0OB 4D8PA 1NAKH 3QUXB 1PKOA 1E4KA 2PO6C 4UQ2B 1PVHA 3EO1B 2AJUH 1KIRB 3QIBD 3CK0H 4CNIB 2FECL 4R2GC 4HXBL 1F4HA 2WBJD 3AFLA 3ARZA 5IVZB 2QSTA 2DN7A 1QO3B 2HRPH 3V0VA 1V3KA 3H6JA 4IRJC 1B0GA 4XNZC 3O41B 1I8IA 5AYUL 5T3ZE 1G9MC 2AJXH 2MNUA 2R0KH 3ARFD 4R0LB 4JG0H 1TQBB 2VXUH 2B39A 1VCAA 1NCBL 4G8EB 4M6OL 4YDJA 4UTAL 1UADC 5LQBL 5JIHA 3CUPB 2VSCA 3TZVD 4NO2A 4J7RA 4DFHA 4W6YB 1QKZH 1XF1A 1W0WA 2J1KA 4FQJL 4POYA 2YD5A 4LLQB 3DROA 5TDNB 3QXUA 1GAFH 1TLKA 2IF7A 2ICEA 3MRPA 5ALCL 4OSUL 3GB7B 3QZWA 1JYVA 4UT9L 1JGLH 4LQFL 3SDCC 5J3HD 3T0BA 1K5NB 2JELL 3O3DA 5ISZD 4Y4FD 4FQCL 4JO3H 3DUHA 1KCLA 4M6NH 5ACZB 4KRPB 2ESVE 5GGTH 1FAIL 1CZ8H 2B1HL 1CGUA 3DMMB 5IOPA 3LB6C 5BS0A 3VRIA 4YHYB 4ZFZA 4GAFB 2ZOKA 1IC5L 4GW5B 3MNWB 3PHQA 4JM2D 2IBZY 3OXRA 2YS4A 2XFXA 4XP5H 4U6YB 2Y6SC 3D2UB 3KPNB 4QHMB 4F9LA 1T1XB 5MHSD 4JRYD 4Z95H 1G7MA 1MLCA 4R97B 1TENA 2DWEA 4DZ8A 3O6FA 5L88L 3FAWA 3V6BR 5JPMB 1U8QA 4Y4KB 1IC1A 5HTSA 5FECA 3OR7B 5IB5A 4CVUA 1SJHB 1MF2H 5LJYH 2CR6A 1D7FA 4G80B 3KXFB 3RJQB 5I8EA 4Q0XH 4UILL 1AO7E 1RJZB 4WEBL 4JREB 1DE4A 2CDEA 2IWGA 1T0PB 2W60A 3ABZA 3INUL 1A6UH 2OJZH 1EUTA 4EOWH 5DD0L 4PJ8C 2B4CH 4KJPC 3HC0B 4Y5VC 5IIEB 3A6BL 4HK0A 1HQ4A 5BOPA 3ILPB 5D5MF 2QADB 2X40A 1E6OH 5EO1A 3T04D 4QO1A 3NFNA 2BVOA 5D2LB 5TJWK 5AD0A 3RUGF 1UEYA 3GMPA 5IV2B 1CICC 4QF1B 3TPUB 3I2CH 1IAIH 3TYFB 4WI5A 4A2MA 1IGFL 1U91B 3S36X 2ZSWA 3BESR 3RWHA 3RPIA 5C0IA 3PWUA 1ZLUK 3O2DA 5CAYB 3S36H 1OT2A 2ZCKH 1AGFA 4ALAH 1UB5A 2EO9A 4JY5L 5ESAB 3SY0A 2VKWA 1NLDL 3G5YB 4YLQT 1OW0C 4OLZH 3QDJD 4JQXA 3BPLB 1HZHL 4FQHA 3LEXB 4YWGH 1HI6A 3WO4B 4HXAL 1Z0NA 4MNHB 4GKOA 4HEME 3GKWL 4M4RA 5DSCA 4BSVA 3IDXL 5HYQB 5TF0A 3LIZL 2J5LB 2PR4L 1FDLH 3BUTA 5HHOA 2A0LD 4OD3L 3VI4E 1TJGL 3G6JE 5C07A 4NO5A 1CD1B 1NFIA 1JUFB 5E8OB 2EIBA 1S7SA 1UZ6E 1I7RB 4S0TD 4ZSOA 4K3JL 1T7WA 3IRPX 3IETA 1AHWA 4MJ6B 4P2QA 1A4JA 1JRHH 4Y5YA 4OGAC 3TCXA 1JPSH 3WFHA 1U8IA 4FOMA 3SEPA 2IBBA 1P7HL 3VXPA 2P8LA 3AMLA 4O9HH 3BYTA 2FJFB 3WIIL 1M1SA 3RIAK 5I75B 1HXMA 5T3ZD 1R5VA 3RHWK 4U6XB 1OTUD 2EXWD 5I1DA 5E9DA 5EIQA 4YX2H 1N8ZA 2Z91B 5FDYA 3SGJC 2XOTA 1X4XA 4RBPK 3KPSA 2X05A 5HDQL 4KKLD 2HT4D 3FFDA 3RI5K 1JGDA 4NQSB 3H9SE 2R56H 4KK5D 3TBVA 2O61A 3PP3H 2Y9RT 3VI3F 1CWVA 1VFOA 3E1F1 4FZ8H 1EHLL 1A64A 5JMRA 3T4AB 4ELME 1MI5E 1AFVL 1JFQL 5E56A 1NBVH 2RQ8A 3EHBC 3WJLA 1J0YA 4OZFA 1L4IA 3PQYB 3OAZK 4FNLL 3KLSA 1D5BA 2W0FB 1DQQB 3KYMB 2IH3B 5F8RC 2X4TB 3V5DA 3VCLA 3IRZA 2GSIA 3ZDYE 4OCYH 5FOJA 4C54A 1A3LL 3U9PH 1PGRB 4YHIA 2ESVD 2J4WL 3LQZA 5F89A 4KQ3L 5E99H 3MACL 2OCFD 2AXHA 3MRBA 2YZ1A 5E08H 1IAOB 4YXLL 4N5UA 4RAHA 5CJ5A 1I9JH 3F7RA 5F9AC 2F5BH 2GSGB 4LIQH 2VL5B 1PZ5A 5F6HJ 3VXME 4RIRA 1OGAE 1UWEL 5KSVA 3SE8H 2EIZB 2ENSA 4Z7OF 2CLRA 5LBSL 1DUYB 2XKNA 3V7MA 1DQDL 4CMMB 3ZDZE 5IFHL 5DD1H 5DR5H 3GMQB 2NYYC 1CXIA 3WFBH 3MLTA 5LCVH 2YXFA 3LZFH 3WNPA 4HIXH 3IDJB 4EI5D 2NY3B 2OR9L 4ZAKC 1MFDH 5HGDB 1MREL 2CIIB 3D69B 1AO7D 1J1OH 2R2HB 2XYCA 2P5WD 5T1KB 3J8F7 1CD0A 1F58L 4K71B 2Y07H 4U1NA 4ODHL 3HTLX 1UQSB 5IVXE 1CDJA 2AK1H 4X4XB 3AAZA 4JPVL 3SDXE 4LCWE 1MCSA 3B4NA 3QUKA 1A02N 4ZFFB 3IAPA 3SKMA 4ZUWA 3QJHA 1IGCL 5KJRL 3L3GA 3EFFB 1I85A 1YDPB 4WHTA 3NAAH 4MB3A 3Q5YA 4FXKB 2OS7A 3LSOA 4P48A 5B21A 4N8CL 3MSPA 1H5BA 2R2BA 2VE6A 2YRZA 1MJJA 5I1GL 3BP7A 1KN2L 2CMRL 4PG2A 1GOFA 5A40E 1FYHB 3HB3D 4L3CB 2GAZB 5HJ3A 5EOCJ 4B5EA 3DPBA 2IC2A 4MQXC 1UFUA 5KSBA 4JZNA 4G9DB 2G60H 2E7HA 4LCCC 3VXSE 3ZSTA 2Z93B 2E8YA 4RZCA 1KJ2A 2YBRA 4EIZC 3CNKA 5BO1L 1E6JH 1S3KL 5IHZB 5IT2L 2AEIT 1RIUH 3S34H 3C8DA 4ONHB 4TTGA 4DN4L 4R9HA 1VACA 1DQTA 2BVQB 4CADA 3EYVA 3V4UH 2Q8AL 5FGBA 3UTZB 4XNYL 4FA8A 3V79C 3RDTA 4JHWL 3BO8A 2IPKB 3QIBB 3IFPB 1WBZB 3HZMA 2WBJB 3H0TB 3QFJA 3RL1A 3D3VA 5EBMA 2N56A 5FDWA 5H35B 1B4JL 4M6AA 1T0MA 1FVEB 3FT2A 5DJYA 3U2SB 3EKCA 3ARFB 4MNQD 4HWZB 1IKNC 2DL2A 1J1XH 1RV6X 3BP6B 4UIMA 2FGWL 4XVSH 5IBUG 4PRPE 4X8JB 2P48B 3TZVB 1KIPA 2NY7L 2RHEA 4DKAA 1UEMA 1WJ3A 1B0RA 4GLRH 3T2QA 3U0WH 4NZUH 3H9SD 1M7XA 2JTDA 5IK3B 3MX0A 5I74B 1JZ2A 4I18C 1A2YA 5IW6B 1JZ5A 3SOBL 5GGVL 1BAFH 5E2VH 3FFCE 2EDYA 5FO9A 3LKSB 4WUUA 5ISZB 5JZ7D 5JNYA 4P59H 2X89D 3RZCA 4R3SB 4Y4FB 4F57L 3K2UL 5M7QA 1LO0L 2HJLB 3I9GH 1OGTA 3MLUL 1V3JA 4NZJA 3H9HB 3QP3A 4FQXD 1YYML 4OGXL 1OQXA 1SVCP 2J8UE 2YZ8A 2F54A 5D7JC 3VFMB 1EBAA 2KDGA 4OAWB 5FYKH 4ZYKA 5IJKA 3HAEB 4W81A 4NQVB 1JGUL 3UJJH 4JM2B 1OM3H 5GRJL 2VAJA 5D7SH 2CKBL 3CFKB 3DRQA 3KPPB 4J23A 4X6FB 1ORSA 5FHAL 4JRYB 1DBBL 5EO9A 5AG8A 4PS4H 3VXMD 8CGTA 1NGYB 4NN5C 4RMTA 3ZO0A 3ES6B 4G7YH 4L1HA 3O11B 2JJUA 3VG9B 4TSCL 1C5DB 3EO9H 1G7HB 5LG1A 2XNAB 3T3MF 4XPGH 3L7EA 3PV6A 3TJHD 5B39A 1KPUB 4Z9KB 2ITDB 4LSTH 2M8XA 4WW2B 2VDKH 3VFRB 4YC2B 3BP5B 1NLBH 4XGZB 1MFAL 4YQXH 1R3JB 2WINB 5L7XH 3E0GA 5F97E 1S8DB 4YDKL 5L0QC 4JCMA 3Q6GL 1HHHA 1QLEH 2HFGL 2YMXL 4PB0L 4D0CB 4UBDD 2DQTH 1CFBA 4X4ME 5F72S 1KFAL 1RZKL 4J8RA 5E8EB 1XR9A 4D3CH 4IOSD 5I9QB 3QB7C 4HD9A 1DN0B 1KGCE 5D5MA 2GK0A 5GGSA 3ZKXC 4IRSC 1U9KA 3O2VL 4LDLB 2AEQH 2GY5A 2AJYH 3GMLB 1LE9B 3HFMH 3QQNA 3CH8A 1QSFA 1XAUA 2C3GA 4NJAL 1KTLA 3DUSA 5FKPB 3DIFA 1K3IA 3U48A 1GZQB 3C09C 5CBAB 1FJ1B 3D48R 4POZD 4C55A 1KCVL 3VMPA 4Y5XC 4PJ9A 4QCIA 2ARJQ 3QDJB 3U7YH 4KI5E 5E6IC 3STZA 2BSTB 1XCTA 3FT4B 4N0YH 5MI0B 1AGEA 1TQCC 4OD1H 4RWYH 3EJJX 2Y5EA 3VXSD 3QNZA 4XCEA 4Y16C 1V7ML 4JN2B 1N4XH 2ADIA 4ZXBC 1HE7A 1S7UB 4G6FD 3STLB 3T0EC 4KZDL 4HX1A 4JDTL 3DBXA 4HC1A 1OLZA 3GJFH 3FQNA 5EU5A 3SKJL 3X14B 1A3QA 3IXTB 3BDYH 1FL5B 4UT7L 4HQQL 3DI3B 2CSPA 4P9HH 4JFOB 2DTMH 3G6AB 4R4FH 3TEUA 5IR1B 4GUPA 4QXTA 2OL3B 2NLJA 4UINH 4J2XA 4GSDH 3MZGB 3BIAX 1IJ9A 1IL1A 4PLOB 5CMAB 2AGJL 5LGJB 5JW4R 1SEQH 2MPAH 2PTTB 3H3PL 3WFZA 2AV1B 2UVFA 2WWKT 4ONFL 1FPTL 3UAJD 4AIZB 1BIHA 3UYPA 3TNNA 5MP6L 3BX7C 3WEXB 1MELA 1ITBB 1FO0B 4C56E 3BMWA 1TVDA 3H9ZA 5ICXB 4OQ1A 1U0QA 3DNKA 5DEGA 4GOSA 8FABA 3FFCD 1AKJA 2YWZA 1RVFH 3EYOA 5CP3H 4P3WA 3B9AA 4LEXH 4YEFA 3QUYC 3MBEC 5CCKL 2ESVB 4UB0H 2EDJA 3OPZH 2A2QT 1KIUA 2FHFA 4ZUTB 3B3IA 4NPYB 3S35L 3DGCR 4NM4L 1CT8A 1D6VH 4YZFF 4YE4L 4CDGC 3QNXB 1CL7L 5KSUA 1GC1H 3IU4H 1ADQA 3GSNB 3MJ9H 3V5KB 3QUXC 4R96A 2FB4H 2R2EA 3SDDA 4YJZL 2VITB 1RUMH 1XF5B 1J86A 3MA7A 4WUKL 4GAYB 1GHFH 3RQ3A 5KSAD 1GGBH 1K2DB 4EI5B 5C09E 3X11B 1FCGA 3ULVE 3RNKA 1HHKA 2ORBL 4AT6B 3DXAA 5DUPL 4OCRH 1MFNA 1CE6A 4DGYL 1TQBC 4W4OC 4WI3A 4LP4A 4S2SA 2AV7B 3C2AH 4G7VH 1T04A 3O6LH 1AO7B 1XGRB 4JFXA 3R06B 2P5WB 4DCQA 2NNAB 3GBLA 5ITFB 1RFDL 1QSZA 1F6AA 3L3HB 4NHCH 3FN0H 4GS7C 4HWBA 1INQB 3VWKA 1JHTB 1WAAF 4OCWL 2DQDL 4TYUA 5DQ9A 1MWAH 1T5WB 5HY9A 3QRFM 4X0KB 2GIYA 1KGCD 1IZKA 1U93B 1NGWA 1OAYL 1Z3GH 4LNRB 3RVVC 5E2JA 2WLZA 4LNVA 4BELD 4KTDL 4X6CB 4AQOA 5GGRA 4KRPC 4X4ZA 3NCYP 3T77B 3DMMC 4EN3D 3NIDE 5BS0E 1YUHA 3QUML 1AJ7L 5GPRA 4PUBL 5EZJA 5K9OA 4U1SB 3HZKA 4P4RB 3TO4D 5KVGL 4PJDF 4X7TB 1SY6A 3SQOL 1F11B 4AG4L 3QULA 1CDCA 3DYOA 1K85A 4KI5D 3JWNC 4MAUH 5AYQA 3U1SH 1NCCL 3NTCH 5DMGC 3W2DL 43CAB 1FZJA 1YEKL 3W5MA 3Q1SH 1BLNB 4R97C 1WBXB 5CZXC 2O5ZL 4XHQA 5HGHA 1X6NA 2FD6H 5FFLA 5HBBA 1CU4L 2V9RA 2FCBA 2MHAB 1Z9LA 1DBKH 4MS8C 4PJXF 4DUVA 5HYSA 3HMXH 3G6JB 1NCNA 3CVIL 1FNFA 3MRMB 1CXLA 3PWNB 1S9VB 3D9AL 4DKEH 2QHRH 3BH8B 4NGHH 4PR5A 2HKFL 2HWZL 3P4MA 2CO7B 5HI5C 2WUCH 3L1OH 3O0RH 4MNQB 4H25A 4YXHL 4JREC 5I19H 4G6MH 3U4BL 1C5BL 4XWOC 1JHKL 4ODSL 3BHBA 4R4BA 2Q86A 1KEGL 2CH8A 3LVEA 4LKCA 4O4YL 5JO5A 1OB1B 1FFOB 2DRUA 4WEMB 1IGYB 3JZ7A 3H9SB 1QLFA 3OKEB 2QADC 4TUOA 2AXGB 1KXTB 3T2PA 3VWJA 1MIML 3D25A 4Y4HD 3W0WD 3GI9L 4ELMB 5DUML 3PWLB 5HD8D 4HG4J 2EXYC 1B88A 4M61A 4ZTOL 1AIFB 4PLKD 3X17A 2LU3A 2DS4A 1BFTA 1UJ3B 4FQXB 1NEZB 4AQ1B 1LEKA 2A6KB 4AY0A 3P9MB 4F7TA 1MUJA 5I8OH 1B6DA 3VFPA 4L3ED 5C0JA 4P5MB 5FYJU 4PJIF 5BMFL 1KENL 3S5LG 4P46A 3WO4C 2MWCA 4WHCA 1JK8A 3BZFB 4F7CA 1XF3B 2RBLA 4QOKA 4KJQD 4UAOB 5IVNA 5LGHH 5TPWH 2J5LC 2F5AL 3VXMB 3VXTB 5TH2B 1T21A 1S9XB 3WIHA 2GUOB 3E6FA 1ND0A 1FZKA 1OGAB 5D70L 1Y6MR 5HHOE 3C5SA 3NACH 3WFDH 5EN2A 2BSSA 2EDKA 1CLOH 5IMLB 4NCC1 1GGYA 3QEQA 2Y06L 5CJQL 4LPCA 4ODTH 2LABA 3DARA 4P2QE 2HMIC 3DX8B 1H3TA 5KVEL 4B0MM 5DJ6A 3E3QE 4IMKA 2C1PA 4KMQA 3D18A 4BJLA 1CN4A 2AABL 4FP8H 4HGWB 5I75C 5C09D 3ULVD 1J0JA 1MCQA 1QZ1A 5CWSB 4NZRH 3D0VB 5E9DE 5BVJB 1KTRL 4JZOB 4KVCH 3BKCL 1UB6B 2FYYB 3P11H 4KK8D 5I1IL 3R1GL 1BF2A 3TH2T 4MDIA 1MH5A 1IAKB 1M7IB 5IVXB 3NABL 4K8RL 3SDXB 5AAMA 1U95A 4U1KA 5D71L 4KDTC 1AI1L 1LK3H 3GSWA 3O4LE 4OQTH 4XCFL 1MHHA 5DMKA 4IRJA 3RJDA 5ID1A 1CG9B 4UTBL 1KPVB 2DI8A 2FLBT 1G7IA 3DV4B 1H8OA 3DOSA 3TBSB 3ULUH 2BCKB 3GIZL 3VGAB 5F7KC 1RZJH 1RURL 2F58L 5JOPD 1XGYH 2Z31C 2QR0A 2PW2A 1EXUB 1NBZB 3VXSB 1PY4A 1KTDA 5HHXH 4PLJC 4OIBA 4DGVH 5J6GA 4F3FB 3NCJH 1YECH 2XTLA 5BXFB 4G6FB 1VFBA 2V2TA 1CFNA 1A7RL 2DQEL 3BGAA 4YAQA 4D0DA 2EDOA 4I77H 3SDCA 3FCTB 1OAUL 4Z6AT 3MA9H 5MEQA 4U1MA 4HUWA 1MCFA 2H9GA 1QOKA 4HIIA 3LKNA 3AVEA 3RU8L 4K9EH 1EGJA 3LKRB 1X5LA 3BFOA 2VNCA 3PXJA 2NY3C 1MPAH 4RA3A 1C1EH 2X4RA 1ERNA 1CDUA 2FH8A 5EZLB 2ZCHL 1CDIA 1HYSC 4NWTH 4JDZB 4FFZH 4YIQB 3MGOA 3K0WA 2OK0H 2C7UB 3UYRL 3UBXB 5CIPA 5K9QG 4C4KO 3B9VA 5IMMB 1YQVH 2A9NL 3V5HA 1FN4A 1QYGL 1B3JA 1S9KC 3EW3B 1PSKH 1RJLA 3QRGH 2VXVL 4G5ZL 2FO4B 4JFQB 1IKFL 1CYGA 4OZ4B 4N0CD 1MHEA 3BWUC 1DEDA 3WSQH 1W72B 3QDGA 2K7QA 5FK9B 1S78D 3N1PC 3SHSA 1ZANL 3C5ZD 3FFCB 4AH2A 4PJ5A 3VW3L 1UWGH 1XF4A 3S4SB 1EERB 1QTYT 1OTSC 4NDMB 1D5MB 3P4LA 4U1JB 5KSBE 2FATH 2XWBB 4HIHA 4OFYA 4L8CA 1RIVL 3CXDH 1CVRA 1JI2A 1RK0A 4MSWB 2X9XA 3GHEL 4PJ8A 4U3CA 4Y5VA 1MCBA 2H1PH 5DT1L 2NW2A 1YEFH 5ICZA 4KUZL 1MHCA 2P7TA 3OF6A 3N50A 1IM9B 1VB9A 4Z7QE 1CICA 5I30H 3MJGX 2BVPB 3KPRA 1BEYL 1BM3L 3C87A 3QIBC 1VA9A 1CDHA 2WBJC 3MYJB 1R0AH 4KV5E 3QFJE 3SGDI 3D3VE 4GMTH 3X3GH 5KSAB 1G6RA 4M02A 2GY7B 5EBWA 2QL1A 4P2QD 4UV7H 5CGTA 1OW0A 5D7IE 2HH0H 1DQML 2H3NB 3ARFC 4KHXH 3LHPH 3EGSB 2PTVA 1Q72L 2AEWA 5A3IC 4M5ZL 1FG2A 4GMSH 4K3DL 4LKXA 3TZVC 3LQAH 4FFYL 5E9DD 4Z5RA 5CD3A 4U33A 1NJ9A 5IKCB 4FXGB 4LCIH 5T1DH 4HKBB 1IILE 1A7OH 5DWUH 1AD0B 1SJEB 5FYJE 3WDHA 2VQUA 5B38B 3L3DB 3CDFA 5D1XD 3SE9H 1WAAA 3JWDL 1QFWH 1JGEA 5J3HC 3U0PA 1LK2A 3HPJA 4RISH 4KUCF 4WUUE 5M94B 1MCRA 3O4LD 4E9LA 4QLRA 1P7QD 2FHCA 1I7ZB 4U1GB 4UDUB 4X9GA 2CRYA 3V4PL 1Z2KA 2Z35B 4QWWD 1EX0A 2YUXA 1LO4H 4EN3B 1KB9K 5IWLA 1IAIM 4XX1G 5HGAB 3SGJA 2Q76B 3PNWB 3QCUH 1YMMA 5DK0B 4JM2C 5GSVB 4NN7B 3TO4B 1L7TL 3P4NB 1O0VA 4RMWA 1JZ6A 3VA2C 4Z76B 3HZVA 3DV6A 4TUJB 5F9DC 4PJDA 3LN5B 5C0AA 3CSYB 1BVKA 5F7YC 1Q94B 4OLEA 1WBYA 4TVPH 4ZTPL 3IDGA 4NNYA 5T1MA 4QRPE 2I5YL 2UWEF 4BK4A 2Z8VC 4HT1L 5CHNA 2DB8A 3DGGB 1YN6B 4CUCA 3TA3D 3JV6A 3VG9C 1PW3A 1U3HD 3N1GC 4PJXA 4WI2A 1BZ7A 1MNUL 6CGTA 1T89C 3MMEA 1NMCB 4WW2C 5CJ8A 4YC2C 2P43B 3BQUB 5EU6D 1ZLSH 1Q9KB 1F42A 4GKNA 1ED3A 4ZD3L 5E2TL 2E7CA 4YHLH 2XPGB 4GQPH 1Y0LB 3ALWA 5EC2B 2OQJA 3UJIL 4LSPL 2A73B 3MO1B 4E41A 3EFDL 4ODXB 1FSKB 1XH3B 3BPCA 2DBLL 3NIFF 1NUNB 5GZNC 1VFMA 2XT1B 4ODWA 1EO8H 3IJHA 1XFPA 4XMKH 4FABH 2EDTA 5D5ME 1RD6A 25C8L 2OMNA 2CD0A 5D8JH 4Y4HB 3HPLA 3RAJH 3VFTA 1OAKL 3HZYB 4GKSA 1QBMH 3U4AA 2EH8L 3BIKB 1JF1A 4TSAH 4JVWA 1QSFE 4C56B 3KLHD 1AE6H 15C8L 4ZAKA 5DD5L 5FUOL 4D0BB 1FYTA 2EO1A 3OV6A 3QIWD 3IDMA 1YEHH 3JUYA 3VDAA 1D5XB 5AWNH 4L3EB 5K9JH 5DVLA 1PAMA 1RHHA 3B9KD 4ZFOA 5MI0C 5GRVK 1QQDA 2OSLA 3NZ8B 4PJIA 2VZTA 4KQ4H 4P3DA 3GK8H 4OFPA 1HEZB 4O51A 2OTUA 4FQ1L 4MCYB 2VZSA 3I6GB 4HUUA 2ITCB 4LOUD 4RGND 5SWSE 4M1DH 4O2FA 2A0LC 2Z4QA 4NFBA 1RQ5A 3CVHB 3ALPA 1KB5B 3CFDA 1TVBA 1OAQL 1QD0A 4XPFH 1IE5A 3WD5H 4M7KH 1INEL 1X7QA 1R24B 5EA0H 3QNYA 3MRJB 2UUDK 5DRXA 4X4YB 4GAGL 3AM8C 3QFJD 3VXRA 3WBDA 4PTTB 3BW9A 1Q1JH 4L3AA 4WDIA 1GIGL 1P4LA 2MJWA 4KKCD 4XTRD 3VGHA 5C09B 2X70B 1UCTA 4NQDD 1OTUC 2ICCA 2D7TH 3FO1B 5T33H 2DLHA 2EXWC 4IS6A 1DLHB 2KQMA 4QT5B 3MTRA 4KKLC 1JZ3A 2HT4C 5C08A 1PDKA 4JKMA 4XXDA 1T6WA 3LAFA 5HDOA 2V7NA 1EAJA 4KK5C 3FRUB 4D9LH 1W0WB 1KJMA 3FONA 5BQ7B 3VI3E 2J2ZA 2OJEA 4LMQE 1QFOA 3U4EB 3MXVH 1I1YA 4OCXH 5EOCL 3MRPB 5GS3A 3F12B 4MAYC 4FTVA 2G5BB 4RAUB 1PJ9A 1TJHH 3QXWA 4EKXA 1J0ZA 1MRDH 3CK0L 4HJJL 2XZAH 3O3DB 4WUUD 4JRWA 1IKNA 3TT1L 3RVUD 5IB4B 5M95B 2NTSP 3MRRA 3O3EB 1FRGL 3P73B 5IOPB 2A77L 3BE1L 2ATKA 2OXGA 4U7SA 3TV3L 5D72H 1F4WL 3DETD 1C12B 4F80A 3P77A 3PHQB 1BWMA 3OXRB 1JPTH 4ZOAA 1BIIB 4MQTB 2OP4L 5D2LF 2NY5C 3UCRA 1S7WA 1EEZB 3NOIA 1QKZL 3L5WA 2MSPA 4I18A 4XNQB 3GJEA 1K8DA 3KHOA 4QRPD 4YBLB 3V6ZA 4DZ8B 3G04B 1EDQA 3G5VA 1AXSA 4LCUB 1X5IA 3O6FB 4RCAA 1RZ7L 2QV2A 4V1DA 1WFTA 2VLKD 3CLFH 5JW3L 1XGPB 4FZEH 5EOTB 4F37F 2FSEB 1LEIB 3QG7H 3OAYK 4PG9A 4BZ2H 3LEVL 5D7JA 2GJ6D 4EI5C 4DZBB 4OZIF 5T5NF 3DXAE 1I7TA 5C0FA 1MHPH 5I8EB 1PG7X 4UZGA 3GSQA 2R69H 3KR3H 3OXSA 1ZVSA 3B2UD 4CJ1A 1JWMB 2W60B 3VE0A 1FBIH 3BN3B 2H41A 2EE2A 4IIQC 2BSED 1CD8A 1U92A 4PRNB 4KTEH 2VDRH 1MOEA 4KY1H 1KYOJ 3ZTNH 3F6IA 4HK0B 2BJML 1AQKH 1MJ8L 3RGVD 4ACPA 1HINH 3HNTH 2P45B 4XH2B 4RAVB 3TNMB 4JDVB 5C6PB 1UVQB 3GMPB 3IU3A 3C5ZB 3NFPB 5LWYH 3BKML 3EYSH 4UV4H 5ADOH 2J88L 3HB3C 3TIEA 2X4PA 5C0IB 3X3FH 1OF2B 4JQVC 4WNQA 4GXVL 4RDQG 4I48A 1LD9B 1ETZB 3QWRA 4UT6L 1LQSR 4PJ9D 4YBQD 4Q74A 1JYWA 1XR8B 1U8NB 2DLFL 2C3VB 4L4TA 5DEFB 4MXWH 1EMTH 1WZ1L 3LS5H 1A6UL 2OJZL 3L3OA 2NY4D 4PJ7E 4IRSA 1IT9L 2ZUQB 1UACH 3CCHB 4H5SB 4CVXA 3VD3A 5K59E 3RWIB 2EC9U 5SWSD 5HDLA 4PY8J 3LDBB 2IALB 5CGYD 3IFNL 3TF7C 4S11A 1NFIB 1RZ8A 3VGEA 1OTTD 1TETH 5D93B 4APQC 2ATPA 2JJVA 5JORA 1O7SA 3I2CL 1TCRB 3FQUA 4WI8A 4P2QB 4Y5XA 4GG6E 4Q9CA 2W9EL 3HRPA 5E6IA 1BHGA 1U8IB 1M6OA 4QHLA 3VXPB 1GCFA 4XCNB 4Y16A 1AQDB 4X6EA 3VA6A 3S36L 4JN1H 4ALAL 4HS8L 1R5VB 2XWJA 5K9KB 2FX9L 4ZXBA 1KACB 5E9DB 3T0EA 2AJSH 5DI8B 4IDLA 2QSQA 4D2NA 4F7MA 5EC1B 4JLRA 1EZVX 4J6RL 2O61B 2EYSA 5D1XB 4EUPH 4PGEB 1IGJA 4X99A 2FGZA 4Z7NF 4WCYH 1K6QL 2HFTA 5JZ7C 3MLYH 3O4LB 1MCOH 1P7QB 4QHNA 3CPLB 1P4IH 4XAWL 4FQXC 1D5BB 5C0CE 4HH8A 4NYLA 3V5DB 3X13A 3HR5A 1JRHL 2P24B 1KLGA 5FO8A 2C1OB 5F89B 3LQZB 5IG7B 1ZWIA 4K7PX 1G7JA 3MRNA 5IB2B 4AM0B 2EDBA 4UAOC 3K7UA 4I3SH 1P9MC 3WLBB 1HSAA 1PZ5B 3KPTA 3TBWA 1NEZG 1KG0A 5KN5B 2UWEA 2HLFD 4HXBH 3TA3B 4HUMB 2GTZB 1Q9WA 2B5IC 1U3HB 3VRLE 1YEEH 4A6YL 2R2CA 4PJBB 2Q20A 5C2BL 5AYUH 4PRIE 3TJHC 4F2MA 3Q5TA 1NBVL 3CX2A 3QUYA 3MBEA 3U79A 4LF3A 1JPFA 2BNRA 1KUMA 1NCBH 3MLTB 5EU6B 4M6OH 4UTAH 1L9NA 1CD9B 5LQBH 5DUBA 4HCRH 5A43C 3V6OC 3DO7B 3G08A 4FQJH 4Q6IB 4UBDC 5CKAA 4C57C 5E99L 4LHUG 1A6WL 5I76A 1KOAA 4YHML 4YPGB 4LEOB 2ZJSL 1K9TA 2L4OA 4HS6A 1J0KA 4OSUH 4LIQL 4L8DB 3QUXA 5DDHB 2QBWA 1DQJB 1YPZE 1YY8B 1CL7I 1FNEA 4UQ2A 4LQFH 1VGKA 4F37K 1EH9A 4I0PD 5IVZA 4RQQB 3ZKQD 4FQCH 2D7MA 3HN3A 1QO3A 4ZUWB 5GS0D 1A6TB 1FAIH 2UZIL 4MA3B 2WWMD 2B1HH 3L3GB 3O41A 5DJ2B 3RA7L 3MOAL 4UDTB 5DJ0B 3LSOB 3ZKSD 5DR5L 4I3GA 1IC5H 4W4OA 4HMCA 1T22B 1V3LA 4G8EA 3BP7B 4J3TA 3VGAC 4POZC 3CMOL 5DQJB 3B9KB 2X09A 4NUGH 4XBPA 2APXA 1CK0H 3B9EA 1KC5L 4LLQA 4JZNB 4ESKA 1IEBB 5FV1L 5TDNA 1TZHA 2BERA 4NQXB 3BPNB 4RZCB 4HDIB 5L88H 1J1OL 4XI5D 5GSRA 4L8BB 4JPWL 1NBQA 4PP1D 2E6JA 4RGNB 1JHLL 3MRKB 1MFCL 3QCTL 1VACB 4G8FB 4NM8L 4LL9A 5F7LB 1ZLWK 2PCPB 3MROB 2VSDA 2VMFA 3BKYL 1H9VA 3BO8B 4UILH 3DMMA 4DJMA 4WEBH 2P44B 3QFJB 4JR9L 3RL1B 3PE9A 4JM2F 4GW5A 3MNWA 2CGRL 5FDWB 4NZDA 5SWQA 4H20L 1SBBA 3CFJB 4WFGE 3T0VA 5D7IB 4U6YA 3INUH 4NQDB 3RWCA 3KPNA 1AH1A 3EDKA 3O4OB 2XKUA 1T1XA 5DD0H 4YFLF 1ZLVH 3ARGD 1J88A 3GHBL 4G43B 3N1MC 5FV2A 5JPMA 2DLGA 3SGDH 2GJZA 3UAJC 4FFVD 3OR7A 4IBLT 5DRWA 3FHAA 1IGFH 4X7EC 3DSNA 1SJHA 4WW2F 5HHME 3VGBA 2W07A 1I8LC 3QDGE 1N0XH 2VN4A 3G9VA 4Z0BL 5IQ9B 4G80A 4PD4K 3KXFA 4JY5H 4PJ5E 1R3KA 4HV8B 1RJZA 1NCTA 4WUUB 1NLDH 1WWBX 1KXQE 1SYSA 5JNYB 2VLJE 4NP4L 3KYAA 5C0CD 1NAML 4HJGB 1MJUL 3R0NA 2X4UB 1VKXA 3IDXH 3WKNA 4XCYB 4YHKH 3LIZH 3HC0A 4HFUL 3WV0A 2PR4H 4ZQKA 5IIEA 1ZT7B 4NQEE 3ET9F 3ILPA 4OD3H 4QTHB 1TJGH 4CN6A 4QXUL 1ES0B 5D2LA 4PJHB 5KOVC 5IV2A 4QRPB 3IKKA 4QF1A 3TPUA 3TYFA 2V9TA 4K3JH 1NGQL 2DDQL 3KPRE 1U91A 5TDPB 1GGUA 2OZ4L 3CC5B 1HOCB 4LP5A 1JVKA 1BOGB 1ODAA 1BQHB 3WIIH 1BAFL 2Y5TB 1UH2A 5INDB 2GJ6B 5ESAA 4PRID 3G5YA 2AQ1A 3HS0B 5B39B 3MREB 4OZGF 4F58L 4OZIA 3LEXA 1LGVA 5HDQH 1WEJL 4MNHA 2VDPL 2RIKA 4G9FD 4Y2OA 5FYKD 1F2XK 2CLVB 1EHLH 3ARDD 4NO0D 1OM3L 1DL7H 4Z7WE 1AFVH 3FT3B 1JFQH 2V7HB 1CD1A 5JHLH 1JUFA 5E8OA 4J8RB 4PBVC 4FNLH 3UMTA 1I7RA 1XR9B 4MJ6A 2YUZA 3RGVB 4EDXB 4IDJL 4I9WE 4P23D 1BBJB 5D7LD 4U1GC 2J4WH 2FJFA 4KQ3H 4AIXA 1F90H 1QSFB 3MACH 4KFZC 4EN3C 4YXLH 5D7KE 1H8NA 4EI6B 1EAPB 3DUSB 3HC4L 2Z91A 3HA0A 2MQCA 4XPBL 1JGVL 4PY7B 1DLFH 3ARTA 3TO4C 3GSUA 4NQSA 5KANG 1JPST 4PJ9B 4QCIB 1NMAL 1UWEH 3OB0H 4YBHA 5DXWA 1AGEB 3QNZB 5LBSH 3SKOB 5E0QA 3T4AA 4OKVA 4KDTA 1DQDH 4HHAB 2CUMA 2NY4B 1AR1D 5IFHH 1EHNA 1IAMA 4U05A 4EDWL 1U8LA 1NFDE 5SWSB 2W0FA 3KYMA 1DQQA 2IH3A 4D3CL 2X4TA 3MUJA 3C2SA 5K33A 3FQNB 1IGIL 1VFAB 32C2B 5EU5B 2OR9H 5IM7A 3OMZA 3MLRH 2APVA 1NMCC 2HG5B 2YD6A 2Z31A 2J8HA 3IXAB 3UTPD 3P9WB 1LEGB 2GSGA 2VL5A 4ODHH 5D1ZD 5C0ND 4WFGD 1C7SA 3GMNB 4JPVH 3QHTC 3U7YL 4P57B 4E41E 3U6RA 4N0YL 4M4PA 5J7CC 4L5FH 3RP1A 5KJRH 1IGCH 1DUYA 5IW1A 3C9NB 4CMMA 2HVKA 3IFOB 3SKNB 5ETUB 3MJ7B 3GMQA 1P53A 2P49B 4Y4HC 4N8CH 5I15L 3L5XL 5DJAB 5I1GH 1KN2H 1TTUA 3TNNB 3S8WA 1OAZL 3QDGD 4PLKC 1FYTE 3K81A 5HGDA 5LVEA 8FABB 1T7ZA 5AEAA 5IB3B 1AKJB 1IGML 3VMNA 1F2QA 1S3KH 2VLJD 5T1KA 5IT2H 4U0QB 4K94L 2ZUSA 1UQSA 4X4XA 4PJIE 3DUUB 4DN4H 4KJQC 3A67L 2C4FU 3QXAB 2Q8AH 4PJ8D 4XNYH 2HT3D 3NH7L 4NQED 1QBAA 3EFFA 3L5IA 1IMHC 1Q9OB 5A2LH 1CGXA 4FXKA 4AJ0A 4X6CF 2RAMA 3PGCB 2YD8A 2AJZB 4LSUL 1B4JH 2XTJE 4R96B 3UYOD 3TT3L 3KPRD 5ESVB 4UIKH 1AXIB 4L3CA 3DRTB 1MCIA 1AXTL 1BD2E 3VXRE 5T3XE 4JZJB 2FGWH 2RFXA 4LLYB 2Z93A 5DFVD 3ULVC 1C8PA 2NY7H 3TJEL 1HHKB 5IHZA 1C16B 1IFHH 3I02B 5K9QI 4QHKI 4ONHA 5HDBE 4UMGA 4OM0L 2BVQA 2HA1A 2D4DA 5C08E 1L6ZA 4DCQB 4GJTB 5MEOB 3SOBH 3VI4F 3G6JF 1SVZA 4G8IA 1F6AB 5GGVH 1DEEB 3QJFA 3QIBA 1WCQA 3IFPA 1I9RL 1WBZA 2WBJA 3KNBA 4I0PB 1UZ6F 2R4SL 2H45A 3K2UH 4OF5A 1LO0H 5EIIB 3MLUH 4BQBA 4FTVE 4OCNC 5HY9B 5H35A 4OGXH 1FVEA 3NCCB 2FB4L 4JGJA 4I9WD 5DK2B 3ARFA 1UZ8B 1JGUH 3BP6A 4Z0XA 5GGRB 3DVNA 4HIJB 4N8VA 5I8CB 2DI9A 5GRJH 5ESQB 3QIUC 5H94B 3TZVA 5FHAH 2BMKB 4OCRL 1DBBH 4LLDA 3QZWG 4TPRL 5K9OB 1AY1H 1ORQB 3WXVL 2EDDA 1R3HB 3O3BA 5IK3A 3IYLW 1GJIA 4TSCH 4ELMF 5IW6A 4XMLL 4YBLC 3RWJB 3LKSA 4PJ7B 5ISZA 1SEBB 2QKIB 3LY6A 4P2OD 5J12B 4MWFB 3LS4L 3H9HA 3MRHA 3ZDYF 1MFAH 1TVHB 2D0GA 4MVBD 3VFMA 5HHQB 1TNMA 3ULUE 4OAWA 1OWWA 4YDKH 2IAND 1S9YA 3HAEA 3Q6GH 1KT2A 4J3UA 2HFGH 2YMXH 4PB0H 4JM2A 4GG6B 3ARRA 3CFKA 4X6FA 3KPPA 1KFAH 3MNVB 3EOTL 4JRYA 1RZKH 1UCBL 1LO5B 3ARGB 3WNMA 5E8NB 1NGYA 3MZTA 3VU2A 4R4BB 3MLWL 2F74B 2E8ZA 2Q86B 3U1SL 3NTCL 3O2VH 1C5DA 2BP3A 1G7HA 3UXFA 4N0CC 4DKDC 5GRXG 4LK4A 4BK5A 5HHNA 2XNAA 3HG1D 4NJAH 1T89A 1KPUA 4WW2A 1I3RB 1K8IA 3VFRA 3C5ZC 3ZLQC 2HAZA 2C26A 1I3GH 1KCVH 3QQ3B 2WINA 1FAKT 3BAEL 2LTQB 5FM8A 3I6LE 1QFWM 1S8DA 5C92A 2QHRL 5C0CB 2R0ZL 4D0CA 2Q8BL 4QTIL 5EUKB 3CX5J 2OM5A 1MUJB 5E95B 3DECA 4KRMB 2VLRE 5IVXF 5E8EA 4KZDH 3SDXF 4JDTH 4L4TE 4G6ML 5I19L 2PYED 2DQGL 1JK8B 4O2CB 1DN0A 1V7NH 3O6ML 2SEBA 1F8TH 3SKJH 2ZUQC 3TBYB 3D85D 5GS1C 4EZMA 1LE9A 4WHYG 3MV7D 3LDBC 5F9WC 3C5SB 3GRWA 1UG9A 4UT7H 2MQ3A 5AUMA 2BSSB 1A4KA 2VAAA 4HQQH 3RX8A 5D93C 2CJUL 4YFLI 5IEHA 2XTJD 4QNPF 4X6DF 2UZYB 1FJ1A 3UPCA 4PRIB 3QDJA 2ADGA 3QWOB 1BD2D 4KROD 5AZEL 5DJ6B 3E3QC 2DM3A 1RIHL 1MY5A 1V3MA 1LILA 3F6LA 4OZGA 4G8GD 3JTSA 4JN2A 1MCNA 4G9FB 5E8DL 2X1XR 2AGJH 2FJGB 2FNBA 1CR9L 3QO0A 4QXGL 4JGUA 3H3PH 3STLA 2QQLL 4YUEL 5DJDB 4ONFH 4TOYL 3QEGL 1FPTH 1CI5A 3OAUL 3O2DL 1YNTB 2F19L 5C08D 2ILLA 5MP6H 4RFOL 1MAML 3X14A 4JFDD 1RPQA 2DL9A 4DUXA 5D1XC 1YPZB 4WV1C 3IXTA 4BSWB 1WQVT 1FL5A 5FUZL 2FR4B 4P23B 1C08B 3MODL 2DQJL 3AM8A 2XY1A 3ME0A 5D7LB 5BV7L 5CCKH 3BWAB 4JFOA 4QWWC 5IR1A 4HZLB 3FN3A 1M7DA 5DMYA 3O3AA 1KXVC 2OL3A 5ERWA 4LDOB 1IARB 4JG1L 1A7NL 5GIRA 5GRUL 1X5KA 2Q87A 4NM4H 4NKIL 3S35H 2LVEA 3FMGL 5H37H 2AERT 4Z77B 4YE4H 1CGSL 5GGRY 5JW5A 1CL7H 5CMAA 5B3NA 5LGJA 3EJYD 2PTTA 2QR0B 2DTSA 2EE6A 5J13B 2AV1A 4OZFG 4KHTH 2HT2D 4B53A 1KV3A 4OF7A 1I1FB 3PWVB 3O9WD 3WEXA 1J1PL 4I0CC 1FO0A 5D9SB 3TA3C 3OJDB 5ICXA 4MAYA 3C8KA 4WI6A 1U3HC 3LOWA 4K3HA 1DZBA 2D31B 4D0DB 3V52L 5IUSA 3CD4A 2ORBH 5DUPH 4U1MB 4OQTL 2E7BA 4DGYH 5F6IC 3BP4B 5DQDL 1TPXB 4HPYH 1X9QA 3LKNB 4ZUTA 2EYTA 2VLLB 2QTEA 3ULUD 4NPYA 2NQCA 3TCLB 4WFFE 3B9DA 5MERB 1RFDH 5D1ZB 4Q6IC 5AZ2L 4ERSH 5GJSL 3GI8L 3OZ9L 1EPFA 1QBLL 3UJTL 3QXDA 2PXYC 4TTDD 3GSNA 5DHVH 3V5KA 2C3HA 2FX8L 5HHXL 3NIFE 1T1WB 4JAMB 3DHJA 1FN4B 2FBJL 1EO7A 3K4ZA 1OAYH 2VITA 1XF5A 4GAYA 4KTDH 4XXCC 1FGNL 5CUSL 5C6WH 1KJVA 1MHEB 1VGEL 1K2DA 3CFIC 4EI5A 1I85C 5HHMB 3X11A 3KLHC 2WANA 4FN0A 4FQQB 3QDME 1EK3A 4AT6A 5FEBA 3QDGB 3QIWC 1AJ7H 4PUBH 2JJWA 2AV7A 1KEMH 5CD5D 4F7EB 4PJ5B 5KVGH 1AO7A 2LU4A 1IEHA 5J6HB 1XGRA 4AG4H 1XF4B 3R06A 2P5WA 2VLJB 3B9KC 1NCCH 2NNAA 2ZUWA 2WZPD 1MPAL 3RX5A 5ITFA 1YEKH 1GXEA 1CGTA 2O5ZH 1JNNL 3L3HA 4X5XB 5D1QD 1INQA 3BPNC 1BWWA 1CU4H 1RK0B 4IIQA 2VLRD 1JHTA 4PJ8B 1QHPA 3V4VL 4Q9BA 2EKJA 2CO6B 1AGDA 4NQEB 5ICZB 4LOUC 4RGNC 4X0KA 2DQUL 5ENWB 1PSKL 4LNRA 3CVIH 4CDHA 1OL0A 3QRGL 2JJSC 2Q3AA 3JV5A 4N0UE 4X6CA 4KC3B 2HKFH 3T77A 3KPRB 1QSEE 1JBJA 3MV9A 2DLIA 4YXHH 5DLML 1SYVB 4JQVA 4P4RA 4KI5F 1DFBL 3U4BH 3RFZC 4KKCC 1C5BH 1JHKH 4ODSH 1KEGH 2P8PA 3O4OC 3OSKA 4O4YH 1F3DH 2P5EA 3IDYB 5DZOA 4ZUVA 1XZ0A 1X5XA 2FATL 1G9NC 4TUKH 2HYMA 3QG6B 4LKXB 2E9JA 1N6QL 2JIXD 2MHAA 3EDFA 1MIMH 3CDGB 3TVMD 4Z5RB 2CLZA 2H1PL 3C6SB 5EBLA 1NJ9B 5CEZH 4QRTB 3IGAB 3GI9H 1J12A 4Z7WB 1G6VK 4JFPB 5DUMH 1IC4L 1PQZB 1KJ2L 3MV8E 3CZFB 4ZTOH 3RWEB 3MRMA 4APQA 1S9VA 2JK5B 3BH8A 1LO2L 4JFZL 2I24N 4RRPA 1QPPA 5E2WL 2MMXA 4ONGL 4MNQA 3QQ9D 3ORJA 3NBNA 3RVUC 1X6LA 2R4RH 5BMFH 1KENH 4W6WB 3VXQA 2EDXA 4C83B 4Y0GA 3MRGB 3HC3L 1KLUB 3S88L 4UV7L 2Y25A 3JTTB 2HH0L 1OB1A 1E4WH 1FFOA 2F5AH 3DETC 1KN4L 5E4IA 3JWOL 3H9SA 5D70H 3DV6B 2AXGA 3FB8B 2JCCE 4BYHA 3BVNB 1BVKB 2WP3O 2VRAA 4LVNB 3U46B 4BFGA 3F7YB 1ZXQA 1U8JA 2Y06H 5CJQH 4NUJB 4LCIL 5T1DL 4ELMA 2P46B 1A7OL 3PWLA 2AK4E 2X89A 3QCVL 1MWAB 5KVEH 4P2OB 1AIFA 2AVGA 4PJGA 5DRZB 1NFDB 4FQXA 1NEZA 3SE9L 5I66A 2AABH 4PGCB 3P9MA 1ZK9A 5FKAB 5E6YA 2F9BT 4P5MA 5FYJL 2B2XL 1L0QA 2IANB 2E5EA 3QR2A 5DEZA 4OZIE 1S5HB 2P4AB 3BKCH 2CKBA 1JJUA 2QQNL 3BZFA 5I1IH 4WFFD 4TN9A 3SGEI 3BRFA 1P9MA 5IHBA 3VXMA 3VXTA 5TH2A 4MA1B 3B2UC 4HKZA 3NABH 1S9XA 4JFYB 4K8RH 4BZYA 3JBG7 2GUOA 2VXSL 2OQJB 5CEXA 2W9LA 4TVPD 5B39G 2H8PB 1AI1H 5IMLA 5D6CB 1JTTA 2VDLL 4NOBA 2DQIL 4P4KD 3DJ9A 2HJKA 4N0RA 5KAQF 1G7QB 2JB5H 3RGVC 4UTBH 5IB1A 3RWDB 3HPLB 1RMFL 5E00A 3VFTB 3ULVF 3GIZH 1JF1B 4HGWA 3AB0B 2F58H 1RURH 3QDMD 4Y2DA 5CWSA 3D87B 3PP4L 3V6OA 5JTWA 3D0VA 4XP4L 5BVJA 4JZOA 3FB5B 4F8TA 2FYYA 3IDMB 2C3WA 3GSOB 3KLDA 4PJ9C 5FOBB 4YBQC 4ISVA 5F7UA 3OJMB 1QQDB 1IAKA 1A7RH 1M7IA 2DQEH 2PYEB 5IVXA 2BX5A 4PJIB 1ZA6B 3SDXA 1OAUH 3GDBA 4JY4A 2B4CC 1BQLL 4P3DB 2NY4C 2OTUB 2G75B 3GMOB 3OJVC 2ZUTA 3D85B 3NA4A 5GRWA 5CGYC 3R0MA 1CG9A 4P5KB 1HCFX 3HNVL 2ICES 3TBSA 1OTTC 1N2RB 2MCG1 1U41A 2IFFL 2VXQL 3HNSL 2XTJB 2ZCHH 3NIDF 1QSED 1NGZB 5A2FA 3UDWC 4E0RA 2VLME 4U49A 4X6DA 4HSQA 5DRNB 1BD2B 4KROB 4PGZA 3MRIB 1NBZA 5BZWB 1J8HE 3UYRH 3VXSA 4G8GB 4U1IB 1UKQA 3WDJA 4CU8A 1P4LB 1YEHL 2A9NH 5EULV 5IROA 1F4YL 1QYGH 4F3FA 5IFAL 5K9JL 1I1AA 4IS6B 2IG2L 1WISA 5BXFA 2DKUA 2VXVH 4PRHE 4G5ZH 5BRZE 1IKFH 7FABL 4OJFL 5C08B 3EYFB 3WHXB 3ZHLA 3ROOB 3MRDB 4JFDB 4M1CD 5JIPA 2VB5A 2Z8RA 4KK9D 1ZANH 1KCSL 1VEPA 3LKRA 3MFFB 3MV8D 4Y8AA 5EZLA 4M7KL 4WGVB 4XWGL 1ZEAL 1RIVH 4XC3L 4CGTA 4AZ8A 1CTOA 1C7TA 3WN5B 4JDZA 3GHEH 2VDNL 4YIQA 1FZOB 2C7UA 2WMPA 3UBXA 3C6LD 5DT1H 4FRWA 3MRRB 5IMMA 4KUZH 3V6FB 1X5JA 5L6YL 2ATKB 3FTGB 4MQ7B 1OARL 3CDCA 3VRJB 2GYSA 4OLXH 5FA4B 3OKNA 1BEYH 1BM3H 1WZKA 3O9WB 5J0BA 1YJDL 1LWRA 2CDGB 2HLFC 1I8LA 2E9IA 4JHAL 5J11B 5CILL 1BFOA 2EDRA 2XXMB 3GJEB 5JA9A 4HWNA 3V6ZB 3FFCA 3G5VB 3LH2L 2X42A 3S4SA 2AK4D 3PGFH 5FCSH 4NDMA 2VQTA 4U1JA 4GW4B 4JZJC 1ZKAA 2XWBA 3HKFA 3FQXB 1Q72H 1Z9OA 4M5ZH 5F88B 5CEYB 3L3JB 3BGFC 4K3DH 4MSWA 4FFYH 3KPQA 3BZ4B 2WBWB 3S98A 5C0FB 4X98B 3WNNA 3QO1B 3TBTB 1OP3K 2XY2A 3L6FB 4P0DA 3KJ6H 3OTTA 3OXSB 4FQIL 1JZ7A 3S7GA 5I18L 5BVPL 3BYYA 4ZNEE 2BVPA 3JWDH 1JPTL 2NY6D 4NN5B 4PJAB 4MDJB 4OFIA 5F96L 5EU7E 3FO0L 3MYJA 4I0PC 2V17L 3MLXL 3UBXI 3V4PH 5DFWH 4MHHG 4W6XB 2F15A 4OF0A 2WWMC 2H3NA 1ADQL 1WC7B 3IU3B 5HXMA 2ICWA 4NKOA 3EGSA 1L7TH 3ZHKA 5CJOL 3JXAA 4M8VA 5L0QB 3BI9X 4ZTPH 4DVBB 1JNHA 1P69B 5IKCA 4FXGA 4I48B 5D1QB 4X4MA 4HT1H 4HKBA 4PBXA 4HGKC 2VLRB 1AD0A 4XI5C 4Z18A 2NZ9D 1A14L 3V0WL 3L3DA 5B38A 1B90A 4PP1C 4GRLD 1PG7L 1VEOA 5HHVL 3ZKXB 1L6XA 4KDWA 4KTEL 1I7ZA 1F3DJ 2VDRL 4UDUA 1RI8A 3HUJB 3KPOB 3T65B 1QPXA 1EO5A 1RUKL 4TRPL 4HWBL 4EN3A 3QUMA 2ID5A 5C8JB 1KJ3L 4ZD3H 4I1NB 4YH6A 2V2XB 1FCCA 5E2TH 2Q76A 3PNWA 1EHXA 5JR1H 3JV0A 4IM8A 3HLAB 5DK0A 5GSVA 3TO4A 3P4NA 3WUWA 5MENE 3MGTB 3UJIH 4Z76A 4LSPH 2ZOLA 2ZNXA 3EFDH 2Z31D 3LN5A 2NPLX 1JL8A 5MHSE 3CSYA 1J8HD 1Q94A 2DBLH 4JRYE 4PGDB 3ARGC 3L7FB 5HYSG 4LPXA 4QHUA 1PX4A 3DGGA 4OLUL 1YN6A 4HGMA 5JHDE 3TVMB 2LV4A 5BRZD 4PRHD 2YOCA 1OAKH 4PJBF 4Y89A 4WI4A 2EH8H 4MXWL 4I2XE 1RULL 4FFVC 3ZYIA 1SY6L 15C8H 5IQ7L 5DD5H 5FUOH 4CVZB 2EYSB 1BX2B 1TJIL 2JB6B 3H7BB 1UACL 2N7AA 1IGJB 1NL0L 1Q9KA 1XIWD 2AQ3A 4CAGA 2LTQC 4FQLL 2ZKHH 2XPGA 4QRUB 1Y0LA 3VDBA 4I3RL 5KANI 4WIQA 1HYSD 5CZVL 2A73A 1NSNH 3MO1A 4MA8L 3GNML 4OI9A 4ODXA 2D03L 1XH3A 2H32H 4FQ1H 4YFDB 2Y36L 1Z0MA 5TQ0L 4X5LA 1ZWIB 1OP5K 3R8BB 1G7JB 3S96A 1QNZH 4CMHB 3ARBD 1BJ1H 3W0WA 3FOMA 1A7PL 1OAQH 1HSAB 2X9YA 1QVOB 3TBWB 1INEH 3BIKA 3C08L 3VJ6B 4H8WL 4QRQA 1RSFA 4GAGH 4DAGL 5B22A 3AXLB 4D0BA 3HCVB 2XA8L 1Q9WB 2MKLC 1T0NB 3UO1L 1GIGH 4WCYL 1E4XL 4XNXH 1D5XA 4F2MB 1P2CB 2FEEI 4L3EA 4WJ5B 1A0QL 1JPFB 2WUBL 3VFUB 5C6TL 4OZGE 1X5HA 3NZ8A 5EU4B 1ZHLA 4KJYB 1HEZA 5DUBB 3G08B 1FZMB 4MCYA 1MFBL 3I6GA 1BZ9B 3ARDC 2ITCA 4LAQL 5I76B 4BQ9A 12E8L 4Z7QF 3JVGC 1KCRL 5J4MA 3CXHJ 3CVHA 5I1JL 4MLIA 1KB5A 5TDOA 4I3SL 2YD4A 3IDIB 3PJSB 4K7PL 4P4KB 1R24A 1FNEB 4KV5F 5DVNA 4HJJH 1VGKB 3MRJA 4P23C 2CXKA 4X4YA 4BKLB 3L3IB 1YQ2A 3TT1H 4PTTA 1D5IL 1HCVA 3IAGC 4DW2L 4FS0A 5D7IF 1YEEL 2J8OA 1FRGH 2W59A 3WIHL 5C09A 2X70A 2QQQA 3QDMB 1Q0XL 2A77H 3BE1H 3FO1A 3J7HA 3TV3H 1DTUA 2G5RA 1DLHA 1F4WH 4QT5A 2A6IB 1MEXL 4X80L 4LLUB 5CINL 1II4E 5A3ID 2OP4H 5T3ZH 5F21B 3ESUF 4N9OB 4HCRL 3FRUA 4XBPB 3NZHL 5BQ7A 5J13C 4DKFL 1MLBB 1TZHB 1P84J 1HQRB 4GS7B 1A1NA 2JKXA 2B7DT 2R15A 3U4EA 1NUGA 1RZ7H 2LE9A 1AR1C 5GSRB 4R26L 5JW3H 3A6CL 3F12A 3DX6A 5D96B 4CN4A 2UZXB 5F1KC 1WFOA 1T83C 3NCBB 2CUIA 2G5BA 4RAUA 3LEVH 4M43H 2Y4SA 2ZUXA 4MJ5B 5IB4A 4N0UB 3ZSSA 2BXYA 5SX5H 4PD4J 4G6JL 1TPXC 4L9LB 3ARED 2YPKB 3O3EA 1QSEB 3QIUA 2KL6A 1CXFA 3P73A 5C0BE 3UPAA 1KTKE 1FV1B 3F65A 3KJ4B 1C12A 5SWQB 5D1ZC 5C0NC 5MEND 1RJCA 1BIIA 5J06A 4PJHF 3RWCB 1G9ML 1EEZA 2BZDA 4NUGL 4BFIA 2AJ3A 1GH7A 2JE8A 4XNQA 1CK0L 1P1ZB 4E42A 3G04A 4QHKJ 2BJMH 1MJ8H 3KPLA 4LCUA 1PY9A 4RNRB 5JHDD 3KGRA 1XGPA 5EOTA 1YYLH 2FSEA 1LEIA 2GJZB 2BOCB 2NY2C 4XBGB 3ZE1F 3W82A 3BKMH 5DRWB 4CW1A 3MV8B 3QHZL 4DZBA 3V7AE 1CLCA 2J88H 3QISA 1AGCB 2BC4B 3MNZB 3GUTB 1A6AB 4OFVA 3V2AR 4GXVH 3PWPE 3EOBB 3VFOA 1LE5B 4UT6H 1R3KB 3MRQB 4LFHG 4P9HC 1SBSL 1SYSB 2P5WE 2Q7YB 3MLZH 2DLFH 3C6LB 2EH7L 1DBML 1EVTC 3OB8A 1JWMA 1VKXB 2VDOL 1DN2A 1WZ1H 1EGJL 4X9BA 1A6VL 4PRNA 1IT9H 1NGPL 2IPUG 2HT3C 4AEIL 5GZND 4ZQKB 3IDUA 3B5TA 4M03A 1NFKA 5GRZA 3IFNH 2JCCB 1FIGL 4XH2A 3CU7A 4RAVA 3TNMA 1MRCL 4JDVA 4UOW1 1UVQA 3C5ZA 4X6CE 4EVNB 3NFPA 5ECJE 3LV3B 1ZT4B 3VFNB 2AK4B 2W9EH 5HYEA 4DK6A 1KCUL 4J12A 3MV9E 4V2CB 1PLGH 1DBAL 1N0XL 1OF2A 5FYLL 3N0PB 1LD9A 1ETZA 4LVEA 4HS8H 1I3VA 5DFVC 2FX9H 5F1IB 4KKBD 2D7PA 5TQ2L 1XR8A 4OZIB 5DD6B 1U8NA 4G6KL 2C3VA 3IDYC 2P5EE 2N4IA 1NKOA 1X5GA 5DEFA 1AD9A 5C7XH 1N64L 4J6RH 4YHKL 4LAJH 5GS1A 3CCHA 4H5SA 1NEUA 3RWIA 3THML 5LAXB 2NY6B 1GC1C 1JPGB 1K6QH 2A1WL