3DV4B

Crystal structure of sag506-01, tetragonal, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
119
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fv fragment SAG506-01
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 119
sequence length 121
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dv4B00
5TDPB 3QI9B 5GS1B 1DANT 2FYYB 3VGAB 5F6IB 2ZSWA 4K3EH 5BVPL 4OCNC 4XC3H 4JFDB 5DC9B 4LVNB 1BJMA 1VKXA 5E7FA 1U8IA 4OFPA 3E6HA 2J12B 4ODTH 3H9HA 4HUUB 2B20A 4R4BB 3ZKND 4YHPB 4EI5D 3SDCD 3RPKA 2C1OB 3S5LB 4WCYL 3FKUS 2ADJA 2J8HA 4W81A 3TWCH 4GUPA 4OBSA 4M7ZB 1F3JB 2ZUQC 1PDKA 3MRBB 1JHLL 4WI9A 5EO9A 2YN5A 4FQXD 4NO5A 5DRWB 1MJUL 2J8UE 4WGWB 4AJ0A 3RWDB 3ET9F 3BEWA 2BVPA 1MHCA 3QEUB 1ZLWH 3ARBD 2JB5L 5E24E 1HKFA 4QRTB 3G6AA 1V7NL 3W11D 5L6YL 1F4WL 2BVTA 4G6FB 4LLQB 4Y4HC 2ITCB 1MUJA 2VLJD 5K9OB 1AGBA 2AKRB 4OLXH 1U8NB 1KFAH 4CJ0A 3B9KB 2R29L 3CPLB 3SN6N 5E5MB 3EYQC 4N9GB 4OZGA 1X5KA 4PJGE 3L5XL 4EZMA 2X89A 3HZYA 4PRDA 5DUML 4Q6YA 4Y1AE 3O3EB 3VFOA 1AGFB 1UJ3C 1S3KL 4LCCB 3KPOA 3VJ6A 1G1CA 3RIAF 4P5TD 1C5DB 1ETZB 4X4XA 2FECI 1FHGA 1U9KA 3OHXB 4OLEA 1A6ZA 5HHVH 1FO0B 3QIUD 4NHCH 1KLGA 4OM1L 3BQUA 5DUPH 1VERA 1U8MB 4MA7H 5DJZA 4ZOCA 1A2YA 4DZ8B 5F7KC 2F5AH 2HFEB 4OZFG 1HINL 3M1BA 3MNVA 1MY5A 2BJMH 2UWEB 1KN2H 4PJ7E 5JHLL 3DJ9A 4X99B 4JM4H 5A16B 4OGXH 5B22A 3UTTB 1NGQL 3ZDZE 1KTDB 2E7CA 2FH6A 4HDIA 1WZLA 1A1NA 1GGBL 4JPKH 1DCLA 5C7XH 3UCRA 1DBAL 4G9DA 4YBQC 3QFJB 4RWYH 1OTTD 5T1DL 4F9LA 1FDLH 5JHDE 2WK2A 4FZEH 3P11H 4LVOB 2NXZC 3AS1A 3DETD 1CIDA 3VD9A 4M6ML 3HFMH 3GSXA 2IBZX 4Y4HA 2IH1A 3L7EB 5B8CC 5CEZE 4NRXA 2RIKA 3G6JA 4QRPA 5KTEL 3UJTH 1RV6X 2CUIA 5HYSG 3F7VA 2QQLH 4LCIH 5K9QG 2NY0D 3NTCL 4TTDD 2A83A 5MERB 3PP3K 5EU7C 1S9VB 1DFBL 2I07B 2AEQH 1MLBB 1N0LA 1UJ3A 5DGQA 2DDQL 1MWAH 2YSSA 3W39B 3DTXA 3HC4L 1EEZA 1JUFB 2FIRT 3VXMB 3OJMB 3PGDB 2H1PH 1ODAA 4K3HA 4S1SL 1WWBX 2DLFL 4POYA 5HI3C 5KSVA 3V4VL 3UTQB 1S9YB 4FTVB 2F53E 2Y36H 2NY4D 1U92B 4OD3H 5E6IC 2HT2D 1C12B 4G42A 5DR5L 1ZLUH 2OYPA 3BESR 3MLUL 5AYQA 1YEFH 3MOAL 5KG9B 5BRZB 4KJWD 2IFGA 4JG1L 2Z4QA 3SE9H 4GMSH 4EDXB 3C08L 1IAMA 2BSED 5HHMD 4FNLL 1FSKC 3S4SB 2P46B 4L4TE 1N64H 5D93B 1MH5B 1P6FA 4PLKC 4NQCD 3OXSB 4PJ5B 2Z31A 5BZDB 3BZEB 2BHYA 3EDFA 4YFLF 3GSRA 4JFED 4NZRH 5ICXB 5EO0A 5H8DA 5B8CA 2XKNA 4PJFE 5SWZE 3VRLF 2B0SL 1N4XH 1ZVYA 3O4LB 2ZUYA 1T1WA 5K9KB 3RZCB 3PWVB 1XEDA 3EFDL 1M71A 1FNSH 3DVIA 1BHGA 1S5IL 3KPRA 2CDGB 4DGYH 4X83A 4BH8B 2PO6C 3E1F1 5JLZB 4L3EA 1I7UB 1T4KB 1DEDA 3FQUA 4KRPC 1A7RL 5GGSY 1HSAA 3O9WB 4CADA 2APBA 3NFPB 3QXWA 5C92A 2CLZA 4LKXA 2AK4E 2KKQA 1DBBH 3C5JB 4ENED 1N5YH 3MODH 5IT2H 2YOCA 1ZHKA 3BRGC 4WTZG 1YEDA 4HULB 4PS4L 4RSVA 1JHTB 1E27B 4G8GA 4DKAA 3FQNB 4XBGB 4OAWB 1A14L 2CQVA 1K4CA 1S7UA 3GMRB 1S9XA 2EYSA 2UZXB 1F97A 4NM8L 1MCPH 1U42A 4KUZL 3QO1A 2EH7L 4PRIB 3RUGF 4OLUL 3VFVB 3AROA 1WSST 4KH2A 3ESUF 4ZUVB 3X3GH 1GC1C 3CZJA 1AY1H 4KKCC 4I5BA 3RVTD 1G7HA 2BNRE 2Q76B 5J57B 1FIGH 2PNDA 5ID1B 4JVUA 3U36B 5C0AA 1WZKA 4Y0GA 3QPXL 4PJIF 2XN9D 3VXOB 5DZNA 4YEFA 3SKNB 1EFXB 2UWEF 1UQSA 5FM8A 1ZANH 1G7MB 5H35B 5DURB 1II4E 2L7UA 2OR9L 1RUKL 3D69B 4JZNA 4M03A 3TJEL 1E4XH 1TJIL 1TLKA 4KDWA 3ZTJH 1M7IA 4JG0L 1FFOB 4RIRB 3W0WD 4CN4A 2H6PB 2CDFA 4JFQB 3ORJA 4ZO7A 4L29B 1QFUL 4KMTH 3M45A 4JRXB 2Q3AA 4PRBA 4HEPG 1YY9C 4LRNH 1MEXH 1PBYA 1W0VA 3OKKA 4XXDA 1B4JH 1U8IB 1VKXB 2HFGH 2LE9A 1W0YT 1OQXA 1QFWL 3GO1L 3BIAX 2BRRL 1QUNA 4OZIA 3GBNH 5IBTL 4JFFE 3ZYOA 2EEAA 4R4ND 1JWMA 1JGVL 1PLGH 2YRPA 3M8OL 1LEGB 1MHCB 4C56D 3QEHA 3V5KB 5INCB 5JIKA 4ELME 4K7FA 1MVUA 5CINL 1E28B 1QRNA 4P5MB 3ARQA 1UKTA 3LKOB 4PY7A 3NPSB 5J89A 3L3GB 4XGZB 2HH0L 1QR1B 3UTSB 5CJQH 3VXSB 2FHCA 4P5KA 1MJ8H 3CMOL 4Z0BL 2NTSP 1XGPB 1QLEH 3TH3T 1CD8A 3V8CA 4MXQD 4MD0A 3PL6C 3QR2A 3QQ4B 4NCC1 3DMMC 4K8RC 1PG7X 4PTUA 1TVBB 5F7UA 2EDDA 5DRNA 5HHOA 3QDAA 2HT4D 5GGRY 3HZYB 4PRDB 4HFUL 3LSOA 3VWJD 4M1DL 3VFOB 1KCVH 3THML 3KPOB 3DVGB 1CI5A 1FZMA 4ODHH 4KROC 1A6ZB 4HPOL 3MV9B 1KLGB 4JLRA 4B7IA 4ZOEA 3QUYD 1R5WB 1YEKH 1OAUH 1RZ8A 1Q9LB 5ID0A 2EICA 3DGGB 1DZBA 2R4RH 1Q8MA 1D9KD 3L3KB 3U82B 1D5XA 1UA6H 3MNVB 2XNAA 3EOTH 5HGDB 4I0KA 2BFVL 3O3BA 4NC0B 3WFBH 2Z8VC 4JREC 3N1MC 1LO2L 2X4QA 3QO0B 2BHUA 3MCLH 4NKOA 3C87A 3VRJA 5C6TH 1C5CL 3FO0H 3T1FA 3N1FC 3UO1L 1AJ7L 5C2BH 4QOKB 3MR9A 1IM9D 2AGJH 4AH2A 1DTUA 2AJVH 3MBEC 1OD7A 3ARGC 5C0ND 1NL0L 5IB4A 4OV6F 1JGDB 4XCCH 4UTAH 3ILQC 4WHTA 3SDYH 3GSXB 4BZ2H 1KULA 3CJJA 1T0MA 2NY6B 4DKFH 3PL6A 3EYOB 4Y2DA 3FZUD 5LQBL 3DMMA 2CO7B 1GC1L 2J8OA 4PUBL 2C3GA 1G9NH 5DEZA 3GNML 2A83B 4X5WA 3BSZL 5CEXA 1WK0A 5HVHB 3WE6A 1ZLVK 1L0XA 4U0QB 4MMXC 2YD6A 4XP6L 4FFWC 4YPJA 3DTXB 2IPKA 2WIMA 4JQXA 3HMXA 1KJ3H 3ARRA 1XCQB 2R2CA 1EX0A 3U46A 3T1WA 3I6LD 1GAFH 4N0UB 1JHKH 3S88L 3QIWB 5CZXC 2J5LB 1S7WA 1CR9L 5KSVB 3STLB 2AK1L 2XTJD 1IGFL 5FGBC 4UT6L 4NWUL 3U1SH 3L7FA 3HG1A 2OX5A 4QRSA 2DBJA 3ULUF 3NH7H 4OTXL 1MRCH 3OKOA 3MJGX 2IAMD 1MI5D 4G42B 3DIFB 3DX8B 2BDNH 1KJVB 1ADQH 2CMRH 2Q1EA 3BP5B 4O51A 1CE6A 2IG2L 1QBMH 2CLRA 4FQIH 4TPRL 1RK0A 5FYJU 1VFBA 1JPST 3ARGA 1OLZA 2HTLD 2ZPKH 4WO4C 2WP3O 3SO5A 4KVNH 5DD1L 4GKOA 2H3NA 2Z31B 1B9ZA 1N3NA 3FN0H 3D3VE 4IOFC 1FP5A 5E56A 1QKZL 4FQJH 2VITA 4XCNB 1IC5H 1NDMA 1I3VA 4B41A 4LCUB 4DFIA 1RJZA 3X3FL 4HK3N 4IJ3C 4X6FB 5T5FL 3SJVD 2DL9A 1VENA 4QHKJ 4LARH 1OM3L 2D7QA 2NY5C 4PJHF 4LQFH 4XMLL 1T1WB 1M71B 4PTTB 3N50A 4PRAA 3AXLB 4ZPTB 4MS8C 3LZFH 5ITBL 5I19H 1T6VN 4K23H 4YX2L 4L3EB 3FQUB 1IAKA 1HSAB 4GBXC 2WQ8A 2A0LC 25C8L 4LSRH 3DYOA 1MWAB 3MZTA 2VDNH 4XPFH 4LKXB 3Q6GH 2YPKB 5KZCB 1ZHKB 1Z9MA 1I9JL 5FOJA 1J87A 1B6DA 1OVZA 4OZFA 1KOAA 3GSWB 5FGBA 1U3JA 4HJGA 3X12A 2GSIA 5B21A 3VFWB 1KPVA 3BOVA 1S9XB 1GPOL 3BAEH 3DVFA 4KTEL 3WJLC 1J1OL 5TPWH 2FGWL 4HUWB 2FATL 2VSDA 3WNNA 4NRYA 5FYJL 3ARXA 1BF8A 1ZEAH 2VAJA 4NKMA 2VZ1A 4LLWB 5E94A 4GLRH 5MENE 4R97B 4HLZG 4ONGL 4YK4B 4I5BB 4PJBF 3ARFB 3TN0C 2DQCH 5T3ZH 3H0TB 3PHOB 2AABL 3HKFA 3D2UA 4WO4A 1WT5C 3JBG7 4RRPG 2VDKL 1BD2D 1AI1H 2MNUA 3EHBC 3VA2C 5EC1B 4U49A 3O3DA 4YHKH 5GGVL 1X5LA 3EDKA 1KCUL 1DEEB 4ODWA 4R7NA 3MLWL 3QJHA 4JZNB 4IRSD 2LAGB 1VGKA 4NT6B 2APVA 4X5XA 3TFKD 2Z92A 2CUMA 5MEOB 3BN3B 1ZT1A 4OB5H 3CLEL 4KZDL 1FN4A 3HN3A 5C0RL 3HNTH 2ZCKH 1MJJA 1P7QD 2NW2B 1UM5H 3EOAB 4PJEF 5FCSH 3TNMA 2GJZB 1F90L 1HIML 1VPOL 4PRBB 4ONFL 5C3LD 3H9SB 3VDBA 4QRRA 2J4WH 4I3RH 3ZZ1A 1TZIA 2VLRD 4BFGA 5I76A 1W0VB 3OKKB 4WY7L 1OPGH 1BQUA 4MNHA 3K8MA 5HGHB 8FABB 4JHAL 3SDXB 3STBA 5EORH 2VL5A 1YN6A 2RJMA 3T3PF 5GS0H 4OZIB 4C54A 1XFPA 3R1GL 4XVSH 3SGEI 3QA3A 5E1AA 2A9MH 4DW2L 4M61B 4PB9L 1GHFL 2HJKB 3WJLA 1GGIL 1NCBL 1KJ2A 2MMXA 5IFAH 1IQWH 1CG9A 4K7PX 1LO0L 2VB5A 4QF1B 3GMOA 5C09E 4K7FB 3BGMA 1QRNB 5TDOB 5DT1L 4MJ4A 1ZVHA 4Z5RA 5L7XL 4H1LB 3U30B 1YEJL 4NUGL 4RBPH 3OX8B 2VH5H 1AQKH 4CMMA 4NKDB 3TN0A 1J0ZA 1I8IA 4ZUSA 1K5NB 3QUZA 1WT5A 5E8NB 4LAQL 3IDUA 4OGAC 3KPQA 3MO1B 3WKML 4PTUB 2CUHA 2AJXH 7FABL 1FORL 5T33H 3MNWB 1LE5A 1T1ZA 2JTDA 1BAFL 4Z7QF 5D7IE 1MHPL 3IT8D 5L2KE 2EKSB 4QHUA 1KXQE 4UOJA 1PG7H 5DK2A 4AL8H 1AO7E 3TV3H 4L3CB 2OL3H 1OF2B 2XXMB 4YXKH 6FABL 4ZPVA 1E4WL 1EAJA 1RZ8B 2YPLD 5CJOH 5LGHL 2ZNWA 2DI7A 1HE7A 1IEAB 5A2LH 3TJHD 2ORBH 2WNGA 2BNQB 5C9JB 1JNLH 1J1XL 3TZVC 2E9WA 3H6JA 4F3FB 3MOBL 1YQVL 2CK0H 3MLSL 4WEBL 3UZVB 2FD6H 3W82A 2MKWA 5JMOC 1IGYB 4GAGL 5M7QA 3KR3H 4M93C 1RZFL 3I50H 1UACL 4KQ3L 3IKKA 3QEQE 3D39D 3ARPA 5E5UB 2HVKA 3UZQA 4RDQF 2BSSA 5ICZA 1UXWA 1DUZA 3GDBA 3B9EA 4PJ8B 3CUPA 4OSUH 4P23C 1IGCH 3SBWC 4FP8L 4RGNE 2E7HA 7CGTA 5I1AA 5J1TC 1Q0YL 4MQXC 3K2UL 3QG7H 3ROLB 5E2JA 5J1SC 4RDQG 5IB4B 5IMLB 2VZUA 1KG0A 1UENA 4U2YA 5EZOL 4JFZL 4HHAA 4PJCF 4WHTB 2OI9C 4O4YH 5HGAB 2FEEI 1KJ2L 1RZJC 1NLBL 2OJZH 1YMME 4J3SA 1T0MB 2V5TA 4HXBL 4G6ML 5DJAB 4CL7A 4N90D 5I1EL 2FR4A 4HZLB 1Z5LA 4Q7DA 3T08A 4Y2DB 5DFVD 3QDGA 3I6KA 2QLVB 3CFCH 4X6DB 3I02A 2XZQL 5D1QC 5I8CA 3QUMH 5E00A 3W9EA 5LKNA 4KI5E 1WCBA 5E2WH 2AERT 2K7PA 4LCYA 2ADGB 4KROB 1BZ9B 3RY4A 3DUUA 3U46B 4JY6A 3PABA 5GGRA 2LU7A 2XQYK 3ULVE 5E08H 1P6AB 4ZAKC 3OZ9L 3BXNA 3EGSB 4U3XA 5GGTA 1CICC 5I1JH 1RIHL 3HG1B 3B9DA 4GW4B 1BOGA 1HI6B 4S1QH 4QRSB 3IKCA 1X5JA 4JFXA 1CDBA 4NQVB 4JKPL 5DD3L 3WN5C 5EU6B 4H8WL 2BZDA 4HW6A 2IPTL 2CKBA 4KXZH 3FONA 4XVUD 4NBXB 4D94A 1DQQA 1EUUA 2DKUA 3L5WA 2V17L 3DSFH 2HJLB 2JF1A 1RK0B 1A1OB 5EOQL 4OUUA 1G9MH 3SBWA 4X98A 3RVUC 4ZFFB 5IR1B 1YUHB 5ESAA 2H3NB 4Z7VA 1N3NB 1T03H 1EMTL 4EI6A 3LKQB 2QADD 3QNZB 1MPAL 2VITB 2YWYA 3H2WA 2F54B 5HYJE 2X2YA 3SDXF 2O5XH 3LAFA 5JQ6L 1Z0NA 1BM3H 3Q5OA 1BBDH 1GGCL 4IRJA 1LP9E 1AXIB 3CCHA 4PB0H 4PRPD 3ZL4L 2FEDD 3HC3H 4PRAB 1MCNA 2QQKL 4HZAA 3QEGL 1NCNA 1QSEB 5HPOA 3X13B 4FQ1L 4WI6A 5CCKL 5ADPH 1UYWL 3EO9H 1IAKB 3V4PL 1UWXK 5I1IL 2AV7A 2W0LA 5E1HB 3NIFE 3DO7B 2VO5A 1WAAE 4QHMA 35C8L 2GK2A 4HX1A 3KPSB 3J8F7 3SGJC 3HE6C 3MLTA 4TSBH 1IZKA 4PV8B 4H1LG 4M5ZH 1QNZH 1YYMH 2PKDA 1CICA 4HJGB 1RJYA 4LLAA 3X12B 2GSIB 2ADIB 4P2RE 5I1GL 1F8TH 1CTOA 5I73B 2PXYC 2PYFA 3TO2A 3P0VH 4QHNA 4HFWB 3QDHA 3QNXA 5HYEA 5I1KL 1ZA3B 4IIQC 2GCYA 2D3VA 1NJ9A 5EWIL 1A5FL 3T3MF 4E0RB 3MXVH 1T3FA 1TJHH 2A6IB 5E94B 1OLLA 2WBJD 5HVGB 4HWBA 4PRHA 4MDIA 3U4EA 4ZTPH 3B3IB 3ROOB 4NQDE 3VXRB 3C8KA 3CC5A 3PF2A 2HLFC 4XCEA 5E9DE 1LEKB 4NC1E 3D2UB 2CKBL 2ILLA 5D6DC 3ZTJG 1ONQA 3LDBC 1UWEL 4GXVL 1URLA 3VXQB 4MA8H 4N0RA 2GTWA 2NR6D 4ODWB 3O81A 1QTYT 4R7NB 3QJHB 4HH9A 3LQMA 5IOPA 1VGKB 4NO0D 5DJ6B 4PY8I 4X5XB 1A3LH 1AD0A 1H8NA 2GW5A 3BDYH 5E4EC 5I8EA 3VFPA 3S6CA 3T0DA 1J5OL 1MJJB 5EPMB 2QBWA 1RZGA 4LLMA 3N1PC 4Z0XA 4KGLA 1RZJL 2OZ4A 1QEWA 3D25B 3C5ZD 3T09A 5CLWA 4ZS7H 4KJQD 2AJUL 1XMWA 2OQJA 4OLZH 2Y06H 1BBJA 5ABDE 4KV5E 5EC2A 2P5EA 1GOHA 2I5YL 4DGVH 1MFEL 3WCYA 1B0WA 1MIML 2VL5B 1YN6B 3SGJA 3HE6A 3AM8C 5I75B 2NX5A 4EN3D 1T7ZA 1BVZA 4G6KH 3QA3B 4F58H 1PKOA 4X6DF 4Z7OE 1YJDL 5D2LA 1OP3H 1I3GL 1GZPB 2PXYA 5FHBL 3M07A 1CG9B 3UJJH 1S78D 4IIQA 4PJ9D 3GBML 1IEBB 3IFPA 4J6RH 3BGMB 1UCBH 3IRZA 1NC2B 1I7RA 4Z5RB 2X1PA 4YWGL 3LEYH 2VUYA 4LSUL 4JY5H 5CUSL 4QKXB 1VGEL 2OTUA 4DJMA 4K7PH 5JW4Q 1I8IB 5JDJA 1QR4A 4RMWA 2CH8A 1F4XL 3AMKA 3QUZB 4WJ5A 5D6DA 5EN2A 3H3PL 4AEFA 1M1SA 5HSFA 3GMNB 4N0FA 4NP4H 5IEKB 3V95A 3KPQB 2FX8H 1PZ5A 5CSGA 4HWBL 3TCLA 5GHWH 2FX7L 3SEPA 4BQ9A 5F1IB 1LE5B 2BERA 2DQJH 1S8DA 4LCWD 3V5DB 2R2BA 1T1ZB 3T2NL 5ISZA 4OZGE 3DBXA 2VLKA 4HK0A 3GK8H 4JO1L 4LPCA 5DK2B 3SDDC 4JFFD 3CX2A 3H42H 4XNXH 1NPUA 1FG2A 1BVKB 3DECA 4ORGB 3L3IA 3QUXB 3IFLH 5GQBA 5E8OA 5TGBA 1INEL 4LPVA 3M17B 4LSVL 4R0LB 4S2SB 3K80A 5TDNA 3ZE2E 4D0DA 5BS0A 3WXVL 1N6VA 2GY5A 1BJ8A 5T3XD 5GS3A 4C4KO 4KKAC 5FYKD 4M48H 2OZ4L 5KOMC 1FNLA 4IM8A 4R96B 3VI3F 3AM8A 1T66D 5KSBF 4RAUA 5CZVH 5INDB 4OCRL 2YRZA 3SKMA 3UAJD 4XAKE 3BH9B 5FM4A 3WIFB 4Z76A 1UKSA 2F58H 2BVEA 1DUZB 3ZE1E 3KWWB 32C2A 1NLDH 3H8NA 4ZFGL 1FYTD 1ZHNB 1NAKH 2DJ4A 3AREC 3H3BC 3JV6B 5EUOB 4LLVB 1INDL 1KG0B 1NCAL 3LKPA 5T5NF 2OJEB 4HHAB 3DXAD 3QNYB 1OAZL 2A6KB 2E8YA 4V1DA 5ENWA 1NAMH 3RWFA 4LHJB 2WUBL 5GZOD 1LO3H 2FR4B 1RHFA 5T5NG 1RFDH 4YHYB 1MFCH 4I13B 4IMLA 2JCCB 4F7TB 3OR7A 3I02B 3VD7A 4EUPB 1CK0H 4P4KC 3DOSA 3G6JE 4QRPE 5I8CB 4P2OC 1W72H 5ACLA 1XR8A 4WU5B 1HH9B 3WFHB 5L8KB 5C08D 4G7YH 2FCBA 2ICWB 3G5ZA 4G43A 1DVFD 1TXKA 4O2FA 1B2WH 3KLHC 4LCYB 3RWCA 2YD8A 3UX9B 3DUUB 4JY6B 4JR9H 4OZHF 5SWQB 4GW5A 3QDMA 4UDUB 2EE6A 4TNVK 4XBPB 1S7VB 1QYGH 4M43L 5MEQA 4PJEA 1ZWIA 1MY7A 4C83A 5J13C 1G7PA 4Q9RH 1A4JA 5DVOA 2A2QT 4JFXB 2W9DH 1WFTA 5KN5A 4NGHL 4BZ1H 2VSCA 2H45A 1DL7H 2CKBB 3OKMA 4U6YA 1YECH 5IBUB 1DQQB 2F8OA 5F7EL 2IBZY 3BGFB 3GHEL 3UPCA 4N8CL 4OUUB 4X98B 3WDIA 5I1CH 4AY0A 1A9BB 1JRHL 3IJYA 4J3UA 3AREA 5E8DL 3L3HA 5BZWA 1MCKA 5L9DH 5IIEB 3MLRL 1MCQA 5ESAB 3GSOA 5D8JH 4KJPD 2I27N 4PIRF 3TBWB 3GKZA 5E70A 3P30L 4O9HH 3ZKMC 3SCMD 1MOEA 1PJ9A 3QHTC 4AIZA 1P1ZB 4IRJB 4HIIB 1JNHB 4F7EB 1VADA 5FECB 1G6RA 3U0WL 5E2VH 4NQEA 5TE7H 5KSAD 1UZ8A 2L7JA 2RBLA 4GRLD 4OI8A 1GH7A 3ZKSD 4A2LA 3WIHL 4YHIB 4P4KA 5I6XC 3CFKA 4M5YL 2BXYA 3UYRH 5IBLD 3PWPA 4P2OA 4S1RH 1G7JB 1RZKL 2PYEA 3EYUL 2XICA 1SYSB 3P0YH 2DAVA 3FRPG 3GKWH 3KPRE 5GRUH 5EU7E 4E41A 3HE7C 4QHMB 5E2TH 5B39A 3GB7B 5KJRL 2GUOA 4CUCA 3MLTB 2OXGA 3VCLA 4X6EA 3BT2L 3DUHA 4M62H 3MV8E 3EJYD 5T1KA 4K3JH 3C60D 5IGXH 1RJYB 5GJSH 4LU5L 2B5IB 5K9QI 1X5YA 4GG6A 2PYFB 3KJ4C 1FV1B 1G7LA 3F58L 4L1HA 4M8VA 4G8GE 4ZD3L 1XIWC 1AQDB 1EGJH 1CWVA 1JTOA 4P2QA 3FB5B 4Z95L 3TO4C 8CGTA 1T3FB 4W6WB 3ZMRA 1JI1A 4LSDA 1G84A 2G75B 2Z8WC 4HIJA 3U4EB 5A40E 1UH4A 1ZV5A 4Z7WE 1YEHL 4I9WD 2JJUA 2UV3A 2NZ9C 2P47B 3OKEB 4XCEB 2AJZA 4JGMA 1Q72L 1QO3A 5I8KH 1D5ZA 1DQDL 2E27L 5E4IA 2E7LA 1SM3L 3CFEB 2GTWB 1JMXA 5ESQB 1MNUL 4KKLD 3BMWA 5C0AE 4L5FH 5IOPB 5EBMB 4NHUA 3T4YA 1AD0B 2E8ZA 3MRLA 2IPUG 5J4MA 4Y4FD 3TM6A 1EIBA 1UGNA 1YY8A 4FQCL 4H5SA 4LLMB 3WNPA 1I9RH 4XP1H 3VXPA 4Z0XB 2FL5A 4AEHL 2AXJA 5EFIB 4N9OB 5EUOF 4RFOL 1JN6A 1G6RL 4HC1L 3LPWA 2HTKC 2OQJB 4HAFA 4M4RA 1BBJB 3ZYJA 2ZCLH 5IHUH 3CH1B 5L8JB 2P5EB 1I9IH 5I15L 1TTFA 4HF5H 4CVXB 3CXDL 4JRYE 4X4MA 3ZKXB 5C8JB 4U1SB 4PBVC 2VXTH 3KPPA 5SV4A 2NXYD 3MRIA 3MRJA 3VG0H 2BSRA 4YFLI 1WEJL 2EZ0D 4QRUB 4OM0H 2JCCF 3C2AL 3O2VL 4YC2B 3HNSL 3QIBA 3KNBA 1S9KC 2R0KH 4S0SD 1I1AC 3ALWA 3NABH 1J8HB 2FLBT 4BQ8A 2D31A 1A7NL 3IFPB 4D0CA 1AKJA 5HTSA 2EYRB 3TA3B 2K3TA 3S97C 5A43C 1J8KA 4OQTA 1HWHB 4PJXB 4M6OL 2N4IA 2OTUB 3FO2A 4NJAH 2ITDA 1SVZA 4WJ5B 5EN2B 4MNQA 4N0FB 4L4VE 4WENB 1FH5H 2OTWB 2QHRH 1OGAA 5HYQB 2J88H 5MP6H 3QI9D 4XCFH 3MRDA 1YC8A 1ZVSA 5J9PB 2MQCA 1NCCH 2VDOH 4PLJD 4JFDD 5HHOE 2DLHA 5DVNA 3O2DH 4NO3A 5C07B 2BOBB 4KHXL 3QCUH 5FO7B 2ZUVA 5IF0A 1HQRA 4I8DA 3G6DL 3TT3L 3EDEA 2EECA 5E8OB 5TGBB 4DCQB 4ZS6C 5IBUG 4RFNB 5ALCH 1A6WH 3PGFL 4CN1A 4D0DB 5BS0B 3WKNA 4HKBA 3ALXA 3DV4A 2AQ3A 4MLIA 3T77B 3U6RB 4LNRA 5C0DA 3OJDB 1IKFH 1W8OA 2R0LL 4YHOL 5K9JH 1OT1A 4P9ML 4LSQH 1JGUH 4U7MA 5FYLL 5KW9H 2NY0B 2A73A 1EEYB 1OAKH 4IOIA 5IQ7H 3WHE0 1XGQA 4FFYL 1CDHA 2NNAB 4G6FD 2P24A 5LCVL 1I1AA 5AEAA 1JWSA 2GQHA 2AV1B 2HKFL 4IHOA 4K3DL 3V0WH 1A1MA 5TE6H 2IBBA 2R39A 2WW8A 1OTUD 5GISH 3B9KD 4M9OA 3HB3D 5DJYB 3BH8A 3QFDA 3BP6A 4MXWL 4D3CH 1Y6NR 1T6WA 3IDIA 2YUZA 3U0PA 3T04D 1RZIB 1R5VB 2E6JA 4RMSA 2A74A 3RWFB 4QNPE 1NBVH 1CXLA 4R26L 2QEJA 4HT1H 1AGCA 3SQOH 1BGXH 4K94H 1QBBA 3TEUA 2H32B 4KHTH 3TVMA 4OQTL 2BY1A 2G60H 4ZXBC 1JI2A 1IAIM 4L9LA 4ZYKA 1XR8B 4BA8A 4WI7A 3GMMA 3G5ZB 3MQIA 4G43B 4YDIH 4O2FB 2EXYD 3RWCB 5LWYH 2DQIL 3GGWB 3MMEB 3PQYE 4P4RA 2QSTA 2A9NH 3HMWL 1BQHB 2UZIL 4GW5B 5F1NB 3NZHL 1NKOA 5E8PA 3QG6B 2D9CA 4WFEE 4FZ8H 1HHKB 5MEQB 1GGYA 1GIGL 12E8H 4X7SL 2MQ3A 5IVZA 1VDGA 5FA4B 2V2TB 5J56B 4JGUA 5KN5B 4TVPD 2UYLA 3RNKA 3BFOA 1JWUB 3QFJD 4YDLB 3OKMB 4WV1C 1FG9C 4YE4L 5ALBL 3JVGA 1CF8H 2DMBA 1OAQH 4WVRA 5ADOL 1U8KA 5IB3B 2WUCL 2CO6B 4KUCF 1V3KA 2X7LA 4FXKB 3IJYB 3OMZA 2JIXA 1T1XA 2P48B 1P4BH 4O58L 1Z2KA 2GSGB 2YHGA 3L95B 3GSOB 1JK8A 2M26A 4GKSA 1G9NC 3SDAA 4XP4L 2AJYL 1TIUA 3BKJL 3BX7C 3QULA 2D0HA 4Y5VA 4M7JH 4AIZB 4I0PC 2ESVA 2MQ0A 1NCWH 2Z9TA 1G6RB 4NQEB 3P9MA 1MCLA 2EDTA 1CL7I 5JW3L 1CQKA 1UM6H 2FX9L 2ERJB 4PG9B 3VXMD 3RWGB 3BKYH 4P2OB 2GJ6A 4U1JA 1X4YA 4RAVB 4H88H 4HPYL 3HI6H 2BVOA 5A2IH 2MCPL 4FTVD 3VXUA 4D0BA 4KRLB 3LN5A 3MLYL 3EW3B 3IAQA 5B39B 1JZ3A 5K59F 2GUOB 4Z8FH 1MAKA 5DMJB 4X6EB 3VH8B 3VMNA 3WEXA 4E42B 4KAQH 3IF1A 3RVXC 5BRZD 4LDOB 4Q0XL 3T65B 1I7TA 3QQ9D 2CRIA 1ZT7A 2GIYA 4B7LA 1KELH 1YEGL 1OP5K 4GG6B 1N0XL 3BN9D 2XTLA 3JV5A 2B7DT 1NC4A 4MJ6B 4P2QB 3A6CH 3SGEH 4JFPA 4PJ5D 4OF5A 2OS7A 3IU4H 1WZ1H 3CLFH 3NCMA 1FAIH 2PW1A 2ATPB 2X10A 4CNIA 3X14B 1IGTB 5D1ZB 2QSVA 3MCKA 4HCRH 4WWKB 5HD8D 3ZHDA 1D5ZB 5D2NC 4TN9A 4NUJB 4QTHA 3O4LD 1S7RB 3J7HA 3K74B 1OW0C 1PKQA 4OIAA 3RZCD 2C9AA 3HNVH 4NQTA 4TQEH 3MX0A 3LV3B 3KXFE 3GJFH 5ILTH 4DOHE 1RURH 2XI9A 2O5YH 5DDHB 4CMHC 5J11B 1EHLH 2ZKHH 3T4YB 2VDML 3MRLB 3KPTA 4GMTL 2AQ2A 5MI0C 1ZS8B 2Q86A 5IM7B 1FLRL 2DWEA 1ZKAA 5JMRA 3O9WD 4UQ3A 2Q8BL 5DWUH 4C56B 4H5SB 2V5SA 4U3HA 3JTSA 3S35L 5DZLA 2W1NA 4NJ9L 1KCRH 2FL5B 3QQNA 1GXEA 5GIRA 2I9LB 4NN7C 2C4FU 3ZTNL 5CD5C 2IADA 1LE9B 4U31A 3MLVH 2DQUH 4C55A 1T7VA 4HT1L 1NSNL 4FOMA 1ZXQA 4XPAL 1P7KA 4YHZL 2VISB 1ZTXL 3O41B 2XG5A 5IB1A 3MRGA 3BUYA 3T0BA 4QRRE 3QWOA 3LD8B 1ADQA 1R24A 2N7AA 4RWHA 5H2BA 4NQDD 4BSWA 1MRDH 2JELH 3MRIB 4NOFA 4PRID 4J4PA 3QXUA 3TH4T 3MGTA 1FL6A 3W5NA 1EAPA 4GXUN 3D5OF 3QIBB 4R8WL 1Q0XL 1DQML 2O5ZH 5F7DA 1XGUA 5CJXC 3QZWB 1BZQK 4D0CB 1VCAA 2CR3A 1XR9B 5CWSA 4DVRH 1IM3A 2W9LA 1TZGL 4Q6IC 3OF6D 4U1LA 1OTSC 1EFXD 3BRDA 3EO0B 3C8HA 3SPVA 5DURD 3STZA 4AYFA 1D5MA 3UPAA 2AVGA 4KTDH 3KPNA 2ITDB 4K2UH 2DTML 1T1YB 2YK1L 5FKPA 3WD5H 1XF3A 1T20A 2DD8L 5JW5A 1JYVA 4TRPH 2MOVA 1XGTA 2V7NA 4MVBD 1BQHG 3FQRB 1OW0A 4Y8DC 5H94A 1X4ZA 2GT9A 5IW3A 4XTRD 4U7SA 3TBSA 2VXUH 3MRDB 1N6QH 5F70A 4JRXD 1KN4H 1U0QA 2EC8A 2VNCA 3RL1B 3JUZA 5DRXB 1B0GB 2CIIA 1FBIL 3IXTA 4OLWH 4XPBL 3LKNA 3RKPA 4E9LA 4G6JL 2HA1A 5IG7A 5IF0B 4PJGA 3BO8A 1FL5A 3GIVB 3LEVH 3LH2H 1RIVL 4OBRA 2DLGA 3RGVC 5F88B 2EH8H 4RGOL 5D7JB 3BD5A 1NCUA 4P46C 3VE0B 3WHXA 5JW4R 2NPLX 3QQ3A 5EBWA 1P4IH 1TETL 5CGYC 2Q20A 3DV4B 4K7PY 2H8PA 2IH3B 3IU3A 1GGTA 3S3JA 3IDYC 4LNRB 2XZAH 1RVFH 2NY1B 4XWGH 3RVVC 5I1DA 1UXSB 4QHKI 1AXTH 4X9BA 1V05A 3CSPA 1KENH 1MREL 2PR4H 4F15B 4XHJD 3JWOH 3UTSD 4GG8A 4PREA 3HZMA 3PWJA 4Y8AA 4AG4H 4PJ7A 1U95A 5CJXA 2P24B 1G9EA 4IHOB 3R8QA 5BQ7B 1H5BB 2QSCH 1MCFA 1QBLH 9CGTA 5KVDH 2C26A 3DHMA 4XNMA 3QFDB 3BP6B 1KIUA 3U0PB 1LDSA 1CXKA 2A74B 4OGYL 1JPFA 1VEPA 2X89D 1ZGLA 1AGCB 3WS3A 2MPAL 1DUYA 4PJAA 5JHDA 2EEDA 4ZUUB 3TVMB 2IAMB 1U3HC 1MI5B 3RUGE 2IANE 3MV9D 1BEYH 3VH8G 3RNQB 4L9LB 4ZYKB 3MRNA 4MXVF 4Y89A 4PGZA 3GMMB 1N7ML 1EJOH 1BFOA 3QDGE 1PSKL 4UB0L 4BKLA 3CD4A 5AD0A 4PJIE 3ARDC 3AS3A 4P4RB 1B3JA 3E3QC 4G8IA 2W0FB 4F2MB 5HYIA 2LU3A 5E8PB 2H2SC 1RK1A 5HI5C 3ELAT 3RGVA 2HRLA 2Z93A 3L3OB 4P46A 3O4OB 1NFIB 3O6FB 4I3SH 4QOKD 3B2VL 5DQDH 4FMKA 4G9FA 3D85B 1KEMH 1QSZA 3CFBB 1XF5A 2UYLB 3RNKB 2DF3A 5DMGD 4MJIB 5JXAH 1F3RB 2BVYA 4JN1H 5CEYB 3FQXB 2R0ZL 2F53A 5K33A 1U8KB 5MHSE 3GMPA 2I9TA 2HVJB 1HKLL 2WV3A 1U8HB 3P4OA 1PFCA 3CVIL 2NY6D 2KZWA 5CILL 5FM5O 3QJFA 4HK3J 1T1XB 3LMJH 2WLYA 4GAJH 1MCOH 4NPYA 1JK8B 4GKSB 5D6CA 3SDAB 2LV4A 2DS4A 1MCWM 1AGEA 4GAYA 3EYQD 2DI8A 3EYSH 4YPGB 3RJDA 4Y5VB 4JY4A 1JYXA 2D4FA 4XCYA 2Z35A 3HUJA 4Z7VE 1PGRB 2NW3A 3C8DA 5JO5B 4FA8A 4U1KA 2DQTH 1Y0LA 4WDIB 2P5WB 2FHFA 1TTGA 1CLZH 2O61A 2OL3A 3T0EC 1U3HA 4UDTB 2MCG1 4MAYB 3DX9A 2LTQC 2JE8A 3B4NA 3P9LA 4EOWH 3NIGF 4OF8A 2H2PC 1DLFL 1NGZA 3PWUA 5I9QB 4XMKH 3QIWD 4PJFA 1WFUA 5SWZA 4YQXL 2DQHH 1RUPH 1I1RA 4DGIH 3VXUB 4D0BB 1WC7A 4N8PA 1TCRA 3QZWG 3ARDA 2NY2B 4FFVD 5IJVB 2Y7QA 5CEZL 3CDGB 2Q8AL 1NBQA 3HRPA 4JZOB 3O6MH 1PD6A 3WEXB 3JWDL 3JWNC 3D48R 1JFQL 2EE2A 3QISA 1ZT7B 4OFYD 3WFEH 3NAAL 5KBNC 1R3IH 4U1IA 3MLZH 3NCEB 1G9MC 1Z3GH 2AK4A 3ZKNC 4YBQD 1ZA6A 4NWTH 3SDCC 4EI5C 5CKAA 1NC4B 1YEEH 1NGPH 1P7QB 1R0AH 2NCMA 43C9A 3MRFA 2Z31D 3EO1B 4PGCB 2B2XL 3JV4A 4CBPA 4LLYA 4FQXC 3O11A 1LK2A 2BY3A 5DD5L 2VLRB 5T3XH 5FYKH 4OLVH 4PRHE 3ARBC 4QTHB 2AI0L 3QH3A 5DUBA 2WAHA 3BWAA 2CXGA 1PKQB 3W11C 4HMCA 5SWSA 4UT7H 4BFEA 3QUMA 3QCTH 3KG5A 3SO3B 1Y6KR 2YD5A 3RWJA 3UEZA 2X4OA 3ZDXF 4MMZC 4L3ED 2YD9A 3KDMB 2Q86B 3GUTA 4AM0B 5IEHA 4D9LH 2GI7A 5JOPD 5IQ9A 4HIHA 1B0RA 3BPOC 4HKZA 1PVHA 2XZCH 2OK0L 5IESL 1OAYH 1T0PB 3P73A 5KZCD 1J10A 2H41A 2IADB 1S9WA 2W92A 5A1AA 1JPGB 1E6OL 2VDRH 3QDJE 4M1GL 4RFEA 2AW2A 1P7KB 5C0EB 4I18C 4OUOA 5GRYA 1FVDA 3BKMH 3LN9A 5KVGL 2B4CH 3BUYB 3F62A 4HKJB 3QCVL 4YDJA 3QWOB 3QIUC 1R24B 4IRZH 2DLTA 4WFHD 3UJIH 1K85A 3T8XA 5LGJB 4UUJB 1FL6B 1MFAH 3Q2CA 4PR5A 3ETBF 5GSRB 1LO5A 2A6DB 1RMFL 2NX5E 1A4KB 1CBVH 2I60L 3ZDYE 3ARFD 1Q9KA 1A47A 3SDCA 1HSBA 1IM3B 1J9CT 5ANMA 4MDJA 4GFTB 5D2LE 4H26B 4U0RC 3D1MC 1IAIL 2O26U 3OWEA 3RHWF 1QFOA 5KAQG 2J8UB 2R2EB 4FQXA 4NKQB 5GGQL 3RGHA 5CAYB 1M6OA 1FGVL 3V9FA 2G5RA 1JZ8A 5FKPB 1NCDH 3ULUE 1SBSH 1OTTC 4ELMA 3FFDB 3D18B 3ARBA 1RHHA 1KNOA 1XGTB 2V7NB 3QAZC 1TQCC 3JZ7A 3KYOA 4I3GA 3K4ZA 1AXSB 1JGEA 1MJ7L 2AJSL 2G9HA 5H94B 3WL9A 4MD5A 1QLFB 1AHWC 1BJ1J 3HI1B 4HIXL 3GJFB 1U8PA 3WO4C 1DQJA 1IBGH 1S7TB 3H9SD 2VLJA 5HXMA 3WXWH 3D0LB 1MF2L 5F89A 1F02I 5J0BA 3IXTB 5F7LB 5HPMA 3LKNB 5F9AC 4GKNA 1ACZA 3MA7B 3S37X 1NKRA 2YA2A 1KGCD 2YPVH 4PJGB 4H0GA 1FL5B 2V2WB 1K3ZA 4TTDC 4NNXA 5ISZE 4Y1AB 4PJDF 1WFNA 2VLKE 4LLUA 5F3BB 5FIEA 4S1DD 4LIQH 1KCLA 4NN5B 4MX7A 4AQOA 5IMMA 3QQ3B 2ZOLB 4I18A 4GXUM 3DRTB 3BHBA 3PWLA 4PJHE 1RPQA 2H8PB 2Y07H 3IU3B 4X0KB 1X5XA 3WS6A 5BO1L 6CGTA 3AC0A 4BQ6A 5EU5A 1KPUA 4OFVA 2VXVH 3MA9H 2HFFA 1QRND 2MTPA 5IVXF 3MRRA 3O2WH 3P9WB 3VFSA 5JW4N 5IUSA 3QRFM 4MQSB 4RGMB 3HZMB 3PWJB 2NY4C 5GRXG 3MRQB 4N0YH 2HT2C 1XGRB 5C6WH 4MLSA 1GZQB 2QQQA 2W60B 2DKSA 1EVTC 3NCJH 4WFGE 4XNMB 4KJWC 1U6AL 2OSLB 1A3RL 1BMGA 1Q9WB 4LEXL 3FAXA 3VW3H 1CVSC 2D03H 4DUVA 4NM4L 3MUZ1 4TUKL 4OIIL 5JHDB 3GM8A 4L8DB 5J1AB 4V1DE 3MJ6A 3FT4A 2CIKA 1JNNL 5E2UH 3GSVA 1EDQA 5AYUL 1AHWA 4HS8L 3MRNB 3R06B 3RHWK 4LSPL 1BFOB 4PJBE 4BKLB 1U8JB 5F9OH 1A6AB 2BNQD 5JXED 2JJWA 2P8MB 3NA9L 4JM2C 3OAUH 4G8IB 1MHEB 2VZOA 4MQ7A 4XMPL 5DS8A 2N7BA 1MFBH 2EYTA 1YC7A 1DBJL 4NYLB 2Z93B 4IDJH 3NIDF 4IMKC 1ERNA 2HJFA 3PWNA 1I8KA 5FB8B 1U3ZA 3QDME 2AAVA 4ZODA 3V6ZB 3GSNA 5BVJB 2DL2A 4QT5A 2EDLA 3B83A 4PJ8D 2XRAL 1NUGA 2X4NA 3IDYB 3IDNA 4WHCA 4LP5A 4ENEC 1YPZF 3MBXL 2FRGP 4PJEE 3BPLB 2D7TH 4PP1D 1FCCA 4CVUA 1I9EA 3RTQC 2ED9A 4NN6C 2SEBB 2YD4A 4ALAH 2KZ1B 3MV7E 1UC6A 1EPFA 3S9DB 5GJTL 3P4OB 3OR6B 3QJFB 3NFNB 3U7WH 4BQBA 3R4DA 2BVQB 5FF6B 1YEIH 3PL6D 1Q1JL 1F4YH 4NPYB 3T3PE 5FGCE 4Y2DD 3RU8L 4YHNB 3DMMD 4GAYB 5I1HL 2VC2H 3MACL 3HR5A 4RISH 2DWDA 2VIRA 4KK6D 3HI5H 4AZ8A 4JY4B 1WV7T 1UFUA 4CW1A 4H25A 1RZ7H 4L4TB 1CLYH 4ZO9A 3RI5F 2X9YA 1ZK9A 2AEPL 1HEZB 4U1KB 1Y0LB 2DBLL 5SX4H 4NQCA 3QYCA 4BK4A 2O61B 2X4UB 3LRSA 3H9YA 1CFSB 4FXGA 4KROD 4LVHC 5EZIH 4HBCL 1QPPA 5DJDA 3MV01 4JFEA 3GM0A 5E99H 1PQZB 4PJFB 1DLHB 4U33A 5SWZB 5FYJD 5M95B 2WBJB 1K2DA 4N0UE 4PP2A 4E5XA 3MFFB 4NKIL 4AK1A 1FNHA 5D72H 1IRAY 1MQKL 4NFCA 1TCRB 2J8UF 4JM2A 3MRHA 3PWPE 4W4NA 3HG1D 5HBBA 1UEMA 2EDYA 4LHUA 4DWHA 1OSPH 4DN3L 1R3HA 3NN8A 3JSSA 3VXTB 2ADFL 2PYEE 2C3VB 1HK6A 5J12C 5EU6D 3I6GA 2XWTA 4OF7A 4IMKA 4I48A 2FECL 2V5YA 2NMSA 4Z7QE 1F58L 1KC5L 4NO0B 4XX1G 1IGMH 1U2CA 4JO2H 3VGFA 2AK4B 4DVBA 4NZTH 1ZA6B 1ACYL 1CE1L 4DEPB 3I2CH 5CHNA 1MLCB 1FRGL 2MWCA 4K07A 1CDIA 4OI9A 5DD0L 3T0WA 3RTQA 3FHQA 1IFHL 2N56A 5DLMH 3JV4B 4R4NC 3GSNL 3BRFA 3D9AL 3GRWH 5DVLA 3F6IA 3QWRD 2X1OA 4JFHE 3SE4C 3KAAA 3TYGL 1NEZB 1KSRA 3QH3B 5MENA 3BWAB 4APQA 2BNRB 15C8H 4N8VA 3TNNB 2FZ3A 5D1XC 1QSED 4HLJA 3RWJB 3BKCL 5H37H 1BWMA 3V0VA 4YGVB 3B5HA 4MXQC 3L3DA 3O8XB 5IEHB 3RY6C 2XXCB 2XN9A 2DM3A 3E2HC 1E4JA 3A67H 1K6QH 1B0RB 3PHQA 5DEFA 4AIOA 4PJCE 3P73B 3KPSD 1KLUA 4M6NL 1S9WB 2AXGB 2HT4C 5J7CC 2J6EH 3ZDZF 3A6BH 1RUQH 3VWJC 3OAYK 1K8IA 1NCTA 1CYGA 4Y7MA 5D5MF 2CRZA 3HLAA 4O2EA 4K9EH 5I1LA 1M7XA 1FVDB 1N2RA 1KEGL 4OFKA 3RX8A 5IFHL 3QUYC 3S36X 1C5BL 3WUWB 1FO0H 4RAHA 1J12A 2EDJA 2IFFL 4P49A 1CD1B 4HSQA 1D9KC 4NNPL 4TNWF 1A6UH 5AWNH 3UTOA 4X4ME 3LIZH 2A77H 4YBHA 4TUJA 1FZKB 3VXRD 3VFGL 1WBYA 1OARH 1HSBB 1IGIL 5F7MC 3BE1H 3D2UD 4JFFB 3LQAH 1NFDA 4M7LH 4QTIL 3MUGB 4ODBD 4WGVB 2R4SL 4ODUB 5IK3B 3EOBA 4LPWA 4YNYB 4JFOA 3PV6A 3TIDB 2XWBB 2V5RA 3FB7B 4AEEA 3BJ91 3SE4A 3RWHA 4ELMB 5C0NC 4GLRI 4TVPH 2C1PA 3B9VA 2YKLH 1H9VA 1RHHB 4XPHL 1KNOB 5FCUL 1JGEB 4O2CB 4BM7A 3KYNA 4HV8B 5FUZL 2R69H 1JGLH 2XZZA 1P9MC 3SOBL 4MD5B 1MCDA 5D1XA 5DHVA 4A6YH 4MNQE 3VFRA 1CFVH 3RWIB 2R0WH 5D9SB 3GMQB 4Y19E 1U8PB 3N06B 3ECBB 4FG6D 4QRRD 2BY2A 5J3HD 1OGAE 3RY6A 1J7VR 1J05A 3OJ2C 3NCYP 5JTWA 1EVUA 5D7KE 3MPCA 2KDGA 2ZG2A 3DX6A 2VDLH 4XRCA 2ARWA 5ITFB 2VL4A 3RAJH 3QXDA 3GI9L 3TBYB 5TE4L 5D7IA 3I9GH 1X5IA 3UXFA 4EDWH 3VWJA 4X7TB 5L2KA 1LDPL 2M1KA 2YC1A 3NACL 1G6VK 1UJTA 3KS0H 1XF2A 3IFNL 3UTPE 4UILH 2DM2A 3BHBB 3PWLB 3S37H 4P3WA 1HYRC 3C6LC 3DGCR 1ZLSL 4XB8A 2OP4L 1EGJA 4LASL 1KPUB 3QUYA 3SKOA 4M7KL 2HFFB 2WWMD 3MLXL 4OCXL 5D71H 5JR1L 4OT1L 3MRRB 1NC2D 3L6FB 4L1DA 5B4MD 1D9KA 2XTJC 1MFDL 5D96B 4UAOC 1K4DB 2VZVA 1FLTX 1BZ7A 2VE6A 3QEQA 4DN4H 1LNUB 3QUZD 3BEVB 4YUEL 5L88H 4RQQB 1IILE 4XPGH 3U4BH 3X11A 4FS0A 1KIRB 3IDXL 2HWZL 1A7QL 1HHGA 3UPRA 5GXBB 1LD9A 1M05A 3ILPA 4N1EA 3G5XA 2HT3D 2HTLC 1S7XB 4HWEH 1A02N 3KLSA 3OGCA 2IPUK 3O45A 1M7DB 5FA3B 3FT4B 3WUZA 1F3DJ 3FO1B 3GMLA 3WDHA 2EE9A 3FT3A 3OKLB 5BJTA 1P9MA 2FB4H 1AR2A 2FO4B 1YMMA 3GSVB 4WUUA 5D7LE 3TYFA 4G5ZL 5J8OA 3QBTB 3SE3C 2X4RA 2WM0A 5FAAA 1MAML 3MJ8B 5E0QA 5KVFL 2GK0B 5KVEL 5BVPH 2F74A 5I74C 3IETB 2ICWI 1ORSB 4MQ7B 5DS8B 3U0TA 1QSFE 1TJGL 5F9WC 3OKDA 3UZEA 2JJVA 4X4YA 5JIIA 1NQBA 4LOUD 2XA8L 4F37F 1D5IL 2GHWB 4ZNCD 1I8KB 4YDVA 4WCYH 4NQSA 3GSNB 5C0CE 3ZHLA 1FE8L 3C6LA 2W9EL 4RBPK 1FZOA 2EDRA 1JHLH 1NEZG 1MJUH 3MREA 1W0WA 4GRLB 4J3OC 4M00A 3CXHJ 2EDHA 4KPHL 5FHAL 3Q3GA 4RX4A 3RBGA 2EC9T 5HY9B 2D7NA 2JB5H 1ND0A 1P5UA 2VLMD 2P45B 1V7NH 5L6YH 3CFIC 1F4WH 1TTUA 3OQ3B 4TSCL 4Z18A 3KYMA 4K94C 5ACZA 4PPTA 4I0CC 4N5ED 1UB6A 1VACB 2DWDB 2VIRB 3CNKA 2RFXA 1UWGL 1T2QL 2R29H 1NMCC 4HJJL 3PE9A 4LPYA 4GH7B 4CW1B 1WIPA 5LBSL 2Y25A 5FDYA 4FQHA 4S10A 5DC0A 4KK8D 4PGBA 3L5XH 5LJYH 1HN1A 3NCYS 5DUMH 5DJXA 3D3VB 4HD9A 1ITCA 1S3KH 2P42B 3LRSB 5DJCA 1MIEL 2QKIB 4IRSC 1LP9A 4YBLC 1K2DB 4PP2B 4EIGB 3SE3A 3TBVB 4OM1H 3TFKC 2WSKA 2ARJB 3BZFA 4GW1A 4JM2B 3ZYIA 3MRHB 2GJ6E 4LHUB 1TPXC 4MJ5B 4NIKB 1X5FA 3B6SA 4X6BB 1HINH 2GTZA 2BMKB 4Y4KB 2FJFA 5MHSD 1U3YA 4ZTOL 1T83C 1UH3A 5JHLH 4JCMA 2X05A 4XAWL 3VGBA 3BPNC 3TESA 4YH6A 5DXWA 1KXTB 1I8LC 4QHLA 1NGQH 2I25N 3TH2T 1DDHA 3EYVB 4O02L 1GGBH 3BW9A 3LRGA 4XH2A 4HGWA 1GOFA 1RUML 1HZHL 1H0DB 1DBAH 3QUKB 1CZ8L 1RIUL 2FIKB 3ZSSA 5T1DH 1H3UA 3IFOB 4WRLA 4P2RA 2IEPA 1LK3L 3S8WA 1NGXA 2VXSL 3MRKA 4XP5L 3ULVL 4IRJD 3MJ7A 1X5GA 2V7HA 4M3JA 4M6MH 2PF6A 4D9RE 4HUKB 2CGRL 5C0FB 1Q94A 3MRPA 3VI3E 1DQTA 2DRUA 5MENB 1LEIA 4ZG1A 5KSBE 1FFPB 5KTEH 4APQB 4N8VB 1Y6MR 2EO9A 5EH1A 1E4KC 5BV7C 4P9HC 3NTCH 1T5XA 1DFBH 4OCWL 1YN7B 1XH3A 1BD2A 3PHQB 5DD6A 2VABB 5DEFB 5FKAA 4G8FA 2DDQH 1EXUA 5DJ0A 4ZUWA 5HDQL 3HC4H 1J0HA 3C09C 1NBZB 4IRSA 5IHZA 1QSVA 1KIPB 5KS9F 1I7ZA 4J12A 3O6LL 5I1LB 4S1SH 5ETUB 1NFKA 2VZTA 1JZ7A 2DLFH 1N2RB 1T21A 3V4VH 2ZP0T 2UVEA 5F3HB 1KB5A 5E95B 1TQBC 4MAUL 5IMOB 4RMRA 2WIIA 3JUYA 1C16A 4RA0C 1CDYA 1T83A 3QP3A 1GCFA 3LS4L 1WBZB 5DR5H 1I8LA 1IVLA 5HHQA 3MLUH 1H3VA 3MOAH 5CBEB 4ISVA 4TUJB 4JG1H 4TUOA 3C08H 4NDMB 1QA9A 5GGUA 4FNLH 4OZHE 5I0ZA 5F44A 2XA3A 4YFEA 3IDMB 2K1MA 4MCZA 1LO4L 3EOBB 2W65A 1OCWL 3AB0C 1IQDA 4D9QE 5GRJL 4HUVB 3CXHK 4XI5C 5C09B 3RWHB 4JQVA 5FFLA 1UADC 5DRZB 2B0SH 1BIIA 3PIQA 1MHHA 1SY6A 5CSBA 3UMTA 5DHVB 3VWKB 3VFRB 5D2NE 4KUCD 3EFDH 1CFBA 1RU9L 1S5IH 2QV2A 2XY2A 2BSTB 3GJEB 1U8LA 1P7HL 1J05B 5DFVC 2P5ED 4ERSL 1Z0MA 3RDTA 4IBLT 1RD6A 1A7RH 1UKQA 3ZKQD 4XRCB 3UBXB 2JJTC 2YMXL 3VI4E 2K9UA 2J2ZA 3HE6D 5D7IB 2OLDA 1I3RA 1IL1A 1IC7L 5L2KB 1FNEB 1R5IB 3Q6FB 3P4NA 2YC1B 2DQEL 4EXKA 4PS4H 1AO7B 4Z7UF 4JZJC 3VU2A 1JVKA 3DUSA 1BLNA 4QY8B 1A14H 4I4WB 3ES6A 2Q6WA 1J8HD 1UM4L 4YHLL 3SKOB 2YPLA 3DHJA 4NM8H 2BNUA 3TA3D 1NGWB 4KUZH 4QYOA 4BUGA 2EH7H 4MCYA 4DKEL 5J6GB 1JRHI 1SHMA 4DTGL 2PTTA 4L8SB 4LRIC 4OLUH 1T0NB 1KB5L 3AMLA 4MZ3A 3DARA 2VE6B 5EZLA 3QEQB 3PXHA 4HXAL 1T22B 1FFNA 1F6AA 4HS3A 1BQSA 5T3ZE 1BQLL 4XVUC 5HHPA 3QPXH 4MNGA 3HPJB 2QR0B 4L9DA 2ZCHL 3X11B 1TZHA 3UPRB 4NNYA 4RGNB 1LD9B 1M05B 3HS0B 2OR9H 3ALPA 1RUKH 3G5XB 1H3XA 3MNZA 3JTTA 1SEQL 3TJEH 4QRQB 2VDQL 1TJIH 4JKMA 2WMPA 5C07D 4JG0H 2QADC 3VG9B 5BJTB 1FPTL 4PRNB 4YO0A 4UV7L 3TYFB 3ISWA 4PJAE 3EJJX 1A0QL 4A6YB 4WW2F 1QFUH 4CVWA 3FB6A 1HH6B 2ZSVA 5F7WC 5BS0D 1OAXL 4PLNC 1F11A 2F74B 4K71B 1SY6L 3U0TB 1KJMA 4I77L 2JJTA 5BV7L 4P9HL 1QFWH 3CAFA 3RX7A 3GO1H 3OG6B 2H26A 4W6YB 2BRRH 2FWOA 3FB8B 1J18A 4YDVB 5C9KA 5I30L 3HAEA 1SMOA 5IBTH 2UY6A 2EIBA 4Y5XB 1N8ZB 4HS6B 4EJ1C 3EJZD 3V7AG 5C0GA 1FZOB 2HG5A 5D5MA 1JGVH 3HC0A 2DIAA 3M8OH 1W0WB 3S7GA 4P0DA 3Q3GB 2AEIT 1UWXH 1EA9C 3L5HA 4G9FE 5E5RB 4HWZA 5CINH 1XZ0A 1ZHLB 2YBRB 4LRIA 3BPCA 2HH0H 4OZ4A 3W9DA 5HDBF 3CMOH 5HHXL 4Z0BH 1IC4L 2VKWA 5L0QB 1OWWA 5AZEL 4FQQB 2CRYA 4KWUA 3K4DA 1RJLA 5DJ8A 1HXYA 2X9XA 1S7QA 5EZJA 1KIQA 4LKCB 5CGMA 1CFTB 1U58A 3B2UD 4U1GB 1CFNA 2FBJL 4PBWD 4Q2ZA 4RZCA 2LU4A 4PGBB 3CDYA 4HFUH 3S36L 1HILA 1KPRA 4M1DH 4X9GA 1RULL 3RL2B 1L7TL 3THMH 2EDBA 5HYJB 3HUJE 1NDGB 4HGMA 1GYAA 1DSFL 4OCSL 1LP9B 2QQNL 3GSUA 4HPOH 4GS7C 3RPIB 4X8JB 2CLVA 1DE4A 4GW1B 2IF7A 3OPZL 4WI2A 5JPNB 2G2RB 1LQSR 2FH8A 5E8EA 1R3KA 1V5JA 4KMQA 2BFVH 3AFLA 4JO3L 3H9ZA 5TQ0L 1V3LA 1FZJA 3C5ZC 3KPMA 4KJQC 1IARB 5FK9B 3S5LG 3E3QE 1LO2H 3CIQA 2R1XB 1DN0A 3NBNA 2B39A 1QOKA 1HQ4A 1C5CH 1INQA 2D9QB 1HCVA 1SEBA 3DYPA 3UO1H 1AJ7H 4HGWB 3E6FA 1QQDB 5KANG 4AENA 2NY3B 5I71C 3RY5A 3MV8A 4EN3C 3OB8A 4KTYA 4XBEL 3DVNA 1NL0H 2D7MA 3RX5A 1DBKL 4P2RB 4NCC2 4LL9A 3FL7A 3WO3B 3VGGA 1AP2B 5D70L 4CVZB 3QHZL 3O0RL 4JB9L 3MJ7B 2V7HB 5JUEL 2OTPA 5H37G 1U91A 1C7TA 4J8RB 4OQ1A 2MHAB 5EOTA 5CJ5A 3FCTB 4ONOA 5DVKA 4YZFE 4PJ9C 4NQED 2LAAA 3MRPB 4N0CD 5E6IA 1LEIB 3FFCE 1G7IA 4EVNB 4NQDB 4W70A 4Z7WA 5LQBH 5HHNA 4H1LH 1GC1H 5E9DB 3Q1SL 4P2OD 4PUBH 4LF3A 1YA5A 1WBXA 3GNMH 1T5XB 3BSZH 4F8QA 1J1PL 3IRPX 5SWSE 2FEEL 1PYWA 5IHBA 3ZE0E 4LPUA 2PCPA 4E41D 2EXWD 1A7BA 4G8FB 1EXUB 3FT2B 4OKVA 3ARYA 5JPMB 1CT8A 4OCYL 4XP6H 1W8NA 2DQFB 4U1HA 1AE6L 5IHZB 5FUOL 1I7ZB 1C7SA 3T0EE 5IB2A 3S88H 4QXGL 4YIQA 3MOQA 4UOW1 4UIMA 3H7BA 1CR9H 4WFFD 2AK1H 1IGFH 1KB5B 4KDVA 3BZ4B 4NWUH 4UT6H 2WIIB 4XNZB 2HRPL 5C0BE 2LVCA 1JP5A 3P4MA 4P2QD 4LSTL 4OTXH 3H7LA 4N68A 4ZFZB 2F19L 3I3EA 4R90L 4ISVB 2PO6A 2ZSWB 2BXZA 4U6XA 2ARJQ 4JRYA 4YLQT 5FO8A 2IG2H 4Q58C 5D1ZD 3K46A 4TPRH 2NY7L 4WWKD 3E6HB 4EN3A 2Y6SD 3H9HB 4R2GC 1NUNB 3IJSA 1T7YA 5DD1H 3ZKMD 1QRKA 2ADJB 4GUPB 4KI5F 1QKZH 5ANME 1HYSD 1UEYA 4L8BA 3CVHA 5C70A 5EBLA 5HVFB 5EO9B 4PJ9A 4NO5B 2V5MA 3X3FH 2IQ9L 5T5FH 3BEWB 4Z9KB 2BVPB 1O0VA 1OM3H 4XNQA 4XMLH 3ULVF 1DANU 1IGJA 3G6AB 4I2XA 2DN7A 5GZOC 2EIZA 5ITBH 1U8LB 5FYLD 3TCXA 4YX2H 3KHOA 2VN4A 4L4VA 3D6GA 2B4CC 4P3DA 1MUJB 3RDTB 3MZGB 5L2JA 4HKXA 1AGBB 4ZUTA 4KY1L 4X5LA 2B1AL 25C8H 1A7OL 2VLJE 4KRNA 4BH7A 4WHDA 1ZHBA 1ROWA 1IL1B 3MYJA 4P99A 4UBDD 1F6FB 3P4NB 4OZGB 1I9JH 3TBTA 3F12A 2HKHL 4OF3A 1DVFC 1RUAL 3QIBD 2X41A 3DUSB 2H9GA 3CFDA 3Q5YA 4J2XA 3VJ6B 1GPOH 1ITBB 4BFIA 4KTEH 4X4XB 1J1OH 2BNUB 2FGWH 3ZT7A 2FATH 4QYOB 5FYJH 4MCYB 2P4AB 3BQUB 1S5HA 5DJZB 1A2YB 4MZ2A 4UU9A 5EZLB 4ONGH 2X1XR 3TT1L 3M1BB 2P1YA 4Y5YC 1A6PA 5K59E 3S4SG 3V52L 1F6AB 4UIKL 4LFHD 3WIIL 1T04A 1TNNA 2AABH 1KYOK 5HHPB 2AXFA 5B38A 3B5TA 2NYYD 2VDKH 1TZHB 2LABA 3VRIA 5GGVH 4YXLL 1QHOA 4HDIB 5F6HI 1KCUH 5LAXA 1A1NB 4TSAL 3JTTB 2ZUQB 3MLWH 3NIFF 4LLDA 2C5DC 2VXQL 4G9DB 1WAAF 4KJPC 5DFWH 4YHML 3CLEH 4KZDH 5FYKU 5C0RH 4YO0B 1NMBL 3SCMC 2YN3A 1X9QA 4LEOA 3CVHL 2Y4SA 2ZOKA 1F90H 5D7JD 1HIMH 2ZSVB 1LMKA 1VPOH 5J06A 4ONFH 1I3UA 5KSAC 4Y4HB 2IH1B 1QHPA 4GKZA 3K81A 2EDOA 1FJ1A 4NRXB 5F7HA 4JPVL 4OLYL 5CMAA 1KJMB 3G6JB 4JAMA 4QRPB 5AAMA 4WY7H 4LAJH 4PV9A 3F7VB 4JHAH 2NY1D 2Z0BA 3KYKL 2X4SA 2WP3T 4CJ1A 4M7LT 1DVFA 3UTZA 3R1GH 3MROA 4WTXA 3PQYA 2L0DA 3F7YA 3FQWA 5C0GB 1UJ3B 2HG5B 2YSSB 4KK5D 4KQ4L 4DW2H 4PB9H 1GHFH 1GGIH 1NCBH 1EEZB 2VAAA 1LO0H 3B43A 4Q9BA 3EJYC 4JPWL 3C60C 1XZ0B 5DT1H 5L7XH 1CFQA 1YEJH 4NUGH 3W9DB 3WLWD 5FDWA 2EDEA 4X6CA 4Y5YA 4MA1C 4GRWE 5DK0A 5B3NA 4XC1L 1RJLB 5DJ8B 1HXYB 4JDVA 1S7QB 2HN7A 3CGTA 3TVMD 2NZIA 4LAQH 3WKMH 2X4TA 5F96L 1VFUA 1OB1A 1CFNB 4KU1A 2Z4QB 3REWA 7FABH 4JANA 5IV2A 1BFTA 1FORH 3BD4A 4P57A 1HILB 1BAFH 1MHPH 5HHME 4TOYL 3MBEA 4KVCL 4JHWL 1LHZA 1TFHA 4KKLC 3SCMA 1MQ8A 2JKXA 3G08A 2NXZB 4NQCE 1YNLL 4R6UA 6FABH 1E4WH 2DM4A 3GSRB 5LGHH 2F8VA 5EO0B 3V6BR 5KSAA 4Y4FC 4JFEE 3U9UA 3GHBL 3O6FD 2XKNB 2ATKA 3VDCA 5B8CB 3D85D 4WW2C 1J1XH 4JDZA 2VQTA 1TVHA 5F7NC 3RA7L 3HR6A 3MOBH 1YQVH 3MLSH 4MJID 4WEBH 4QXUL 2NLJA 3S34L 4GAGH 1RZFH 1UACH 3FO9A 4KQ3H 3KPRB 2HFTA 5DK3A 1DN0B 1HQ4B 1INQB 3IDJA 2VOTA 4CADB 3PXJA 5I8OL 4K8RL 3KLDA 3MV8B 4Z7UA 4FP8H 2CLZB 2NXYC 4W68A 3EFFA 1Q0YH 3K2UH 2EZ0C 1C1EL 3SDAD 4UOW0 5DMYA 3BIKA 2DQDL 5HDLA 4OD1L 1CDJA 1TNMA 5EZOH 4JFZH 1YEDB 5GS2D 3TLRA 3WSQL 4G8GB 1U91B 2ESVD 3IJHA 3I75A 2A6JA 1KJ2H 1K4CB 1NLBH 1XCTA 5DMIL 1S7UB 3HMXL 4HXBH 4G6MH 2EYSB 5E6IB 2P5WD 2ZUWA 5I1EH 3DROA 1KB9K 1G7IB 4Z7WB 4MAYD 3QO1B 4MYWB 3RVWD 2F9BT 5E7BA 4JN2A 5FEBA 4LF3B 3WFDL 1BVLA 3PDDA 1WBXB 4KDTC 3SQBA 2XZQH 3ZE2F 3KVQA 3VXNA 1G7HB 3W2DL 1KT2A 1JV5A 3VXUD 1FSKB 3CDFA 4OKVB 3FOMA 4QCIA 4Z77A 1FGNL 2NY2D 5C0AB 3S96A 1YNKL 3KXFA 3LS5L 3QT2A 5IJKC 5GS1C 3QI9C 1UQSB 2JK5A 2XN9E 3L1OL 3VGAC 5F6IC 5IB2B 3C6SA 2VDPL 5GRZA 4PLJC 4YIQB 4LVNC 4UIMB 4Y4FA 3H7BB 1ULVA 3OZ9H 3ZE1F 3DI3B 1JL8A 1A9EA 1HDMA 5EUKA 2DJUA 1RIHH 1M7IB 4ZSOA 1AIFA 2Q7YA 5HYSA 1NC4D 3P4MB 3K7UA 3UDWC 2CDFB 4EKXA 3W0WE 4JKPH 5DD3H 1HOCA 4H8WH 3GIZL 2IPTH 4M7ZC 5F9JA 4YDKL 2PO6B 2V9TA 4DQOL 3WFCL 4P3CL 4BSVA 1CIUA 3LB6C 2OBGA 1YYLL 4KRPB 2V17H 4GBXA 4D8PA 1X3DA 2WBWB 4FQ2L 4XXDB 1V7ML 5EOQH 2EDQA 1H3PL 3DV6A 2FSEA 2EEBA 1A7PL 2R23A 4R4FL 1EERB 1CGSL 2X70A 2G5BA 2ZUSA 1EMTH 1X5AA 5I18L 4JKLA 5C0IA 1MPAH 1NFDE 3QHFL 4L8BB 5GGSA 3O3AA 1JWMB 1YZZA 5JQ6H 2C7UA 1GGCH 1JYWA 1OTUC 1Z9LA 3INUL 3HB3C 3NFSL 2GAZA 3V5HA 3QEHB 4U1NA 4C56E 3ZL4H 2ENSA 1MVUB 5ICYA 1P5VA 1IGJB 4PY7B 2QQKH 4KDTA 3QEGH 4P5KB 4ZDHA 1HXMA 4J1UA 4FQ1H 4OF6A 3WBDA 4L4VB 2RCSL 4LCCC 3UC0L 4AEIL 5CCKH 4P3DB 3KPLA 1UYWH 3V4PH 5I1IH 4MD0B 4ODXA 5AZ2L 5FO9A 5HGGS 1ZHBB 3CH8A 4IS6A 4ESKA 4EUPH 3QI9A 3MYJB 3PP4L 5IJKA 35C8H 2FYYA 4J4PD 5DRNB 4IDLA 4FQLL 5HHOB 3G04A 1SJHA 1QACA 2A1WL 5TFSL 2EXYC 3LSOB 1DBML 3MJ9A 4XWOD 3N9GL 2XQYG 4R4BA 5I1GH 3LQAC 3Q48A 4GSDL 1FZMB 4HMEA 4OFDA 2C1OA 3UDWA 1SQ2N 3UYPA 5I1KH 3LPFA 4JLRB 5EWIH 1A5FH 2W0KA 3RRQA 5ID0B 3GRWA 1DQLL 1F3JA 4BJLA 3MRBA 4P59L 2Y9RT 2F5BL 3RWDA 1D5XB 2NY5L 4O5LL 4ORZC 2XNAB 5JIHA 3QEUA 4YR6A 4NC2B 4Q9QL 3O3BB 1I1YA 5M94B 3EIFA 1H8SA 4QRTA 3PHSA 2CKBH 4LVOC 4NQUA 4WTZA 4WUKL 1UWEH 2X4QB 4NO2A 4GXVH 5ACMA 3VRIB 4NKOB 4HUXA 3VRJB 4BYHA 5DSCA 3ABZA 4CDGC 3A6OA 3T1FB 2ITCA 4NZUL 2UUDH 5K9OA 3MR9B 5I2IA 4AH2B 2AKRA 1U8NA 1L7IL 3CPLA 5E5MA 1J5OH 2CJUL 1VFAA 1WITA 2VJXA 2DYPA 5CD5D 2E9BA 4Y1AD 2PTUA 3LCYA 1RZJH 4ETQA 2EDXA 1AGFA 1HNGA 2AJUH 4WUUE 3RUGA 1C5DA 1CGWA 4JAMB 2IANA 3QPQC 4JJ5A 3PL6B 1L4IA 3Q5TA 2I5YH 1MFEH 1S7SA 3DMMB 1U8MA 3BYTA 1MIMH 4DZ8A 5CD3A 4X5WB 5F8RC 1XF1A 5CEXB 1WZMA 3OSKA 4S0TD 2HFEA 4PJIA 3PQYB 3WE6B 2UWEA 2HMID 1YJDH 4TULL 1EEUA 2CD0A 4K55A 1I3GH 2IPKB 5FHBH 4PY8J 4BFBD 5CIPA 4A2MA 3UTTA 5BMFL 3GBMH 1PW3A 1KTDA 3QQ9C 4QEGA 3I6LE 4DUXA 3MJ9L 1S7WB 4YWGH 4LSUH 2Y5TA 5CUSH 5C86A 5IWLC 1VGEH 5IW6A 2XTJE 3L7FB 3QFJA 3TZVA 5JHDD 5D93C 5CBAA 1F4XH 4JREB 4HJ0C 5KVMC 3OKOB 3H3PH 1R6VA 5DO2C 1OP5H 1J0IA 5LXGL 1MI5E 3CX5J 1I8MA 1A6VL 1QFHA 4HWBH 5CEZD 4O51B 2FX7H 3L7EA 1AFVL 4S11A 4JCLA 5HD8C 1CE6B 2CLRB 1VFBB 4P23A 3T2NH 3MBEB 3ARGB 4G3YL 4UV4L 4JO1H 1EO8L 3G08B 5MERA 4PYHA 4ODVL 2I07A 5KSUA 1CXFA 2AXHA 1BECA 1NDMB 1MLBA 1MCHA 3O6KL 4OZIF 1INEH 3U9UB 4G7VL 4LSVH 5DA4A 1RJZB 3O9WC 5EOCL 4J3TA 5D4QA 1WLHA 1JUFA 3WXVH 3VXMA 3PGDA 3SJVE 4URTB 4JFYA 4CAGA 2M2DA 2OZ4H 3HA0A 2NLJB 3LOWA 4DAGL 5D1QA 4HGKC 3UTQA 2F53D 1S9YA 2VWEC 1G1YA 3UP1A 2V6HA 4OCRH 1V8HA 3I3DA 1NH6A 3BI9X 1G7QA 3FMGL 4KGJA 5HI4D 2QL1A 1U92A 1C12A 3PG2A 4P2YA 4UI2A 4GQ9L 4ZFGH 4XPTL 4JQIL 1KCSL 3EFFB 3CK0L 4PJDE 1OD9A 5TF1L 5KG9A 1INDH 4CDHA 4LGSB 4EDXA 3DYMA 1NCAH 4ZAKA 4OZFB 4MSWA 2XQBL 1IT9L 4L4TD 1OAZH 3S4SA 2YUVA 1XCTB 1KPVB 4V2CB 2WUBH 5D7SL 1MH5A 2OM5A 3DROB 3OXSA 4PJ5A 2DLEA 3BZEA 3WN5A 1U3HD 3ZYZA 4NRYB 5IVXE 5F93C 4GRMA 4X7CC 5GGTL 5ICXA 4LBEA 4NKMB 3ULUC 5SWZD 3SE8L 1KT2B 1JV5B 5MEPA 4XNUL 2BOCA 3O4LA 4MVBC 4JDTL 4Z77B 3KXFB 4DOHB 3PWVA 4WO4B 5CP3H 3DURA 4XTRC 3DRQA 2CDGA 4POZC 4DUWA 3O3DB 1BD2E 4ETYA 1T4KA 3U9PL 4JO4L 1SBBA 4F57L 3E8UL 5CGTA 3O9WA 4IJ3B 4M43H 3NFPA 5EUKB 2AK4D 2Z92B 1H8OA 1U93A 2ZUTA 4EXPX 1ZT1B 2ZJSL 1FN4B 3C5JA 5JORA 3KJ6L 3TC9A 1JPSL 1QVOA 2X09A 4NGHH 3QDJA 3TNMB 1JZ4A 3LHPL 1E27A 4X9FA 3FQNA 5GRWA 1CLOL 4QNPF 4QRRB 3GMRA 1JPTL 5F7EH 1TZIB 3GHEH 4GBXB 5I76B 1CGYA 3NGBC 4N8CH 1QFPA 4MNHB 4PRIA 2R23B 1JRHH 4FABL 5E8DH 3VFVA 3S98A 3NPSC 3MLRH 4XHJC 5EA0L 1D7FA 4XNYL 4ZUVA 2BNRD 4X9IA 3V4UL 1RI8A 5GGSB 2EIDA 4U6HA 3P30H 4UINL 4OJFL 5E1AB 5ID1A 2Y23A 1YPZE 3O8XD 1KJ2B 3OF6A 3VXOA 2GAZB 3U0WH 1EFXA 4U1NB 3X17A 1G7MA 5H35A 3GMOB 5IW1A 4C4KT 5ICYB 3RJQB 3WIHH 4M5YH 4M9PA 4U6VL 2ED8A 4CMMB 5HVWA 3TN0B 1RZKH 2YA0A 4ZUSB 3CX5K 4KI1A 3EYUH 4RIRA 2Q3ZA 4FFZL 2H32H 4JFQA 3AGVA 4JE4B 4L29A 4IS6B 1CL7L 4TNVF 4C58B 2B1HL 1VB9A 4JRXA 5KJRH 2CPCA 2R8SL 3G04B 1SJHB 2CSPA 3BT2H 3U7YL 5DYOA 4YXHL 4QHUB 4LU5H 5E03A 2YXFA 4C57C 3LRHA 2YD3A 4LMQI 3VMOA 3F58H 4ZD3H 4ZPVB 4Z95H 2FDBP 1D6VL 2VLLA 4PJHA 2YPLE 4NBYB 1LEGA 4Q74A 3CU7A 4XX1E 1YEHH 5DMGC 4YR6B 4F9LC 3V5KA 5INCA 4X80L 1I1YB 3TP4A 4WU7A 4F7CA 1E28A 4P5MA 3LKOA 1Q72H 5CFHA 1NMAL 1DQDH 3L3GA 2ENYA 4XGZA 4NO2B 3UTSA 3VXSA 2E27H 2P8LA 1QR1A 1I1FA 1SM3H 1CN4A 4HUXB 5DSCB 3D39E 4MGXA 3S35X 2HVKB 5DHXB 1P4LA 1MNUH 4AMKL 1XGPA 2NY6C 2BSSB 5ICZB 1UXWB 5I2IB 3ARWA 4MNGE 3QRGL 3L5JA 3CUPB 3QQ4A 4PGJA 4HMDA 2PTVA 5I1AB 1TVBA 1VFAB 4FQCH 2DICA 2DYPB 3EZ8A 3K1KC 3N0PB 1KCKA 4AEHH 4ETQB 4MWFA 1X5HA 5HVHC 5A3ID 4RFOH 1G6RH 3DVGA 4HC1H 3RUGB 4XVJL 2IANB 4RRPA 4JJ5B 4N90E 1Z5LB 1JTTA 1MRFL 3MV9A 5I15H 4D2NA 1S7SB 3ULUL 3QDGB 1R5WA 4PJBA 2GKIA 1Q9LA 3GI8L 3I6KB 3QIWC 3CXDH 2J5LC 5CD3B 3DGGA 1Z6JT 4LSSL 3L3KA 4PJIB 5E00B 1QG3A 1WEJH 4XVTL 3W9EB 1HHIA 3C2AH 1WCBB 3O2VH 5HGDA 5GGVY 1KLFA 4FFVC 3HNSH 2LQRA 4U1MA 4XHQA 2OR8A 3SDDA 5CIPB 3AU1A 3QO0A 1B88A 4UT9L 1A7NH 3PABB 4MA3A 1MFNA 1N59A 5GGRB 5D5ME 2ICEA 2R9HD 4QOKA 3BXNB 2DQGL 1WFOA 2Y5TB 2Y1VA 4X8XA 1E6JL 3UROR 5IW6B 4M6OH 3TZVB 2X40A 1C08A 1BOGB 2OCFD 3IKCB 5C3TA 4NFDA 5CBAB 2O93L 4OIBA 4KZEL 2Z31C 4HQQL 1FNFA 4M93B 1JGDA 3MV7A 1KACB 1I8MB 3FONB 4XP9L 1BFVL 2WBKA 5EIIA 2PETA 5K93A 3SKJL 4ODSL 2W38A 3L5WB 5T1LA 4P23B 3EYOA 4JHZA 3I85A 3OAZK 3MXWL 4XB7A 4J3VA 4EBQL 4JGJA 4H20L 1SJVA 4Z7VB 3RP1A 4KHXH 3HHRB 1XGYL 4EI6B 5KSUB 1FC2D 2OI9B 3G6DH 3TT3H 3PGFH 4NBZB 4XZUA 3CCHB 1XCQA 4JFYB 4N0UA 3QIWA 2KUTA 4PRPE 5FGSA 5D1QB 3STLA 2R0LH 1CU4L 1KBGL 4YHOH 3RQ3A 4P9MH 2R56L 5FYLH 1G7QB 1HCFX 4UTBL 2AV7B 4FFYH 3RIAK 3N85L 5EOCJ 5LCVH 3DIFA 3DX8A 1KJVA 4JVPA 4HX1B 2HKFH 4K3DH 4K3EL 2Z8RA 4IOSD 3BP5A 4OFYA 4XC3L 1F4HA 4R97C 4ZAKB 4YK4C 2DOCA 4MSWB 4MXWH 5SV3A 3T0VA 3ARFC 1CICB 3K8KA 3GZKA 3ZSTA 4ODTL 1F6LL 4R26H 3U7AA 5DHYA 3TO2B 3D3VD 5F21B 4QHNB 3QNXB 3WN5B 5C1MB 3TWCL 2GCYB 1NJ9B 4RMQA 4GRMB 4XCNA 4LBEB 4OQTH 3I3BA 4LCUA 2A38A 1J86A 3V6OC 3NZ8A 4PRHB 4X6FA 4MDIB 3C8KB 3CC5B 5MEPB 3LY6A 2BOCB 5B3JE 4JM2D 4LHUD 1ONQB 3DURB 2DQIH 2GYSA 3BP4A 4PTTA 3DRQB 4Y4KD 3AXLA 4ZPTA 4F8TA 3HMWH 4OI7A 5SX4I 2UZIH 3NZHH 4HH9B 4OLXL 3N1GC 1OHQA 1KFAL 1MWAA 1GIGH 1U93B 4PJCA 4X7SH 5I8EB 2RHEA 1AC6A 3VFPB 5JORB 2YPKA 2WLZA 1QVOB 1RZGB 4S1DC 3QDJB 3ZLQC 3RTQD 1MCRA 1QEWB 3GSWA 4YE4H 5ALBH 4KC3B 3VFWA 1HHJA 5ADOH 2WUCH 2OMNA 1OL0A 4HUWA 1ZT4A 5EC2B 5HHVL 1TDQA 3HE7A 4NHCL 2AS5M 1U2HA 5DUPL 3FRUA 4MA7L 5MEND 4O58H 3WNOA 1QP1A 4LLWA 3U30C 3HE6B 4APQD 3CZFA 2F5AL 2NX5B 4XP4H 5C6PB 3KS0J 5FXCH 1MCIA 2BJML 4U6HB 2AJYH 3ARFA 3BKJH 1KN2L 3MRCA 3DI2B 1ZGLM 3H0TA 3PHOA 5D2LB 3RKDC 1JCKA 2PXYB 4JM4L 3H3KA 2BRQA 4OGXL 5EC1A 4IIQB 2D7PA 2DIBA 3OTTA 5IW1B 1XIWA 5JW3H 1JF6A 3TO4A 1DEEA 1I7RB 1J0YA 2FX9H 5LG1A 4EUPG 5KANI 4JPKL 2LFGA 5C7XL 1NANH 2COQA 3B8SA 4NT6A 3V6OA 5MEOA 4RWYL 4HPYH 1FDLL 2HP4A 4I2XE 2MCPH 2IBGA 4FZEL 3P11L 2NW2A 3EOAA 2XY1A 3LDBB 3MLYH 2GJZA 4Y19A 1PZ5B 3HFML 3T0AA 1G0DA 3H9SA 3TCLB 3UBXI 5JXEC 1U8OA 1S8DB 2R2BB 2D2OA 3UJTL 5DYOB 4Q0XH 4LCWE 5HGHA 3AAZA 5E4EB 8FABA 5ISZB 1UZ6E 1YEGH 2QQLL 4G6AD 3DBXB 1N0XH 3SDXA 2VLKB 1F00I 4HK0B 4LCIL 1NUFA 1FG2B 3OKYA 4K3GA 3P77A 2AEQL 3L3IB 2BHZA 2VLLB 4PJHB 1MWAL 3ARZA 4M61A 4Z7VF 2HJKA 4PJ8C 1JMZA 5TDNB 1WQVT 3NGBB 5DEGA 5C09D 2H1PL 4QF1A 4WU7B 4F7CB 4PP1C 5TDOA 5T3XE 1I85C 5FYKE 3NCCB 4H1LA 2P8LB 1I1FB 5D1XD 4RAUB 3OX8A 3VWKD 1P4LB 3SKMB 2Y36L 4NKDA 4Z76B 4OD3L 4ZMAT 1K5NA 1MCJA 32C2B 3OG4B 5E8NA 2VDMH 4J23A 4GMTH 4Y2DC 3MO1A 1VEOA 1FLRH 1J0JA 1YEFL 3G5YA 4KK6C 1FYTE 4UQ2A 2Q8BH 3SE9L 1AR1D 4GMSL 3S35H 4CN6A 3LKPB 4NJ9H 3MNWA 5GS2H 3DWTA 4MWFB 5L2KD 5SX5H 1CQYA 2VRAA 3DXAE 3ZTNH 4V1DB 2EKSA 5ENWB 1N64L 1AO7D 5JZ7D 4JQXC 1NSNH 2GJJA 2VKXA 4GQPH 2FNBA 4XPAH 5D7LA 3OB0K 4LMQE 4L3CA 4U3CA 4YHZH 1OF2A 1A64A 1ZTXH 4KKBC 4PJBB 4IMLB 3OR7B 4NZRL 1P2CA 1IEAA 2BNQA 1BF2A 5C9JA 5JXEA 4W4OC 1Z9OA 4RMTA 1N4XL 1HHIB 1Y18A 5F97E 1QSFA 3U2SA 2XPGA 4F3FA 4U1MB 4KMLB 4R8WH 1Q0XH 1DQMH 5C08E 3QEQD 3IYLW 1IGYA 3SDDB 1FNSL 1UT9A 3AU1B 4DGYL 4MA3B 1N59B 5EU4A 5KS9E 3QDMB 5C0CA 1TZGH 1BJ1H 2ICEB 1VSCA 4KK9D 4RGND 4PJ8A 4PJEB 1ZWIB