2CR0A

Solution structure of nuclear move domain of nuclear distribution gene c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
b'GSSGSSGKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear migration protein nudC
publication title Solution structure of nuclear move domain of nuclear distribution gene C
rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cr0A00
2WJ7A 4I88A 4YLBA 4YE0A 2WJ5A 1X5MA 4JUSA 3J07A 3QORC 4MJHA 2Y1YA 3L1GA 3L1EA 3L1FA 4RZKA 2O30A 1RL1A 4PBDA 2BOLA 2Y22A 3Q9QA 3GT6A 4ELDA 2JKIS 3QORD 4JUTA 3QORB 4YL9A 3EUDA 3Q9PA 2CG9X 1WFIA 3N3EA 3W1ZA 3AABA 5DS2A 2K8QA 1WGVA 2XCMC 2Y1ZA 5LUMA 2N0KA 1SHSA 2N3JA 3QORA 4YDZA 3VQMA 1EJFA 3AACA 2RH0A 2MNWA 4YLCA 2CR0A 2KLRA 4PCKA 4ZJ9A 4M5TA 1GMEA 5DS1A 3VQLA 4FEIA 3GLAA 1WH0A 2KMWA 4M5SA 3IGFA 3GUFA
chains in the Genus database with same CATH superfamily
4BCYA 4XXDB 1C7SA 2P5WD 5LCVH 3W5MA 1NGQL 2BVOB 2AXJA 2UY7A 3L4UA 4G6AD 1Q0XL 4MXVF 3T3ME 4H8QA 5IB3A 3ZL4H 2IH9A 4WV1B 2IO5A 4TUOA 1OTUC 4G80A 5JDJA 3KJ4C 4Y1AB 1USZA 2W59A 3VXME 2PNDA 4N25A 4LP5A 1HYRC 1TIUA 2E7LC 4GUQA 4AKQA 3BH8B 4NRZB 2YD5A 2AQ1A 1MJ8L 1BQHB 3QJZA 2F7RA 1EHNA 4AE0A 1RUKH 5T5NG 4S0HA 3DRQA 3OAUH 1JF1A 2CA4A 2EYTA 2ZYRA 1I3RB 4Z7NB 2PCFB 1SOKA 1U8CA 4KVCH 4F7CA 2IV9A 4P2AA 3VSUA 1AXSB 1QEWB 1MRCL 2XWCA 3N85L 2AW2A 3US0A 1C1EH 4FMVA 1A4KA 4OW6A 5DLML 2R0ZH 4UT9H 3WXVL 5DCCA 1UB6A 4NDMB 4JPWH 5AAWA 2FX9H 2NY2C 4XN8A 3JWNC 4LEOB 2EDYA 5AKSA 1UG9A 2B0SL 2LTQB 4DHLA 4G9FA 3UBXG 2R69A 2ZUQB 4XE0A 5DVNA 1FGVH 3LZPA 1JP5A 2HN7B 4XCNA 5IUSA 5KSBA 1FH5H 3FH8A 2FO8A 2JB5L 5GSRB 3GBML 2K70A 3WS3B 1E6JL 5E6IB 3EOBB 1T2XA 2OK0H 3QULA 2J1XA 2GJRA 2ZCHL 3LQAL 1OCWH 1QO3B 3FYEB 2NQCA 4AL8H 3Q2NA 4RMWA 4XNXL 1XQ4A 4NM4H 4HH9B 3DUUB 1WUNT 3Q1SH 5DQJA 1IGJB 4YHOH 3CPLB 2R0WL 4OTXH 2X05A 5DK2B 1V3LA 4JFEA 4WIQA 5DD6A 4HCGA 1JL8A 3ETSA 3QNXA 3BGFC 1TJMA 3FUJA 3FO2B 3QXDA 4KJYB 2ESVB 4HHGA 3FHEA 2VM3A 3JUYA 5DD0H 5BNXD 4B9KC 1P7HL 2Y5TA 5I23A 3OKNA 3CVIH 3EO1A 1XV8A 4H8WH 1HHGB 3QC6X 3D50A 3OSKA 2A83B 1A1NB 2YWYA 1LP9A 2FQGA 3OXSA 3AG2B 3D3VB 4WWOA 3QIUD 4K94H 1VEMA 3AXLB 2QMJA 5AW2B 5D7KE 4LPVA 1I3GH 4ELKB 3V4VA 3UACA 3CH8A 4DK3A 1MG3C 2XWTB 3P0YL 3HC3L 5AW3B 3BCDA 3B6SA 4UU9A 4I0KA 4KI5D 4F9PC 3K8MA 2G2NA 4KITB 4ES8A 3DVNA 5B7EA 1XGQA 2NUPB 1JRHL 2EE6A 2OBGA 2WWMD 3CSPA 3QRGL 3IMVA 3UO1H 1OAXL 3ULVE 2APBA 4JFTA 3U4AA 2BNUB 3HR5B 4GKNA 4QRUB 3ZO0A 3RAJH 2I07A 3QJTB 3NPSC 1PG7L 2DN7A 5CJ5A 1A4CA 4G8FB 5FCUL 4M00A 5B8CC 3EYUH 2VDLH 3QZNA 3B7RL 4PS4H 3X1FA 3U1SL 3TVMB 4LVNB 3QORB 2HVJB 3QH3A 4BFNA 3TJPA 2Y07H 1FZKB 4C56D 3PIQA 5MEQA 2HMID 2KKQA 5C09E 3RB7A 5C0JA 1GMIA 4H88L 1J8HD 3QUZA 2IWKA 3HKZA 2DIEA 1XIWB 3NK3A 4IGBD 4L3ED 4MAYC 3EZJB 4GRWH 4PJ5A 1Q38A 3ZGIA 4JFDD 5C07B 1T20B 1UACH 3BFQG 2CPCA 3CBJB 5GISL 3U2SA 3MLRH 3DX3A 1XGUB 5D1XA 1PD6A 2X6BA 2FD6H 5IFJB 5KS9A 2JJVA 1F13A 4FQLH 4JRFA 4WHCA 5FIEA 3VG0L 4Z7OB 5C0NC 3LZRA 4X8CA 1UXWB 1RMFH 2YD3A 1YPZF 3U0TB 1F90L 4FQCL 4UDTB 3TYGH 2WCSA 4FI7A 2NNAB 5CWSA 5LAXA 2UZXB 1A6PA 3MC0A 4P2RD 3C75A 1XGTA 3RTQD 4JFYB 1X7TA 5C0BB 1OB1A 1OTTC 3P69A 4DWHA 5EWIH 2IPUG 3I3BA 2IDQA 4JHWL 3UX9B 3L17A 2P8LA 3LKNA 3KPTA 2BSSA 4UTBL 2KLTA 1PS3A 2KPNA 4KPHH 1E2WA 2WY3B 4LO9A 1HHKA 1KJ3H 4K15A 2P47B 4Y9GA 1TLKA 1I7RB 1ZHNB 2X5PA 3AVEA 1JYVA 3BWAB 1AZZC 1FFNB 1C5DB 4L05A 4G71B 1D5IH 5DRWA 4GI6A 3SDXA 2AK4A 4OGXL 3PXLA 1UGNA 2FUQA 2RCSH 4JY6A 3MACL 3ARZA 1IAIM 1HQRB 3UP6A 3CC5B 4HK3J 5C0FB 1AO7E 1P84J 1CB4A 1E4XI 1IGTA 3HKFA 5C0AE 2EE3A 4BV1A 4KXZH 2WUBL 4NN5C 3ZDZB 5GIRB 5LBVA 4C57C 1NGQH 4S11A 1Q0XH 2AVGA 3SDCD 3TWYA 4BFIB 3SB3A 4TNVF 3VW3H 2XQBL 3MUJA 2M83A 5E1AB 4U31A 3QEGL 3WUWG 4PIBA 1U92B 2VLRD 3QCUL 4DOHB 1EDYA 2GC7C 4DVBB 2CGYA 3MRNB 2ROXA 5F7YC 3KMDA 3BWUF 3I6GA 4L5FH 4G3YL 1EZLA 3ZVVA 4HULB 4XH2B 3BVUA 4Y5VA 1BZ9B 3GUTB 1VSCA 3U9WA 1MJ8H 2WB1A 3MBEA 4HSCX 3NP4A 1O6TA 4G72B 2WSPA 4NENA 2L0DA 4LKXA 3FFCD 3KW7A 4ZSOB 5AZEL 4RRPG 5D1ZD 3K7UA 4GW4B 1MFUA 1KIUB 2VZ3A 4ABVA 4N0RA 4LARL 2BHFA 4HAKA 4OD1H 1BOYA 5IB4B 2XKSA 3AQYA 5FW7A 3OGCB 1OKEA 5DLMH 3T4YA 5C6WH 3WXVH 4K3JL 1SF3A 1ODUA 1B0GA 3ZBMA 3RBGA 4GEIA 5DHXB 2ENYA 1INQA 1FYHB 4AVKA 5KSVA 4DZ8B 1F6AA 4JFXB 3MLPA 1WFUA 3KWWA 4NT6A 3SJVB 5IOKA 2XXMB 2LU4A 2IG2H 3C09C 1EAJA 3S37L 2P48B 5F0JB 3IN0A 2DWEA 4X7EC 4OFQA 5H94B 2FWOB 1UQSA 1E6JH 2VUYA 2NY1C 4HLZH 4BIKA 4R83A 5D5ME 1HCZA 2IAAC 2WNXA 3LN9A 4RLDA 5I9QB 5IVXA 1J8SA 3H9SA 5J12C 3HRZB 1U9KA 1ONQA 4WENB 3Q3GA 4LLMB 4XNXH 1GZPB 4JDTL 1CD0A 1R0AL 2YPVL 3EJPA 2VABA 5TQ0H 2J5LC 2J8UF 4OD2A 1NBZB 3ERXA 3GYRA 5EF2A 3REVB 3TC9A 3GNML 5IHUL 3WN5C 1AKJB 3HHRB 1SYVA 3W9DB 4Y8AA 4KUCD 4OCYL 3T8XA 4BFRA 4ZQKA 3VXRA 2VQ4A 3H6JA 3RZCC 4GKLA 3HAEB 4HSAC 1LO0H 1N6UA 4F57L 2YKLL 1KOAA 2HJLA 3HI6L 4A7QA 3DX6B 5KVDL 2A74B 2X7LA 1CQYA 2EKJA 3DYMA 4G9FD 3WTTA 1E7UA 1X5XA 4NBZB 5JMRA 4XP9H 4A7GF 2EUVA 4N0UE 1THAA 1ZLEA 3CZFA 2WM0A 2V2TB 3F8UB 3V0DA 1RXLA 4GW1A 4WEBH 5C2UB 3J27A 4E9LA 4UF7C 1DVFC 4JN2B 1I9EA 4XWGH 5D7LE 1QA9B 1KLUB 2AJUL 4YFDB 1T4WA 3FFDB 5CLWA 2AKRB 3QNYA 2X10A 5DRZA 1S7TA 1NFDE 1SDDA 3AMLA 1ZY9A 3FCUB 1JRHH 1R34A 4XE5B 1R3KB 3CVHA 5FFLA 1OAXH 3C60C 5FYLD 1KN4L 4JFED 2ED7A 2OCFD 3OL2A 4JFFB 4PGCB 1ZSDB 2UX7A 3ZDYF 1J87A 1QASA 5EBWB 2IDUA 1CLYL 2C7FA 3VFWB 1Y7VA 3D7PA 3MCG1 3O45A 1PG7H 1E3ZA 5FCUH 5CS7A 1IAKB 3OKOA 4GRLA 3U1SH 2QKIB 3MA7A 3IJSA 4WSJA 3LN5A 4LK4A 4XMUA 3C6LB 1COBA 3PHOA 5DFVC 2VQ1B 4EKJA 3QRFM 3M7OA 1JPSL 5FF6B 1HQ4B 1FSKB 3LV3B 1KCBA 3BIKB 3PS6A 4OLXL 2IGTA 4MMYA 2YD0A 4P5TB 5D2LE 1PG7X 5GISH 1WQVT 4UILL 1NGWA 43CAB 3KLHC 1P6WA 4PJ8A 1SUHA 2Z9TA 1M9SA 2FIRT 2G2RB 2XKNB 1FV1B 3MYJA 3DC0A 3VG0H 1RPKA 2WBXA 5T1KA 3GJFH 5J8OA 2QMKA 5DJXA 3WJJC 4UQ3A 3VD1A 2NSMA 2R4RL 2NXZD 4L37B 3KDPB 1K5NA 2ZUTA 3QR1A 1IM9A 4C59B 4JO3H 1WZLA 4N0FB 2NUTB 4XHJC 5C8JA 3IXAA 2ENJA 1U8IA 4LOEA 5FPIA 4FXKA 3LIZL 2HT4D 5E8DH 4PJIF 3EHBB 4JHWH 4UUJB 1OAKH 2CO7A 5FKAA 5I5RA 4ZQTA 3QR2A 3TO4C 4EPSA 1WRFA 2CLZA 2CRMA 3ESVF 3DURB 3KW8A 4YE0A 3U46A 2VWEE 4K2UL 5DUBB 3QXTA 1M1XB 2VAAB 1HCFX 1MCWW 2FJFB 4PJ5D 5IFAL 2P9RA 1WDAA 3M88A 3ARQA 4XB8A 4ZOCA 3T6WA 1AQMA 5IB2B 5C7ZA 1MFNA 5HHME 3FB6A 3CDFA 1K4DB 3MACH 3FT4A 3MLWL 3X13B 4WNQB 4XP1L 1DCLA 2P24A 3UPRB 2KDGA 2R1WB 1QW8A 1UD8A 3PV6A 5BVJA 2FSEA 4MAUL 1FYTB 4G8EA 4PLKD 1LO2L 2G60L 4YS4A 4Z8FL 1EO8H 3MXWH 4RH4A 1ILSA 4DUWA 1XSJA 2A73B 2IANA 2BOLA 2J44A 1IARB 3VXQB 1LD9B 1HXKA 3CFUA 4U4BA 2DQEL 4JKPH 3AXIA 4PJAB 3FO9B 3MROA 4EIBA 5EORL 1Q94B 4B9JA 4NQEB 1QZ1A 5F7EL 4K07A 4E42B 1EPFA 4XC3H 4WVRA 2D0HA 5JR1L 1KNOA 4NCC1 1JZJA 1TZ8A 3KJ4B 2QV4A 1NZRA 4I13B 4PBVC 2OMNA 2XZQL 3QPXL 5C08E 3J07A 1F4WH 2AK4D 1VGEL 4NUGH 4PRIB 4S1DC 4WI0A 2HH0L 4EI5A 3ZT7A 1NFIA 2X6AA 1EO5A 3O8XA 1USQA 5EO1B 3HMXH 4HUMB 4Y2DA 3DSFH 4F5CE 1K4CB 1E5YA 2XFGB 1CYXA 1KV7A 1KEML 4LOUD 4XNUL 1O5PA 5I0YA 2J1WA 2NW2B 5CGBA 4NJAL 1W0WB 4L2LA 5C0GB 1H8OA 4B53A 3N5AA 2YD8A 3L4WA 3QO0B 3HJ0A 3T2LA 3I75A 1L6PA 2B4CL 2JCCF 1U8QA 3FULA 3IJHA 4AW7A 4BINA 4G43B 1M2OA 3VXSB 4ICXA 3O3UN 2C9XA 4J7RA 1O9VA 1PD0A 3Q7JA 3TONA 1XB8A 3WNNA 4R3SB 4XCEA 4BXVA 1I8AA 4PG9B 3MBED 4X5XB 4LEBA 5FFGA 1GZHA 4F8OA 1TXKA 3JTTB 1XCQA 1JN6B 3FT1A 3QI9B 4HWEL 4JDTH 2NYYD 5J9PB 4R90L 3RURA 4XZUA 5GRZA 1JXFA 4J6RL 4CVXB 4NC1E 3Q8AA 3GNMH 3PJSA 5IHUH 3KBPA 1IBDA 3UTZA 2AQPA 2Y22A 4QO1B 4JQXA 4OCSL 3GSWA 1D2PA 3EGSA 5ETUB 4UT6A 3ISWA 4F57H 4TUJB 2FX7L 3BGFB 2HPOA 2CRYA 4ZMVA 5KVDH 1OT1A 2A9NL 4CNIA 3SOTA 5GGSY 2PYFA 4G83A 5CKAA 5J7CC 3T71A 4YH6A 1PYWB 1RL1A 3EGDB 4DFIA 4XP5L 4FQ2L 1JXGA 1AXIB 2AJUH 2DYPA 5ACMA 3H9SD 4E5XB 5A16B 3HS0C 4F24A 3L4CA 1D6VL 3NZUA 3JYBA 4C8XA 2AFNA 4NZJA 3L9BA 4DETA 4B95C 1NUFA 3HPLA 2X2UA 3AITA 4EBQL 4FFYA 3G5ZB 4MQXD 3PWUB 1KN4H 4KV5F 5EUKB 4GKOA 3BFOA 2JJSC 5JPMB 1JHKL 1HYSD 3VXRD 5CHNB 3QXAB 4M6OL 1I85C 1IKFH 3NRFA 3GKZA 3OLIA 5HGAB 3HS8A 4ONGL 4D0CB 3G6DL 1X5YA 5F44A 2Z8RA 4HIHA 2V9RA 1DEEA 3DPBA 3LN4A 5BRZE 1Q9KB 3MBXH 1A6ZB 4BSJA 1DLFH 2FH6A 4EIGB 4WRLA 1CFMA 4JMNA 1MVUA 3EAKA 1P9MA 2CK2A 4GAJL 4OFKA 4PJXB 2NY3B 4BM7A 3WTXA 4ZOEA 4N8CL 3WV0A 4F2MB 4JG5A 4KX9A 1IEAA 1YVLA 3GUFA 4MAYB 2Q76B 1U58A 2E9JA 5B38B 5JOPD 1UTDA 5BO1H 2DKMA 3KZ8A 1BX2A 3UTSB 4TULL 2FWLB 2DQIH 2QSTA 3ARDA 2VDNL 4PRHA 5GGTL 5FYKD 2XWXA 5D8JL 2WWMC 3TU6A 3WS6A 3HNTH 2BXZA 3T0EA 4A67A 1T83A 1T0PB 4X9YA 1HHIA 1BREA 2YRLA 3ULVF 3MBWA 2BMKB 3DYPA 1ETB1 5B1JC 2OJ1A 2I5YL 4IS6A 1FFOA 3D0AA 2H2PD 5K39A 2V17L 3AY4C 4GRLD 1R5WA 1YN6A 3D4GA 4K8RD 3RFZA 1A7RL 3GMRB 5EZOL 3L13A 4JGJA 4WJ5B 1E5CA 2PP9A 5CP3A 5KYNA 1IC0A 5I8KL 1KLFA 2Q7NA 2O5YH 5T33H 4AIXA 3LTVA 2VXVL 5EU6B 1ZKAA 2Y36L 2YAHA 4F33B 3B34A 3V0HA 3PWVB 2HMIC 3L4ZA 4Z78A 2WC7A 4GG6A 4G7YL 3OMAB 4BZ1A 5DTFA 4IGBC 4F58H 3U4BH 5TF1L 1QZNA 1GYVA 2I85A 4PJ8D 1Q9WB 1KYOJ 2D2CC 5LNEA 2EICA 5T1KD 1FL3A 2ZSWB 4Y9BA 3VVWA 2VIRA 3ROOA 4H4NA 3RQ3A 2QELA 3ZTJG 2HFGL 1SN5A 2G60H 5LBGA 4YDLB 5CZKA 5FGBC 4Z8FH 1IM9D 4X0NA 3EYVB 1O7SA 4D8PB 1D7CA 4NN5B 1WHPA 2DQEH 4PW3A 3EGXB 4R6UA 3RGVA 3P73A 2BP8A 4XNYL 5EORH 4HHAA 2IADA 4BH8A 4FFTA 3UYPB 4WKXA 2C1OB 3AT8A 5F7EH 2V8LA 3ECQA 2DIJA 1EEYA 1H3XA 3AS2A 4FQXC 5CN1A 4FZ8H 5JR1H 5JO5A 5J3HD 3AY2A 5L2JB 1DBKL 3ZYOA 5L9DL 2B1HH 3WEXB 4L8SB 2XZQH 1Z1WA 3QPXH 1F45A 3G5VB 4XN9A 3L1FA 3GK8H 4UM8A 3L3GA 4CRPA 1VGEH 1KPUA 3CFIC 2IFFL 4EAEA 1UB5B 4MVBD 3SYPA 5AZUA 3WJMB 4Z7IA 2R29A 2EECA 5SWZA 1QI5A 3SBWC 1KEGL 3ETBJ 1KB5H 1KEMH 2L8AA 2NTFB 2VLJB 2MNWA 5HYIA 3DHPA 1KXTB 2A9AA 3SDCC 5I1HH 4NERA 1PSKL 3ARGA 5SX5H 4AUJA 1HK6A 2VXQL 4GI8A 1RHFA 4QF1A 5KYUB 2B4CH 3RWIA 4O2CB 1YMMA 3BUYB 1MQ8A 2DMKA 2YD4A 4LHUA 4W4OC 4YL9A 3SOBL 3ZXAC 4WK0B 2F53E 2IMMA 4R4FL 3UO8B 2EO9A 3ZZ1A 1HOEA 3PGFL 3AS0A 4A37A 3VD7A 4YLCA 3E8UH 4F7MA 2ZAIA 2CE6A 5EOQH 1X5ZA 4DNLA 4AY0A 4C83A 1INDL 2ZWKA 4OQTL 4EI5D 4MCNA 1CJYA 1KCVL 3A0OA 1KBWA 2GK0B 3WOVA 4AZ8B 5IIEB 5J12B 1KPRB 4ENED 2XQYA 1S7UA 3HAEG 4XMTA 4I9WE 4Y2DD 3IGLA 4ZMYA 1MHCB 4KOCA 3NFPB 2NRDA 3T1WA 4OCSH 3U9PL 3DLQR 1ASPA 4ZO9A 3KPSE 3U9UA 4ADGA 1BA9A 1JWMA 1Z0NA 3KGUA 4JAMA 4XPGH 4YNYA 3RZCB 1TJIH 4I5BB 1UT2A 3MRPA 1EZSA 5BV7B 5IESH 5C2BH 2LR4A 3ZE1B 1WTLA 4OIFA 2A9NH 1CK0H 2CAKA 5CZRA 1JNLH 5C0CB 2FBJL 5AKRA 2FO4A 1U8KB 4N0YL 4WGVB 3U0WL 3V6ZB 1MCHA 2WNKA 3R0NA 1K6QH 2H47C 2QGCA 4JO5A 3CFJB 4XPHH 4FQ2H 4Z77A 2XZAL 3ZR6A 3TPUA 1SF5A 4OM1H 4UV7H 4RX4A 2Q86A 4QOKB 3GSUB 1U8NB 1DVFB 1E50A 1GC1H 1QRNE 2J55A 4G7RB 5JIMA 1CR9L 5H4YA 5KG9A 3RWJB 3CZJA 4XPTH 3INUH 3A4AA 1AIZA 5KEZA 1IJ9A 2HYMA 4LASL 3BLPX 2J6EL 4PEEA 5DJ0B 4JGUA 3ZKSD 5ICYB 2XN9A 2CGRH 2MIZA 3W0WE 4U49A 1PIFA 2MFNA 3NJFA 1F4XL 4W4NA 3RPKA 3A47A 1D9KC 4IDLA 2XG5A 1E27B 3NJXA 3RWDA 1CGTA 3B2XA 3Q6GH 4ONGH 3NZSA 4X6BB 5E51A 4FG2A 3G6DH 3SCMC 1OSYA 3CN0A 2VLME 3V6OA 4FABL 4HOXA 4AMXA 3EOTL 2EDNA 5HGDB 5F8QC 4Q0XH 3G04A 1E5AA 4PJBA 2XXFA 2CIIB 3K6IA 1DBAL 1YEFL 2E6QA 4GAJH 1W2KT 3VFSA 2AXWA 1WC7A 4N8CH 3VFUA 1X7QB 3VTMA 2DYPD 1DVQA 3JV4B 4OZGB 4F9LA 4FEMA 4BUHA 4JFOA 1J9QA 3D2TA 2YUZA 2B59B 4PY8I 3WKYA 1BLNB 1M42A 3VFOA 2YA0A 5T1LA 5ADOL 3CSYB 1NFDF 3S5YA 1DO5A 2Z7YA 4R4BB 2WBJA 4ATTA 3IF1A 4X4ME 5IMOA 4EN3A 1IBFA 5IJKC 4L8DA 3JV6B 1VPOL 3IFOA 4KUZL 1HXYB 1BVZA 2I5YH 1GYCA 1NPNA 4WKZA 2XNAA 4Y5YC 3TH4T 4JM4H 4AVHA 1T6WA 1HX0A 1T1XB 2FSDA 4ETQB 4ZW5A 4R7LA 3ZYJA 4ABWA 3VQ1C 4M8QB 4F37F 1S7QB 5I8KH 3C5ZA 3LEVL 4H1LA 2ZNWA 1A1MA 1SHWA 3OBAA 3TO4B 1NL0L 2WQRA 4IU3B 2VR7A 3O3BA 3N42B 3BH9A 2JIXA 3BUPA 4G7YH 5DJ2A 3BZ4A 3KYNA 1MN4A 2G3MA 2OA9A 3LHPL 1X5JA 5CLZA 1QVOA 4OF0A 1N8OE 2GUOB 2GTQA 4C47A 5D2LF 1E4KA 1E2ZA 2P8MA 5ITFA 3LEXA 3O11B 4Y5XC 4N20A 3ARDD 2OJZL 4IHOB 4PRHD 4P2YA 4RDBA 3FQ1A 4HJIA 4M62H 3TIDB 4NKMB 1EAOA 3T0ED 3PF2A 3Q8EA 2NXZC 4PJ7A 1PZCA 2Y1YA 4EIZC 5A2KH 1BFSA 4X2UA 4D94A 3MV7E 1BZ7A 4Q52A 2IAMD 1G9EA 2X4QA 4Z7QF 2G4GA 3MRGA 3WFHB 3BT0A 4XX1G 5DQDL 1WZMA 2A6KB 2GAZB 2HT4C 4OF5A 2KL6A 1YDPA 4H44C 1U93B 5E2VL 3GMQB 5FV2A 1FHNA 4F8TA 3M17B 3QEQA 4F7PA 2CDGB 4JCLA 4BZ2L 3TIEA 4WDIA 5J13B 4HP5A 3V79C 2DQ6A 1CD9B 3A6OA 1OGAE 1XBDA 1G6RL 3LRHA 2MCPL 5IEKB 3B2MA 2EEDA 3W38A 3BRDA 1CI5A 5I73B 1FZJB 4N6RB 4QMEA 1ZHBB 4PJDB 1RZ8B 3P77B 4HUVB 3R18A 2ALWA 3L4TA 3LPWA 4LBAA 5IROA 4YSTA 4ANWA 4KNTA 4P23A 4CU8A 1JK9A 4ZFZA 4F8LA 1G7QA 4YGAB 5I2IA 1S9XA 1UXSA 2O5NA 1KEGH 3TEYA 4PLKC 3GXPA 4LZKA 1KTCA 3F58L 1L9QA 4HJJL 4W81A 3OR6A 4QI3A 1A7NL 1MCOL 4PWFA 1T5XA 3M8OL 4FTVE 2XWRA 4PJEA 4CUCA 4Y89A 3IT8D 3HCVA 3RGVD 5IMLA 3I02A 4PJ6A 3GIZH 3H6AA 3MZTA 3PAUA 2XWJA 2EC9U 3EFOA 3I6KB 3MNVA 4FHBD 4G1EA 4ODUA 4P59L 4TQPA 3B7SA 1CICA 3PJLA 4UZSA 3TS8A 4IOFD 3EADA 5E2UH 4W9KC 1FL5B 5ERWA 3BKCL 3OX8A 5CUSH 4EDWL 2YAQA 1JUFB 4I87A 1UWGH 2IQAB 3UROR 3MRDB 2D73A 1JJUA 2KPWA 2WTPA 3OG6B 4JPQA 2ZUXA 3PGFH 1PZDA 5E9DB 3RJQB 1XTMA 4J8QA 1ORSB 3B7TA 3I84A 1FNHA 3LPOA 2HRLA 1NICA 3DXAE 1MZYA 3ZOAA 3CU7A 4PRBA 2BSDA 4J3OD 4OQTH 2XQYK 2NR6A 2Q8AL 1KCVH 3DVFA 4B0MM 2BC4A 4UAOC 5GGRA 4ORZC 3VXPB 1ZVSB 4HX1B 5SWZD 3L3KA 4WF7A 3PNWA 2ZP0T 1E28A 2DWSA 4JO4H 3MRMA 2BP0B 4WI8A 4GUPA 4BWWA 4M6NL 4LLQB 3HG1A 3ZT6A 1F6FB 3O3DB 4JM2F 4C55A 4ZI8A 3JTBA 4YJZL 1REIA 5FYKU 4L23A 5GRUH 1C16B 1G7IA 1ERNA 3ARGD 1OVZA 3DX9A 4PRPA 1OTSD 1TYRA 6PAZA 1R24A 2K8MA 1ZXQA 1U41A 4M93C 4IIQB 4NP4H 3EXLA 1YMMD 4HBCH 4LHUD 4R0LA 3CFMA 5BPPA 5DJ8B 1ITCA 1SXSA 3MR9A 1G0DA 1OW0A 3MLSH 5J0BA 3BRFA 1XF2A 3U0WH 1LE5B 1X4YA 4KRMB 4R7VA 3FT3A 2IXQA 1L5GA 2AJ3A 1FVEA 4BDVB 2ZYSA 3UTTE 4FQJL 4ZMOA 4TVUA 2DDQH 2VERN 2QHLA 1T4KB 4PS3A 1BVLB 2NYYC 4WCYL 3K0YA 3WGUB 2FEDD 3ZTDC 3DKHA 4D9QE 2H0JA 1MELA 3HS0B 1GTNA 3SIKA 4JM0A 3TF4A 3FDWA 4LASH 4CW1A 2BVQA 4YHIB 2Z31D 2ESVE 4IBTA 1HILA 1M7IB 4P4RB 3HBZA 4KKBD 4JDEA 3VI3A 5ABAA 4A68A 1X6NA 3WGVB 1IC5L 2CO2A 3VYPA 1A21A 3IPBA 4AEEA 4LHQB 3SE6A 1CDGA 1KCSH 3SDAB 4D9RD 3S0PA 1HL5A 4RBPH 4Y8DC 4AH2B 3D51A 2FIKB 1KTKE 3MUGA 1JIBA 3FTGA 1KLGB 3EOTH 4POZD 3DRTA 5H35A 4DEPC 3V5KA 5KAQF 1VFAA 4BH7B 1W72L 4ANUA 3JWOL 3KYKL 1YEFH 1G7LB 3KPRA 1DSYA 5B38G 2ZCLL 2WXIA 4RFNB 4TVPE 1G7PB 5FUCC 4OLUL 5I1AA 1EA9C 2YPLA 5DRXB 3WEBA 4TLKA 5JW4Q 1ET7A 1UENA 5D71H 4KDTC 2OV0A 4UQ2A 5ADOH 4OJDH 3A4FA 3CZGA 4APXA 5FA3A 4JHAL 1BFTA 3P2BA 4NM8L 4PV9B 2RGSA 1IGIL 3ETTA 2A4ZA 1VPOH 3QFJE 3DUSB 2XN9D 2I27N 3GSXB 3JZ7A 5IV2B 1HYSC 4HK0B 3MLTA 5TH2A 4GQQA 2BWIA 2D7TL 4RZCB 1FZMA 1KB3A 4YSUA 2C3WA 2X4UB 3N55A 2WLZA 2FWSA 1NGYB 3NBNA 3TNNB 2PYEA 1RUAL 3KPQB 2AEPL 4DPRA 5IMMA 4AIZA 3IDJA 3M45A 4MTMA 2EDFA 2H6PA 2LT9A 3LEVH 4PV8A 5L8KB 3T2NL 4NBXB 3N50A 5HTSA 3U1QA 2PCPA 5JHDE 4UQBA 3U0PA 1FNSL 5CSGA 3DWTA 3HVDA 4OGAC 4YO0B 3O2WH 3MJ9A 1WAAE 5G5DA 4C56B 2CHDA 3QUXB 3QZBA 2MEJB 2UXVA 4LU5L 3QUML 4DTGL 3V0AC 1HZHH 1FIGH 2P3YA 1ED3B 3NA4A 4L3EB 1AD0A 5AVVB 3GMOA 2BSBA 3L3HA 3FCGA 2OJZH 3BVVA 3QIBA 3QXUA 3EO0B 1AGEB 4XZ4A 1WS8A 2Z34A 2WBJD 3FF8A 1RFDL 2JJWA 5IW3A 4EN3D 4Q97A 4XRCB 2JE8A 4WO4B 1WWAX 4XP6L 1A7OH 5EZJA 2R2HA 1OSZA 5C0BE 5ICZB 3N43B 2G4EA 1I1CA 4FL4C 4YHYC 1WFIA 2EEBA 1XFPA 4CDHA 3OMNB 2BWDA 5DQDH 2OSLB 1I9JL 2H2PC 3MLUL 5GS1C 5FM5M 4GRLC 3SBQA 4YMPA 1P7BA 2D7OA 4K8RC 4P2RB 5E7BA 1EEZA 2BLFA 3BO8B 3ROLB 2CRZA 4ZMLA 1FN4B 3C5ZD 3P9MB 1VFUA 2WOBA 3SDDB 4KWUA 5L2KB 3A6BH 2LGNA 4P2OA 3SQBB 5HYJA 2JIXD 1DQML 4FQXB 4HPHA 2CUIA 5CIPA 3UZVA 2MPAL 1JD7A 2MCPH 1DEDA 1G6RH 2AQNA 4TNWK 3NZ8A 1PEZA 2A4CA 3ASNB 3CMOL 1MCPH 2VW6A 4PJ8C 1YYLL 4J2QA 4PJFA 1I4FA 1U8LA 2WQUA 3GLZA 5EU3B 1RZ7H 2QHRL 3GGWA 3CZEA 5D7SH 3VGEA 4JFHD 4YBHA 4M9OA 4APQA 2WLLA 2PXYB 4UQAA 2VMJA 4PP1D 5DMIL 1QOKA 4KY1H 3D33A 4HJJH 4BKSC 3OG4B 2OZ4L 1MCOH 4KI1A 3VD0A 2DM7A 5TGBA 1ZWIB 1IAOB 3G6JE 4FXKC 5T8IA 4P59H 1MJ7L 1MJUH 4O2EB 2GIMA 3T4AB 2IQ9L 5FO9B 1HHJB 1BBDL 1G9NL 3N44F 3D12B 3MXVL 2FWUA 4FA8A 4QRPA 5BVPH 1QFUH 3C9NB 1ZHKB 3QEQD 1B2WL 5J3HC 4E9QA 3BSHA 3ZKQD 2ZYHA 2JF1A 4J3OG 2VZTA 3KYMA 5LNDA 1BD2A 2OL3H 2QDVA 2CR0A 4XNAA 1X9RA 2GITB 3BSGA 2QPUA 3FS9A 5T5FA 1VFBB 5CEZE 3BVNB 4ZSOE 3RIKA 3MRBA 3QQNA 4XAKE 1I8KA 4UWQB 2EXWC 2PWEA 5IROD 1IKNA 4P23D 1J48A 3RFRA 1AHMA 1B9ZA 3MLZL 5A6LA 3DTUB 3THML 1OOWA 3ECBB 1W0VB 2OAAA 5FECB 1MCFA 4NNXA 1JWSB 3K74B 3FB8B 3R06B 3VO0A 1TENA 4RWYL 3QRBA 2OLDA 3SJVE 1GR7A 4PUBH 5AOIA 1J5DA 5TDOA 4YEFA 2FZ3B 1NSNH 3O4LA 4HGWA 3OHMB 4J12A 1CICD 4QYOA 3WD5L 4AIOA 3DJZA 5A6IA 5BS0B 5AB0A 4YDVB 2LU7A 4HPYL 2VRKA 5F1NB 4A04A 1ZE3H 3SSGA 1U30A 4HWBA 3M1OA 1LWRA 3KEDA 4FYSA 3FQRB 3DJ9A 4QT5B 1N67A 1BVOA 3QDMB 1NKGA 4LESA 3VGAB 4Y88A 4CBZA 3BHBA 4YZFE 2XIDA 2IGFH 3TJHD 2XQYG 5E1GA 2ZD0A 1GJUA 4K5PA 4WCYH 1DSFL 2F19L 35C8H 4QRRA 4B9YA 1HDMB 1W8NA 5D1QB 2B9AA 4M3HA 2UY6A 5EH1A 1QFWL 3GI8L 5D2NC 4ENEC 4J2XA 4GKZB 3RY6C 2MQCA 4YBLC 5I6OA 4M03A 3HG1D 3BIAX 4JJ5B 4Y4KD 3LCYA 2QJDA 1Y0LA 2X4NA 3DK0A 4PSPA 2QPSA 3WNKA 5LCVA 2PO6C 4PRPD 4UI2A 3ZL2A 4LCWA 5HBBA 2BOCA 2MHAB 4OVUA 5HVHC 1D9KB 5EEYA 5EU7C 4KO5A 4N3TA 3PHSA 1XGPA 5LGJA 3V0VB 1S2EA 1KGIA 1U3HB 5JPNC 3KR3H 1G7MA 4DO5A 3SCMB 3O3EA 1IEHA 4O02B 1W72H 3REWB 3VNZA 4X4KA 2NCEA 2VDOB 2JWYA 4MCZA 2HCZX 4X4YB 1GZHC 2Q7YB 4OLUH 3HBQA 2JCWA 3LD8B 3RBSA 4LT7A 4EQ3A 1WCBB 5I1KH 3Q5TA 4W6YB 3MUHL 5T3ZD 1EFXB 1AACA 3KM2A 2DPKA 3E6HB 2GIYA 2BP5M 5KJ4A 3T3PB 1I8LA 4K9EH 2B14A 3MTRA 4UTCA 2X70B 4U6YA 3VA6A 4JFFE 3BZ5A 4UMSA 5GZNA 1IQWH 1IGIH 3PP3K 2GCYB 4Z6AT 4JQXC 1NFKA 2BFVL 1W0YT 4MNHA 1GVIA 4RA0C 2ZSVB 3RL2A 4EKXA 2D7TH 1F2QA 5HYQA 3ABMB 5DD6B 4NKOB 4UT9A 1N6VA 2DJMA 4A7TA 5BCAA 2UWEF 2EYSA 3STZA 3U7AA 5SWQA 3MV8A 4Y5YB 3Q2WA 5DHYA 3ULSA 1V55B 2NX5B 3L3DA 3LQMA 2WUCL 2F7IA 2XX0A 4GG8B 4IU2A 5IBTL 3UZQA 1QNZL 1F4YL 4NC2B 1VEOA 3T2NH 5AEAA 3OAZK 2DYSB 1BIHA 5EF0A 1JI1A 2HVBA 1OAUL 1FNSH 1VCAA 3ARFB 4XR8C 3V5HA 5F97E 5I76B 3VWJD 5DWUL 4W93A 2IWGA 4WU7B 3TX4A 3II2A 4NQVB 4LCYA 3VFVA 4H8PA 2WVUA 4HIEA 3S96A 3U4EA 4OZ4B 5CFHA 5I19L 1NEZB 3UIZA 5HI4C 3ZHDA 3H8NA 3V6BR 4P5KA 2YPLD 5E8EB 5KYXB 4IBWA 4Z7AA 1WBYB 3WU1A 5FOBB 2LLLA 5AWNL 2DEYX 1Q1JL 2Z65C 4HKBA 4Y5XB 1XGRB 2YXFA 3RVTD 2W94A 3VYOA 3BJ91 4H0IA 3Q6FA 3I3EA 1OZTG 4OAWA 1OO2A 1NCDL 5DYOA 5GRWA 2YSTA 2HFTA 3DV4A 3KM1A 3DGGA 1LK3L 3TGXA 3BSZH 3I2CL 3O2DA 2XC8A 4YXLH 1EXUB 3T6QC 3OR7B 1I9JH 4H1LG 3MGAA 1A6AA 3WHE1 4MS8D 1LMKA 2J2ZB 2CA3A 3DNKA 2H0FA 4OZHB 2OMXA 4Q9RL 2F5BH 2EINB 2EIBA 2XUWA 2WVVB 5DD5L 4ZUTA 2O61B 1X5MA 5GRXG 3FQWA 4HS6A 1P9MC 3ILPB 2ZUUA 3AAZB 1DUZB 3Q9QA 3EO9L 4NUJA 3CMOH 1JGUH 2DKSA 3GMMA 4PJ5B 1YYLH 3S4SA 3VI4E 4N2NA 1FJ1A 2H41A 3O6LH 2QHRH 4OV5B 5MENB 1TZIB 3ARDC 2EEXA 1OGTA 2DYRB 1P0SE 5E94B 3RWGB 4W9CC 5EZLA 2NY0C 5DMIH 1T83C 2Z6FA 2H1XA 3NJLA 4UV4L 3CQQA 1KPVA 3V4LA 3TESA 3HUJB 4WHTB 4KK5D 3S3PA 2IAMC 4NNYA 2CH8A 1CZ8H 4WGKA 1RJYB 2RFXA 1ZLWK 2ADGA 1KB9J 3EZ8A 1MJ7H 1HH9B 3DV6B 3ARWA 3QCTL 4LL1A 4NQEE 4KZEH 2IQ9H 2FH8A 1MUJA 4JHVA 1G9NH 3GM0A 1V10A 5DD1L 4ANKA 1U8PA 5A6MA 3EH2A 3B9AA 3B9DA 3SKJH 3UJIL 3OZKA 4QXTB 4QCIB 5IW6A 4ZNEE 5HYJD 4P2OD 1PLGL 3V0GA 4OUUB 4W6XB 4WFFD 4MWFB 2FB4H 5K9OB 5F7AA 1CF1A 1KFGA 2TSAA 4PJHE 5I5MA 4GXFA 3W3BA 2OMTA 4PRIE 4U6XB 4M48H 1F5WA 1HVXA 4LCUB 1WBXA 3MGTB 5FUZL 4X6EB 2LFGA 1KBBA 3DMMA 5AKVA 4APQD 2YAOA 5T3XH 2O5XH 4UAOB 1E8WA 4ZZFA 1YNTF 4B3EA 3P4LA 5IJVB 1DDTA 2VQTA 5FB8B 3BGAA 4XVSH 4JO2H 3WIHL 2KQNA 2JV6A 1UM6H 4QY8B 3FRPB 4A2LA 3K71A 4JGMA 1R3IL 4LAJH 3BVTA 3RGVC 1S3KH 4DK5A 1KJ2B 3CK0H 3WD5H 3HNVL 2X4TB 1YQVL 4OLVL 4QRPD 3FRUA 4Y1SA 1FZOB 5F89A 3QARA 3S48A 5IBUB 4M93B 1P7QA 4HPYH 4IOFC 3EYFA 1ACYH 2ZJSL 2ZX5A 3DROB 4NAJA 3IPFA 4NQCA 1ADQA 2JTDA 3Q01A 3MCKA 1QG3A 4N90D 1BD2D 2C3XA 1YN7A 4WY7L 5IKCB 3FB7B 4BE5A 5EEZA 5A2AA 1Q9LA 1JGEA 1RK1B 1DSFH 1RK0A 3CU1A 4HIJA 4TTDC 1CIUA 1ICTA 4N2EA 4CMHC 2D9CA 1E4XL 5KVEE 4G8IA 4P3DA 4XBEL 3RUGE 3H7BB 3VMPA 3ZDXB 1CDYA 4HUNB 4IRSB 2WZ0A 5GRVK 1PY9A 4ELMB 1IBHA 4ANXA 4PRAA 2R27A 4U0QB 1RULL 5ID0A 5AVZB 4LFHD 3RHWF 1MI5E 3ILDA 5I1LA 3MYZA 3PWLB 3ARGC 4OFIA 4AJVA 4L8BA 5TQ2L 5IWLA 3O4LD 5AW5B 1FP5A 3AS3A 4HJ1A 4W9ZA 1LK2A 5IMKA 5PCYA 4BXSV 2E27L 4BUGA 5EZPA 3Q43A 1J0KA 3NIFE 2OMZB 1PDKB 4JJHA 4RAUA 2WIIB 2Y3AA 3D07A 5FW8A 5GGQH 4MA3A 5DZNA 2FJHB 4QRSA 3E9UA 2NDFA 1KXQE 4DEPB 4IMLB 4YVNA 2J12B 4PRNB 1ILUA 1S9YA 4NC0B 3R8QA 2O72A 3WG7B 4IBVA 1IT9H 7FABH 4PG2A 4CMMB 1U8MB 4QRRD 3OKMB 2FEDC 1HWGB 1AKPA 2NYKA 3BDYL 5FV1L 3FJTA 2HX8A 3CDYA 3DBXA 1XR9B 4OB5H 5D7IA 2OKMA 3OZ9H 4NPYB 3F64A 4H8VA 1KGYE 5AVXB 2AITA 3ETBF 3IS0X 5I5JA 5F7FA 2BFVH 2AXFA 2Z31C 5FK9A 5AVWB 1TJGL 2PETA 3UYRL 2W0FB 3OSVA 1WWWX 3QZWA 3UGEA 1S9WA 4LCWD 4P05A 1TZHA 1WZ1L 4DP1X 4P2CG 4YHNB 1FPTL 1IE4A 2D31A 1MFDH 1TTFA 2I25N 2WUCH 3FU7B 5IBTH 1QNZH 1F4YH 3TASA 2HUHA 4LDLB 3SE4C 3BZEB 3EYOB 4POZC 4XVUD 4BEIA 2ED9A 1J1PH 1QLEB 3AABA 3N9GL 4WUUA 3N41B 5SWSE 1KBVA 1S5HA 3TWCH 3FT0A 5I19H 2WWOA 1FNFA 4UQDA 2JKRM 1A6UL 1XF4A 4DO4A 1NQBA 4RIRB 4ZMAT 2RQEA 3O41A 3D4ZA 5K9QI 4ZFOB 1Z5YD 3GSNB 5HHXL 2VC2B 1OCCB 3GSVB 4NO2A 4XI5D 5GZND 3K2MC 3VMNA 4JVPA 4JFWA 4TVPL 3NFNB 1MPAL 2WXOA 5E2TL 4P8QA 3Q8CA 4NQDD 5JNYA 4QJ3B 1S4IA 1OP3K 1DBJL 3MV8D 2YFNA 4L4TE 4DFHA 4FL4B 2CJUL 1PZ3A 4YHYB 2NCMA 1YLBB 2QVIA 4I3RL 1U6AL 3LRSB 4U1SB 2X4SA 3T9WA 4Q9RH 5GS1B 3DO7B 5DS8A 3MLYL 2P44B 3KBFA 5EO0A 3HHSA 4NRXA 2WYIA 4CC4A 2GJJA 3HN3A 5K9JH 5AD0B 2ZG3A 3UDWA 3VXTA 3HRPA 2AJVL 1E9PB 1WAAF 3EO9H 1T66D 4N0CD 3NN8A 2H6OA 3L3OA 2B77A 1AGCB 2W88A 1FORL 4MLSA 4PGBA 3PY9A 4PREB 4QEGA 1IC4H 1ZT1A 3F85A 4Z7OF 2J25A 5DVMA 4YSEA 2HG5A 3V95A 4MSWA 2BSEA 3WDHA 2WBJC 1CT8B 2QQNL 3GBLA 1N7ML 1RP9A 4L9LB 4UV4H 1IEBB 2K6WA 3IFNL 3CDCA 5AVUB 1C8PA 1CGXA 2LAAA 1BF5A 2H8PA 1JZ6A 3KDMB 3ZMNA 3KPPB 1NH6A 3QRLA 2R1YA 4I0PC 5DUMH 4UDUA 1YY8B 1U8IB 5CCGE 5EU5A 3C5ZC 2BNRA 1JHLH 2A9MH 4HEMA 4OCXL 2XG4B 1CXFA 2JSFA 5FWRA 3RYMA 1AIFA 4TOYH 5KBNC 4G8AC 4JANB 1XL6A 1MIEL 1XCTA 1MW2A 1MFCL 5DEFA 5E1HB 1LEIB 1FLRL 1M7DB 4ZUVB 3TBBA 4FXGA 1OWWA 1E4KC 1QHOA 4R7NA 3RIFK 5TE6H 1CD1B 3WIFA 1Y18B 4BQBA 2ATAA 1M2VA 3GJFA 1AC6A 5D4QA 3RJDA 3LPGA 1URZA 4JRYB 1BQ5A 3N6YA 3ZRCC 4RAHA 4X4XA 4PP1C 4U1MA 4URTB 4E0RA 3QO1B 3KYOA 3B8YA 1E90A 5EU4A 1A0QL 3JT0A 3CWGA 1R3IH 2W9LA 4GO6B 4XWOC 1CF8H 1NPUA 4YBQC 3TBSB 1QSEA 4PCKA 2IDTA 1WFTA 4U1IB 3BX7C 3ESUF 1ZS8B 3LZFL 1G9MC 4FOMA 3L95B 3BZDA 2FJGA 3SGKA 3S97C 3G6JF 3ARBB 5CSZA 4JLRA 1S5IL 1DJHA 1WEJL 3CXHK 2BJML 4UTBA 3ZYZA 4GMTH 3VFTB 2YN5A 3IDGA 4LLDB 4L1TA 2LU5A 3UAJA 1A02N 3VJ6B 2YAEA 5C1MB 2Z91A 4WY7H 3BFWA 3NACL 5D72L 3BP4B 3D52A 2HA1A 1C08A 7PCYA 5CINL 2Q1EA 2VMDA 4OCMC 5ES4B 2IALB 1NCNA 1UCBL 1FE8L 3SKNB 3T77A 1E4XH 3KPLA 5IROC 4GSUA 4P23C 3DMMD 5A1AA 4JZJA 2KERA 4XO4A 1EZVY 1RZKC 4DN3L 1QR4A 1TQBC 3WFCH 2G3XA 5E8PA 4X9FA 1CPUA 1RULH 5D2NB 1PCSA 1I1YB 4HC1L 4YBLB 2ZZUT 4RCAA 4M02A 5CEZL 4MJ5B 1IFHL 2A1WL 1HEJC 3LKQB 3N3EA 1HI6A 5TQ2H 2NXYC 4FJYA 4JDZA 1DUYA 2F54E 3VH8B 2PO6B 3HFFA 5JLZB 5I8CA 1CICC 5F9DC 1P7QD 4XTRD 4ZK8A 2BNQB 4YC2C 3SGEH 4FD0A 4P9HL 5CU5A 3CJJA 1WT5C 5JIPA 4NQCD 2IWEA 5JPNB 4BK8A 1J8KA 2BOBA 2BSRB 1GRWA 3ARXA 4ZPTA 1FVDA 4QOKE 4G6KL 5JUEL 1IJNA 1LHZA 2BHZA 3KGSA 4ODTL 3U79A 2K4WA 3FTYA 4YZFF 2XHNA 5ALBH 3Q1EA 3BDYH 2ITDA 2LE9A 3JTSB 4MMXB 2F58H 3HE7A 1NGXB 4KZDL 1I7UB 3U6RB 3WNOA 2L4OA 3QG6A 2YKKA 1VADB 1TJGH 3UYRH 4KY2A 3B2UD 4Y4KC 1HT6A 3N91A 3NVQA 4IEFB 2ZOKB 4M7LT 4LLYA 1UJ3A 3EG9A 1FPTH 4KTEH 1NCUA 2DQTH 1BVNT 3ZZQA 2EADA 3LPPA 2R56H 1CN4A 4NB7A 4E41A 5EF3A 1DJIA 3EDEA 2BZDA 2ICWB 1OW0C 1PG7W 2WD0A 1KV3A 1NEZG 3MA9L 3N9GH 3N1FC 5F1IA 1VDGA 2VL5A 3GRWL 4OZGE 4CN1A 5JORA 4XMZA 1TQSA 3D34A 3PUUA 4M9PA 5FO8B 1PU0A 4RFOH 4K5MA 3WL9A 1O9ZA 3MJ8B 1UHVA 1TZOA 4TF4A 3TO2A 2YPVA 3FQXA 3FSAA 2P43B 3BPCA 1QX1A 2ATPA 2O6DA 3ALPA 3IXTA 1AG0A 3QP3A 2RBLA 1T89A 1UFUA 2I9LA 3VFNA 1NCWL 1KENH 5C6PB 4LCCA 2BY0A 4C4UA 1MPAH 2OSWA 5HJ3B 4BA0A 4TUKL 3GEWB 1D7BA 3L9RA 3U36B 3AJ7A 1SHSA 4KGJA 3LZLA 1EUTA 1DBJH 1MDTA 1QFWM 1KGCE 2CJUH 1LNUA 2G5UA 1A8ZA 4J6IA 1U6AH 4TUUA 5K93A 4CC1A 4PGDB 4BYHA 3IU4H 5LN8A 3OD3A 2YGNA 5SX4H 3P30L 2Q3AA 2WV3A 4YSRA 3T8MA 3B3BA 4WUUD 1SOQA 1UWXK 3VWJC 5I17A 1J0HA 2AJVH 5AAPA 5EZIH 4OD3L 5AZ2L 5JW4M 3OKDB 1W91A 2CBPA 4BKLA 1FORH 2HVKB 3MRHB 4A7GA 3TBYA 3BDXA 3MNZA 3HE6B 4X83A 3AGVA 1TFHA 1UM5L 3MCYA 2WXHA 1F41A 4HWNA 4X6DA 3SO5A 1IU1A 1ZT4B 2G75A 5HHPB 5JW5A 3QDJB 1FC2D 3MLXL 2EXYC 4GFTB 1S8DB 1F97A 4JPKH 2HUEA 2IF7A 3CQFA 2X6VA 1OARH 3L5WA 1WLHA 3D0LA 4LSPL 4V1DA 4OLZL 5FUOH 5ILTH 4MAZA 1KJVB 4S2SB 4TQIA 1KIQB 2NY0B 4LBEB 4U1JA 2GT9B 5D9SA 2A3TA 3BAIA 4ZAKA 1T04B 1RJLA 2J8UB 2IAMB 5IJDC 2PABA 1HAWA 5D7JA 5F7NC 1INEL 2E8YA 2X4RA 4MS8C 2P8PB 5IG7A 4F1SA 1CMOA 4BSVA 1PZ5A 3WNLA 4CVWA 3RY4A 3OXRB 2CPUA 4HUUB 4OCXH 2NY7L 4FXLA 4D0BB 3MRCA 1ZTXH 1AD9A 4LDOB 1MFCH 1RJCA 3QAZC 4I18A 1D5BA 3BI9X 3GSRA 4YDJA 4PIRF 5CJBA 5MEOA 3O6FA 3MDJA 5IFHL 1I1AD 4LAQH 5JIHA 4B9FA 2BY2A 3GJFK 3RWEA 4KRPB 2ZTBA 5LWYH 2X9YA 4OM0L 4QTHB 3VI4F 2WINA 2AXGB 4QR7A 2E4FA 2BSED 4XBPA 3SGJC 1JZ5A 4HOZA 3FRPG 5KYYB 3WFDL 4JZNB 2C7UB 3EFDL 2X9XA 4HF5H 3ROOB 3AB0B 2G30A 2VM4A 1SJEA 5CJXA 1A0QH 2EIDA 3BZFB 2YD9A 4KK5C 4RFEA 5FWQA 2P5WE 4RESB 2W9DL 1N3NB 1UEMA 5IBUG 4XMXA 3UEZA 3FSZA 4M1GL 4IMKA 3LIZA 2IPKA 2RD0A 2ODHA 3RX5A 3PCYA 1KSRA 1IAMA 1Z5LA 3NRQA 2R0KL 2QBWA 1OE3A 2BNRD 2CKBB 4KKCD 4O51A 3RKDD 3ZIMA 3ZTJH 2BSTB 1HFUA 3WLWD 4AYFB 4KK6D 1SXZA 4DGVH 2QSVA 1CLZH 3KXFA 1U4EA 3GINA 4XNZC 3ZIYA 3LNGA 3NACH 4JN1H 4FNQA 4PJ9C 1EHXA 4PJIA 4LNRB 4MD0B 4YK4C 4AQAB 1H5BB 1G9HA 3JVFC 4LIQL 5DJYA 3AU1A 1TCRB 4QTIL 5I8EB 4GI9A 2Z8WC 2CIKA 2J57A 3LXAA 3OB0K 4LLWA 4DN3H 4J39A 4APQC 4CMHB 4UOQA 2EABA 3AM8C 1AP2B 1I7TB 1AJ7H 2NY5C 4PTUA 1XF1A 5IQLA 1NAKH 5LXGL 5D6CB 4LPUA 3W5NA 1FA4A 3Q9PA 1IFHH 1QSED 2ADJA 2AP2A 1HHHB 3HZMA 5CZVH 1XSOA 2Q20A 1NJ9A 4WWNA 1ET5A 3E0GA 3FTZA 1AGFA 1GHFH 2WXKA 1YAZA 4P9HH 4TNVK 1A1OA 2FEJA 3D09A 3CH1B 3QYCA 1KIRB 1W6LA 2G3NA 4KVNL 3UAJD 4Y0GA 2P4AB 4WUKH 1T5WA 2Y7SA 5DI8A 5FW6A 4DGYH 1QPPA 2Z4QA 3QK0A 1BWMA 2DWYA 4PI2A 1MCDA 4X9BA 2EIEA 3WY2A 4A7VA 1BF2A 1H8NA 2WKOF 5INDA 3L08A 1MQKH 2ICWI 4UT7L 1HINL 1IKNC 5FO7A 2GJZB 2DQHH 2PTTA 3BAYA 3GB7B 4JRXB 3VFGL 1ZCRA 2HB0A 3MNDA 5DD3H 3RUGF 3O0LA 1IILE 2GTWA 3LB6D 2P5EB 1KB5A 3UIYA 2X09A 3MVSA 2XV6B 5IVZB 3DDGA 2Z31B 5I1EL 4L4VB 4M7JL 5I6LA 1I9RL 1UZGA 4AYSA 4HK3N 4DN4H 5KVEL 2GJ6A 2YEZB 2YMXH 4L3CB 3P0VL 1TETL 2A9BA 3HAEH 3DK2A 2D03H 1DN0B 3R7RA 5JXEA 2FR4A 4OFPA 3MA9H 4AIEA 1T7WA 1BJ1H 1F0LA 1YEKL 3FUEA 1XCXA 3K6FA 3NIFF 4OT1L 2WQSA 1BXUA 4X4ZA 1AMXA 3HB3C 4Y4HA 5J6HB 1SBSH 4MJ4A 1J05B 1DQTA 2JCCA 4P2QB 2VR9A 1JZ3A 2VRAA 1EAPA 2W65A 4KI5E 1OPGH 3HE7D 2KZ1B 3ZKXC 3VXMA 5MHSD 3U7YL 3RX9A 4YXHL 1DVZA 3QZWG 3LEYL 3S5LA 1AG6A 2C9UA 4URKA 5IQ9B 2VR4A 4WWKA 4XNMA 3H56A 3BW9B 3BWSA 1I1FB 5KYWB 4MJIB 2FVNA 5M95B 1F1AA 5DVKA 1DVSA 2VZ1A 4EI6A 4NP9A 4U6HB 5I15L 5BUGA 1TKWB 4WW2C 1ZTMA 4Z5RA 1ES0B 3NIGB 5EOTA 4E41D 2FT8A 4HUXA 1K8IA 4QAMB 2EIZA 5KUMA 1A7PH 4FFZH 3S3DB 2P49B 3HC0A 4C56E 3FN9A 5DRNB 2FYYA 4OD3H 3T2OA 4PJXF 2BS8A 3O6KL 5AZ2H 3T3MB 1HSAB 3FKUS 4L3EE 4PYHA 1M05B 4P48A 4JFDE 3QJXA 5CLXA 3VDBA 1UM5H 3F62A 5EO9B 3P4MA 1DVYA 3QFDB 3K6NA 4N2OA 2QQQA 1MFAL 3CDZA 4LF3B 3MLXH 1GA2A 4RMTA 1HOCB 3MRJA 1MIML 3HJEA 3K81A 4XI5C 2WLNA 3O9WB 3V2AR 3VWKB 5GZNC 1A6VL 4NNPH 4LSPH 4OLZH 4YIQA 3RNKA 1XAUA 1PKQB 4B9PA 4Z18A 3BRGC 3IETA 4GH7B 2ZF8A 4NXSA 1FG9C 5KZCB 3LVTA 4P2RE 3QUYA 1N2RB 1INEH 2OMVA 4ZYKB 5BZWB 2NQ3A 3QCVL 1M3JA 4GRMA 4X9IA 4I0PB 1KN2L 1A65A 3UG5A 4P99A 4FAAB 2NY7H 3RG1C 4FYRA 4YDIH 2OI9C 3DVGB 3MQIA 3B1UA 4CSZA 4JDVB 1HH6A 4ICWA 4FXTA 5F9OL 3T04D 1SEQL 3LXCA 1H0DA 1VFMA 3A6CL 5DHVB 3OKYA 1JF6A 4ODVL 4AL8C 2C3VB 4OM0H 1OSPL 4ELDA 3F7YA 1KTDB 1FL6A 1YMHB 2X88A 4IRJA 2Q2EB 2OMBA 2ZXQA 3BD4A 2DI9A 1DQDL 3HZKA 5GGTA 3QEHB 3WFDH 7TAAA 2BX5A 1N59A 1YJDH 1MCKA 3EFDH 3G5YB 4EZMA 1ZGLP 4QAWA 4V1DD 4XCYA 2B15A 1ZLDA 1IBGH 4AENA 5EEXA 2W60B 1G1CA 3TFKD 3EYSL 4HLEA 3CFKB 3L4XA 5E2WH 4AG4L 1JVOA 4GINA 1HSBA 4NC1C 5D7JD 5DURD 3RGHA 5FR3A 3NK4A 3FQNA 5KANI 2NNCA 1BJ1J 5F7DB 2QDWA 1H9VA 1A6WL 1BSIA 2A6IA 2VLRE 5JHDB 1SJHB 3MHZA 2EH7L 4OIIL 4M1DL 2JXMA 2SEBA 2WO2B 3DARA 3ISRA 4N2AA 5JQIB 3PDOA 3O6FD 4MA1B 4FLQA 5EV7A 4JFQB 4KXAA 1N64H 1JFHA 4MQ7A 2W0KA 1NM4A 4LIQH 5LQBL 1J1OL 1A9BA 1R46A 2QR0B 1VEPA 2V9UA 3BP6A 3FFCE 4I3GA 3PWNA 3CUPB 4B7LA 2J1ZA 4LPYA 1JGLH 2X28A 4TL5A 1IE5A 3L1EA 4UM9A 5C09A 5J6GB 4AC2A 2Q10A 3MLVL 1LO5B 2DD8H 3PWPA 1M53A 3RNQB 5I8OL 3D18B 4N26A 4NO5A 3VH8G 1TQBB 2GSGA 3FHQA 3MOAH 1QFOA 4JB9L 4EDXA 2OR9L 4BFGA 5JHLL 3BN3B 5D70H 3K4DA 2X0VA 2YSSB 2GSIA 3NEXA 3LXBA 2W0LA 4R5XA 3X14A 2EEAA 5E6SB 2HRPH 3ZE2B 4JPIB 2NXYB 3QJFB 1W15A 3WKPA 3GO1H 1CFQA 5IEHA 4JPSA 5FDWB 5MP6L 4M61B 2Y0SA 3KD4A 2DLEA 4BCZA 3L7FA 3KXFD 3QDME 1JV2A 1NBVL 3DOHA 4OBSA 1HN1A 4X98B 3V0WL 3VG9C 4NZUL 1EAQA 2N7AA 2AQ3A 5F6HJ 4F7EB 5FDYA 1IFRA 2CG9X 3D2UA 4Z7WA 3ESPA 1RH8A 2FECI 3FO1A 3T5WA 4UT7H 3MRFB 4NKQB 8CGTA 2WW8A 1BZDA 3D48R 5EULV 2CU9A 3DMMC 3VFGH 4V33A 2W07B 2NY6D 3HI1B 3D06A 4JQVC 2XRAH 3GKWH 3WXWL 4NQSB 2NW3B 3MODH 4POYA 5HI3D 2AANA 3FUDA 5I1EH 4K3DL 4Y19A 2A77L 1SLWA 1NMBH 1TTBA 4AGNA 4LOFA 4H20H 4Y4KB 5PAZA 3WSQL 1KULA 3RVUD 1EO7A 4LSQL 3WHE0 2VXQA 3ZE1F 1RZIB 1SMOA 1WITA 4Z3IA 3P0VH 4HWZA 5E1IA 5JW4N 1TETH 1MCNA 3PYCA 4P06A 4G9FE 2ZQKA 4DKFL 4XTRC 5FHAH 1S9KC 5KSBE 4PWIA 4F80A 2G0KA 1T6VN 2MTAA 4XT1C 5BV7L 2ZUYA 4RQQB 5C92A 2XSKA 4LSRL 2YN3A 3IJYB 1TQVA 1G7HA 3T3PE 5IVOA 2VH5H 4EVNB 1WFJA 3BKYH 2X9WA 1LO3L 4OQTA 3STLA 4YHPB 1SPDA 4DERA 4Q6IA 1CVRA 3T0DA 1FNEA 3P11L 2YC1A 3MV9A 4G8GB 5B7MA 3IVKB 3OKLB 1HAUA 4PD4K 3T0VA 4QRTA 3VQ2C 5FYLE 2JELL 1F3RB 4JFEE 1M9WA 4MASA 2OXGB 2AV1B 2NT1A 3PAYA 4Q4IA 3PXHA 3L48A 1V8HA 3F7QA 4XMLH 3KHOA 5I15H 3I9IA 5DS1A 5IWLC 5K69A 1AQ8A 2GJ6D 4ALAH 1TFPA 1DQQA 1CURA 3K2UH 1AO7B 2QVMA 3BPOC 4UT6H 4R26L 5JXED 4M7LL 5C0AB 5I30L 2HFFB 4WU5A 3IDUA 5EN2A 4L29B 3AG1B 4LRNL 1OB0A 3AREA 3FF7A 3WNIA 1I7ZB 5EUOA 4Y4HD 4YGVB 4DP6X 4FADA 4FP8L 3VXOA 2QKSA 5FGSA 4KJWD 3VWJB 4OZGF 4XCFL 4PJCB 1AC0A 4UIMB 4P9MH 3UC2A 5DR5L 1HS6A 3L2NA 1YEJH 4NJ9L 3KNBA 1V54B 1MFAH 2XA8H 5F1KC 1IKOP 3LMJL 2GI7A 1S7SB 3S35H 2KUTA 3QHFL 2J6EA 2N7BA 2Y1VA 4PCYA 2OTWA 2H3NA 5DZVA 4WWKD 4O9HL 1NDTA 2BWQA 2C4XA 3JSSA 4NFBA 4FS0A 3BEVA 2WGXA 3F7LA 4MZ2A 5ISZA 2PW2A 5C0IA 2QPFA 3H9HA 3L7EB 4BQCA 2WKLA 2JKLA 1E5UI 4EXKA 1DYZA 3FCSB 1KN2H 1D3CA 4UMGA 3OB8A 2ZXEB 3HLAB 3PABB 3W9EA 3N42F 1T7ZA 5GJTL 4B9GA 1ML0A 5L8LB 4PV8B 4G82A 1XH2A 3DBSA 3Q06A 4H25A 1ZA3A 1T1WA 4RGND 4PJ5E 1E4WL 1XTLA 4RZKA 5JMOC 1U95B 3A6CH 3EFFB 1E43A 3QAZB 4WI9A 1BF8A 4WFGD 5DJ6B 5MENE 1OSPH 5JXAL 3GZOA 3FOMA 3HBGA 3OV6A 5KS9E 3ILEA 4N0UA 1MY5A 1QFPA 1DQDH 1IMHC 5A43C 1U4FA 3SBPA 2F5AL 4GXUM 5D5MB 3WDIA 3CVCA 4HG4K 1H6FA 2WSKA 3C12A 3TNMA 2OSYA 2A9DA 2J43A 1CL7I 1Q4NX 1GGUA 4G1MA 2EIJB 4JS7A 4XPFH 4AG4H 3QUYD 1P5UC 4U4IA 4GW5B 1NFDA 1D5ZB 4NHUB 4JE0A 4AT6B 2CO4A 4PB0H 4ZS7L 4G9DA 1EJOH 2EZ0D 1A6WH 5A7EA 5IT2L 4W9LC 3F7VB 1CU4L 1E42A 3MJ7B 4BFEA 2OX5A 4CC4C 4M1DH 4LQ1A 3DDFA 3G6AA 4HFWA 4S10A 2VZVA 1JI2A 1KFAH 2N0KA 3PREA 5TE4L 1RU9L 5CP3H 2BVPB 2COQA 5CIPB 1I8IB 1DSWA 4JREC 4N85A 4HJ0D 4PJ9B 2ZUWA 1I1AC 1TYEB 5GSVB 4NO0A 3TA3C 2FO1A 2AK4E 4TTGA 1FGNL 2XZZA 4G7VH 1NOAA 4IRJD 1U8JB 2W80C 2XKUA 5C0DA 4N9OB 4BZ1H 5B39B 1AGDB 5HHOA 5MI0B 2RA1A 3MLVH 2AEQH 5A2CA 3H9YA 1KGJA 4YE4H 4YWGL 3SODB 5I8OH 3L8QA 5D7LB 3RU8L 1RIHL 1R3HA 2A6JA 2OR9H 5JHLH 1LEGA 1RPUA 2DQJL 4YFEA 3CSFA 1Y1DA 4FQHB 2R8SL 3ES6A 3ET9F 2JK5A 2V0AA 4HV8B 2GTZB 1S78D 3FOLB 4LLAA 1JPEA 2DLIA 4DO6A 3DTXA 1IUZA 4DCQB 1XEUA 2V9TA 5H8DA 1XF3A 5TE7L 5DDHB 4K4KA 3RKDC 3FQTA 3VACA 5C0RL 1NWOA 3WLWC 3NFSL 1JXDA 4M5ZH 1QWUA 2ZPKH 4XMPL 4X6CA 3M1BB 2MCG1 2OMUA 1EEUA 1U8OA 4QHKJ 1J5CA 5ALCL 5TF0A 1CYWA 1QNIA 4MD4A 1G6RA 3V6FB 1DBBL 4FXGC 4ZTPH 3SKOA 5MERB 2E9GA 1MNNA 4HU8A 1FFPA 1ORQA 3DHJA 2XXCB 2QFPA 1QP1A 5DZOA 3DI2B 3IDIB 4JJOA 1M71A 3LKOA 3PWPD 15C8H 3JWDH 5F3BB 5E4AA 2WIMA 5L0QC 2NYZA 5L7XL 1KJMB 4J3OH 1TJHL 3BLKA 4O58L 3K4ZA 5AUMB 5IOPA 4ISVB 5D2LB 4DZBB 4K3DH 2A77H 3ZLQC 1T3FB 2WXLA 1TZGH 5EBMA 3WSQH 2CGZA 2R29H 1AQHA 1HXMA 4YUEH 3BP5A 3SGKC 1TO5A 1WF5A 3L5JA 3MFFA 2OQJA 3PQYA 3F05A 2CDFA 4J4PC 2CLRB 2ERJC 1LO4L 4NQXA 2I9TA 4IOIA 1NANH 5E6ZA 4OJEH 4XPBH 3LQZB 2PWFA 1KTLB 4Q74A 5FA4B 3UAJC 2YOAA 3V4PB 4Z3JA 5BV7H 1UZ8B 3VFPA 5DO8A 2BPBA 4LSRH 5HYSA 3WY3A 4D0DA 3HB3B 3D2UD 4XPAH 5CM1A 1LO3H 3KHQA 3H9SE 3QQDA 4I77L 1YQ2A 2XIBA 1MNUH 3S3JA 5E7FA 1B0RA 3DX8B 4XN4A 1A7QH 4LGRB 4WHYH 4ZS6D 2AVFA 5HHNA 4JZJC 3UC0L 3JV5A 4F3FB 3GMPB 3ZKXB 1TOXA 1DDHA 1NDMA 2YUXA 1DJXA 2JELH 2BW5A 4GSDH 1P4LB 1IM3B 3GBNH 3KPNA 1GIGL 4P4KB 5F96L 3NABH 4ZUUA 5CMAA 2ADIB 3VXRE 1UD6A 1T1YA 4Y19D 2K1MA 4PLJD 2KLRA 3BP7A 5DU7A 1DO6A 5J06A 4Y4FC 1IGYB 2EC9T 1NWPA 3NP3A 4DPBX 4NKDB 5LHDA 4DP2X 4WW2B 3H42H 4HGMA 1JPFA 5D93C 4JM2A 3K72A 2WN2A 4P5MA 4LRNH 5E5LA 1M7XA 1S7VB 3NCJL 1OF0A 4MNQB 1TEGA 1KIPB 1TQWA 5IB1A 3VUAA 4PRDB 3OAYK 3QVAA 5C9KA 4FYTA 4AXWB 5K33A 1GS8A 1KGXA 1MAJA 1TYJA 4Q58C 3SE9L 1IZKA 4FKKA 1ID2A 4X5WB 4R97C 3S5LG 5JOPE 4FF9A 3SYCA 4R96A 2HT3D 5I1JH 1UC6A 2YS4A 3BGMB 3HE7C 3MV9D 4GS7B 1Z9SA 2EJ1A 2Q8BL 4GBXA 1NLBH 1LWHA 1WS7A 3CSBA 3QHFH 4MRBA 5DLLA 4AI7A 2ZOTA 5FYKE 2H2SD 3D4YA 4U3HA 4O9HH 2UX6A 1DQLL 1U0QA 1TU2B 5EIIA 5C08B 3K1KC 3S8FB 2OYPA 1SHMA 5DUJA 3RA7H 1O7VA 1MWAB 1MY7A 1ETJA 4RBPK 2O6FA 3GLDA 4NQDB 1AZBA 5DFTA 4DQOL 2NMSA 3PP4H 2JKSA 4HFUL 2X4PB 5EFIB 1AHKA 1A2YA 2OXHB 2LHAA 2DWTA 1QSFA 5ESAB 1GH7A 1W72A 1WPCA 4X0KB 1FH2A 1K3IA 4KHTH 4LL9A 3TT1L 2VN7A 3TLRA 1E4WH 2XETA 5FFOA 2XV2A 4LP4A 2LLNA 2ISDA 5J11B 1P1ZB 4QYAA 1V05A 2ITFA 3E3QE 1MLCA 4FDWA 2UZYA 4F7TB 1BOGA 1H15B 1NLDL 2RAMA 2PCXA 2M1KA 1K2DA 3W11D 2F5AH 2J73A 5I75C 1T89C 2VITB 2DEWX 2XWBA 4J3WA 3SKMA 3WYRA 3IWUA 5BZDB 4LCCC 1NPJA 2K7QA 3CHQA 1O6VA 4NKIH 3ZSTA 1X5IA 4AM0B 1ZGLA 3EH5B 3MRLA 3N43F 5ISZD 4FQQA 1BVKA 2PKDA 1O6SA 3UMNA 2ALAA 2D4DA 1N5YL 5C70A 3GXDA 5IM7A 3H2WA 4FLSA 2K9FB 1X7SA 2GFBA 3VFMA 5LAPA 3DI3B 4N2CA 4N9GB 2PW1B 3ATDA 2P7TA 3T09A 4F37K 5HGBA 1RU9H 2DJUA 5DGQA 1T7YA 5EPMB 4E9VA 1CDIA 2DBLL 3QUMA 3IFPA 5EOCH 1QW9A 3BMWA 4DEUA 2V3FA 4ODXA 1XSIA 2YPKA 3QFGA 4LQFH 1JPTH 5BRZA 2JKTM 3TN0A 4JRYE 2I7OA 2ZCKL 1T80A 3E7JA 5IB5A 1JMZA 4JFZL 4LRIA 1LE9A 2Z64C 1CFNA 3MGOB 1JYXA 5GJSH 4JW3A 2VQUA 3DYOA 3MRQB 1NGPL 5LBSL 1JZ2A 3KLAB 2NZIA 1RIUL 5CEYB 1RIHH 4A6YB 1K85A 1MVYA 4CU7A 2Y1ZA 1J9SA 3GXMA 1JWUA 2VMCA 2R8SH 3BSZA 4CN6A 4MCYA 1EHLL 3HFML 3WFZA 4H26B 4H40A 2MOQA 1JHTA 4N2GA 5D7JC 4P3CL 1NCCL 2N7SA 2ZE0A 4BUQA 2AQRA 3F12A 1AY1L 3GWJA 3IFLL 4K3GA 5C0RH 3P3TA 5IW1A 2Y7QB 3NESA 3IJ9A 3EDDA 1HIML 2R2EB 1FNGB 4XMPH 4IK6A 5I0WA 3TEZA 3U30C 4U3SB 1EV2E 1YEDA 2V5TA 5ALCH 3WN6A 2VYRE 1KBGL 2QADD 5DMJB 4BHUA 4Y2OA 3UTOA 1DBBH 4LNVA 4XO8A 2X4OA 3IRCA 4NO0D 3QNZB 1F2XK 3VG9B 3QJHA 3UCQA 1CD8A 3D85D 4XNQA 3PV7A 2DBJA 1BM3L 1Q72L 3GQFA 3PWJA 4ZPVB 2Y7MA 1GMEA 4YSCA 3E1ZA 5HHOD 1XH1A 1NUDA 4ESKA 2ED6A 1TVBA 1TJHH 1H6TA 5CJXC 5DVLA 2OZ4A 1L9RA 1XF5A 3QW9A 3RP1A 1N6QH 2L7QA 1NCTA 3UAFA 2EUXA 3BQUB 4DPAX 4FNSA 4A7SA 2Y7OA 3K4AA 4OCRL 2HKFL 5DC9B 1BBJB 4JY5H 1TNNA 4WFED 5EU7E 5DEGA 5HDQH 4PVMA 4PJGA 5KVFE 1LO4H 3CXDH 2CLVA 4MB4A 1DP0A 1OANA 1Z5HA 4ONFL 1RIVH 5I1CH 1AHWA 3VDAA 1XVSA 3D25B 3HA0A 4FEIA 3KCPA 3QWOB 5GZOA 4F15B 4YDNA 1NINA 1ZANL 3CFBA 1CTOA 4I77H 1AAJA 3MCLL 1PCXA 4JKKA 2RHEA 4NYLA 2Q2LA 1P2CA 1DE4B 2D3LA 4PY7A 3UC0H 2H26B 3RDTB 1U91A 4KKLD 5ANMA 2AJSL 5E23A 3FTVA 1CGWA 1ZT7A 2VLKA 4Y9CA 1WUZA 4GQ9H 4FQ1H 1JPGB 5M94B 4DVRH 1LVEA 1SYSB 3SO3C 4HKXB 3RVUC 2R2BB 2MNJB 2IH1A 3L6FB 2VJ0A 4QHNA 1SVZA 3PQYD 3RL1A 4A63A 1TMCB 3MO1B 2FT6A 4RMSA 3F6LA 3QIWA 3NCJH 2ZWSA 2XPZA 3RGBA 1TEFA 3VRLF 5EOCJ 1V7MH 5CD3A 1K5WA 3MMEA 5J5EA 1Q9OA 3H55A 3MREA 3WE6A 5GGSA 3WUZA 2N4IA 4GXUN 1G7JA 5FYJL 3UGUA 3SPVA 1EGJH 3T3PF 4O02L 4GIPD 1QPXA 5E8OB 2B39A 1YEHH 3BAXA 1NAMB 5IHZA 2F53A 4NRYA 4OGQC 1P7KB 2EP6A 1NGZB 2VLLA 2AABL 3RVVD 5BQDA 1DQLH 3VAEA 1BAWA 5T3ZH 5ADPL 4N2DA 5HSFA 5J56B 1RV6X 2Z93B 2DQCL 3CNKA 1DJZA 4BBWA 3RVXD 2DY2A 1DLHB 4U7MA 4I4WA 5B1BB 4DQOH 3A3YB 2DOCA 3TYFB 3G08B 6FABL 2YZ1A 2YXVA 4RRPA 5GRVL 4JM2D 5FYLL 4MFHA 5JXEC 5F7WC 3VRIA 3F6JA 3BXNA 1H9DA 2R23A 4Q14A 25C8H 1SDYA 3HNSL 2GKIA 3DOSB 1EHKB 1JZFA 5IGXL 4AITA 3X12A 3C5XA 2HPTA 2OMWA 5ITBH 3ARUA 1RUPH 1R5IA 5JQ6H 3T1FA 3JQOB 3UERA 5C0EB 3ZDWA 4DKEH 1NC4B 2F8XC 1UADC 4HBQA 3ME0A 2EIMB 4PRHE 3CD4A 3B3IB 1S3RA 1CFTA 3NSFA 4JL1A 4BFJA 2JH2A 3NJMA 4QHUB 4DEWA 2IFGA 4WWKC 1A3RH 1OAZL 4FERA 1JK8B 1L0XA 3L5HA 4UINH 1CFVL 2ZOLB 3IDYC 3SPJA 1QRNA 4YHKL 1OP9A 4E36A 4ZNCD 43C9B 4FFVD 4OZHF 1Q0YL 1P5UB 3COOA 3VCLB 5GHWL 3PP3H 4S1RH 3AGWA 5I1GL 1JYNA 1N5AA 2FL5A 2BXYA 3CIQA 1QSFD 5F7LB 1WBZB 2ZG2A 2CUAA 3KPSB 4O4YH 3R0MA 2UWEA 5J1AB 4GG6E 4MNGA 4RGNC 4NHCL 3SE3A 2DBLH 3BAEL 4K3EL 4OLWH 1YY9C 1N4XL 3HZVA 5INCB 1ZLSH 1E9OB 2C4FT 3NN8B 3OAZH 4JREB 2YARA 3LZNA 1GC1C 3RWHA 1I1AB 4PS8A 2CMRL 3TA3B 1ZA6A 4JFZH 1WA0X 3IDMA 4PGJA 5CEXB 5KS9F 3UCRA 2YHGA 2C9VA 1NGPH 1XH3A 5LBSH 3UTQA 8FABA 2YD2A 2XWDA 1QR1A 2R0LH 1P1VA 3HUJF 2L04A 5F0PB 1FRGL 3WLBB 2FLMA 2JTYA 1UUSA 3GXUB 4XMVA 2JB6B 5GS3A 4P46A 3WAKA 3QUYC 4XBGA 4DP8X 5IR1B 1NCCH 3FUIA 4NLAA 3KL3A 3GJEB 3QWNA 5K5YA 4NFDA 2GBUA 3SY0A 2EZ0C 4EQ2A 3QG7L 1AY1H 3IFLH 5D96B 1QEXA 5JOFB 4GAYB 2CDEA 3SBRA 3W0WB 3O6ML 4HMDA 1HIMH 5C6TH 2B7DT 3ZPDA 1KBGH 2DIBA 3NZHH 5MEPB 4KGLA 2E7CA 1FCCA 1MFEH 4OUOA 1HWWA 4H8HA 1RUMH 4HJ0C 4TN9A 4KKAC 4W70A 4XGZB 5K59E 3VQMA 4JR9L 3TN0D 2EYRB 4OF6A 1IAIH 1BM3H 4PR5A 4YXKL 4ZFFA 2V7HA 4X6FA 2AQ2A 2CBMA 2XIIA 2WSDA 2R2CA 4ZFQA 5SWZE 3QJQB 1E5ZA 1UVQA 1JE6A 2YQBA 3UJTH 1R3LB 4LPTA 5B3JE 1U3JA 1N12A 1QSVA 2OYMA 3BN9C 1VRSA 2LFEA 1QMUA 2Q6WB 2GB2A 2HKFH 3GHEL 1JXJA 1S78C 2YBRA 4KMQA 1YMME 1BIIA 4I2XA 4JRLA 4ONFH 4PM1A 4ZG1A 3MV7A 3WFEL 4W9FC 3KGRA 2CR3A 1UYWL 1BFVL 4KXZI 1ZLWH 4EXPX 1IGCL 3X3GL 5I26A 2OTUB 3AG4B 4Q6KA 4HZLB 1JZEA 2CM6A 3FTSA 1FVCB 3MCLH 4PTTB 2Q87A 3VXNB 2DQDH 4MDIB 2VISB 2KYIA 3C08L 4OCWH 2DWDB 3ZDXF 1U33A 3S34L 3KCWA 2P5EE 3T77B 5K1NA 1AR1B 2V4LA 5T5FH 3FU0A 4O00A 1A6TA 2K3HA 2V3DA 4RGOL 3VXUA 1A64A 1F3JA 1LLAA 4NSKA 3US9A 3T0BA 3WIIL 3WIHA 1A3LL 3C87A 1SHXA 3C2AL 1D5XA 5IQNA 5H37G 3AWEA 1L7IL 1BYNA 1HC1A 1WA2X 1WIPA 2AJYL 1S9VA 2YZ8A 1OAJA 2MCMA 1MHHB 1YNTA 3G3LA 4MDJA 4D9RE 4LCIL 4GQRA 4Y4FB 1OCOB 4PCTA 2H9GB 5HYSG 5HD8D 3HC2A 2BVOA 3WJLC 2EDQA 5D93B 4HUKB 4RAVB 4AEFA 4DAGL 5GZOD 4AE1A 1EH9A 4WV1A 1BZQK 5FYJH 1F42A 3FH5A 3A24A 4I1RA 2XYCA 4Y1AA 4W9HC 4O02H 3KL0A 1PBYA 4P3WA 5G55A 5I1DB 4ILDA 3PE9A 4WLCA 1A66A 2VDOH 1PNCA 4JZOB 4MS6A 1F8TH 4HS3B 4QLRA 4ZS6C 3BH8A 4NRZA 4O2FB 3V0IA 3EH1A 1OEZW 1BQHA 2RQ8A 5T3XD 5AOKA 3ZTCC 2F2HA 1EK3A 4QKXB 2VLKD 1A5FH 5D6DA 1WWCA 2QQKH 3P4OB 4HHWA 4TLUA 2XN9E 4QXUH 5ADPH 1OGAB 1I3RA 1MCSA 2PCFA 2DQCH 5ID1B 2YD7A 1LM8V 2HFEB 3PPEA 4G6JL 1AXSA 3NIGE 1QEWA 1PQZB 1N0LB 2PR4L 4I3SH 2BM3A 3VRJB 5B1AB 4A38A 5DJDB 3Q48A 3EJYC 2EE0A 3OLGA 1RCYA 3QIWD 4MMZB 3KLDA 4NDMA 1RHHA 3JVGA 1J0JA 1MLBB 3HNSH 3N41F 4PJBE 3V5DB 2UVEA 4FTVB 4LEOA 5AW8B 4HJGB 1OV8A 5F21B 4LE8A 5EB9A 4XX5A 2HN7A 1MFBH 3ML8A 1QLEL 1ND0B 2DQUH 1G5AA 4Q6IC 4EZKA 5GSRA 5AALA 3SZKC 3WS3A 5EIIG 2D7MA 3FUNA 3EOBA 5E6IA 5EMYA 1FAIL 1OE2A 2MH4A 4U7SA 3LYRA 4TNGA 1AQKH 2BZ7A 5DMKB 1PKQE 2ZCZA 4X7CC 2ATPB 4U1KB 1OAZH 1QO3A 5I75B 3ARSA 12E8H 3DXAB 1ZIAA 2X1WL 4PB9H 1SLXA 1W80A 4ZFOL 1CDUA 4HH9A 3GSNL 3DUUA 5B3NA 4I48B 3K2KA 4YHKH 2DQFB 2VC2L 1IGJA 1GGIH 3CPLA 2C1PB 2NOYA 2XJKA 5E5MB 4DP4X 1Q0YH 2KZWA 2Y7LA 1YEGH 4TQEH 4WK4B 5DK2A 5GHWH 5FYKL 5I1GH 1LNUB 2XT1B 4QXGL 3FO2A 1BQKA 1UA3A 2ESVA 4KJYA 5ENWB 3TPKA 4GLRH 4Y16D 4CA4A 3AQZA 2F8IA 5G4NA 1KCLA 3BJLA 4BA8A 3H9ZA 2MOVA 1VF5C 3H4HA 4YQXH 1MCQA 4YPGB 5KAQG 2APFA 1HHGA 3BAEH 1WZKA 2BIPA 1T0NB 5E2JA 5E6YA 1N4XH 2A83A 1A1NA 3LKRB 4K8RL 4Q9QL 2ZG1A 3D3VA 3IJEB 2DTSA 4M3KB 3AXLA 4Z7VB 1EZUA 1T03H 4MXQD 3W11C 2CBOA 3I9PA 3QUGA 3BMVA 3QNFA 4JFHE 2XWTA 1DL7H 4R2GC 5HHVH 3UL4A 3BKJL 4M8UA 3UTTB 4PJ7E 4FKHA 1IBYA 4R7DB 2M26A 3HI5H 4LSTL 3C6EA 1QRND 4K7PY 2E6PA 2NUPA 3DIVA 2WXPA 5TDNB 2GIXA 3UADA 3PL6C 2BNUA 3HR5A 1OE1A 2P80A 1UWFA 1PZSA 5EBLB 4QRUA 1AGBB 4MZIA 2BVYA 3O2DH 3HZYB 1N8ZB 2W9EL 3O6MH 3O81A 3QEQE 4RNRB 4N2LA 5IBLD 2A9CA 4GQPH 3GSOB 3NA9L 4U1LB 4G8FA 1B4JL 2B2XL 3C6SB 4AQ8A 3D39D 4X99B 1RZGB 1OP3H 3U30B 1AQDB 3TVMA 4MJ2A 1BMGA 3QORA 2HVJA 2ATKB 3L3JB 4JR9H 4S1QH 1FZKA 5BMFL 3RWFB 2O93L 1G4RA 1GAFH 1X5LA 1Y6NR 5H2BB 4H0GA 3BEWB 2RMNA 4JY4B 3EBHA 5JHDA 1ZLUK 1XIWA 4J3BA 2GEQA 1U21A 2QSCL 1L3WA 1WAAA 3EDJA 1QBLL 1IQDB 5C07A 1T20A 5FKPB 1IGMH 5E9NA 5J1TC 1DFBL 2TRYA 5DA0B 1XGUA 3OWRA 3CHRA 1J5OL 5IFJA 3BT2L 3IAQA 4P46D 4PJEE 3ZE2E 1OM3L 4EI0A 4ZX5A 1UXWA 1XH0A 1J1XL 2CK0H 2VDPB 4NN6B 4QXWA 4HD5A 3U0TA 4BQ6A 4UDTA 2NNAA 1SY6L 3PXJA 3QFJB 2UZXA 4LLVB 5IJBC 1F18A 4QHLB 2WOYA 4YAQB 3KJ6L 3QWRA 2NY4D 2DLFH 3FMGH 1P5VB 4JFYA 1BFVH 1KJ2H 3D05A 4R8WH 5C0BA 1IGCH 2APXA 2AZAA 2BIHA 2ZWZA 4GSRA 5EDXA 3TZVB 4AW4A 1HESA 3QQXA 4MJ6B 1S6NA 2Z92B 4ZUWB 3P3YA 1XGYH 3KWTA 2FEEI 1X4ZA 5ABDE 4U6TA 3T65B 4J5VA 5BUPA 2N01B 3T0XA