2CR0A

Solution structure of nuclear move domain of nuclear distribution gene c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
GSSGSSGKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nuclear migration protein nudC
publication title Solution structure of nuclear move domain of nuclear distribution gene C
rcsb
source organism Mus musculus
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cr0A00
1WFIA 4JUSA 2O30A 3AACA 3L1FA 4M5TA 3L1EA 2Y22A 3J07A 3L1GA 4PCKA 4ELDA 2CG9X 1WH0A 1WGVA 4JUTA 3QORC 4ZJ9A 4YLBA 2JKIS 3IGFA 2K8QA 3GUFA 2RH0A 2Y1ZA 4MJHA 4YE0A 4FEIA 5DS2A 4YL9A 4M5SA 2WJ5A 1SHSA 2KMWA 3GLAA 3QORB 4RZKA 1RL1A 3Q9QA 1GMEA 3VQMA 5DS1A 2CR0A 3VQLA 2N0KA 2XCMC 2N3JA 3Q9PA 2Y1YA 3W1ZA 2BOLA 3QORA 3GT6A 2WJ7A 4I88A 4YDZA 4YLCA 3N3EA 3AABA 2MNWA 3QORD 1EJFA 4PBDA 1X5MA 5LUMA 3EUDA 2KLRA
chains in the Genus database with same CATH superfamily
1KXTB 3FQ1A 3H9ZA 4QAMB 1Z5HA 3HLKA 5SWQB 2O6CA 4UAHA 4XNYH 1Q9OB 2Z91B 5IB5A 5CUSL 4F2EA 4TLTA 4N2KA 1B4JH 1VKXA 3VTAA 1PDKA 4R4FH 1I9RL 2GY5A 1BQLH 3U0WH 2W65A 3L4VA 2Z1KA 3T1WA 1JNJA 1SUJA 1VF5C 1T83A 3FULA 1TZHB 5EEXA 3OWEA 3FN3A 5E2JA 3ZVVA 2JB6A 2EUVA 2VMDA 1I7UB 4XRCB 3W9EB 4HKXA 5HDQH 1XB3A 5T1LA 3WFCL 3ZBMA 4EIZC 4AG4H 5FOBB 2YD0A 3MV01 1U3ZA 3IFPB 3ORJA 1MVUA 2VZUA 4JFZH 5HHMB 2CHDA 4KVNL 4BCYA 3ESUF 1YECH 1JF1B 3DV6A 3HN3A 3KW8A 3O3AB 1DJHA 1U8MB 1W72L 2BHZA 1IQDB 4DNLA 2B0SL 4YVUA 4OCXH 1EDQA 1Y6NR 2YPKB 5M94B 4Z7UE 5K93A 2EC9T 5F9JB 4HWBA 3P9WB 1V8HA 4X7TB 4JPKL 4TLSA 5JOEA 1J1OL 1A47A 1P1ZA 2ZF8A 3OX8B 2OSYA 2BY2A 3WTYA 3RWJB 2OJEB 2BW5A 1FGVL 1MJUL 1AY1L 4GAGL 3APNA 2NZ9C 1TZ8A 2DWXA 4HJGA 4XMXA 5DRWB 4DO5A 2W5PA 4B53A 5LQBL 5CJXC 2B5IC 1KY6A 1LK3H 2W88A 3EGDA 1A21A 3BHBA 1NDMB 1A3RH 3FB7A 1IBHA 4H8PA 4JN1L 2P48B 1D5RA 4L9LB 3NMEA 3GIZL 2E47A 4ODXA 1QSEB 4P4KB 2JB5L 1MI5E 4HXAH 4RMBA 1OGAB 2MOQA 3WD5H 1IEAA 4X99B 3K6OA 5KVGH 1G9NC 3JWOH 3IDGB 4YGVB 4CILA 4F37K 4YHLL 2IBZY 4ONOA 5G4NA 3L8QA 5D7IE 4FMKA 4DH2A 4IOFC 4NUGL 3PXLA 1PG7X 4KI5D 4P5TD 3D50A 4O2EA 2WWNA 3ECWA 2ICWB 2NW3B 3PPSA 1NOLA 3CU1A 3L5WA 2PCFA 4QR7A 4HXBH 4OZ4B 4YL9A 4LRIC 1I8AA 1RZPA 3BPLC 3IDMA 1IFHH 1RZQA 4BIKA 5L2KE 1XIWD 5ICZA 2O6EA 3EDDA 4FQ1L 4DN4L 4G3YH 5CLWA 3AXHA 4A66A 5F7NC 3HVNA 3QDME 4MMYA 1NAKH 5D2NB 3DSNB 3L3IA 3ZE0E 3MNWB 4D0CB 4NRZB 1UUNA 4I5BA 4P3WA 4PBVC 4R7NA 5IV2A 3VFVA 3T0EB 3NP3A 1ZOXA 2EXTA 4BQ8A 4KUZL 4K8RH 3UZQB 1V7ML 1BGXL 4K55A 3IMUA 5I9QC 5DA0B 5C7XL 1X5KA 2B14A 1DSFL 5AYTA 2WBWB 1CURA 1RZFL 1G6RA 5TE7L 4MKTA 2H7WA 1MCDA 4WDIB 3GMOB 4X83A 3VU2A 3TJEH 5BS0D 3HC3H 4OLUL 1VZHA 4D2NA 4OVVA 4M8VA 3UTQB 2YAHA 4AEIH 4LNRA 3V0VB 1GYWA 4AC2A 2EDFA 1TU2A 3L5IA 5EEVA 1KIRB 2YAEA 5F96H 2CO7A 3ARVA 4W9LC 3NRQA 3PL6B 5I0DA 5LGYA 2VABB 4NKQB 5I1IL 5DUBA 1YY8B 3HG2A 3LNFA 4HUUA 1NC4D 4PP2A 3VFPA 4F8NA 5JZ7C 5GS0L 2EEXA 3EHBD 3NZHL 2W9DL 4Z3TA 1OTTC 4LLDB 1F6FB 4OV6F 2DQ6A 3H9SD 4WI7A 5EUKA 4WV1A 3RHWF 2GY7B 2PTVA 4LVNC 2A6KB 4HFWB 4MQ7B 3CDYA 3D52A 3HB3B 4PGEB 4RWHA 3QNXA 2C3HA 2XZQH 5FKAA 5IP4A 2YQ2A 2BIQA 3MOAL 3CLFH 3FO2B 1D5ZB 2PXYC 4PJCB 3ZE2E 3O2WL 2EVJA 3ARUA 4K8RD 4NUPA 4CMHC 2YUVA 4WUUB 1V7NH 1ASQA 4G6JL 1IGIL 2R56H 3O4LE 5IBUB 3P3UA 1RZJH 3FH5A 2YD2A 2I7SA 2EO7A 4ZO7A 4XC1H 3GSQB 3GSNA 5CU9A 3V7AG 4HT1L 2EUWA 3T77B 3BP6B 1PY0A 3MV8B 2XV2A 4JQIL 2ZXCA 2FDBP 3FTGB 1I3GH 3QWNA 4W6XB 1F56A 4CGTA 5AKSA 4TULL 3GBDA 3WNJA 3NIGB 4GFXA 1YNTA 4IGBC 4QTFA 2JJWA 4X4ZA 3MACH 4LSQL 5DRNA 1CBVH 2Z34A 2BIPA 4LP8A 2NY7H 3F8UB 2F7PA 3X1GA 1BM3H 4AEHL 4CAGA 1VKXB 4EDXA 1I8UA 4MRBA 3TA3C 1ES0A 3LPWA 1T1WA 4QHMB 1JHKH 1A1NB 3CC5B 5D6CB 3RWIB 1QI5A 2XN9E 2VAJA 3GXNA 2BNQA 2HT4D 4HKXB 4I85A 5T1LB 1D3CA 4WW2C 1F6AA 3WTSA 5BRQA 2P44B 4EN3A 5DYOA 4LIQL 4Y9BA 2CO6A 1KTRL 3WKYA 4AENA 3ZDXF 1MVUB 1L4IA 1OT1A 4LPYA 2ZOTA 4PW4A 1J5HA 4HJ0C 4F8TA 1NBQA 4Q6KA 1BX2A 2Q7NA 4HUMB 1RXLA 2E76C 1NAML 3MLSL 3G9AB 3UJTH 2J8UF 3N42F 2N0MA 3W1ZA 5HDBE 2OSLA 3GZOA 4A2LA 1W9XA 1P1ZB 3TONA 4Y1SA 2H0JA 2Y7OA 1F8TL 5GHWL 1NWPA 5LLIC 3HNSL 4P59L 4YSSA 4PGZA 4L3EE 4HJGB 2Z6FA 2FX9L 4JMNA 1USQA 1QFUL 4N2HA 3EGDB 1CDHA 3BHBB 3BLPX 3QO1A 4WY7H 3UBXA 3C5SA 1SNRA 3V8OA 2WWKO 3FB7B 1CD8A 4HZAA 4PRHB 5JORA 3FT1A 1UCTA 2W1NA 1MRCH 5AB9A 3K6DA 3A5VA 1F4XH 3ATEA 4PGDA 3O4OB 3GXFA 2GTWA 4JFYA 1IEAB 1ET7A 1WTLA 1MCCA 2GHWB 2MRYA 3PFUA 2DI7A 3CPLA 5L88H 5CCJA 5FFOA 4JKPL 1A1OA 2WKOA 4XI5C 3I75A 4OUUA 1MEXL 1ZDSA 5D4QA 3BIBX 2P5EA 5EOCL 3BPNB 1UD6A 2ZG2A 4O2EB 2H2PC 1NL0L 3OZKA 4KJYB 5FEBA 5DJXB 1OVZA 3L5WB 1TQTA 3OLDA 3VXRE 3LEVL 4KI1A 4YHKH 2YD7A 1NUNB 2DIJA 1RJZA 1U42A 3FW6A 1BIIB 1HH9A 5JHDE 2DH3A 1TMCB 4ZI8A 4MJID 4XODA 1SN0A 2DIEA 5DI8A 2PW2A 4EUPG 3TM6A 5CFHA 3PGFH 1KB5B 3B7UX 1ZRUA 3PUUA 3SY0A 1XHHA 3B43A 4BKTC 4F3FB 5AENA 1QUNB 5B21A 1LE5A 2XY1A 2ODHA 3GXMA 1GZQA 4FYSA 2GI0A 4I5BB 4OCRH 1KENH 3TYGL 1VADA 5FYKH 1TF4A 5ACZA 1BAFL 1F02I 2YJLA 4M43L 4PVNA 4QRAA 4WU7B 4X4KA 2QKIB 5HDBF 2ZUVA 4ONGL 1XGYL 1Q0XL 4P57A 1Z66A 1L9PA 2EDOA 4IJ3C 2F0CA 3L3DA 4L2LA 4D9LL 2HFFA 5KVMC 1TLKA 2XRAH 4ZUVA 4KJQC 1KLUB 4XX1E 3EYUL 3A6CH 3JTBA 2XYCA 4A7GA 1KJ3H 1JCKA 5BMFH 1KWKA 3HUJA 4GUPA 4FKEA 2ZP9A 5E6IB 5C71A 4L23A 4HUNB 4WO4A 1AXTL 2P4AB 3KPMA 3V6FB 3K6FA 2AXGA 4FG0A 4QRQA 4B5EA 1TU2B 2YEZB 3T1FA 4N5EC 1E4WL 2H3NA 1HQ4A 2GIXA 4PJHE 3KVPA 3TBTB 1LP9B 5AWNL 3MX0B 3OC8A 4Z3IA 2IH3B 1IM3B 1KCKA 2QGDA 3QR2A 4HUUB 2Y22A 4PP2B 4Y16D 3VFPB 3B37A 4ZODA 3VH8G 1NDTA 3DJRA 1YEGH 5K9JH 2AJYH 5DT1L 3WENA 2A6DB 4K73A 1HOEA 1JFQH 5I1KL 5DJ6A 4ZS7H 1AE6H 3MXWH 4A68A 3U1PA 3ZT7A 3BRGC 3I9IA 5FYKD 3RVTC 1FFPA 5KTEH 2OR8A 5MENB 4U3SB 1IC4L 3QZLA 4K3JH 2LVEA 4E41D 2F8XC 1KYOK 4FQJL 3RTQA 2CIKA 2DEYX 3K0YA 3FFDB 2PMZA 2K4AA 1BZEA 3DSFL 3AGWA 5TDOB 4PH8A 1U30A 1KEMH 5KVFE 5DGQA 3FFCD 1YNTB 1XCQA 1Y7VA 4LCUA 1EGJH 1TVHA 4BE5A 2KI6A 5KSAD 2AV7B 5C09D 1I53A 3EH3B 2P80D 3CQQA 3WIHL 2ZAIA 5D1XD 3GQFA 3ZE1B 4EDXB 5HVWA 5ILTH 1I7ZA 2G3NA 4L1SA 2YMTA 5EU7C 9PCYA 4JG1H 1ES0B 3VXUE 3ZQ9A 1U8PA 1PQZB 4RX4A 4R97B 3T04D 5GZNA 3QCUL 1JNNL 5IQ7H 1R3JA 1TTBA 4XNDA 1F6AB 1LD9A 2YPLA 2Z7UA 1AKJD 3D8MA 1HZHH 5DYOB 5E2UL 4Z77A 1NICA 2XWJB 2RFXB 3LNHA 1CIDA 2YGPA 2ZKHL 3Q3GB 5K59E 2AQNA 3HBQA 1AJ7L 1WQVT 5JDJA 3GRWL 4BQCA 1R3IH 3L1OL 3T4YA 3B3IB 4M7KH 3MBEA 1T7XA 1WZAA 3IDXH 2E4FA 1R5VA 1HFUA 4OZIA 1X5FA 3UBGA 4ZXBA 5L4JA 1P5VB 3DIFB 4XNBA 4Y4KD 3AXLA 2X9YA 3LZNA 3RPKA 3VXMA 1JDAA 1FLRL 4LQ1A 2PCXA 4JY6B 3V0AC 1YYMH 3E6HA 1HHIA 1CFSA 3QO1B 5D7JA 1IE5A 1XCWA 2DLEA 3GJFH 3VTTA 4F7EB 4BYHA 4GIAA 4S1QH 5JORB 2IBZX 2PWDA 4Y4FC 4JQXC 1V05A 5BV7C 2YRLA 1PLAA 4LDEB 5C08B 4HIEB 1UWYA 4BFBD 1E5UI 3K6SA 2GTWB 4JFYB 4Q8BA 2C1PA 1RUKH 4UT6A 3RQ3A 2E74C 4IOSA 3RX7A 2PO6D 1IFGA 1KXQA 5J1TC 1FNGB 2XIBA 3HMWL 3ZKNC 3ULVF 4M1DL 4WQOA 3JWNG 2ZSWA 2X1QA 2DQEH 3AS3A 4KKQA 3BW9A 4X80L 5EC1B 4GG6E 4YSUA 4KROB 1XD1A 1AHMA 3RIAK 2XG4A 4LVHC 4HIXH 1RUAH 3C8KB 3FT0A 4G8GE 4PBXA 2BVQA 3KJ4C 4I2XE 5IW1A 3LKPB 4YUEH 2VZ1A 5KSVA 1RJZB 4R3SA 3SDYH 3QXVA 2JELH 3OKMA 4N9GA 4JM2D 4WHCA 5KYUA 1AKPA 2PW2B 4TUUA 2NX5B 1ZA6A 4R7LA 3G6JA 1J18A 4P46C 1BQHG 4RWYH 1MJJA 3HG1D 4B0MM 2XIIA 1LE5B 4Y4HA 5K59F 3OR7B 3O8XC 1GZQB 4C4UA 2PYEA 3E2HC 1VADB 1ZVHA 3AWEA 3MOQA 1CFNB 5ACZB 1JNLH 4JRXA 3SODB 2XA8H 4P57B 3SPGA 2WQSA 3QRGH 1RIHL 4ZUVB 3EBHA 4N6QA 4XP4H 3EH2A 1WA0X 4MWFA 4GUPB 3LRHA 3GDCA 4G6KL 2J6EL 2I9LA 3RWGA 3ATAA 2AW2A 3KPMB 2AXGB 2QSTA 4NENA 4QRQB 3T1FB 4J8QA 1QOKA 5DF0A 4WJ5A 5C0CD 4NQDA 4AQZA 3TZVC 1G7HA 1FNAA 3KLQA 2EO9A 5IY5B 2VDNL 4DESA 3PHQA 4MQSB 4A1RA 2EJ1A 5J3HD 2BP0B 4Z7OE 1KGJA 4GSRA 3KDMA 4K3GA 1IGMH 1IV8A 2EEDA 1TIUA 2WUCH 3IF1A 3HMXA 1N7MH 5ES4B 4XPGL 5BUAA 2QHLA 3QUZC 3FB6B 3IVKB 5E00B 1OGAD 4W1TA 4X5XB 2A83A 1JE6A 4YE0A 3K81A 1H15A 4Z8FH 5DJ6B 4BWTA 4JAMA 2I69A 4L5FE 5E2VH 4GG6F 2QEJA 1RL1A 1B4LA 4YXKL 3P0YH 4TVPD 3T2OA 4OAWA 4N4YB 4EDWH 2GJJA 2YD1A 1FFPB 4KGLA 3BZ4A 1UJ3A 4UOW0 3RTQB 2CIKB 4EZLA 4D0DA 5GRWA 4ZMYA 1WCBA 2AHIA 4GKZB 3UAJD 5CP7A 3VDBA 1EEUA 4HU8A 1NMAH 2D2CC 3TBBA 4YDVA 4PCSA 2UWEF 1CFMA 3VGAC 5EU5A 2VMEA 3SJVA 2OMZB 1AZBA 2E3VA 3RIAF 2ESVA 2KERA 4KHTH 5BJTA 5HYJE 1I7ZB 1HK6A 4HIQA 1U8PB 5DK0A 5D1QD 5E95B 5GZOA 5LWYL 4QRRE 5H8DA 4Z7WF 3ARGC 1UFUA 3FH7A 1ORSA 2X40A 1K5WA 5CLXA 4LSRL 4NM8L 1R3JB 1LD9B 3FFOA 3OBAA 4U49A 2YPLB 3QJVB 5PAZA 5HPOA 1DVYA 3UZEA 5I1DA 5H2BA 3L1FA 1NCDH 4Z77B 1A65A 3C09C 4JFFA 3MLRL 4OJFL 2W81C 3PV7A 1RIVL 2R83A 4PV8A 3FOMB 4H8WH 2VN6A 1LO4L 4ENEC 4ZOBA 3SGKC 2WLLB 3EADA 2ZKMX 5CU5A 1EVTC 1KPVA 5ESAB 4ZFOL 1NGQL 2WIIB 3BOVA 4P2QB 1OEZW 4J1UB 3SEPA 2B59A 2C3GA 2G75A 2J21A 3MBEB 3IXAA 3GSOB 5DHVH 3VJ6B 4P5TA 4OZIB 4XCYB 1OPGH 3IKCA 4ORZC 3HS0A 1HINH 4OW6A 4AK2A 2EAEA 4M00A 3UZVA 3LTVA 3W3BA 3P4NA 3AXLB 3QUXA 4YX2L 1TJMA 3BRDA 4QXUH 2NY4D 2R1XA 2AFNA 2LLGA 3WFBL 3GMNB 1IIIA 3O6FC 1HHIB 1CFSB 5D7JB 3VDAA 3A4DA 2NNAA 1XIWA 2V17H 2BWIA 3KH3A 5B3JE 3F12B 1EHLH 1OKEA 1LGVA 1VIWA 3WGVB 1PSKL 2FH8A 1NEZA 3F7YA 2XY2A 5IG7B 3CDCA 3K6SB 1G4MA 2C1PB 1EO7A 3FAWA 4MMZB 4B0MB 4LHQB 1DJGA 3CFKA 5ITFB 3T2NH 1ULVA 2WBKA 4Z1PA 4AE1A 1X7QA 2LHAA 3MNMA 2JKIS 3H85A 4M6AA 3U1SH 2ZSWB 4ECNA 4C55A 5CINH 2QPFA 3BW9B 3NABH 4LLUB 2D7TL 1NM4A 5B38G 4X7CC 3BFOA 5I1AA 2XG4B 4R4BB 5BS0A 5F7AA 4NKOA 2BVQB 3AQYA 5IW1B 4O51A 1JXGA 3BSHA 4Y0GA 4JFPA 4DTGH 4R3SB 1WAAA 5BZDA 3VSQA 1FO0H 4FQXA 2CIIA 1T1ZA 3Q2NA 3DV4B 3D18A 2JI3A 1ZA6B 2L04A 3ECVA 1E9QA 3ZTJH 5FYJH 3C6LC 4V1DB 3RB5A 3PWJA 4CJ0A 1E4XH 4LLYA 3R18A 1WS8A 5BVJB 1NC4A 1VFUA 3SZ6A 3S4SG 2YC1A 3CSBA 3BVUA 5AQ0A 5EEZA 4HUCA 2VUKA 3T8MA 3H9SA 4KX8A 4V2BA 4RDQG 5E94A 3SQRA 4XPBH 3NJVA 4BXSV 3WDHA 4FJZA 2DB8A 1F4AA 2D73A 4P2OC 1JVLA 3APMA 5E2TH 2A77H 4NQED 1EMTL 5EU6E 3T4AA 3MJ8A 4XPHL 4MWFB 4WHDA 4O2FB 1RU9H 2I9LB 4YLQT 3RWGB 4PJCE 3V55A 3L3OC 3PG2A 5GXBB 4PYGA 4BGLA 3QJTB 3VO0A 4OIIL 1QLFA 3EJPA 1AO7E 2EE0A 3OF6D 5A43C 3MGAA 1G7HB 3CN3A 4ELKA 1PYWB 3VD7A 4CU6A 5JHBA 4ZW6A 1U3JA 4AQAB 4XH2A 4OTXL 2XCMC 3QXDA 5DD3H 1FCGA 3SBQA 3AY4C 3BWSA 4FADA 1YUHA 4MTMA 4QXVA 3RIFK 3S8FB 3AQDA 2DMKA 4G6MH 2RCSH 4FOMA 1QKZH 3HZMA 4RBPH 5FYJD 1B2YA 4JAMB 1D5IH 3D9AH 4OAWB 2KPNA 2X0UA 3KCPA 1TYJA 3MRLB 3RVUC 3BZ4B 5B39G 5IVOA 4HEPA 3MLZH 1IFRA 2ENQA 4HKBA 1KTJA 1TQUA 4ZQKA 3RNKB 1AAJA 4LSSL 5CP7B 4Y2DA 4UOQA 1CL7L 2R2HB 5KAQF 2N7AA 1I1RA 1ADQL 1ACCA 1M05A 4TTDC 3T6QC 4NQXA 5G55A 3SJVB 3GXDA 1DANU 3MUUA 5LBVA 3CE1A 5HGGS 2ESVB 5BJTB 4LLWA 4YHOH 5F44A 4X0KA 2O4EA 4WK2B 4RGMC 5I6MA 2JJTA 2GK0B 3S8WA 2XKNA 5KS9B 2ICWJ 3GLZA 3MV11 4PY7A 1E3ZA 1ZSDB 3QYMA 4ODSH 2IO5A 2F5BL 1E6JL 1ORSB 3D2UA 3QIBD 2EUXA 3NCYS 1A6ZB 1Y6KR 1N0LB 4YSTA 3VMPA 1FL6A 1X5YA 5DO8A 3W0WA 4X9HA 5J11B 5JW4M 3ZZLA 3W2DH 5H2BB 3ZDYF 2PYFB 3VRLE 2R2EA 4HG4K 3QORD 1FYTD 1WBZB 4Z7AA 3QCTH 4JFFB 2G2RA 3NQIA 1Z5LA 3KPRA 1AGEA 2CKBL 4PV8B 1WDAA 1WRFA 1ECZA 2F61A 1W8OA 4U0RC 5CLTA 3ZKSD 4NIKB 1LEIA 2B1OA 3V4UH 1ZANL 1ZHLA 4UQBA 1S3RA 1KPVB 2K45A 3NJIA 3JSSA 3TJPA 3AW5A 2C3WA 3N1MC 2WWMD 4N2IA 3SD2A 1XGRB 3I6LD 1QBBA 2D9QB 4YXLH 2G75B 3RFZC 3DHUA 4IMKC 4H20L 4JO8A 4R7DB 1FGNL 5IFHL 5IQMA 2CDFA 3IKCB 3N3EA 1KC5L 3CZLA 4ESKA 1OAYH 3HS0B 3ARDC 5JR1H 4DVRH 3UZVB 3FMGL 3QUXB 3V4VB 2IQAA 1JPTL 1OGTA 1A3LL 3DXAB 4MCMA 2J6WA 4TUOB 4FABH 4Q9BA 4LARH 4NGHL 1Z6JT 1SGKA 2CO4A 2DM2A 3WEAA 3QJQB 4U2YA 2NT0A 3LXAA 3P40A 4PHXA 4U0QB 2WN3A 3B34A 3ALPA 3APFA 5B4MC 1P4BL 1NEZB 3CIQA 2WNWA 2NY6D 1FG2A 2CUAA 3C9NB 1AGDA 1CGUA 3BAEL 4LEOA 2OI9B 5HYFA 3DECA 2WJ7A 5CGYD 2EDHA 3QJUB 1DN2A 3CFKB 1BFVL 3LRGA 2ENPA 4PBDA 1RJYB 3OWRA 4N0CD 1UXMA 2JCCA 1DQDH 1YN7A 3EJJX 1YA5A 4KI5C 4GRLD 4B50A 5HI3C 1FL5B 4OZGA 2R0WH 1FNEA 4JDTH 5HVHC 4MFHA 2GG1A 1XGTA 5IMLA 3OZLA 4HK3N 4NKOB 4OJCA 5AZEH 4AM0Q 1MLCA 3MRBA 4ZBJA 1FG9C 4UV4H 4E0RB 4W68A 1KYUA 2V8MA 4GAAA 4NI6A 4FQXB 2CIIB 12E8H 2IGLA 1T1ZB 4X42A 4I0PA 3D18B 3ZDZB 4EN2A 2OZNA 1SN5A 4OLWH 2OMNA 3CXDH 5I6OA 3EJUA 1E9QB 4PS7A 3PWJB 5CSZB 1ZY9A 4MSWA 1CU4H 4Y16A 5ADOL 2V2XA 4GIPD 2HSIA 3EOTL 4JFVA 5AOIA 3RGVB 5CN3A 3FTXA 3K4AA 4Y19D 3GTNA 2D4DA 2D3JA 4K5NA 4M4RA 3V4PB 4ZX3A 2Y7MA 4BZYA 1QBMH 4GP4B 1P0SE 3K6IA 2LV4A 4NFDA 5BO0D 1T89A 2YJQA 4UBDC 4W9GC 4NERA 3T4AB 2G4GA 1CYWA 3MLYL 1SFDA 2ICES 4P5MA 4E41A 4LGRB 4FFYA 4IBSA 1NM9A 2ATKA 3HZYA 4ICWA 4YPGA 4DOHB 5I15H 1QLFB 3VD0A 1DYZA 2CBMA 3C08H 2EILB 4ELKB 3M46A 5HD8D 5HHOD 5IHLB 2VR6A 3TT1H 3C60D 4OV5A 3BVNA 2VSMB 1BVOA 3FTVA 4BFEA 4ORGA 2OZ4A 4BWUA 5C08D 2VDML 5DD0L 4ABWA 1MY7A 1BM7A 1YUHB 5D1XA 4HJ1A 2H9GB 1DQJA 2V5RA 3ZE1E 3HZMB 5IHUH 1KELH 1CFQB 1UWEH 3EJZD 4FLQA 3L6FA 1KB3A 1F0LA 1CICB 3EF4A 4PRBA 1BW8A 2BNQE 2PETA 1ML0A 3GKWH 3NA9H 1AKJA 1L9QA 2OMTB 3RZCB 1OM9A 5CILL 4WU5A 3GK8H 5DUML 4Z23A 2LVCA 3DUUA 2E59A 5K69A 1KIUB 5D6DC 1CQKA 4PLNC 4AYBA 5I73B 1JD9A 1T22B 5E99H 4GSDH 5KVFL 1O9WA 4NQXB 1MRDH 4WCYH 3BDYH 4RZCA 4HWUA 4NCC2 1IQWL 2H8PA 2KBGA 3UTPE 1EANA 2CHXA 4LLWB 2FD6H 2E27L 4X0KB 4DZBA 2F53B 3ULVL 4HCIA 5KOVC 1YMHA 3ROLA 2ZSVA 3LS5H 3TX4A 3UTOA 4XNZC 2XKNB 4YDIH 4PY7B 1U4FA 1ZLUK 4NUJA 3D2UB 1XR8A 5AW8B 1ZTMA 5I66B 2ZYRA 4F2ME 1EGJA 2HT4C 3W0WB 1AD9A 4JREB 5C0BD 2BP3A 4YNYA 3LZQA 3IDJB 4JNXA 1DQQA 3IDNA 4N8UA 5F89A 1MOEA 5AAMA 1C16A 2FYYA 2G2RB 3FT4B 5I0WA 1IB5A 3KPRB 1AGEB 4FF9A 1HL5A 4G8EB 5D1ZC 4PI2A 1AZVA 1K2DB 2YGVA 2ICEA 1CDCA 3M45A 1TJHL 1ZHLB 2V7HA 2NXZB 3PS6A 3Q44A 4D8OA 3IGKA 4PLKC 1H9DA 3RX8A 5DR5H 4A2EA 1YMMD 2QV2A 5SWZD 2PO6A 3EO9L 5FHBH 4AV0A 4N90E 3E6FA 3FF7A 1CDBA 2JKSA 2QGCA 3TBYA 4ZTOL 3IMBA 3LPPA 1BOGA 2HJFA 4XNQA 5DFVC 2QDWA 1HILA 4JG0L 1QBLL 3SOTA 1VGEL 1E5ZA 2CDFB 3JWDH 2P5EE 3BKML 2XKSA 4MD4B 1TNMA 1ETZA 3L3GA 1CXKA 4MNQD 2YKLL 1OGTB 2VR7A 1XV8A 3AMLA 2CR3A 3VFRA 3TS8A 4WEBH 5DEGA 25C8H 1FIEA 2NY2B 3N40F 3HI6H 2OYLA 4XB7A 1TQWA 5FR3A 2EYSB 3KBHE 1PZ2A 3T3PE 4H0LC 1P4UA 1IU1A 1OGPA 1S9KC 1FG2B 4UMSA 3ILPA 1OB1A 1AGDB 1X4YA 1GPOH 1L6ZA 1RJCA 4LEOB 4NZUL 1JHLH 3P4MA 3KGTA 3OAZK 3TN0C 4QXGL 3SE6A 2D0FA 4APXB 1OE3A 1CG9A 4G6AD 3BZEB 4LPUA 1LJMA 3I9GH 4FFZH 1YN7B 3LKNA 3LOWA 5F9WB 3RZWA 1Z9OA 4OZGB 1FVDB 1FNEB 1AH1A 4HSCX 1HOCA 1FFQA 1DLFL 4GKOA 1CLZL 2UUDH 1PAZA 4GAJH 4KXAA 3MRBB 4WEMB 2UY7B 3EZJB 1HSBB 2HH0H 3HUJE 5T5NF 5HGAB 1T7YA 4HMCA 1CMOA 3AG3B 3C6SB 1JWMB 4I0PB 4L29A 1SJMA 4IQHA 1OWWA 1H3WM 2DLFH 3EYSL 5C0CA 4G72B 2WVTA 1G1CA 3QR0A 4G5ZL 3QZNA 1IKOP 1KCRL 1J8HA 1R34A 1QO3A 5KN5A 3N50A 4NJ9H 1N19A 4Y9EA 1XTLA 1U8IA 4QTIH 4NWTH 2QGEA 2XXCB 4AMXA 4P5SA 1KGYE 1QPKA 2QADD 4PB9L 4U1MB 4M4RB 1XGUA 3H4HA 2VLKD 2K0RA 2FATL 1BZ7B 2VDRB 3LY6A 2FIKA 5AZ2H 3VQ1C 4P5RA 4F8PA 3U7WH 1EAPA 5L8JB 3ZZ1A 1UWFA 4R4ND 2QHRL 4P5MB 1S7QB 4YPGB 3HZYB 2V5YA 2Y06L 2MOVA 3DBXA 3AM8A 3L5XH 3SOBL 5IWLA 1VGKA 1C1EL 2AEWA 4O58H 4JDVA 5IQ9A 1XR9A 2G0LA 2YFNA 4PN6A 3T3PF 2QVMA 3CMGA 3AACA 5AALA 4OV5B 3BVNB 2K8MA 3GBMH 3EOYG 3TO4D 1KIPA 3UCQA 1TKWA 1TQVA 3HE6B 3WE6B 2I5YH 1ZHNB 5MP6L 4NO5A 1QWUA 2OCCB 4ZT1A 2DLHA 3M8OH 4G8FA 2O93L 4K0OA 1MUJA 1NCWH 2WXJA 4L5FL 3KS0H 3LEYH 4AJYV 4MA7L 3L6FB 3MO1A 5H35B 5AW3B 3WN5A 2YAPA 3EDEA 5KZCD 1F4YL 4KO9A 4D0BA 2AI0L 1E7VA 3O9WA 2HTLC 4YBLB 3HUJF 3KPLB 2YPLE 4F58L 5I1CH 1ZXKA 4WU5B 4MCNA 4NZTH 4DIXA 3RTLA 3LPGA 2VLJB 3KPNA 4KMQA 5JXAL 4UT9L 1NCAL 1W8EA 4MNHA 4KRPB 1E6OL 2QSCH 3LQAC 4ZZFA 1X5JA 4HKZB 4QRPA 4OLYL 5KSAC 3UC2A 4DZBB 2JMRA 1YMHB 1DQVA 2ZSVB 2O5YL 5D8JH 1YJDH 4NN5C 4NUJB 2BSDA 5T3XE 3F62A 3QNFA 4OZIE 4GQZA 2KZWA 2KZBA 4J6RH 4JFXA 2CDGA 4KUCF 3HAEG 4U1JA 1CDYA 3VXME 5DD5L 2JE8A 2VT0A 1JPEA 3DA0A 3S5YA 2X09A 2WJ5A 4AL8L 2DS4A 1A7PH 3VWKD 2APVA 1WAEA 2YS4A 2P24A 1ZT4B 1O75A 4X7SH 2ICEB 4PB0L 3B2UC 2BRRL 3FU7A 4M8RA 5KJRH 3HPJA 4APQB 1NFKA 2V7HB 3JVGA 1MHEA 1RZKH 2Z31A 1J5DA 2QDVA 2VH5L 4JM4H 1FZMB 1MFEL 4MZRA 5LN8A 2J20A 1RULL 3Q43A 4OD3H 1QFHA 4HZLA 3MUY1 3DUSA 1KXQE 2HJFB 3MXVL 4NN7B 1MHPL 3DJ9A 5D5MB 3C5ZA 3K2UH 3NAAL 3QJRB 3CZJA 4M56A 4WWKD 5TFSL 1A9BB 1FNHA 4PLJD 1U8KA 3ULUE 3CUPA 3MCLL 1ETZB 3LSOA 4XBGA 4WSJA 4X9YA 5J6GA 4KZDL 3VXSB 4RISH 1BBDL 4Y4KC 2NTFA 2DTSA 2UZPA 2V5SA 3I2CL 3OMNB 4PJ7B 1N0XH 2OTUA 1EEQA 3VFRB 4UILH 2WYZA 4XTRD 5DEGB 3B2XA 1U8QA 2VZ3A 1WGOA 1DVFD 4K5MA 4LNVA 3CBRA 3MV7D 5DHVA 2ATAA 3O3UN 2XA3A 5FV2A 1FHGA 3O2DH 2MNWA 1IRAY 2MQGA 1OGSA 3UDWC 1KTBA 4ABQA 4F15B 1F41A 3QEQA 5DEFA 5I1HH 1VSCA 3OQ3B 3TWCH 4POZD 3G6JE 1OB1B 4XR8C 3PJSA 3Q6GL 3AG4B 4POUB 4AQ8C 5J7CC 2VLRB 2IWGA 1EO8H 3QDGA 2YQGA 3C8DA 5E0FA 2PYEE 1BMZA 5DC2A 2XQYA 4JRXE 4JPIB 4AYFB 3QG7L 4PIRF 1SHMA 1URLA 1CT8B 4NQEA 2ISDA 1HOCB 3HE7D 4L3AA 1E4KC 5IB3A 1JGLL 2FEDC 4ZZKA 3QEUA 4GMTL 4JG5A 5DS8A 5J0BA 1KJ2H 5CKGA 1QLRA 3OF6A 4JM2C 2Q86A 1ZS8A 3WXVL 5I18H 4MJHA 1J8HB 4NQDE 3GRGA 1I8LC 4LU5L 2PWHA 4FI6A 1CLYL 3MA9L 3CDFA 3ZZQA 5C0EA 2VQUA 2WUBL 1U8IB 1KN2H 3SGJA 3WY1A 5HTSA 1FO0A 2BS8A 3N43F 4MDIA 2ROXA 3L17A 1SXNA 2F2HA 4XP5L 3R1GH 2E56A 5GSRB 1XGUB 1IAII 4KU1A 1U93A 3WLWD 3K5RA 3UPCA 3X11B 4CGUB 2Y9RT 1GAFH 3I6KA 3PHOB 4QTHA 1MREH 3VMOA 1EAPB 5F0MB 3ULUF 3WTUA 1YQ2A 4RAVA 4TQPA 3GNMH 3OG4B 1PD1A 3S3JA 3WY3A 5HVFB 4ADIA 3B83A 4HDIB 5EUOB 5GISH 5BQ7B 4OCSL 5H94A 5A2LH 2R4SH 3BSZL 4TUJA 2JQZA 3BT2H 4JDVB 3LH8A 4WI6A 3LB6D 3VWJD 3C12A 5IIEB 1XR9B 2A9MH 1T21A 2R1WB 3SDXA 2HLEB 4N0UA 4QOKD 1JV5B 4GSXA 1I4FB 3KLHC 4B60A 5JYMA 3ZHKA 1IGJA 4YS4A 1KIPB 1ZGLP 1PX3A 4L9LC 3B6SA 3DYPA 5J3HC 1A64A 2ZOWA 1G84A 2CNYA 3HBGA 4AWJC 2WWOA 4LVEA 1M7UA 4PJIB 4PJFB 4P4KC 4F91B 1QWNA 3ATFA 3MLWH 4FXKB 3TIDB 1MUJB 1ZLDA 1CK0H 1P4LA 4LHUD 1XF4B 3CH8A 4QWWD 3O41A 3ZX1A 5JXED 4W9DC 4AGNA 3WN5B 2QT6A 5AW2B 4KTEH 4NM4H 4N0RA 4NC1C 4W4OA 3U4BL 4E2OA 4JX0A 1OE1A 3UACA 4XX1G 3U9UA 3O9WB 4ZO8A 3QORA 5KW9L 2IXQA 7TAAA 2AABH 2VLLA 5GRUH 1DJZA 2VL4A 3U30B 1AR2A 4JFFE 3WMSA 3I6GB 3UAJC 3NACL 4J5VA 3I02A 1BZ9B 1FH2A 1ITBB 1EZVY 2APSA 1HTYA 3L95A 3NCJL 1CDIA 3L1EA 5D71H 5EO1B 3AREB 1T66D 4ZPTA 1DBMH 4QRPB 5IK3A 1O7DE 2DQCH 5A2CA 1XH3A 5D2NC 2AS5M 4Y5YA 4HWBL 5DTFA 2OYPA 1BQRA 3EOBB 2X4SA 4AM0B 4MDJA 3T0EC 3NSXA 4RFEA 1Q9KB 5D1QC 3FYEB 4HGWB 3V0HA 4X5WA 4QCIA 2AJXH 5HGBA 4JFXB 1IC7H 2CDGB 3UOAB 4AIXA 5CSGA 5H37H 4F8OA 3JUYA 3FUKA 1UVQB 3W5NA 1IAOB 2WN2A 5J12B 4PJAA 2P24B 4Y5VA 3FCGA 3VA6A 1CUOA 1PEWA 1XGQB 5FYLH 3FU7B 5IW6A 3HPJB 3DK2A 2Z31B 3IE4A 1OAJA 4YSRA 2X4QA 3MREA 5IT2L 5J6HA 2XV3A 3AJ7A 3DJZA 3DUSB 4IDJH 4JR9L 2XN2A 3C5ZB 4KKBD 3BDXA 5HY9B 4GRLA 4JUSA 4KITB 4MJ5A 2H47C 5E4AA 1U8KB 3CUPB 2WNGA 2UZIH 1OTSC 1N2RA 1GW0A 2NSQA 3LSOB 4OZFG 4AQEA 4CADA 5J6GB 1PVHA 2NTFB 3TVMD 2G2PA 3KS0J 4JZNA 2OTUB 5BS0E 2NY4C 4OFQA 5KVGE 1NGXB 2P43B 2VLME 2ZXGA 1U8QB 3HB3C 2ZUTA 3NJGA 1UOLA 1DUZA 4X98A 1XDTT 1E27A 3OL2A 1WAAE 5CGBA 3WS6C 3TBVB 4LL9A 3CLWA 4LE8A 3FZUD 4KQ3H 3BMWA 3QEQB 5DEFB 1ZHKB 1UH3A 2IQ9H 3WEXA 2DQIL 3L2MA 2OSWA 4C4KO 2AQ3A 4CW1A 4BHUA 2YEVB 3ARBD 2NDFA 1FPTL 1OAXH 1XWVA 5HDRA 3QDGB 5I8KL 3UGEA 4DGVL 4WF7A 5TE4L 2MEJB 2YO3A 2ID5A 5C97A 2YBRA 5DQDL 5CD5C 1DN0A 5EORH 3FO1A 1D7CA 3H9SE 3QS3A 5FYLD 5T33H 5HYQA 2VMJA 4K9EL 1YEDA 1J9SA 4UAOC 1G7LB 4LRNH 1G6RL 3EYFA 3L3KB 3CFNA 4G43A 4KI5F 4GW4B 3IBEA 5DWUH 5IB3B 3SYPA 3VXPA 5F88A 3QEUB 4KH2A 2MTAA 3QZPA 4GLRI 2ZICA 2E6JA 2XPYA 2B39A 1SEQH 4JLRA 1QLRB 1Q9LB 3DOHA 1A02N 5CMAA 2Q86B 1ZS8B 2I85A 2XVGA 5HHOA 2ZXQA 3DC0A 1UXSA 5E5UB 5IB2A 3ECBB 1R4XA 1FHNA 5DQJB 5C0GA 2CUIA 3CFDB 3MFFB 2BVEA 4NPKA 2K4WA 5AW0B 3WUWA 1U93B 4MXQC 2VUOA 2WAHA 2W59A 4KK5D 2BC4B 2N7BA 3I6KB 4QTHB 2YQBA 5E1HB 1VRSA 4M48H 3VGFA 4G71B 4I89A 4H88H 4RAVB 1QNZL 3D12B 2Y6SD 3DWTA 3JTSA 4KMTH 1KY7A 3HS9A 5CJ5A 4WI5A 4M5ZH 5GRVK 4GUOA 2BM3A 2E5EA 4FQLH 4LBEA 4TUJB 2G4EA 3WL9A 5CEZE 1WAAF 2CJ3A 2VQ4A 4AYEC 2BH0A 2WVUA 1K72A 3GSNL 4HH9A 4N0UB 3RVXD 2ZE0A 2NSMA 3DTUB 2XPGA 2F74A 4BE6A 3B6SB 5C0FA 1FP5A 4HVBA 4EI5A 3PHAA 1GL4B 3QC6X 4M61A 3Q06A 4OLXH 4JY4A 3QIWD 3LEXA 5CGTA 3O4OC 1Z5YD 4NO0D 4W9JC 1J0KA 2ETWA 4WI8A 3MRNB 1J0IA 3O41B 4PS4L 1Y6MR 3ZYOA 2PTTA 1KCSL 4NRXB 2MHAA 2VW6A 5GQBA 4EIUA 3CFEB 4EKJA 4PGBB 5C0BA 4ZNEA 3BPNC 2W0PA 2J72A 3U9UB 3AY2A 3MKKA 3W0WE 2A9NL 2IXQB 4FLSA 43CAA 3OAUL 2VXSL 2VLLB 1R3HA 2DKMA 4LF3A 5DJCB 3VFGL 1RURL 4ATTA 4MA8H 3EH5B 3I02B 3L95B 1UWGL 1KTKE 3IE9A 2FJSA 3G5YB 2VN7A 1UZ8A 3LRSB 4ZPTB 5F7BA 1DUYB 4X6CA 5FF6A 5C7ZA 4NDMA 3QJXA 3UGUA 2DN7A 4OCNC 2BW4A 5MEQA 3FU8A 1A4AA 5DTFB 4JY5L 4A63A 2O6FA 3FO0L 2X4SB 1XCTA 4MDJB 5BRZD 1AGBA 3JV4B 2M83A 4QKXB 4YC2C 2YZ8A 4K7PL 1D5MA 3QIBC 2QKIC 4L1HA 4QCIB 5HGBB 2HLFC 4N8CL 4R96A 2WP3O 3K91A 4H8QA 4HS8H 4NBXB 4RNRA 3GI8H 2WLJA 5DD1H 1SDDA 3P9MB 4W9CC 3UO1L 4LPTA 2XNAB 2P8PB 4MJIE 4X4XA 3MRDA 4Y5VB 5JUEH 5E6IC 4MD0A 1GGCL 4GO9A 4N6RB 4IRZH 5IW6B 3TESA 4P9HH 4C4KT 4MAUL 4W93A 3FCSA 3TEWA 4EIBA 1I8MA 1U92A 3SHSA 4L18A 4D9QD 3TP4A 2EE3A 2WWMC 3MREB 5J6HB 3N55A 2VITA 2JSFA 3LMJL 3Q8FA 4OQTA 4P3DB 1E28B 1GGTA 5GIRA 4JO5A 1FIGL 4DKEH 4MJ5B 2JCCE 3KHQA 3MUHL 3OG6B 3RBGA 1AMYA 1DJIA 3UC0H 4AQEB 2OJ1A 4ZAKD 1N2RB 4ELMA 2FECL 4PYHA 3QCVH 1RPKA 4OZGE 3S35X 1JYWA 2WVSA 4BZ2H 3MA7A 1F42A 4HGKC 1J11A 2PR4L 5ABZA 1T0OA 3L7EB 4FFWC 2DLGA 3RDTA 5E8PB 5B1CA 1H6TA 4JMXA 4FYQA 3ARYA 2AEIT 5MEPA 1KLGA 4BFIA 4L9DA 5I8OH 1I85C 5EIIG 3WEXB 1KCUL 3JTTB 2Q87A 1LDPH 1NCTA 4X8JB 4HWNA 3HTLX 4UTBH 5CFAA 5HVGB 3FT2A 1CGTA 1M1SA 3P30L 2VLKA 5AVQB 5BOZG 1DN0B 3FO1B 1WF5A 1KTDA 3VM5A 2W38A 1TQBC 1C8PA 3EYFB 2WSKA 4G43B 4XAWL 1ACYH 2JCWA 1ZXQA 2WLNA 3VXPB 5F88B 4KO5A 4NPYB 5TDPA 3TV8A 4F7PA 2RGSA 3CVIL 3M1OA 2XJLA 2IAAC 3KXFD 4FFZA 4E41E 4RH4A 2A6JA 4JLRB 1YCSA 4NNPH 2ZD0A 5JQIB 2NNFA 1JTTA 1LO3H 1RUQL 4Y2OA 4F7TA 2G5UA 2QTEA 5IB2B 2WY3B 2VXVL 5C0GB 3FFCE 4XZ4A 2N1KA 4DQOH 5K9KB 4U6HB 1IKFH 2JWYA 4R2GB 4KKCD 4EZKA 4ZMLA 5C6WH 2VWEC 3RI5K 4CN4A 4NT6A 1NSNL 5D1XE 3SPIA 5HHPB 3MNZB 3WDJA 4CVXA 3O6ML 4BK5A 2DWEA 3F65A 3R8BB 4DGYH 3MRCA 3JTSB 3I50H 3SCMD 5IHZA 2PCPA 1XTMA 1HQRA 4JANA 3VFWB 2BNRD 3ETBJ 3GBNH 3TPUA 4MXWL 4NNXA 5HD8C 4XXCA 2J4WL 2XPGB 4QGYA 1KBGL 2X6CA 5J89A 1UD3A 1MCBA 5C0FB 3L4CA 2WXMA 1B9KA 3HA0A 4EI5B 4YWGH 3QHTC 1FI8C 3T0BA 3LEXB 3QWRD 4E9TA 1TT6A 4LSDA 1TITA 4CSZA 4I88A 1FZOA 1XGPA 5JA8B 1Q8MA 1QG3A 1WK0A 5BW7A 3EJZC 4J23A 4WI3A 4WFHE 1DL7L 4KVPA 2HKFH 1JGVL 3QQDA 4HIIB 2WP3T 4C56D 2I07B 5CIPH 3R19A 5ISZB 1EZVX 1K6QL 5M95B 1A2YA 43CAB 3MR9A 4IHOA 1IBZA 1BPLB 2BVUA 4KROC 3VWKA 1ZVYA 3IYLW 3NIDF 3OHMB 1S7RA 4JPVH 2MOGA 4YDJB 3TYFA 4JL2A 2DQFA 5FB8B 2CR0A 1ZE3H 3M6DA 1DEEA 1UZ8B 5GJTH 3V6ZA 3AMKA 1KCLA 3MLTA 4X6BA 4M8QA 5FF6B 5JQ6L 2P26A 3PXHA 3EBIA 5FUZL 2CH8A 2I60H 2X89A 5MEQB 4N2EA 2F9BT 3B9VA 2FT8A 3LS4L 3VG9B 1AGBB 1JGIA 5T3XL 1WZMA 2VDLH 3HRZA 3DMMD 2NLJB 1D5MB 4Q7DA 3VFTA 4DP2X 5EEWA 4JFDD 2FNWA 1DE4A 2R51A 2X10A 3NJNA 2FLMA 3N1QC 1WFOA 1G0DA 4PRIA 1JYXA 1VPOH 1DVFA 5B1AB 2E8ZA 3X3GH 1QI3A 5KSBF 5C0DA 3MRDB 1A4JB 1X3DA 2AZUA 5J6SA 1EJOL 2AJZA 4I3RL 5ICXB 5B1BB 1BD2A 3HI5L 2VO8A 1UG9A 4TXVB 1I8MB 1U92B 3HG1E 5D7LB 3UAAA 4M5TA 5ALCH 4H44C 4GYBA 4DCQA 1F90H 3O11A 4UT6L 1J7VR 3WKMH 4WSKA 4A6YL 1VACB 3BIAX 4LFHG 3L48A 5AOLA 1VERA 4OF0A 5I1JL 5GIRB 4DUXA 1MPAL 1XSOA 3ULUL 3VI3F 1SQMA 5DURB 1QFPA 4J4PA 1HSAA 4PREA 3NT0A 1DLHB 3HE7A 4ELMB 4UNIA 2CGRL 4XAKD 3MA7B 4M6NH 5CZKA 3LN9A 5F9OH 2EIDA 3RDTB 5IHHA 2HX8A 3QB7C 4YE4H 5GGVL 3DGGA 2EH7H 4EUPB 5LGHL 2XV6B 5MEPB 5CJBA 1PEZA 4BFIB 4RMRA 5CJQL 5C0CE 4Y1AD 5ALBH 2D9CA 4QJ5B 1J8HE 4LOUD 2ZX5A 1BVKB 3FT2B 3ILEA 5TK4A 2DQJH 3BCDA 1RSFA 1OZUA 5E2WL 4IKNA 4EVNB 2HJKB 3O2DA 1CD9B 4LLVB 1NCCH 1P84K 1RSYA 1CFVL 4GW1A 1WWWX 5FW8A 1NCBH 2Z4TA 2XQ0A 2DPKA 1NCGA 1FUNA 3IMSA 3V0WH 2AJUH 2R15A 1QSFA 3PWUA 4I48B 4PY8J 3ZDWA 3VSVA 1LO5A 3U4KA 3U0PA 1ITCA 3CZSA 4UM9D 3RIKA 1IJ9A 2IDUA 4U1IA 2OXHA 4KTGA 1TJIH 4NKIH 5TDPB 1QFWI 3NJXA 2D03H 3LH9A 2B4CH 1INQA 1D6VL 1AP2A 3LNGA 1ET5A 3V4LA 3VXNA 5GZNC 3GSVA 2LU4A 2JJSA 4NZRH 5FLVA 3BUBA 4E5XG 3MRKA 1EEZB 1SJEA 3BUQA 1F1AA 4JM2F 4F7TB 4QOKA 3QXTA 2ZWSA 3MRIA 4DWHA 2R69H 3DVFA 2ZXAA 2BERA 5C07A 1MCWM 3VH8B 4S1DD 1QW9A 2A1WL 5GGSA 1YEIH 1A7OL 5JHMA 1KJ2A 1K8IB 1TTRA 1HX0A 1ZS2A 1WPCA 1ZT1A 4G1MA 3WNMA 4I9XA 4A2HA 1MCJA 2QADC 4LLQB 8PAZA 3HMXL 2EECA 5GGRY 4A38A 2ADFL 2Q20A 4NT6B 5JW3L 1Q72L 1IM9A 1MAML 2IADA 3IGAB 1HCYA 4FXTA 4LHUA 4F2FA 4HPYL 1Y1UA 3OJ2C 5JXEA 3ISRA 4U6VL 1T6WA 5AVTB 4KAQL 5K39B 4MLSA 3T0VA 3KHOA 4LKCA 3OZ9H 4WO0A 5IHZB 3P3RA 1RD6A 4KFMA 1R1CA 2CJSA 2JKJA 1CN4A 1ID2A 3BP5A 3FQTA 1ZLSH 3QYNA 4ZFFA 3IBOA 5D72H 4JB9L 3BQUB 4LCVA 3DURA 4U7MA 5D7JC 2Z8WC 3N9GL 5D93B 1S3KL 1XEDA 1RCYA 5DJ8B 1M2VA 1W15A 3QPXH 3S36H 2V7NB 5ICYB 2Z3FA 1OLZA 4IU2A 2EE6A 4G1EA 4A7TA 4XMWA 1MRFL 3W82A 4N5UA 4NSKA 1YQVH 4QRPE 4LHJB 4R83A 3RVVD 4G8AC 1GGIL 2R7EA 3M7FB 3PU7A 3CVCA 1I9EA 4HQQL 4MMZC 4U1SA 1E9PA 4XVJL 2AQRA 2ORBH 3HNTH 3OAYH 3QQDB 3N41B 3AU0A 3BVWA 3MNVB 3FQNA 4XNYL 2MPAH 1X5IA 1ZT7B 2DV6A 3OXSB 1B4JL 1JVKA 4OSUH 4NZFA 4FS0A 2B20A 4R4FL 1TZIB 3PGCA 1BQLL 3U0WL 3AAZA 1SYSB 1IZJA 4JHBA 1S5IH 3TYFB 3ZMRA 3N0PB 2DQFB 2HT3D 4TPRH 3CFMA 4BFOA 2Y4SA 1S9WA 4PAZA 2BCKA 5EC2A 5EO0B 3V6ZB 5HDQL 3TEZA 2FBOJ 3KGSA 3MLTB 4KC3B 4AG4L 1AVAA 3EO0B 4M8QB 1NLBH 3JYCA 4DPCX 4YR6B 1PBYA 2WXHA 1B90A 4JFZL 2ITFA 1KJVA 1YECL 3RWFA 4OI9A 2A9CA 1I8KA 3HRZB 3LKRA 1XL6A 1CXLA 1S9VA 3MODH 3MRFA 4YVNA 2QQNH 3VFTB 2XJKA 3CN2A 1AGFB 4OCXL 1HHGA 1R33A 3TVMA 4FNPA 1WBXA 1SXAA 3B8YA 4PRIB 4IS6A 3WNLA 1G9MH 4ONHA 5DS2A 4OZHB 4GI9A 5FK9B 4AUJA 2XQYK 1X4ZA 2AJZB 1BD2B 1JERA 3V6OA 1O7VA 3QEQE 4I18A 5KYXA 3ARBA 4I13B 4G7QB 3O11B 4UZGA 2QTVA 3SGEH 3QDGE 4BKLA 5JIHA 3MMEB 3FBQA 1NAMA 1SOSA 2KL6A 3GTVA 4WWKC 2W92A 1G7MB 1M71A 5F0JB 4PLJC 4ES8A 4PMEA 4HXAL 3GUTA 1CFTA 3FONA 2V3EA 4NQEE 1ZLWH 3WD5L 4ZD3H 2ZWNA 4HFUH 4LOFA 4M5YH 4N26A 5BXFA 5KVGL 2F5AH 4FNTA 3N85H 3W11D 1S5HA 2CMRL 2WAQA 4XTRC 4UNVA 3DGGB 5T5NG 3NDZE 1PPIA 3U6RB 1BQHB 2ZP8A 2H2SD 1CTOA 4WTZA 3SDAA 3UBXG 4HXBL 4AK1A 4UQDA 3S4SA 1IFHL 2JH2A 3PQYB 4XBPA 5B1JC 5IBLC 4DP8X 4G3YL 3MJ7B 4FN0A 2VDQH 2E6QA 2JLPA 2X1OA 1FYHB 1NAKL 1P69B 2R8SH 1LEGA 3NIGF 1NBZA 4MB1A 1QSFB 1NLDH 1RZKC 3PWUB 2QMJA 3NSDA 1LO5B 5D1ZI 1THAA 4P04A 4U1IB 2OXHB 1CE6B 2Y07H 4FNQA 2DWTA 2FWOA 2UX7A 3TURA 1UM4H 3VXNB 3GSVB 3VFNA 5C9KA 3WFZA 1SJEB 1H3XA 3RE0A 3D69A 3UZEC 3MRIB 1WFTA 1VA9A 3QDJD 3TJEL 3SDXE 3L9EA 4N0UE 4TQIA 5C07B 1M6OA 2FUQA 5GGSB 4AEIL 4XXDB 4G1MB 1ZT1B 2CBTA 4HBCH 3U2SB 1M1XA 5F96L 4HJSA 2J1XA 1IM9B 4NJAH 3U9PH 2WBJB 5E1QA 3ESVF 1IO4C 5ITBH 4NZJA 2VN3A 3NRPA 2V9UA 2WMPA 4L4VD 4WWID 5FUCC 3SKNB 2Q8AH 5A3ID 2Q10A 3ESMA 3NSFA 1M7XA 1RHHA 3NZ8B 1LILA 2B1AH 5HDWA 5CEZL 1EO5A 4N2GA 4UQ3A 4LEXH 1FYTE 1L5GA 2IH1A 3EJTA 4OGAD 4BH7A 1CPUA 3VWJC 4H8UA 2WXNA 3DURB 2FR4B 2XZQL 4GRMA 2F8IA 5TD4A 3CLFL 1G7IA 2VW4A 3LXBA 4IU2B 5JOPD 4L4TD 4RMQA 2MFNA 3QQ3A 1V7NL 1BEXA 3QEGH 2FQDA 3REWA 5GRVL 1RZJL 1T3FB 4AJVA 1P5UB 1ROWA 3BGMA 2TSBA 1BBJA 2OI9C 2R7EB 3FUFA 4F8LA 5E8NA 4U1SB 1JYVA 2N01B 4D7BA 4QWWC 5CR8A 5E4OA 1I3GL 2WK2A 4S2SA 4ZSOB 2Z92A 4LOEA 3DRQA 4P0DA 5CZXC 1Y18A 3CSGA 3DRTA 1NBCA 1SLUA 3MACL 3PNRB 1CBVL 3HPLA 1CCZA 3KGUA 2WO4A 1E2VA 2XG5A 4K23L 4ONFH 1BM3L 4KY1H 1NANI 4B97A 1B0WA 3PGCB 2FEEL 2YGQA 4MX7A 4ZMNA 3QQNA 4RESB 1JHKL 5E51A 4PJAE 3ZHDA 5GJSL 1E3XA 3SYQA 1V3JA 4GI8A 5I23A 15C8H 4OZFH 1S9WB 1WWCA 5EC2B 4H25A 1T66C 4CBPA 1C08A 2VR8A 3QQ4A 3AQXA 2P49B 3RVWD 3EG9B 3ARXA 1KJVB 5E7BA 1NFDB 3CLEH 2X70B 4GSQA 3UBFA 5IMOB 4LCWA 4XWOC 3HC2A 4JZJB 3CFBA 4UANA 3RGVC 4ZAKA 3CC1A 4X4YA 2X7LB 1BJ8A 1S9VB 3ZKXB 4U1NA 4MNGA 3P3YA 4KZCA 1I1FA 1NUGA 3IAQA 2YD3A 1NGWA 1ZTXH 4ONHB 2H32H 4FQCH 3OB0H 3GSWA 3T4AC 1A1MA 2CALA 5JTWA 5IJCC 4OI7A 2JTDA 3EF7A 4XMPH 1I3UA 3SDCA 3MRPA 5J1SC 6PAZA 4UU9B 1TYEB 3DIVA 1ZMYA 4WY7L 1KACB 2QELA 4BKLB 3W81A 1LP9F 2DWDA 4RGNE 1NAMB 3QIUD 4G7VH 4Y19E 3VYOA 1A7RH 4F8QA 1BWMA 4IRZA 1MRCL 4HWEH 3BAXA 3MGTA 3QAZB 3VACA 5E6SB 3GKZA 1F4XL 3IETA 2MCAA 5B38B 5IMMA 5L2JB 4G6FB 3GGWA 1CFTB 4NI3A 4XCCH 3STZB 3OHXC 1H19A 4MVBC 5BXFB 3DVNA 1GIGH 2A7BA 4GKNB 5L88L 2HG5A 2WXPA 4PRNA 5E1GA 4HAGA 5HHXH 4DUWA 5GGSY 1CICC 1IGYA 1O5DT 2IAND 4IEFA 3TCLB 1T1YA 2Z7WA 3FZUC 2W0FA 3H7BA 1L0XA 2F19H 3RAJH 3VNZA 3RZCC 3SDAB 4G59C 3QUYD 5HHOE 4RSYA 4BZ2A 1QRND 1HKFA 3F5WA 1FC1A 3S4SB 1MW2A 4YHKL 3EFOA 4XVSH 3MRQA 1XX9C 3GPEA 4NQCD 5I73C 2V2WA 3FHQA 3VI4A 4DK6A 2ZCHH 3CX5K 4WK0B 4GI6A 4XBPB 4NXSA 5PCYA 4ZUTA 2EKJA 3PGFL 1SLWA 1IMHC 3P54A 3MV9D 5LO7A 4I87A 3UAFA 4K3HA 1NBZB 2OYMA 5EB9A 5I8CA 2IAMD 3DX9B 2YSSA 3Q8AA 2BP5M 1X7TA 4JFOB 3I6SA 2JF1A 4MRCA 1KENL 2ZOLB 2ZWKA 3BZDA 1G9HA 2L7QA 1AZRA 3GMRA 1UURA 5GS3A 2FWOB 4GRWH 4EQ2A 2BNRA 2X6AA 3VFNB 4BDVA 1BQKA 3HW7A 4IBLT 4F9PC 2XRAL 3D69B 4JREC 3SO3B 4WW1A 1INDL 3V7AE 3A6CL 5EIVA 3F7KA 3EFDH 1KJ3L 3F6JA 1KDIA 5IM7A 3CV5A 2CGZA 4HW6A 5EOTA 5BMFL 2P42B 3MHZA 4KJWD 4NKMA 2WO2B 5FPIA 3GMPA 2ROYA 1HEHC 2OZ4L 4AGMA 4GEJA 1M1XB 5TH2A 3MUGA 3U2JA 3TH2T 5DUJA 1D7BA 4AT6A 4ENZA 1BVZA 2GBTA 2WMPB 3W9DA 1VESA 1AMXA 2M26A 5FW6A 2DQDH 2OK0H 1OCRB 4C56A 1R5WB 4S0TD 4BD4A 2CA4A 4PGCB 5B39B 5AVWB 2DD8H 4WWNA 2FHBA 3VFMA 4ZNEE 1WWAX 5C0BE 3S3BB 1KYAA 5K9JL 3ATBA 4UQ3B 4IRJD 5DJ0A 5DMIH 1L5GB 4DKDC 1JFQL 2IH1B 4BH7B 2XZCH 4R5XA 5AUMA 4ZS7L 4XPAH 3MXWL 5CR1A 3RVXC 1JUFA 1PKQB 4JFED 3WDIA 2NY2C 2DYPB 4RVBA 5KTEL 3AADB 1K5NB 1FNFA 3IJYA 3QQ3B 4K3JL 5JQHC 3BEVA 3US9A 4JRWA 3REWB 4X6CE 1RHFA 3FQWA 4FGMA 1L9MA 4PJGA 3QIWC 2GCYA 3IPFA 3BGMB 3R06A 2BSTB 1BBJB 4CNIB 2Z64C 5E8NB 1GCFA 1EHXA 1KEML 5C6TH 3SO5A 1HZKA 5EO9A 4ZDHA 2Z92B 3DRQB 2YA2A 1QHQA 3DRTB 2JLLA 3EYVB 1FNLA 4MNQE 1EGJL 5F9WC 4JO2H 4HUVA 4XP9H 4LVOC 2FL5B 4UTAH 2HRHA 5T3ZH 1CD1B 2XWTA 5IJBC 3WY2A 1RUMH 4URTB 1HJBC 2OQJA 5B7FA 5A6MA 1G9NH 1NGPH 1O9ZA 3R0MA 4KXCA 4UDUB 5DDHA 2R2BA 5CIPA 3UYPB 4M62H 1PW3A 5IQ7L 2LQRA 1HZHL 2ZUQB 4BGDA 1C08B 1PTZA 3D0VA 2Q0ZX 5IF0A 1K9TA 2VXQH 2EDMA 4PCTA 5IKCB 2X44D 4OQ1A 2MCPH 1XAKA 1U91A 4LCWB 4KKZA 4YFLF 4UM8A 1RV6X 5SX4I 1A6TB 4YZFE 1BSIA 1I1FB 5K9OB 4ELME 3HZKA 4Z3GA 1NGWB 4RMUA 1UM6H 3CK0H 3LDBB 4FHJA 3WIAA 2YUWA 4M7KL 3CFUA 2GI7A 1MW3A 5IVZA 2NZ9D 3T3MB 4LPWA 5AL8A 4AC4A 1P7HL 2CCVA 2YA1A 2J1WA 1E4JA 1BFSA 2ITCA 4IK7A 4DSYA 2XWDA 3CSPA 4XPTH 3HR6A 3ILQC 1OZTG 3HC0A 3QJZA 3SDCB 4PQXA 5AKTA 1D6EA 4Q6IA 1U2CA 3DLQR 1YYML 1OTUC 2QR0A 3DOSA 2R9HC 4X6CF 3H54A 3I74A 1GRWA 2MKLC 1UT2A 1I9RH 3P2BA 2D7PA 3WV0A 2VLKE 1PD0A 3MGTB 5IMMB 2ICWI 2E9BA 3FS9A 3HE6C 3K71A 1W0VB 2UUDK 2WYIA 1J8SA 4IOFD 4CC4A 1T5WA 1RUKL 3DVNB 2XHNA 1LQBC 2HG5B 1I1YB 1ASOA 1MFUA 3CPUA 4KY2A 3IU3A 3MBWA 1QMUA 4WWOA 4OJEH 4M6MH 4FZEH 1IGYB 1J86A 4IEFB 5FUOH 4BZ1H 1T1YB 1MDAA 1JN6B 2W0FB 3H7BB 3IJEA 1N6QH 4YBLC 1W72H 2BVPA 5DRXA 4HIXL 1RUAL 3F5WB 3H4FA 1KIQB 1BJMA 3EFOB 3X1NA 4YUEL 2GJ6A 4U6TA 4QYOA 1Q9WB 2V2WB 3SDYL 2JELL 3F6IA 4NN6B 4KRPC 4J3OD 2WXGA 5DO2D 3UP1A 3INUH 3NCYP 3QEHA 4JDZA 3QDAA 4MXVE 1AD0A 2DJMA 4X5RA 1OK8A 2VR4A 4KDTA 4LAQH 1C8QA 2CHNA 3T0DA 5EZOL 4YZFF 1NINA 2G9HA 4DT2A 3F05A 4OF7A 2O1AA 3GMRB 1JNLL 4IBYA 1X4XA 1PKOA 2FSEA 5JLZA 1BV8A 2ZIDA 3ESOA 2NNCA 2XA8L 2GYSA 5L7XH 3LD8C 3GIZH 3M1BA 3QRGL 1AHWC 2D31A 2X3BA 4ZOAA 4XN1A 3BO8B 1CBJA 1LWRA 3UMTA 4XP4L 2WZ5A 1UQSB 5TQ0H 2DYRB 4DHLA 3EFFA 3RJQB 1GJIA 1QR1B 1D9KA 2ICEC 2LAAA 3GMPB 2DICA 3MRRA 1HEZA 5CCHE 3ME0A 4APQC 4MCYA 5TH2B 4IDLA 4KKNA 2EDLA 3AT0A 2ZYHA 2KHAA 4KKCC 3QPQD 3TIEA 4DZ8A 4QUOA 2R69A 2H6PB 3SY6A 4AT6B 1OTTD 4PJ5A 1HHKA 4DUVA 3WI9A 4ZUSA 3OMAB 2IGFH 4J3TA 1OT2A 4I77H 4YN3A 1IGML 2AQSA 1HIML 2PPAA 4Z7QE 4B7LA 3VFMB 2WUCL 2A9AA 3SCMC 3LX9A 3REVA 5CBEB 3IGUA 5LGJB 1D7FA 4Z8FL 1B3IA 3ABMB 3ZZSA 1JPSH 3P0YL 1JTPA 3HG4A 1HYSC 1WZKA 1JZ4A 3F7PC 4BRVA 2EC8A 1HKLL 4RIRA 2WNXA 3FL7A 3IJYB 4PTTA 3IDYB 1K4DB 2UVEA 2VDNB 3BEVB 3V52H 3EH1A 2J8UA 4HF5H 5L4MA 2Z4QB 3N44F 2HPOA 4IGBD 4WVRA 1NMAL 4L8SA 1IAIH 4PP1C 4IYKA 4JJHA 3ZUCA 5EO9B 4TNFA 4HA1A 4ZDHB 2ATPA 1IC5H 3MAWA 1VFAB 1PJWA 3VXTB 4XXWC 1Z32X 1DP0A 4IW4C 4QRUA 4KHTL 4HUVB 4ZW8A 3DX4A 4PRIE 3NIFB 1ORQA 2J73A 3MV7E 4LESA 2I24N 2AV1A 4GW5A 4XMVA 4OT1H 4G9FD 2J2ZA 2JKNA 2OQJB 4MLIA 1PZAA 4YFEA 2J5WA 1C7TA 3CVHA 1INEH 1GTFA 5DDHB 4TL5A 1GZHC 3GBEA 1BD2E 4QO1A 2OL3H 1JI1A 4NHCH 1S7VA 1ADQA 3FOLA 1L6XA 3WJLA 5D2LB 3K1DA 1NCDL 3SE3C 4I4WA 2WQAA 1ZAGA 5IF0B 5F7YC 3CN0A 4LXFA 5LNEA 4H8WL 1U91B 3MYJA 4YPJA 4WTXA 4G80B 3NEOA 3BFWA 1KB9J 4S1RH 3DMMC 4YSEA 1FLTX 2Y5TA 3FUNA 4PV9A 3HZKB 4R90H 3PAVA 4LCIL 3PIQB 1DEDA 5AOZA 2X41A 1ET8A 4C57C 1P9MC 4UDTA 5DJAB 3QWQB 4G6JH 1IGIH 1BG9A 5T1KD 1C12A 5ADPH 3GM8A 5DZJA 2ITCB 3ARFD 1OPGL 3L5HA 4H5SA 1TCRA 4O02H 2IDFA 3HC0B 3MLVH 4OJYA 4K5OA 4Z0BH 5JPNA 2YPVH 4GQ9L 2EIMB 5IWLC 3EW3B 1J0JA 4QXUL 3HVDA 1D6EB 2HN7A 4Q6IB 1JZ5A 3A67H 3RX5A 3LKOA 1HWGB 3FRUA 4MGXA 4NO3A 1XZ0A 3OKNA 2QR0B 5B1KA 3DOSB 3ABKB 4ZFOB 2WZPA 4Z7UB 3T6WA 4AIOA 4FLOA 1EHLL 2AXFB 2XPZA 4YDLC 2ZYIA 4Z6AT 2D4FA 1S8DA 3CWGA 4XI5D 1GVIA 2BSRA 1T5WB 2VQ1A 1QSFE 2FX8H 2RTTA 4WLCA 1RVFH 3P73A 4FXKC 3DBSA 3L08A 4IKKA 4NOBA 1OF2A 3T2NL 3JV0A 3MBWB 5ESQB 4B9FA 4BWWA 3MLPA 3K2IA 5K5YA 1TVBA 2P3YA 1I1CA 4NS0A 3H2WA 3U1SL 3VQ2C 5CINL 3IJEB 3MRGA 1DVTA 4ZUWA 2QJDA 3O9WC 3ISWA 1A0QH 3GDBA 5DRXB 3NSYA 4QOKE 1DBKH 1UA6L 4RMVA 1WBYB 3MLSH 3U30C 2BZ7A 4GG8A 4DTGL 1RKRA 3M17A 4QYOB 3WMPA 4EIGB 1FO0L 4EZJA 2NY3B 1OSYA 4IBWA 5HHNB 2RQ8A 1YY9C 3NP4A 5DJZA 3AREC 3U6XS 1FBIH 1JOIA 3QEHB 4JDZB 5GHWH 2IEPA 5D7IB 1MFVA 5TPWH 2WQUA 3JV6A 1AD0B 1P6AB 1E4XL 4KV5E 4P59H 2NXYB 3TBCA 1SVZA 2FX9H 1MFCH 4QHNA 4KJQD 5CO1A 1KPRA 3VXRA 4JQVA 2FSEB 5JLZB 1RZGB 1NGYA 4XPBL 5DK3A 1B0GA 2ZX8A 5KANI 5IJKA 4RZKA 3L2LA 2D31B 2CK0H 3KPSD 1G1YA 4G8IA 3PWLA 4B9GA 2A77L 3LXUX 4UQCA 3ZTEA 4M29A 3QDMB 4L4TA 1RU9L 3EFFB 5F1NA 1XD0A 4S1DC 2ZUSA 3ZK0A 1D9KB 4KQ4H 5F7DB 1GSKA 2Z93A 1KGCD 2XYBA 3ME0B 3QG6A 4H1LH 2RB8A 3JVGC 4MCYB 3T8XA 4EXPX 1B3JA 4L1BA 3E9TA 3TIEB 5I1EL 3NPSB 2VTFA 1HHKB 4PJ5B 2DQUH 3APDA 2RA1A 3ZSSA 4F7CB 3ZT5A 3LEVH 5DD3L 4QF1A 2TRHA 5I0XA 4ZK8A 5ICUA 3X3FH 2OMUA 4M02A 3REVB 4GLRH 5LDSA 1U8LA 4G6ML 2NUTA 5EBWA 4HETA 2VSCA 1IEBB 1UB6A 3SDDB 1BDYA 3ZDXB 1D5IL 3D9AL 3HNVH 1MVYA 2LLLA 2E7LA 4PTTB 3MLZL 3TYGH 3Q1SH 2YSTA 4WK4B 3VFSB 1MLBA 4AX3A 2VZVA 2KQMA 1CJYA 3W39A 3D39A 1XGYH 3WNKA 2CQVA 1E43A 2DMCA 1S7WB 2Y25A 4L8SB 2JNZA 3ZL2A 3P11L 2C4FU 3E3QE 2EH8H 3NFNA 5E6ZA 3HAEB 4MS8C 3GB7A 3S7GA 4QJ3B 3FTUA 4YHOL 3EJYD 3ZE2B 4N1CA 3SYCA 3QI9B 1TETL 1QA9A 2J2ZB 3O4LB 3FUEA 1N8OE 3WO4C 3CVHB 4ODSL 2OTWA 2BZDA 1SHSA 1BZ8A 4J8RB 4NUQA 3V6OE 3A0OA 4QO1B 2X2UA 4Q2ZA 5EOQH 3FOLB 3W2DL 4UOJA 1I9IH 4M4PA 5GRYA 1QLEB 3ZDZF 4I4WB 3QCTL 3QE5A 5INDA 4Q56A 4MHHG 4FTVD 2YRPA 3QIUA 3O3DA 3MRHA 4RLDA 3IRZA 5ACMA 4P2AA 3VGHA 2K9FB 2CLZA 1GCYA 4LEBA 4UZUA 5FYLE 2GB2A 1UGNA 3E0GA 4OZFA 2BPBA 3V4UL 1QHPA 3VM7A 2Y5TB 1XH2A 2GW5A 2HVBA 4MMXA 1P7BA 2NR6C 5JDSA 4FQJH 4YXLL 3TCTA 1OAKH 3BYYA 3HR5A 5CF3A 2Y3NA 2GJRA 2R0LH 3UAEA 4H5SB 4ANKA 1TCRB 5CHNA 1AXIB 3WHXB 1BFTA 1OAYL 5JR1L 2C1OA 3CVBA 4DVRL 4HSAC 1I1AB 2TSAA 1EAQA 4JJOA 3WLBB 1ICTA 2HN7B 2IPTH 3J27A 1V5JA 4Y4FD 1ANUA 4PRDA 1MJ8H 1P7QD 2X28A 3FRUB 4NQCA 4W9FC 4LARL 4FABL 1OHZA 4BSVA 1XZ0B 3OKNB 1A7QL 3H3KA 1J12A 1NFIB 4L37B 2WQWA 3MV9A 3P1VA 4OM0H 5HDBB 1TR7A 1H8NA 3BD4A 1S8DB 4YLBA 2C26A 3TU6A 2BY3A 4OFDA 3H6JA 1JNNH 5FM5O 2HKHH 3D85D 3P73B 1Q0YH 2K3TA 2ZCLL 1OF2B 2IDSA 4Z7NE 4L3EB 1G7PA 2KYIA 4WWPA 1BYNA 1IIKA 2IPUK 2WQ8A 3GF8A 4HHGA 1IGTA 4A2GA 1DQDL 2PW1B 4BFFA 3WKPA 2WCGA 3MRGB 4JO4H 4ZUWB 3P0VH 2H2SC 2R0WL 4JDTL 1G5GA 2DQGL 2QPSA 1BVLB 3CHOA 5HGDA 5L6YH 3GZQA 3NK4A 4YFLI 5AZEL 4GMSH 4UV4L 3KYOB 4P46D 1E40A 3M17B 3L1OH 3OVUB 5IQOA 12E8L 1LO2H 1OW0A 3O8XD 2XBTA 1I8IA 2Y5EA 2J5LC 4OLWL 3CXDL 1JDDA 2ALAA 3BWAA 3JV6B 3CDGA 2FJGA 3BKJH 1WEJH 4QHUA 4TKWA 4UMGA 4B9YA 1E67A 3SE4C 2VAAA 4QHNB 4PJ9A 3BEWA 1MCQA 2KT6A 3DROA 3FPYA 1KPRB 3VXRB 1OCCB 4IBUA 1NGYB 1NC2D 2NMSA 2DRUA 2YAOA 3M7OA 1B0GB 5C3TA 1YEJH 1QBML 1K85A 1WGVA 2Y7QA 2CKNA 4XOAA 2W9EH 1M7IB 2L4OA 2OS7A 2UWEA 1IILE 3ABZA 4FG6D 2VE6B 3HRPA 5J56B 2F1BA 2NNXA 4FZ8H 1LMIA 1TQCC 2D3NA 2X6MA 2ZCKH 3QG6B 3ETBF 3NCXA 4ZYKA 3VD1A 2ALWA 2OMXB 5IR1A 4M1DH 3C08L 1H8SA 1NIFA 3BGFB 1AHKA 2YGOA 2P5WA 5KG9B 4N2MA 3KPQB 3QUZD 4HK0A 4XN8A 3TT1L 5C1MB 4H8HA 4Z7WA 1EEYA 2AEQH 5F9AC 3FBKA 2GEEA 5T1MA 1J0ZA 3FQXA 5KYNA 5BZWB 1OV8A 3KG5A 3TNMA 1EFXA 4HAKA 4Z7NF 1N5AA 2NUTB 3X1FA 4DJMA 5EBWB 1JPGA 5FAAA 4JHWH 5IHUL 4OGAC 1KELL 1UWEL 3IRPX 2W8CA 5FA4B 4LDLB 4JBSA 2DI8A 5I2IB 1YPZE 3NA9L 4D9QE 4QRTA 1MLBB 1ZK5A 2IOMA 4WNSA 5TQ2H 3GK8L 3W39B 2ZXDA 4OM1H 2O5ZH 2X1XR 1OY3B 2EDDA 3FQUB 4YOKA 3S3DB 3L3JA 4WI0B 2VDMB 3RWHB 2C3XA 4IKLA 4AOFA 5C3LD 5E99L 2KPWA 4GSDL 1AQMA 1UB5A 3FUMA 4LCWE 4LSUH 4W6YB 2ZUXA 1MRDL 4WCYL 3BDYL 3NFNB 5LNDA 3LRLA 3CMOH 3GB7B 3GC3A 4MNGE 3TWYA 3ARGD 4LP4A 5DZAA 2FD6L 2OFQA 2F68X 3G5WA 3K1KC 4PJDE 4F92B 2O26U 3LS5L 4YEFA 1QA9B 3NJKA 4YDIL 5CJXA 1PFCA 1J9CT 4QXWA 3O3EA 3G6DH 4Y8DC 5EF0A 1CF8H 3ECQA 2V8LA 4LDOB 4J2QA 5IROC 2EKSA 5H4ZA 4HV8A 1MCPH 2VDOH 4Q2ZB 1MY5A 1UZ6E 2ZZUT 1J05A 2FH6A 3C2AH 1SBSL 3G5XA 4UT9A 4ENED 1IBGH 1JWUA 1T4KA 2GPZA 2H0PA 3HN8A 4XO9A 5EF1A 1ZIAA 3INOA 3B5TA 3BH4A 2W07A 3O3DB 3RVWC 3ARRA 2AK4D 1HXYA 4NKDA 4OZFB 4HC1H 3LIUA 3UL4A 3ZW3A 5ID0B 5EOCJ 4NYLB 3VXUB 3VUAA 4FFVC 3TASA 4R2GC 3ZQXA 1I3RA 4I1NB 5FHBL 3Q01A 5JDSB 2VXQA 4PR5A 3RL2B 3HR5B 3KXFE 4LRIA 4OIBA 1R17A 1XF1A 2Y0SA 2N7SA 3JWDL 3A6BH 3MJ6A 3O6FD 5A2BA 3EO1B 1JL8A 3G08B 2C1OB 5CP3A 4JCWA 4QMEA 1BXAA 1DDHB 3R4RA 3EGXA 4KTDL 3BIKB 1BYPA 1HNFA 1YPZF 4PRDB 4QLRA 4WENB 4WEBL 4X6DA 25C8L 4R8WH 3WNPA 1FZKA 2Z8RA 2E6PA 3VI4E 1S9YB 1R3LA 4RMWA 3CSFA 4EI5C 2QPEB 1KTCA 3UG4A 4AQ1A 3B1TA 3PAUA 3QJFB 4QRBA 3D2TA 4LSRH 1UXWA 1JHLL 3T6ZA 3D3VD 1SOXA 3CHSA 1N64H 3QZWG 3I9GL 2WW8A 4FFZL 1RIVH 4PJDF 4WHTA 2BNRE 1JXFA 1KNOB 2XTJD 3F7VA 1LO4H 2ZXEB 3SKMA 5CD3B 4P2RA 5KWYC 5L9DH 2OMBA 1B0IA 5HYSG 1QEWA 2C9SA 2VDKH 3DX3A 3QUYC 2DMGA 3L7FA 4GAJL 4PLOB 4X6FA 2H0FA 1UZ6F 5KVEE 4GT0A 4KJPC 3C6LD 2XX0A 1P6WA 4K3EH 4XVTH 5EU4A 4W70A 4BZ1A 1I8IB 2DLFL 2FRGP 5A2JH 3K4ZA 2BSSB 2KLTA 3CDGB 3QFJD 2GUOA 4KRLB 3MYZA 5E70A 4YX2H 4QTIL 2J88H 2XQYG 4GG6B 2AJVH 3IWVA 4KKPA 4PJ9B 3KYAA 4QHPA 4C56E 4MAZA 4P2OD 4PG2C 2XFXA 2FBJH 4N0FA 2BMKA 4G8GB 2PXYA 2W0LA 1S7SA 1AGCA 4PJ8A 3WIIH 5F6HJ 3NQKA 1SMOA 3HI1A 1ND0A 4GNKB 2WC7A 1WICA 4HLZH 3SZKC 4NWUL 2UWEB 3EH4B 1U3HD 1JAEA 3V9EA 2Y36H 3QNYB 1BPVA 3FK3A 1H0DA 1VFMA 1WD9A 2D7OA 4ZYKB 3CXHJ 3S48A 3L5XL 5AKVA 4QI3A 2SODB 4IGBA 5IR1B 1E2ZA 4OLZH 4PJGE 2XVBA 3DDGA 4B9CA 4OLEA 4HK0B 2P9RA 1JK8B 3GBML 2NY5C 3TA3A 3TBSA 4JFDE 2C4FT 2KQNA 2DKUA 5D5MF 2DJSA 4TL4A 3ZTJG 2I5YL 3TNMB 1EFXB 1UWXH 4B9KC 1JV2A 1QFWH 1N5AB 5I0ZA 1VAHA 1JWSA 3FSZA 4WW2A 3RVUD 3M8OL 4DEPB 4G9FA 1NCWL 2MMXA 3LEYL 3ZRCC 3HFMH 4RMTA 4PJ7F 4JHAH 3GHBH 1ZKAA 4NLHA 5FFLA 3TCXA 1J1PH 1PG7H 1HHJA 2QL1A 2CO3A 2DEWX 3SBWA 3TNNA 3DIDA 4U1GB 4JPSA 5I0VA 4TTDD 5I1CL 4X7DC 5F7KC 4NZTL 5ANMA 4WI2A 5DZVA 3DETD 4QXTB 1NKGA 4FYRA 3PPEA 3WIFA 3KBPA 4P4RA 1MI5D 2E0PA 1R24A 1EAOA 3C8HA 4KO7A 2QSCL 1X5XA 3H1ZA 3RNQA 3OB8A 4AEEA 5IFJA 3L4UA 1MIEL 4N0YH 2FIRT 2VN4A 4IRSA 3KWUA 3KPOA 4XAKE 2X1WL 3FTZA 1G4RA 3Q5TA 1UOVA 3OKEA 5IEKB 4EI6B 3B2DC 5DHYA 3U1QA 3FO9A 5D8JL 5I1GH 1KCVH 1YJDL 1HXMA 2BINA 2CD0A 1YYLH 4YK4B 1T0MB 2EKSB 4HV8B 5J4MA 2DQHH 2E9IA 3B2PA 4J6RL 4YFDB 2DWSA 2F1AA 5I16A 5L2KD 2A6IA 1T4KB 3L1GA 1A7PL 5CS7A 1R9FA 4R7VA 3S2AA 1XXDC 2G5BA 2YD5A 3FNKA 2VSDA 5KANG 4X7SL 4PJGF 3GJEB 5KJRL 3ZY7A 5HYJB 1MCFA 1F58L 4P23B 3QXUA 1A9VA 4GBXD 2OL3A 4JM4L 2WXQA 4FXGB 1I3RB 4QRRB 5EF3A 1MH5B 5EN2A 4LDCA 1IAIM 2QPDB 3ARDD 4UIKH 1LO0H 4LMQI 4E36A 5I24A 2OMWA 2FJFA 3K2UL 4LSSH 3MLUH 5AKRA 4BH8A 4BK5C 3BPLB 2D7MA 5EU3B 4PJ6A 1CL7H 5EIIB 4H26B 1ZLEA 3RHWK 3GINA 4GKLA 1SHWA 4RISL 3EGXB 4CKVX 2APXA 5E9DA 3BQUC 4G7SB 1U58B 4UILL 5B4MD 3BVVA 1WTGT 2GJ6E 3D6GA 4DAGH 1NWOA 1FZKB 4Z3EA 3O2DL 1S7TA 4L0PB 3H9YA 4CDGC 1AZZC 4WUKH 2FX7L 4O02A 4Y89A 1C9SA 3KLSA 1L7IH 2B7DT 1I7TA 5I1HL 2YPVA 3TWCL 3GM0A 3AT8A 3APCA 4YO0B 5I9QB 5TDNA 4AQ1B 5C86A 3LZFL 3CNKA 1U8JB 3KR3H 1UXWB 3QH3A 4PJIF 5DHDA 5HI3D 2RALA 2AJ3A 5BW7C 3QFGA 4E5XA 2WTOA 3F7VB 4MCZA 3KPSA 4P2RB 4W9HC 2BXZA 3L13A 1KLFB 2CLVA 1QEWB 2L7JA 5AVVB 3CHQA 5DEZA 1QD0A 3L7FB 2XKUA 1QNIA 3FN0H 4KZEH 4WFED 1G7QB 1KJ2L 3LH2L 5HDOA 4H20H 4PUBH 2C9QA 4ZPVA 4J3OC 3SQBA 3TPKA 3V5DA 4ZMZA 5I18L 2H6OA 5DO2C 3H9HB 4U05A 1KZQA 3IKKA 3CSTA 1GC1L 1N3NB 4PJ5E 5FA3B 3E7JA 1M56B 3KPPA 1EIBA 3ZSTA 2X3CA 5DMGC 1T03H 2M1KA 1FWXA 3NN8A 1EBAA 2XFXB 3DJSA 3GMMA 4N0FB 4UBDD 1E65A 2BMKB 2PXYB 2HX7A 1S7SB 1BHGA 1G7JB 1FN4A 3QA3A 4PJ8B 3B9KB 4CMHB 2XN9D 4OU3A 3FUJA 1MREL 3BE1H 2JFCA 3ZDXE 4N9OB 1CLCA 2FCBA 3GNML 3HG5A 2AVFA 2J56A 1KF9B 2I25N 3BC9A 5EN3A 5GISL 2J71A 5JIMA 2R4SL 4I3SH 4AV4A 3CHXA 1CGWA 3BT2L 4N2OA 5F1SA 5BZZA 5KYYB 2J8UE 2CRYA 4U1KA 2YEQA 3FJTA 4KNUA 5EZLA 1NKOA 3QPQC 2CRIA 1A14H 3TA3B 4YDMA 1MG2C 2PCYA 4KGJA 3TBSB 3WUWG 3JWNC 4W81A 1E8ZA 4H1LA 2H5UA 3ROOB 5EU6B 1MSPA 2IPKB 4J4PC 2JKTM 2KLRA 3ZDYB 5G4OA 3MLWL 4OBSA 5SWSA 2E7DA 3BXNB 3UTTD 1CK0L 1HDMA 3K6NA 1A4KA 1E5BA 2XI9A 3QAQA 4N24A 4NOFA 5E6YA 4BJLA 4ODBD 5IOPA 1AFVH 3L5JA 4BFJA 1AO7B 3ML8A 5F70A 4MD5A 4LCCC 4AVIA 1HHJB 4J3BA 5AG8A 3EOTH 2BOCA 1YHPA 3DNKA 4ZNCD 4ZS6C 1LNUA 2ZAHA 4FTVA 2AABL 4UIMA