2CR0A

Solution structure of nuclear move domain of nuclear distribution gene c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
GSSGSSGKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of nuclear move domain of nuclear distribution gene C
rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Nuclear migration protein nudC
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cr0A00
2K8QA 2WJ5A 3AABA 4PCKA 3N3EA 1EJFA 3AACA 2Y1YA 1GMEA 3QORC 3VQMA 3J07A 2XCMC 2WJ7A 5DS1A 2RH0A 3VQLA 3W1ZA 4I88A 4M5TA 4YLCA 5LUMA 3QORD 3IGFA 1WFIA 2Y22A 2KMWA 3Q9PA 2O30A 4YDZA 4M5SA 2BOLA 2N0KA 2JKIS 3QORA 1SHSA 3GT6A 2MNWA 2Y1ZA 1WGVA 2N3JA 1WH0A 3L1EA 4FEIA 1RL1A 2KLRA 3L1GA 4JUSA 4JUTA 4PBDA 3GLAA 4MJHA 4RZKA 4YLBA 2CR0A 5DS2A 3EUDA 1X5MA 4YE0A 3GUFA 4YL9A 3QORB 4ELDA 3L1FA 3Q9QA 2CG9X 4ZJ9A
chains in the Genus database with same CATH superfamily
1FL3A 4M5YL 1UZ8A 4QRSB 4PD4K 1QAWA 3GMRA 2PP8A 2WN2A 1CG9A 3RWIA 3SDYH 3QUYA 4XPAH 4O9HL 1GPOH 1LMKA 5IVNA 5I0YA 1D5BA 4WVRA 2VWEE 1HL9A 2DTSA 2MNUA 3P4NB 3IM1A 3PGCB 3TTSA 4DCQB 3HE6D 5DJ8A 2IFGA 4I0PB 4XNDA 3K8MA 1XAKA 3OB0K 5JXED 1HZKA 5JW4M 1U8LB 4IRJB 4E36A 4KKBC 2HX7A 1NOFA 3QUZB 2GAZB 2QQNH 5SV3A 1D5ZB 3IXTA 1IGCH 2CDGB 4U3SB 4NNXB 4DEUA 4ELDA 3D5OF 3U9UA 5L2KB 5HGBA 4AKPA 1MKFA 1ZVNA 1I8KA 5LBSL 1U36A 1YYLL 4ZAKD 4MX7B 1ITCA 3WIHA 3BH8B 2VDRH 2E8YA 1E9PA 5IOPB 4LPYA 5K9JL 1WAAF 3ZXAC 2D7OA 5ACZB 4JMNA 5LAXA 3SOTA 3ZZSA 4L8BB 1RU9L 4NC1C 5H2BB 2J1KA 5JNYA 3CUPA 4H25A 2BVQB 1FH5H 2DTML 1UFUA 3DTUB 5HGDA 1GC1H 2YARA 1AI1H 5KSUA 3RY6A 4LPCA 4PRPE 3X2QB 3MGTB 1H3VA 3H9HA 2HH0L 5HHXH 1XCTA 4BK5C 5CKAA 2H41A 5CWSA 3GMNA 1GTNA 2BSTB 2AEIT 1PVHA 2NXZD 5EO9B 2BWQA 4HBCH 5C92A 4K23L 3RGVA 1SBSH 1UOWA 1I9EA 3K2UH 3O8XD 3MNWB 3OKLB 4X6BB 4WTWA 1WFOA 1ROCA 2FL5A 2PWDA 1UB6A 1J8HD 4H13C 3UBXG 2ZCHH 4J1UB 1P7QD 3C2AL 3VXQA 1P5UC 1WP6A 5FHBH 4QHNB 5CJQL 3MSPA 5IBUB 4ZX6A 2W0FB 3LYRA 1MCKA 3A6BL 4I18A 5C0GB 3AY2A 4HJ0C 3KR3H 5KVDE 1RJLB 5CD5D 4M1DL 2XPZA 4ATWA 2DIEA 2VSMB 3OPZL 1XIWA 4J27A 1UCBH 1L9PA 4U6HB 2P42B 3H54A 3QXDB 5AVTB 2YOCA 3U0PB 2TAAA 1QUNB 3VXUB 4DP9X 4UIKH 4UINH 4P46A 2KZ1B 3MLRL 2FQGA 4FC3E 3VI4A 5IFHL 1NCBH 4X6FA 5MP6H 2ZPKH 4JGNA 3R8BB 2I60L 1BMZA 3L3KB 1MH5B 2FJSA 2XOTA 2A83B 2ICWB 4M8VA 1DQDL 1BD2B 5GSRA 3SPCA 1IJNA 1GMIA 4H8WC 2EUWA 5JORB 5JXAL 1NMCB 2V17H 1YEIH 4PG9B 3OMZA 1ZTMA 1PZCA 2I07A 1HINL 4KNUA 4LSSH 4NO5B 3UCQA 4DGYL 2EIDA 2HVKA 3VGDA 2DQUH 1OAXL 2YA0A 2PTUA 4JY4B 3VXMA 5LB1A 4NERA 4EZJA 3VXME 4ZX3A 1JWSB 3BQUC 4R90H 4QHMA 2X6MA 4NZRL 1ZHBA 1MEXL 2N01B 3IKKA 5DJCA 2V0AA 3F12B 1H6UA 1VZGA 5E03A 2EDJA 2N0MA 2HFFB 5FYJL 3PWPE 3LRMA 1YNTF 1X7QB 3EHBD 3N85L 1LQSR 4QO1B 3DX4A 4R84A 5CEXB 2QHLA 5I26A 1MFEH 2WLKA 2UZIH 4OLVL 4ZJ9A 1YEKL 1W6WA 4Y9FA 2YUWA 1L9OA 1DVYA 5J06A 1FL3B 3GJFK 3NBNA 4CVZA 5DYOB 3LXBA 3GMRB 3RUGB 5GGVH 5HXMA 1HSAB 4LAJH 1HE7A 3GMPA 1DANU 3AU1A 4H4NA 4NPYB 4KUCF 5FGCB 5TPWL 2HFGH 3HC4H 4OIAA 1A14H 1X5YA 5D70H 5KSAA 1GY2A 2YZ1A 5DVPA 4CSPA 2E7LA 2WKOF 4I0PA 2H26B 1O7VA 3CDGA 4LEXH 5ERWB 4G8GB 1B9KA 2WM0A 2WBWB 4HMEA 5D70L 3VXNB 2Z7WA 5GS0H 2G5UA 1JPST 3H2WA 4PVMA 1JNNH 1HL8A 2EZ0C 3BZ4B 2P5WD 3JWNE 4JQVC 5CEYB 3IDIB 4YVUA 1KLUB 4Y9EA 1LWRA 2QLYA 4F7TA 5I28A 3QZWA 2GEQA 4U1IB 5A2AA 1G1YA 2ADJA 2P8PB 3T08A 4JZOB 3REWA 4AMWA 2J88H 4HALA 1H0DB 3FYEB 5F7EL 3H7LA 1YPZF 4EI5A 4JPSA 1ANUA 5SX4I 5HGDB 2GY7B 2VR8A 3C5JB 5D7LA 3O3BB 3HTLX 5FYJH 1IC4L 5K93A 3IRPX 4O58L 3X1GA 3WE1A 5E1GA 3LKOB 1DHKA 2L7QA 3G5VB 4XCFL 5AVYB 3W38A 3PL6C 3QULA 2IIJA 4CSTA 2O4EA 3KYOA 3T8XA 3HG1A 4RMTA 4Z7IA 3MRRA 2PYED 2XYBA 5IBUG 3LEXA 3F7PC 3ILQC 1XCXA 2JK5B 3BDXA 4N68A 4AC2A 4DGYH 3DO3A 2DMHA 2A9NL 1N64L 4I3RH 4UV7L 5E6UB 3CGTA 3VXQB 5KAQG 3FUFA 2NY0B 4FXKC 3S2AA 4N24A 2PO6C 3GXDA 4PJEE 4Z3IA 1S7RA 1A65A 3SGJC 4LP8A 3S8FB 1KIUB 2H2SC 2W38A 3HIZA 5ESQB 3CU7A 5HHVL 4KI5F 1LO2H 4U6HA 1UD8A 5I1DB 4LHUD 1K3IA 5GGRY 4ACPA 3TO2A 1N8OE 2A6KA 1N2RB 2IV9A 1USZA 1LLAA 3FF8A 1I9RL 1EXGA 4ANKA 1HN1A 4OZGB 1OCOB 1PNDA 1JNHB 1INEH 1ORQB 1PBYA 2NY2C 3ZDWA 5DS2A 3SDCD 1G1KA 3T1FA 3TBCA 2CUIA 2V9QA 1KBGL 3B9KA 1MH5A 4HXAL 4E42B 4ZRGA 3GSNH 3A6BH 3QNFA 3VQ1C 4ZW7A 5TPWH 3QPQD 4JFDB 2F53A 2Y6SD 3JTSB 3KGUA 4Z0BH 2YD3A 4XVUC 2FT8A 2L04A 1PG7X 2W5PA 3B43A 4F37F 2R51A 4KKLD 3SGDI 4ZUVB 2BY0A 3BKML 1KGCD 2XC8A 4U1KB 5GGUB 5I76A 3GTTA 4HHWA 3TASA 2XV2A 4EJ1C 2Q86B 2QDWA 3L6FB 2WIIA 4MAUH 1PJWA 1J9SA 1KCVL 3ASNB 5AEAA 1LEKA 2NLJB 5DO2D 3IJHA 4K94H 4U6VL 4P2QB 2BSSB 2Y69B 4K3EL 2WP3O 2H3KA 1WUZA 5IQ7H 4FXGC 4XP6H 1OEZW 5T33L 4PJ9D 3QXAB 2BY1A 2WNKA 3VRLF 3QEQA 3MLVH 1UHVA 2DBJA 3ETBF 3IWUA 1ZLUK 2MQGA 1RULH 3D39E 3DYOA 4WFEE 5LQBH 1OAXH 4AQ8A 5BRZA 1NGYA 1OHQA 7PAZA 3ARXA 4NC0B 3W9EB 4ODHH 5EOCJ 1WSST 4YE4L 3CLFL 2EAEA 3WJMA 1SRDA 3FCSB 5KSAB 3H3KA 5ICXA 3M8OL 4OBSA 3WFCH 4PJ7F 1AGDB 3O6FB 4UUJB 1UXWB 3CHPA 4N8VA 1BLNA 2O5NA 3GJFH 3FFCA 3M6DA 2DYPB 2WYTA 2YPLA 2V9TA 4GW5B 3C6LA 5CEYA 4L1BA 1YEGL 3O6FD 4MAYD 2FBJH 3LN9A 5CEZE 2QHRL 5C8JA 4HWBL 1B0GA 3DXAA 3PP3H 4M1DH 1HXYB 3CDFA 4E9RA 1KBKA 3BKCL 3M17A 3L2LA 3DVFA 4XVTH 3TYFA 4HEME 4TTDC 1GKEA 2HRGA 1NDMA 3R18A 2ENJA 3C5SA 2X05A 4P23A 3RURA 4YSUA 2P28B 3SQBB 2PXYD 1B9ZA 3OAUL 2BIIA 4B95C 4M02A 2YQBA 2PWEA 4PV8B 1SHSA 1NPJA 3ECUA 4JFHE 5E2UL 2WD0A 1N70A 4M7ZB 5JUEL 5LWYL 4TQPA 1P84K 3TV3H 4J8RB 3FSAA 3OKDA 2G3XA 2RQEA 3EH3B 5D4QA 1CS6A 1CFQA 2X2HA 2IWKA 4JPWH 2QKIC 1GC1L 3IMVA 3CHRA 4U1HB 3WD5H 2N7AA 2UUDH 2DYRB 5IESH 1K85A 4XH2B 1UCTA 5F88B 3WDJA 1R5WB 3LZLA 4NN5C 4XVJH 2QBWA 3VRIA 4G7VL 5I1DA 4OBRA 4AW4A 5AKTA 1HHKA 3ARDC 3AFLA 3V0GA 1XSIA 4PJGA 5DURD 4DW2H 5DHMC 1MI5E 4N90D 4AG4H 3ZDYE 3VM7A 3BMVA 1BOGA 2OTUB 3BVNA 3GS7A 5C2BH 2VM3A 3CFJA 5E2JA 1HKLH 5AVVB 4IGBB 2CBOA 3LRLA 2X3AA 3LIZL 3MNZA 5ACMA 2QR0A 3WJJA 1G0DA 3NCEB 3GSVB 3TBWA 1N68A 3HCVB 4B7LA 1HC1A 1ODAA 4KHTL 5C07D 5DWUL 4YFDB 5HYIA 4B60A 1BQHB 2E27L 2VO8A 1KUMA 3CFEA 3OHXA 4O51A 4P5MA 5K69A 1K6QL 3CXHJ 3O0RL 4WI0B 1GZHA 2IAAC 3VE0B 5HGAB 3WIFB 2FIKB 2WKLA 4ZUVA 2YFNA 1MCQA 2VLJA 4O4YH 5FKPA 5CINL 1XCWA 3L1OH 3N40F 4W9IC 1F42A 3VD0A 5DT1H 1YQ2A 3B2UC 4Y5YA 2AJYL 2Q9OA 2XZAH 1KJ2L 3MRGA 3VWKB 5KYWA 1NANH 1OPGL 4KZEH 2FLRT 3RDTC 1JGLL 3F7KA 3WFZA 4PBXA 2ESVB 2ZUWA 4P2QA 2PLTA 1ETZB 2GBUA 1P4LB 5DLML 1KYFA 2VSDA 1AVAA 4G6JH 4ZZKA 4YX2L 3BSHA 3W3BA 3I2CL 2XBZA 3L8QA 4ORZC 4YEEA 1RZIA 1SGKA 4HUNB 3V0WH 1A6WL 1FZJA 3MRFB 1MELA 5CJ8A 1JPFA 1XGPA 3FB8B 4HWEL 4PD4J 5DUBA 4LLYB 4HGKC 4EVNA 3LEVH 4Y8AA 4OH2A 4TVPH 2APSA 4QJ3B 2R1XB 4PJ8A 4UMGA 1FAKT 4X8JB 3K8LA 4XP4L 4DK3A 5KVFH 3ROOA 5A7BA 2LOEA 3OMNB 2IOMA 4X8CA 3C09C 1M53A 4JPIA 2Q6WA 4D8PB 3NEEA 4K94C 1E5AA 1KCUH 4KQ3L 4FTVB 2OQJA 3NACH 2XN9D 5TD4A 5MEND 1BLNB 1CDJA 5IG7B 3TU6A 2Y2TA 3ETTA 2AEPH 2CR6A 4NENB 4U0RB 3ULSA 3DUUB 4L4TB 4Y4HA 2A4CA 1INQA 4LK4A 2O5YH 4NHCH 4XTRD 1MFUA 1E5BA 3GK8L 5BUPA 1AD9B 5C8JB 4DP6X 5E00B 5C0EA 5ADPL 3NIFF 1HXYA 2F54D 2WVSA 1ZT4A 1BAFL 1R33A 2VRKA 1ZOXA 4XGZA 4YC2B 4ETQA 5E6ID 4XPHH 4D7BA 2AK1H 6PAZA 1WITA 3RIAK 3TYFB 2QTVA 4OCYL 1KV3A 4KRPD 3ZL2A 4IHOA 1C5BH 4OQTA 4TULH 5ITFB 1M1SA 2R0LL 2PMZA 3O3DB 4MNQE 4ZFZA 1AFVL 1Z32X 5HGHA 1F3DH 3QHZL 5GRVL 4DGIL 1GR7A 1T83A 2WXIA 2O26U 1EEYA 4TUUA 3WMQA 2APWA 3EYFA 1P69B 4H5SB 4XPGH 5E0QA 1MRFL 1PG7W 2OM5A 5ABDE 3K71B 2MKLC 4KAQL 2J2ZA 2EKSB 3GNML 5T1KA 4AGOA 3HI1A 5I1KL 4JQIA 1AR1B 1KGYE 2LAAA 1R9FA 5DK2B 2J6EH 2WXNA 4U1HA 4HPYL 4RNRA 1Z6JT 1XF4A 3IDUA 5C0CB 3QORA 3N55A 1VEMA 3S88L 4HH9B 1EO7A 4KX7A 3B3IA 3MLWH 3EJZD 5AZEH 2DQIL 1D9KC 1NBCA 1MCOL 4LARL 1QKZH 1CL7H 1N10A 4WJG3 3K0YA 1UZ6E 2ESVE 4CSZA 1TZGH 2XZCH 5CJXA 4KKQA 5C0CD 2EYTB 4Q6YA 1D5BB 4IIZA 4PLJD 2CK0L 1MCFA 3APCA 2G75B 4ODTL 1LEGA 5CJOL 2WUBH 43C9A 4K7PL 3C5ZB 4QRQB 1QASA 1E8ZA 4RMWA 3R8QA 4CJ1A 1B0RA 1CGXA 3IMRA 4R6UA 4Y7OC 1NGWA 2E0PA 3QJFB 3BSZA 2G9HB 3CSBA 3PGFH 2R4RH 4XP5H 4DKAA 4KK6C 3ELAT 3RX9A 3KEDA 1MNUH 3N6YA 4N25A 4P5MB 5HVFB 1VERA 3IU4H 2YLHA 4J4PA 4BZ2A 5DA4A 4FA8A 1MCPH 3ARED 2HG0A 2KH2B 35C8H 4JM2D 2X7LB 5FYLH 4PRNA 5JPMB 4JX0A 3MKKA 1BIIA 3QIBA 3ZKMC 3MRGB 3K4ZA 3VWKA 3MV9A 4A66A 4PP1D 2YRBA 3DBXA 3GF8A 2J57A 2MTPA 2R7EA 3P4OA 1ILUA 2PCFB 4MQXC 4UM9B 3LNDA 3BSZH 4PSPA 2VLME 4DUWA 3EYSL 3GGWA 3FHQA 1JPSH 1FFQA 3QE5A 3VWJB 4PG2C 5D7IB 1CG9B 1NKRA 3GZKA 5EO9A 3U6RA 4FTVD 5EIQA 1VFMA 2G3NA 2BSRA 4OJCA 1JZIA 2Y36L 1XD0A 4OJAA 3EXLA 4YN3A 2D3JA 5DJ8B 3BSZL 3AJ7A 3KJ4B 4U0RC 3VW3H 1MJ7L 1W0WA 3EBIA 1DFBH 4X98B 1XR9B 3DK0A 3QUZA 4PV1C 4QHNA 1MCHA 2EDOA 2UYLA 1BVZA 3I3EA 4GUPA 4P2RE 3ZDZE 3DIVA 3ZDXB 3ZE2B 5E08L 1Z0MA 2PF6A 5LHDA 1NC4A 2JCCB 1OP9A 3OSKA 4OV6F 3JZYA 3TX4A 2XX1A 2CNYA 2NUPA 4I0CC 1L0PA 2BVEA 2PTTA 4N1EA 4HLJA 5EUOE 4ANXA 3QQDA 4FQ1L 3EOTL 4A6YL 5I8KL 5H2BA 3E3QE 4PGBA 2B14A 3DRTA 4OV5A 4G9DB 5AAWC 1CXEA 4PUBH 5L88H 4IRJD 4N1HB 2XPYA 3ABMB 5D93B 5IW6A 4WJKB 1URIA 1U21A 2MOQA 4AXWB 4ZFOB 3IFPA 4ODTH 5CJOH 1OZTG 2B15A 4K15A 4OZGF 3VFGH 3OKKB 2R0ZH 3WDHA 4M5ZL 4M8RA 2VDLH 5JORA 2F19L 1IBGH 5F7DB 5DJDB 1OKEA 1ZANL 3OKLA 4NUJA 1E40A 4PGZA 4YHIB 4Y16D 2BXYA 5HSFA 3FOMB 2X10A 3CHOA 3ECVA 4U1MB 5TF1L 5F6HI 2EH7H 5TH2A 5SWSB 1A0QH 1DVFC 1J18A 1TYRA 5SWSE 3ZGHA 7FABL 2FHBA 2R15A 3C60A 3CFCH 5I1KH 2LU4A 1EUTA 4UQIM 4FXGA 3WKNA 1XIWB 3ALWA 4LLQA 3FRUB 2I27N 3H55A 3RTLA 2GPZA 5I8EB 2EVFA 5ISZA 5KBKA 3SQRA 3DSNA 5ESAB 2N56A 4MD4B 5KEZA 3QORB 3ABZA 2VXVL 4D0DB 2I9TB 2W8CA 4CNIA 1DSFH 1G0XA 2FBRA 4IQHA 4WENB 3T2QA 3DX8B 3ZX1A 4CVZB 4JHAL 4MSWA 2DLEA 1EIBA 2IH9A 4NI6A 3QW9A 2EYTA 1BD2A 5GSRB 3ZSTA 1IEHA 2ROYA 1NMAL 1XSKA 1HJBC 4NQVA 2QVFB 1G7MA 3AWGA 2ZOKB 3RWEA 3QO0B 5AL8A 3VFNA 4NQDD 5JQHC 5JQIB 3BQUB 2ZCKH 3CCHB 5IVZA 1BGXL 1T5WA 5EU5B 3MBXH 4TM9A 3O6KH 3POHA 5E8NB 1FLTX 1Q4NX 1V54B 2P47B 1F6FB 5CU5A 1ZHBB 2VZ3A 5LGJB 4R97B 3BJLA 3NJVA 3ULVL 3NACL 3RGVD 3TCXA 4WKZB 5AOKA 1B4JH 2F8VA 1R3HB 1NFDE 4R4FH 4FA6A 1PKQB 3HB3D 3EO0A 4HWUA 2NY4C 1QG3A 1FNGA 4FERA 4JFDD 4J3VA 2DQTL 1J8HA 3BUYA 5EU6B 4M6OH 2R27A 1ZTXE 1MF2L 3HS0A 4X6DF 3KEHA 4UV4L 3GUTB 1N3NA 5HD8D 1R75A 1SYSA 4Y89A 3RL1A 5JYMA 4HLZH 4GKZA 1ZJBA 3IGLA 3HRPA 3FFDB 3CZNA 2VR3A 1WPCA 2P49B 1U58B 1A47A 3MZGB 1TCMA 1HSAA 4M48L 3EKCA 4PY8I 1P9MC 2FJHB 1X5IA 3HE6C 4EN3B 3W37A 4LZKA 4NPYA 2FAUA 3L4ZA 3NFSH 1U8KB 1DO6A 3FO2A 1XGYH 4KJYA 2IDUA 4WY7H 3FTGB 3EFFA 5EU4A 5HHQB 4F37K 2WXLA 3DJRA 3F6JA 2CDFB 4UB0L 3V9EA 2IQ9H 5FS5A 1KJMB 5I6XB 5CGBA 3RHWF 1KB5H 3UTPD 4C8XA 2HLAB 4PJ5A 3RQ3A 4A2EA 2VUKA 3O2WL 4FQXC 2XKNB 5G55A 4ZMZA 3QBTB 3FQWB 2I85A 4GQZA 4IBYA 2ALWA 3ZRFC 4RMQA 4PWIA 1K6QH 5C86A 4Y4KC 4CU7A 1JERA 2VN5A 1W80A 1X6LA 2PTTB 3AACA 4F5CA 3GHPA 4BSVB 2WGXA 5J6HA 1LEIA 2MJWA 4NBZB 3UC0L 2FHCA 3V6OE 3L3JB 2C4XA 4KV5E 4N0YL 1F3JB 1I7TB 4NWTL 4KY1H 5LGKA 3RTQC 2C8NA 4PVLA 4KRPC 5C2BL 5IROA 2DI9A 5DVNA 2BS8A 3L3DA 1E9QB 2Q7YB 3O6FC 2FO4B 4PJFE 3NCXA 3KYOB 3T8XB 3STZA 3QUXA 3DJ9A 5I1EH 4TL5A 1X4XA 1JMZA 2DLIA 2BP8B 2V5RA 4Z3GA 4LSTH 4XN5A 4LVOB 5TQ0L 4J3OC 2OMBA 4BA0A 1H6TA 2WBJA 2FJFA 4G8EB 3TFBA 5A2LH 2DQTH 4LSPL 4N0RA 5FYLE 1O5PA 3CJJA 3C60B 2DMKA 3LQMA 2ZXCA 5HI5D 3H2QA 2EEAA 1NCCH 4UM8A 2R8SH 4PJBB 4PWFA 3D52A 4EDWH 1TSHA 4K9EC 4R83A 2ATPB 4QGYA 4HULB 5DJ0B 1ORQA 3CVHL 3QNYB 3EFOA 1KDJA 3MRCA 5DEJA 3UCRA 5LVEA 4KGJA 4W9GC 4LU5L 4DK5A 1GXEA 2R1WB 3L9BA 3VO0A 4E42A 2V37A 1VA9A 1L6XA 3PWPB 2A5UA 1NUDA 4TVUA 2YFOA 4ZSOA 1HE8A 3PXJA 5GISL 2I32A 4GNKB 4GFXA 1YYMH 1R24A 4EI5D 3DOSA 1E5ZA 3FO9B 4A2GA 4Q58C 4QRTA 3VW3L 1Z2KA 2LGNA 2P8LA 4JFDE 5JW5B 3VXSD 3KLDA 2JJSA 4M43L 3Q6FB 3B2PA 3SE4C 3SBQA 3C6LB 4PJHA 1N0LB 4XNYH 4RGOH 1GOHA 2NUTB 5J11B 2BXZA 4MX7A 4I13B 4UTBA 5JHAA 1KB5A 3TPKA 2ZNXA 1FNHA 1K5WA 4OGXL 4LBEA 4ZD3H 3EGSA 5IJDC 4MXWL 1ZRUA 1AR1D 4PLKD 1NDMB 2VCOA 5F96H 2UXTA 1M9WA 3LKNA 4Z6AT 3NP3A 1YEJH 4XBMA 3E8VA 5IY5B 1T83C 3KH4A 4J7RA 1ZANH 4MCNA 5DRXB 2R4RL 4B9ZA 1RZQA 2OTWB 2FWSA 4GBXC 1N59A 4R2GC 5CGTA 3QRLA 4YPGB 2OCCB 3TT1L 4U6VH 2CJTA 2FL5B 3RWHA 5EU4B 5HHQA 5GIRB 3I3DA 1EVUA 2H45A 2HN7A 2X44D 2W0KA 4L5FE 3I75A 1R4XA 1S7QA 5DO2C 3VH8G 4MA1B 5FGBC 1IE4A 4X80H 3FFCB 5K1VA 1AO7E 3QWNA 1FZOB 1RK1B 3D3VB 4PJ5B 3ENEA 4ZUUA 4E41D 3G5YB 4AC4A 2XY2A 4IRZA 2D03L 2BFGA 3RDJA 1W9XA 3QXDA 4Z3EA 3ZDXE 3ZE2E 3UZQA 2WZ6A 3CE1A 3RP1A 2CMRH 3ZYOA 3RI5K 5C0NC 4GAYB 1IM9A 1UJ3A 5J9PA 1ZHNA 4NZDA 1V3JA 1SQMA 2YD4A 4FULA 4TKWA 4F3FB 2HUEA 3GNMH 4B9JA 1DFBL 1EZSA 4DVRL 1AZVA 3Q13A 2KDGA 3QP3A 4N9GA 3QEUB 5T1MB 3L3DB 5E1AB 1P0SE 2EEXA 1NGQH 3T8MA 4AVKA 4G1MA 3A6CH 4ONOA 1WWBX 4R4BB 5JHBA 2I07B 1DL7H 3DX9B 2HVKB 4H26B 4MAYC 4EN3C 2V5TA 4JVUA 1T7ZA 1I4FB 3IVKB 2YEVB 2EDXA 2O6PA 1F00I 1HIML 4FFYA 1QFWM 5IQMA 2A6DA 3B2XA 2XKUA 1Q9OB 1FV1B 2ENQA 4LIQH 1MCCA 1N64H 1FYTA 1WHPA 1E43A 2W07B 2SEBB 5D6DA 5GSVA 4LVNC 3WFDH 5I0WA 3HE6B 4GG8B 2GEEA 3KS0J 1V3LA 1CCZA 1KTKE 4M93B 3IE4A 3PU7A 5BVJB 1S9XA 1EZVY 1MDTA 3GEWB 3HN3A 2CLRB 3NAAH 2HRPL 4Z7VA 2YPLD 1VADB 1BXVA 3ARBC 1NCCL 4AK2A 4O58H 4I3SH 1IC4H 1S5HB 1D6VL 5C9JA 1Z1WA 4KTEH 5FM5O 4LCVA 3FB7A 3MNZB 4OAWB 1QFHA 1S3KH 4KI1A 2OR9H 3L16A 3LS5L 2JIXD 1I1YA 2O5XL 2UV3A 3ATBA 3ZU8A 3TJHC 3U46A 4X7DC 4PLKC 1TZGL 2XZCL 4C83B 2YD6A 4JPIB 1S46A 3T2NH 4D8PA 1CFNB 4LHUG 5I74C 3FO9A 5CN3A 1RY7B 2EEBA 3O4OB 3TBTB 4JFOA 3VE0A 4PJGF 3JT0A 1U6AH 1DJHA 2PXYA 2IANE 1AZUA 3AG2B 2GJJA 5F9JB 2CHXA 2CZNA 1KGJA 1Y18A 4TSCL 4PGEB 4KJPD 4AYGA 1N0LA 5AW7B 1GJUA 1OF2B 1NGZB 1TZ8A 3I02A 4YUEL 4D0BA 3OKMB 1BQUA 1L4IA 4IBUA 1TQVA 2RTTA 4GRMA 4YFLF 1C8QA 3GMMB 3QZPA 4LOUD 3WE6A 2ADJB 2P8PA 1YNLL 3UBHA 2EXSA 2AEWA 1DBML 4OQTL 3OF6A 2DIAA 1F1DA 4JRWA 5SX4H 5K5YA 4FJ6A 4JQXC 1RZIB 4OCRL 1JF1B 1T21A 3O3DA 3PL6B 4ZFZB 1H3PH 4B9KC 1NLBH 2W1NA 4XMTA 3DJTA 4QUOA 3QULB 4J2XA 3MLYL 1VKXB 3MV8A 3ARZA 5F3BB 3EJQA 4X8JA 5D1ZC 5B1JA 3UYPA 4GUOA 1WICA 3ROOB 1T7VA 2ID5A 5EZOH 2GABA 3VNZA 4FQLH 4UB0H 3QCTL 1KPUA 3DXAE 2A9DA 3GSOA 1WRFA 5I1GL 4LF3A 3HKZA 2EIEA 5DK2A 3WUZA 3EGDA 4LE8A 4IBLT 3Q2WA 4DIXA 4DFIA 3NFSL 1U2YA 1XSJA 2VSCA 3V95A 4RLDA 4ZUUB 3T6XA 2R69H 1AGEB 2DQGH 4KC3B 1P7QA 1GSMA 3B3BA 2DQUL 1T6VN 1T89C 3GSRB 4XHQA 1RUML 3C8KB 2DEYX 1RV6X 4AT6A 3Q2LA 1UJ3B 2LU7A 3QZWG 5H37H 1XHHA 2VDML 3LEVL 3H9YA 5EU6D 3SDXB 3UJTH 5L4JA 3TBYB 2BNRD 4OZIE 2Q10A 3SDXE 1NC2D 3B9KB 3MYJA 4DPRA 1C16A 1AXIB 2EXYD 1TTRA 3AB0B 4ZFGL 4UAOC 1JYWA 1A6ZA 2IQAA 4X5RA 1R3KB 4CAGA 4P3CL 5CZXD 4LSUL 4WFHE 1SJEA 1QX1A 4Y19A 2BW4A 2W59A 4IIQB 1DQML 1GGCL 3BVWA 1VF5C 2ERJB 1EK3A 5CR1A 4JANA 3I74A 1JGDB 4H26A 4KKZA 2EE2A 2YD9A 2J2ZB 4K7PX 4J39A 1OPGH 2W80C 5L7XH 4GP4B 3VG9C 5F1IA 2X1PA 5E8DL 1LYQA 1BM3H 1JDDA 3B9AA 3DO7A 4JY5H 1SJHA 1CXHA 3C2AH 2HPTA 2VC2B 4JHAH 2AV1A 4OKDA 4F33A 3P30L 4P8QA 2EUXA 4O02L 2LU3A 4W81A 5D7IA 4FFWD 1CE1L 1M1XA 2X6CA 2ZYHA 3NG5A 5GZND 1LDPH 1MCWM 3ZUNC 2MQCA 4NEHB 2AV7A 2OXHB 5H35A 4RMSA 4D9RE 3QRFM 1R0AL 4X8XA 5DHVB 1AHKA 2VDLB 4U1NB 3ZKMD 3F84A 1E4KC 1G4MA 3ZDYB 2K6ZA 5I19H 1UOLA 4ZS7L 3FULA 2Z0BA 4LQFL 2BVOA 4ONGH 5KYNA 3WNKA 5I30H 3RRQA 2F5AL 3MRQA 1HQ4B 4EXPX 2JCCA 1VCBC 2GTQA 4Z7UA 5GZOC 4ODXB 2Y22A 4G42B 1N6QL 3BAEH 3U4EA 1QFUH 4WNQB 3IDMB 4PW3A 3MLVL 1UXWA 3UABA 1YY9C 3UAFA 5LBSH 2PXYB 1HWHB 5PCYA 5CUSL 5AD0B 5IESL 4MD5B 5AAMC 2EIKB 1U0QA 3H9SE 2OL3B 3APMA 1G7PB 1WGOA 3T3MB 1HEZA 2H9GB 3F7YA 5DJAA 2R7EB 3X1EA 4P9ML 4PI0A 3GMMA 3WE6B 3L45A 2ENYA 3NP4A 5AW9B 4QTFA 3FPYA 3P2BA 5CZRA 4MAYB 4BH7A 1CQKA 4BFOA 2XFXB 1LMIA 3BKMH 3D69B 2R2EB 3NRFA 1YPZB 5FW8A 5IV2A 4DP7X 2DL9A 1XGUB 3STBA 5DMIL 1RI8A 1WZ1L 3TA3B 3WNMA 2HVJA 4Q56A 4X98A 3OXRA 2YEZA 3T2PA 2ZKYA 4TPRL 5L2JB 2I26N 2K6YA 2H3NB 1ZGLA 4HG4K 2G5RA 3KLSA 2ODHA 4X4MA 1XSOA 4HUMB 2R29L 4PS8A 3BVTA 15C8L 3CBJB 4HWBH 3EF4A 4G7YH 4PP1C 4WU5A 3UTSB 2VZTA 3MRDA 5DVMA 3KJ6H 5MERB 1EHXA 1U42A 5J1SC 1RPQA 3S7GA 1GGIH 4NO3B 4N2EA 4BIKA 2EDFA 5ESAA 2XZQH 1IT9L 1GVIA 4OGQC 4UBDC 3CFNA 4ZO9A 3KBPA 1XX9C 1JGIA 4FXLA 4RFNC 4DH2A 4UQAA 1DCLA 2P9RA 2AABH 1VFOA 1QD0A 3FU0A 4YE4H 2AITA 2F08A 4LMQE 2IMNA 1YQVL 3HNVH 5DJDA 4CJ0A 1TJGH 3I9AA 3QDHA 3WTSA 3GI9H 4B3VA 4XTRC 2VJXA 3J7HA 1TEYA 4TNWK 1CFVL 3IXAB 3PWUB 3SGJA 1QOKA 3FQXA 5KYXB 1T04A 4UOJA 3G6AB 3S3DB 1RFDH 3BP5A 3LV3B 4Y1SA 1AQHA 3F58L 4FOMA 1NC2B 3RTQD 2OXGB 3OZ9L 3SCMD 3IF1A 4ELKA 2VDPH 5KANG 4K94L 3ESOA 3EO0B 5JYLA 5I66A 3QDGD 4O2EA 5E5UB 3FO0L 5FKPB 2DMBA 1CT8A 1T20B 4PJCE 1TOXA 1AIFB 4KI5E 4JREC 4L8SA 4WHYG 4MS6A 3RDTB 1AZZC 3QQNA 1SJHB 3KWWB 2FTAA 1G7IA 2Q76B 5ALBH 3U2IA 3FFDA 4PJBF 5DS1A 2MNWA 3QYMA 5TF0A 2DQIH 3OL2A 25C8H 1KC5L 4XNZB 1U95B 5F7MC 1CYGA 4FFZL 4MBRA 4MSWB 4L3FA 3T1WA 1PL3A 1WA1X 4EZMA 4WI4A 1WZAA 5J12C 4JFEB 3QXWA 1HI6B 5E8OA 3GRGA 2ZOKA 1NZRA 3OC5A 3P02A 4HXAH 3RWEB 3KVQA 3FT4B 1TQCC 3IB4A 4EOWL 1U8LA 4IRJA 1E2VA 1VZHA 1PW3A 3F65A 1EZLA 1L9RA 2DL2A 1PZBA 1D5ZA 3BHBA 1A14L 4HBQA 2OKMA 1E42A 2XN0A 2OJEA 3FF7A 3QEQD 1ZK5A 4JL2A 3DURB 3A23A 1V5JA 3WXVH 2DKMA 2Q3XA 1NJ9A 1HQ4A 5JHLH 4PH8A 2DJUA 4HKJB 3ZY7A 1K5NA 5ADOH 4FG4A 1MJJB 5BRZD 3TNMB 2VDNL 1XMEB 2H6PA 1PKQA 3FTXA 4RMBA 1T1XA 2F15A 1PKQE 1UWEH 5D7LE 5IG7A 3ZW3A 1LE5B 1AZRA 2GTWA 1DSYA 2DQJL 4XP1H 3TURA 4HS6A 4L4TA 1IAOB 3U9PH 2HT2C 5IJBC 4QXGH 3TT3L 3JWOL 2LW3A 3QR1A 2Y6TE 4EI6A 1BV8A 4NB7A 5CWSB 4WWOA 2Q2LA 1AANA 4NZRH 5KZCD 3O2VL 4LCYA 4MAYA 5DUPL 2AEPL 3ULVD 1U91B 3D6GA 5B39G 5ISZD 5DHYA 1PLGL 4XCFH 4RDBA 3N42F 4X6BA 2YSSB 4AMXA 3U1QA 4OLWH 1CDUA 1NQBA 5B8CC 2KKQA 3I9GH 4YO0A 3NSYA 3TESA 2V7HB 7TAAA 1YEIL 1JCVA 3VGFA 2P8MA 2QV4A 3TEXA 5ICYB 2XWZA 3NUKA 2H3NA 5KVFL 1ZGLB 4OCXH 2D73A 3PHAA 4HKZA 5D1QC 5LNEA 1BD2D 4LKCA 5GS2H 1BD2E 1PG7H 4G9FA 3MJ8B 4AGPA 4X6EA 3FQ2A 2A6IB 4G6KL 1Q0YH 3W0WD 1J5CA 3T71A 1EDYA 1LD9B 3KYKH 4UM8B 2AXGA 2WZPA 5L0QC 4KKAC 5AUMA 3U0PA 3VXUA 1T1YB 3V4PL 1LEIB 1XF4B 4POZC 3TH2T 4KKPA 4F27A 2BNRE 1WIUA 1K2DB 3FN0L 4UU9A 5HDBB 3RJDA 1Y7VA 2ITEA 2FT7A 4X6FB 2QJDA 5DWPA 1A6TB 4I9XA 4EKJA 2Y06L 2ICWA 1FZKB 5F1OB 3MN8A 3PWPA 4RH4A 3RU8H 1NINA 2V9RA 3UBGA 3NJIA 2X1WL 3SGEH 2ZCHL 4FA7B 2VLLB 2BERA 1XF3A 3PPEA 2BP8A 2X4TA 3FQXB 3QJOA 1T04B 1ZJAA 5SX5H 2BFVL 1BQLH 3CC5B 2J4WH 5IMMB 1IC0A 2JELH 5DFWH 2NUTA 2CLZA 2B5IB 1PD6A 2HFFA 1DDTA 4GYBA 5AQ0A 4QO1A 5CEXA 3D07A 4O2EB 3X11A 5HHNB 4F24A 4U1LB 1SM3L 3VNYA 1L9TA 4RAVB 1PDKB 3QPXH 4HW6A 3QA3B 4XODA 4Y1AB 2B77A 2LTQC 2P5WE 4L05A 5DJ0A 4BK5A 4PJ5D 2X0VA 2VLJD 4E5XB 1MIML 2H6UA 3GGWB 1JK8B 1FJ1A 4QPEA 4R26L 5D93C 2K78A 3BEVB 3S98A 4LSSL 3UX9B 3MR9B 5IQOA 3TS8A 1U33A 1T0MA 3ML9A 5IB5B 4M29A 3D39A 1IGCL 3J07A 2ZAHA 2YMXH 1NGXB 2XNAA 1AR1C 3R1GH 2APBA 4IJTA 4P2QD 3AREB 3NIGF 1ERNA 4GW4A 4JM2B 5IBLC 3U0TB 3WFBL 4OZIB 2CJSA 4EBQL 2J20A 4TL4A 2HT4D 2EJ1A 3BD5A 3NJFA 3KBHE 3VXNA 1E6JH 1NUFA 2VDKB 4WU7A 2UYLB 5JUEH 3D48R 3ZIYA 4GUPB 5IROD 2UVFA 5C08E 2Z31B 3R19A 1FORH 3ZK0A 2CO4A 5KZCB 2YD7A 2J5WA 3NCMA 3WTWA 4P9HH 1L7TH 2A9AA 2BP0A 3MLUL 3K0WA 1J86A 3LZFH 3AY4A 4XPTL 1SXBA 5A2JH 4OLYL 1CLVA 2WQUA 5SV4A 4EIZC 1YEDA 1NCAH 1RJYB 3L9YA 3V5DA 3IS1X 4Q97A 4O02A 1HAWA 4XT1C 3QC5X 2FYYA 5IEKB 2FWUA 1JNLH 1DFXA 2JI3A 3D87B 1Y07A 4P5TB 5FHBL 3VXPA 2JJTC 4F15C 2VLKA 5MENA 4QGTA 4PJEA 2QHRH 4OKVB 4AV5A 3RWGA 5I5RA 4P9HL 5T3XH 2VT0A 4KKAD 1IAIM 4LDEB 4LCYB 3WEAA 2E86A 4N2GA 3Q5TA 1I3RB 3Q8AA 3KGRA 4YPGA 4JPVL 5T3ZE 5K9OB 2YC1A 1T66D 2HH0H 5HHXL 3RWHB 2XJKA 3UBXA 1UUSA 4KV5F 3OGCB 2A6DB 1O75A 3O6LH 3QJZA 3P9LB 3CLEL 1G9MH 4P3WA 4TVPD 5KVFE 1Y0LB 3S34H 3WJJC 5KBMA 2GUYA 3IN2A 5BMFH 2JB6A 1U8JA 5A6MA 2NY3C 4ZAKB 4KZDL 1IILE 1LD9A 5IT2L 3VUAA 2VJ0A 3WLBA 3CD4A 1WF5A 2R23A 2WVTA 4H1LB 4HWZA 4LVHC 1SM3H 4M1CD 4M62H 2VDQB 5INDA 3VD7A 4OZFB 5IQ9A 4BZ2H 4EZLA 1OGTB 3UADA 3OV6A 1FVCA 1KEMH 4K3EH 3MV9E 1D5IH 1CXIA 1SXSA 3RIFK 1EBPA 2HT2D 3LKQB 4OFYA 1KCVH 2O72A 2FATH 3SQOL 2HYMA 4QLWA 2ZD0A 2DQHH 5EULV 3B37A 4ODSL 1I3GH 1TFPA 1KEGL 4HJGB 3RE0A 4HZLB 1V8HA 2X0WA 1NUNB 3OX8B 1CFNA 4FI7A 2ZP9A 3D9AH 5D7JA 4GMSL 2IMMA 3V4PA 3B9VA 4W9ZA 4JRXE 5EU5A 5IIEA 4NNXA 3IFNH 4YBQD 1HNFA 1HQRA 2FWOA 3MGOA 3SKOA 1BF2A 4D0BB 3NA9L 1G84A 2X70A 1OD7A 2WB1A 4G8GD 4O00A 3EYVA 2A6JA 2BOLA 3F64A 2C3HA 5I6OA 3VDAA 1ACZA 2X42A 4K3JL 3C08H 3RILA 3SGKC 1TJHH 5B8CB 1A5FH 2DWSA 3VXRD 3QA3A 4K8RH 2CO1A 3QC6X 1UD4A 2XQYG 1A7RL 1MHHA 4J5VA 2A1WH 5E4AA 2CUMA 2QVIA 4GAGH 1XCTB 1WZKA 1XQ4A 4GT0A 4LNRA 1MFAH 5CP3H 3VU2A 3X12A 1ZEAH 4OAWA 3MPCA 3ZT6A 4A67A 4Z7VF 2NW3B 3VWKD 1GZPA 3MV8B 4DEWA 3P3YA 1S9KC 4HJIA 2MQ3A 3T0DA 3DWTA 3NIGB 2ADFH 4JM2F 4BM7A 3NRQA 3NJNA 1NKGA 4OW6A 1MNNA 4DNLA 1CZ8H 5J13B 4E9QA 3H3BC 5JMOC 3EG9A 4JFOB 4XVSH 4NZUL 3L54A 1PLGH 3KLAB 3V6BR 5EBMA 3SIKA 3O2VH 1FSKB 1QACA 1UJTA 1Y18B 2OX5B 3EBGA 2I9LA 1S9VB 4UT9L 3AXLB 4PJ6A 1OXYA 3QZBA 5D1ZD 4Z7UF 4NNPL 1DN0B 3ZQXA 4TF4A 3MRNB 4B0MB 3FU8A 4IMKA 1UFGA 3CN3A 2Y6SC 5GZOA 5IEKA 5T3ZD 4G6ML 3VI4B 1D7FA 3AQZA 3UEZA 1CGSL 4QTIH 3MREB 1T2QL 3WN5A 2Y7OA 2VM9A 3L3KA 1FYTD 4Y5VB 1S7UA 4TNGA 5D9SA 4L29A 5EN3A 2Y3AA 1PCXA 4QLRA 1KACB 5EOQH 3TCTA 5JHLL 2HLFC 3KD4A 2F7RA 3AB0C 2Q7YA 2QGDA 1SJEB 1T5KA 2FGZA 3OLIA 4LRIC 2I5YL 4Z7OB 1I3GL 1VZIA 3JVFC 4LCWD 3WL9A 1RH8A 3UYPB 4BK4A 1EGJL 4YXHH 4PS4L 5HPMB 3PP4L 4IIQC 3FU9A 3QG7H 4J8RA 1KPUB 5FO8B 4U4IA 3KLHC 5D7EA 5I6MA 3L3GB 3OGCA 3DTXA 4UTAA 1KCRH 3RIKA 1JMXA 4Z7NF 1F4HA 2CO6B 1HHGA 2FO1A 3W5NA 5IT2H 1Y0LA 4NFCA 4WEEA 2EDKA 5C2UB 1BZ8A 2QSCH 4XX1G 2Z4QA 2NY6C 1I3VA 1SF5A 1CU4L 2WCGA 1ETA1 2CNZA 4HOZA 4WZ9A 4K3DL 5JOFA 1QBBA 2AMUA 5EUKA 3SY0B 3EO1B 3ZT5A 2QSQA 1A7PL 3B9EA 3O6LL 4K9EL 3W2DH 2BNQE 3WS6A 5INDB 4FL4B 2BNQA 5GRUL 1F4YH 1QLFA 1TF4A 3BPLC 2IFFL 3DHUA 1ZLSL 1KN2H 3SDXA 1MFEL 4Q6IC 4H8VA 1NCTA 5C09D 2BRQA 4WCYL 1HDMB 2CE6A 5E2TL 1R34A 4H8PA 5AKSA 4UAHA 2WTPA 3GXNA 4NQCA 2XSKA 1ZWIB 1R24B 4K71B 4PG2A 4Z8FH 3DOSB 1AIZA 3H1ZA 4GB9A 3O9WA 2BMKB 4N5EC 1ZE3H 3LHPH 5JW5A 4F7PB 2WB7A 4XB8A 5DHVH 2A9CA 4XPBL 3WJLA 2YO3A 5F1IB 1IKNC 2MIZA 3WFHA 4P2YA 1NIDA 1G7PA 5A40E 4XXCA 3F7YB 5DJAB 5KYWB 3MV8D 2ZX5A 2AQSA 5GGQL 4HSQA 2WQRA 1SN2A 2KUTA 4AGNA 2ZX7A 1KLUA 5TDNA 1Q9LA 3FO1B 3NIDE 2Q3ZA 4LBEB 1AHWA 2NY7H 3QEGL 5BZWA 4JS7A 4ELMF 4HOWA 1RUQL 1N4XH 1MAJA 3PNRB 2ATKA 5GGTL 4ZDHA 2VRQA 5JHDE 5B8CA 3AADB 3CK0L 1UTDA 3H85A 1EV2E 1NMBH 2NW2B 3Q8FA 4M6NH 3RWJB 3VI3E 5C3LD 1T03H 5IZ7A 2J1YA 1EERB 3FB8A 3UC2A 5DRXA 2R29H 4HZ1A 5DVOA 2ENPA 2NW3A 1N59B 4YWGH 4GEJA 2QQLH 3MI6A 4K3HA 5CM1A 1GOFA 3Q5OA 4Z7UB 4K5LA 1UWXH 1OK8A 1PZSA 2Q87A 1WG3A 1M3IA 5L6YH 5DI8B 4WWKC 1SBSL 3K2UL 3QPXL 4BGDA 4X7FC 3QAZC 4CVUA 1ZA6A 4YHMH 4N0FB 3PIQB 1INQB 2D3VA 4RQQA 4QYOA 5DMGC 1MFBL 1GAFL 4X6DE 4A39A 2OSXA 1HX0A 3L9EA 2VXQL 3SE9H 1DN0A 3VSTA 4OCNC 4ZG1A 2N1TE 4JPKL 1ZLDA 4GAYA 1M57B 1KIQB 4OZGA 5CEZL 1ET8A 2XFXA 1RU9H 2XV6B 5E6YA 2NNRA 4TUJA 3RZCA 1OHZA 4Y1TA 3MQIA 2MCG1 3FQRA 4BSWA 5K9JH 4KXCA 3J2PA 4MJ6A 1KTCA 5ILTH 3JUZA 3W57A 3BH9A 5T1MA 4B3EA 1JZGA 5F1KC 5E1AA 1G6RH 4CU6A 2HKFL 4JFUA 5FYKL 1D9KB 3MGAA 5GZNA 3KG5A 4ELKB 4HCRL 4RBPH 4U1GB 5IUSA 1EFQA 4GAAA 3VTAA 2F54B 2IBGA 2EKSA 2YWZA 4LIQE 3ALPA 3THMH 4HUCA 1FYHB 4IBWA 4U1KA 3CN0A 2PCYA 2FD6H 3KHQA 4LCIL 3L3GA 4XN8A 3LZPA 4NZTH 3RDTA 4DFHA 1OSZA 3P11H 3QUXD 4ZNCD 5CCKH 2WIIB 3COOA 4BFRA 4M56A 3B3IB 1FN4B 1JRHH 5HDRA 3TPUA 4DZ8B 3CWGA 4GG8A 3P30H 3W81A 2BS71 2Z4QB 4Q74A 5BVPL 2ADIA 2RCSH 2XXGA 2YA2A 4L4VD 1OB0A 3DTDA 3EO1A 4OCXL 1XIWC 2E6JA 3AGWA 4JFEA 3V4VH 3ZKQD 5EG6C 2E9BA 5DD6B 3PABB 4IYKA 1AS7A 1YECL 1U2HA 3FT4A 1IAKA 1MZYA 4XC3L 1OGAA 3U7WL 3HLAB 5AVSB 4P4KA 5DEGB 4PTTB 1GS8A 3W9EA 3HFML 3QJFA 4PJ9C 3BP5B 3CSYA 2KYIA 3FCSA 2DQEL 4C83A 1G43A 3N50A 1JUFB 1K5NB 3NSJA 5ECGA 1HHIA 5FA4B 2OMYB 4DQAA 3O9WB 3G5ZB 3Q8CA 5F1SA 4GKNA 2BOBB 5KW9H 2EXYC 3QDGE 2XBTA 5HHOB 3TEUA 4LDLB 1CT8B 1C08A 1E4JA 1UKTA 4L37B 4WQOA 1CLZH 1IAOA 4PGEA 4U1JA 2AF2A 4MDRA 1NGZA 3BAWA 4UDTB 1G7IB 1ACXA 2CRZA 1WEJH 1BEXA 3BAJA 4DP2X 1MFCH 4S1DD 3L5XH 3TZVD 3FH5A 3DVIA 1U91A 5A7EA 4BZ1L 3G04B 4DGWC 3NIDB 5FGCE 5BXFA 4YR6B 5E8OB 4N2DA 4P23B 1D5XA 2FH8A 4LAQL 3SQBA 1TITA 4LLAA 1BXAA 1F5WA 3L4CA 4LEBA 1ZLWH 1V7NL 1JNJA 4TNVK 1XR9A 2V7HA 3ROLA 3VG0H 2P8MB 3L5IA 3RKDD 5ICYA 2HRHA 4HQQH 2VITA 2HRLA 4M1GL 5DHEA 4PRID 2J3SA 4H8UA 1QO3A 1KCKA 1H3PL 1FNEA 4TLKA 4G71B 3WDIA 3OKOB 4MDJB 4JGJA 3QQDB 2NY0D 1RZ8A 2HLFD 3IPBA 1LE5A 2DQCH 5LXGH 1DBMH 1YN6A 4HEPG 4PJAB 1W15A 1DUZA 1EJ6A 2XWDA 3EOBA 3LTVA 3ATAA 3ZHDA 3KDMB 4EI6B 3MOAH 5AW6B 1S5IL 3UBXI 4NS0A 4FFZA 3IFPB 3FK3A 2JJWA 2CG9X 3IFLH 5JO5B 3KXFB 4AZUA 4EQ2A 3AQXA 1QEXA 4OQ1A 4N8CL 3MACH 1TETL 5LNGA 5DHYB 3GEFA 3C6SA 3O4LD 4FLQA 4MJ6B 3GI9L 3KXFD 5DK0B 5BW7A 1Y6KR 4U1MA 3X3GL 2N4IA 1R3KA 3H6JA 4WTQA 3SKJH 2V3DA 1P6FA 3R0MA 3OMAB 4A2MA 5IMOA 1QSFB 2DY2A 2VDKH 3QAQA 5E9DA 4XB7A 1JGDA 4WEUD 4PJFF 2A6IA 3E9UA 2ZE0A 4WHTB 3PWVA 1YAIA 2AP2A 4GG6E 3GHBH 3VWKC 3NJJA 5AZ2H 4CRPA 3UO1H 3ARFA 3RTQB 1PDKA 3DSNB 3O3AA 4KDTC 3HG3A 3SDAD 1G9HA 1TQBC 1JVKA 1K2DA 4PB9H 5GGRA 5I2IA 4U6XB 4FXKA 1OD9A 4LT7A 4NWUH 4A1RA 1LP9A 2VGLM 3RWIB 1I9IL 2NSMA 4FFWC 1T0MB 3NJMA 4YHLL 2AQQA 3VFTB 2A74C 2MOVA 2DDQH 4HXBH 3SN6N 2OZ4L 4QKXB 5IJKA 4L4TD 1IAKB 3WO4C 4L3CB 4M3JA 4U1NA 1HH9A 4ZBJA 3U36A 2GJZB 2VERA 3L2NA 2QZ5A 5IVZB 4KKLC 4NQEE 4PQXA 2WANA 3MCKA 3AM8C 4OF0A 4WU7B 1AE6H 4P4KB 4E5XG 1KIPB 1N5AB 1JWUA 2K6WA 5DK3A 3VFUB 2R1XA 4LASH 5E5LA 1NGQL 4FNSA 5LGJA 2Z0UA 2VDOH 4PLOB 2V2TA 4GBXA 3IDMA 3AU0A 4Z3JA 3P4MB 4IOSA 1U3HB 1RJYA 1FNGB 2JIXA 1LO5B 5IBLD 2X4PA 5JNYB 3QCUL 3B2MA 4Y4HB 4P5TA 2ZWNA 4MDIB 4TNVF 1N3NB 4K5OA 3PUCA 1NM4A 4YAQA 2V6HA 3I6GA 4KO9A 1PD0A 4X99A 4U7MA 4NKMB 4OVUA 2IAND 4Y5XA 5IBTL 3RUGF 1EA9C 1ED3B 4FEIA 5J3HC 4DKEH 1TZIB 2H3XC 4YDIH 5BXFB 5K9OA 3BUTA 4NQQA 3FTUA 5DMGD 5HDLA 4XCNA 4GW4B 4OZIA 3UJJH 1CLOL 1TTAA 2BSEA 4J1UA 1UVQB 1FFPA 2BRRL 1OOAA 3ATFA 1I1AA 4S1SL 3TT1H 5KBPA 1JZ2A 4UBDD 4L4TE 2Z31A 3WUWG 2YKKA 3I9PA 4H5SA 3DV4A 4F8OA 4IK6A 1QNZH 4O02H 2AQTA 1RAMA 4RIRA 2BHZA 2BS9A 2ZKMX 3UMTA 4HH8A 3LMJH 5MERA 3U7YH 3ESMA 5B1AB 3DIFB 3RL2B 1CC3A 1O5DT 4P46B 1A1OB 3P2DA 2O5ZL 1RIHL 4QRUB 5D1QE 4JFHD 3KDMA 2WLIB 3OJDA 1AY1H 4OIIL 2WMPA 1FPTH 4MB5A 5D2NE 3RWGB 3U48A 4UQ2B 4GAFB 5EDSA 4FLHA 2WW8A 1ASQA 3MROB 3SJVA 5K33A 3CIAA 3QIUA 4QD2E 4TS6A 2R0WL 4ZMVA 4PJFB 3EUUA 3STZB 4YQXH 1I85A 1MXDA 2VZVA 5D7JB 1LO0H 1R19A 4N6QA 4JY4A 4QRQA 1BQHG 4QRFA 4XMLL 3VXUE 3KCWA 1YYML 1NGWB 1KY7A 3KPPA 3QI9C 1DO5A 3G3LA 3PXHA 2ARJQ 4QHMB 1IGFH 2FWOB 3MGOB 5GISH 2BNRA 5EWIH 2BVYA 3C8HA 2OSLA 3GI8L 1NC2A 4NM4H 4PP2A 2X70B 3IF1B 2YXMA 1N6UA 2WYZA 4AGMA 4S2SB 2Y23A 1U8JB 1X7QA 1CLCA 4LRIA 2GUOB 3PWVB 5HYFA 2P1YA 5FO7B 4KO7A 4PBVC 4YHPB 3CFIC 2EC9U 2VERN 1LQBC 2B1AH 1QW8A 3O3AB 1BIIB 1ITBB 2FVNA 2WC7A 3IU3A 1AACA 3QIBB 4HJEA 3QHTC 4ZXBC 4KXAA 3D12B 4FYTA 3TO4D 3QNYA 2DEWX 3LDBB 5HYQA 5FKAB 4HKXB 3K74B 3QRGH 5D6CA 4RA3A 3CMGA 1PAMA 1MFNA 4N3TA 1F56A 4PCKA 4XNBA 3IDNA 4GRWE 1GGBH 2W94A 1XR8A 2XACC 4P9HC 1CMOA 2GTZA 3WU1A 1GC1C 4FNQA 2HG5B 2B08A 1TNNA 1W0WB 1XDTT 1OCWH 4IW4C 3PHSA 1DE4A 1RK0B 2YN3A 4V2CB 3V4PB 2CALA 2YK1H 3GBML 3IBEA 3MCKB 1MFDH 3BIBX 3KLAA 2GI0A 2WZ5A 4OQTH 1JWUB 2NR6A 5IHLB 1FFTB 1W72L 2JI1A 4X6CF 3U83A 4L9DA 1NC4B 4Y4KD 3LB6D 1FFOA 2DYSB 1SXNA 2WGNB 4OI7A 1BVKB 2EQDA 3IMBA 3EYVB 2H6PB 2X40A 4LQ1A 5BJTB 1FGVL 3ZKNC 3EYOB 1PLCA 4LHQB 1U3HA 3RA7H 3RZCC 2OLDA 3EGSB 4NO0A 1CTOA 4I3GA 4Q2ZA 2XHNA 2GBVA 3REWB 3SDDD 3DRTB 3T4YA 3V6FB 4OV5B 1T6WA 4HS6B 1AGFA 1T4WA 2JV6A 3DPBB 3EFDL 2FQFA 2XVLA 5H94B 3WY1A 5DC0A 3KWUA 3MREA 5D1QB 3CVBA 3WN5B 4X99B 4AXWA 3WN6A 1S7UB 1YJDL 3TJEH 4JDEA 2AMGA 1Q0EA 3NTCH 4HJTA 4Y5VC 2EH8H 3S37L 1D3CA 1URZA 3QB7C 1DBJH 2A99A 1ZIBA 3OB8A 4UILL 2ZTBA 4EUPH 3U2SB 1MQKH 5HPMA 4G7QB 4XCNB 4JKWA 4I3SL 1Z9MA 3RY5A 1M6OA 2PO6D 4ZW5A 5AVWB 5BV7C 5TH2B 1FFPB 3QQXA 4WRLA 3INUH 2DJ4A 5GHWH 1FZOA 3MYZA 1Q38A 3A4DA 4LKCB 3H2PA 1G4RA 3DV4B 3H56A 1ECYA 3GSNB 3MJ8A 4FABH 2BOCA 1DTUA 2QPFA 2I9LB 3G5YA 5ESQA 5HYEA 3D8MA 3QJRB 3LH2H 2AXGB 3MUY1 1T66C 3K5SA 1HEJC 2JNZA 3MRNA 3E7JA 5AOZA 2VQTA 2ZOOA 4FP8L 4MD4A 4M6OL 1YG9A 4I5BB 4TSBL 2J6WA 3WNIA 3WY4A 2CWRA 1KLFA 2H0JA 1BEYH 2PR4L 3HG0A 5DD5H 2P48B 4MYPA 4GFTB 1DJGA 4O2CA 3S35X 3B5GA 2VW7A 4MJ2A 1KN4L 3AT8A 1BVNT 1CR9L 1QA9A 3QWOA 4NC1E 5LN4A 5K1JA 1ZXQA 2YXVA 3MC0A 3QO0A 4LKXA 5E99L 5JHMA 1MI5A 5FFLA 1YEEH 2WQSA 3AXHA 1YNKL 3WNNA 4GQQA 1NAMA 3FDWA 1BFSA 1CPUA 1W0YT 2GHWB 5L4MA 3QISA 4AUJA 1XBDA 4J8QA 4B53A 3CC5A 4R96A 1PF3A 4LPWA 2QPEB 2WXMA 4HMDA 1E4KA 2CLZB 4OLXH 5IROC 2SEBA 1MW1A 2K3TA 3UTZB 1VENA 2GUOA 1AYRA 3KYAA 1GIGH 3ESPA 4IM8A 4PHXA 5AWNL 4QHKJ 4KZ0A 4JHWH 4ADGA 3V0VA 3NIDF 3NCJL 5DD1L 5C0RL 3HS0B 3SE3A 2VR7A 2E7BA 3PY9A 4HS3A 3GUTA 3IU3B 1A3RL 2BNQB 3QEQB 2F1EA 1FVDA 3QDGA 5C0BB 4S0HA 2JFCA 3CZGA 4MQSB 2WCSA 1BG9A 1IV8A 4H20L 4PHZA 1QFWH 3D25B 5HJDA 3SDCB 4ESKA 3FB7B 1NCDL 1NGYB 4ATTA 3MR9A 3IDNB 5AYUL 2FJHA 4F2ME 3NZHL 1BVOA 3VDCA 4JO1L 3FQUA 4QHLB 3MNMA 5FUOL 3JTBA 5IMKB 1NGXA 2XNAB 1QSZA 2HG5A 3L1GA 4LLUB 3RKPA 1L7IL 5INCB 1UM6L 5T1DH 3FT0A 2AHIA 2WLNA 1U3JA 5B38A 3SO3C 5T1LB 2DYPA 1N26A 5MEPB 4TN9A 1AQDA 2HLAA 2R0ZL 2X4UB 4FLRA 4L9LC 1HCFX 4N0FA 2VC2L 5FHAL 3QNZA 3VFGL 5IFAL 2K70A 3QI9D 1OF2A 3I02B 1XB8A 1QSFD 4A2HA 3W1ZA 1CBVH 2VKXA 3Q05A 4DKFL 2WQWA 1F90H 3LVEA 4W4NA 2BIHA 4IRJC 2JTYA 3T4YB 4PV9B 5BUGA 5KJ7E 5HYJD 5AB9A 2CIKA 2NY6D 4NXSA 5DEZA 5MENB 1UENA 4XBPB 1PSKL 3D3VE 3L81A 4KPHH 4MMZC 3PDOA 3MRHB 4YIQA 1XZWA 1M3JA 1DJWA 1G7JA 2FO4A 3LDBC 4MCYA 4U3HA 1VKXA 1NCUA 4Z7UE 1Q1JH 3C2SA 2YC1B 2BNQD 2CHWA 1DBBL 3BKJH 1MJ7H 2CPUA 4OM1L 5JW3H 3KPQB 4IU3A 4PMFA 1CR9H 3KWTA 2QPSA 5IB1A 2JSFA 2WBJB 3DO4A 1GGYA 5D1QD 3QIWC 2R8SL 1CXFA 4OFDA 2P5ED 4TLUA 1BZ9A 3MRPA 3CZUB 5F88A 1E3XA 1TO5A 3BW9B 1SUJA 4DO6A 2X6VA 1AGBB 4PJDB 4FMVA 2Y1AA 4POUB 5IFAH 3GXPA 4FP8H 2Y07L 3NIFB 2R23B 3S3SA 4UT9A 1KPRA 5FUCC 2BC4A 3T3PE 2OTUA 4G43B 5I6PA 3W0WA 4LPXA 4UTAH 4F5CE 3C9NB 3KH3A 2WZPD 4PPTA 3WSQL 3LKQA 1C16B 1T6BX 3VXUD 1A4JA 1MNUL 5DEGA 1VACB 4ZSOB 1SOQA 5TDOA 3PJLA 4HJGA 1RZFL 2A9BA 4JO1H 3B56A 4X4ME 3WFEL 4IIQA 2CU9A 1A9VA 3CFEB 1JUFA 3K2MC 1BSIA 1ZVHA 4LKXB 2YQ2A 2B4CC 3BIKA 4R0LC 5EFIA 2JQZA 3WAJA 3QCVL 4TTDD 3SE8H 1FE8H 3M46A 2WUBL 4UT7L 5F0JB 3FSZA 1X9LA 1Z5LA 1NGPH 3BUBA 3MA9L 4ZT1A 5GGSB 3QK0A 3T2OA 3W39B 4BSJA 3O41A 3O81A 4KRMB 3GMOB 4H8WL 1HQRB 2EACA 4Z3TA 4PJHB 4IEFA 4L0YA 3L1EA 2QTEA 3WY3A 3OAZH 5E1HB 1XVSA 3DVGB 3EOAA 3IAQA 3UTZA 4PJXE 5K9QG 2A6JB 4YE0A 3WEOA 3N43B 4E41B 3O2WH 1QUPA 4LGSB 3K46A 1IARB 2WV3A 1P4LA 1THAA 3AABA 4NQDE 4R5XA 3BESR 3NDZE 4AGQA 4CN1A 2CIIA 4GI9A 3FHAA 1CJYA 3DDFA 3PYCA 5L8LB 2OXHA 3BPCB 4WUUD 1D5XB 4B5EA 5GXBB 5C0BA 4R9HA 1ZLVH 3V5KA 4RESB 3BWUF 3LN5A 4QAWA 4DQOL 5DUMH 3DX1A 4F8LA 4AJYV 3QUGA 3D33A 4YK4B 3UZVB 4DT2A 3NCYS 2OTWA 4I77H 5E6IC 3GXMA 5I5IA 4YZWA 3EDKA 1QO3B 5DD5L 4FQ2L 1WV7T 1E90A 2KS0A 3EJSA 1XF5A 1MRDH 4N0UA 2GY5A 3U4EB 3WJLC 4MDJA 3T0EE 4L4JA 1VLXA 3FW6A 4S1RL 4S11A 4JJOA 1JWMB 2JB5H 1OALA 1C08B 1QI3A 3BI9X 1YN6B 5K9KB 4PJAA 3VFVB 3QNZB 3MODH 1KCWA 4LFHG 5DCCA 4UDTA 4I18C 1KBPA 4U4BA 1F1AA 2WBKA 3T6VA 2A2QT 1KIRB 1SDDB 4MNHB 4ZS6D 4WHCA 4OGAD 5JMRA 5J9PB 1X5AA 3MLTB 3O6KL 4NX0A 5GHWL 3HZYA 3UXFA 4MD0A 3G04A 5E56A 3D69A 4BWWA 2IWEA 4KQ3H 2HVJB 4XBPA 1SLXA 3S37X 3TVMD 1TJIH 2FCBA 3PDOB 4MCZA 4LSVL 4X5WA 1EEYB 3KPSA 5BO0D 1IGIL 2L7UA 4EKXA 4JFED 1UUNA 4BFEA 3QFJE 3APFA 2IPTL 3V5HB 3O8XB 5T1KB 4AVJA 2PR9A 1MCBA 3QUMA 4WU5B 3Q6GL 4GH7B 2B20A 2CBPA 2WWMD 3U4AA 3P11L 4NO3A 4GLRH 4CMMA 1I7UB 2CO6A 1JHTB 1T80A 2X3CA 1A64A 3EGXB 2AEQH 5DLMH 1FPTL 5A2FA 2ZOUA 4FXKB 1Q94A 1JGLH 2EO1A 4TQHA 1QBMH 4NI3A 5I6NA 4ECNA 1EH9A 4JO3L 1CL7I 1NL0L 1DVFD 1QLEB 3IRZA 1S9XB 3NFNA 1MG3C 4XWGL 5B1JC 5HI3C 7FABH 1J12A 4A2FA 2CLRA 3ESVF 1QTSA 4HETA 1WD8A 3L1OL 4M9PA 5TDPA 1LEGB 1H3XA 1XBRA 2PCPA 4S1DC 3C9NA 3BCFA 2BZCA 4L3CA 1F45A 4JREB 1XMWA 1CQYA 3ZTDC 4EUPG 4YDNA 4HPOL 4FKHA 1KIPA 3VFUA 2CBTA 2NNCA 5DRZA 5TDOB 5FDWA 5GRWA 4IJ3B 4KHTH 3NFPA 3TJPA 1FIGH 1HJCA 4LCWE 4FZEL 3DGGB 3PQYE 2GK2A 5JPNA 2GQHA 5F7FA 5F9AC 5B22A 3EYQC 1TQBB 3FQNB 5JIHA 2XQYA 2GJ6D 2BH0A 1Z9SB 2B1AL 4AV4A 2QL1A 5I8KH 1UXLA 3KYMB 4F7MB 1RZFH 5HJBA 4IEFB 3V55A 2H32B 4ZOCA 3MV9B 4DZBB 1X5HA 4R2GD 2K3HA 2Q76A 5GGRB 2EDEA 4GRMB 4LL1A 5IREA 1Q9LB 1DJSA 1BYOA 3FO1A 5GRVK 3VFRA 2AQ2A 4AIZB 2MCAA 1G9NC 3VB8A 1LP9B 2HLEB 6CGTA 5BUAA 5DD3L 1BBDL 2ZSVA 2ZWSA 3NIGE 1E5UI 1J11A 1D2OA 3W82A 5JW4N 3WD5L 5EV7A 3BPCA 2ZAIA 5FO2A 5D5MF 4ZFQA 1FNLA 3FH7A 3SYPA 4PMEA 4O5LH 1N5YL 5E6IB 3M07A 3VXTB 3LN5B 4GMTL 4B9CA 1XH0A 5CXPA 2B59A 3UZVA 1N5AA 2C1OA 3EBHA 3IGAB 2OJEB 5HDBF 5GS0D 2NY7L 4IKLA 3ASWA 1JPSL 3KYNA 4WK2B 5JW3L 1AZCA 5EC1B 3R7QA 4I1NB 1MJJA 5HGGS 3ILEA 2WTRB 1DBBH 4QRRD 1XWVA 5GGQH 3EGDB 1DQQA 3O4LA 4HXBL 4TMPA 2JIXB 1DLFL 4Z77A 4YHLH 2X4PB 4G6FD 5FYLL 3EH5B 5H4ZA 2XKSA 3KWXA 1TQWA 1XH1A 4GW1B 3ZKND 5CP7B 2NR6C 1KNOB 1GCYA 1XF1A 1ORSA 4NQSA 3S3BB 4Y5XB 4PLNC 3P3UA 4PJEF 1A6UH 2BY2A 4MNHA 5B7FA 4XCCL 3KPSE 4LDOB 5I74B 4WJ5B 1MCRA 4S1SH 4M7LH 2GT9A 4G80A 3AITA 5IGXL 4JHZA 1G0YR 3SDAA 3FQRB 4BSWB 4U1SA 5KVDL 1YYCA 4OF5A 1RJCA 1M7IB 1IBDA 4X5XB 1FO0B 4YO0B 5AYTA 3VRLE 3QJVB 2VDKL 2WN3A 1DQKA 3ATEA 2XYCA 4IRSD 5F9DC 4ZW8A 1ZLSH 2JKXA 2OYMA 4W9JC 3TEYA 1XD1A 3KPPB 4BFFA 1YEFL 3HMXH 3OSVA 1SOXA 1CXLA 5BCAA 3TJHD 3IMTA 4HKZB 2HTKC 1CL7L 2J71A 4RAHA 3Q9QA 3BSGA 1NMCC 2QSCL 2ZF9A 4HIPA 2DV6A 2BO0A 1TCRB 3NSXA 2B5IC 3TM6A 2XI9A 5AUMB 5ISZB 4Y16B 3RFZB 1OSZB 4BK8A 4XP6L 3QCUH 1TTFA 1KFAH 5IQ7L 3IFLL 1IKFL 2QKIB 3PXLA 2R4SH 1H3TA 3P0YH 1KYUA 4DZ8A 1MCWW 5FKAA 3HBQA 4BWUA 4HHGA 1Z9LA 4NKIH 2D0FA 5C70A 1FFRA 2QGBA 4M7ZC 4YBHA 3MAWA 4I1RA 2I5YH 2WUCL 1G7QA 2CGRL 4BA8A 4M4PA 3ZSSA 2EIMB 3V4LA 1I7ZA 4M6MH 5BS0B 3QS2A 1JD9A 2Y7SA 4QTIL 1C5BL 1XF3B 1BLIA 2GAZA 2X9XA 4OLXL 1DVUA 1SHXA 2IANA 3CPLB 4FQXD 1MPAH 1EUUA 4OB5H 2EXTA 1I8KB 4ISVA 1BAFH 3GSNL 4X7TA 3VXOB 4U6YB 4AL8H 1JZEA 4XI5C 4NQCE 1AP2B 4OD1H 4GXVH 4NQCD 5I5MA 1UGNA 2GSIA 3IDXH 1P2CB 2V2WB 3T3MF 5CSZB 1KN4H 2AGJH 2UWEA 4JFFB 4F7MA 1I1AD 4MJIB 3T04D 2AJVH 4C57C 1S78C 5AB2A 3GHBL 3NPSC 2C5DC 4YSEA 1T7YA 4BDVB 3VFOA 2J1WA 4HKXA 2EADA 1BPVA 3L4UA 4U1GC 2CDEB 1P5VA 4TSBH 5CBEB 1BZOA 1XR8B 1U8KA 1MVFA 3D39B 3MLZH 4A2LA 3K7UA 5KBLA 4TYUA 5CBAB 3TA3A 4BFKA 3U6XS 2NY4D 3IGUA 3GIVA 2CDFA 1X9QA 3I2CH 5FYKD 5AAPA 2NY6B 1A5FL 2YMOA 2XQ0A 1KJMA 1QSED 3Q48A 4XO5A 2XX0A 2B1HL 4XNMB 4Y1AE 4Q9RH 1IFRA 3HVNA 3ZZLA 3KYNB 2V4LA 1RK7A 1ZS2A 3OPUA 3AS3A 4YHKL 5FM8A 3MRMA 3OM3B 3MRDB 3LXCA 4OFQA 5FGRA 5B3NA 5DQ9A 1QI5A 3QXTA 1DQQB 1ULVA 3KL0A 4KU1A 4PM1A 1YEDB 3V5DB 4X83A 4LOEA 3FUKA 4IKKA 1MLBA 1AGFB 4MZRA 3NTCL 2PXYC 4P2OD 4DP1X 5BVPH 3AQDA 4R8WL 4F57L 5BV7B 4GMSH 1B6DA 4FF9A 5BOZG 3FSWA 3HNTH 2Z91A 3FRPG 4FE9A 1X5FA 3AC0A 1EWHA 1BZDA 1WHOA 4FQQA 4DP0X 3RWFA 3ARGC 3T6WA 1OW0A 1QHQA 2GT9B 3GKWH 2R29A 4G80B 3RA7L 3FH8A 3VDBA 4U1SB 4FFVC 4XP9L 2ED8A 3TYGH 3UROR 1NCOA 2E3VA 3TO4A 4L2LA 1QLEL 1OGAE 5HDQH 5EORH 1TEGA 1CD8A 1OB1A 1FG2A 4Z0XA 1OP3K 1AKJA 2OXGA 4AYMC 4AJWA 1JVLA 3KPRD 1NBVH 1DN2A 1G1OA 3NIFE 4KK8C 3FQ4A 4XVJL 4AIEA 2PW2A 5K59E 1BF5A 1XZ0A 5I66B 1T0OA 1ZHLB 3HZVB 2DS4A 2NRDA 2V8MA 3BDYH 1DVQA 2ZOLB 1TDQA 4NP4L 4PJBA 4FQCH 4PRAB 1B4RA 3NABL 2HPOA 4QJ5B 2W9LA 2XETA 3BD3A 4U2ZA 1JPTH 1P4BH 5DRWB 1PY4A 4JPWL 2LVCA 4PEEA 4EXKA 1GSKA 5A3ID 3SE9L 1PIFA 2Y24A 4N2FA 3U4KA 3RVVC 4UTCA 4U6XA 3CDYA 5D2NC 3X14A 1KMGA 4UQBA 5FYJU 1YRKA 1ES0B 5E2UH 1P1ZA 1UEYA 3PAUA 1MEXH 4HIIA 1UC6A 4NO0D 1Q9KA 5AW3B 4HZLA 5IMKA 1VGKB 4YSPA 3UPAA 4APQB 4L8DB 1BF8A 4XC3H 4L4VA 2VR4A 1WTGT 2AXWA 3Q1SH 4Y19E 5DVLA 3NPSB 2P44B 1JK9B 2XWTA 5L9DH 4ANWA 2CJUH 2EDMA 4F7CA 5BZXA 3VXSE 2WWNA 3DMMA 1U8CA 1OT4A 5E70A 1NCAL 4ISVB 3EJYD 4X7TB 4OTXH 4YBQC 4YH6A 5G4MA 4MJ5B 2Z4TA 3Q0HA 3LZRA 2E75C 5AFAA 3FCGA 5BQDA 3EJZC 5CSZA 2Z8RA 1OF0A 4G8GE 3B7RL 4OT1H 3ZO9A 2FHFA 2NTFA 2OJZL 5J13C 1E6JL 3LKNB 5JHDB 3HZKB 1A6VH 2FD6L 4LCIH 2FGWH 4XOEA 3C5JA 4TUOB 1SJXA 2CD0A 1A2YA 1IGML 4JRXA 1TTBA 4NKMA 3TWCH 4LNRB 1ID5I 2ZG2A 2J1XA 5KOVC 3CLFH 4F8PA 5DZAA 4TLTA 2CDEA 2OMUA 2QV2A 5CBEA 3SBRA 4AEEA 3MU3A 2AQ1A 4H40A 4BJLA 5IMLB 3FQUB 4QHLA 4RA0C 5CJQH 2ILLA 2EYRB 5ANHA 4RWYL 3G5XB 2YAMA 2ZOWA 3IMSA 2NXYB 1H19A 3VI4E 3KPQA 2HJFA 3EHBC 4IU3B 2VW4A 1I1AB 2YD1A 4MJID 1KPVA 1QQDA 3FUDA 1HSBA 3QEHA 1OT2A 3HG1D 5ETUB 5EBMB 2PYEA 1RK1A 4APXB 3MFFB 3IEAA 1B4TA 5BQ7A 5C07B 3SYOA 3TZVC 3BW9A 3CZEA 3AXLA 2WO2B 3MRMB 4K7PY 2B4CH 1I8IA 4HCGA 3ULVC 1BWWA 3TO2B 1ZT7B 2JELL 1N2RA 3FZUC 3BXNB 1A1OA 3L13A 1DUYA 1JNHA 3N0PB 4K3DH 3P3RA 2OYLA 3V6OA 5EO1B 4KJQC 3ZKXC 5HJGA 4G82A 2CBQA 2WLIA 3P54A 4JY6A 3V9FA 4Y5VA 3SPVA 4UQ2A 5IW1A 1YYLH 1SJVA 3RGVC 3MROA 3X17A 1ZK9A 4G1MB 5D7JC 4BD4A 4V1DD 4MCYB 1F4WH 2ZSWA 4J2QA 4PJFA 4HIXL 1J1XH 2VLLA 3FYIB 4Q7DA 1CYXA 4ONFL 1BMGA 3GZQA 1IL1B 1I4FA 3GKWL 3TO4B 2YSTA 1DJZA 3NPZB 2X4TB 5C0ND 1CI5A 5DJXA 3B2VL 3JV0A 3OJ2C 2NDFA 3GMOA 5I82A 5E24E 3MNVA 1RUQH 2MCPL 1QATA 3KYKL 3FUEA 4Y7MA 3KLKA 5AOMA 3D4YA 2PTVA 2EILB 1ZHLA 3HZVA 4M5YH 1ZPUA 4QAMB 3UEQA 2LFEA 2KBGA 3NEOA 4JVWA 5FO7A 1MUJA 4G6MH 2WPGA 1U8HB 4OD3H 4UQ3A 3MBWB 3WUWB 4URKA 2X38A 1VADA 4K3GA 5JIMA 5F7BA 2Z65C 3FTWA 4E5XA 4PTUA 3V5KB 5HYQB 4OLWL 1FJ1B 1JZ5A 4KGLA 2NSXA 5BRZB 1F8TL 1FBIH 2B1HH 2VXSL 2X4RA 3O4OC 3AQYA 4XX5A 4PVBA 2RQ8A 2C9PA 4NZUH 4NUGL 2Q2EB 1QPXA 2QT6A 3U0TA 3TBTA 3O45A 3ZE1B 2Z9TA 4N8VB 1M7UA 1JK9A 4JKLA 1MJUL 1F4YL 1Z5LB 2YPVA 1OM3L 2V8LA 4PY8J 2KDYA 1NCWH 3VFVA 3TBSB 3SKJL 5F9WB 5TGBB 3OKMA 4QWWC 3ZN6A 1DDHB 3EOAB 3OAYH 3V4VB 3ZO0A 5BJTA 4RDQG 4NSKA 3HNSL 5BO1L 4ENZA 4BH8B 1JNNL 4A55A 4U31A 3V6FA 5CEZD 4G83A 1X5JA 3HZYB 2F5BL 3QPQC 1USQA 4WI2A 2VLKB 4JN1H 1F1GA 2JJUA 5D1QA 5C08D 4TUOA 4PJEB 3H4HA 4CVXB 4TTGA 1ETB1 3GIZH 3KBFA 1DQIA 4MJIE 4PS4H 1RURL 2ZONA 1QRNB 4XNAA 4MCZB 4R97C 2CQVA 4X9YA 1C7SA 2OMWA 3I6KA 5CZKA 4D3CH 1FI8C 3HKFA 5IMLA 3QDJB 5IEHB 4BKLB 2A3TA 1E4XL 4NCC1 4PJ5E 3ZL4L 4D94A 3KPSB 1IEAA 1U8PB 4FFZH 3KLHD 2K7PA 4A04A 2M8XA 5C0FA 4E2OA 1EANA 3ZYIA 2HJLB 1R5IB 3S2CA 3O2DA 2MRYA 3IJYA 1CGSH 2HJFB 4F57H 3T0ED 2AAAA 4WTXA 1OWRM 3OQRA 4JO8A 4ORGB 4CMHC 1J7VR 1A4KB 1F6AA 4AH2B 2WQAA 1K3ZA 3RFRA 3VG9B 4D9RD 2ADGA 1Z9PA 3P1VA 1I8MA 1AQMA 3PIQA 2FATL 2AJUL 3SQOH 5IWLA 4QYOB 4QRAA 4Z3FA 5DU7A 3ULVE 3S5LB 4ZAKA 3CVCA 5BS0E 3OMIB 3OZ9H 2AAVA 4PCSA 4KMQA 1HHKB 7PCYA 2FB4L 2ZXQA 3C8KA 4R90L 1J0YA 1P7BA 3BKYH 1NICA 1IIKA 3RZCB 3UDWA 4GXFA 1J5IA 1BX2B 1WK0A 3CFJB 4UAOB 4FFYH 5KUMA 3U79A 3CLWA 5CCHE 3ZMRA 3LD8B 3MYJB 2GK0B 5EMYA 2H1LM 2IQAB 3GSVA 3S4SG 3PV7A 1K72A 3MLZL 3KL5A 4YDVA 1F0LA 5MEOB 3FRPB 4FCHA 5DHDA 5EU3A 2ZSWB 1JV5A 1MJUH 2OR7A 1QZNA 3S3JA 4WI0A 4F1SA 3VD1A 4JG0H 4J3TA 4BZ1A 3O8XA 3ZHFA 1U41A 2IH3A 4A68A 4HVBA 4UT6A 4XXCC 3MLRH 5IIEB 2IWFA 2Q8AL 2J5LB 4CMMB 1SBBA 3VD2A 4IRZL 3HFMH 1ACCA 2Y1ZA 3SKOB 1KB3A 2H32A 4AYEC 4DZBA 5IB2B 2KERA 2C9SA 3DHMA 4U0QB 1OE2A 3SOBH 1COBA 5EEZA 2YJLA 1HK6A 4CKVX 3T65A 3VFRB 3OG6B 4ACTA 1VIWA 4Q8BA 2F7OA 1XIWD 1D9KD 1M1XB 5D1ZB 1P53A 2G0LA 5ALCL 3O2DL 3NCWA 3PPSA 2DD8H 4XN4A 3RIAF 2BP3A 3PABA 4YHOH 3SO3B 5H35B 4V11A 4OLYH 3EHBB 1FVDB 2J8UB 2TSAA 4HISA 3MLUH 4P2RD 4BGLA 2E9WA 1XGPB 5I17A 2WCPA 4FDWA 3D85D 1AXTL 5FAAA 4HBCL 2RD0A 5EZPA 1PY9A 2FLMA 2OMXA 1KEGH 4R4ND 4WO4C 3IJSA 3IDYC 4UT6H 3RY4A 2OMYA 4P9MH 3MO1A 1FC2D 3VXRE 4BUHA 3MA7A 3JSSA 1ADQA 4HSAC 1QFWI 5B38B 5HHOA 5DUJA 3X1FA 2R56L 1H9DA 3HC2A 3LPGA 4NT6A 4L37A 4X0NA 2CCVA 4D9LL 3FU5A 1HXMA 2X4UA 1SVZA 2AK4E 2ZX9A 3CX5K 5FFOA 5DFVC 2D3NA 2H2PC 3G6JA 4U1JB 3HW7A 4EPSA 3GXFA 4WEBH 5I24A 3AG1B 1EJ8A 4NUPA 1GA2A 3ME0A 2VDRL 2W0LA 3DHPA 3KPSD 3CH8A 4GW1A 2F61A 2X2UA 4HF5H 4WK0B 4HPHA 2F5AH 3DRQA 3ISYA 5I30L 4Y4KA 1X4YA 3RVWC 2VMDA 3WEBA 2NY3D 3TBVB 1H3UA 2ICWI 3WELA 1B0IA 2IOIA 1TVBB 2JTDA 3BFWA 2D2OA 3BVXA 1NBYB 4DPAX 5E6IA 1X5GA 3VXTA 3FFCE 1QRNA 2VDOB 4JPVH 5CCGE 3ILQD 4OLUL 2B59B 4YHML 5DSCB 3IGAA 1EJOH 2XVBA 3FMGH 1IAIL 3ETSA 1MFVA 1NPNA 3JV5A 2ETWA 1P84J 2DOCA 5EC1A 4OCLC 2EE3A 2HWZH 3OKOA 4OFIA 4AWJC 1TJXA 3QUXC 1BAGA 4MA7H 2X6AA 4FQIL 1MREH 3Q7JA 5KVEH 4P57B 3TCLA 4TSAL 3C6LC 5CILH 5HVGB 5A43C 1K8IB 4ODWA 2UY6B 3VD9A 4TXVB 4WUKH 4JO2H 2C9UA 3H0TB 3HHMA 5T8IA 4WI9A 2UVEA 2NTSP 3QJHB 4NUMA 4N8UA 4HU8A 2IPUG 1KNOA 1L7TL 1NMBL 2FGWL 1ORSB 4NDMA 4ABQA 5BNXD 1DQMH 1A6VL 2F54E 3C75A 2XWRA 1RQ5A 2E6PA 2ZUYA 4WSKA 2CXGA 3LKPB 2P5EB 2JKRM 3D2TA 4FMKA 3DJSA 4MZIA 3QEGH 1BYNA 2F58H 1A3ZA 4Q14A 3NGBB 5A6IA 1VHPA 1E5YA 1B0RB 5D7LD 3Q06A 2ZP0T 5B3JF 3S5LG 4ICXA 1KV7A 4JG1L 3EYUH 1J87A 1NM9A 4TQEH 4OCSH 5I15H 1NIFA 1ZWIA 2GSGB 3BO8A 2MWCA 4P4KC 5EU3B 3VXOA 4F8QA 3QWRD 2L4OA 2Z7ZA 1WBXB 1VSCA 4F7PA 4RCAA 2LFGA 2W9DL 3JWDL 3BE1H 4NQED 4I7ZC 1E3ZA 2NXYD 4WWKD 5DUPH 3DJZA 4E9TA 4JFFA 4EIBA 1IRAY 3VYNA 5EDXA 4U7SA 4M1CC 5E2TH 1UA6L 3O3UN 3ABLB 2D7TL 3P4OB 4JM0A 3TO4C 5I2IB 1KXTB 4MA8H 4JDZA 5G5DA 4CADA 2YKLH 3JWOH 4QXGL 3TT3H 1JZ3A 1UA3A 3BAIA 3ECBB 4WI8A 2ATKB 2CIIB 2HT3C 2J4WL 4ZDHB 3M88A 2BFVH 2IALB 1DSWA 4HKBB 1HI6A 1WWCA 1UWEL 4ES8A 4FQCL 5KVGE 2J8UA 4BFBD 1TKWA 4FAAB 2GJZA 3E1ZA 1H15B 2UZXA 4Y2LA 5I17B 2Y3NA 3B9KD 2EE6A 4H0IA 1LVEA 3VGAB 4KTDL 4LVEA 4Q0XH 4MAZA 3RU8L 3KE0A 3MKGA 1YNLH 3BUIA 3RBGA 3CVHB 2EDBA 4HKJA </