2CR0A

Solution structure of nuclear move domain of nuclear distribution gene c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
GSSGSSGKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of nuclear move domain of nuclear distribution gene C
rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Nuclear migration protein nudC
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cr0A00
4JUTA 3EUDA 3GT6A 4PCKA 3VQMA 3GUFA 3Q9QA 1EJFA 3L1FA 4ELDA 2Y1YA 4RZKA 2MNWA 4YDZA 3W1ZA 2RH0A 2WJ7A 4I88A 1X5MA 4JUSA 2JKIS 2XCMC 5LUMA 2KMWA 1SHSA 3Q9PA 2N0KA 3QORC 3QORA 3QORB 1RL1A 3N3EA 2Y1ZA 2KLRA 2N3JA 4FEIA 1WGVA 4MJHA 3IGFA 4PBDA 4M5SA 3QORD 2O30A 2WJ5A 2CR0A 4YLCA 4YLBA 3AABA 2Y22A 1WH0A 3L1GA 3AACA 4M5TA 3J07A 2BOLA 5DS2A 5DS1A 3VQLA 2K8QA 4ZJ9A 4YE0A 3L1EA 3GLAA 1GMEA 1WFIA 2CG9X 4YL9A
chains in the Genus database with same CATH superfamily
2P1YA 3V0WL 5DRNB 4NKMB 2R2HB 4H8WH 4I9WD 4RMUA 4Z7WE 4R7DB 2K7QA 5E0QA 5CCHE 2VXQA 1BFOA 1FFRA 1OPOA 4NSKB 4BUGA 3GSNL 4G42A 5BXFA 3HIZA 3G04B 3JWDC 4AQ8C 1OE2A 2YWYA 1YEKH 4DTGH 3AMLA 3SGJC 2HYMA 3DUHA 3ZDYF 5A40E 4OCSH 3VWJB 4DZBA 1KTRL 4G8EB 3NIFF 3CLFH 1XCTB 2IH3A 5DYFA 4YJZL 1JPTH 2PCPA 3HFML 5JNYB 2F19L 1KGYE 4PJ7B 4WEUD 4PSPA 3DPBA 4XMKL 4CUCA 1F41A 2CALA 5J13B 4NUJA 2WNGA 4G43B 1U58B 4AC4A 2ALWA 1S7QB 3E9TA 5AOKA 1WFUA 3U6XA 5IBUG 4YX2H 1AQMA 4WKZB 1FNEA 2NX5B 1PBYA 2CHZA 4UQDA 4X8GA 4O02A 4QXUL 3OR7A 4JHAH 5E2WH 3UTTB 4QO1A 2YEVB 3GMOA 1CLOH 4KH9A 1RHHA 3DHJA 3LQZA 1N3NB 4BGDA 4I2XB 3QI9A 3SDDC 1TVBA 4PJHB 2FO4A 4TQPA 3MZTA 4O02L 3MREA 4M3HA 1YQVH 3KYOB 2VC2B 5IFAH 4POZC 3GSRB 3KLAB 4DHLA 3BP4B 4YL9A 5HYJA 4ZUTA 2XZQH 3DX6A 5D7HA 1HWWA 2P5WE 3CVIH 5IB5B 2Y7OA 4NEHB 1GSKA 3WL9B 1GSMA 4POZD 1ZLDA 3NN8B 4KROB 1N6UA 2ATPB 3ILQD 4JR9H 4NIKB 3OSVA 5T8IA 4QUOA 2XXMB 2GTQA 3RU8H 1N19A 5F7YC 4HCRH 1ZT7A 4WTWA 3UTOA 1ZGLM 4W4NA 2JI1A 1U8LB 3NMEA 1FPTL 2NQCA 2X9XA 3AG2B 4UAOC 3UYRL 4JDVB 1KELL 4FQ2H 3NQIA 4FG6C 4TRPH 4DGYH 5FDWA 2Q2LA 1YC8A 4Y19E 4MAYB 5ACMA 4NS0A 2HMID 4ZOAA 1EEYB 2OR9H 2R0LL 2NY3C 1T03L 1WTLA 3IMVA 4OZIE 1O6VA 2J44A 5C9JB 1V7ML 4LVOC 1EAJA 1JHLH 4JHBA 3N2JA 3SCMD 3STBA 2D0FA 3OKKA 1MDTA 1E3FA 1I3RB 1KJ2B 2CLRA 2G9HA 2NW3B 2OA9A 4GAJH 4CSPA 4X0KB 1UM6H 5AYUH 4MZ3A 1NGYB 3UDWA 3JUYA 4IOSD 1G9HA 1QWNA 1X44A 4PRNA 4BHUI 4HOZA 5I17B 3KLKA 1LO2H 3K6SB 3SKNB 2WQSA 5EDXA 1AJ7H 5IHZA 3INOA 4KRPB 4TUKH 3RGVB 5IHWA 4LLDB 4Z0XA 3D51A 4N68A 4QYOB 3HBQA 3WSQH 1KBPA 2HFEA 5MEQB 1F1DA 5EBMA 4JFSA 1HINH 2DLIA 2YBRA 3RVUC 4JVPA 4S1SL 5D2NB 1FZKB 1JD9A 5ITFB 1P2CA 3MNVA 1S7QA 4X4MA 2H3XC 3MGTA 4YHOL 4NWTL 1G7JB 4PJIB 4B7LA 2YGNA 4IOFD 5GS1B 4OY9A 4HSAC 5FB8A 2YN3A 2A9NH 1HKLH 3EYFB 4HAFA 1LWJA 3UJTH 4BFRA 1KGJA 2ZOTA 4D3CL 5J8OA 2Q10A 3GBLA 1NL0L 5FOJA 3RY4A 1T0NB 1MJ8H 1ASQA 4HQQH 3ET9F 4I5BA 4J3OF 5E70A 3GSXA 3I6KB 1WD9A 1JYXA 4HKJA 1T1WA 3VD0A 3WTWA 1EHLH 2R2HA 2N7AA 5D5ME 5EULV 4JGNA 5T1KA 1NQBA 1TQTA 2A73B 1P84K 4LSRH 1FL6B 2V3EA 3TNMB 1FLTX 1ZLVH 2XLLA 5FYKH 3WIIH 2G5BB 5IVXA 3WYRA 4ZUVA 3CTTA 4NQEA 2P80A 4QXWA 4F8LA 3QI9D 3HKFA 1T5KA 4FI7A 3BSHA 5A6IA 1O0VA 3JWDH 3TN0B 2R0KH 2WD0A 3ARPA 4AZUA 4YK4C 3BRFA 1UXLA 1K3IA 1W0VB 4LLMA 4GJTB 5EOTA 1VIWA 1SJHA 32C2B 3I6GA 3RI5K 4Z78B 1Z9LA 2OZ4H 5CM1A 5ERWA 1MVUB 2MQ0A 4AYMC 2HT2D 3RLSA 3O4LE 4FERA 3BYYA 5I6XC 3QHTC 1WDAA 4JMXA 3MUY1 4O2EB 4Y19B 5CIPB 2G5RA 3GMLB 4DOHE 2O5ZH 4PGEA 2GJ6D 4GG8B 1LWHA 4NRYB 2ZKMX 1QO3B 3RGVD 4APXA 3SOBH 1AJ7L 2BRQA 2E74C 2FT6A 1EXHA 1FBIH 1B0RA 2R2EA 4FFYL 3GHBL 3W2DL 1S2EA 4P3CL 5IHUH 3SHSA 1H9DA 2VSKB 1ZHKB 2JI2A 1TKWB 4X9HA 2VDRH 4UTBH 5C0AB 1KF9B 3VMPA 4HVBA 5K93A 1CE1H 2WWNA 3VFRA 3D85B 4ZFFB 4BM7A 1RJCA 1NAKL 1OSPH 5HYSG 3FU7A 1A7QH 1PEWA 2ZJSH 5DS1A 3WO4C 3ZOAA 3VACA 2Y06H 1AKJB 1AO7B 4O4YL 3MCYA 1T1YB 4JQVC 2QTEA 4B6ZA 4ACTA 3X3GH 3LSOA 4M5ZL 4TSAL 5CEYA 4U4IA 5E9NA 1ERNA 2QHRH 2AXFA 2P52A 4Q2ZA 4NIYE 2MCAA 4MAYC 1GVIA 4PQXA 1F3DJ 3MOQA 4YZFF 3L4VA 3E8UL 1NOAA 3EG9B 5KANG 1IT9L 3Q8CA 3IXAB 4XCEB 3NRPA 1LE5B 4ZS7H 4TVPH 2YKLH 3DVIA 4YBQC 4JN2B 3DUSB 4PRDB 2VLKA 3ULVD 1XWVA 4NM8H 4F5CA 4R6UA 1UA7A 3QIUD 3HVNA 2EVFA 5TE7H 3HTLX 2WNXA 1G9NL 1M6UA 3SKJH 4UT9A 4Z7VF 3ISWA 3VM5A 3BGMB 2XZAH 5JMOC 5IMMB 4GO6B 3GUTB 2V5YA 2VISA 1JXGA 3UFIA 3ESOA 2X4QB 4LP8A 4M6NH 4LCIH 4HIEB 4P5KB 4GKSA 4J3TA 3LRSA 1WUZA 3VFPB 4MLIA 2IWEA 3MV7B 3SN6N 1AIFB 2VDKB 2WOYA 2EIEA 1KIRA 3PXLA 3OGCA 4MAUH 3KYNB 2FJFA 4DZ8B 1BHGA 3QEUB 4NBXB 2YAPA 1YMMD 5I8OL 4X4XA 4BINA 4GRLC 1AZCA 4DGYL 4Y2OA 3IJHA 3O3EB 3OD3A 1JS4A 1A9EA 4XMKH 3VWKA 3QQ4A 4XNYL 4EF3A 5GZOC 5IMOB 4W6XB 3WFHB 4G7QB 2NSMA 4BUHA 2JKWA 2QFRA 3UJIL 1WZKA 4UOJA 5IB3B 3L9YA 5AVTB 1H3GA 1WA0X 4OZHB 3RGBA 2VR6A 4C54A 3PIQA 3DMMC 5F2FA 3LB6D 3WXVH 1AP2A 1QFWM 3RHWK 1F18A 2MOQA 4U2YA 1Q72L 3ZTJH 2CGZA 2X1PA 4YZFE 5T1KB 3GSWB 5LAPA 3HR5A 4APQD 1OD9A 1MAJA 1T1WB 2C4FT 2KUTA 4YVUA 4I5BB 2ICEA 4UT7H 1NMAL 1U4EA 3G5ZA 2Q6WB 5HYJB 4M7ZC 4FMVA 3K8KA 5AZUA 3C75A 5HHQA 3D0VA 1E27B 4XO8A 1E7UA 3NJXA 3RKPA 2ZUUA 4NQTA 3ZRFC 3H3PH 3BPCA 3SPIA 4Y5YC 5EPMA 4L4TA 4AMXA 3BEVB 2C9XA 4HKBA 4WUUA 2R39A 1RZKC 1DBAH 3PF2A 4KRPD 1T04B 1YLBB 5EUOA 4DVRL 4FQXA 3HI5L 3CLFL 4DGIH 2VDMB 4YC2C 2KPNA 4HHAA 2FT7A 1J88A 1WO2A 2WXFA 3LPPA 4B97A 4G8EA 1NGYA 5F89A 4AEIH 3AG3B 1PL3A 1KV3A 2CLRB 3ZW3A 2Y9RT 2EIJB 3U36A 1W15A 2HH0H 2YRPA 3ATFA 1X5IA 1K2DA 1K2DB 3BFWA 3L5IA 3RHWF 1QI4A 3VXUD 2K6ZA 3MNZA 1EERB 4LPVA 4N8UA 3VXPB 3GSOA 3O0RH 3U30B 1CICC 3V10A 3MROA 5M94B 4TTDC 1RD6A 5A6LA 1FH5H 4HXBL 2YA0A 3T2PA 4HFWA 1ZAGA 3AU0A 3ZE2F 1ZTXE 3V8CA 4EN3C 2AQTA 4JLRA 1VFBA 3F7YA 5D7JA 1LJMA 1GHFL 2CO7A 2Z93B 3S6CA 1T7YA 1NCIA 3GGWA 3AVEA 5CF3A 3TEUA 4F1SA 1J48A 5D9SA 2XVBA 4DGWC 2FEJA 1EJ8A 1YHPA 3OZKA 1CIDA 5D7IE 5KN5B 1GGBL 3NPSB 3RVXC 4I85A 4UT6H 4DKDC 1C1EL 1F4XH 5CJBA 2WVSA 5CNHA 3SGEI 4MJID 5G4MA 1U30A 5IBLC 3GSVB 1EHXA 4NI3A 3MBEC 4QT5A 5KS9B 1QI5A 1Q9LB 3B6SB 3QZWG 4JFDD 3BPOC 1E9QA 1IC5H 1EJFA 4P23D 5GRXG 4KZEH 4PLNC 1N2RA 4QHUB 5T1JA 2V0AA 4Y5VC 2GY7B 4JZNB 1QNIA 5GS0C 1UUSA 2O6FA 2ICEB 1SQ2N 4P5RA 1QA9B 4H8WL 3TA4D 1KYAA 4U7MA 1NEZG 1M4KA 1R3LA 3DTXB 4ZW8A 2R4SH 4LL1A 1JV5B 2BW5A 3RTQB 4NQDD 3FUDA 5IQ7L 5JHBA 1FUNA 3Q3GA 2FSDA 5IEKB 3FFCE 2Y06L 1DQLH 3LH8A 4ADIA 1XBDA 1W6WA 3KBEA 1XAKA 4K9JA 4PTUA 4M6ML 3LIUA 4ALAL 5DSCA 2IC2A 3QXVA 4LLQA 3IRZA 2HRLA 4XPBL 4Y4FC 5E03A 4N2HA 3WFHA 1J1OH 3FCGA 2QVKA 4MCYB 1JE6A 1HZLA 3O3EA 2HB0A 1MCRA 3IJHB 5E5LA 3VWKB 4OV5A 4F7CA 2W95A 4YHNA 4N0CD 2YD5A 3DBXB 3IPBA 4NSKA 2ICES 3B2DC 1CDYA 1JERA 1R47A 1IBDA 3RVUD 4ENZA 3BQUA 2ZWLT 4HIEA 4P5KA 4X6BB 3NZHL 1RP9A 2YD4A 1C9SA 3L9RA 3EFDH 5IMMA 2FQFA 1HU8A 3GUTA 1FGVL 1G4RA 3QDJD 5DYOB 4YHML 3O6MH 1GS8A 3JWNG 3FTXA 4S0SD 3FC8A 4TNFA 5T5NF 2OM5A 3ZKNC 1J5DA 2OR7A 3KLHC 4EMZA 3U2SA 1KEML 4P46B 3JWNC 4PRPE 5GGSY 2WXHA 3WCYA 3WNPA 2CR6A 1NCGA 4DNLA 3ARVA 3IDNA 4F33A 1G84A 4R7VA 1KGXA 4AGOA 2BVUA 3S37L 2BVQB 1XIWD 2L8AA 2SEBA 3CFMA 3O2WL 4OTXH 3S5LA 3VA2C 4F3FA 5JQ6H 1CXFA 1N59B 3WBDA 1NZRA 1TU2A 5FLVA 1VGEH 4G8FB 1A7NH 4X7CC 2YAMA 1PSKL 1AO7A 2IQ9H 4M7LH 1HS6A 5EIIG 4APQC 5L2KD 2ZOLB 5HVGB 1P69B 1T2JA 1IC4L 5E6IA 3WHXA 4Y9FA 2B9AA 3QJUB 3E9UA 4IGBD 4AENB 2VM9A 2QQKL 1I7TA 3D07A 2E7LC 5J6GB 3HLAA 4N8PA 1A3LH 3IDXH 5HGHB 3U6RB 4WW2C 5AKSA 1XCQB 5EA0H 5AAPA 1UOLA 2W1NA 1TCRA 2HKFH 1KFAH 5LBSA 4BFKA 4K4KA 2BNQB 3MI6A 2CM5A 4TVPL 1DBBH 4QRTB 4HKZA 1MREH 2MOGA 4IQHA 4NO3A 1MXGA 4J1UA 5KSAA 1H5BB 3ARBA 2VXSL 4N20A 4Z18A 2VTFA 5I76B 2VKWA 5BOPA 3CSTA 3H9YA 1MFBH 1KSRA 1YEEH 3MA7A 3CSFA 4JFEE 2X2IA 3O6ML 2LHAA 1GRWA 1K4CB 3OHXA 3QORC 3ROOB 3JV6A 5I5MA 1UKQA 4BGLA 5IF0B 4N2EA 2IBZX 3P4NA 2J6WA 1JPGB 3BSZH 4W9LC 2BP8B 5AW0B 4AY0A 3FUKA 3H9SD 4PJGE 3M7OA 4NC1E 5EBLB 4IRSA 4IS6A 1BFSA 1F4AA 1PS3A 2IPKB 5EU7C 3U4BL 3WN5B 1A22B 3VXOA 1V7NL 1F6FB 2AI0H 4XVTL 1U8PB 5LWYH 3HPJB 4OI9A 1KB3A 4Z7VB 3I3DA 4NP9A 4F8OA 5ECJE 2G2RA 2JKNA 4KJYA 3QEQE 5I0WA 4CNIB 3LPOA 3MOBL 2WWKO 3WMQA 1J0JA 2PN5A 3VB8A 4W9FC 1KGCD 3S34H 5I1CH 2CZNA 2BCMA 1AFVH 1QZ1A 3COOA 4JB9L 1JZ2A 1HIML 1OF0A 2ZSVB 3MR9B 3HJEA 1IILE 3EBIA 1LMKA 4KKAD 1IM3B 4N6QA 4RIRB 1IT9H 1Y1DA 2ENSA 4NDMB 4YHIB 4ANWA 2A6JA 4RA3A 3VM7A 1G7LB 3F85A 5HGDB 1PY9A 1ZGLA 1MF2H 2YOCA 4NDMA 4PAZA 4OIFA 4X9GA 4H25B 1E4KA 5DEFB 3WE6B 2WXOA 5HY9A 1AIZA 3S36H 2HT2C 2VXTL 2ZXGA 2NCMA 1DQQB 3KPSB 2FL5A 3MUZ1 3FQYA 3NFNA 4JFPA 1BPLB 1A6ZA 1DFBL 3KPRA 5EH1A 2YZ8A 1R3JB 1JXFA 1P4LA 3V7AG 2AK1H 2QKSA 1JWSB 4HX1A 4KY1H 3OJDB 2D9CA 3NSXA 3BCFA 2MMXA 3HPJA 1I8LA 3LIZL 2GCYB 1VGEL 4HIIA 2XDHA 3U7YH 4A63A 4WFEE 1P6WA 4DOHB 3PWPA 5SWQA 4MNQB 4E41A 4LF3A 3QORA 4MHHG 1JCKA 1OCWH 4HG4J 1BX2A 1S6NA 2CIKB 5D71H 4LMQE 3FU0A 1BBDL 1KB5A 3JUZA 1LE9B 1NUGA 1QZNA 4PYGA 4YEEA 3MV8E 5IF0A 5IJCC 2Z4QB 5C0CA 3GEWB 1MCOH 5FS5A 1I3RA 1KJ2A 1JZJA 4F37F 1SXAA 3BVTA 4MHHI 2UWEA 1GMIA 5F96L 5DDHA 5EEXA 3AS0A 4X5XB 4K9EH 1ADWA 4EIUA 5F1NB 4G1EA 4UINH 4JZOA 1AKJD 2E7LA 2VDNL 4CC0A 1SEBB 1T0PB 4PJGB 2H3KA 4Q56A 4EZLA 5IKCA 1TTAA 2OMWA 4YSDA 4TUKL 3NP4A 5CUSL 2OXGB 3QQ3A 2P45B 3S8GB 5C0RH 3QFDB 1LVEA 3C5ZA 3G6JF 2MOVA 5F9WC 3FU8A 2AJVL 1AQ8A 2VM4A 3B9AA 4BXSV 1UENA 2Z91A 4XO3A 3ARTA 3BZ5A 5ELIA 3UROR 2WINB 1BBJA 2FRGP 4UT9L 4JFUA 3CZGA 1MWAB 3RGHA 4MA8L 5I19L 1DFXA 3ARDB 2Y2YA 2PYFB 3D5OF 3TGXA 4HH9A 4PGCB 3H3PL 4EI6B 4XB8A 3IFLL 4G11A 5B1AB 4MA8H 5I19H 4PB0H 5D4HA 4IBVA 4XCCH 3S3SA 5IESH 4YPGB 3IM1A 3DLQR 3EH4B 4IIQB 3UZQA 2YA1A 4DP8X 2AXHA 3N9GH 5B3SB 3T2OA 3WS6A 1PTZA 1CE6B 3PV6B 4W68A 4FA8A 2FX7L 4KTDH 4AQ8A 5INCB 4D0CB 3SPHA 4M9PA 3WFBL 4MKMA 5IM7B 4OFYA 3TX4A 1B0WA 2CBQA 4QHNA 3N41F 1JZDC 4N0YL 4R84A 3WHE1 1W0WA 3HLKA 4NRXB 3DPBB 4RVBA 3ULVF 3HI6H 3WSQL 5ISZE 4L23A 2IH3B 1XCTA 5CLXA 2A4EA 4TQEL 4N5EC 4RZCB 4U1KB 5CBAB 4KO5A 5B7MA 1E4KC 2D3NA 3MJGX 2KHAA 1UM6L 3ECBB 4ZOCA 1HHIA 2EEFA 4PIRF 4U6YB 3HG5A 1AGDA 4KI5D 3ML9A 2VDML 4LE8A 5F9JB 1UM4L 3LZQA 3IWVA 3X14A 1SN0A 3GHPA 5GZOA 5DZVA 1OP3H 4OZ4B 3CVHH 1A02N 3M1OA 1SPDA 3FB8A 3KJ4C 1JHKH 4B53A 5J89A 4YSSA 4BCYA 4FQ2L 3WFEL 4WO4C 1KUMA 3EJQA 4I0PD 4DQAA 1UYWL 3CN3A 4YSRA 1DVUA 1GGYA 2E9WA 3TO2A 3IVKB 1G1OA 3WKNA 1DUYA 5K1VA 3GTNA 2F9BT 3CMOL 1QHQA 3VMNA 5F7AA 4H0IA 1N2RB 1MI5D 4KMTL 4QHUA 4W6YB 1EHNA 4L0YA 4HS6B 1X4YA 1OARH 1PZ5A 2R1WB 3L6FB 1KC5L 5EO9B 5K9KB 3O3UN 3OM3B 4KQ0A 1MI5A 2AXGA 3GBDA 2XZQL 3QHFL 3QJSB 4GH7B 4OJFH 2H32B 5EFIB 2A99A 2XXGA 4U1NA 5HYQB 3BH8B 3O6FB 4KUZH 1GTFA 1MAML 1T4KA 2AVGA 4DKFH 5B38B 2XV2A 1NMCB 5DTFA 4L1HA 3OJDA 3PAUA 3WFCH 3R19A 3FFDA 4FQPA 4HUVA 2WLLA 1XX9C 3HNTL 4Y1AE 5HHPA 4Y9EA 1TF4A 3GI9L 1FDLL 2ZXDA 4R26L 3SYPA 1EGJA 4PCYA 3DTDA 5DFWH 4ODHL 2G3ZA 5FGRA 1JHTB 3IDIB 2W80C 4LLYB 2CIIB 2CNZA 2Z8SA 5JR1H 1H9VA 2HWZH 2OSYA 3VI4A 1X6NA 3F7QA 1T1XB 4UUJA 1KXQA 3C08L 4NQCE 1ZK9A 4TNVF 1TFPA 1MW3A 1CI5A 2V7HB 1EFXD 2ZOUA 3QJVB 5HGAB 5A1AA 1NA8A 3NCJL 1MVFA 1A2YA 2ZT9C 1KULA 2NR6D 3MBWB 2DKMA 2X3CA 5CLZA 5IOPB 2EEDA 4ZQKA 5FYLE 2I7SA 2E6QA 2GI0A 1UH3A 4YDIH 2ZE0A 4FG0A 3V4PL 2N0KA 2D0HA 4ZPTB 4ZPTA 3PGDA 4E42A 1D2PA 4X4KA 4NAJA 1P1VA 1HI6A 3L5JA 4LK4A 4JCLA 2F1AA 5F3BA 5F3BB 2LAGB 4M8RA 1CGSH 3H6JA 3JSSA 2NTSP 5JA9A 4MNQD 3VNYA 1KT2B 4WU5B 4PVNA 1F58H 4OZGA 3T6VA 5D2LF 1MFAH 2VE6A 1MZZA 2WCSA 2DQJH 4IRSB 4IS6B 1L4IA 35C8H 2ZSWB 3U9PH 1FNFA 1TCMA 1VGKB 4XPHL 5F9AC 4H7VA 3E1F1 5AL8A 3GHEH 4G6FD 2IMMA 1FNHA 3EBHA 4GMSL 2CIIA 5EU6D 3U9PL 5T3ZE 3Q06A 1A66A 2F74B 1EA9C 2O30A 1K72A 2B1AH 3FFCB 4KI1A 2OL3A 2X53A 4PLOB 2K0RA 2WLNA 5C0ND 5JW4Q 4PHXA 4RNRA 4NO3B 4DERA 2NY0C 1MCNA 5FA3B 3ZGIA 1MG3C 2WLLB 4EO5A 4AGQA 2XPGA 1L9QA 3T71A 1KIQA 5AVQB 3ML8A 3JWNE 1N4XH 1PW3A 1GH7A 1A4AA 1XMEB 1EEQA 1F4YL 3KHOA 4GBXB 4P2QD 2V37A 1CF8H 1T4KB 3B9KC 4R97B 4ZFZA 1E4WH 2BK8A 4HU8A 5CN3A 1KIQB 2X09A 1JXDA 3C9NB 4ETQA 1JZ5A 1A9EB 4N26A 3FH8A 1FC1A 1RZ8A 2XN9E 3L45A 4A6YL 1FZJB 4NQXB 5BO1L 2P49B 5I0ZA 3GMMB 4G8GB 4HSCX 3NACL 1EMTL 1TJXA 4PJFB 1J9QA 1F4WH 4MJ6A 3EYUL 4J2QA 2XIDA 4JKMA 1NUFA 3LKRB 4RAVB 5AVWB 1HYSD 1QVOB 4GKLA 5T1LD 3QG6B 1KIUA 1L9NA 1K85A 5HJ3A 3L6FA 4IK6A 3V79C 1DN0B 2ZF9A 1PLAA 3PAVA 1WITA 2DKSA 4MMXA 4F57H 3LRHA 2O6DA 5CZVL 1MHHB 3FB8B 1BXVA 1QAWA 1EBAA 5E2VH 3TO2B 5LWYL 1KT2A 3OF6A 4KVPA 4J39A 3KGRA 3B3BA 1QSEA 2J3SA 1R24A 3K1DA 4NENA 4L5FE 1GGCH 1S7TB 1F5WA 1J1XH 1V3MA 5CJXC 1ZHNB 4XTRD 4KI5C 5EEUA 4JQVA 3ZRCC 4EE2A 4MDJB 5KBNC 4HXAL 1KTKE 4MQXD 2VQTA 1DVZA 1M56B 3OKOA 1PFOA 3MLSL 2Z0UA 4U6YA 3U2JA 1HXYB 1KLUB 1T6WA 4GQQA 4OCRL 1OGTA 2RFXA 4M4RA 4IBLT 1SN2A 3WIHA 4LL9A 3ZL4H 2W8CA 3I02B 1S7UA 3QIBC 1TYRA 5BQDA 1NMBH 2A4ZA 4N0UB 2CJUL 1NGZA 4QHNB 4GUPA 1T21A 3PHAA 4HIJA 4Q6KA 2CR0A 3B2MA 1OALA 5DMJB 4DO5A 5LBSL 5ADPL 2WXPA 3L5HA 3P0YL 5G2NA 1IGMH 1YY9D 4NO2B 4GSXA 4B96A 1G5AA 1JHTA 3IDYC 3CK0H 1CWVA 4BFOA 3OX8A 3EIFA 1EPFA 5IFJA 1AGBB 3TJHC 1M7XA 1YY9C 4KX9A 4R5TA 1UGKA 5J3HD 2WVTA 5SX5H 3DJRA 2Q86A 2ISDA 5KBKA 1E4XI 3DDFA 5E8NA 4Q52A 1FI8C 1VZIA 4R7NB 2AV1B 3H55A 4OB5L 1KBGH 5I6PA 2CHNA 1XF2A 5GS0H 2PYFA 2VDQL 4YMPA 1Z7JA 3MRMB 4U1NB 5HYQA 1PIGA 1B0IA 1ZVHA 1MI5B 1JYVA 1WFIA 3K4AA 4HIXL 3C2AL 2B1HL 5DGRA 5CUSH 4LDLB 3QYMA 3QFDA 1FFNA 1BBJB 3T04D 4NWTH 1B3JA 1MFVA 3TLRA 2DBLL 2I25N 3VX1A 4DTGL 2IAND 1ZE3H 4WSKA 3NFSL 5GGSA 1DP0A 1JGDA 1IZKA 1P0SE 3GO1L 4JPVH 5EEWA 1X5XA 4Z5RB 2KQMA 1C16A 5JHMA 4HWNA 2JB5L 4MLSA 2DQFB 2VLLB 5DHVA 3U46A 4ZD3L 1DLFH 4IKLA 2DQMA 2BZDA 3VWKD 3QRGL 5HDRA 3OKMB 4P48A 5AUMB 4KFZC 4JFXA 1UB6B 1U2YA 2DQDH 3KXFE 4LGSB 4MRBA 1SEBA 4IKNA 1EIBA 2EC9U 4EI5A 3ZHKA 5TE6L 1RURL 3MRKB 5CD3B 2YAQA 5EO1B 5F7LB 5D1QE 1Q94B 25C8L 1A7OL 5D1XC 5FUZH 2Q7YB 1RK0A 5DZPA 3FTSA 2EQDA 4PI2A 3WDIA 1UD8A 1KLFB 2Z4QA 2ZCZA 2YLKA 3F64A 1MCQA 2IADB 2WLZA 4OLZL 1MCDA 4OQ1A 5CP7B 5CSZB 4XBPA 1GCFA 4OFIA 1R46A 3EW3B 3LV3A 1KN2H 3D39E 3NCMA 4O58L 1CO1A 4H40A 4PGDB 3TWCL 3FMGH 1JWSA 4HX1B 4GAGH 1SY6H 1N10A 1UACH 2CRMA 2R23B 5KTEH 1KPUA 4ZW3A 3V0FA 4IYKA 2R29A 3IMUA 3PE9A 5ESQB 2O1AA 5D1ZD 4JFHD 1JZIA 4M00A 3K91A 3ULVC 1K5WA 1XZ0A 2X41A 3ARFC 3OB0H 3MTRA 4LASL 4NB7A 1CFTB 4XCNA 4I3RH 3FONB 1WZ1L 5GGTA 5KOVC 1H3UA 5KJ4A 3L3JB 2OULB 3MBEB 3WY3A 4PW3A 5I1LB 2XTJD 4FN0A 4FJ6A 4XNYH 1WWCA 2Z1KA 3UC0L 2V6HA 2G9HB 1JD7A 5KBMA 1PD0A 2VERN 2HTLD 3SGEH 4HJ0D 4QLRA 2OX5B 1JPSL 2FLRT 1U3HC 4GS7B 1QFPA 2VLJE 4AQ1C 3CE1A 3VFGH 2ZKHH 3C12A 3NABL 3ZT6A 1BWMA 4YX2L 4B27A 2NQDA 3P4OB 1DCEA 5I1KL 1P4BL 4WWKA 4AT6B 2Q3ZA 3QQ3B 2BLFA 2YOAA 1GAFL 5AWNH 3BUTA 5IB3A 3LTVA 5CINL 1DLFL 3LB6C 4OCWL 1EGJL 2CMRH 1ZOXA 1V54B 4JM2B 4N8CH 5D96B 5IMOA 3T4AC 3GSUA 3LHPH 3PJNA 3CFDB 4JJ5B 2NUPA 2BSSB 4AXWB 3TT3H 2DBLH 2OMBA 4EEEA 1OTSD 1U8IB 5DRXA 4PY8I 2BSEA 3FTUA 4AE1A 1Q1JL 1K8DB 4RISL 4PJ8B 2VXVH 4DAGL 4XXCA 2DQTH 3FUMA 4HETA 2Y07L 3BN9D 5LBVA 4TSBL 2BWIA 5DZ9A 3Q44A 3VO0A 5EF3A 1Q90A 3ULUH 3DX9A 4FGMA 5SWSA 4XVUC 4ZMPA 5GS0L 3CFIC 1C08B 4AJWA 5DJAA 1WFNA 3H9HA 1UXSB 2FX8H 5IEHA 5EIIB 1SHWA 5ISZB 5DK3A 1JV2A 1JRHH 1SYVB 5HP5A 5DMGD 3AADB 4UB0L 2RBLA 3KPRB 5KUKA 2W5PA 1I8LC 3P3SA 4WI7A 2BIOA 4PY7A 1AHWA 1C5CH 2NLJB 3O4LB 5K39A 1LDSA 2P42B 2IOOA 2EXWC 3G7TA 2I5YH 5SV4A 1UA3A 1OCRB 1EZUA 4DF9A 5IQ9B 1KWGA 5AW4B 2GI7A 1KCVL 1NBCA 1QKZL 4RWYH 1FN4B 1IBZA 1LQBC 3N44F 1S7RA 4KMLB 4OLVH 4JFFB 3TO4B 4F37K 1U8CB 5BJTB 4YFLI 1S9WA 1IBYA 3BDXA 1XR8B 4TLUA 4UIKH 1NLBL 4XXDB 1BA9A 5A7EA 2Z8WC 3CSPA 4R3SA 4XP5H 5F70A 4FXKC 3NZHH 1YPZF 3Q6GL 3GINA 1EXGA 2EIMB 3L4CA 4LHUG 1G7MB 4YSAA 3UPRB 1RJZA 3P4MA 3CDZA 3TZVC 1R1CA 4XVJL 1Y6NR 1NGXB 1AXSB 4OLYH 3ZHDA 5ID1B 3TV3H 3IDMB 3B3IA 4JY5L 2F7RA 1C8PA 2CGRH 4RETB 5KSAC 4FHBD 1OHZA 1J05B 3W1ZA 1BZ8A 3L3GA 2Y7SA 4QOKB 1BAWA 2JKIS 2L7EA 1FRGH 4I48A 4YHKL 3WNOA 4XPHH 2Q20A 4ENEC 2NY1D 4NBZB 5CGTA 1EHLL 1FJ1A 5AOZA 3SD5A 2B39A 1SMAA 1BSIA 2D7MA 4Z23A 3EH2A 2EE6A 3D0LA 4FTVB 3MVSA 2E47A 4CMMB 4L4VE 1OTTD 2BHFA 2UY7B 3HNSH 5BO1H 2V9QA 1BP3B 4OKVB 5LCVA 3QUMB 1XF3A 5DURB 2H6PA 4G1MA 3TWYA 3SODB 1DBJH 2EO9A 4PRBA 2QHRL 4WI5A 3FUIA 1JV5A 3OLGA 4FJZA 4K3DH 2G5BA 4PP1C 4HKZB 3U7WH 3BMWA 4F1ZA 1BECA 1HH6B 1CTOA 1I9RH 1NANI 4FRWA 4NQCB 5FR3A 2LU4A 3H0TB 3KDPB 4F2ME 4XPAH 4WSGA 3RX9A 2P3YA 1E5CA 3QJZA 1AOHA 1JDCA 5KS9F 3S9DB 1TQBB 4G9FA 4GKNA 4Z3FA 3TEZA 2D73A 4R96B 3T3MB 2CWRA 3HBPA 3IGUA 4WI2A 4PCKA 4HUWA 5K59E 4K7FB 4YVNA 4J27A 5C2BH 1BYNA 4AL8H 3IJEA 3V4PA 2X4PB 4LLVB 3NJFA 4NZJA 2IDFA 2FZ3B 5KN5A 1BWWA 1QLFB 2HLFC 3II3A 5IFHH 4R4BB 2AI0L 3NCYS 1A6AB 1M71A 1FO0H 3KL0A 1P7KB 3NA9H 4LDOB 5FYLD 3HE6B 3OB8A 2OYMA 1M2VA 2HLFD 4JY6B 4FFVD 1ACYL 3K2KA 3R4DA 5EHFA 2XWZA 1NCDH 2DI9A 3TA3C 1PZBA 1A6WL 3BESR 1OGAE 4OBRA 3F05A 5EO0A 2WBKA 4CJ0A 2VXVL 1DCLA 4DAGH 3P2DA 4PJCB 4PCTA 1JAEA 2AGJL 2IPUG 5F1IB 3RNKA 1CL7I 1OB1B 4FC3E 3SKOA 4CA4A 5B1CA 4X6BA 5EZIH 5AD0B 1THCA 5F21B 4K3DL 3WGUB 1NGQH 2CUMA 4M7JH 3QBTB 3VXSD 3PWVB 4U1MB 3ZL2A 4P2QB 1VFAB 1S3KL 2OMYB 3TN0C 4CKQA 4J7RA 1G0YR 1KFAL 3GBNH 4PJXE 5T5FA 5D7JC 5FGBA 5AVSB 5L7XH 4X7TA 3ZUCA 3WIIL 1Y18B 3TJHD 1U8HA 2O5XL 3DOHA 1IAOB 3VXNA 1GGIL 2H2PD 4QOKE 4FG2A 2WM0A 1A3RL 4PJ7E 4XCCL 1OAZH 1XHHA 2AKRB 4ODTL 4X80L 3QJTB 4M7LL 4KNQA 1CT8A 1KXVC 1BAFL 4OZGE 4XNXL 3RL1A 1EEUA 3ASOB 2VN4A 2WANA 4I18A 4YDVB 3VFUB 3J7HA 1YN6B 5IVZA 5C0BA 3Q2WA 5CEXB 2ODIA 4LLUB 3P11H 4FTVE 3BEVA 3UMTA 1GHFH 2WV3A 3VXQA 4F2MA 2CK0H 4NKIH 1PKQA 1FVDB 3WFCL 3GXNA 2QHLA 1WZMA 2EDDA 1R3LB 1IEAA 3DTXA 5H94A 5I1DB 5JIQA 3UJJH 5ESAA 3WTTA 1KTLA 2QLYA 4JRXB 2XN2A 5IB4B 1E8ZA 2PYEE 3KBHE 4TNWF 4FX5A 1EO8H 2P8PB 3CHSA 3GSRA 3KLAA 5D72H 5ESAB 5CR1A 5KVGH 3VGHA 1MIEL 5D70L 4X6CE 3EJJX 5BS0E 3QDMD 4PJEB 2B20A 2E8ZA 2CM6A 4XP6H 3L7FA 2XT1B 5IW1B 3HVDA 3BLBA 4TVPE 2C3HA 1AZRA 5D6CA 3GSWA 5EOQL 3QXTA 3US0A 2C5DC 3D8MA 3MUHL 5FW6A 4I7ZC 2B16A 5DJ8B 4DN3H 2ROXA 5I8OH 5E2UL 2P8LB 5D1XD 1WJ3A 3CD4A 3NDYE 4MD0B 3UBGA 3MNWB 1NINA 4D0BA 2Y5EA 3MV9D 4JZJC 4X7EC 1KCRL 2PF6A 4KHTL 3IFLH 4I3SL 3O2VH 1P53A 5CZXC 5F71A 4K5NA 3PWVA 4KKLD 3MV9A 1ZWIB 1TEYA 3AWEA 4OFPA 5AENA 4M5SA 2BC4A 3C5ZC 4Y4FA 2YIHA 1F2XK 4NBYB 3BXNA 3WN5C 3QJFA 43C9A 5ECGA 3QFJE 1G7PB 3VD4A 1FIGL 1PZDA 5E8PB 1JMXA 2XTSA 5GGRB 1ZLWH 3TT1L 1A3QA 1XGUB 3QHFH 3N91A 5E2TH 4BD4A 1XSOA 2YKLL 1DBML 4LSVH 2NY2C 2ZUTA 3CZLA 5I1IL 5I1AA 3BAEH 1X7SA 1I8IB 4ZO9A 5CWSB 4PJXB 3VH8G 4ORZC 4LQ1A 1EZVX 5HVHC 3KXFD 1GOFA 1T5WA 2VLKB 4LEBA 4MX7B 4WV1B 2KS0A 2GIYA 5CEYB 1XGPB 4P2RE 1BFVL 4JG9A 2UZYA 5I8EB 3MRLA 3ZHLA 4NM4H 4HUWB 5BUAA 2WYZA 1YJDL 3DHUA 1ED3A 2ICWA 4PJ6A 1RJLB 2R69H 2ZXCA 5LGYA 1RUAH 3QHZH 4PTTB 4WI0A 1SLUA 1HHGB 4U6XB 3HW7A 4POUB 4ZXBA 1XT5A 4APQB 1SBSL 3PU7A 2J8UF 3GSQA 4NCC1 1VADB 5C2BL 4JRXE 1Q0YL 1JV2B 1LWRA 5ADOL 1PX4A 2CGYA 3HR5B 3MXWH 3SYAA 5B4MC 1ZHKA 1WP6A 3WXWH 5CILH 1B0RB 2R2EB 5D1QB 3MRHA 3MA9L 2H8PA 2JLLA 1TKWA 4OZIA 3II1A 3KH4A 4IBYA 4UZSA 5CJXA 2J57A 4QRRD 2Z6FA 2FIKA 2NNFA 4XC1H 3SE4A 4BQ9A 3QQ4B 3ULAB 1Q0XH 4LLAA 2I60H 1BMGA 1NCAH 3QO1B 4JKWA 1DBJL 3PWUB 3MFGB 4PLKD 3V4UH 4WEBL 2WLHA 2XRAL 3CHPA 2OI9C 2QV2A 4JJ5A 4XBEL 4XVSL 5GS0D 4JM2A 4NKIL 4R90H 5J4MA 2K9UA 2AK4B 2LVCA 1TPXB 4ZUWA 4ATWA 3N0PB 32C2A 3I6GB 1XGZA 1RJZB 3P4MB 5FGBC 1MUJB 3VRLF 1KJVA 3DA0A 3NCFB 4HT1H 2K4WA 2IAMA 4WFFD 4AT6A 1SNRA 5DJXB 1Z9OA 2HG5A 3RX8A 4C8XA 5C0DB 5IWLA 4HZ1A 3O2DH 3QPXH 3QRLA 1FFQA 2DQEH 1OEZW 5A2FA 1BGXH 4UNIA 4YDJA 4Z0BH 1UT9A 4Z77B 4ZMTA 3MCLH 4UDUA 3T0DA 4DP5X 4HKJB 1PVHA 3U4BH 2C34A 1PFCA 4OD1L 2XU9A 3LJ3A 5MEND 1CC3A 4APQA 4GLRH 2K45A 3DROB 3QQ9C 3OLDA 3ARSA 2LLGA 3PABB 4ELKB 1CDGA 1J7VR 3BUYA 3V5DA 4ELDA 2YXMA 1R6VA 3AM8C 1DQJA 3VG0L 3B1TA 3VFSB 1G9MC 1T1YA 4L0PB 2V5RA 4Y4HC 3KL3A 2FUTA 4JO8A 3TBWA 3AGVA 4OFVA 3OPUA 3MNMA 5J1SC 1G7JA 2Z1PA 4PJIA 2JXMB 3MRQB 3WJLA 4AL8C 5FO7A 1TOXA 2JKXA 2AJUL 5J6SA 1CD1A 1C12B 4XN9A 5F7DA 3ZE1F 1S9KC 3FS9A 1BAGA 3V9EA 3MX0A 4JJOA 1FO0L 2R1XA 4HV8A 4ZYKB 2DYPA 4YE4L 1IQWH 1S7WB 3PS6A 5IB2B 2I07B 5D2NA 2FHBA 2J56A 3N43F 4I89A 1RVFL 2XV3A 3S35H 4XAWH 4K9EC 4AG4L 3VRLE 4KQ4H 1RFDL 3C6LD 3V95A 4N6RA 3TU6A 1JGEB 1RK0B 1ET5A 1KLGA 1JZFA 1TJMA 3KL5A 1UZGA 2EIKB 2E7MA 1HAWA 2BSSA 2R2BB 5E9DB 2VABA 4AXWA 2H32H 1PZUB 3G08A 3KYKH 5EO1A 2NUTB 3GSUB 2YLHA 3D18A 2R4RL 2YPVL 3E3QE 3CHRA 1R3HA 3CVHB 3SCMB 1QP1A 5H2BB 4XPAL 1RPQA 1R19A 4IRZL 2MKWA 5JIKA 2RB8A 1SVCP 5DZAA 3U0PB 1LEGA 1QFWL 4NJAL 1PPIA 3PQYA 3UDWC 3T08A 1BLNB 5FDWB 3CXFA 2WYIA 1KJMA 1T1ZA 1SJVA 3VYNA 4HMCA 5DO2D 3IDJB 3UAFA 2BFVL 2EUWA 5D7LE 5GGTH 2AK4E 2UYLB 2QADB 2VXQH 3E1ZA 3DYPA 4CSSA 5JUEH 3L08A 4IGBA 3X1BA 3EJYC 1Q9OB 4ZTPL 4H2AA 1EAOA 4JFYA 3ZE1E 5C08A 3QEHB 2NY6B 2XIIA 4PJEA 2FTAA 3B9KA 5CKAA 1AHWC 4X6CF 4XE5B 1R5IA 1U2HA 4FMKA 5I1LA 1QTYT 3NG5A 3K80A 4IRJB 4Y5YB 7TAAA 3L3JA 3MBEA 3BSGA 5C70A 1NWOA 4IRSD 1L3WA 3HC3H 4OIIH 1W6LA 1UEMA 3HC0A 3IFPA 1RJYA 1YSOA 1RAMA 2FO4B 1KEMH 5T1LA 2JF1A 5L8KB 5TK2A 1NAMB 2B9BA 5HDBE 5FYJL 1RHHB 4XB3A 1Z2KA 3O8XD 2DWDA 4FLQA 1PCXA 1IARB 1AGEA 3FUEA 5TQ2H 3DNKA 2GC4C 2QR0B 2G0LA 3T0EA 4YDIL 5HHXH 1KB5L 4XBPB 3CNKA 1I9EA 1KB9J 4KNSA 2LGNA 4HK0A 4PRHB 4S0TD 3KLQA 2YMXL 2YS4A 1IAOA 3QEGH 2X4TB 3Q2LA 1FG9C 4NPJA 3T4AA 4RWYL 4N0UA 4QWWC 4NLHA 3W9DA 4BSJA 3TTYA 5B8CA 4CVXB 2V2TA 1Z3GH 1NDTA 2Q7YA 3AABA 1OCZB 1SY6L 2BVPB 3ESMA 1CXIA 3HMWH 2BVOB 3IT8D 3EJSA 4OD3H 3BUYB 3V5DB 4DCQA 4EXKA 2JJUA 4N2OA 3PPSA 4Q8BA 2K6WA 5DD3H 4WU7B 5JW5A 1LYQA 2IALB 1MFNA 4JFYB 6CGTA 1WSST 2L7UA 5IW6A 3TZVA 1JPFA 2VC2H 4B9JA 4JHVA 1J5HA 2EABA 2BDNL 3QUXD 3H8NA 1NBZA 3D2UA 3MJ6A 4X7DC 5DU7A 3TH3T 4L3FA 4QGTA 3TIDA 4TV3A 2HUEA 1BVZA 3VRJB 1M53A 1PKOA 3DJ9A 1T1ZB 1CFVL 5D1QC 1R3KA 3QCVH 4FJYA 4J3OD 3C5JA 2WP3T 1OGAD 4QEGA 1BVLB 4HWEL 3VGBA 1LEGB 2L7QA 2YAFA 3OR6B 3UC2A 2X0UA 4B60A 2BNRD 2HZHA 3BX7C 4JG0L 5D7IB 5IW1A 4RX4D 3M46A 5C0RL 5TDPB 4CMHC 4BJLA 3D06A 3R0MA 3A6CL 1MWAL 2X9ZA 1NCCH 2EDRA 1OHQA 3ECUA 3G6JB 3GXIA 4OCSL 4MJIE 4TNGA 1VZHA 3C87A 4MJ6B 2YSTA 1QLEB 1OP3K 4HLEA 1MEXH 4XNZC 2YK1H 1KEGH 2IDQA 5KW9H 3HMXH 3MYJB 3H3KA 2N7SA 4AH2A 5H94B 5I1DA 3PQYD 4FL4C 2CCWA 2VOTA 5AW3B 3VGFA 4UT6L 2QPSA 4MWFA 2DKUA 4JPWL 5A3ID 5EC1B 5CJOL 4OGZA 4I18B 3QO0B 3K4ZA 6PCYA 3UCQA 2DQIH 1KZQA 3RNQB 4WW2A 4E0RB 2BRRL 2GTZA 3A4FA 4HFUH 1GPOH 2COQA 1TZHA 2LABA 5L2KA 2GUYA 2MWCA 2Q8BH 5KBLA 3D7PA 4KRNA 2JIXB 4WO4B 3C5ZD 3QE5A 3ZDZF 2XQYK 3GFUA 2MRYA 2MHAB 1J0IA 1I1AB 3KJ4B 4ODTH 4X80H 2NZIA 1AO7E 5DJCA 1RK1B 5JTWA 1KLUA 1NIEA 1H19A 1PZCA 3DURB 3DRQB 5L88L 4I4WA 2B2XL 2DLTA 3Q2VA 4P9HL 4WK4B 1DEDA 3MNDA 4OZGB 3HEIB 4WZ9A 5BMFH 2CRYA 2VXTH 5GGUA 2Q2EB 4R7DA 1AOZA 3UPRA 1KC5H 4MRCA 4OUUB 4TPRH 4K0OA 4IKJA 3AG4B 5CD5D 4Y19D 1WV7T 3T0ED 4TOYL 4GRLA 3INUH 2VKXA 1H15B 3GRWH 4CL7A 1WAAA 4J6RL 1XTLA 1DN0A 1N0XL 2AABL 4TUOB 2CA3A 5GJTH 2HKHL 1N8ZB 5IIEA 2GSGA 2XTJE 1FN4A 1CE1L 4P49A 1OAQL 5DVPA 3MRIB 2JQZA 3SDDA 4PS7A 1CGVA 3H4HA 2NXZC 1NC4D 1XMWA 3CXDL 5JIIA 3O0LA 2BNQD 4R0LC 5ACZA 1ULVA 3IDUA 1FVCA 4UT7L 3MLPA 4NCDA 1G9NH 3SKJL 5CHNA 1FHNA 1CGTA 5E5MB 3S2CA 4DUVA 5A2CA 2BWQA 5FYLH 4J3BA 1U91A 2P8LA 3ISRA 3HZYB 4HZAA 4F7TA 2C9VA 2EUZA 2M8XA 5DJ8A 1FZMA 4ONHA 1F02I 2CK2A 1WFTA 5I1JH 2JKSA 4ANXA 1M9SA 5EFIA 1HKFA 3N1QC 2EDBA 1IAIH 1VADA 1SLWA 3WS3B 3QCUL 2ZYHA 4AQOA 4WI9A 3WI9A 1FLRH 3QIBD 2IGLA 4PJ8A 4D9QE 2EXYD 1NOLA 2OW6A 3LKPB 4GLRI 4PWGA 4DSYA 2LLNA 3WY2A 4YWGL 4W9GC 3VQ2C 1J9TA 3KYKL 2NDFA 4UNTA 1B4LA 2ORBH 1ZA3A 2ZKWA 4NFBA 3QZWB 4ZUUA 2FWOA 1D5XA 3CPUA 4BDVA 1XF5B 3D05A 3H9SE 2R8SL 1HJCA 3V6OC 1RIUH 3ME0B 3ZJAA 4MA7H 2JJTA 3APCA 4U1SB 3NK3A 4UM9D 4BSWB 3LPFA 3VFWB 1SHXA 1IM9D 2FLBT 1U6AH 1FGNH 1QNZH 4Z7QB 1ODAA 1I8IA 5L0QC 1KXVA 3L3OA 3JV5A 2FECL 4BQBA 1IGML 3MRCB 5EB9A 3VGGA 1NWPA 4OD3L 1MJJA 3QUZA 2RMNA 5DWUH 1OAKL 3MBWA 1KGCE 1INEL 1GGTA 3VFNB 5DR5H 1VEPA 4KRMB 4PHZA 5E5UB 4JAMB 3QQXA 2NY6D 4LGPB 4YZWA 3WXVL 3ZDYB 1JZ4A 3WU1A 3HG1B 4XP9L 3RWJA 3DDGA 1IKNC 5CIPH 3LRMA 1EXUB 2KERA 1DVXA 2IALA 2QPFA 2Y2WA 2YUZA 4UWQB 5FOBB 5IW6B 2YRBA 4X0NA 4QXGH 1KPRB 5F7MC 2D03H 3EFDL 2VSMB 4LL4A 4Q4EA 3CLWA 2ARJA 3SY6A 3FF8A 2PUQT 3QDGA 4XN5A 5TQ0L 4L4VA 3UXFA 2XTJB 5DA4A 1AFVL 3HB3D 4GP5B 2K70A 1FNSH 4NC1C 4XN1A 2N7BA 2PXYC 5F7WC 1G9MH 3K5RA 4JFED 1SLXA 5F7FA 2YFOA 4KZCA 3VCLA 4DVBA 3LQAL 4ZW6A 1XBRA 2WK2A 1UXSA 3C6EA 3CH1A 3DGGB 5CZVH 1KTDA 1FAIH 4H8PA 3GJEA 4KZDL 3HB3C 3WJJA 2AK4D 2DWDB 4JUSA 2UY6A 2ZUQB 1JHLL 1R17A 2JKRM 2E9IA 3GBEA 4QYAA 2WJ5A 3NZ8B 3CN4A 1RKRA 4G6ML 4W9DC 3BHBB 5I18L 3RVVD 4P5SA 2WINA 5EN2A 3UTQA 3MRFA 5KVEL 2IIJA 1B0GA 1YEHL 3GF8A 3C8DA 2GYSA 4XOAA 1KXHA 3CPLB 2HLAB 2UZXA 4TTDD 1QFWH 2VR3A 2Q76A 3IU3B 3SGKC 3O41A 5JO5B 4YHOH 2VW4A 2YKKA 1TZGH 2VH5L 4LLUA 4L3CB 2X1WL 1AR1D 4N0CC 5BW7A 3TBCA 1AGCA 2G4EA 5C6TH 2VDPB 4Z5RA 4NO0D 3FQTA 4HZLA 1J87A 2C9RA 1R3KB 4X5XA 4DGVH 3QUKB 3EOAA 4LSPL 4RMVA 1MHPL 2J1XA 4FQJL 1GL4B 2IO5A 1MCPH 1XAUA 4NO0A 1MCWM 4PJIE 1RIHL 3K72B 4XBGB 3DJTA 2GJJA 1ZS2A 3D4YA 3L5XH 3OQRA 3PREA 4NNPH 2ZXEB 1WT5C 4ZFQA 1GZHC 2B59B 2VUOA 4PJ8C 5GZOD 3ZU8A 4I3GA 4DPCX 2R51A 3ASWA 3SGDI 3MRJB 4U2ZA 5KYXA 1CFQA 3UTSA 2YO3A 1MCBA 4N25A 2EVHA 1TR7A 5JOFA 1H8SA 4AV0A 3RNKB 3FONA 3WEOA 4ELME 2AJXH 3DX8B 3QNXB 1CE6A 4PJIF 1MN4A 2EH7H 3WTSA 5E2JA 3FB5B 3ZUNC 4GRMB 4KKBD 2X6BA 3T0EB 4IIQA 4IBWA 2Z9TA 4WNSA 2AC0A 2DYPB 5DRWB 3W0WA 2F8OA 2JJVA 3B5GA 3KLSA 3D52A 5I1EL 1F2QA 1MRCL 4NT6A 3K0YA 3FCSA 3CDGA 1RJYB 3OPZL 2VLRE 4KXZI 2B15A 3J07A 3IBOA 3NSDA 4ZQTA 2QVFB 1TENA 2OSLA 2WY3B 5FW7A 1XH3B 5L88H 3WAKA 5JORB 3VYOA 4Y5YA 1SOKA 5CU5A 1FORL 1ZHBA 4ZSOB 5TPWL 5ITBH 5L8JB 1MFUA 1HXYA 4JHUA 4MS6A 4PRAA 2ZYIA 4YDLB 5A6MA 1ZHLA 2W07B 1AHWB 5ACLA 3MYZA 3DROA 2WWMD 4HC1L 2QADD 1R34A 4FL4B 3GI9H 3JVFC 2QQLH 3BWAB 3CWGA 1AQHA 4LVNB 1IAKB 4ECNA 2IGFH 1XTMA 2BDNH 1TZIB 1N18A 4G5AA 3TOPA 1VFOA 3ULVH 2QADC 1RMFL 3SQOL 1DJGA 1T66D 3ZSSA 2Y1AA 3G5YB 3RTQD 1MG2C 3F83A 3KPLA 4TVPD 4FTVD 3UAAA 2HG5B 4PUBH 3O45B 4PMFA 1BLNA 1IEBA 1YC7A 3Q48A 1EUUA 1XR9A 3GXTA 3HZKB 4ZD3H 5J0BA 4H20L 3O8XC 5EBLA 4CMHB 5AVUB 1AQDA 1JI1A 1JDDA 1T83A 4IHOB 5D7LA 1I4FA 3S3CB 4B50A 3NIDB 4QI3A 3VAEA 2NY4D 4YHZH 1NCCL 1IKNA 5D72L 3V7MA 3L95A 5DZJA 3GTVA 1V8HA 5FO2A 4M3JA 1EZVY 5EU6A 1MJUH 2DI7A 1QBML 2Z7UA 4FA7B 5I74C 2J8UA 1P7QD 2YEZB 3T77A 1TQUA 4MS8D 2ADFH 1E42A 3GIZL 5IB2A 3NZSA 4M6OL 1DQQA 1W80A 3GB7A 1GPOL 1L7IH 2VXUL 2PXYA 4HC1H 3EYQC 4LCIL 2FEDD 4L3EA 3TIEA 1X7QB 4ELMB 3F12B 1C12A 3GZOA 1JNHA 2EDJA 1A4CA 1WFJA 1KIPA 4PS8A 1HDMB 1FWXA 1RK7A 5IQ7H 1NGZB 2AAAA 4XWGH 2WMPA 5L4IA 4JDZB 5DXWA 1DEEA 4NM8L 3VXSE 4ZX4A 5GISL 1I8KA 3EUDA 3FB7A 3LY6A 4KQ3L 4F9LA 2WBJD 1BXUA 2DRUA 5I9QC 4AEIL 4KUCF 5FAAA 2OMTA 3E8UH 1IGTB 3TBVA 5FYKU 1P9MC 3ZXAC 1M1XB 2D7OA 4X6EB 3ARWA 2DQ6A 2YC1A 4ODWB 5DS2A 2CLZA 5BMFL 5F7HA 4UV4L 3BSZA 1MHEA 5CEZE 5HHXL 5HHOA 3G5VB 1FAKT 1BVKB 4D0DA 4EKXA 5DO2C 1PAMA 4YDJB 1QSFA 1T5XB 3I74A 4B0MM 5C0DA 4RQQA 4DEUA 3AXLA 2R23A 4QXTB 1X6LA 4JO3L 3G6JE 1IC1A 5GXBB 1Y07A 1U3JA 5A3IC 4MNQE 2NY6C 2YUVA 2FBJL 3R8BB 4FQQA 5HHMB 4JKPL 3IAPA 3BRGC 2X1OA 5ETUB 3BKJH 4MJ5A 1ONQB 3L81A 4GRWH 2AJYL 4Y4FB 1P5VA 3FL7A 3AACA 4ETYA 4KK5D 1A9BB 5CAYB 1IQDB 3UYPA 3I9IA 1M3IA 4EI5B 1UJTA 2XY1A 4TM9A 2VZOA 5JW4R 4GO9A 1RUPL 3MLXL 5JPMB 2MQ3A 1QFUH 5BCAA 1XGTA 4OZIF 4WDIB 5DHVB 1QHPA 3BVXA 2ZONA 4MNGA 2R56H 3CFBB 3FT1A 2YPKB 3A23A 2L0DA 1HE8A 3BISA 4A7SA 1OP4A 4EI0A 4AIEA 3EYOA 4R9HA 4QWWD 3D85D 1VDGA 5KSBE 5T3XL 3OLEA 1DANU 4P2OB 1F4HA 3OL2A 2XXFA 2VDQH 4KTYA 1CI3M 5C0GA 1ZPUA 1Z9SA 5I0VA 2IAMC 1I9IH 4FKEA 2AFNA 2FBRA 3HNVL 2V9RA 3K71B 2PO6D 3HE6D 1XEDA 4HOMA 2IBZY 2O4EA 3PWJB 4WU5A 1U8QB 1BYPA 1HZHL 1VF5C 5DD3L 1ZLSL 5INDA 5DHVH 4FI6A 2AITA 2DBJA 2OMXA 1NPNA 3LZRA 2PPCA 1T5WB 4R90L 4F2MB 1R5VB 3NSCA 1NIDA 5E6IC 3NH7L 5BV7C 4PJXA 5TD4A 3WD5H 1OL0A 4D3CH 3QR2A 3BQUB 2HVKB 4HUXB 1NCWH 2I24N 4HGWB 1KGWA 2AKRA 3JV4A 4H2CA 3PWLA 4FP8H 4WVRA 3EDEA 3S2AA 3P77B 5T1MB 4PW4A 3ZKQD 1J5IA 3KWUA 4JHWH 2PP9A 2LV4A 1KJ3H 4XWOD 2VCOA 1VFAA 3MGOB 5AKRA 1QUNB 2LR4A 2OP4H 4PJ5E 1AGFA 1A7QL 3ZX1A 1LK2A 3EJRA 3RY6C 4FNLH 4KX7A 4LKCB 2PPFA 2WZ6A 4MDJA 5IT2L 4JFXB 2Y24A 4B95C 3QIWB 4ANKA 1TPXC 1WHPA 2PYEA 2OBGA 4LEEA 1ETZB 3C5XA 1ADQA 1BZ7B 3HRPA 2QDWA 1EH9A 2BVYA 1GOGA 3NTCL 1SN5A 3FRUB 4JFQB 4Y8AA 3UPAA 3TBTB 3K8LA 2XWRA 4HP5A 5AW5B 2F7IA 4ZO7A 2EC8A 4MCZB 3IMWA 1IMHC 3K6DA 4E9VA 4LSQH 4HK3N 1HN1A 2OQJA 4LCUB 2XNAA 3DX4A 4PGCA 4EI6A 2DYPD 5MEOA 3ESPA 4O51B 4KUZL 1SRDA 3GXFA 1CIUA 2X89D 1NCUA 2Y3NA 5PCYA 2WKOF 3N41B 1CLYL 4L37A 1I31A 3DWTA 4H8QA 4PJDB 3TVMB 2AQ2A 1RULH 4YFEA 4BA0A 2Z3FA 5JHDB 3MV01 1N4XL 1RL1A 2FB4H 3I6LD 2EP6A 5JMRA 5I1JL 2D7TL 3TBYB 2H6UA 3BD5A 3C9NA 3IEAA 2NT0A 1IGJB 5I6XB 1RERA 5G5DA 1W0YT 3HKZA 2VQ1B 4H8UA 3GZPA 3Q8EA 3B2VH 4LKCA 4RWHA 4TNEA 2GBAA 4AYEC 1A9BA 2JQAA 1X4XA 5LGHH 5TE4H 3GM8A 1AAJA 1ECYA 1P5VB 3ECBA 4OKVA 2R0WH 4NZFA 1JZ6A 1TETL 3L3IB 4RDBA 3ZKSD 1WZLA 3US1A 4JG5A 1IE4A 4I0CC 5T1MA 1UZ6F 5EU5B 1KCRH 1BEYL 1UGNA 1OAUH 3ESUF 3OJVC 1QASA 1E28B 4GKSB 4WAFA 4ABWA 1W72B 2X9WA 3MLTA 4KJQD 4BWTA 1FNAA 4NRXA 4D9LL 2EZ0D 3RWFB 2A0LD 1ZA6A 5AD0A 4Q9RH 2B7DT 4LRIA 3S7GA 3BGFC 3CSGA 3NSJA 2A5UA 3OB0K 3KCWA 4POYA 43CAB 4ZMXA 5H37H 2IFFH 1QEWA 4JRYA 2JMRA 3FUFA 5FYKE 1I7ZA 3MCKA 1GIGH 3QDJE 4ZO8A 3WFZA 4ODXA 3O6FC 4A7GF 3EO1A 1BZOA 5DVMA 2VZ1A 3SBWC 1Z9SB 1PF3A 5CJ8A 5CJ5A 2XBDA 3SDAC 3G5ZB 3BAWA 1EUTA 4QHLB 1UWXH 4XCYA 3U48A 1QFHA 1W72H 4JFEB 5I73C 3VG9C 1X5GA 4NCC2 1BJ8A 4YHIA 4ZX6A 2WB1A 4NYLA 4ZFFA 3LKSA 2R69L 2D3VA 4XN8A 3RWIA 3KVPA 5FUZL 5HD8D 2P5EE 4LPUA 4U05A 2E86A 2AABH 4UYPA 1JNLL 4M93B 1FV1B 3RJDA 4GBXA 4ZFZB 5IJDC 4M8QB 4IOSA 4X83A 2OPCA 2GUOB 2BSBA 5KSBA 3BUQA 5L7XL 3KVDD 3QISA 3FFDB 2G2RB 2EACA 5ISZA 1ZV9A 2A2QT 5I1HH 2MKLC 4APXB 3BKYL 5B38A 3EOBB 1I1CA 3QJQB 4IIQC 4JVWA 4IU2A 1JF5A 1UA6H 2Q7AA 1HXKA 4GSDL 2AQSA 2C4FU 5CIPA 1ORQB 3DRTA 2IPKA 4ZOBA 4AYGA 4NERA 1PDKA 5TF1H 5A16A 3BVUA 4Y4KA 4LBAA 1MWAH 4P57B 2L7JA 4MSWA 2B1HH 3ARDC 1SJHB 2OV0A 2VISB 4N9GB 1K8DA 2DQUH 2D7NA 1DZBA 3BKCH 4XH2B 1NCDL 3K2UL 3BGMA 1K4CA 3HZKA 5SWQB 2R59A 4XMVA 4MQXC 4LCYB 3ZYJA 2BZ7A 3LAFA 3VFOB 3JVGA 4OQTH 4ZUVB 5KSAB 1YDPB 2F61A 2NZ9D 5FF6A 3RWHA 1JP5A 1OW0C 1TZIA 2HJLA 4P4KC 5AOJA 4OQTL 15C8H 3UTPD 1UTDA 2VLRB 4GEJA 4B9GA 4N90E 4E2OA 2QFPA 2XZAL 1Z5HA 3T0XA 3LOWA 2GJRA 3C8KB 4PWJA 5L8LB 2EO1A 5DD0H 3EFFA 2YSSB 4JFHE 5IMKA 4HK3J 4ODWA 4HIHA 5FYKD 1SXSA 5KVDL 5JORA 4D7BA 1AKJA 1EZLA 2H5UA 2R83A 5DK0B 4Z3TA 4I1NB 1A6TA 5FM8A 3TO4C 1KGUA 1OSYA 2CXKA 3CIQA 3CQPA 2VAAA 4BYHA 3BFOA 3QUML 2ATKB 1MY7A 2EE2A 1P4IL 4YBQD 1RZKL 3KDMA 3ULVE 3ZL1A 1T22B 3GK8L 1NGWA 1MFCL 2Z34A 3AU1A 3F2LA 4JFFE 4GAGL 4BE6A 4OJEH 2WUBL 1KIPB 1QSZA 1QI3A 4G9FD 1OM9A 5KVEH 2Y23A 2LFGA 2K8QA 1Z1WA 2WYTA 1SFDA 2YEZA 2CCLA 3UZVB 3B4NA 3PV6A 4M9OA 1E6JH 1X5HA 2E6PA 5DTFB 4PJ5D 1D5MB 1HCYA 4N2AA 3SBRA 4KX8A 4QRFA 3G6DL 3O3AA 5LNDA 3W57A 1MCLA 3ARRA 3SPVA 4RA0C 1W16A 3DGDA 3ZDWA 5ITBL 3IPEA 2NW3A 2BS9A 3BT2H 4L8BB 2J8UE 2XQ0A 4YNYB 3LKNA 4LVOB 4Z78A 3DBXA 2B59A 1ODUA 3UO8B 1FNSL 1VENA 2C7UA 1TNMA 4WY7L 4UTCA 1J18A 3ZLQC 2OP4L 2BINA 2ZKXA 5FHBL 3TASA 1CDIA 1KJ3L 2GG1A 3NRFA 4X5WB 2EDLA 1SY6A 1BDYA 3KEDA 1F6AA 1KG0A 1B3IA 1DJHA 5BO0D 1E30A 2QMKA 3RFZA 4YDZA 4A67A 1I8MA 2WQXA 4Q6YA 5B39B 2ED9A 2D31B 3SKMA 4HW6A 2PW1B 2PW1A 5I82A 4KI5E 3MJ8A 3RWDA 3D25A 3RQ3A 4GIAA 5B39A 1LHZA 3PL6C 1I9JL 1C16B 2CO1A 1DL7L 3EHBD 2ED7A 5BV7B 4YIQB 5IJKA 2ZP9A 2R4RH 2YPVH 3BO8A 3GLAA 4PRIB 4V1DA 5CP3H 5TFSL 5KJ7E 3NA9L 3P4OA 1ZVYA 1WICA 4AIZA 1I1AC 3TVMA 1XH3A 4GOSA 3LD8B 4DT2A 1ZLSH 5GPRA 1IL1B 3RWGB 5L6YH 1YMMB 1N59A 3BIBX 2HX8A 2X10A 4FDWA 4EOWH 1D7BA 1IEHA 3LIZH 3GHEL 3CDGB 5MEOB 4PJHA 1OAZL 4WF7A 2IPUK 3CBRA 2FE0A 4P2RA 4I18C 4L8SA 1I9IL 3QDMA 4KPHL 4D7PA 5DFVC 3QIUA 1HEHC 1FZKA 5ITFA 4GMTH 4I0KA 4YQXH 3ABLB 1D5MA 3ETTA 4JFQA 4KVCL 4OM1H 1ADQL 4OGAD 3ZL4L 3TEYA 4P2OC 4FYQA 5KZCD 1TQCC 1DE4B 2WO2B 2RQEA 2AJUH 2VH5H 1DVYA 5AYTA 4DETA 1S9YA 4JM2D 2ZAIA 4IMKC 4RBPH 2FX9H 3ZE1B 2F1BA 3OMAB 3ULUE 5JNYA 5CCJA 4OT1L 1FL5B 3BE1H 3P4LA 4QRRB 3MLUL 2V17L 1U8OA 5K69A 1OAXH 5HY9B 5I1GL 1EFXB 2W9EL 1QUNA 2HX9A 4OLVL 5C09A 4O4YH 1QFUL 5J9PA 5GSRA 5B21A 1QKZH 2VRQA 4JY4A 2DL2A 2QGEA 4NGHH 4XGZB 5EF1A 3Q1EA 1J1XL 1AANA 4PGBB 4L29B 5JIHA 5J57B 3MRJA 5DC4B 5EIQA 1VFMA 2XICA 4WY7H 1EEYA 5FUOL 1IIIA 4P5MB 4L1SA 5JXEA 5FKAA 5I1CL 1U8KB 1YYCA 3ATAA 3O6LH 4W6WB 1GAFH 5AWNL 4PYHA 3HG1D 3FDWA 1JF1A 3JWNH 1BQKA 5E2VL 3WUWB 1UXWB 4N5ED 2G75A 4N86A 3MRCA 5KVFE 4PJCF 4OF0A 3JT0A 4BK5A 3IAQA 3CU7A 1ES0A 4M3KB 1U41A 1B2WL 2VR9A 2WQRA 4Z8FL 4QCIB 1LILA 2CQVA 4M6MH 4UQ9A 2Y22A 1A6UH 1K9TA 4KFMA 3EYVA 3GNMH 6FABH 3WL9A 1N9PA 1PQZA 4I77L 2DTML 4MXQC 5KYNA 4F9PC 3D09A 3THML 4L4TB 3FW6A 4A2GA 1HOEA 4NC2B 3NEXA 4TUJB 5CFHA 4U1GC 2GHZA 1JK8B 1IC0A 1WZ1H 1E9QB 4Y2DD 3UZEC 4MJJA 2VDOB 3UTQB 2Q6WA 4KK6D 3ECWA 4BXVA 1EV2E 1MVYA 1AC0A 4A37A 3L4ZA 3FT9A 4FNSA 2R0KL 4HUCA 3CUPB 4YXLH 5FPIA 1XD0A 2VERA 1UZ8B 2B08A 4WCYH 1PLGH 3OAUH 3ARBB 5BVJB 1FZMB 3IDXL 4ONHB 4JFFD 3TO4D 3UBXA 4CADA 4B5EA 1QRND 3KGTA 4IJTA 1D6VL 2W88A 2Q86B 3GJEB 1IZJA 4WI4A 3I9AA 3WENA 1J1PH 4PRPA 1KYOJ 4PJBB 4HFWB 2R69A 3OX8B 4GIPD 3P69A 4BKLA 4K7PH 3V7AE 2ALAA 3GLZA 2ICEC 3KYAA 4TLKA 2C8NA 1KNOB 2NXZD 3WNNA 3ULUL 2FJFB 1WH0A 2DYSB 4DZ8A 1CGSL 2E9BA 4HJGB 4JM2F 2KL6A 4AYSA 1HWHB 2AV7A 5JXEC 3N06B 3UOAB 1A5FL 5E24E 4GIOA 5L4MA 3ZYOA 3OVUB 4BH8B 3M1BA 3RIKA 4ISVA 4JFDA 4UQIM 3RUGF 5AQ0A 5KW9L 3C5SA 3KCPA 5F3FA 2I27N 2APTA 4MZRA 4PJAF 4JGMA 1AACA 3IJ9A 3RA7H 5ALCL 1O9VA 5DQJB 4NZDA 5IWLC 2EH8H 5EOCH 5FKPA 1IAIM 5E1IA 3SE4C 1FO0A 2ZKYA 2A83A 2VZSA 3O8XB 2J72A 3SE6A 1OPGL 1SGKA 4B9ZA 3L3DA 5FYLL 1MDAA 3ME0A 1X5YA 4HF5H 4JO1L 4U49A 3JVGC 5GSVB 3QZWA 1IFHH 4MA3B 3DHMA 1BGXL 1OV8A 2KKQA 3BOVA 1M05B 3L9BA 1PG7L 1OW0A 3L1OL 1R0AH 3D0VB 3DURA 3K3QA 1REIA 4DPBX 1QLEL 2FWOB 4BDVB 4PJAE 3H2WA 1Z5YD 1UWGL 3OAYK 4G8GE 2J2ZB 5J12C 1TJHL 3F6JA 1URLA 3WS3A 1DJSA 2CUAA 2ZOKB 3KBFA 5H8DA 3SB3A 1W72L 5AOIA 1J8SA 1SYSA 1L3NA 3H56A 3B9EA 2D9QB 4X8XA 5GRJH 2QKIA 2WXQA 3HMWL 2A9CA 2DQCL 4OZHA 2EVJA 3LD8C 2NY2D 4P2AA 4WGKA 3LNGA 1AI1L 5HTSA 3ZN6A 2P5PA 1UG9A 3N6YA 4XI5D 4HLZH 4MB5A 4AMKL 1OGAA 3GO1H 3UTZA 3FQRB 4PJFF 2P47B 4GUCA 4LSVL 3U1SL 2BNRA 3V6OE 2XVKA 3B5HA 5KSUB 1MIEH 5D70H 2BS71 3FT4A 1QABA 2FR4B 3A21A 3MTXA 2VR8A 3GJFH 1VHPA 3KYMA 4LXFA 1E7VA 3OGCB 2FEEI 4FS0A 4O2EA 3ZDZB 3K6NA 3QWRA 4PJBE 3V4VB 1F3RB 1AE6H 3VFPA 1A6PA 5D7EA 2HRHA 3MOAH 3MRIA 2APFA 3TXAA 5D7IA 3K46A 3FQUA 1G0XA 3EF4A 4RX4A 3DV6A 1L7IL 2AJ3A 2VXUH 4JHAL 3MUUA 3QUYA 2ZKHL 4XNUL 1PZSA 5E2WL 1MPAL 2DMHA 5HDOA 1YO4A 2EXYC 1INQA 2GK0A 3V0EA 4K7PL 4MGXA 3QDJB 4HFUL 4OZGF 4AZ8A 3O45A 4WTQA 3OTTA 3A6BH 3LN5B 1PNCA 1E6OH 3BAKA 4E41D 4MTMA 1CZ8H 5K5YA 5CGBA 3TN0D 4IGBC 2J8OA 3WEXA 1GGIH 1U8JB 2VB5A 3CFQA 3HZVB 2MQGA 2G60H 3X13B 4E42B 4UMGA 1F42A 1MFMA 5ALBH 2NZ1A 2VO8A 4BH7B 1FIEA 3WIFA 3QR1A 3OG4B 4TL4A 4OD2B 5LGJB 5F6HJ 4M7KH 3MNZB 2CJUH 2FB4L 1ZHBB 1RK1A 5G55A 1U36A 2V2TB 2J25A 3EHBB 4ONGL 1NSNH 1RZGA 1WYJA 1EO5A 2PPAA 4J23A 4HHGA 2ZOWA 1JN6B 3FMGL 1A7PL 4ODBD 1YEWA 1OM3H 3T3MF 4N2GA 4OM0H 3JV4B 1DO6A 5EZOL 3OKNA 5HPMA 4C55A 5C08D 3T8XA 2YHGA 4KVCH 4OM1L 1JZ7A 1MZYA 3DMMB 3FB6A 1DBAL 3SBWA 2XWXA 4NKOA 4LP5A 2WBJC 1YYMH 3FFOA 1FVEB 5DJ0A 3MBED 3N1MC 2ITEA 2Y6SD 1MRFH 3IJSB 2HRPH 1IU1A 2VDKL 4P5TB 1RZJL 3NJMA 1U8QA 3WTYA 2IG2L 1FAIL 3ZMEA 4HUKB 3QZPA 1DZ0A 3O3BB 3K6SA 4KHXL 4AK2A 4IRJA 4NUPA 3HS0C 3G6JA 1XCXA 4P4KB 2Y1VA 4X99B 3UYOD 3B9KB 1P4UA 4FHJA 3R4RA 1D9KA 1Q9KB 2IOMA 4HKXB 3LEYL 2JI3A 2RHEA 4LAQH 3HMXL 4NGHL 4A2DA 4WEEA 4OF3A 1BQ5A 5HVHB 5MHSD 4Q58C 5IGXH 3ZO0A 2Y5QA 4N0FA 4RRPM 3V52H 4YH6A 3T2LA 5JHLH 2CKBH 2H9GB 1SF3A 4Y2NA 4KDTA 4QXGL 3FQWB 5KSVB 3NJVA 1NLBH 2NTFA 3N43B 3OWRA 3O3DA 1SLVA 5ICZB 3QB7C 1QSVA 5IQNA 3CFBA 1KCLA 2PTUA 2BWDA 3JTTA 3F7YB 1VFBB 2O5NA 5BZWA 2ZG1A 5F88B 2A6IB 5LG1A 3VFMA 4KGJA 4AYFA 3ILQC 4BSVB 1XGQB 3S98A 3RPIA 4WHCA 3ORJA 4JANB 2P24B 3QUXA 1X9LA 5L0QB 3RB7A 3B43A 2YXWA 1ZTMA 4M6NL 3OXRB 1HHKA 1AYOA 2Y0SA 1FRGL 4WU7A 1BG1A 5ENWB 2VDKH 3SYQA 1S8DB 1CG9B 3FOMA 2P5WD 5ETUA 4Z7OF 1U8OB 4CGTA 3QFJB 2BVPA 3E7JA 5HVFB 4F91B 5BRZA 2O5XH 2FYYB 3CXHJ 2XA8L 3KLDA 1I1YA 4IEFB 3D9AH 5ADPH 3OC5A 3V55A 1CVRA 2H6OA 1NPJA 3T1FA 1WPCA 4LPCA 1F90H 1L9SA 3UL4A 3FT3B 3QJXA 1IAII 1YMHB 3DV4A 3DV4B 3RIFK 4F8TA 4PM1A 1QSFB 3BI9X 1U58A 3A22A 4AITA 4PV9B 1A14H 4UIKL 3QEQA 5HHOB 4L2LA 4P2RB 1PG7W 3MCG1 4JO4H 4V2CB 3LPWA 4PJ7A 4ES8A 1EEZB 5HYJD 2FL5B 3PL6A 3QEQD 3VTTA 1SOQA 4LSQL 3HS0A 1TVHB 1AR2A 2CDFA 2TSBA 1XL6A 4KVNL 3QEHA 4MXVF 5C08B 3U4EB 5BXFB 4U7SA 5IFHL 5CR8A 2OCJA 2VDRL 2YMTA 4BUQA 3AS1A 5BW7C 2NXZB 3RVWC 4GNKB 1M6OB 1WUNT 3CZFB 1PY0A 5HHVH 5F88A 4IBUA 4Q6IC 5HGBA 1AP2B 5IT2H 3NUKA 1ETA1 4ZUSA 3D33A 1BREA 4MBOA 3SOBL 4KUCD 1YJDH 1KG0B 3QG7H 4NQSA 1TXKA 3KPSE 4F7MB 4XP4L 5F9OH 1YNTA 3S5ZA 1ZTXH 3R18A 5B3JE 3V0JA 4LEXH 2DN7A 2XG5B 2C9QA 4Z7VA 4XMPH 1NDGB 2J12B 5F1NA 4PR5B 1DBKH 3ZMNA 3A4DA 5FK9B 3GK8H 2F15A 1U8PA 5DEGB 4ZUUB 2B0SH 3KPRE 5AW9B 5SWZD 2ZWZA 3T6ZA 1OARL 3NCJH 1VRSA 3MJ9A 1I4FB 3NQKA 4HJUA 1ZT1B 1QG3A 3V0VB 2QSCH 2HRGA 4LCWD 2DWYA 4XPGH 3AAZB 5LAXA 3SJVE 3HE6C 4OZIB 4LF3B 1S7WA 4FOMA 1L0QA 1OF2A 4RESB 3IMRA 1RLBA 2IGTA 3WG7B 4BFIB 5DJ0B 3GSNA 1X5ZA 4LHUA 4M5YL 4UILL 4GEIA 3QIUC 5DZLA 5F1SA 3ZMRA 1IGCH 5FCUL 2JXMA 2GBVA 1OWRM 3HE7B 3RGVC 2BNQA 1MCWW 1D5BB 4PVMA 5DD6A 3BWAA 4XT1C 1CD0A 5ABAA 2YQ2A 2GJZB 1IGIH 3VFTB 4XNQB 3Q1SL 1UD5A 1AXTL 3LNFA 2YPVA 2ZOKA 4ZNEE 1QBMH 3BLKA 2DQTL 3V0DA 2ADJA 4ICWA 4NWUH 4X4YB 3UC0H 4RGNC 2C9AA 2EYRB 4Z76A 3G04A 4KU1A 2ZIDA 2HTKD 4DUWA 2DMBA 3QIWC 1OPGH 2UZYB 1U3HA 4D94A 5B3JF 2GEQA 2UZPA 3HS0B 3KHQA 1DJZA 3ESNA 4U3CA 1XF4B 3DXAD 4NKMA 4XNAA 3NBNA 1AMXA 1EVTC 4K73A 5FB8B 5EDSA 5B1KA 1HXMB 5EU3B 1FL3B 1U8JA 4Z7WA 4C57C 4WNQB 2EUXA 3MA9H 1H15A 4OD1H 4LO9A 3OKDB 4FKHA 3RWHB 1O5PA 1P2CB 3IRCA 2R29H 2Z35B 4GRMA 1E67A 5F9DC 1UADC 4TLSA 5EZLA 3LN5A 4I1RA 3O9WD 3R7RA 1CZ8L 5J11B 5E00B 1CU4H 1FE8L 2A0LC 4ZI8A 2HVBA 4ISVB 3CFNA 2XSKA 2Z7YA 3PDDA 3BXNB 1DQDL 2NY5H 1RUMH 1IBFA 1S7VA 1I1YB 1YJDC 2F8IA 3IDGA 4IEFA 5SWZB 2D7PA 3KE0A 2I69A 3OKEB 4NHUB 3QFJA 3DK0A 1T03H 4JFOB 1JTTA 4XPTH 5C0NC 3ZZSA 1ZSDB 4LPXA 5GJTL 4LCCA 1I3UA 2DPKA 2D7QA 5DJCB 5I30L 3K7UA 4JFZL 3RAJL 5HVWA 1IGYB 3QA3B 2N59A 2Y07H 1NMAH 4ENED 2MHAA 4MNGE 5I2IA 1PLCA 3RUGA 4XVOA 4WFFE 4DPRA 4L3AA 1YYLH 4XRCB 2GTWB 1MFCH 3X2QB 2E4FA 3UTZB 3KAAA 2I60L 4Q89A 5TDOB 5BZWB 3VGAC 3STLA 4BFFA 3QCTH 1AGCB 1H5BC 1XGRA 3M1CA 2BM3A 3A0OA 3G9AB 3CVIL 4L5FH 3HRZB 1MCFA 1HL4A 2MCPH 3E8VA 2ATPA 4K9EL 1I7TB 1LP9A 5F97E 4J2XA 4EQ3A 3ES6A 4WFGE 5IVNA 1WIPA 1B4TA 3K2MC 3U4EA 1ACYH 5DMYA 3WIHL 5DHMC 5ISZD 1P4BH 2EIZA 1XIWB 2K9FB 1D9KB 1NFDF 3CFKB 3H54A 1KTLB 4JRXA 2YGQA 2EAEA 3AZUA 5TTRA 4GG6B 2BY2A 2J20A 3TPUA 4KJQC 9PCYA 2ATAA 1EEZA 2GABA 25C8H 4FFTA 3W9EA 2C26A 4KXCA 3B7SA 3WS6C 2VLKD 3L3DB 3HAEA 1YVLA 3O6LL 4A39A 2A9ML 2N0MA 2YBRB 2WQUA 1GMEA 3VCLB 3BJ91 3TNNB 4OSUH 3VXNB 5D9SB 3KW7A 5I1AB 4XNBA 4P4RA 4DN4H 1U2CA 1KCSL 3S36L 4RDQG 3ABGA 2G5UA 2IQAA 4CN6A 3P9MA 3ARED 3CFEB 4L4JA 5BRZB 4PJ9B 3PLYA 5C3LD 4HPHA 1E4XL 4J3WA 5JLZA 2EINB 1QACA 1P5UA 3ZDYE 1CF8L 1LD9A 3FOMB 3OAYH 2KZWA 3H2QA 2EVIA 1FIGH 3HMXA 3OXRA 4FNTA 3X1GA 1MCOL 4WI6A 4HYTB 2WVVA 3O4LD 4PJCA 4QY8B 4QIRA 2WWOA 2MPVA 3UTSD 1NKOA 2YN5A 1COBA 3K6OA 4X6CB 5DJ2B 1RPUA 2BP3A 2NOYA 3ZYIA 2A6IA 4ZRGA 4AYFB 2V5SA 2ADGB 3PG2A 1S5HA 2BIQA 2PCFA 1S9YB 3S3JA 3CSBA 3L5WB 5EUKB 1F0LA 4NQVA 3WLBB 1RU9H 4DKEL 2ZZUT 4M5YH 3UP1A 3L1OH 5BVJA 4GW4B 3GMNA 3BWUC 5HHNB 1NCBL 1UKTA 1UT2A 3WAJA 4YE0A 1FCCA 3B2PA 5KYYA 4WNJA 2ZAGA 1FFTB 4K7FA 3DO7B 4OCYL 3BT0A 2Y6TE 4PJ7F 3L7FB 4KDWA 5ANHA 1QPPA 1Q9KA 5T3XH 2XUWA 5AB9A 3Q6FB 3UADA 4FNPA 4CVZA 4JZNA 5I74B 3AS2A 3W3BA 3DX7B 2FSEA 2I9LA 4J3SA 1MF2L 4P5TD 4XMLL 3KM2A 4KK5C 3BYTA 3RRQA 3LNHA 1OZUA 3VRIB 1M57B 5EZJB 5FYJE 3BO8B 1HNGA 1PQZB 2B1OA 3N0AA 1RZJC 4QO1B 1HH6A 1YN6A 3MN8A 5C0BB 5CEXA 2KZBA 5GHWL 1UWEH 1FVDA 4XAKD 4D9LH 4KKCD 4PJHF 5FHBH 3QARA 5FO8B 5D1QD 4WWOA 4LFHG 1YQ2A 4DW2H 3HZYA 2UZIH 2C1OB 4MAUL 5BQ7B 4CRPA 1ZRUA 2R7EB 2UY7A 1ROCA 1AGFB 2Q8AH 3T8VA 2ADGA 2AF2A 4QTIL 1NBYB 1QHOA 4HJSA 3CU1A 1BIIB 4XNXH 3T0WA 1UWFA 3CVHA 1U8HB 1MAKA 4B3EA 2WCPA 4S1DC 2AK1L 4KZ0A 1KOAA 4LVNC 1W8NA 5IJKC 5EBGA 2PTVA 5HD8C 2FH6A 3L3HB 3OC8A 4TSBH 5E6RB 4KDVA 2DD8L 5EO0B 3DX2A 4WHYG 4QRRA 1V3LA 4HGKC 3PWNA 5E8OA 5F0LB 5IB1A 1OM3L 1N5YL 2V17H 4PG2A 4QRSB 2EE3A 1U3NA 4W93A 4XC3H 2Z8VC 4L8SC 3BZFA 1N5YH 1BMWA 1KY6A 2GSIA 2XFXB 1N12A 2D2OA 2XWJB 4ERSH 1FGVH 4UI2A 3WHE0 5DC2A 1QLFA 1RCYA 5BVPH 3FPXA 5IGXL 2X0VA 1INQB 3PJSA 1HFUA 3DUSA 3DECA 4LQFH 2HKFL 5DJYA 1UQSB 4NLAA 4B41A 4ONFH 1S7RB 1NICA 2FLMA 2VQUA 1P84J 4H0LC 2L3BA 1IE5A 5EU4B 2ZCKH 2JJSC 5C2UB 2JJSA 1XB8A 2VAAB 2XKNB 3GS7A 3V4VA 5CGYD 4JDEB 1YAZA 3MJ9L 1YMMA 4H0GA 2EDNA 4ELKA 4WHYH 1PU0A 4XHJC 3TA3D 4ZSOE 5B1JC 1D9KC 5JQ6L 3NABH 1ZGLP 4HIHB 3EYOB 2DWXA 3GIZH 1CQKA 1YYML 3E6FB 3F01A 2JIXA 4WO4A 4E36A 4XR8C 4PMEA 5AW8B 5LHDA 1XGTB 3DO4A 1MHCB 4MQ7B 4AOFA 3LRLA 3EYSL 2D31A 3SKMB 4G2AA 1LO5A 1UD3A 2XWEA 5E4IA 3P3RA 4YGVB 5E8DL 4HD9A 2N56A 5DUPL 4OJFL 3HI6L 4X5WA 1NH6A 4XMLH </