2CR0A

Solution structure of nuclear move domain of nuclear distribution gene c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
GSSGSSGKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear migration protein nudC
publication title Solution structure of nuclear move domain of nuclear distribution gene C
rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cr0A00
2MNWA 2N3JA 1RL1A 5DS1A 1WH0A 3QORC 4ELDA 2Y22A 4M5TA 2JKIS 4MJHA 2KMWA 3N3EA 4ZJ9A 2N0KA 2XCMC 3VQMA 2WJ5A 4YLBA 4YDZA 4YLCA 3VQLA 3L1FA 3QORD 1WGVA 2Y1YA 3GLAA 3IGFA 3QORA 4PBDA 2RH0A 3GT6A 2CG9X 2BOLA 3Q9QA 4M5SA 5DS2A 3AABA 2Y1ZA 2WJ7A 3L1EA 1SHSA 2KLRA 3QORB 1GMEA 4RZKA 5LUMA 3EUDA 4I88A 3Q9PA 2K8QA 1WFIA 3GUFA 3J07A 1EJFA 4FEIA 4YE0A 4YL9A 3L1GA 2O30A 4PCKA 3AACA 1X5MA 2CR0A 4JUTA 3W1ZA 4JUSA
chains in the Genus database with same CATH superfamily
1WBZB 2XX0A 1D6EA 3AS2A 4LPXA 5EZIH 4FYQA 1PG7W 2E56A 4E41B 5FCUH 3DX4A 2XWRA 4LFHG 2XN2A 4H88L 5FLUA 1ZV2A 3B6SB 4Z18A 3PL6C 5T3XH 4PVLA 2JFCA 1FFNA 4JFSA 2BHZA 3UBXI 2YOAA 3NRFA 2GJ6E 2JTDA 1KDJA 4EE2A 2NY4D 3K4AA 5B8CA 1CR9H 2IMNA 3DK2A 4M6OL 3FO1B 3CSGA 3CLEH 1IBFA 3K4ZA 1BOGB 2F54B 3F7YA 1QPXA 3QFDB 1GYCA 5E9DB 4WI2A 1U30A 4L05A 2DQGL 1U3HC 5KVMC 4WFGE 1J1OL 3ARFB 1P5VB 3G3LA 4ONGL 2UZPA 5J0BA 4S1DC 4HUUB 1TCMA 4KFMA 1NMBL 2ADFL 1RZGA 2K1MA 2VGLM 1PDKA 4GXUM 3MLTB 4FFZH 2ZOWA 3HHSB 4P2RB 5D1XA 5CLZA 4DN3L 5I0XA 4M8VA 1E4JA 1MDTA 1URLA 1U95B 1AQDB 2WSPA 3TESA 2CHWA 5F88A 4NPJA 3NIGB 2IAND 4ZMAT 1TCRA 1X9LA 3AS1A 2J6EA 3BH8B 1I82A 4FQHA 5B1AB 3HMXH 5AWNL 2FIKA 1A9VA 4NO2A 4AG4L 5KAQG 4LKCA 2B1HL 4FLHA 3VFNA 4YZWA 4XNDA 4M48H 4OQTL 1L0XA 3KDMA 3VGAC 4HUCA 1XIWD 4NC0B 4NKIL 2XXCB 3TEXA 4YBLB 3LV3A 5HHMD 4Z95H 2WIIB 4KNTA 4MNHB 1WSST 2XV3A 4B6ZA 3KPNB 3CFDA 4K7PH 5C2BH 1KBGL 2XLLA 2YAMA 3T6WA 4GPVA 4KO7A 5KVFH 4K3EH 3EG9B 4I87A 2JVUA 4K23H 4ZXBA 3VXOA 4QF1B 1TVBB 2C3GA 4BSVB 1C1EH 4N0YL 3L3DB 3IF1B 1YEGH 2ITDA 4H40A 5E6SB 2V5RA 5F6IB 2FWUA 2NYKA 2BJML 4NX0A 1UZ8B 3NJNA 4W6YB 4YNYB 4ERSH 1BJ1J 5DJDA 1XB3A 4PRIA 4ZMPA 1LO3L 3NAAH 4M61A 1PLAA 3T09A 5J89A 3WJMA 3RPKA 2JKXA 2F18A 3D69A 5E94A 2XACC 4DTGL 1GGCH 1BBDL 4QWWD 2NCEA 3DLQR 1FFOB 2NY5L 2Q2LA 1P6AB 4ES9A 4BCZA 1HXKA 4LPYA 2VSDA 3PIQA 4GRWE 1I1FA 1K2DA 2XNAA 3O6LH 4KUCD 4NWTH 4YWGH 4ANUA 4X83A 4X4YA 5EIIG 4YFEA 5IG7A 3LRLA 1XIWC 3AS3A 4OLVH 3FAWA 3O3DA 4NNXA 5SX5H 1X5ZA 2J43A 2HJLB 2P8PA 3QDMA 2CR3A 1XD0A 1X9QA 3GGWB 4PHXA 3CDGA 3FO2A 3MNZA 4O02H 4BZYA 4F27A 1OP4A 4KXDA 3BZ5A 2JI2A 5L2KD 3OQ3B 1NC4D 4KH9A 4TVPE 1DVFB 1XO8A 3ZRFC 5C0JA 4YL9A 4ENZA 1MIEH 2DPKA 5BRZD 2Q86B 2EYSB 4WJG3 2Z35A 1X7SA 1IM3B 5J56B 4GY4A 3TL5A 4K5MA 1G9MH 2YRLA 4ZQKA 5KJRL 1RUAL 3J8F7 4HCFA 4AIZB 4BEIA 1MLCB 1OOAA 5AFAA 4GP5B 3EYQC 4RA0C 1GZQA 3MRRB 3N85H 4JO8A 4JO4L 3QWQB 2F1EA 3QJOA 3IFPA 1V10A 2BOCB 4AM0B 3GMPA 2Y69B 2V9TA 2CAKA 2TRHA 3KGTA 1F02I 4JANA 3OPZL 3NJLA 1XXDC 5GGUB 1CICD 4ODSH 3QULB 5TE6H 3W39A 4QHMB 4NZRH 2YGVA 2ADIA 1Z9LA 2BERA 4G42B 4UT7H 3IAQA 3KVPA 1DO6A 2B15A 5I6XB 1BWWA 3DJRA 2EH8H 5FA4A 4YZFF 3HAEG 1U3ZA 3K2MC 4HUWB 3BD3A 3C8DA 1Y0LA 2G4EA 1JNLH 5FAAA 3BH9A 1BQHA 4JQXC 4UQAA 4RBPH 1SQMA 1S78C 2WM0A 2TSBA 3D51A 4JFEE 1RZKC 1PGRB 5CJ8A 4H8VA 1YVLA 1IILE 3D05A 5CUSL 1R3LB 4DHLA 1UKTA 5DJCA 2X70B 4CN4A 5F7MC 3VFOA 2CUIA 4FNQA 5IHZB 1UWGL 5E2TL 4JG5A 3BX7C 2AKRB 3NFNA 1LE9A 2D3JA 1BYPA 1LO4H 5EZIL 4XBGA 4WFGD 3V4VB 1DVSA 5DS1A 4GG8A 2UYLA 5FCUL 5CP3H 5DK0B 3NIFB 4N6RB 1M2VB 4A7GF 1BZOA 3ZLQC 5DFVC 5T3XL 4YBHA 4WWKA 4POZD 1CICC 4KJYB 4OIBA 4K7PX 3O4LD 3QZWA 2FLRT 4EOWL 1DVXA 1IKNC 1MI5D 4Y4HD 3T0WA 3SKUD 1FAKT 3IDJB 1CR9L 3BKJH 1R34A 3IPBA 2SEBA 1T04A 3CLEL 3QNZA 4PRHA 1WBYA 3ETSA 2VLJD 4HETA 4OZHA 4UF7C 4WUUE 3RX8A 3CZFB 3KXFA 3O3BB 2A6JA 4FNUA 4KRPB 3MJ7A 1N70A 3GS7A 1ASOA 4JKWA 2NY7L 3U6RA 5JPMC 1JF6A 4FC3E 4HKZB 4W9LC 4FQLL 3MGTB 4N2EA 2BS9A 3RB5A 4L0YA 2NY2C 4KKAC 3QQ3A 2FEEL 4HSQA 2Y1AA 4HWBA 4DUXA 3TZVD 4FFZL 5JHLH 2Q20A 3K2UL 1DUZB 4G7YH 2VDPB 1A6TA 2JKWA 2B0SH 1NFIB 4XP5L 4Z7UB 1FNEA 4JHBA 3IXTA 1CYWA 2MEJB 2WTRB 3NFPA 4MA7L 4RSVA 2MPAH 5E8NB 1GC1C 1T1XB 3OAUL 3B8SA 4MNQD 2EJ1A 4R90L 3ZOAA 5DJ6B 1VZHA 4FNSA 3LKPB 1XR8A 5TF0A 3W1ZA 2N4IA 2E9JA 4OAWB 5LB1A 5FWRA 2EDTA 2PPCA 3A21A 1IZJA 3DDFA 4M48L 1A7QH 2J6EL 5HYJE 1JYVA 1INEH 3VCLB 4U3CA 4EQ2A 1JGLH 3P4NB 4HHAA 3EYOB 4CC0A 2XN9A 4XMLH 3RVVC 4Z95L 5HYSG 2FGZA 4ELMF 2ITCB 2NY6D 2ZSVA 4K7PL 1TT6A 3O11B 4R8WH 5C2BL 2OMYA 4NJ9L 3B2VH 4K3EL 3ZTJH 2V2XB 4MSWB 3IGUA 3RWHB 4K23L 4PGJA 2OULB 1OAZL 2JELH 1NEUA 2IGTA 43C9A 1C1EL 3PABA 2IAMD 4AV5A 1YEGL 1MREL 3MQIA 3K6SA 1DFBL 1O6VA 5KW9H 3L5XL 3QXUA 4ERSL 2I85A 5SV4A 3DO7B 2PPAA 1HZHL 1BA9A 2RH0A 3NAAL 3VSVA 3VW3H 2OK0L 3BIBX 3ZDZF 2APBA 3PDOB 4PJBA 4LCWB 3X17A 4HZLB 5DMJB 3BHBA 3S5YA 1SJHA 2G5BB 5F89B 4C59B 1GGCL 3D4GA 3TCXA 2WLMA 4LDOB 1N0LA 3WMQA 1EEQA 5HYQA 5CMAA 1E43A 1HKFA 1MG2C 3FSVA 4YWGL 6FABL 4NHUB 4PG2A 3SOTA 2MNWA 3V4PH 3QS3A 4IIQB 4O2EB 1T1ZB 4XNQA 1EIBA 2YIHA 1JHTB 1F4WH 3U4EB 1OD7A 5F44A 3A4AA 3W2DH 1A66A 4O02L 2Z1KA 3GMOA 4WFFE 2QVMA 5EBLB 5FCSH 2AERT 4AL8H 1DBKH 4NUPA 4F7PA 2VOTA 4D8PA 1Q94B 3I84A 1MIEL 4LHUG 4H7VA 3VMOA 4OZ4B 4K07A 3UPRB 4NQEA 2EDYA 4KZEH 4FTVB 3RBSA 4GG6F 2BY1A 3BO8A 4JPKH 2Z8RA 1G9ML 4HU8A 1U36A 3BE1H 5FYJE 3IJ8A 3SDCB 1I85A 2J56A 3N85L 4ORZC 5I6KA 2I9LA 2YRBA 1VEOA 2ED9A 2K3TA 4NRYA 1BFTA 1XT5A 2X6BA 5AOZA 5I6NA 4N8VG 5IR1B 3MLUH 4OI8A 3MV7B 2FQFA 1ZDQA 1U93A 2YD0A 1CUOA 5GZND 2WB7A 2BOBB 3F7KA 1E28B 4G9FB 4Y19E 3X1GA 5TE6L 5F7EH 3V55A 2KLSA 2EZ0D 3LKRB 4UNTA 3ZIYA 3MCKB 3CVHB 1IGJB 4NZRL 1DE4A 2VMFA 1XV8A 2X1OA 4OD2A 3V95A 4F8NA 5E24E 4UT7L 2EE2A 3LNGA 4FABL 4HJ0D 5JHDB 2GITB 4X6BB 2IDQA 5ESQB 2EH8L 3KW7A 1PQZB 3FRPA 3QXDB 5FYLE 4B9IA 3T4AA 2HT3D 1NIFA 3BQVA 4U6XA 3DX7A 5JMRA 1JNLL 1U8MA 2EEBA 4F37K 3RG1C 4H8WC 3CIAA 2CM5A 2GJRA 3K6NA 1CFSB 3CFKB 4WUUD 3SOBH 4PJEF 1P84J 2IG2H 1TUPA 2DAVA 4M5YH 2E59A 1IGIH 3NCCB 2KQNA 1J8KA 1UASA 4BFGA 5F3BA 1F86A 1LO4L 2P5EB 2UXGA 4CW1B 4B60A 2GJZB 3O9WB 1ZANH 4KK6D 5I1CH 3D0VB 5I0ZA 4E9LA 4DUVA 2N7BA 5FLVA 3VGDA 3HPJB 3X3GH 2EUWA 1HWWA 1OARH 4EDWH 5CGTA 1BV8A 5GZNC 3QXAA 1NCHA 3W9EA 4P5KB 5EEWA 3MNVA 1PAMA 5BQDA 4LNVA 3JWDL 4XP6H 1A3RH 3ECBA 1DVYA 3O41B 2W60B 3BKJL 3QEHB 1EXGA 1IGCH 3MO1B 3TVMD 3VWKD 5F1IB 5B39A 5FA3B 4PJIA 3BZFB 3LN5B 1YEFL 2HT3C 3ARBD 2B2XL 1Z7JA 1CFQB 1U8CB 1BCIA 3HN5A 2R39A 3UCQA 4AXWB 1HXYA 1IEAB 2CRMA 3PHQB 4ZFFB 4J3VA 1NL0H 4L4TA 3MR9B 4WNQA 4DGIH 3VDCA 2Y06L 5C86A 5JHLL 4G7YL 4IOSA 1MAMH 1YECH 2B0SL 3VDBA 3DX6B 3SODB 2QR0A 3N91A 3FT0A 4Q9CA 4NQQA 2MPAL 2F54D 3RFZC 2H26A 1MY5A 3EYVB 5HTSA 4X0KA 1VPOL 3BPCB 3RI5K 3LKQB 1HQ4B 4UQDA 4ZSOB 3QI9C 4UIMA 1PJ9A 5GS2D 5HHQB 2QMJA 1KB5A 1A7QL 4M5TA 1AHMA 5EBMB 1QFHA 4N5ED 3CIQA 4HH8A 2E47A 3VXNB 5AYQA 1FCGA 1D6VL 2GTQA 4P2RD 4XMLL 3UOAB 1TEYA 5I28A 1Q1JH 4OF7A 2WLZA 4UM9B 5AW8B 1Z9MA 3OKYA 2ALWA 5HDOA 3VMPA 1KJVB 1KENH 3BZ4B 2H0PA 4W9HC 5DUJA 3IDYB 5E99H 3M1OA 1URIA 1Q38A 3PHOA 3QXVA 2L7EA 5AUMA 5A6MA 1JYWA 4M7KH 3EDDA 4K8RH 3VI4A 3S36L 5IMKB 5KW9L 1SYSA 1MXGA 2VDNH 3GM0A 2AJYL 4WFFD 1L6XA 3N06B 4XVUD 5KANG 1UD8A 5IWLC 5KVGE 3ZE2F 4H13C 2EDNA 4DP7X 3Q6FA 3WGVB 4E9TA 1QWNA 2XT1B 2WD0A 4PTUB 2XBZA 1TETH 4FFTA 4NFCA 3O3UN 4TNVF 3OSKA 1NDMB 2HX7A 1J12A 3ZDWA 2XVGA 4ODHH 1TEFA 5TF1H 3V4PL 2PLTA 1DQTA 3NFSH 2X1XR 1M71A 2BIOA 2W80C 1F4WL 4H26A 4I5BB 5HVGB 4DSYA 3ECVA 4PGEB 3OLIA 5CHNB 3GBDA 4HDIA 2Y5EA 3W2DL 4JG9A 3B9KD 2MKWA 5BVJB 2E9BA 1F90H 1JXGA 4G11A 2I7SA 2W95A 2X2HA 3GC3A 3BP5A 5I1KH 3TJHD 1F3JA 4H0IA 2YEVB 1DBKL 3EBGA 5FM4A 1ZHBA 2ENPA 1NLBH 2CHDA 3I6LE 5FB8B 3OC8A 4DP9X 3OGCA 5FYLD 1CWVA 5AZUA 5FXCH 4FEIA 5F7UA 2YRPA 4JFXA 2P5WA 2B77A 4IRSA 1TU2B 3BE1L 2VN4A 1NCUA 1YJDH 1FZMA 2H32B 3T77A 4PWHA 4Z7NF 2HG0A 4XVUC 3SBWA 3QWRD 1GS8A 1KB3A 3QUKB 3BAWA 2DM7A 1AXIB 1LEGB 3MGOB 3MLUL 1MPAH 3S5LA 3JV6B 4QRPA 2J1WA 3KYAA 3BLKA 1FI8C 4WHYG 3R8QA 4NDMA 3GS4A 2PYFB 1L9TA 3ALPA 4LGPB 3BUTA 1IM3D 1MJJA 1LK3H 4TKWA 3MV8B 4KXAA 4XZUA 4P2OA 1SMDA 1S8DB 3QRBA 3SDXB 2EADA 3BAEH 3BWUC 5KSUA 1R0AL 3BP6B 1TSRA 4JGNA 4L0ZA 4I9WE 3GM8A 3MRIB 1RAMA 3GUTB 4LEBA 1JV5B 3SY6A 3PAUA 2H6OA 4OUOA 4PRPA 2UX7A 3UBGA 2ZUUA 4H0LC 3DBXB 3SYOA 1JZ7A 1HCZA 1RJCA 5F3HA 3EYUH 3SOBL 5E8OA 2IG2L 4M5YL 1MFEH 1IGIL 4XHJD 2DLIA 5D1QE 1E9QB 7PAZA 1FA4A 1DR9A 3D39B 1DEDA 1TITA 5CEZH 1J5IA 3LPWA 1PZBA 1GCYA 2C9QA 4AKPA 3BFWA 1ZANL 5EU4A 1UGKA 3K72A 3O3AA 5CILH 4E9YA 3VFWB 5IROC 5I1HH 1BQSA 1IFHH 3T2OA 3FYEB 5AKVA 3GKWH 4Z3GA 3P73B 3IDXH 5B1JA 2CQVA 4PJFF 3IXAA 1KV3A 4YBQD 5E8EA 4XP6L 3QFJA 3SE4A 1AP2B 4IU3B 3DTXB 3BVTA 5DK3A 4ZMOA 1IGCL 1IE4A 2YEZA 1KCVH 4KZEL 1HAUA 2A0LC 1ULVA 4MCZA 1XVSA 2ZX8A 3NA9L 3H2PA 5ENWA 3FHEA 4N25A 4ZX6A 3L16A 1NGZA 2ZONA 2HTKC 4MAYD 1J8RA 2F58H 4HS3A 5KSAA 1RCYA 2CO6B 2GBUA 4ZG1A 4PRNA 1IRAY 4DFIA 5MEND 2A3TA 1KEGL 1NL0L 4P5RA 3L2NA 4GAGL 3V7AG 2OMVA 4DGIL 1KLFA 1CYGA 3VVWA 3HG1A 3GMMB 1MAML 1YECL 1CXKA 4FNRA 1AQHA 4MZ3A 3PWLB 4AGLA 1O7DE 3HI6H 1FN4B 1ZLDA 1IGTA 4NQCE 4XX5A 4C4BA 3RL2B 5KWYC 1P5UA 1AO7E 5DHDA 2TSAA 3CH1A 4GW4A 2CO1A 4TSBH 4DF9A 4WEMB 3R18A 4MMYA 4IW4C 5D7JC 2H0FA 3WL9A 2NY0C 4LEOB 5DHYB 5C07B 5CR8A 1ZIBA 1VEMA 4KRMB 4XCNB 1JDCA 3VRJB 5GS0C 2ZCKH 5HY9B 1KB5L 4Y5YC 1YMME 3DX9A 4KJWC 3PWUA 2J72A 1J1XH 3UH8A 2ZKWA 3CFIC 2IPTH 3L7FB 1G84A 1ZSHA 2HVBA 5TE7H 5GGRB 4NKDB 1KENL 5E23A 2YXFA 2BZ7A 4MAYC 1FGVH 3WYRA 3OR7B 4YZFE 1CD1B 4L4JA 1KB9J 3LKOA 3X14A 1ADQA 2OX5A 4K8RL 1Y1DA 3WFHB 1H8LA 3EJRA 3V0FA 3WEAA 2VDNL 4RX4A 1SXSA 2J8UF 3AWGA 5F7YC 2W88A 1E7UA 5FO9A 1F3RB 3EYSL 4BH8A 4HV8A 4JPIB 4Z7OB 2QSVA 4NP9A 4AE1A 2H8PA 5DVOA 4UNVA 5BS0B 1G43A 1VESA 2EACA 5ICYB 4OF8A 2Y7SA 3KPMB 1REIA 1H3PH 4PJAF 3IGKA 4RDQG 1TETL 3NPSB 5F1SA 4J6IA 3CDYA 3P4MB 4WKXA 1CMOA 2A9NH 4RWYH 2ESVB 4ODHL 3RDTA 1DQMH 5TF1L 4HIJA 3NFSL 5A6LA 2JJVA 4LQ1A 5DQ9B 1GOHA 1F1GA 4FKHA 3ARZA 4TLKA 1LWRA 4A7VA 5EUOA 3BLPX 2CKBB 4DVBA 3N3EA 1JNHB 5HPMB 1JHKH 1F90L 1EUUA 2KI6A 3NJVA 3EDEA 4AW7A 3N40P 5KSBA 2AABH 2IOMA 3WIHA 1FO0A 3IJHB 3LNIA 4UQ3B 4OKDA 1LDPL 2W8CA 1NLBL 1LTXA 3GXPA 4H20H 2X9XA 2M2DA 4I9WD 43CAA 2QGBA 3PV6B 3W3BA 2IMMA 5IJKA 3KPSE 3H55A 2X40A 3FOMA 4WSJA 1I1YA 2MNJB 1I7RB 4G8AC 5AYUH 1YJDL 3CD4A 3KR3H 1JAEA 1ED3A 3VX0A 3QQNA 4NUGH 5HDBB 4HJ1A 1RHHA 2Z7UA 4ZMVA 4PJCA 2Y3NA 5TH2A 3SO5A 1WEJH 5D1QD 1MPAL 4I85A 2HA1A 4N90E 1QACA 4MXVF 4FYTA 3DTDA 1FL5B 3BKCH 1GVIA 1NUDA 1ONQB 4OJCA 3SD2A 2EDDA 4MWFA 4XWOC 5FOJA 5J11C 4FTVD 2BX5A 3UO1H 1DBBH 5GS1A 3I9GH 3BAEL 2DWYA 5EO0B 4OCLC 3RPBA 2EXTA 2E74C 4IU2B 3QIUC 2IAAC 4Z3JA 4Z7VF 2DQCH 4KDTC 1JI1A 3OMAB 2VO8A 2IANA 1VFOA 4JY6A 2BSTA 4ELME 5DLLA 5DJ0B 5FEBA 2HT2C 3ARWA 2DMBA 3FONB 1F5WA 1F8TH 2ZXCA 2H3KA 1CGYA 3OC5A 4ALAC 3DK0A 2D3LA 3KPQB 4L3FA 2B4CC 1SMAA 2XY1A 5CEZL 4RGOH 5HGGS 5T5FH 5KBMA 2Y1ZA 2YMOA 3TLRA 2ZSWB 3AUVA 4XXDA 1YPZB 4RZKA 4WW2A 4X6CB 1AZVA 3W9DA 3O2WH 5JHDD 5CILL 4D9LH 1VFMA 3GD1C 5I1HL 3U0TA 4BM7A 3QZNA 5LHDA 2WAHA 5D1QC 1IFHL 1J0IA 3SYAA 3IDIB 1ORSA 3GKWL 3IDXL 3CFMA 2YC1B 4HISA 4U1NA 5BV7C 4WDIB 4F92B 5IEHB 5GRJH 3FUHA 3MTRA 1BBJA 3HKZA 5C0AE 1ZVHA 1J05B 2GSGB 2WK2A 3DYPA 1RZFH 3U2SA 4DKDC 2ED8A 1ZS8A 4ES8A 1KXQA 2J73A 3CC1A 4UDTA 1KCVL 2F2HA 3RVUD 3EOYG 3TYGH 2YAHA 4WKZB 3F12B 2P5ED 3G5XA 4HIHA 4BSJA 4MASA 2WNGA 3SDDC 1NCTA 2CALA 3K91A 3A5VA 1SDAB 3GTTA 3VD9A 2F58L 4ENED 2AEOA 3IJEB 3GHPA 4MD0B 1BQHG 3FFDB 3OD3A 4LXFA 5DD0H 1ZA6B 4AOFA 3HNVH 4D0DB 5KS9B 4YFLI 4MA3A 1F4HA 2DYPD 4GINA 4E9RA 5IW1B 1RZ8B 4LOEA 1QKZH 5HD8D 4EQ3A 2DQMA 4J3WA 3UZEC 4QI3A 3HI6L 2C7UB 5I1LB 5CP7B 1X5IA 3D4YA 3BRGC 1P9MA 5L2KA 1WIUA 1NC4A 3KH4A 3WIIL 5LGKA 3RY6C 2BXZA 1ZRUA 1JFHA 4GYBA 4TSBL 4UM8A 3ZMRA 2OL3B 4NM8L 4N0UB 3R1GH 1O7DC 1U8IB 3EFFA 2XFGB 3QZWG 1RZKH 1Y1UA 5DC9B 2ZCKL 3BAKA 2H3NA 4NO3B 2X88A 4BFOA 1J1XL 4F15C 5ESAA 4Q56A 2IPTL 5I82A 2EC9T 3CTTA 3IAGC 5ABDE 4AI7A 4UCFA 3Q3GB 2F19H 4NZ8A 5I1DB 3T04D 1FGVL 2QVFB 2H1LM 5J12C 2ADJA 3NQKA 3BW9B 1I7UA 1E8YA 3QEUB 5IBLD 2AXFB 4E5XB 1WFIA 5AD0A 1AHWC 3OXSB 2K0RA 2WVVB 1HS6A 1ZVSA 2CCLA 4G6JL 5EC1A 5EORH 3ZKMC 4PJEE 5HD8C 3CBRA 4GKSA 2VNCA 4JRXE 4XCEB 1GGBH 4LCUA 3PJSB 5JOPD 2P43B 4KKLD 4XP9H 3PP3K 4FMVA 5E9NA 2ZXQA 1HKLL 4AGPA 2QADC 2WYTA 4ABUA 5TD4A 3V79C 1FLTX 1AC0A 4RWYL 3ZXAC 4K3HA 2HN7A 3T71A 3WSQH 1F1AA 5GRVK 5DEGB 4ANXA 1NDGA 2VMEA 1CIDA 3F64A 2X6CA 2OTPA 1KIRB 3S34H 2NXZB 1JUFA 2NZIA 5EUKA 1ZT1A 5LN4A 2AQRA 1Z9NA 5DZAA 1Q9WB 5L7XH 1JHKL 5IB3A 2NT1A 5D6CB 2VXSH 5DEJA 3AXIA 3OJDA 1HEZB 5J4MA 3UBXB 4YMPA 5IM7B 1GC1H 4H20L 4S0HA 1DQQB 3FT3A 5DHEA 3QFGA 2AF2A 3O4LA 4X5WB 2K45A 2H6PB 4WTQA 1JHLH 3EFDH 1MI5A 1M9SA 2BHUA 1TZHB 2UWEA 3R4RA 4PJ5E 4Y4HA 2R27A 4DESA 2XFXA 3KR3L 3W0WB 3ULVD 1EZLA 2VLJA 4MQTB 3ATAA 5I73C 1P7QB 4G6FD 4PU2A 2WIMA 1UFUA 1KYUA 5HVHC 4M7JH 4M3KB 1TFHA 2ENSA 4BRJA 3BKCL 3GSNB 2HCZX 1AKPA 4Z76A 4ETQA 3NUKA 1AKJB 1Q0XH 4JS7A 5HHNB 1IAII 5B3JE 4S2SB 3TYFA 3UO1L 3TZVA 4MDIA 1E4KA 3MFFA 4L3CA 3GRGA 1JPGA 2J3SA 12E8H 1BXXA 2YPVA 1GZHA 2ZCZA 2O5NA 4U6YB 2DQCL 3FTGA 4JB9H 4ZD3H 4MNQA 2H47C 4W9KC 5D7IF 3KPPB 5GJTL 2DRUA 3V0VA 5IMOA 1F8TL 2AK1H 5CCGE 4XB3A 2HFFA 4D9QE 1F41A 3BXNA 4RRPM 1YUHA 1G0YR 4J3OD 4X7DC 4AV0A 3HS8A 4B53A 3MROA 3MV8D 4JPWL 4YGVB 4URKA 4P4KC 2A4ZA 4HSCX 1KXTA 2WXLA 1W0WB 1N59A 2D2OA 5F3FA 1ZCRA 1MVUA 3L1EA 5B7MA 3E6HA 2AQQA 2R7EB 4NSKA 4UMSA 3NACH 4U1JB 2G30A 3SDAB 2Z64C 2BCMA 3MKKA 3QAQA 2OI9B 5J8OA 4PJ9B 3E3QE 5DD3H 4UIKL 4EZLA 1Q0YL 4WGVB 5AB2A 4GRWH 5GRJL 1EXUA 2GEEA 3SBPA 2VDLH 4WI0A 1OQOA 1HH9A 2IAMA 2X41A 3NOIA 3ZHNA 4JAMA 5I6LA 2XJLA 4LK4A 3ZU8A 4QXGH 3FMGL 4XR8C 1FP5A 1M3JA 1OV8A 3GMQB 3TYGL 4HLEA 4E9VA 5CZVH 2DMGA 1ITBB 2NY3B 2J44A 3K1KC 3AG2B 2D7PA 3FRPG 3M6DA 3DWTA 4TVPH 2C1PB 4XPTH 2FBRA 1FAIH 4YSUA 3KJ4B 1QMUA 3E1ZA 1FV1A 3MX0A 2PWHA 3WUZA 1J86A 3DSNA 5DD0L 3HNVL 1QRNA 5F1NB 4NBYB 3TO4C 2QLYA 2FE0A 2WY3B 3AXHA 5DVLA 1OK0A 4KTYA 4J3OC 4HJUA 1AGDA 2BSBA 1QKZL 4WK0B 2OMXB 4UTCA 1O7VA 4QRAA 4WI9A 2ZTBA 3F2LA 4Z9KB 2UVFA 3GXFA 4Y1AE 1E6OH 3JT0A 3L08A 5DEFA 4XNMA 4F7EA 4U6VL 1N6QH 2CDGA 4Z23A 3GRWA 3C12A 1MW0A 3R1GL 4G1EB 4H8WH 3OKEB 2GHWB 2OXGB 1SXZA 2D3VA 4IQHA 3SPJA 4BKLB 2D7NA 4LLYA 4YL4A 3US9A 5D4JA 3TN0D 3G6JF 2H2PC 1BM7A 1JZHA 4X6EB 4LLWA 4AW4A 1FQ9C 5BZWA 4ZO9A 1N10A 1EPFA 2F19L 3Q6GL 3HW7A 3K71B 4DEWA 4RFEA 2HPTA 1MCFA 4TOYL 1AD0A 2FECI 3HC3H 4QRFA 3VE0A 4XGZB 1P2CA 1KYAA 1QUPA 3BQUB 5FF6A 3S3BB 4LLAA 4Z77A 4I88A 4ABVA 4YPGB 5BO1H 4E68A 2ZOLB 1KCUH 2AJSH 3KPRE 4XPFH 5DI8B 5EORL 5M95B 4KXZH 4FQXB 5I1AB 2I9TA 5D2NA 1Q72H 3DHMA 1E9OB 1CIUA 5DRXB 1AIFB 4EIBA 1RK7A 3KPLA 1HJBC 2Y22A 1LK2A 2P7TA 2IOOA 5TQ2H 5DR5H 3IJYA 4L9LC 2CGYA 5ERWA 3L3OB 1X5LA 1OF2A 2Y25A 4UDUA 3DGCR 4QXTA 1QNIA 2JIXB 2XRAH 5CD5D 5HJ3A 2HVKB 1A3LH 1G7QA 4PVBA 3ARYA 2Z8VC 3T3PF 2PO6C 2HFGH 3S34L 3QIWD 3GTNA 3TN0C 3QUYB 2OSLA 5BS0D 2VXSL 4ODWB 3NSJA 1FNGB 4N9GB 4UTBH 4PP2A 4XHQA 3QWNA 3BSZA 2DJSA 1FNAA 3WHE0 1OB1A 1DQKA 1P84K 4JJHA 2AGJH 2XBDA 3VXME 1J8HE 2JB6A 4OGZA 1D7FA 2ESVD 1U8QA 4KI5D 1II4E 2OMWB 4MJ5B 1IAKA 5C09B 4B3EA 2OTWA 2DWXA 3RGHA 3FQXA 3SPIA 1DHKA 1SN2A 4BFIB 3TVMA 3VWKA 5DA4A 1I3RB 4RCAA 2G5UA 5DHXB 4D9QD 1EEYA 4E41A 2Y6TE 1M1SA 2X53A 3ARBA 2V2TB 1WIOA 4W4OC 1J88A 1YO4A 4XCCH 1FFPB 1JWSB 3HIZA 1CLVA 1KGCE 3RWIB 4QRRB 5GGTH 1HHKB 3LZLA 2R2HB 1WGVA 4KBPA 3MLVH 2HFTA 3QR1A 2FR4B 3RAJH 2OJ1A 4EIGB 4HIEA 1J9TA 3MJGX 3NSDA 3FO1A 3ULUD 1UVQB 5B3SB 2A73B 5I8KL 3QORB 4P4RB 5I5RA 1RVFH 1TLMA 2F54A 4JB9L 4ZD3L 3I50H 3QFDA 4BFBD 1CF1A 2NX5E 5BQ7B 4JFHE 3GO1H 4ZW7A 5I19H 3ZR6A 1P5VA 3WFDH 15C8H 4KQ3L 2V3EA 4PH8A 2ZAGA 2VXVH 5HHQA 1BGXH 4P2RA 2DMCA 3MLTA 3HHSA 4IS6A 4YE4L 5E56A 2V5YA 2ATKA 3EYFB 3NACL 1U95A 2J8UE 1AQDA 3OLDA 4AZUA 5HDQL 4A7UA 2WBJB 1OTTC 4HHGA 3S5LG 3GXDA 3NJXA 1I1CA 1RP8A 2VDLL 3GBNL 4LDLB 5HPOA 4TTGA 5HI3C 5JXEC 1KGXA 4PJAE 3TNNB 3T3ME 4OQ1A 3RA7H 4KHTH 1ZGLA 1QAWA 3E3QC 3NZHH 2WIIA 4MNHA 2X12A 3QK0A 4EVNB 3MCLL 3KPNA 4TVPL 5DZLA 3UTOA 1FAIL 2J1KA 4M62H 4P9ML 3WNNA 2HT4C 2COQA 3EG9A 1WE5A 4R2GD 2F53B 4MNGE 5AVVB 1HYSD 4QF1A 1QLFB 3CFQA 2VR7A 4PLKD 1J9RA 3KH3A 4BSVA 3VXPB 3L3DA 3PGCB 4MYWB 3HA0A 3IF1A 1BD2D 5FYJH 2FB4H 4OD3H 1UZ8A 1OTUC 4YNYA 2OTUB 1TENA 3ESVF 1SEQH 3GS0A 3UP1A 4A2FA 1T7ZA 3B9KA 1B0WA 3P9LB 1ET5A 4WCYH 1BZ8A 4PJ8B 2XWDA 3RIKA 5FECA 5ISZB 5E6YA 4ZMWA 1N6QL 1SJEB 3CLFL 3EH3B 3K8KA 5D2LF 2EO7A 1FFOA 5IMOB 5JIPA 5IFHL 4Y1SA 4IBTA 1OGAE 1PLGH 4ELKB 1UOWA 4LVOB 1R3JB 2P46B 4OF6A 4C4KO 3VFVB 4I0PC 2H3XC 3LMJL 4RESB 3GRWL 4N0CD 3SPVB 3BCFA 3JYBA 4FG4A 3ARSA 4RH4A 4Y2DB 5FYLH 2HJLA 2JKLA 3HZYA 3LPPA 4OCNC 2ZUTA 1BW8A 1XWVA 4MS6A 5DD5L 1XB8A 2X28A 5MEQB 4LCCC 3BC9A 4UI2A 3VI3F 3FUDA 2Z3FA 3HC3L 5GHWH 1DVFA 4JGJA 4Z7VE 4Z7WF 2ENYA 3HG0A 3IETB 2Q86A 3SKNB 4NBXB 2ZKMX 1IM3A 2R2CA 1KCUL 2AJSL 4GQZA 4XPFL 5JR1H 1KCSH 4AIZA 1MLCA 4PCTA 2AAVA 4ETYA 1PKQE 3H3PH 3MRRA 4OJYA 1MHCB 1MW3A 2ZCLH 3JV4B 5TQ2L 3V7MA 4Y5XB 5DR5L 2BOCA 4AM0A 1GIGL 4LLQB 2MTPA 4B3VA 4XC1H 1DLFH 2N7AA 1B6DA 5GGUA 4H4NA 5MEPB 2XRAL 3QULA 1IFGA 4LB8A 4YHLH 4EXKA 5BO0D 4QHMA 4XOEA 2HFGL 4G42A 1INDH 2G3XA 4LF3B 4IBUA 2P9RA 3TO2B 32C2B 4HUWA 4UTBL 1GAFH 1J18A 3BVXA 3HE7D 2VXQA 5L4FA 4JHWL 2VMDA 1E6JH 2A9AA 5C0GB 2AGJL 1KV7A 1KGWA 1M05B 1R3LA 1YMHB 1H8SA 5GZOA 2X70A 3NSFA 1G9HA 3BSZL 3MBEC 3UTPE 3EOTH 3ZQ9A 5IHZA 3QPXH 3G08B 4F7TB 6TAAA 3MGAA 2AKRA 1CBJA 1H3GA 2NX5D 2NXZD 2GY5A 4XOAA 3D4CA 3V4VA 5GS0H 5DRWB 1S7SB 3SPGA 5DK0A 1UKSA 4RMSA 2PWDA 2X10A 3EJUA 4FXGC 5T33H 4EF3A 1JPTH 3OMNB 5DHVH 5KYXB 5MENA 3OF6D 3M46A 5GGTL 2FAUA 1F56A 4ADGA 5HVWA 2WNKA 2E3VA 5FO8B 1T4WA 5DJYB 3RAJL 1WFNA 1IC4H 3IDJA 3W0WD 1YNLH 1Z32X 4WUKL 2Z31C 4ZFGH 5ICZA 1CQYA 1P7QD 3C5ZB 3CZFA 4HOWA 3I50L 5ID0B 3MFGB 3F85A 5FO7A 1TYJA 1NZRA 2C7FA 1JWMB 2WXOA 4HKZA 1SFDA 3I3EA 2R51A 3MGTA 4LU5H 5CR1A 2LE9A 5I19L 3OWRA 1HOEA 1AKJD 3WFDL 15C8L 3DROB 3ESNA 1BGXL 5KVGH 1DUZA 1ZLSH 1CYXA 3P2TA 2J5LB 3T5WA 4LLUB 4EBQH 3VXUD 4F2FA 3LAFA 3IGFA 2HMID 3BJLA 5E2VL 1VFAA 5IVNA 2WTRA 1F58H 1NGPH 1D5IH 3I3DA 4AZ8B 3AREC 3OAYK 1T1XA 5E8NA 4JQVC 4FXKC 2QT6A 3QNXA 2YZ8A 4WFEE 5DJ6A 4NRZB 1JF1B 3LKPA 1F18A 3DGGA 5GSVB 1J1PH 4KAQH 4GSQA 4XVOA 3ZE1F 3D5OF 3PE9A 4Y5YB 3NIDF 4KXCA 4ZFZB 1DSFL 1KNOB 2V5SA 4JO3L 4X9GA 3RA7L 4KHTL 3VCLA 4AMXA 3GPEA 3P4NA 3EYOA 3QEQE 5KZCB 2DJUA 5T1JA 3TXAA 3NZHL 4FHKA 2ITCA 2ZWZA 4W9ZA 2X4RA 5DYOB 1QFUH 3SDAD 4ZMYA 4M7ZC 2FIRT 5I71C 4PJHB 4MSWA 3VTTA 3RWHA 5A6IA 1T3FB 1NCBL 4IKKA 5SWQB 5EWIH 2E6PA 2G9KA 4Q97A 2E75C 2AQSA 2Y9RT 1EX0A 1QO3B 4IBZA 2DI9A 2Z92B 5CZXC 5ITFB 5L2JB 5FYJL 4ATTA 1OAUL 2X4OB 1YNTB 2W59A 4ZNCD 3IFLL 1JZGA 1UB6B 3DO7A 1L5GB 2QQNH 1NBQA 1XMEB 3QUZC 2NY3D 2CSPA 4KUZH 1SOXA 3PDOA 4LCWA 1B4TA 1NUFA 2QEJA 3H42H 3TBYB 2G5BA 5F89A 1VZIA 3NZUA 3SEPA 5J1AA 2DQFB 2GJPA 1M1XB 4IRJD 4D94A 3HUJF 1NIEA 4NHUA 4FFWD 2FL5B 4IIQA 4O2EA 1G0XA 1U8OB 1T1ZA 3CDZB 4ALAH 2IDUA 1JXFA 5CGBA 4GI8A 5FYLL 3U4EA 2B4CH 1T2QH 3FRUB 4U0RB 2A1WH 1PU0A 4DPRA 4N2CA 5I0WA 1QX1A 4P5MB 5E8DL 3G6DL 4P3DB 4FOMA 5GHWL 2J20A 4N0FB 4PY7A 3FU7B 1ZPLA 2ICEC 5EBLA 4LL9A 5DUPL 1U2CA 1XSJA 1T83A 4MXQC 4PBDA 4YHOH 1Q94A 4GMSH 1HJCA 4OZ4A 4OVUA 4LVNB 4XAKE 4AY0A 1R5VB 3GDCA 4FTVA 1NGQH 5BV7H 3AB0B 5FOBB 2FT7A 1KGUA 2JV6A 1ILSA 4XMZA 5IJBC 3H3PL 3OKNB 2YSTA 4HBQA 5AB0A 2ZCLL 1A6UL 4P23D 1MDAA 2YGPA 1BQUA 4G8GD 1VIWA 1A9BB 4CMHC 1KLGA 3QQDB 5I23A 1DLFL 2X2YA 4NN6C 2FEDD 1BP3B 2YD2A 3QC6X 5CN1A 1E28A 3BQUD 1QTSA 2DD8H 1X3DA 3LKRA 3P77B 3MCKA 3CVHA 3FJTA 1IGJA 3KWUA 5IF0B 1PY0A 3QIUB 2DTML 1XD1A 1INDL 2X3AA 4FQXD 5AOJA 4A2DA 5JHDA 2GITA 1OW0C 3TT3H 5ESQA 3TPKA 1PQZA 5F7KC 1ETB1 2AXWA 2YR3A 3QXDA 3UFIA 4AEIL 4I3RL 2XG4B 4NAMA 2XSKA 4QYAA 2DQIH 2C3XA 4Y16B 3TJPA 1OGSA 3UMTA 2NZ9D 1PD6A 3FT4B 1ML0A 1CFSA 3CFKA 3RNKB 1QSFB 2JIXD 1JTTA 3H9SB 4WI3A 4A7TA 1NDTA 1ZE3C 1WO2A 3EOTL 3FO0H 3QPXL 3SQOH 5A7EA 1KN2H 1NAMH 2P5EA 2VXTH 4CW1A 5A3ID 2EC8A 3L4YA 2GJZA 2G5RA 3KLKA 3SGEH 5GS0L 3FB8B 5I75B 4OI7A 3TJEH 3QRLA 5K93A 4ZUVB 5T33L 1JPTL 3HPJA 2EQDA 2A77H 2XZCH 1AY1L 1D9KC 8PAZA 2UZYA 2WVSA 2DYPA 3EH1A 4P5KA 4P5TC 1T1WB 2CUMA 3ZMEA 4AJ0A 5IQ9B 1K8IB 2JI1A 3BKYL 4PB9H 4QOKE 3BP4B 3EHBD 2Y5QA 8CGTA 4FLSA 2FUTA 3O41A 2CK2A 4L2LA 3SDDB 1RUPH 1TO4A 3ZPDA 3QEHA 1UH2A 4PI2A 3FTVA 3MO1A 2HJKB 4ZFGL 1Q8MA 1UJTA 5ADPH 4YO0B 1TZGH 3QDGE 3CC5A 3CHSA 5F1IA 5FA3A 2D0HA 3BZFA 3LN5A 5I0DA 3WJJC 4TTDD 3G6JE 2IBGA 5KBNC 5DFAA 4R7DB 1CFQA 1MJ8H 5D5MF 1U8CA 3MACH 4AXWA 4KKCC 5JTWA 1IEAA 4QRRD 4ZFFA 2ZWLT 5EF1A 3QG6B 4N2GA 7TAAA 3MR9A 3EBAA 1MJ7H 2ZOTA 4HEPA 4N2LA 1F0LA 3CZUB 1ZLSL 3HZKA 4U33A 3EXJA 3O45B 1KYDA 3QORD 2OMUB 1WT5A 1D5IL 3EBIA 3PQYB 4YX2H 3B7RL 3QDJB 3EYVA 3KYOB 3MA7A 3FZUC 3LKQA 1HQ4A 4MCNA 4ZSOA 1CDCA 1NAMB 1MSPA 2D31B 3J07A 4IKNA 1BFVH 2EXWD 4DP1X 1C16B 5EBMA 4HULB 3EHBC 4JDTH 4RGMC 1V3KA 3FUKA 3VXNA 2VDKB 1RL1A 3A4FA 4ZOEA 4L9DA 2P48B 4FQCH 1JMXA 3CQFA 3FQYA 5T1MB 3T3PE 3GJFB 25C8H 4PJ7B 1QFUL 1KJVA 5B22A 1N18A 4KC3B 1RD6A 2WBJD 3CNKA 3RTLA 5HHOB 3IMUA 3QB7C 1ZPUA 5EWIL 3DV4B 4L1TA 2DYSB 2AXGB 5CKGA 3QUMH 1YEJH 1TNMA 4L8CB 5IMKA 4YDIH 1BAGA 1OM3H 3VU1A 5BZXA 4I3SL 4ORGB 4WSGA 2QQNL 1XDTT 1YNKH 4N2MA 5J13C 1CTMA 1B2WH 3NSCA 4KUZL 3ZHFA 2WQUA 2D7OA 1M6UA 1XCQB 3H42L 1ZTXE 2DQUH 2ICWB 2IXQB 4G70B 2JSFA 4TQ8A 3CPUA 4PTUA 5B1CA 2F53D 1T80A 2I26N 2WWOA 2EXWC 1NDMA 2VN3A 2GKIA 3GJEB 3OPUA 2PTTA 3QJHB 2A38A 1SOSA 4ALAL 5EEUA 2GHZA 4I5BA 4PGEA 4UT9H 2B4CL 1T2QL 5CHNA 1GOFA 4CU8A 1D5MA 3TA3B 4AJYV 5AOMA 3LDBB 4F5CE 5BVJA 1LDSA 1CCZA 1Z66A 5JOFA 1VKXB 1EZVY 4M8UA 2Z91B 4PJ8D 1I1AC 1FUNA 3DYMA 4Y2NA 4AVJA 5ISZD 2YUXA 4TQIA 2OYKA 4YHOL 2IH3A 4GKOA 4MS8C 2QDWA 3WFEH 4GMSL 5FB8A 1U33A 1QSVA 3NCXA 1MHHB 4PVMA 4G82A 4HG4K 1L7TH 5I1GH 5BV7L 5I73B 5AG9A 3L3JB 2LVEA 1AR2A 1TU2A 2KLTA 4X7TB 1JZ5A 3U46B 2H32A 2WLKA 1A47A 2IEPA 4Y2DD 1E8ZA 1WC7B 2BNQB 3L1GA 1G87A 3V0DA 1JZDC 1LEGA 1INQB 1JTPA 3MGOA 4W9JC 1E3XA 1TDQA 3JV6A 3FN3A 4HFWB 2OS7A 2V7NB 3O8XB 1IC7H 1TSHA 4W9DC 2DQJL 2PYFA 1LE5B 3MV8A 3BH4A 3VFMB 3FB6B 2EE0A 2E7MA 4QR7A 4BE5A 4J3OH 3TT3L 3BP6A 1I3VA 1HAWA 4LFHD 4ZS6C 1O6TA 4EMZA 1MWAH 1XEUA 3MRIA 3GUTA 3C5XA 5DFWH 2NLJB 2YD3A 2DQIL 3HZ3A 1JV5A 3MRHB 4UT6H 2ERJB 1OT4A 1RK1B 1IBYA 1ZGLP 4NO5B 3DBXA 3IRZA 2MHAB 1HESA 4ELMB 4YHPA 5H4YA 3CSTA 3EDFA 4TUOB 1E9QA 5HGAB 3SQOL 3ASNB 1L4IA 3NJKA 1GGIH 3I3BA 3APCA 1HXMB 2V8MA 3PXHA 5EN3A 3PCYA 4Y5VB 3TJEL 5AAWC 2RMNA 3VFWA 4AENB 1XTLA 4R0LC 3WHXB 1E0OB 1MELA 4K94C 1CFVL 4OSUL 4F9LC 2A77L 1F11B 1D5BB 3HHMA 3P73A 4MQXD 2BIIA 4EPSA 2NUTB 1FJ1A 2XVKA 1R5WB 4NQUA 4PB9L 5F96H 3ZDZB 5D2LE 3P0VL 1IVTA 1AP2A 4N3UA 1GTNA 3DTXA 3KJ6H 5C0AB 2G2NA 5ADPL 3S98A 2NZ1A 1MN4A 1OD9A 5ABZA 5IKCA 1SVZA 3CU7A 1DSYA 1MJ8L 2I60H 2CO6A 1BHGA 3MACL 5C0BB 3X3FL 1B2YA 1QSEE 3VI3E 4JO5A 5J1SC 3PHAA 1MXDA 1MWAB 4B95C 2XV2A 2Q2EB 4E0RB 2A74C 4GRLB 4BH7B 1MJ7L 1U3YA 1GGUA 2BSRB 3D2UB 4FNLH 4WENB 4Z7WE 3RJQB 2IGFH 3NABH 4KKZA 3ZQWA 1XGZA 4PW9A 3PWLA 3C60B 2XWZA 2D8KA 1FN4A 4JG0H 4YX2L 1FSKC 4HS8H 4GG6B 2AV1B 1KN4H 2ZYHA 3RL2A 3VG9C 1TTBA 3FUIA 3APDA 1QFWM 2ATPB 6PCYA 2ZUXA 3NZSA 1BFVL 3O6MH 4DKFH 4LEOA 3T2QA 5C07A 3LJ3A 3A3YB 5DXWA 3VACA 3VRJA 4Q14A 3UIYA 5HY9A 2YQ3A 4FQCL 4MHHG 3H8NA 3OLEA 7FABH 3L7FA 4QJ5B 4CJ0A 1W2KT 3GXNA 4Q6KA 5GGRA 4JN2B 4LDCA 4W4OA 3HBPA 2X6VA 1KG0B 4M4RB 3WNJA 3OR7A 4HPHA 1CD1A 5FDYA 2WCGA 3UJIH 3ZT5A 5IVOA 1FH2A 2ZYIA 5CZKA 1NAKH 1KGIA 2DICA 3QUML 4XOBA 1YEJL 3WFHA 4A6YH 1A7PH 4XO3A 4YDIL 3ARTA 3O6FC 5IK3B 1OM3L 1JG9A 3QIWA 3U83A 2P8MB 4C4UA 5KZCD 3ZHKA 4JPIA 1YNKL 2RQ8A 4RQQB 3AY4C 1B2WL 5BS0A 1MCLA 4ZX5A 4I48B 4XBEH 4P04A 2KZBA 3KPMA 2DQUL 2CRIA 4C4KT 2G3MA 1OCCB 4P2YA 4YR6B 4L1SA 1TQCC 2EE9A 1PG7H 3HBQA 4PREB 1DP0A 2ESVA 5E4OA 3T0EB 1HE7A 3FAXA 2R9HC 3ILPB 3GIZH 5DQ9A 1KPVB 3Q2LA 4UT9L 4J3TA 2EO1A 1ZV5A 4HAFA 4BXVA 2CKBA 2BK8A 1JNHA 4RAUB 1NANH 5DD1L 4PWGA 4UANA 3QJTB 4JGMA 1FL6A 3UIZA 4F33B 3UTSB 5JQ6H 3NCEB 3IJHA 1L0PA 4UQ3A 5BZZA 1TQTA 4JZNB 5A7BA 1IM9B 4YHYC 3PV6A 1FG2B 5BW7A 3EIFA 1BMZA 1L7TL 5DO8A 3K1DA 2DWEB 1I7RA 2OM5A 3PWPB 1CDJA 4NUJA 1L3WA 2J55A 5IBUB 3NJMA 4P2QE 4QHKJ 1WA0X 2WP3O 4NOFA 4YUEL 4FI7A 3MRNB 4P57B 1NM4A 3SJVB 2QJDA 4JZOB 4YDJB 1DUYB 1UA3A 2WXJA 3AXLB 4JVPA 4W9GC 4GT7A 2OP4H 3RKDD 1FL5A 3V0WH 1ONQA 1IC7L 1AYRA 3NRPA 3N40F 3L4VA 2V33A 1K5NB 2O5XH 2UV3A 5AAPA 4Z0BH 2X9YA 3ZE1E 1H15B 4E42A 5T1LB 5IUSA 2GTWB 3NIDE 3U30C 2OZ4H 3ZDYF 4BQBA 4IRZH 4MJIE 5GGVH 4IU2A 1I8LC 4OZHF 3KYMB 4UOW0 4YEFA 4ABWA 4HFUH 4DKTA 4H1LH 5DJ0A 4J4PC 4CJ1A 3FONA 1NA8A 2AXJA 4N8CL 2QL1A 4MLIA 4KKPA 3KPQA 3SCMD 1CL7I 3DURB 5FYKE 5BCAA 2W0FB 4B96A 2IQ9H 2MCPH 2VLRB 4LP8A 5GJSL 4UILH 1GGIL 1EHXA 3WUWB 2QKIC 4H25B 1ZA3B 2VN6A 1YPZA 2KPWA 4X6CA 2HRGA 3NP3A 5A2KH 4LLVB 5B1BB 4PCYA 2X87A 4QYOB 4D3CH 4EI5B 1LO2H 3GNMH 1EZSA 3FH5A 3IDIA 1YEKH 4Y16D 2EYTB 3AUWB 2YC1A 3ARUA 3MRCB 3SKMB 4Q0XH 3ZE2B 5F96L 4AYEC 1QSFD 2GSGA 1BD2A 1JGVL 2WGNB 4OF0A 3KJ6L 2AZUA 3L54A 1SUJA 1YSOA 2A6KA 4WKZA 4GS7C 3F12A 4ZT1A 2IO5A 4OJFH 2FX8L 3UABA 2GUOB 2O5YH 2VDQH 3DETD 5MHSE 2DI7A 2WSKA 3IJEA 4MD0A 3FFDA 1OAXH 3O0RH 1ZA6A 5KS9A 5B1KA 1Z5LB 2JQZA 4Y4FC 4FAAB 1PCSA 1QLRB 1RJZA 4LO9A 3VWJC 1ANUA 1I9IL 5IW1A 1RZ8A 4FNLL 1JOIA 4AYMC 1EA9C 2IGFL 4RETB 4H1LB 5DO2C 1RERA 4KFZC 4B41A 4BUGA 1MFBH 1JGUH 1S7UB 2DWTA 4HP5A 4RFNB 1PG7X 2C7UA 5I1LA 3QCVH 4N24A 4XX1E 4JG0L 5CP7A 4HS8L 4CVZA 1RURH 1UJ3C 1KN4L 4O00A 3GF8A 4RGNE 1S7XB 3RRQA 4UQ2B 1T0NA 4I0PB 4Z7NB 2OL3A 1OEZW 2PW1A 3O6ML 4N0UA 5HI4C 1U8IA 1J5DA 4F3FB 4JM4H 4NLHA 2BWDA 3HB3B 5JIHA 1BMWA 1W0VA 1A5FH 4NO3A 3CZSA 2NR6D 5F9JB 2DKUA 5A16B 1NMAH 1O5PA 4OZFH 3Q3GA 3C09C 4YEEA 3V6OE 5F7NC 5I1DA 3PQYD 2R0WH 4FXGA 2VC2B 4A2EA 4WV1B 4KROC 3MUGB 3MCYA 3BW9A 3QEUA 3IEAA 2AXFA 4K4KA 1NAKL 2BIMA 4E5XA 3RVWD 4WI7A 5B3NA 4QRBA 2QDVA 3OXSA 4A6YL 5SWSE 2Z0UA 2OXHB 1KC5L 2VW6A 4YSOA 1CF8L 3ASOB 3KPRB 3OB0K 2WW8A 4DW2L 2YD4A 3PJSA 2L4OA 5CWSB 2N1KA 3Q43A 4GH7B 2BVQB 2IVFC 3HE7A 4OCYH 4Y4KB 2QKSA 3VUAA 5HHOD 4ZMTA 2RCSH 4NLAA 4NOBA 1PG7L 4L1DA 1KF9B 4Z7AA 4KHXH 1R3KB 4WO0A 5DTFB 2Z9TA 4A2MA 3KPOB 5DEGA 1K6QH 4JFYA 1KIRA 4R4BB 4O58H 3O4OB 4WJ5B 5JNYB 4JCMA 1Q9WA 1PZ2A 4PJFB 2DLFH 2SODB 5D6CA 3BLBA 2Y5TB 1HEZA 4NQDB 5JQ6L 1MH5B 1W72B 4ZOCA 4TQHA 5CS7A 3UBXA 3OF6A 5IM7A 2QVTA 4WWID 4ZJ9A 4ZFOL 1BVNT 1HC1A 1OAQH 1NFDF 1DQQA 2QFPA 4XO5A 3RVWC 5D5ME 4Q9QH 4U2YA 4X5WA 2H6PA 2DH3A 3N1PC 4GIOA 2P5PA 4PWIA 2Q6WB 3W0WA 2ZG3A 2NNAB 4B0MM 3BPOB 1P7QA 2PCFB 2MCG1 5JA8B 4BSWB 3W11D 5D71L 3ULUL 4KGJA 1IC0A 3EXLA 3VRIA 3GSNA 4JM2D 3V0WL 1KCRH 2EYRA 3WLWC 4NKMA 4BZ1H 1AKJA 1BAWA 3N50A 5HHNA 4EKXA 5K9KB 5L88H 3V0IA 1KXVC 1AR1B 4MMXB 1B9ZA 2BNUB 1FWXA 3BUDA 2XWCA 4HD5A 1FFQA 3V0EA 5KBKA 2K6WA 4LRIC 2OZ4L 3VXUA 2E7LC 3QUHA 5GGVL 3BFQG 4P46C 2BNQD 4U6YA 5EZOH 4PJIF 5DCCA 4HFUL 3KPPA 1QLEB 3IMVA 4AM0Q 5TGBB 3BKML 4U31A 4G6ML 3O8XD 3WEMA 3C6LD 4V1DD 1NFKA 3N0PB 1CBVH 5F72S 4DEPC 3K8MA 3ZTJG 3PS6A 4WNSA 3RTQB 2XZQH 1YY8B 3ERXA 5GGRY 1DVQA 2NQDA 1R5IB 2R7EA 1AAJA 4D3CL 4U1JA 4XPBH 1LO2L 3GNML 3KNBB 5F7WC 3SDAA 4KVCL 3V6ZB 3UAJA 3FTSA 1IX2A 1YEKL 4PJ9A 3L45A 4PJDB 1DBJH 5IFAH 3FF8A 5DJXB 1P0SE 4AEEA 1AQKH 3MBWB 5E7FA 3G5WA 1WBXB 3QH3B 4HKXB 4IBQA 1CI5A 2WKGA 4PJAB 3GMQA 3IMRA 3WCYA 3FU3A 3H0TB 4J3UA 5HHVH 3MN8A 4OJFL 2FZ3B 4FI8A 2O5YL 3E9UA 3F58L 2VDQL 1A7NH 4AEHH 3NCJH 1A7RL 2C1PA 4MGXA 3ME0B 1I8MB 4W9EC 4XPHH 3EGSB 3G5VB 3O0RL 3MPCA 1DBAH 5F1NA 4IRJA 4L3EB 1AE6H 4OLXH 1F1DA 4J2QA 1CN4A 4OZGE 3S8GB 3BUYB 1VERA 1A4BA 1FVCB 4K3GA 5BZDB 2OMXA 4ODUB 2Y7LA 1EERB 1PY4A 2YAOA 4R4FH 4YAQA 3MLZH 3LH8A 1AVAA 2AJ3B 3V7AE 1Q90A 3QCVL 4MHHI 5HDWA 3DIFB 1RURL 1M57B 5SWSD 2XCMC 3W5MA 3BWZA 5JIMA 1T7XA 3HZMA 4MMZB 1S7RA 2AMUA 4LPVA 2ZF8A 3ECUA 5C0BD 4BINA 4UZGA 3E80A 1BJ1H 1BREA 1FIGH 1A9EB 1YY9D 4JKPH 2AVGA 1S3KH 3MLWH 3CBJB 4IK7A 3OKEA 2WTPA 3N04A 3HE6C 4JM4L 3SGKC 4DWHA 4GRLD 4HK0B 2JXMB 4JO2H 5CLXA 4KNQA 1LEIB 4BKLA 1A5FL 4ZNEA 4UMGA 4RGNC 1Y6KR 4ACPA 4NRXB 4X6EA 4GAJH 1GR7A 5AZEH 1ZE3H 1NMAL 2B39A 3HI1B 3C60D 1KGJA 4P23A 2H1XA 4LLMA 4G8GA 1C8QA 1G7JB 2R0WL 3D0LB 3ROLB 1D7BA 1MVYA 1BXVA 1QA9B 1MZZA 2XXFA 3IGAB 3BQUA 1N6UA 1A1OB 2PXYB 1CFBA 3WTUA 1X5JA 4HK3N 1S7TB 4YPGA 3V6OC 4A38A 2ZOLA 1O6SB 4A37A 3FTYA 1B4JH 1BEXA 5D1ZI 1U8NB 3GI8H 5DI8A 1ZLVK 4HEPG 4FQXA 5I1AA 5I8OL 4N2FA 3QPQD 1E9OA 5DRXA 5EIVA 2X44D 3TCTA 1AIFA 3CCHB 2GT9B 1GW0A 4NN6B 4G3YH 3MZGB 1P7HL 1Z5YD 3KEHA 4YN3A 4PWJA 3TFKD 3C87A 5D1XE 4OCYL 1RMFL 4FF9A 3D07A 3WENA 1MCQA 4JFQA 3L3OA 3W57A 2RCSL 3PJNA 1BZ7A 3HNSH 1WAAA 2NQ3A 5F9DC 1IIIA 1YY9C 2AV7B 2JIXA 5FM5O 4W6WB 5L0QB 2HVKA 3BDBA 1DBMH 2Z4QA 5EO1B 2H0JA 1E4HA 1YC8A 3UJJL 1K6QL 3PP3H 1GS7A 2AJZB 3MLSH 3S7GA 2BCKB 5H4ZA 4ATWA 4EIZC 3ILDA 3QUYA 1U2HA 4M6NH 3RFRA 2VZVA 3WDJA 2DLFL 1XCTB 4ODWA 1FNGA 4N9GA 3N1MC 5D7KE 3IJSB 2WKOA 1XGYH 4X8JB 2XIBA 4NZTH 3SQBB 5C6PB 1OAQL 5CGMA 2APWA 4Q9QL 4BQ9A 1IBGL 4QHPA 3UTQB 4ZW6A 4MJ5A 3LTVA 3A4EA 1BLIA 1G94A 3CXDH 5CJQH 4ONFH 4BFIA 4XMWA 2C3HA 1I3RA 1KLUB 1BG1A 2D3NA 1D9KB 2LQRA 1GMIA 2E7BA 3TFKC 3ZDXB 1HI6B 3TF7C 2IALB 3UTSD 2V2TA 2IFGA 1JWSA 1FFPA 2PABA 4WI6A 2WBWB 1MAJA 4PRIE 1EDHA 3N1FC 5C7XL 3VH8B 1N3NB 2HH0H 3ATDA 3RWIA 4QRRA 1IM9D 2FH6A 4G8FB 4XT1C 1HHKA 5L88L 4F1SA 5AZ2H 4YSPA 1LO0H 3HMWL 2FR4A 2X9WA 2XX1A 3PWPD 5D9SB 2QTEA 1KIQA 1UVQA 1W8OA 2AJVH 2A73A 5IB5B 3QORA 1IEBB 2NY5C 4P4RA 2AHIA 2R69A 1SRDA 2C3VB 3EO0B 3SJVD 1NIDA 3FTUA 5ITBH 1J10A 2X6AA 3DPBB 5BQ7A 2HG5B 4BHUI 1UQSB 5J3HD 1LM8V 4J8RA 4U1GC 3V9CA 4XNZC 1TR7A 4KJPD 5EU6B 5A2IH 3QDAA 4ODVL 1PZUB 2NY1B 1A6WH 3FCSA 4JZJC 3MV01 2XZQL 2B8OT 4CVUA 3DIDA 3EYFA 5F8RC 4XPBL 3T1WA 2WQAA 3U4KA 2WBJA 5KG9B 4A7QA 2WXMA 3BYTA 2P24B 3PPSA 4UU9B 4OZIB 3ZL1A 4J39A 5IFAL 4RAVB 4BK4A 5CGYC 5TFSH 3QZOA 4XNXH 2WYIA 2CO7B 2DMHA 1AQKL 1U58B 5LAXB 3TNNA 4NT6B 4CSZA 3B4NA 2HLAB 2FUQA 2VLRD 4X6DB 5HHVL 3GMLB 3TT1L 4EVNA 2BIHA 3NCJL 3T0VA 4AITA 3VXRB 4EI5D 2IH8A 4XPHL 4NQSB 2WXKA 4MBRA 2LLGA 1P1ZB 2ADGB 1KACB 2F53A 1BIIB 2GSIB 3NGBC 2AEIT 4QHUB 5TQ0L 3CN4A 1AE6L 1QLFA 5J3HC 5EN2B 5E7BA 3RIAF 3VXPA 1H8OA 3PGCA 4QHLA 5DQDL 5DGRA 2QGDA 4XP4H 4AQ8A 4R4FL 3WN6A 3APFA 3G9AB 2WLIB 2EP6A 4NFDA 3P9LA 3WG7B 4P0DA 4X9IA 2LW3A 5LGYA 3PDGA 4PJ8A 2V37A 5IJCC 5ISZA 2WN3A 1SJEA 1K4DA 1FIGL 1G1KA 1T5XB 4JQIH 4FFVD 4JKPL 1CDYA 3HS0A 1S3KL 3MLWL 2K70A 2PMZA 2WKLA 1VFBB 4ELKA 4JO2L 1R3JA 1SY6H 3VFVA 2Y7QB 3RKPA 1JPSL 1GL4B 2YRZA 5HI5D 3F62A 3SPVA 4Y2DA 2D9QB 4GAJL 5AZEL 4PP1C 5EUOF 5AAWA 5MEQA 4L2YA 3WO4B 1K5WA 3ZDYE 1RPKA 2ZZUT 1M7IA 3ARGB 3FOLB 1A25A 2LGNA 1ASQA 4PRHE 2YWYA 4AQ1B 3MI6A 4NZDA 4OZHE 4PV1C 3US1A 1SUHA 4AIOA 3KXFE 4MAUH 3IETA 4XP1H 2GTZB 4K94H 3SKNA 2DQ6A 3O2DH 5DJAB 1B4JL 1NCJA 5D7IB 4B27A 5B8CC 4KZDL 3D3VB 4GB9A 4ANVA 2F7IA 4G3YL 1N5AB 4CBZA 1TJHH 1MHCA 1FYTD 3JV4A 2YHGA 4PJCF 4S1RH 4Y5XA 4ZK8A 3VA6A 2PW2A 3MRQB 3VXSB 4CADB 5I74C 5C0RH 2AJXH 4FFVC 4DPAX 1UT1A 4L8SB 5MEPA 1WA1X 2KPNA 3BPLC 3RWDB 4NKOB 5D1XC 1XCXA 3MLSL 1ACYL 1ACZA 1CQKA 3B7YA 4A2HA 2VKWA 4LF3A 3T1FB 4M6NL 1CZ8H 3RUGB 3TO2A 3VGGA 2MRYA 32C2A 3ZKQD 2X4QB 4B9FA 5LDUA 2XN9E 1XGYL 3AU0A 5IY5B 1CK0L 4I1RA 5GRVL 4Q6IB 3B3IB 3WS3A 3CLWA 5C0GA 2E27H 5JW4N 1ZEAH 1M05A 1ZLWK 2WP3T 1I53A 3RGVB 4AV4A 3BFOA 3FN0H 3Q8BA 3WXWH 1DJHA 3G08A 4ONFL 4F7TA 2YQBA 3L9EA 5C0CB 1I7ZA 3HEIB 1ZWIB 3PXLA 1SNRA 1MFAL 2CGRH 4OR1A 5DRWA 1S7SA 2JTYA 3AFLA 3BAXA 4LHQB 5IREA 5ICXA 4OJDH 5KN5B 1XGTA 4ZXBC 4PQXA 5KYXA 2HH0L 3CZJA 2DIEA 4PJBE 1DZBA 3I85A 2QZ5A 4GQ9H 2WWNA 5AZ2L 1KTDB 4FJYA 1LO0L 2O5ZH 3DVIA 4BYHA 5FO8A 1UM6H 5DJYA 3WFCH 4JDVB 4BGDA 2K4WA 4IJTA 4QOKB 4LAQH 2AJVL 3H6JA 4Z8FH 4X5PA 2IWFA 3L3KB 3ZL4H 1I9JH 1KEMH 1VGKA 3C5ZA 4YSEA 5ID0A 1CXEA 4NZUH 1B0IA 3I75B 7CGTA 1JWMA 2OSXA 2F68X 3L5JA 2FWOB 1DANT 2NXYB 1GZPB 1A6AB 2WQSA 3DROA 3FO9B 1AR1D 2NW2B 3WNMA 4KUCF 1OTSD 1KULA 2EE6A 3QJUB 5EBWB 1CXFA 2AP2A 1FSKB 2VISB 3ELAT 4LLUA 4R84A 4NQEE 4ZTPL 3VA2C 1HWGB 1WWBX 1ZTXH 3AT0A 3NJJA 4AZ8A 4V33A 3H4FA 4KY1H 3C2SA 3ZKNC 2YPKB 3L1FA 1DN2A 4NRZA 4N20A 4WEEA 4Y2LA 5GSVA 3X1EA 1EHKB 5TFSL 4XNXL 4KRLB 1JK9B 4ZFZA 5BJTB 1SLXA 1URZA 1KNOA 5MEOA 5IEKB 4EUPH 5LO7A 1WHPA 3KBHE 1PBYA 4IK6A 4NGHH 1AFVH 5IZ7A 4R4ND 3RTQD 2I07B 4OT1H 3EJSA 1NEZB 3JQOB 3QRGH 2FX9H 5E2UH 4MJHA 5I15H 5DYOA 4JHAH 3RILA 3NCWA 3IKKA 3F7VA 4N2OA 1D7DA 1R3HB 2NYYD 5IV2B 3O6FB 1K3IA 1T3FA 3CFCL 5DLMH 5SWQA 4DP2X 1QO3A 1XF5B 3BD5A 3P11H 3D09A 4JW3A 4TUUA 1MHEB 2VLMD 4X9HA 2J6WA 1E27B 3Q01A 2IV9A 3ZE0B 1R3IL 1NBCA 4XP4L 3SB3A 3UC2A 1FZOB 1YNTA 3LQZB 4HJGB 1MEXH 5LBSH 1UB6A 4XB7A 1L5GA 2EDRA 3K46A 4XTRD 1T20B 3TBYA 5EV7A 4M1CD 3UBFA 3JBG7 2F7OA 2XWBB 3E7JA 2DQFA 4JQIL 5KVEE 4UQIM 4X4KA 3KLDA 1M1XA 3ZTNH 1AZRA 2ZXGA 2VJXA 4HUVB 2VDOL 4L3ED 2FO4B 1SY6L 3S37H 2AANA 2FL5A 1U3JA 3G5ZB 5C6WH 1U8OA 5IFJB 3CDZA 4XCYB 2CCWA 3S3CB 1BYOA 4KTDL 3FRUA 3QEGH 5M7QA 2H6UA 3HAEH 2DBJA 4P3DA 4N0FA 3JWDC 1RFDH 1SXAA 1AIZA 4MAUL 4WWKC 4PJIE 4K94L 3P40A 5IT2H 1H5BA 3DOSB 3CSFA 1R5VA 2LOEA 2UZXB 1BM3H 4QY8A 2FEJA 4U3SB 1OE2A 1FF5A 4JRYB 3UROR 1V27A 1ORQB 5FOBA 2UWEF 4ZAKD 5DC4B 3A24A 2F74A 3PWNB 2JI3A 4K71B 3ZSTA 3D6GA 4L4TE 1WCBA 3OKNA 4GAYB 1TJHL 4LSVL 2BVYA 4M3JA 4X5RA 5CSGA 4S1RL 5DWUL 4OTXL 5E00B 5E08H 2E7DA 1A9BA 3QQDA 4GO8A 5IGXH 4FJ6A 2R0LH 3DVNB 2PXYD 5AW1B 4LPWA 3SCMA 2PR4H 3P77A 1ZOXA 3FHQA 3U79A 1QEXA 2YQ2A 4XPGH 3NN8B 1UXWB 3H4HA 3ZHDA 1RSYA 4U2ZA 2ZG2A 1CZ8L 5I1EL 3F6LA 2FBOJ 4PSPA 4NHCH 1DTUA 2G0KA 1CFTB 4FQPA 1P4LB 1D5XA 4LEEA 4Y16A 2PWEA 1FVEB 3FT4A 4CU6A 3OHXB 2E27L 1ZEAL 5CIPB 5JXAH 3RNKA 3ZTDC 4HX1B 1QSFA 3ZT6A 3EUUA 4HKJB 1G6VK 2PP9A 3H9SA 2W9EH 4N8PA 3FN0L 3WXWL 4Q52A 1YYLL 3L9RB 3I6KB 3VI4E 5I76B 1JZ3A 4IOFD 3DX1A 3FB8A 5CN3A 3UGEA 4JFDB 1LLAA 2MFNA 2ZP0T 3BUQA 4GRWF 2OCFD 3DOIA 3WTVA 2VM4A 3N6YA 4ZUVA 1MNUH 1F97A 2CWRA 4I89A 3KBFA 4K5LA 2IBZX 1MIMH 3OKOB 3LQAC 4GMTH 4GQ9L 3MVSA 1G1CA 5FV1L 3K0YA 1EV2E 1K8IA 4G8IB 1HHJB 4GS7B 4TQPA 2O5ZL 3BP4A 2R59A 5HYSA 1UM6L 3WFCL 1MCOL 4JO1H 4KMQA 4RMTA 2JJTA 4LAQL 1WFOA 2HJKA 1I4FA 1W16A 4YO0A 3ZL4L 3PUCA 2YXVA 1I9JL 2H0EA 1TTAA 4AMKL 2J71A 3MRBB 4R7DA 2X2IA 3OG4B 1QR4A 5E4AA 3UBXG 3MOAL 3VTMA 1VENA 3CXHK 2DLGA 3QG6A 4PGZA 3UTTB 4PG2C 3TWYA 1R46A 1UWXK 1YYMH 1FE8L 1BVKB 3VJ6B 1LQSR 1QFWH 3RDJA 2E7CA 3D52A 2K7PA 2NR6A 2FNBA 3R0MA 4J23A 3TH3T 3O45A 4HC1A 4Z7WB 1CJYA 3VD2A 1ZTXL 2OMUA 4B97A 2P5WE 2W07B 3S37X 35C8H 3PQYA 4KY1L 4EN2A 1MCJA 3KYOA 3VFTB 4X5XB 3CDCA 3JZYA 5DRNB 2D31A 2EILB 5KBPA 5DURB 1C16A 3AWEA 4E36A 3IKCB 3FU5A 1JGEB 2Q7YB 3MRJB 5EZLB 3P2BA 5EU6D 1FZJB 4QRPE 1JNNH 2YPLB 5EC2B 3OAYH 3CVBA 4NGHL 1I85C 4GKNB 4NBZB 5D96B 3KWVA 2G3ZA 4OT1L 2JKJA 2WWKT 4WF7A 5C3TA 1H9VA 3QRGL 4RSYA 5T1MA 5A2CA 3FFCB 5JIKA 1JV2B 3GJFA 2C4FU 1E40A 3QUXD 4JHAL 1GPOH 2H2SD 4PJ7A 4F2MB 2R29A 2XWTB 5HHOA 2ODIA 3MDJA 5DLML 1RHFA 4IHBA 3DV4A 1NQBA 1HZKA 5DMIL 1SHMA 3P11L 3FUFA 4R26H 3KLHD 2AXGA 3A0OA 4H2AA 1YC7A 1CDGA 4L8CA 4PRPE 1PJWA 4RFOH 5I5IA 4KK8D 2P8LA 3HC0B 4LCIL 1KPUB 1MEXL 3S2AA 1BZDA 4ORGA 2YKKA 3T4AC 5E4EB 5J06A 5E5LA 3U2JA 2QVIA 2DM3A 1XCQA 2CCVA 4UQCA 4BWWA 3VXRD 3D87B 1MCNA 2IXQA 4OKVA 1G7LA 3CFNA 1ZIAA 3LQMA 5AL8A 2ZYSA 3GJEA 4JE4B 5CFAA 1NMCC 3QJHA 5DGQA 5SWZB 4IM8A 4BFKA 4A7GA 5DK2B 3H9HB 4NNPH 3QG7H 5CU9A 1M2OA 1XF4B 3QEGL 3B9EA 3TA3A 3IMTA 3J7HA 3QFJE 5LUMA 1UD6A 4N22A 3BAYA 1VKXA 4DKEH 2Z91A 3FW6A 2GIYA 4GXFA 1QOKA 1G5AA 2C9AA 4JM2A 1V55B 1N2RB 4TNGA 4EKJA 5HJGA 5IT2L 5FYKH 4LPCA 4Z5RB 2R8SH 1MHHA 3EO1B 1AS8A 4AWJC 4YLBA 4GEIA 3L3JA 3K3QA 5B4MD 4X7TA 3TBCA 1WC7A 1EJ8A 2XQYA 4ZPVA 3T2PA 2BNQA 2ZWNA 1OPOA 4OFVA 3SBQA 4OBRA 2V3DA 1INQA 3HG1E 1JGIA 3ARGD 4TNWK 5IGXL 2K78A 2D2CC 2NNFA 3CAFA 4JKMA 3E2HB 2NMSA 5JZ7D 2V7NA 1TXKA 2R0LL 3O8XA 3C6LA 3ES6B 3FT2B 4V1DA 2PR4L 1UYWH 3RGBA 2MWCA 2W38A 3FB7B 3SO3C 1F2XK 4P46B 4XPGL 3VFMA 3FB6A 3TBSB 1NJ9B 3F7QA 5LLIC 3D3VD 4OUUB 5DC0A 3KYNB 5SX4H 3X1FA 4U4BA 4QRQB 3ZE1B 3BRFA 2CDEB 2C4FT 3Q05A 3ARXA 1JZ4A 2AEPH 5IB2B 2NLJA 4MJIB 2EEDA 3U4AA 3RWEA 3MRHA 2Q0ZX 1KIPA 3PDDA 3VXSD 3WEOA 1AANA 3WFBL 1RK1A 4LE8A 4KVNH 2E4FA 4NO5A 2MHAA 5FGBA 2QQKH 5JXAL 2G2RA 4NCC2 4YXKH 2W9EL 3LHPH 5HGHB 4TUOA 5IB4B 3VYOA 2EDJA 3FUNA 3T6ZA 3DBSA 4WO4B 1HXMA 4BFNA 4Y5VA 3HBGA 3RIFK 1CU4L 1G6RH 1BECA 3RJDA 1T22A 2BXYA 1DVTA 4AENA 3WHXA 3UAAA 1WTLA 3IU3B 3GRBA 3NIGF 1F11A 1D5BA 4KOCA 4ZUWB 1MIML 1R5WA 2KC0A 2PKDA 1I3UA 2D7TH 3RGVD 1CDUA 2IH9A 4FFYH 3NDZE 4JO1L 5C08B 5D72H 5C0CD 4WSKA 4Y7OC 1ZD6A 2XZZA 3C9NB 3HUJB 5SWSA 2QPEB 3BRDA 5FO2A 2DQGH 3CZKA 4FQ1H 3S6CA 3CN3A 3E8VA 5EUOE 5C0BA 1UZGA 5M94B 2CBTA 4HUKB 3FFOA 1X5FA 2QELA 5F70A 4MCYA 5KSBE 3MRFB 4E0RA 4GRLA 4BH7A 1L0QA 3EJYD 3D2UA 2FSEB 4LIQE 1QFWL 2PCPB 4NWUL 3TX4A 4AQEA 1JP5A 2BRQA 3C60A 3V5KB 4GG6A 2OMBA 1U41A 5C0FB 2AV1A 1XZ0B 2VRKA 3S35H 3HRZB 3GK8H 1C7SA 2D7QA 4PJCE 1D7CA 1WS8A 4OQTH 5GPRA 3S48A 2UZIH 3ZYIA 2FJGB 1T6BX 2NXYD 3OKDB 5B7EA 4U49A 3WKYA 4W81A 2WOBA 4PJGE 4IRSC 4XO9A 5HYIA 2K3HA 4N3TA 1JNNL 4MZ2A 5KYWB 2CA3A 3SBWC 1EAPB 3QQ4B 4LPUA 3WELA 1EVUA 3ZKXC 1CTNA 5JO5B 3WMPA 1FNSH 2ITEA 1GPOL 4JN2A 1LMIA 3RZCD 1KG0A 4M4RA 1KJ2H 3KL0A 4YXLH 4CSPA 1OALA 2XA3A 4Z3IA 3ZN6A 4GUCA 1UXMA 4GSRA 1T4KA 4R26L 4G8EB 3CHRA 2IANE 3NQIA 4NQTA 2BJMH 2EVGA 3TEWA 4HIXH 4P2OC 5IK3A 4RFOL 5F9WB 5BNXD 1O7SA 1K8DB 4HIQA 5EB9A 4EEEA 1KBVA 2EIBA 4RQQA 3IVKB 4NUMA 1CURA 1B4RA 4LCYA 5HHME 1XB6A 2NY5H 3HPLA 5E1AB 2EH7H 4LSUL 2CJUH 4YR6A 1IO4C 1E5BA 5MI0C 3UEQA 4OGAD 4PREA 2KYIA 4DOHE 1QUNB 4WHYH 5DD6B 4KPHH 3T0EA 1JZIA 4ZYKB 3ILPA 1UTDA 1KPVA 5JYLA 3BP7A 1EGJA 2CHXA 2IWEA 4YSDA 4QAMB 3QG7L 3N43B 4FULA 1QEWA 5DS2A 2X09A 1HNFA 4RAUA 1KXQE 3OTTA 2CNYA 4WIQA 2GK2A 3VDAA 4DKEL 5HJDA 3UTSA 4F33A 5BOJA 2QGCA 3RZCC 1IFRA 5B1JC 1FC1A 4JZNA 2IADB 2YLHA 1IM9A 5FYKL 1SXNA 2FYVA 2XKUA 1YLBB 4JDEB 3C6SB 1FG2A 2R8SL 1WH0A 1S5IL 2VMJA 3L1OH 2DWEA 3ILQC 3PWPA 5D5MB 2Y72A 5KSVB 1PIFA 5JLZB 1XGQB 1ZMYA 1DJZA 1BFSA 4RVBA 1QI5A 2DN7A 3MRNA 4P57A 3SJVA 2J2ZA 3OMIB 4PRAB 5KSAC 4JFZH 4JZOA 1DUYA 3NIFF 4H5SB 3AXLA 3M07A 1BZ9B 5GGQL 4FXTA 4FLRA 5JPNB 3UPAA 4BRVA 5L2KE 2APVA 2PNDA 4RX4D 5KYUB 1K5NA 2Z7ZA 1PW3A 3D48R 4JRYD 3CVCA 5SX5K 1H15A 2GTWA 2O6DA 3QJFB 4WY7H 2O6CA 4ZMZA 3S4SB 1TQUA 3JSSA 3LRMA 3KYMA 3S97C 4YSAA 5KEZA 1P69B 1UCTA 4U1GB 4NS0A 2GUYA 4M4PA 2X05A 1Q9KB 2NNCA 4NAJA 3LYRA 2Z4TA 2QQKL 4YXKL 1NINA 3LHPL 3ML9A 1UWGH 3DURA 2BSDA 3ZTEA 4FDWA 4X42A 2W0FA 3MRLB 5CJXA 2VL5B 1S7VB 1J0JA 2VLRA 3EFOA 3S35X 4B0MB 4GBXB 1G7PB 4MLSA 5H2BA 4H25A 4FNPA 3ZYOA 5H94B 1OGTA 5EEVA 1G6RL 1YEIH 4LLVA 4HJTA 3GEFA 3AQZA 4EI5A 2YMXH 1E8WA 1A22B 2AAAA 3CN2A 5GISL 1V5JA 1ZHNB 1LP9B 2EYTA 4MCMA 4JRLA 4JFVA 3VTAA 2V5MA 2C9VA 3MRCA 3SKMA 5TPWH 3T2NH 4DCQB 4EOWH 3ETBJ 5H35B 3FKUS 2D7TL 4PYGA 1YDPB 3DARA 2E8ZA 4FFYL 1C12B 4U1HA 3RVTC 4R9HA 5DMKA 5GXBB 2ZOUA 5D72L 1FHGA 4JX0A 1EDYA 2X4TA 2ZKHL 2ZUQC 2GUOA 3UP6A 3X11B 4DT2A 4JFDD 2NY7H 4DZBB 2EABA 3HVNA 4FQ1L 1FLRH 1A4JB 1Q9LA 2BP0B 2BIPA 1OWRM 5T3ZD 2CXKA 4FQLH 3T6QC 4PD4K 3LKSB 4XN9A 3RDTC 3MV9D 1Z5LA 1AXSB 3DXAD 3BVVA 1UD5A 4JKKA 3LZPA 1NTDA 3K2UH 3KM2A 2GK0B 4X99B 3ZRSA 4BZ2A 4XP5H 2GBAA 4B9CA 4TSCH 1S7UA 3ULSB 4MA7H 3O4LE 5LGJB 3CPLB 3OAUH 4R90H 1MI5E 2UWEE 2VABB 3BEVB 5D7LB 5E5RB 1EEUA 1OF0A 3BISA 1KBKA 1XSOA 3L17A 3SY0A 1PFCA 1M7DB 1S7XA 2VLJE 1PTZA 4UQ2A 3S35L 3GK8L 4JLRB 5D1ZB 3VYPA 4I3GA 4BCYA 2YD1A 1XAUA 3LEXB 2UZIL 2J6EH 3UJTL 4C56B 5IJKC 3RL1B 4H8UA 4Q74A 1FG9C 4F3FA 2NY4C 4F93B 4X80H 4LKXA 5PAZA 2EKSB 4BXSV 4NN5C 2W92A 4U1LA 3OQRA 3JUZA 3IDNB 5F9JA 1K4CB 4HGMA 1TNNA 5I5JA 1FYTA 1FNSL 2A9BA 3KGUA 3UL4A 4NJ9H 4RISH 2VQ1A 2CZNA 4HJSA 4ZW8A 3WNLA 1KJ2L 4YXLL 1OAZH 3EH4B 4WV1A 2PPDA 1R1CA 3MUGA 2A6DB 2ZAHA 2Y3AA 1VGEL 3ATEA 7PCYA 4MNQE 2YA1A 5IUCA 4ZODA 1MREH 4NO0B 1JK8B 5DURD 4X7EC 1DFBH 3ATFA 4HIXL 5GS1C 4MKMA 3L5XH 3NJGA 2AXHA 1AZNA 2BNRB 5L4MA 2OXHA 4QO1B 4AQAB 5D7EA 4MRBA 3H9YA 1HZHH 3AM8A 4NZJA 2OK0H 1H6TA 3L3IB 4LSRH 1HEJC 3P0YL 3VXQB 5CWSA 1S5HB 4CSTA 1A6ZB 2BVQA 4L4VB 2MOQA 1R47A 4Y4KA 1E5YA 4CA4A 5LKNA 4UTAA 2EH7L 2CJUL 2WVUA 3NCYS 4KITB 2XKSA 4QRTA 4QUOA 6FABH 2AQ3A 1R3KA 4KPHL 4YPJA 5DTFA 3VMNA 1PZAA 1WISA 3KPOA 1YEWA 2IBBA 1ECYA 3LZRA 1LO5B 1TCRB 4WW2C 1AACA 2ED6A 1MRDH 5AW6B 2NNRA 2ZG1A 4PJFA 3FCTB 3BEWB 1HHIB 2Y5TA 4NQDA 2A5UA 1MH5A 1W72A 1OXYA 4NI3A 2V9RA 3VNYA 1MCPH 4PBXA 1IAIL 1NOAA 4WHTA 1R6VA 3L1OL 3DC0A 3CFDB 1EEZB 2CBPA 1UC6A 3KCWA 5SWZD 1QRNE 4MD5B 2Q6WA 4TV3A 2UUDH 2WV3A 2PCFA 3VXOB 1KOAA 4BSWA 4TM9A 4JFZL 4R97B 4PRBB 4QWWC 5C6TH 1B0GB 1GS6X 4JG1L 1KSRA 4M93C 2R0KL 1FL3A 3CMOL 3T0DA 3UAFA 2OR9H 1I8UA 2EXYD 4LSQL 4NN7C 4FL4C 1H3TA 3AQYA 1I9RL 5I8CB 4MMXA 4APQB 3ZR5A 1XFPA 4FABH 1ZXKA 1N5YL 4L0PB 1ASPA 4WY7L 1F13A 3ARDB 5ACZB 4YC2C 2VTFA 3NT0A 4NNYB 4ZW5A 5AAMA 1P9MC 2GFBB 4A66A 5K9OA 3HNTL 4Z7IA 1QQDB 5EULV 2XNAB 4MJ4A 3N41B 5TGBA 2F5BL 1OOWA 1TO5A 4O02B 4NNXB 2CM6A 1I8IB 1JXJA 2P8PB 2LTQB 2YUVA 3QDMB 4JFFB 4M5ZH 2ARWA 2C8NA 1BVZA 1KJ3L 2F6AA 3MNZB 4PW4A 1A7OH 4C47A 2AW2A 1WPCA 3HCVB 3RP1A 4I4WA 4BKTC 3RTQA 5CLWA 2WZ0A 1OZTG 4L1LA 1YEI