4Y4HD

Crystal structure of the mcd1d/gck152/inktcr ternary complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 58
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hD02
3IFLL 4IJ3C 2GFBB 2V2WA 2ZG3A 2HN7B 3IDGB 3GMLB 1T1XA 1YQ2A 4OZFA 3FFDB 3X3GH 3EYSL 4YPGA 1P9MC 1X5AA 2YD3A 2D7QA 4OLXH 3S37H 2EDRA 5MP6L 1X5KA 5EG6C 1C1EL 4M02A 3M1BB 4EI5A 4F33B 1SM3L 4PJGE 5DMIL 1FL6A 1TTGA 3CD4A 3T8XB 4M6OH 4F8QA 4N8VG 2AS5M 5A2IH 4O2FA 1QR1A 5J9PA 5EH1A 4OFVA 2VDPL 4P23C 4Z0BH 5KSVA 4NQSA 4OLEA 3O11A 2PYEA 4Y16B 5DJAA 3N06B 4LCWB 4YEFA 3GFUA 4LSSL 4PS4H 1VFMA 3HG1A 4MNQD 4MA8L 3PL6B 5C08D 5FB8B 4MCYA 1RZ7H 1GGUA 5CILH 2WNGA 4N0FB 4GG6B 4FA8A 2VXVH 5CD3A 5J6HB 4HJ0C 4LSVL 2VUOA 15C8L 4PJ9A 4M6MH 3BUTA 2WK2A 4KV5F 2YD7A 4PUBL 5I75B 3CLEH 5C09E 2GI7A 4OAWA 1MHHA 3BKJH 5AD0A 3SDCD 4TUJB 4CN1A 4QRQB 1QSED 3SBWA 3SE3C 4I3SL 1AD0A 2EDHA 5HHNB 1FYHB 2AJYL 3KPLA 4M6NL 2FYYA 3BZFA 3CSGA 6FABH 3TH4T 3L5WB 4JM2A 3BP4A 2EH8H 4LHUB 3VFVA 4WTXA 2W0LA 4FFYL 4XCYA 4AENB 4OI7A 4PLOB 1CTOA 5A43C 2X5PA 4NWUH 3FB6A 1OCWH 5BQ7B 2DJSA 5BV7C 4G8IB 4ONFL 5T1KB 5MENA 5EDXA 4H8WL 4MDIB 4C56D 1E28B 1ZLWH 1EJ6A 4HBQA 2AVGA 3E6HA 4P3CH 1TIUA 4G9DA 4LGPB 1Q9OB 2D0FA 5JIHA 4GAGL 3ZYJA 4D9LH 1AGFB 2D31B 2EE3A 4RFOL 1BIIB 4P3WA 4ZSOA 3KR3L 1A8JH 3P3YA 1GGIL 4QNPE 1CLYH 3LPWA 3SKNB 2DQFB 5E94A 1TZGL 5JHDE 1ACZA 4OZIB 4KKAC 1MRCL 3EYQD 3EO9H 3RWGA 3HR6A 1CFSA 1P4BH 3K8KA 4U1HB 5BZWA 1A14H 4XXDB 3FQRA 3S37X 1HK6A 2WBJD 5DUML 2HT2C 5IESH 2AKRA 4WFEE 1YDPB 1HNFA 4RQQA 4G6FD 4JPVL 2XTJE 3IFPA 3HA0A 4K3JL 4WY7H 5CIPB 1ZGLM 3MRCA 2XXCB 4PGEA 3H7LA 3GSRA 4OV5A 3MJ8B 3FHAA 3NCYS 5BVJA 2H2SC 2AJUH 4D94A 4RAVB 3VWKB 3W81A 3L3OA 3WNLA 3L3OB 4XPAL 3MRBB 3EFFA 4M3KB 1I9RL 2X7LA 3RPKA 3NGBB 2VQ1A 3LN5B 1D9KD 3QPXH 5C0AA 4ZYKA 1RK1A 1EO7A 4WW2F 5JW5B 4LPYA 5ANME 1K4DA 2G75B 2PETA 4NRZA 4TTDD 2AJVH 1CXHA 1HILA 3HI6L 3RWEB 1CI5A 1MWAH 1WF5A 3GBLA 2IH3B 1P9MA 3IU4H 3WHE1 2EYSB 3PP3K 5CD5D 3SDDA 1CZ8L 3EHBC 1ZTXH 4MDJB 1HYSC 1SQ2N 3CDYA 5IT2L 5DRNB 5FO8B 3I9GH 2CKBA 4BQ8A 5EA0L 2HG5B 5D7LE 2LTQB 4ZUTA 5IMMB 2IPUK 1CL7L 5ICXA 2YA1A 1P4IL 5ADOL 5T1MA 3ZL4H 1KEML 5LCVH 2BXYA 3FOMB 3QUXC 4JFHE 1VFBB 4PRHE 1RIUH 4TQEL 3M45A 1XGTA 2O26U 4P9HC 3EDJA 1T7XA 1ZT7B 4HFUH 4KK8D 2XG5A 2YXMA 2I25N 1LVEA 4AEFA 1AGDB 1NSNH 3UJJH 3MGTA 7FABH 3UO1H 5MI0C 3QQ4A 2B4CH 2JK5A 3WIHH 4BKLB 4UTAH 4PJGF 1JYVA 1Q72H 4MA7H 1DUYB 3QWOA 1G0YR 4M1CD 1A14L 5J9PB 2HKHL 3JV0A 4YXHH 5CS7A 4JB9L 2F54D 1G7IA 2W0FB 3GK8L 4M1GH 5DD3H 1PLGL 4R9HA 1DLFH 3DX7A 3TO4C 5E2VL 5D1QB 5D70L 3LS5H 1FZOB 5LAXA 4HIXH 4TUJA 4NC2B 3EGSB 1AJ7L 1AO7E 1IAKA 4ZTOH 3L7FA 3IJSB 4PGDA 2V2WB 1DJSA 2EIEA 3ZYIA 4TTGA 5HPOA 3S3SA 3EKCA 2OTWB 3FRPG 1AH1A 5GZOC 3EYFB 2QQKH 1MJ8L 2ESVE 1UZ6F 4PB0L 3GBNL 3HC4H 4L8SB 1MAJA 3K8LA 5BVPH 1T2QL 2NXYD 1P2CA 3QNYA 3MGOB 4P23D 4O2CB 4W4OC 3P30H 5C9JA 4X80L 5T33L 5DJ0B 2DD8L 2B5IC 2OR9L 3V4VH 3DGGB 3BQUA 4AQ1B 1GXEA 1V3LA 4YGAB 3SDXE 1FORH 4G7VH 4PREB 5LBSH 3C09B 1QACA 1MRCH 1S9YB 4X9BA 4L1DA 3BMVA 4Z5RB 1XGQB 1B0GA 1ZT7A 4NZUL 3O6LH 1UCBL 2QADB 3LKSB 2DICA 3QZWB 1J5OH 5BOPA 5EO9A 3CDFA 5C1MB 5CAYB 4K8RC 1FDLL 4ETYA 4LVOB 4Z7UB 2A6KA 4U1NB 1VFAB 3CZFA 5F97E 5CBEB 4JM2B 4AZ8A 4UBDD 1BEYH 3QQ9C 4OCRH 4IIQC 1TPXC 3FFCA 1KTDA 4K8RL 4QRRE 5E2WL 1A6WL 4HS8H 1WICA 3CFCH 1JHLH 5LG1A 1GYAA 2PO6A 3DMMC 5K9QG 1PW3A 5HVHB 3RWGB 3BVNB 3SE9L 3QDMD 5FOBB 3TIEB 3SKNA 1WCBA 4WI2A 3ILPA 4IHOA 3CFBB 4XTRC 5D72H 3C9NB 1WZLA 1MCNA 1NAML 4R97C 3WDHA 5IVOA 4APQD 2BVUA 4XPBH 1XT5A 5A1AA 4ORGB 5CSGA 4ZO6A 5K9JH 3VXUD 2IBBA 4S0TD 3GSNL 3STLB 4P3CL 5E8OA 2B2XL 4FQPA 2NY4D 43CAB 2BNQD 3R06B 5CJOH 4MSWA 1U8PA 1VESA 1OSPH 2O5ZH 3RWJB 4KKCD 5JPMA 1GZPB 4XBPB 3O3DB 2VITB 3HPJA 1QFPA 1MCWM 3TA3D 3T3PE 4FXKB 4Y4HD 2CR6A 5KVEL 2OMNA 3WKML 3DUSB 2AJ3B 5IEKA 3G5VA 1QO3B 5H2BA 1AKJA 3ZKMC 1NGPH 3UTZA 3UTPE 2Y72A 1A4KB 5BW7C 1IFHL 2BNRE 4NHCH 3GMMA 2K7QA 5E8PA 1VGKB 3CUPB 4K23L 4F7MB 4ODSH 5BS0A 4QOKD 4HK0B 1V7NL 2EXWC 4ZOEA 5HXMA 3MQIA 4OZGB 2W1NA 3N1MC 5E8EA 3VXNA 4YUEL 5LWYH 1LK2B 5ISZD 1ZSDA 1AXSA 3FT3B 2IF7A 3KXFE 2CMRL 3LS5L 2AXGB 3QUMA 4N0RA 1AGBB 5I1HL 3RVWC 4H1LB 1KIQA 4KRLB 1QA9B 4L8DA 3BT2L 5DR5H 5B8CC 1AHWA 5I1EL 5I8OH 2X1XR 3BD3A 3GHEH 1I1AD 1JV5A 1M05A 3EOAA 5D96B 3MV01 5I66A 4PJEB 1YEIH 1MI5E 4QRQA 5CJ8A 1V3KA 3UTTB 1CDCA 4HUKB 1EX0A 1N5AA 4ODTL 2Q1EA 1E6JH 5D1QD 4Y8DC 1U6AH 4CVZA 1FC2D 1KJ3H 1IVLA 2ZSVA 5CD3B 4GMSL 4ZUWB 2EDNA 4YNYB 3DYMA 4JZNB 5CWSB 2YKLH 5GISL 5LGJB 3K80A 3I75A 4L1HA 4MZ2A 3V6ZB 1C08B 2Z8VC 4NQED 4NM4H 2Q6WB 2V5SA 2IANE 1RJYA 1LP9A 1A2YB 4YHLH 4M43L 4M8VA 1AD9A 2BHYA 4W4NA 4LF3A 4G8FA 4U1MA 3GIVA 3HMWL 5F7NC 1NDGB 4NUJA 1QR1B 5HPMA 5HD8C 2B5IB 5CJBA 2IH1B 2QQNL 4KKAD 2Z35A 5C0ND 3LEVH 5DHVH 5MEND 4KZDH 4JFOA 4K2UL 1HKFA 3RPIA 3N1FC 4OFIA 5HYSA 3ARQA 3EJYD 4QHLB 3TH3T 4NZTL 2NLJB 1MCRA 1XCTA 4XHJC 6CGTA 3GM0A 3X3GL 1U91A 5F7DB 3MRKA 3CVHH 1RZFH 2WWMC 1RMFL 3OAYK 2JJSC 1IZKA 2YD6A 4W6XB 2VDKL 3NZHH 5KW9L 3CVHA 4C54A 5D96C 3MA7B 3TJHC 1IRAY 2A6IB 3QI9D 3LRHA 3FQTB 3NTCL 3STBA 3Q2CA 3FQWB 1A7QH 1YNLL 4ZUVB 5T3ZH 3DYOA 3IXTA 2H2SD 1EEZB 1WAAA 1RUKH 1F3DH 4ODWB 5MEPA 3NN8A 1H15A 2AERT 1HKLL 2R69L 4EUPH 4IRSD 4IMKA 3X11A 2RB8A 1EHLL 3FFCE 1I85A 4F9PC 5TE7H 5TF1H 5E4EB 1UH4A 5E6ZA 1Y6MR 3VGEA 2V7HA 1ITBB 3AROA 2EDKA 5KOMC 3K8MA 4QHKI 5BZDB 3WNOA 5I8OL 3PABA 4JFYA 1QLFA 4QT5A 5F70A 1KEGH 3DV6B 4R4BB 1M71B 1NEZB 5C0CA 1SEBB 1P4BL 4MXWH 4OM0H 3X14A 2AGJL 2Q8AL 5L7XL 3LN9A 4FQXA 2X4TB 4OLUH 4QGTA 2VH5H 4YC2B 2EE2A 2AP2A 1HIML 2X42A 4OGXL 2AI0H 4P5MA 2JJTA 4Q74A 5EC1B 3FCTA 4KTDH 4P4KC 1QPPA 3T0DA 4RBPH 3DURA 2PN5A 4WY7L 1P6AB 3IDIB 5C08A 4V2BA 1LEKA 2NY4B 1D7FA 3IU3A 5DA4A 1IBGH 5FYKE 2BJML 1NGPL 4LDEB 1XH3B 2UWEF 3O2WH 4X8JB 3IAQA 4JO1H 3N1QC 4ZFFA 3DMMD 4RMRA 3T3MF 5DK2B 1UM6L 4I0PC 2LE9A 4TRPL 1YC7A 4HUVA 4G6ML 3ULSB 4DW2H 5TFSL 1NEUA 4NKMB 4ZAKB 4JFDB 2DQCL 3HFML 4NRXA 4TUKL 3RVXD 5KVGH 3IYLW 3ESVF 1R5VB 5T5NF 4ZFFB 4RMVA 3D85B 3NVQA 3UPRB 2NX5A 1H9VA 1JNNH 4D0CB 4HLJA 1OTUC 3SKOB 4LCCA 4R90H 1Q38A 4WNQA 5GSRB 4XBGA 1G0DA 5C0AE 3HAEB 3ROLB 3RAJH 4KZEH 1RV6X 2IAMC 1T03H 3WEXA 1P4IH 5KS9A 3PWUB 3KYMA 5TF1L 1XF4B 2NZ9C 3KJ6H 2UY6A 5DYOA 5B39A 2NW3A 1KPRA 4ODUB 5ALBH 1F3JB 5C0GA 3CFDA 2NXYC 3EOBB 5I0DA 1HH9A 4XCEA 2CDGB 4ZFZB 5ISZE 3IRZA 2EKSB 2KQMA 2MCPL 1FG2B 1NFIA 2RIKA 2R0ZH 3MBEB 1QRKA 1JK8A 4M7ZB 1AR2A 1QOKA 1MLCA 3VFUA 4PV9A 3IF1A 5IQ9A 2MFNA 3FO0H 3HRPA 4Z7OE 4KZDL 2NY5C 3ZTJH 1WEJH 2GK0A 1HEZB 3T3PF 2GJ6B 3BEWA 3H3PH 3W0WD 1YEHL 1MI5D 5FHBL 3CPLA 3ZKNC 4R7NA 4ZSOE 3ALWA 1WWCA 2XKNA 3V6BR 1MHPH 4Y4KB 3Q48A 5HJ3B 4LHUD 4O2EA 1YYLH 4ZFOA 2EC9T 4OCXL 4GRLC 4Y7MA 1VSCA 2I5YH 3QXTA 5L8LB 1KFAL 1DQMH 2O61B 1JPTH 2X4TA 1UB5B 4JFOB 3MV7D 5H35A 5LQBL 4ZFOB 4NSKB 4WFFE 4HC1A 2LU3A 3QG6A 3SGJA 2XA8H 5EFIA 1DQQA 1AI1H 1T5WB 3IDMA 1KIPA 1F4XL 1FFPB 3F7YA 4PPTA 4ZO7A 5F71A 2FWOA 1OB1B 2YS4A 1CDYA 2OR7A 2GK0B 3BP6B 2FJHA 2X4OA 2A6JA 4UT9L 4XAKE 1J0ZA 3ZTNH 2VDLH 5DWUL 4EBQH 4PV9B 1HSAA 5E2UH 4EUPB 1JWUB 3UYRL 1K8IB 2NPLX 4APQC 1NUGA 1S7UA 4JPWL 1MFNA 4BFGA 4PJAA 1Q9LA 3P9LA 4YE4H 1BVLA 3DXAA 4YZFF 3D9AL 1KYOK 3C8HA 1KOAA 4JPIA 4ODHH 1LD9B 4LAJH 2WLYA 1RVFH 5ACZA 3L1OL 3N9GH 4PRHB 3UTSB 3X13A 3RZCC 3RWFA 1U58A 5H8DA 1XH3A 1MCPL 3C2AH 4YHNB 4XHQA 5JO5A 3V0AC 3F8UB 2F19L 3MCKA 3QQ3B 4JKKA 3LV3A 1JMZA 1MHCB 4N0CC 4ORZC 4XHJD 1ORSB 2DI7A 4HBCH 5C0RL 2Y1VA 3DIFB 3TA3C 4WU5A 1JHLL 1KIQB 4EI5C 4K3GA 4CJ0A 3ARFA 3BE1L 3WUWG 4QO1A 1IC7L 4QRSA 4YLQT 1TQBB 1K2DB 1BWWA 1OL0A 1T6VN 3VI4E 2JB6B 3KYNA 1M7DB 5AYQA 4G5ZH 3RWIB 3GO1L 1A3QA 4ZG1A 3BRFA 3H7BA 32C2B 3FRUA 5JXAH 4BQ6A 2VABA 2FIRT 3MLXL 4Y5VA 1J11A 1D9KC 4G9FD 4R2GD 3RU8H 3U46A 4YNYA 2UWEE 2X9YA 5C09A 5JXEC 3CFDB 3HCVA 2F5AL 1DTUA 1QSEE 5C0BE 2BVPA 1MREL 4WWKD 2F15A 1OARL 1OF2A 3BESR 5E08H 1T0MA 1E4KC 1JIBA 2IAMA 4TSAL 1G6RH 5JQ6L 1X7QB 1RZKC 2A6IA 3PDOA 4Y5YC 3DTXB 3X12A 2EIDA 4OLWH 3U0TA 2QADD 4Z0BL 3SCMA 4WGVB 4R8WL 5EIIA 3E6FA 4HFWA 2D9CA 5JORA 3SKOA 3ARDD 5DK0A 3U7WL 2GITA 3QUXD 4H88L 5DS8A 4LLUB 2PCPA 4QTHB 3SDCB 1S7RA 4R4FH 5IB2B 2HH0L 1S9WB 4U1SA 4PJGA 3D0LB 3DUUB 2D2OA 1JPST 4BZ1L 3DV6A 4TVSa 4OUUA 3AS0A 4J6RH 1NFDB 1UJ3B 4MQ7B 1NDMB 1IBGL 4LF3B 1EVTC 2G5BA 1D6VL 4KXZH 3RKDD 2VLRB 3IJHB 4TNVF 2GAZA 3KPRB 2EDXA 1NAMH 4WI6A 4OFKA 3OKNB 4CL7A 5FOBA 4OGYH 1H3PH 5D1ZC 5E9DA 4YDKH 3SKMB 1BZQK 2E9WA 4XT1C 3EYOB 3SDYH 5GJSL 3TWCH 3DECA 2VITA 3HPJB 4PJ5B 2VQUA 3O3AA 4LCIH 2BVOA 1NBYB 5A2FA 3HNVH 5I73C 5I1EH 2JJWA 1C5DA 1CLCA 3G6DL 4Z7VE 4PV8B 3SJVA 1RU9L 4K7PX 4Z76A 5HGHB 3VD4A 3FN9A 1MY5A 4HPOH 2BVYA 4C83A 1XCTB 4KUZL 4WHDA 1MFCH 4LEXL 5HI4C 5TF0A 2NR6D 5FCUH 3ULUF 2Q8BH 3JWOC 2RJMA 1B0GB 5F7WC 4Y2DB 1CFTB 1JPGB 4I0CC 1CE1L 2ZPKH 2WBWB 1LK2A 2DQIL 2X4PB 4X6CF 5C0IA 2AQ3A 2W07A 3HB3D 4NHCL 3ZO0A 3MJ9L 4AEIL 2DRUA 3BH8A 4E41B 4JO3H 5I1AB 4M3JA 1BVKA 2J8UA 4NJAH 1C7TA 4FS0A 2J6EL 4HF5L 1EERB 2GCYA 3S96B 5D7LD 5INDB 5GIRA 4HXAH 2J2ZA 4U6YB 3U0WL 3T4YB 2AJ3A 2ZCHL 4XAWH 5CLWA 1QRNE 4W6WB 5T5FH 2AEPH 4XP6H 4F15B 1JGLL 1U3HD 4UTAL 4BK4A 1X4XA 5CBEA 3PWJA 4LCCC 1U8LA 3OAUL 4Z6AT 2NX5D 3ARGB 4EIGB 1T6WA 4KJPC 3GJEA 5GRVK 3ISWA 3WCYA 1AXTH 4LRNH 5KZCD 1EZVX 2DN7A 4C57C 3VXSA 1KCRH 3PGCA 4KGJA 43CAA 1ODAA 5D7KE 2VDOL 2ZZUT 2ADGA 1KPUB 4I0PD 4NN6C 4PREA 3KXFB 1GJIA 1FGVL 1J1PH 1NDGA 2Y6SC 4MB5A 2A2QT 2ZOKA 4FQXD 4EN3B 4U6VH 2ZNWA 1GHFL 5E1HB 4PJBE 3TVMA 3HI5L 3G5YB 2VAJA 4XNZB 4PRID 4GKSB 2FHFA 2OQJA 4YQXH 1N7ML 5E00B 3CFIC 1AP2B 1H5BB 4ELMF 5EZLA 4NQTA 1LE5A 4H25B 5LVEA 2NY4C 2XRAL 4YXKH 2XN9D 4FFWC 2WAHA 4N8VB 3RZCD 1W2KT 3WIFA 2GEEA 3EOAB 5FFLA 5I66B 4KDTC 1RUAL 2VJXA 1RZ8A 3RTQB 1YUHB 3AS3A 2IANB 1SMAA 3VWJA 1OAUL 1OAQH 4LVNB 3QWRD 2BMKA 3C6LC 2EDTA 5IMLA 3DNKA 4QRUB 3ZDYE 2FRGP 2B1HL 5IW3A 5D7JD 4OCYH 5CZXD 1V7MH 4ZXBD 3UJIH 1NJ9A 3K46A 5F7KC 2A1WH 5TFSH 4LGRB 5I8EB 3WD5H 3CXDL 3V6OA 1CG9B 2BFVL 5ESQB 3OF6A 4B7IA 1KJ2L 1XIWD 4KROD 1E4XI 2EXWD 4EUPG 1C1EH 2X4UB 3VXUA 5CINL 1CT8A 5HHMD 4KFZC 3BI9X 1R3HB 5EN2B 2WUBH 4XCCL 4R2GC 4K7PY 4LFHG 4LMQI 3V4UH 5IIEB 1AKJB 3MCG1 3W82A 1JN6A 1CD1A 3V6FA 2FHBA 5T1MB 1A6AA 5IJKA 3PDDA 2ZG1A 4XVTL 4KMQA 4WENB 3GRWL 3RZCA 2EH7L 1Q1JH 3LKOA 1BQLH 3QFDB 3SN6N 3WS3A 4PB9H 4XXDA 3QDME 5D7IA 3L7FB 4GKZB 2YN5A 2OMBA 1AXIB 4NN6B 2QQLL 1FZOA 4UNVA 4JKPL 5C0DA 3GJFK 3QIWB 2FBOJ 2ADFH 2EYTA 1ZHNB 5DRWB 4XI5C 3WMSA 1B3JA 2W0FA 5D93C 2QL1A 4K3DL 4J3UA 2IPKA 3WE6B 5J11B 1KLFA 1QFHA 15C8H 4LARL 1PSKL 3U9PH 5IG7A 4M93B 1ZGLP 4MDIA 2HTKD 3BYTA 3RL2B 3DGGA 1ITCA 2V17H 3QDJD 1A6TA 2BNQE 2V9TA 2WANA 2XZQH 5DEGA 1P2CB 3QNYB 4O9HL 5DRWA 1JP5A 3MGTB 5A3IC 3CSYB 5HD8D 3Q5OA 5E6ID 1TTUA 2P5EB 3MOAL 2IFFL 5D1ZD 1I1AA 3MJ7B 4DVRH 2D7MA 5M94B 1OCWL 1PYWA 1HXYA 3OKLB 3IB4A 2CJUL 5F9WC 4QF1A 1U8QB 4XNXH 1K4CB 3O2DH 5FM8A 4FFYH 1C12B 5IB4A 1FZKB 1H3GA 3BDBA 1T21A 3QULB 3QHZL 1GVIA 3WIFB 3C60D 2VUYA 3KLDA 3STZA 1RZKH 4J3XA 3STZB 1CFSB 2ERJB 4JFDE 4Z8FH 3ZE2F 2A6KB 2ICWB 4M8QA 3CZJA 3V6FB 3ARGD 3MROA 2H8PA 4P9HL 2H41A 1R3LB 5FHAL 1CXFA 1M1SA 5D1XB 5FB8A 2NNAA 1LK3H 3IFOB 2Y06L 5HGAB 3HUJF 2VLRD 5TE4L 5CP7B 2NW2B 3UAJD 1EK3A 5SWSB 1N0XL 4OCNC 1YEKH 4S2SA 5BO1L 1YEIL 4FTVE 4L9LC 4RGNB 1N7MH 1BZ7A 1BZ7B 3VXRB 1TQCC 1YN6B 3D9AH 4CMHC 1QRND 2JB5H 3MRLB 4JFXB 5JXED 1FO0H 1HE7A 2Y9RT 5I73B 4ODTH 1WT5A 1J05A 3SPVB 4Y19D 3H3KA 2VE6B 2R1YA 2V2TB 1HINL 4WWKC 2NX5E 4PJIA 2P8MA 2OL3L 4FQ1L 5DZNA 3QR2A 3L5WA 2DF3A 2DAVA 4PP2A 2CKBH 4ZPTA 2E6QA 1NC4A 3MZGB 4G7YH 3TPUA 4D0BA 5AAWA 2FECL 2XTJD 1ZLUH 4LIQL 3T2NL 2F53D 4DZ8B 1DVFA 2ICWA 4GG8B 2AEQH 5D2NB 3I50H 3MJGX 5ISZB 3BO8A 2R4SL 4F57H 1F6AB 3B9VA 1M4KA 4GAYA 1YEDA 4NC1E 4XNMB 1XGUA 4GKOA 2GFBA 3DX7B 4PD4K 3WS6A 4XAWL 3VFRB 3WFBH 3LKOB 3WS3B 5FYKH 2WBJB 1T1WA 4LNVA 3CLFH 5KSBF 3V0WH 4KJYB 1KCUH 4FMKA 4GKSA 4LSQL 3MLZL 1SHMA 4EN3C 2HT4C 3ECBB 1NC4D 1T7YA 2F8OA 1LP9F 3G5YA 5DJAB 2VDML 1LEIB 1D5ZB 1MELA 4NZRL 1AE6H 4R97B 5IB1A 4NQCA 4OKDA 5J12C 2JK5B 1CGTA 2IBZY 1U8MB 2I9TB 1MAKA 3BQUC 3GUTA 4ZO9A 2YPLD 2C3XA 3WDJA 4NN7B 4APQA 4PJHA 1F13A 2P46B 5L8KB 3BH9B 1JF1B 2DIBA 4P4RB 4LLYB 3OGCA 3BZ4B 2PW2B 3F5WB 2VR9A 3D3VD 1P7HL 1BOYA 4YHPB 4A2LA 3P73A 5H37H 4NQDE 1EBPA 4ZUTB 4Y8AA 1PZ5A 2IAMD 1J0HA 4KK6C 1C5DB 5SWZE 4GRWH 5FIEA 1MCKA 1RHHA 5EPMB 5T3ZE 1FHGA 4UB0L 3RTQA 1YNTA 3D39A 2CRIA 4U6YA 5DMGC 4QXTA 2LAGB 3GMPA 4DN3L 1XF2B 2J1KA 3QIUB 2HRLA 4V1DE 1UADC 4TNWK 4BH7B 1HQRA 1YA5A 4PJ8C 4AY0A 1A6AB 2VH5L 3CDCA 3OB0K 3HS0A 2OK0L 4PJ9B 2APXA 4Z7VF 5TPWH 2DIAA 4X0KA 5DXWA 3KLAA 4IMLA 3PXHA 4ZXBC 1BM3H 4MNGE 2UZIH 4KV5E 4OD3L 3LRSA 5GGVY 1S7QA 2A83B 4AG4L 5GPRA 3IKCA 1MFAH 2B1HH 4UAOB 1F90H 3ULUE 1YY9D 1OT2A 1NCUA 3BGMA 2KZ1B 1S9WA 3ARFD 2FHCA 4X4YB 5LKNA 3VRIB 5I1LB 5KSVB 4NIKB 4YJZL 1MRFH 8FABA 3GBML 2ADGB 3IT8D 4FZEH 2FIKB 5MHSD 3CFEA 3IFPB 4LPVA 3TNNB 4B5EA 1WVZA 4X98B 3VXSB 1DVFC 4Z77A 5CJ5A 1SYSB 1VEOA 2ZUYA 4OZHA 1DEEA 2KKQA 2VLMD 3GZKA 3T3ME 5DRZB 1LHZA 1ERNA 1F58L 1OGTB 2ZCKL 4G42B 4MS8C 3GKZA 1CN4A 3MLSL 3FT4A 1J88A 3UC0H 3JV4A 4ONGH 4H1LH 4QXUL 4YFLF 1EAPB 2V5YA 4UT6L 3D0VA 4U2ZA 5T3XH 3GMLA 1WC7A 1QSEB 2Z9TA 5IESL 1F2XK 1RUPH 4WI3A 3QEQA 1FO0L 1TVHA 4AT6A 5HHQA 4NBZB 2FO4B 3V9FA 3IETA 3RBGA 1WZ1L 3SOBL 4P23B 2FL5B 3KPNB 1NCAL 3KJ4C 3GSVB 4LHJB 5DT1H 2V9RA 4UAOC 5SWQB 3HUJE 3GB7B 3QIBC 1QKZL 1AHWC 3I2CH 1DBAL 4CKVX 4WEMB 2YMXH 5DD1L 3VXMA 4F57L 2FX8L 4HUUB 4EI5B 4F33A 1NGWA 4I0PA 4RGMC 3SCMB 3O4OC 1K9TA 1KGCD 3QQ3A 3ARSA 2C3GA 3KPLB 3O2VL 1NFDE 1KB9J 4G8GA 4P2YA 1U36A 4U2YA 4CADA 5L2KB 2VLRE 3GMNB 1A64A 1RULL 3IU4L 2DDQH 3UTSA 4NO0D 1MFAL 1BBJA 1YJDH 2MKLC 1CFNB 5IVZA 1FGVH 5F21B 3MO1A 2R0KL 4IEFB 2VIRA 3DXAB 2VWEE 5T1DL 3B2VL 1UYWL 4PJ5E 2H9GB 1MRDH 4C59B 1CL7H 1PBYA 4KQ3L 1QFUH 3W0WE 2VLKA 5HHOB 1MLBB 4YDLB 2ZKHL 5BRZE 3P4NB 3F7VA 5CKAA 3QXDA 3HMXA 4XMKL 3VW3L 5KSBE 3OJDB 3IDNB 4KPHL 3VCLB 2FB4H 3GDBA 4LKCA 3TVMD 4UQ2B 1FDLH 4TTDC 1MWAA 4MWFA 2YPVL 4Q6IB 4RX4A 3U1SL 5I15H 1IKFL 5EFIB 3I3EA 3O45A 4LSRL 1N0LA 4LPXA 2WIIA 1D5XA 3DETD 1UB5A 4X6DE 2VQTA 2JB5L 4O02H 5B39G 4P3DB 4N0YL 4F7TA 1BJ1J 5I74B 1C5CH 4CVXB 4WW1B 4EOWL 5HYJA 1RUPL 3AAZB 1KELH 1QBMH 4Y4KA 3UTPD 1RVFL 5JW4R 4E41E 1N5YH 4YBHA 2R4RH 2CMRH 4HKZB 4JPIB 1V7NH 4Y4FB 1CXIA 4QOKE 4HIXL 1CFBA 4NKQB 1JZ5A 1PY9A 3TYGH 5LWYL 2X10A 1Q9LB 4QXGH 4WUUD 1RUMH 4GW5A 2YPLE 1YEHH 1HHJB 5JHLH 5FO7B 1QRNB 3IVKA 2P48B 4C4KO 5JLZA 3NCJH 3BEVB 2EC8A 3DARA 3CFKA 5CINH 5FYKL 2ED9A 1MFDH 4AEHH 3FN3A 2EEBA 3AY4A 4PRNA 2VLJA 1H0DA 4M1CC 3RGVA 1UJ3A 2AJZB 5HGBA 1I7RB 2ZUXA 4O4YL 4OT1L 1L7IL 1FV1A 3EYQC 1QP1A 3ZKXC 1FE8H 4OD1L 1NBVL 4NSKA 4P49A 5IB3A 3AMLA 4JZJB 4N8PA 4OFYA 3OXRB 3SDCA 1ZT1A 4TSCL 5EUOB 2Y07L 5CGYD 1UZ6E 1R0AL 1OPGL 3H9SE 5F3HB 3JV5A 4YHLL 3U0PB 4HFWB 4EDXB 3KVQA 4U7KA 3VDCA 3TP4A 4ALAL 4AK1A 4FQLL 3ARYA 3FB8A 3BEWB 3QDGB 2GJ6A 5AG9A 2YA0A 3SDXF 1IAOB 4AEEA 1A1NB 2BSRA 2I07A 4X5XA 5IBTL 1U58B 2Z0BA 5J12B 1TXKA 1WGOA 1XGYL 3QEGL 3MLVL 1INQA 5DGRA 1EZVY 4QNPF 3DI2B 1VA9A 3MV9B 3DX8A 5ILTH 2G60L 1CICD 2EIZA 1D9KB 1RJLB 3EBAA 4PJIF 1N8ZB 3FONB 3QUYA 3F12A 3CK0H 1MFBL 1X5JA 5E7FA 2Z92B 5E9DD 4PJAB 4Q2ZA 3O6FA 4DOHB 5IOPA 4X7FC 32C2A 1DE4B 3FT2A 3ES6B 1HSAB 4K55A 4IDJH 4Z7QE 1KV3A 4X8JA 5D6CA 2QLVB 3H9HA 1QBBA 2E27L 3BP6A 5FYLE 4DKFL 1KJMA 3DLQR 1IEHA 2CLZB 1FVCB 4M48L 1KB5B 3EO0A 5F89B 3PWUA 3H6JA 5ELIA 1AY1H 4JHWL 2DYPA 1S7XA 4JY4B 4UINH 5F3HA 1FCCA 1IGML 2D4DA 4WWKB 1YY8A 2IADB 4MS8D 3SE4A 2HJFA 3MLXH 3AGVA 1WSST 4NQVA 2FGWH 2VZUA 1NEZA 4GFTB 4Z0XB 1KCVL 2PF6A 1U3HA 2H26A 4JFYB 3HZVB 3ZDZE 4MNQE 3SEPA 2Z91A 5DEFA 1NCNA 3ELAT 4PRNB 2XWBA 4CGTA 1U8OB 3PWNA 4M1DL 5D7LA 1DBMH 1F4YH 2BZDA 3ARUA 3MUZ1 5DWUH 1UACH 4LBEB 5I1IL 1MCJA 1IEAA 3LZFL 1H15B 3NFSL 5C07B 3LQZA 1N59A 4NO0A 3D2UB 2OR9H 3V4VL 3L3KA 3FQTA 1UEMA 2HRPL 5C7XL 1OTTC 4JN1L 5EO0B 4I18A 5C0GB 5FYJL 5EBWA 1A6UH 2DQIH 1AQDA 4UZGA 1WBZA 2BJMH 4NC1C 5JPNA 2ATKA 1E4XL 1GGCL 2BVTA 3R1GL 1FZMB 4F2MB 1AIFA 2EDFA 4OF3A 1CGSL 4KK6D 1MQ8A 3RUGE 3NFNB 5KSUA 5B4MD 4GXVL 2X89A 4MJ5B 1UM5L 4QHNB 1OOAA 1BLNA 3MNVA 3MRRB 1NCDL 1OGAE 4XBGB 4L5FL 1MCOL 1OD9A 1RFDL 5DD0L 1IC5L 1WFUA 4TUOB 1XMWA 4KKBD 4YDIL 1CDBA 4Q9RH 5GJSH 3TWCL 4MXVE 4JDTH 1S7VA 2VDMH 1A0QL 3PQYE 1EUTA 4HS8L 4FQIL 1IQWH 1HHIB 2BOBB 1I3RA 5SV3A 2CK0H 1JZ2A 1MLCB 1F00I 4NFCA 3WN5A 3HE6C 1ZEAH 2VXSH 3RL1A 1YJDL 3FOLB 5IUSA 1QBLL 4OB5H 4HEME 2R2BB 3NIDE 4HWZB 5JQHC 3REWA 3V8OA 4ETQB 1HYRC 4KMTL 5I8CA 3ULSA 2X1QA 5EWIH 4CVZB 3PF2A 5L0QC 1A5FL 4WFED 4CMMB 1KPRB 2BCKA 4N90E 5BJTB 2BSRB 2NCMA 4P4KA 1S78D 4LLAA 3V0VB 1MH5B 2YD4A 3VXQA 4PRPB 4D9RE 4PY7B 5I18H 5SWSE 4OQ1A 2PUQT 4DCQA 4FTVB 4EVNB 4RGNE 3ROLA 2X6MA 1CTNA 3VXRE 2XN9B 1FYTE 3HC3L 2DYPB 3KPOA 4TOYL 5E8DH 4Q6IA 2P45B 4HX1A 3MCLL 4X4XB 4EEEA 4NZTH 1OWRM 1VEMA 2VZ3A 5L88L 1QNZH 3VH8A 2HKFH 2YD5A 4MMXC 5GS1A 2LU4A 5D6CB 3B3IA 1T0PB 2BHZA 1OAZH 2W0PA 2WQRA 5BS0B 2BSED 2RBLA 1QSVA 3DWTA 3EOYG 3TO2A 5D2NE 3PDGA 1DLHA 5ESVB 3TYGL 5A3ID 1QO3A 5H2BB 4X6EB 3DX8B 4ODSL 2R29L 1OAXH 3G6AB 5IV2A 1AGEA 4HCRA 2CDFB 1T5XA 4CNIB 1JZ3A 3IXTB 5CEXA 2XA8L 5CEZE 3HG1E 1Y18A 3SE8L 2PW1A 4DGVH 3WHXB 1WCQA 4NJ9L 2HT2D 1QYGH 1LDPH 3C60C 1J8KA 4OZHB 4WW1A 1KCVH 3QUMB 1FJ1A 3LKNA 3O4LA 1IL1B 2UYLA 4D8PA 1DP0A 2DLGA 3DI3B 1WTGT 2VDRL 4LU5H 2WMPA 4XVTH 5IHUH 1FLRL 4HLZG 1KPVA 4NQCD 4HGWB 4LSVH 4ODHL 3V8CA 3WXVH 4YDVA 3HTLX 1MWAB 3IGAA 2FO4A 5HPMB 4NYLB 3H3BC 5C0EB 1WFTA 4HIEB 1CICC 1LO3L 4NQDB 4NOBA 3QRFM 1XF3A 1AD9B 3BUYA 1AGCA 3BDXA 5IVXB 1FFQA 4YGVB 1JUFB 5SWZB 1G7JA 3TIDB 1C16A 3DUSA 4L8CB 3KPQB 4NWTL 1G7QB 5BW7A 4WI4A 5D9SA 1CICA 3CK0L 3MO1B 4RFNB 5E8DL 3FQXB 3CVHB 2BSSA 3LN4A 3OWEA 5HHVL 2IWGA 3MRNA 1UWEL 2ESVD 3MRKB 4OF8A 1LEGB 1AI1L 4BSWB 3P4MA 2FATH 2J5LC 5GRXG 2C9AA 1Z2KA 3STLA 3CH1A 4RMTA 4LLYA 5I1DA 4U6HA 5CKGA 1OARH 2AQ1A 5J56B 2D7PA 1KTKE 4KK8C 2ADJB 1ZWIA 2DLEA 3BOVA 3ZE0E 4LVHB 4WEBL 4JPKL 4WV1A 2VDKH 3NZHL 2LQRA 5KW9H 3S6CA 4LKCB 3O4LE 3MNWB 3IKCB 2C3VA 3OKEB 4K71C 4PBXA 4XVJH 5DJ0A 1I9JL 1WISA 3BPOC 1GRWA 4XWOD 1VB9A 4U6XB 1O0VA 2EDOA 3HI5H 5HDQH 1C08A 1VGKA 3CUPA 1CGWA 3DX6A 1HI6A 3VXPA 5EBGA 5F3BA 1KENL 3S36L 5GGTH 2A9NL 4HWBA 4KI5F 1I7ZB 2W65A 4JKPH 2OTWA 3FO9A 2UY7A 1A9EA 2VZOA 3ARBC 2K7PA 2RGSA 4F7PA 1GGBL 3EJYC 4XNMA 3L3JB 3UO1L 1PKQA 1MEXL 4F9PA 4XNQA 4YO0A 2FBJH 4IS6B 2FX8H 2ICWI 2ZCLH 1N2RA 5LAXB 2YK1L 3V5HB 1GZPA 1UXWB 4PGCB 2FJFA 3MRPA 4JN1H 2YRZA 2E6JA 3B2UC 1I9RH 1P1ZA 3DROB 1LE9A 5HYJD 3VXMB 2QR0A 3PWPA 1JYXA 1BBDH 3HUJB 1DLFL 2DS4A 8FABB 1XIWB 3DVIA 3VXNB 4X4YA 1T04A 4O00A 2OM5A 1INEL 3GSNB 3GNMH 4HKXA 1SY6A 5KANG 1T2XA 3HE6D 3ZDYF 3MA9H 2WM0A 3B83A 3G6DH 1CDIA 1MFEH 1TVHB 1U8JB 2B1AL 3MLUL 5HDBF 3VXSD 4XPHL 1RZKL 3GEWB 3SGJC 4LP5A 1YEGH 3HC0B 1ONQA 3CC5A 3C5JB 2DD8H 1F4AA 1GIGH 5DJ2A 1I3UA 5EOCJ 3T04D 2WSKA 5SWSD 2FB4L 4PLNC 1GGIH 3JWOH 5F96L 4NJ9H 3UBXB 4WW2B 4ZUSA 4Y5YA 2VN7A 2UVEA 4BH7A 3ZZ1A 1MCBA 1MQKH 5D5ME 4HIIB 3DVFA 1JCKA 2VB5A 3WFDH 3NIGE 1RHHB 5EPMA 3RWJA 1YMME 5ITBL 4DQOL 4NJAL 1U8PB 1ORQA 1ADQH 4BH8B 1KF9B 2QHRL 5E8OB 3VFOA 2H45A 3SPVA 3RJDA 5IKCA 5BCAA 2ADFL 1F4WH 1K4DB 2Q3AA 2JIXA 3QBTB 5DD6A 5DD3L 5D8JH 4DKAA 2VQ1B 4PJ7F 4ZQKA 2UZYB 1HZHL 1S9YA 3LKPA 1S9VA 1TQBC 3E1F1 5HGAA 4S11A 4PJAF 4U3HA 5KOVC 3CFBA 5HYFA 2BOCA 4O2CA 5F8QC 3DSFL 4PFEA 4PGEB 3AY4C 4YR6B 3ECBA 3MV8E 4MJ2A 3QT2A 3V7MA 2VC2L 3HZKB 3VFWA 3G04B 2XI9A 2XY1A 2AKRB 3CCHA 1IZJA 4KKCC 3EO1B 1F6AA 4D9QE 1IKNA 4OLZH 4U1NA 1B90A 2GW5A 4FXLA 4GG8A 3BPCA 3GMQA 3GSWA 1JGUH 4JHAL 4KHTH 1F6LL 1MUJA 3HHRB 3TPUB 4ISVB 4D0BB 3QYCA 3HE6B 1HHGA 5FDWB 1BIIA 3LHPL 1NLBL 1Y0LA 1DBKL 1G7IB 5ACMA 3MJ9H 3LCYA 2VXUH 5K9QI 5DRXA 4QRRD 1FNAA 1FPTL 2VLLA 3GI9L 3DRQB 4RAVA 3UC0L 1DCLA 1K3IA 1IARB 3QRGL 1YN6A 3T0EE 1JRHH 3NCCB 5IQ7L 4NNXA 5BVJB 5DHYA 3MBXH 5AZEL 4ISVA 4OLUL 2MTPA 2VLME 1AGDA 4PG2C 4I48B 4JREC 2VXQH 1R3JB 3BP7A 1SEQH 3IFOA 5E56A 4HJGA 3FJTA 5J8OA 2OSLA 5IM7B 2E27H 4M1GL 4WDIA 4GRLB 1CU4H 5FO9A 3I3DA 3EYVA 4XCNA 1ULVA 1GPOL 3VI3E 3MV9E 5D1XC 1JHTA 2OZ4A 3TN0B 5KVFH 1T22B 3JTSA 3JTSB 1U8KA 2BDNL 1BX2A 1PKQB 3BT2H 2YD2A 3W2DL 1I7ZA 5DF0A 4GRLA 4DW2L 1I7UB 3EO9L 3U9UA 2YMXL 1U8IA 4ZTPL 5LXGH 1MJ8H 3NMEA 1ED3B 3BP7B 2XTLA 4M7LL 2DWEB 1H3UA 3V52H 3W9DA 1QBLH 4AM0B 1FNFA 4AIXA 3TNMB 4OI8A 3RKDC 4BKLA 3RL2A 4PG2A 2IQ9L 5BV7L 4MCZA 4YH6A 2DWEA 4HH8A 4P9ML 3VI4F 5FYKU 4CW1B 4KQ4L 3R0NA 1I8LC 2DM3A 2FX7H 3LRGA 3DGCR 1H3TA 4JZOA 4HAFA 1VPOL 3IDUA 3MJ8A 1UYWH 2QQLH 3BZFB 3WKMH 3F6IA 4XMPL 1Z9LA 3M1BA 1AKJD 2EYTB 3ARBD 4G80A 5EBMB 4MNQB 3EAKA 4PJEF 4YHYB 1KB5H 1W0VA 4U1GB 3L3IB 4TSAH 5EU7E 3U6RB 2DMBA 4GH7B 4Z95H 1EEUA 3QP3A 3LD8C 3OL2A 3MOBL 5C07E 4N0FA 1BPVA 2EYRB 1RZ7L 3S96A 2OSLB 1ZT4A 3KPPB 3OKLA 3WN5C 2F53A 4HH9B 2Y4SA 3DX6B 3VXPB 1UB6A 4GQ9L 2P5EA 5DFVC 2E9IA 2XWJA 5IMOA 3UDWA 1JN6B 5E1AA 4KY1L 3GSQA 4XP4L 2IFGA 2ATPB 2YUVA 4MB3A 1A1OA 1RZJH 4Y2DD 1VFUA 5DD5H 2VISB 4WV1B 9CGTA 4ZQKB 2H2PD 2WWKT 5I8EA 1CR9H 4M62L 5FV1L 3GSRB 1P1ZB 2BVQB 3CH1B 4JFDD 35C8L 4MJID 1IL1A 5B8CA 4P4KD 1A7BA 4LHUA 3PQYB 2P8PA 3WNPA 5BO1H 4PJFA 2CXGA 1GZQA 2M26A 5BRZA 4XNQB 2H6PA 4I5BA 4JZJC 3S36X 4J1UB 2HN7A 3W0WA 3EO1A 3WHXA 1RIHL 2EICA 4DJMA 1BQHB 3KYKH 4OT1H 1A9EB 4FFZL 2F74B 4XXCA 3MLSH 1Q9WB 4PJ5A 1VDGA 1N4XH 4N8VA 4JM4H 4YDJB 4EBQL 3OB8A 1SYVA 1MQKL 1S7SA 3BGFB 3MRHA 3BH8B 5KSAB 4E0RB 1BFTA 4Q6YA 3W11D 5DUPH 5DJ2B 2GTZA 3O6KL 2G5BB 3DRTA 3KPSD 3Q6GH 1OAZL 4XMPH 4MD4A 4PRPE 4R0LB 2HLAB 4IRZH 1RIVL 1UJ3C 2Q7NA 1LNUA 1CFTA 3QCTH 5GSVB 4P2RE 2A1WL 5HGDB 4QRTA 3O0RH 1UM6H 1KC5L 4S10A 5EULV 4OZFH 5EOCL 4AENA 2OYPA 4M7JL 4C83B 3MV7E 5I1HH 1CBVL 3QG7H 5GGVH 5IMLB 3L5IA 1ND0B 3U7YH 4JRXE 2VTFA 3P9MA 3VWJB 2FATL 3OR7B 2GSGA 5F1NA 5B4MC 3O9WA 1Q9KB 3PDOB 1I1FA 2P49B 1MCHA 3QEQE 1A7PL 5D71L 4MJ4A 5CEXB 4YHIA 1T0MB 3SE3A 4G5ZL 3BMWA 4LLWA 3OG4B 1VEPA 1GC1H 1FO0B 4YHKH 1SBBA 4M48H 3G6AA 1NGQH 4KKBC 3T0BA 4CBPA 4H25A 4PB9L 1U41A 4U49A 5J6HA 3MRDA 3KPRA 3U46B 4MVBD 2A38A 3CC5B 4IDLA 3REWB 5E00A 1MJJA 1WBXA 4MCYB 4ZS6C 5E6IB 5GGRB 2HJKB 4LPTA 5DTFA 4HHAB 4ELMB 4HS6A 5I2IA 1FAIL 4U1LB 4UIKH 1MREH 2DLFL 5MEOB 4JRXA 4LLDB 4L4TA 4OZHE 3VFGH 5C0FB 4JO2H 2XIDA 4J4PA 4P46A 5CILL 1W8OA 2V5RA 2Z31D 1XIWA 3GMRB 2XT1B 2DKMA 2UYLB 2ZSWA 4D8PB 4C56A 3S35H 3THML 2FO1A 1RK0B 3MJ6A 5E2TL 4KAQL 3QPQC 4RGOL 4MHHG 4OIAA 3T8XA 2X4SA 1Z0NA 1N6UA 2YK1H 2AK4B 1I8KA 1W72B 3MCKB 1G7LB 1Q94B 1L0YA 3K4DA 4OFYD 3SDAB 3GSXB 5D1XD 1UWEH 1N2RB 4LMQE 4X6CE 4ENEC 3NABL 3BKCH 3C6LA 4FABL 3M17A 4S0SD 1S3KH 1VKXB 4MLIA 4LEOB 2IBGA 2E6PA 2D03L 4YXHL 2VLJD 4BFEA 3OX8B 1OT1A 5EOQL 2WZPD 5J0BA 3I6KA 4R96A 2B4CC 1OP5K 4FQXC 4PTUA 5ITFB 1AC0A 3RZWA 1BVKB 1MNUH 1HKLH 2R69H 5MEQA 3SKMA 4WFGE 4PYGA 5CJXC 5BOZG 1JUFA 5A16A 2GAZB 2NY0C 1YMHB 2R2HA 3QFJA 5EZOH 4PJFE 2HVJB 1AJ7H 2Y5TB 3QCVL 5EU5A 3MV7A 5IFAH 1FP5A 4KJQC 3RVVC 4JDVB 4TVPH 3QG6B 3MMEB 2A9NH 1I9IL 4XCCH 1WJ3A 1QSZA 4P2RA 1ORSA 4JRYB 2Q8AH 5L7XH 4QCIA 3TYFA 2HJFB 4WUUA 4PY7A 2GITB 2ICES 2YD1A 4NM8L 4NGHH 5HHXL 4NCDA 2BHUA 4EI5D 1F4YL 1NMCC 1VGEH 3B9KA 1M7XA 2ATKB 1KN4L 3NZ8B 1TCRA 4RX4D 4KHXH 3VD7A 5F88A 3QUML 2R0ZL 2BRRH 1JTTA 3TBYB 1A3LH 5CBAA 3ARWA 2IGFH 4CDHA 3TV3H 3ARDB 4C58B 3QUXB 1NCAH 1KIUA 3S98A 5E5RB 3FN0L 2R1XA 1JK8B 3KPQA 3FAXA 4WHYH 3UAJC 4HKJB 1XCQB 5IWLA 4DVBA 3LVEA 3J7HA 4OQTA 4HJJL 3OKDB 5EU4A 4WCYH 1QPXA 2MWCA 3P4OA 3TBTA 2OX5A 5K9KA 1BFOB 5TDOB 1UCTA 1IGCL 2ZOLB 1MY7A 3UTSD 3SGEI 3V5KA 3WNMA 1J1XH 5C3LD 1FL5A 1KGCE 4ZUUB 3ARBB 1UZ8B 4PJGB 2HKFL 1AC6A 4ZNEE 4G8GD 3BPLB 2UV3A 2V2XA 1XR9B 3LH2L 1FYTD 3O9WC 4B50A 5JNYB 1PKOA 2XTJC 3KHOA 1RUQH 1NKRA 3JTTA 4U0QB 2AJXL 5CZVL 5DMIH 3ARTA 4FQCL 1KN2H 5J6GA 5EIIB 4FTVA 4YHKL 2NY3B 3PJSA 3CPLB 4OBSA 2ICCA 2OXGA 3O6FD 2QQNH 1I3GH 3UPRA 3KPSE 3KJ6L 3HLAA 4LASH 4GG6E 1AQKH 4ZUUA 3LDBC 5DVOA 5EU3A 5IFAL 5FA4B 2HT4D 4I2XA 1IAIM 1Y6NR 5DJ8B 4MA8H 5C09B 3Q6FA 3QSKB 4DVBB 5DT1L 4S1SL 5DJXA 5CEZH 4Y5VB 3MC0A 4NN5C 1F3JA 2DBLH 2E7LA 2JJSA 2DJ4A 5DK2A 1UC6A 4JFZL 3QFJD 4JVWA 1T2JA 4XNYL 1WITA 2B0SL 1L9NA 4YHYC 3Q6GL 3CXHJ 1LEKB 4HMEA 1EXUA 1Z9OA 4IRZL 2NY5H 1FFPA 1KIPB 5E03A 4PJDE 2BNQA 1SJEA 4OTXL 1W72L 4WU5B 4BA8A 3EFDH 4DGYH 3MRRA 3E3QC 5D7KD 4WNQB 5GSRA 3MRFA 4Q7DA 3GJFH 4P5MB 5EC1A 1OW0A 4J3OC 2NR6C 1E4WH 1KB5A 2A73B 5D70H 1MCWW 4QCIB 2AXJA 3N85L 3MUGA 1BZ9A 4JEGB 3MMEA 4C4KT 1M71A 4WO4C 5DURB 4MNHB 2HTLD 4KVCL 4XZUB 4PRDA 5JW4M 3HRZB 3OXSB 1CLZH 3G08A 3ALXA 5IBLC 1P4LA 2CIKA 1LD9A 3PGFL 5JOFB 2ZKHH 2P5WE 3RA7L 5CCKH 4UILL 2HVJA 3UJTH 2OXHA 3QIUD 1O7SA 3Q6FB 4JFFD 1BD2B 1JL8A 3KG5A 3IF1B 2CK0L 4WO4A 2XQYK 1NMAL 2Y07H 1IEAB 3U1SH 5I15L 1MJ7L 4L4TD 2C5DC 4ODWA 5MEPB 2F58L 4X80H 4XB8A 4GLRH 3ARFC 4XCEB 3IS0X 4Z7WF 3D39D 4K3HA 2Z31C 4JPKH 1P4LB 2CIKB 1J12A 3SE4C 4JR9L 3LSOB 3OSKA 5JW4N 2VXQL 4Y1AB 4MNHA 3BIKA 1J5OL 3ABZA 1J7VR 4IRJA 4F7TB 4NDMB 5DMKA 4NM4L 2DLHA 5E5MA 1JGLH 3TV3L 4DAGH 5TE6H 4XVUC 5FEBA 4NT6B 4PJXA 5B38A 3D18A 1GAFL 1GOHA 3EYUH 3K2MC 3U9PL 5HGBB 5BS0D 2AEPL 4XP6L 5JZ7C 2XA3A 4K71B 3GIVB 3S35X 4JHWH 4YAQA 2AV1A 1KJ2A 3QFJB 5JMRA 2ICEA 1ZXQA 1DE4A 1TJIH 1PFCA 1OQOA 4BUGA 1Z0MA 4WO4B 1J1OL 5DTFB 4LBEA 4U1JB 5D5MA 3QIWC 3IDYC 1U8NB 5DJXB 4DVRL 4PTUB 2VIRB 4UUJB 2R56L 1U8OA 3PWNB 3LH2H 3T77A 5DJ8A 3P0GB 1EJOH 3VGAB 3KDMB 3HRZA 3OXSA 1U3HB 5E8NA 4ZFGL 3I6GA 2Q8BL 2QSCH 3GMNA 5DI8B 2DQGL 4XMKH 3MRGB 3D3VA 1JV5B 1M05B 1MRFL 1G6RB 1LO0H 2AK4A 3QCUH 4YIQB 2HA1A 5H94A 3LZFH 4Y4HB 3MRFB 4PJBA 4XPHH 5DUBB 5JHDD 3C5ZC 3HAEA 4EDXA 4RGMB 4GW1B 4X83A 2MPAL 1LK3L 5B3NA 2IC2A 4AMKL 3QUZC 2VKXA 2ZP0T 5JDSB 5I1GL 2ZSWB 1QZ1A 4YZFE 4CVUA 4QRTB 4MAYC 2V2XB 1FCGA 3ZKMD 2CRZA 3ARBA 1EH9A 2B7DT 5DVLA 1KLGA 5K93A 1FSKC 2DBLL 5E95B 4KRPC 2KL6A 3LKQB 4F7MA 1N6QH 1JWMB 4FQHB 3RGVB 2IJ0C 5GGRA 3RVUC 4X7EC 1AO7B 4YUEH 4P48A 4D0DB 1NH6A 1FO0A 2DIJA 12E8H 5I1JH 1OD7A 4B41A 5I76A 4HZLB 3FQWA 1DVFD 2ZUQC 1DQTA 2ESVB 1VHPA 3L3HA 3GMPB 5D1ZB 2HMID 3DETC 1OAKL 2IBZX 3O9WB 4XPTL 2LABA 1P7QD 4JDTL 5DJZA 1YEEH 3SGDH 3SY0A 3CMOH 3GRWH 4CVXA 4ENED 1ZS8B 5GRJL 4TUKH 4LOUC 2MHAB 1JJUA 2X70A 3WUZA 3BZ4A 2C1OB 5EU7C 4XI5D 1X4ZA 5C6WH 3V4PL 5I30L 3VFMA 3TCXA 2QHLA 3VFNB 2FGZA 1GGYA 5IB3B 4EQ2A 4LLDA 5DZOA 2Z35B 2I60H 3ZE1F 4JVUA 1RPQA 4ELMA 3PABB 3WHE0 4N9GA 4NKDA 5E8PB 4MD4B 1HDMA 1A1OB 3MV8D 2MMXA 1FFNA 3HPLA 2FEEL 4LCYA 5E4EC 3FL7A 2HVKB 3BEVA 1Z5LB 4POYA 3OKMB 2EDJA 5FCSH 2NTFA 3HS0B 2BERA 4NPYA 4KAQH 3U36A 3RVVD 2DJUA 2CLRA 3P9WB 2G9HB 2J6EH 1BD2D 4HF5H 1HQRB 4H20L 1T1WB 1YPZE 2Z8WC 4FNLL 3MR9B 3W39B 2ITDA 4HXAL 3D39B 1NCCL 3EDKA 4OQTL 5JMOC 1X6NA 1V7ML 1A3RH 4GG6F 2UVFA 4FQJH 3HI6H 1NC2B 3WO3B 4PJFF 1CDUA 3NZ8A 3MZTA 1U91B 2F54E 4L5FH 1IGFL 5FA3A 4YHPA 3WSQL 2E7CA 5TPWL 4PY8I 1T3FB 1DUZB 3TYFB 1A0QH 1PEZA 2C7UA 4RFEA 2NY0B 5DDHA 4YX2H 4PJ7B 3V4UL 1CU4L 4GKNA 2R1YB 1MVUA 1TVBB 4N1CA 3H0TB 3H3PL 1AO7D 1JPSH 3D87B 4JFFA 2NY2C 2R4RL 4JFXA 4WV1C 3C09C 3F62A 4Z7WA 3GSVA 5D4QA 5SWQA 3TBWA 5EZOL 4CRPA 5IB1B 5C9JB 3F7VB 1GHFH 3KLAB 2ORBL 4N9OB 1HHKB 2DOCA 4NC0B 3U48A 2UZXB 5JHLL 5K59E 5CP7A 2XKUA 4LLQA 1KXQE 5HHQB 4KXZI 3GMMB 4X4ZA 4H5SA 3JWDL 3MV9D 1XGRA 2GY7B 5LQBH 2VDRH 1OW0C 4Y5XC 2MCG1 4FZ8H 1EA9C 5JIKA 3BP5B 3GGWB 4JHAH 2VERN 3HNVL 3HN3A 4KK5D 1F4XH 2X9XA 2A9ML 1IGTA 4X99A 3M17B 3L3GA 5TQ2H 1NBVH 3IDYB 5KBNC 3MYZA 3EDEA 4PB0H 4AL8L 4H0GA 5B8CB 3FT4B 4ELME 3MXWH 1KYOJ 2VWEC 1J8HB 2ILLA 3T0VA 3BKYH 3DPBA 5FGBC 1LILA 4XWGL 4X4ME 2ZUUA 1PYWB 1S5HA 4H1LA 4YK4B 4ZDHB 4QWWC 1KIRB 1MJUL 4BZ2H 4MA1B 1MCEA 4O5LH 2F5BH 4JGUA 4X5WB 4JQVC 1KB5L 2R4SH 1TZIA 4OZGF 2E7BA 3MGOA 4S2SB 2CSPA 2D7OA 1E4JA 3IETB 2DKSA 4X6DF 3G6JB 4U33A 4JO3L 2D4FA 5I74C 3BKMH 4FQJL 4Y5XA 4PJEE 3DRTB 1A4KA 2DQJL 1XZ0A 4LPWA 3UTTE 1R3LA 3HE6A 2CR3A 1DQLH 4KDVA 2AV7A 3U4AA 3EZJB 5CMAB 3LKRA 1IGIL 4L3EE 5TH2B 4M4PA 3RDTA 4YHIB 1IM3A 1KT2B 3ARED 2ITCB 4JJ5B 3UZQA 5D1QA 1T03L 2UUDH 3MRQB 1J87A 1U6AL 5J3HC 1A5FH 1HHHA 3G04A 1DEEB 4BJLA 3UMTA 4PJFB 4UINL 5I6XC 3QDJA 1VFAA 5T3XE 1ZTXL 5CP3H 2IPUG 3U0WH 4XPBL 4Z78B 4NZJA 4PS4L 3I9GL 4PJCA 5IBLD 4I4WA 3VXRA 5E2WH 1U3JA 1CE6A 2YN3A 4ORGA 4LK4A 3W9DB 5SWSA 3BGFC 5L9DH 1OSZB 1IKFH 1XF1A 2NNAB 1JYWA 3MROB 2O5ZL 2X1PA 1UG9A 3LQMA 2W9EH 2A0LD 3ULVF 3O6ML 3ZKND 5DUPL 3DYPA 3FQUA 1YEFH 3QXWA 3MRJB 4JANA 1ZT4B 4MD0B 3AVEA 4J3TA 3B5TA 1FNSL 4UI2A 3RWCA 1HHHB 4LSTL 4D3CH 4CDGC 5HY9B 1ZVYA 3FFCB 4BZ2L 4Q97A 1ADQA 5IB4B 5KG9B 3P0YH 5C9KA 3GBMH 3QFDA 4HIIA 4PJ9D 3O2DA 1L4IA 3K7UA 2P43B 2IH3A 2AW2A 1YPZF 1Q0YH 4Z7UA 2W38A 3WJJA 3HAEH 5E2VH 3OAZK 2DQFA 5E94B 1KCSH 3WUWB 1R6VA 2X9WA 4PRIB 2NXZD 4Y0GA 4RMQA 1R3HA 2QTEA 3WLWC 4G6JH 1QTYT 5GGQL 1CLYL 3EFFB 1NL0L 1A7NL 4HKBA 3B9EA 4TSBH 4O4YH 1IEBB 1EFQA 2NY0D 3QUKB 4LCUB 4A6YA 3CH8A 5IFJB 4UT7L 5T1KA 3AU1A 3VGAC 5MENB 3QEUB 4JFQB 3SKJL 1NJ9B 4E5XA 5I9QB 2HT3D 3H8NA 1MUJB 3INUH 5CIPA 4Z7UF 3VFOB 1UB6B 4NBYB 4XNZC 3VXOB 4NQEE 5D1XA 3KPSB 5C2BL 2EYRA 4J8RA 3MUHL 1NUDA 2ARJA 4E42B 4OBRA 4LVNC 4MJ6B 2X44D 2DB8A 2APBA 2OS7A 3C5ZD 3HZKA 4GT7A 3E2HB 3VMNA 1YECH 2CKBB 4LAQL 2ZJSH 1B2WL 1D6EB 2ERJC 4IM8A 3BP5A 3GGWA 3GRWA 5EZLB 2FEDC 1AGFA 1H8NA 2D31A 3QEHA 3RI5F 5F3BB 2V2TA 4LKXB 4MQXC 3WFZA 3LKPB 1I4FA 4F7CA 3G6JA 3PL6C 5ESQA 5JXAL 2PTUA 3MRLA 3NCYP 4PGZA 4W68A 1KUMA 1TZIB 5C0AB 1AE6L 4EI6A 4EN3A 3TNMA 5DK3A 3LAFA 4JHBA 3QQ4B 1YQVH 1J0IA 1DL7H 3ILQC 4K7PL 3MRBA 2Y36L 4JFFB 2GJJA 3HNTL 3K3QA 5FK9B 2NW2A 1R5WB 3NCFB 5A40E 4ZDHA 4QRUA 3MFFB 4F37F 3RY5A 2YOCA 1PG7L 3WIIL 4OZ4A 5F1OB 3KYOB 1U92A 4FMFA 3SCMC 3ZL4L 5A2LH 4WU7A 2WP3T 4XNUH 2VLJE 5EUOF 2CLVA 4YPGB 5F7LB 1UQSB 3S36H 5EC2B 3IFNH 3PWLB 1RQ5A 4OFDA 4YO0B 5DQDH 5IBUB 1T1XB 1FSKB 5ID1A 3E8UL 5HI3D 3O6FC 4X9IA 1WWWX 4GAFB 2IFFH 2B4CL 3RZCB 3SDDB 1WAAE 1AP2A 1X6LA 1JZ8A 4Y2OA 4OM1H 3FQUB 2YEZB 2C26A 2Y06H 3S4SA 3DSNA 2GJ6E 3QXUA 4OZIA 4L8CA 4RGOH 3VFPA 4Y1AE 4ZSOB 3R8QA 3OKYA 4Y16A 4LCYB 5DHYB 5TDNA 1AGCB 5IB5A 1OTSC 4RWYH 3RGHA 4XWGH 2ADIB 2C3VB 3OKEA 1HDMB 2E3VA 5C7XH 1G9MC 1TJIL 4X6FA 4AIZA 2ARWA 1TVBA 4QEGA 3O6MH 1E28A 4LSPL 4U1SB 1JGEB 4PJ5D 1WFNA 5FHAH 4ZOCA 2C3WA 4M7LT 5DS8B 4OFPA 1NGYA 1QHOA 2ZJSL 2MHAA 1OVZA 3GJFA 3TBSA 1L7IH 1TMCB 3WL9A 4F9LA 3BD5A 5EZJB 3BP4B 4GSDH 3WJLA 1BMGA 3G5XB 3NCMA 4OM0L 4XX1E 2XOTA 3VDBA 1N3NB 4JY6A 1LO0L 1TCMA 1DQJB 3FO9B 5GIRB 5EZIH 3RWCB 1VFOA 2AABL 3VFWB 1DQDL 3BAEL 2YPKA 3RWHB 4L4VA 5D2LB 3IXAA 2CLRB 4KPHH 5HDBE 3WJLC 1QEWB 2EE6A 1DL7L 2X41A 4HC1H 2BVPB 4WW2A 4L8BA 1LO4H 3LPFA 3UTSE 2NY2D 1QBAA 4WFHE 4OB5L 4Y19B 3C5JA 1S7WB 2VDNL 5GZNC 3RX5A 1U3YA 5IBTH 1ACYL 3VGGA 5HI5C 5LBSL 3MLTB 3SO3B 1HOCA 3IGAB 4W81A 2OJEB 4R90L 3KS0J 3WS6C 1ZWIB 1LWRA 5DD6B 5AZ2L 5BQ7A 3K74B 3QWQB 3L9RB 4AEIH 4OGAC 5IKCB 5FF6B 3HUJA 4XCYB 2M2DA 1ZS8A 2VSCA 2PTVA 2QV2A 1DBAH 2GT9A 5J1SC 5ESAA 3MRNB 4JCMA 4OGZA 4XH2B 4OV6F 3FN0H 4CJ1A 5JIPA 1RZGB 2VLKE 4MJIB 3NCJL 2DMKA 5JOEA 4FG6C 4AJ0A 3C08L 3K81A 5BXFB 4XRCA 3BJLA 4ZXBB 4G43A 4ZTPH 2X89D 2UWEB 3FQNB 3L3GB 1BOGA 3C5ZB 5DMYA 1I7TB 1CGVA 4GXUM 5E9DB 5ICYA 3RGVC 3KDMA 5C0BB 3BSZL 1G0XA 1EFXB 2W65B 4Z9KB 4YGVA 4JDZA 3NH7L 2OJZL 2NXZC 3ULVE 2OQJB 1BVLB 1IC4H 1CQKA 4ZS7L 1FG9C 3RL1B 2ZUSA 4GBXB 5F1KC 3S8WA 4U6XA 4LCWA 2QKIA 1R3KB 1ZVSB 5I1CL 2ICEB 3JWDH 3DVNA 1OAYH 4FN0A 5D7SL 3CU7A 4F8TA 3PWVB 2FR4B 4NO3B 4JM4L 3O3UN 3GNML 1P6FA 1MAML 5JDSA 4DK3A 2V6HA 2XRAH 4YXKL 4PGBA 5B38B 1CDGA 1FNLA 4PUBH 5D7IF 1ZLSL 1TETH 2J4WL 4KDTA 4NN7C 4KDWA 4LSRH 5IQ7H 4G6KL 1WEJL 1TLKA 4OIIL 5F7YC 5JR1H 5F1IA 5I1DB 2HP4A 5GS0L 1G6RA 3U0TB 4DN4H 3PHQA 1IILE 4PGCA 3RWDA 3MOBH 4LRIC 3S88H 1A6UL 1MCFA 1T7WA 3U2SA 4ZOBA 4P4KB 2P5WD 1TZHA 2AGJH 2RHEA 1NC2D 3TZVA 4MNGA 3KPRE 4N1EA 2CIIB 4L8SC 4R6UA 2D3VA 5T1LA 4X7CC 1NBYA 4NWUL 2ENSA 3BPOB 5I8CB 3M8OH 4NRYB 3L3KB 2DYPD 5F9AC 1NKOA 3RFZC 1NGZA 3WIHA 3P9LB 1HI6B 3D39E 4LNRA 1F8TH 3FRUB 4H26A 4Z7VB 5A2JH 5C0CD 1FIGL 3SDYL 3B3IB 3MRIA 3IJHA 1B0RB 4HCRL 3HG1D 2XWBB 4TNVK 4WCYL 4A6YH 3BW9A 2D7TH 1K2DA 3DHJA 1IGCH 1JPGA 1QLRA 2NY1D 3L7EA 4NT6A 4QKXB 4S1DD 4HUXA 2AK1H 2XNAA 3MUGB 2YD8A 4PJ7E 3QEQD 5B39B 4PJHE 1S7RB 4HPOL 1EVUA 1UWXH 2IQ9H 2VXSL 5DHVA 3LQAC 4PRPA 5IR1B 5F9WB 5DK0B 1FAIH 5FA3B 5DJYA 5HGHA 1I1YB 5T5NG 3SDCC 3U4BL 2GJ6D 3BIKB 4GAJH 2LFGA 1NC2A 1VPOH 4JGMA 5J13B 4RDQG 4KMLB 5ACZB 4RISL 1MJ7H 2ITDB 1HEZA 3L3HB 1T4KA 1XAUA 3UP1A 2IAMB 2G9HA 4K94H 5I76B 4HDIA 4ZAKD 5CHNA 1S7UB 2QJDA 2NTFB 4IRSA 2X4NA 4OCRL 5EBLA 3ULVL 1EO8H 3OKNA 5ENWB 4M7ZC 1OGAD 1D5BB 1CDHA 1KTLB 2GTWA 4M43H 1QVOB 2W9LA 3BUYB 5HVHC 2NQCA 4GW4B 3MV11 1MFBH 3CFCL 3TO2B 1S7VB 1EHNA 2Z91B 4I2XB 4NO5B 5C0EA 5DVNA 3PQYD 3MREB 1T5WA 4WIQA 4NN5B 1KPVB 5HTSA 3O8XA 5GS1B 4RSVA 1M7DA 2D9QB 5AWNL 2CO7B 3PGDA 1UM4H 5E2JA 1FJ1B 3LKNB 5FUCE 4EOWH 3LDBB 4PJXF 4QTIL 1TFHA 3W9EB 1BGXL 5ID0A 1DDHA 2CDEA 4PJBB 4ZD3L 2HWZL 3T4AB 3WLBA 5DURD 3FO1B 3ZDXF 4I8DA 5F7EL 3VXQB 1Z6JT 3MUJA 4YXLL 2F53E 2OJZH 1F11B 4L29B 5TQ0L 4OCXH 5C0CB 5CJOL 1M6OB 4KRPB 1H3PL 1KFAH 3QDGD 3DX9B 4X9FA 1CLZL 1IGYB 4L3EB 4JFDA 1DLHB 5ESVA 1SMOA 5I71B 1PX4A 1DEDA 3WV0A 5DJ6A 3BFOA 4KGLA 2OR8A 4BFIB 2R1XB 2DQDH 3RWIA 1M6OA 1PX3A 1RU9H 2CUIA 3MX0A 2F58H 4X5XB 5HVGB 4KK5C 4CN6A 5CD5C 1HXMA 2H3NA 1NEZG 4RISH 3BRDA 4XC1L 4R2GB 5EIQA 2BC4B 1GL4B 2P42B 4PY8J 3C6SB 2YZ8A 4QHNA 3L6FB 3WJJC 3P77B 4I18C 1PJ9A 4RIRB 2Q20A 4LAQH 4WGWB 4YIQA 3LY6A 5JNYA 3PV6B 5E70A 3A67H 3GMOB 1CBVH 4HW6A 2VAAB 2X05A 5HJ3A 1NCTA 5TE6L 3WDIA 3VJ6A 3IFLH 3F58H 4Z7QF 5I19L 3VXMD 5K9OA 5IF0B 1R0AH 1U3ZA 5GGQH 2OI9B 3TM6A 3AXLA 3FOLA 4Q6IC 3CAFA 4LQFH 4HDIB 1J1OH 4OZIF 1C5BL 2N7BA 2VOTA 4GMSH 4JLRB 2P44B 1I3RB 1MCCA 4EDWL 2X4OB 4OCWH 3O6LL 4HKZA 4KJWD 4M6OL 5K9OB 1REIA 3MA7A 4CU7A 5CSZB 2IAND 1OB1A 2FX9L 2VDPH 4UDTB 3BWUC 2P5ED 4PRIE 5CIPH 3U4BH 3UTTA 2VZVA 3MYJA 3GSXA 3UYOD 1WLHA 1QHPA 3TT1H 4G8GB 5IR1A 1BFVL 5D6DA 1QSFD 4JM2C 1WZMA 2P1YA 1OLZA 4NCC1 5MENE 5DVMA 5MHSE 3MYJB 2EEAA 3C6SA 3ULUL 1SJEB 2BNQB 3WNNA 4LSUH 1FV1B 2RCSL 3F7RA 4MWFB 1TJHH 3LB6C 1MEXH 1HNGA 3RY4A 3O3EB 3OJDA 4NO3A 4NQEB 2QBWA 2X1WL 4JFEB 4ODVH 4JE4B 3EOTH 4P23A 4MQTB 1XFPA 3MRIB 4OD3H 2MCPH 5HHOA 3QDMA 4M6NH 5MEQB 3X11B 4AH2B 2HJKA 1YY9C 4JAMB 4OTXH 5F7MC 3ORJA 4JDZB 5AWNH 3ZMRA 5KVDH 3OB0H 3SDAC 2L7UA 2JCCA 2VL4A 5TE7L 1N5AB 1WC7B 4JB9H 2B2XH 4M6AA 1LDSA 4JJHA 1BZ9B 4S1DC 1TJGL 4HWEL 1ZOXA 4U1IB 1CFVH 2FEEI 3HNSH 1H8OA 4YHZH 4CN4A 1OGTA 4XH2A 4HUUA 3KAAA 3T1WA 1SYSA 4JY4A 2PYEE 2VRAA 3VGHA 1MCIA 2SEBA 3BD4A 2LVCA 5HYQA 4RMSA 4JFFE 4Q9RL 3L9RA 2Y7QB 1C5BH 3V4PH 5I30H 2NX5B 4JZJA 3X14B 3QXDB 2O93L 5CP3A 2K1MA 4ONHA 4UTBL 5F6IC 5GSVA 1X5FA 2DQHL 1QLFB 4QT5B 2GY5A 1VENA 1ZHKB 4LLMB 4NRXB 2VLJB 3UBXI 5DJ6B 1X5YA 3ARRA 1PGRB 3EZ8A 4DEPB 7CGTA 4UV7L 1KXTB 1GSMA 1QVOA 1Q1JL 2DLTA 3MRDB 3OJMB 4ELKA 4GMTH 1IGYA 1X3DA 1EDQA 1HHJA 5FGBA 3MBED 2FCBA 3SO3C 1YNKL 4JQIL 3D0VB 4YDJA 1YPZA 3DVGA 2FLBT 4LIQE 3BZEB 1HZHH 4XBPA 1I1CA 5F7UA 1N3NA 3BPLC 4H0HB 1E27A 3AFLA 1F42A 4J1UA 5C0RH 1OP9A 4Y4FC 5JOPD 1FVDA 3DMMB 1K6QH 3MLWH 5IJKC 3VRLF 2DQCH 5IMKB 3H9ZA 3WXWL 2NLJA 2DWDB 3VU2A 4K8RH 4P4RA 5F1IB 5C0AD 5IEHA 5HGDA 5ERWA 1WV7T 1HH6A 5E8EB 1IAIH 2XNAB 3ARZA 2IH1A 1LNUB 1W0YT 2CGRH 3V5KB 43C9B 1FGNL 3PP4L 3P0YL 4AT6B 5FUZL 4WW2C 5C92A 4JY5L 2VDNH 2P8LB 4NQCB 2V7HB 4X7TA 3C8DA 3JXAA 1G1CA 2GTZB 1A2YA 1D5BA 5EU6A 5I16B 4Z7VA 3LEXB 1H3WM 3F7PC 4RZCA 2AEIT 1NAMA 4DEPC 2NY1C 4MXVF 4L4VB 3C60A 2AK4D 4LLVA 4FTVD 4NRYA 1DBKH 2WBJA 5IVZB 1WTLA 4Q9CA 3GI9H 4UIMB 4DZBA 1LDPL 1YEDB 2OCFD 3RVWD 1I7TA 1JNLL 4K7FA 2H6PB 4I5BB 4Y19E 1J8HD 3PWLA 2GJZA 1TZHB 1W0VB 4MAYB 3FMGH 1YN7A 2B0SH 3RWDB 5HI3C 1N0XH 2CD0A 5KS9F 3WO4C 4OZ4B 4PBVC 5ESAB 4MA3A 2FZ3A 3QO1A 5GS2D 4APQB 1RUKL 2EH8L 2A74A 2HKHH 4PGBB 4YPJA 1RUAH 4KVNL 5FF6A 1BBDL 3RDTD 1AXSB 3BW9B 2VL5B 3RX8A 3GSUB 1U8MA 5D2LF 3BQUB 3KPNA 1E4XH 1GGCH 4JG0H 4OZGA 4Q0XL 2R56H 1EMTH 4ONFH 4BQBA 4NCC2 3SJVE 3IDXH 5MEOA 1RUML 2I5YL 4MJIE 5EOTA 3O0RL 4OF7A 1JI1A 1FNGA 5FM4A 3ZT7A 5ITFA 4UT9H 4G9FB 3KLHD 3QJFB 2I60L 25C8L 5JUEH 3HMXL 3O4OB 5E9DE 5C0BA 3T1FB 2JCCE 3VG9C 4L8BB 1QSEA 1NMAH 3RHWF 4YDIH 5T1LB 3C6LB 1IAKB 2UWEA 3FQNA 3LHPH 2YPKB 1UQSA 3RWHA 3MLZH 1GC1L 1NGXA 4DN4L 5EO9B 3WO4B 1NC4B 5ITBH 3V5DB 4JM2D 1K4CA 3QI9C 4B0MM 3QDHA 2DBJA 4JZOB 4HJGB 2EH7H 2EIBA 3MJ7A 1AGBA 3CFEB 4WO4D 3OF6D 4QRPE 4YBQC 3CSYA 4S1QL 3CJJA 2G75A 5ILTL 4NNXB 1F45A 3BPNC 1JGEA 4KTEL 3BGMB 3MLVH 4KRNA 1JZ4A 3OZ9H 4AM0A 1ZVSA 1IEBA 4U1LA 2VLLB 4RMUA 2DQEL 1FL3B 5BMFL 3O3BA 3GI8L 2C4XA 2R39A 4BQCA 5F8RC 1CWVA 4MZ3A 1JHKL 2JKXA 4HCRH 5TGBB 5B3JE 1X5XA 5GJTH 5IB5B 3UTZB 5L2KE 4X9GA 4IHOB 1I7UA 2BDNH 4PRIA 1B4JL 3U9UB 2H8PB 3K2UH 3LPGA 4NQXB 1HQ4B 1B2WH 3BN9D 4IOIA 1XGUB 3VXTA 1G7PA 4GUPB 3IJSA 3VD3A 3GMQB 3GSWB 3T65A 1WAAF 2JIXD 1I8IB 2D0GA 4XP4H 1U8KB 1A7RL 4ZXBA 3QPXL 1MCDA 4K9EL 3DXAE 5D7JA 1FNSH 2P24A 2VSDA 1KTDB 3ARVA 1RI8A 2EDYA 2EDWA 1FZKA 4G42A 1BHGA 2HFGH 4FP8H 3W0WB 3IRPX 5HHOE 4DFIA 4E42A 4LSPH 4QF1B 4RRPA 4Y1AD 1P84K 4UQ3B 4F7EB 3TT3H 1IGMH 5KSBB 3JUYA 2N7AA 5SX4H 1BAFL 1FGNH 3RGVD 2V5TA 2PW2A 3W11C 2L7JA 4FFZH 1CLOL 5DEGB 5IIEA 5JA8B 1BQSA 1RY7B 1CFQA 1A6VL 3QEUA 4JFQA 4LVEA 3VD5A 3MLYL 3IAPA 1BF8A 1CD8A 2EDDA 1A7NH 3MA9L 1V3JA 4GOSA 4R0LA 1GOFA 1QYGL 4S1RL 1N64H 1BQUA 4H20H 2NY2B 4MA7L 5TDNB 3NIGF 1TVDA 5C8JB 3FOMA 1G9EA 2XY2A 4QXUH 3NCBB 1KTRL 2FH6A 3EW3B 1QFWL 2N4IA 4NNPH 1D5MA 4IOSD 3RI5K 4GQ9H 4BZ1H 2YPLB 1D3CA 1YNTB 1MF2L 3C2SA 1C12A 2BY2A 4MDJA 3CCHB 4EJ1C 3I6LE 4R3SB 3RKPA 1MHHB 3QG7L 5GGVL 2NZ9D 3PQYA 3S7GA 4M5YL 1QFWI 4I2XE 2X2YA 5GQBA 4PGJA 1KC5H 3AUVA 3FB5A 3H42L 5CGTA 3KYOA 3BKML 1CD0A 4MAYD 3P0VL 1C7SA 1OGAA 3LN5A 2WINB 5KZCB 4JRWA 3ULUC 2DQTH 1XGQA 2CXKA 2VISA 3E6HB 4KRPD 5KS9E 3H9SB 2IPKB 5GS1C 3WE6A 1L0XA 1YJDC 1GC1C 3S3PA 1CFQB 3RVUD 4EDWH 5GGSB 2VDQL 1B0WA 4OV5B 1BQLL 4HKBB 5C0DB 3G6JF 1KIRA 1G7MB 4RNRB 3VFVB 3QEHB 3PGCB 4XPFL 3EYSH 1ORQB 2EDBA 5CUSL 1LO4L 2XZAH 1UXSA 2WW8A 1OP3H 5SX5H 2GIYA 1BX2B 2ID5A 4I0KA 4JJ5A 2E5EA 4MXQD 1LMKA 1EV2E 5J7CC 1JGVH 5TH2A 3BE1H 4Y5YB 1AFVL 4MNQA 4DOHE 1S9KC 3T4YA 4DK6A 1WIPA 3MXVL 2AV7B 3KNBB 1FQ9C 3HZMA 1KENH 4JRXD 1H5BA 2Y5EA 3SJVD 1NLDH 4HXBL 5IM7A 3S34L 3MRJA 1HXYB 3OZ9L 4H5SB 1J0YA 4RNRA 2G2RB 3UDWC 1V3MA 5EO1A 4FABH 2VE6A 3O3BB 1PZUB 3QUYC 1CG9A 2VZTA 3MRMA 4MCZB 2XFXB 1DUYA 2Z31B 1ZLVH 2LV4A 2ZOKB 1MCSA 3CFJB 3BZDA 4F7CB 4F3FA 4RAHA 4WUUE 3SO5A 5CFHA 1OM3L 4XPGH 2XWTB 3MBEC 4PJ7A 2WINA 2L4OA 1X44A 3U7AA 1N5YL 2NTSP 1NGXB 1JFQH 1OQXA 3CNKA 4OLWL 4TSBL 1P7KA 3VG9B 3JWNC 1FIGH 2CRMA 1WBYB 1LEGA 4RWHA 4Z76B 4Y4FD 1JI2A 4Z18A 3IDGA 1CIUA 1T21B 1DQML 2OP4H 4N8CH 4N0YH 1LQSR 1P53A 4NFDA 4P46D 7FABL 3UXFA 4G9FA 2ITCA 5EORL 3QB7C 2HH0H 3E0GA 4P57A 4HT1L 1ZV5A 2VYRE 2DI8A 3T65B 1FNGB 1X4YA 2L0DA 1F58H 2ZCKH 2EEDA 4HC1L 5C08E 1FRGH 1HQ4A 4HGKC 4WI8A 5GGSA 3JVGA 3CX5J 3FO2B 4G6AD 4X6CA 2MNUA 5TGBA 1NDMA 1CT8B 4Z7WB 1A9BB 3H9SA 3WXVL 2BSTB 3I85A 4OUUB 5C09D 3RJQB 2C3HA 2XZCL 2AI0L 1Q0XH 4YBLC 3T2NH 4C55A 5IB2A 1SY6H 1T83C 1OGAB 5ERWB 3RTQD 1Y6KR 4H1LG 3O9WD 4OCSH 5H37G 4TULH 3UYPA 5DC9B 1ZHNA 4ALAH 1YYMH 4QLRA 3MRCB 1FBIL 3I02A 5DUMH 1J1XL 3BPCB 3L95A 4PG9A 4U3XA 3DMMA 4YC2C 3U83A 3FFDA 5DJZB 4UQ3A 5ICZA 4M5YH 1LO5A 1T1ZB 1TENA 3HFMH 5DR5L 2BSSB 5KG9A 2I24N 5FCUL 2X4RA 5BZWB 3P0VH 3H9YA 3FHQA 1D5MB 2DKUA 3PG2A 1EFXD 4HZLA 5D71H 3O81A 1IM3B 3V0WL 4NHUA 3ARDC 2J8UB 1WIOA 1WIUA 5IV2B 5CMAA 4XPAH 1QD0A 2XACC 2F9BT 1CL7I 5TDPA 3RDTC 2KZWA 5FUZH 1KACB 3D25A 4UT7H 3ZHKA 3IJYB 4J12A 5E7BA 5EN2A 1ONQB 5C0IB 5HYJE 1A6ZB 3QO0A 3BHBA 4JN2A 4MQ7A 1OP3K 1S9VB 1CK0L 5L6YL 5KSAD 3INUL 4G9DB 3UTOA 4OKVB 4NM8H 1AY1L 4X6DA 1EHAA 1IT9L 4ZPVA 3Q1SL 1GH7A 2PYEB 1FYTB 2JIXB 1U8HB 4KJWC 3MLYH 3QUMH 5LGHL 3KLHC 2APFA 5LJYH 4HX1B 4X4XA 3QCUL 4YFDB 4GKNB 4QY8A 2E8ZA 3TO4A 5KSBA 4BH8A 4QHUA 3DROA 4HPYH 4L3CA 3Q3GB 3N1PC 3QNZA 3X17A 4OIBA 5H94B 4LCWE 3DHMA 3ZE1E 5BS0E 1I8LA 2FJFB 3MRPB 5HI4D 4Z7OF 1H5BC 3IS1X 1ZLVK 2H32H 4WJ5B 3NCEB 3PWJB 4XCFL 4RWYL 5D93B 4OZFB 4WHTA 3PP3H 4Y4KD 4DZBB 3LB6D 4KVNH 3TN0D 4IOIB 4YBQD 4DWHA 3QIUC 2R2BA 1MI5A 1XGRB 3ARXA 3U36B 3HG1B 4NPYB 4WWID 1NFDA 1YYML 2PYFA 4PP1C 4LL9A 1NMBH 4HIHA 4X6BA 3TVMB 3LEXA 5GXBB 1F6FB 3DUUA 3ZT6A 3OBAA 1KG0B 2FJHB 1N26A 4JKWA 3O11B 5IP4A 4Z8FL 2PCPB 4QTHA 2E7HA 2VL5A 3HMXH 1KPUA 2A6DA 5K33A 3BN9C 4DGVL 3CX2A 3PGFH 4R7DA 2R15A 4PJXB 1BFSA 5L8JB 5F72S 1Q72L 1T3FA 2O61A 2C1OA 2PR4L 4FFVC 4FXGA 5C71A 3X12B 2F8XC 4G3YL 1YN7B 3AC0A 4BSWA 4K3EH 4LU5L 4XPFH 3RWFB 5JPNB 3OKOA 4K9EC 1IFHH 4R7NB 4ODXA 5BV7B 4DGIL 1IGTB 3EIFA 5JHDB 4OZIE 1KLUA 2V9QA 4D9RD 2E7LC 3QJFA 3T77B 2BY3A 2Y6SD 3QXAA 4FQ2H 4L4VE 3G9VA 3D2UA 1CXEA 2GCYB 5ECJE 4JAMA 4QRRA 1JVKA 1MCPH 1U8NA 3C2AL 2PTTA 5F6HI 1F2QA 2VKWA 4RZCB 3HI1A 3VXRD 2F19H 3OPZL 2NZIA 1IM9B 2DLFH 3QIWD 3MXVH 5I16A 4HGMA 2EKSA