4Y4HD

Crystal structure of the mcd1d/gck152/inktcr ternary complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 58
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hD02
1TNMA 2BVOA 5HHQA 3CSYB 3SKNB 5DRXB 2R0LL 3MRCB 3RX7A 3P0YH 3STZB 1BBDH 5FAAA 2AEPH 4NZRL 2VR9A 1P84K 2FNBA 2EO9A 2GJ6E 4KK8D 1KCVL 5BMFL 1U93B 2YXMA 5D7IE 1ODAA 3GSUB 3NZ8B 2D0GA 1NQBA 2GTWA 3DGCR 1EK3A 2FD6H 4JJ5B 3SOBH 1OY3B 3D3VA 4CNIB 5KJRH 2PXYB 4U1HA 4TULH 3MFFA 1B0RA 4HWNA 2OI9B 2BVPB 5DURB 2F19H 1WBXA 2OXHA 3CLEH 5F71A 5T1DH 1NDGA 3NIGE 5KSBB 3RVVC 3SDDC 1D9KD 1P69B 5B39B 1F4HA 4HWBH 4JPKH 4BKLB 1I75A 5C0GA 1PFCA 3PL6A 4C54A 1H0DB 3FFDA 4M1DL 2X1PA 2FX8H 3T0BA 3C60D 4ACPA 1UWEH 1NC4A 1QFUH 3VFGH 5E2WL 3ZDYF 5ESQB 4BQCA 3QHZL 4IRZL 2FGWH 3C5ZA 4F57L 3DRQA 4Y8AA 1FFPA 3NGBC 4LCCC 1LE5B 5DJYA 4DGIH 5LCVH 3VW3L 3ZE1E 4JB9H 5J9PA 2W0LA 1ZGLM 3U7YH 1RIVL 4KUCD 3FQTA 4KKBC 5IKCB 1FJ1B 1QNZL 2XZQH 3VGFA 2BDNL 4ZUSA 5CUSL 4M62L 4OLXH 4RNRB 4UT9L 5JUEL 3TA3B 3VG9B 4EDWH 3IFLH 3G6JB 4JFEE 4MMZC 1HDMA 3ZSTA 4X4XA 3ZKXB 2A83B 1SJEB 3AVEA 2DYPB 5E8DL 2UYLB 3CH1B 1QVOB 3IDNB 3IFPA 3D3VD 4Y1AE 3Q3GB 4NQCA 3LKSB 5AG8A 1U8NB 4OT1H 1NCDH 1X5IA 5DJZA 4F7MA 1MHHB 3T0AA 4WCYL 1DR9A 3PL6D 3ROOB 3ZO0A 4XBEL 3QUXB 1Y18B 4L4VD 1LK2B 4HEPG 4LAQL 1IFHL 4EZMA 1NC4D 1S7VB 4K7FA 4O2FA 2DI7A 4PJ9C 1ZLVH 2CXKA 1AXIB 3WNMA 1LE9A 2C7UB 2DLHA 2I9TB 3C5ZD 4HJJL 4N5EC 1PQZB 2A0LC 1GZQB 2F58H 4XMKH 3LEXB 2EDXA 4IHOA 1FFOA 4X99B 3CK0H 4P0DA 3CFDA 3VGAC 1GGBH 3UXFA 1U0QA 3O3EB 2BY2A 1IC5H 3W9DA 2WW8A 4ZUVB 4KJPD 2EKSB 1CD1A 3T77B 3PWPB 5EBWA 4Y16D 5JQHC 1OP3H 4PLKD 4XP6H 2BSTB 3S37L 2NY0B 4WV1B 4TUOA 5HI3D 5HDQH 1I1AB 4M8QA 3QO1A 5B4MC 2XWBB 4GAGH 3BW9B 2XN9A 5DUBB 2B2XH 4Z76B 2H2SD 4HIXH 1Q72L 3GMRA 3S7GA 4NM4L 4PJFF 1NMAL 3GMNB 4YUEL 2Q8BH 3CFEA 4OZGA 4P4KA 4NQCD 5D5MF 1A6TA 4UTBL 3DUUA 5CEZL 4LCWD 3LV3A 5EU6E 3H7LA 3U7AA 4ZTOL 2Y5TA 1FDLL 2M8XA 2DWEB 3ZKMC 5CD5D 1PBYA 1E4KA 1TJGH 3C6LA 3KAAA 4N0FA 3B9KC 5F7HA 2XTJD 4G6KH 1CICA 1L6ZA 3BQUB 5EIIB 4B41A 1PG7W 4E42B 4ZO7A 1W8NA 5JXAL 5GRUL 2HT4D 4HGMA 1YMHB 2F74B 1VERA 2YC1B 3B3IB 2Q86B 1LO4L 1J1OH 4D0BA 1A4KA 1OW0A 5GSRA 4RGNC 4ZPTA 1KT2A 2JJSA 4PYGA 5IVZB 3B2UC 1WUNT 2WIIB 4WW2C 4XCCL 1C5BL 4XZUA 5B21A 1AD0A 2F54D 3T3MF 4A6YB 2AJXL 3ETBF 4Y4KB 4Z7UB 2R1WB 2D0FA 2N7AA 2XG5A 2YEZA 4DVRL 1QLRB 3ULVL 1MCOL 4DWHA 2FZ3A 3MRMA 5D7LD 4M43L 4WJ5A 3IKCA 5LAXB 3O3AB 4DGVL 3D87B 1RJYB 3KDMA 1CGYA 1NAMA 2XN9D 1HQRA 2AJSL 3TFKD 1RK1B 1CE1H 1T2JA 3QUKA 3V0WL 5TDNA 4YK4C 4IMKC 1DBML 4RGOH 1E4WL 4LKCA 3MRHB 4P4KD 3MLPA 4OV5A 2H6PB 3NCYS 4ZD3H 5C0AE 2YWYA 5MEQA 5DJ8A 4MQSB 1YQVL 4M7ZB 1EEZB 5HHXL 2Z8SA 4JDVB 1HQ4B 2YSSA 2Y7QA 1QRNB 2X44D 5D7IA 4YQXL 1DBKH 4JY4A 1CICD 5L6YL 1JZ7A 1NCBH 4IOIA 2AJYL 1JHLL 3CGTA 3W9EB 5C0RH 1KXQE 3MOBH 5FM5O 1K5NA 4OZFB 1MI5E 1A6UL 3HR6A 3IDXH 1IC1A 4FQQB 3FHAA 5DA4A 3VWKC 2DRUA 5F89A 1QACA 2YBRB 3T04D 1CFTB 3O2WL 4OJFH 1Q8MA 4LSVH 2ADIA 4OZIB 1T7WA 5B38G 3DV4A 4CW1B 3MJ9L 2J12B 5ANMB 2JKXA 5IW1B 2DIJA 3IDMB 3TVMA 3CDGA 3UYRH 2AK4E 4S1QH 1WISA 1A1OA 5DD0L 3O41A 4UT6H 3VD9A 1IJ9A 1ZT4B 2EE3A 2O5XH 4IRSD 1P7QB 1J05B 3HR5B 4IIQA 5E08L 1H5BA 1CDCA 4K94L 5DMKA 2NR6D 3FOLA 1P7KA 3RI5F 1G7LB 2BSSA 4HS8H 3AAZA 4MA7L 5AZ2H 1Q0YH 4MD4B 1KV3A 1V5JA 1JF5A 3LDBB 3BFOA 3EFFA 5I1JL 2EH8H 3PXJA 4JZOA 5E9DE 3AFLA 1P1ZA 5EZOH 2WBJC 5IBTL 3O45A 3BEWA 3DMMB 1MJ7L 4J8RA 1TVHA 2QADC 1ZA3A 2B1AL 1BIIB 5HHPB 4X8JB 3VH8A 1QA9B 4XB8A 4YE4L 3ZT5A 2MCPH 3OKNB 1T83C 4X6CF 3STBA 3HZKB 5GXBB 5EC2A 2XPGA 1K8IB 5FYLH 5BZDB 2VH5L 3L3GB 3K7UA 2OTWB 1OT2A 3OQ3B 3P73A 2R0LH 3IDUA 4HKZB 4AT6B 2Y25A 3ZTJG 3BH9A 1EAPB 3CAFA 3TH3T 4CJ0A 4WI4A 2VZVA 4AZ8A 1S9YB 4APQB 4NZRH 2IMNA 1Z5LB 3BH8A 4NNYB 4MJ6A 2P5WA 1KCVH 1CFBA 2DDQH 5DJXB 2JJWA 1OGAB 5BMFH 1A7OL 4DZBB 4NRZB 3QQ9D 1DQQB 1BREA 5F44A 1B6UA 3MRRA 4AMKL 4M4RA 3L1OL 4NNPL 2X70B 4MVBD 3PP4L 1HHJB 3CFKA 3OB0H 3O9WB 1IAIM 1LK3H 3U9PL 1G6RB 2D7OA 2PTVA 4UOJA 1FZMA 5EZLA 1JTTA 3WHE0 4LVEA 2XXCB 4ZFOA 3WIFA 3U7WL 3BWAB 4X83A 4PLOB 4MA1C 3TT3L 4L9DA 1XFPA 2PTTA 1YEIL 2BHZA 2A2QT 3DBXB 4X0KA 1Q0XL 5D96C 1AP2A 1D9KB 4XNXL 2JB6B 5C0CE 1HIML 4QLRA 3UTTE 3V6BR 4PJGF 5F7FA 4I13B 3QXAB 2QR0B 1SBBA 5E2WH 5SV3A 5DEFB 3QHZH 2FIRT 4IRZH 1DDHA 4F57H 1N7MH 3C60B 1UXWB 4ZQKB 5CMAA 2XQYK 1O5DT 2IBGA 1KJMB 1AC6A 4KV5F 1W72H 3D18B 3MRQA 2BOCA 4L29A 1LO5A 3DRTB 2EIZB 3L3HA 1RIVH 1JMZA 2OL3B 1IAIH 1IGYA 4U1SA 4LPXA 5DK2B 1XGRB 1QNZH 2BDNH 5CUSH 5KG9A 5EBLB 5EU6A 4M62H 3OJVC 2BVOB 5HHQB 2ERJB 2YA0A 3NACH 4UT9H 5HGAA 4P5MA 1SMOA 2P5WD 4P9MH 1MWAL 4MMXC 4JQVA 5HYSG 5IGXL 5JUEH 1JRHL 3L95A 1DQLL 1JHKL 4PGDA 1XF2A 4LNVA 1MJ8L 3QEGL 5F9AC 1OM3L 4F9LA 3SKUD 3EFDL 4TSCL 3RWGA 5IB4A 4Q6IA 2ITCA 1A1MA 4LASL 1JV5A 5B4MD 2FEEL 3DO7A 5I73C 1SYVA 3C5JA 5D2LF 4J3TA 3S88L 3CLFH 3RJDA 2ATPA 3AMKA 1C08A 2GTWB 3B8YA 4WCYH 1TZIA 1EPFA 5IJKC 4JY6A 4U1HB 1FZJA 3QISA 3TH4T 2NLJA 3MFFB 1B0RB 5A2FA 1WBXB 2J8UE 4XBEH 2HFEA 3TBTA 2VZ3A 2E7MA 1NDGB 5BOZG 4Y5YC 4LAQH 4R4BA 2DM2A 1PLGL 5FGCB 1IFHH 4M48H 3GBLA 5C0GB 1CXHA 3BD3A 1A8JH 2DTML 4HJJH 2H32A 3TH2T 3ARXA 4ODTL 4BZ1L 1NC4B 2HVKA 2NXYC 2BVYA 3EUUA 1H3XA 5IFHL 4OIAA 1QBAA 1ZEAL 4MB5A 4RGND 1N3NA 3C5ZB 3NPZB 3B2UD 3DRQB 1FFPB 4ZXBD 5C0AA 3F5WA 3EKCA 5DJYB 4U7MA 5EU6D 3CPLB 2I25N 5J9PB 4OAWA 3FQTB 3JZ7A 1WICA 1Q72H 5EH1A 4D0CA 4NM4H 5KSBF 1E4XL 3T1FA 3BJLA 3CDYA 3VXUE 5C07D 5DEZA 4OQTL 2IMMA 1NMAH 3NIFE 3H6JA 3PDOB 1OTSD 1MI5A 4H1LG 4PRHE 4NC0B 5EBMA 4WU7A 2O5YL 1OWRM 2EDTA 2APXA 3BKYH 5CEZH 2PUQT 1HDMB 4X4XB 5C08E 4RWYL 1TPXB 5C0IA 2J6EA 4OD1L 3IFPB 4L8BA 4S1DC 3H7BA 2YPLD 4NQCB 1OB1A 2ZSWA 4OB5L 2PW1A 5DJZB 1YY9D 3D6GA 2VKXA 4F7MB 2ZG1A 2AK4A 5JXAH 5I74B 5GRUH 4LSDA 4PJ8A 5J1TC 3D39E 3AGVA 4WWKA 2XTJB 4XVTL 4QHMA 5IR1A 4NRXA 1C5BH 3SBWC 4K7FB 4O2FB 5E9DA 1JIBA 2AJXH 1OVZA 3ARUA 3VWKD 1OOAA 1LE9B 4DVRH 3G6JF 2QHLA 2ILLA 3ULVH 2DKUA 3BP7A 1MCOH 3KPNA 2DQCL 3W5NA 1OLLA 4WFGD 5EU7C 4M43H 5I8EA 5C0AD 4LVHB 1EAJA 5KOVC 4IHOB 1FFOB 2NY7L 5MEOA 5J1SC 5D72L 4X5WA 4DGVH 3O11A 3CFDB 1BZ9A 1A7RH 4K71C 3JWOL 3O81A 3W9DB 4F80A 2AJSH 2FSEA 1CD1B 5EBWB 1VGEH 2GSIA 3ZYIA 1T80A 4F9PC 4TUOB 1E4WH 4M8QB 4ZDHA 3SE3A 3TJEL 5GS2D 5HVHB 4POZC 2YWZA 2XN9B 4ZPVA 2DL9A 4W81A 1CIDA 1J0ZA 4LCYA 3GMRB 2X9YA 3PUCA 2AGJL 4XCEA 2NX5E 3MYJB 5SWQA 5HHXH 2WBJD 3I6GA 5M95B 1EFXA 2J5LC 2YD8A 3CC5A 1U9KA 1ZHLA 3CFEB 4OZGB 3KHOA 4P4KB 4YQXH 1A6TB 3QAZB 3DUUB 4G6AC 1NBYA 4WI3A 3LV3B 2D9CA 3LRSA 1IGCL 5L6YH 4NZTL 3N9GL 2AK4D 2HN7A 1JHLH 4PJ8D 3RWEA 1H8SA 2Y5TB 3QULA 1A6UH 3C6LB 4N0FB 1BGXL 5T33L 2CQVA 4R4ND 1CICB 5D7JC 5H94A 3RBGA 3O6KL 2EXWD 2R1YA 3CXHJ 2PO6A 2YRLA 1XF3B 3GMLA 1ZE3C 3O2WH 5C0NC 4KTEH 4J3VA 3MJ9H 2P4AB 4D0BB 5C0CA 1A4KB 5I0DA 5GSRB 4Z5RA 4ZPTB 1KT2B 3DNKA 5DD0H 2GFBA 2VQTA 4XZUB 4TTGA 1IKNA 1AD0B 3WS6C 3S35L 4ZTPL 2YEZB 1BJ1J 5E08H 3NPSB 4K94H 3CCHA 1MF2H 2VLMD 2FZ3B 3MRMB 3DX7A 3P4NB 4WJ5B 4HCRA 4HG4K 1UH3A 1WJ3A 3VFSA 3IKCB 5FF6A 2HFGL 3RGHA 5HI4C 3AB0C 5EFIA 5F6IC 4HQQH 2Y36L 1NAMB 3KDMB 4P5TA 5ISZB 1NKRA 2A6IA 4L1DA 1HQRB 2RFXA 1MJ7H 4HFWB 3QUKB 5TDNB 3RL1A 1V7ML 2DKMA 1WQVT 4R4FH 4YE4H 1EFXD 4LKCB 3FRPG 4OV5B 4IJ3C 3WV0A 2VH5H 5D1ZA 1FQ9C 2ZOKA 5JW5A 1X5HA 4J4PD 4M6OH 5MEQB 4ALAL 3GMPA 3D25A 5D7IB 2YSSB 2Y7QB 4KPHL 1DQJA 5I8KL 4GBXD 4Z7UF 1I1RA 4JY4B 2P5EA 5GJTH 1KYOK 4IOIB 4JY5H 4TVPL 4RX4D 1J88A 5F1SA 1A7OH 2EDNA 2J8UA 1N2RA 1K5NB 1BD2E 1EZVY 2WM0A 1IVLA 3MUHL 3L1OH 4G6FB 4NNPH 5C0CD 3RWIA 5F89B 3PP4H 1FRGH 2H3NA 4G80A 5GZOD 4OGXL 3U9PH 2ADIB 4Z78A 4MXQC 4ZNCD 3DV4B 3JXAA 4KJQC 3ESVF 1HYSC 3U7WH 4GSDL 1GSMA 1ZKAA 2VXQL 4AY0A 1F3JA 3TVMB 3CDGB 3TT3H 1A1OB 3O41B 1YEIH 2VSCA 1Q0XH 4OIIL 4OI8A 1BJ8A 4IIQB 4XNXH 1H5BB 1HIMH 4MCYA 1T2QL 5DMKB 3FOLB 4GLRI 1P7KB 4FFWD 4P5TD 2BSSB 3HN3A 3KPRD 3AAZB 3SE4A 1UZ6F 5DD1H 4W4NA 3EFFB 4JZOB 4JHAL 4RRPA 1T20A 1MLBA 1P1ZB 4PY7A 5E70A 1M4KA 4JFDE 3O45B 5D1ZD 5DVMA 3TO4A 3BEWB 4MAUL 3VXUA 4RFOH 1JHTA 4J8RB 4X6BB 2VDRH 1TVHB 3J7HA 1FPTL 1ZA3B 4PLJC 3KPLA 4PRHA 1S9XA 4QHKI 4D0DA 1I8MB 1ZLVK 4OZIF 2AVGA 3VH8B 2EZ0C 4YHLL 2IAMA 4QRSA 3A67L 5C08A 2MKLC 5EC2B 2XPGB 4IS6A 4LSTL 2P5ED 2ZNWA 3FB7A 1AQKL 5HDBF 3TPUB 3V2AR 3P73B 5CZVH 1MWAH 4MWFA 4TNWK 1DQLH 1JHKH 4W6XB 3BH9B 5L0QC 2HT3C 3GMMA 3QEGH 1R5IA 1OM3H 3SKJL 4TSCH 4MNHA 1F2XK 3ALWA 4HD9A 3BH8B 4LASH 3JV6A 4MJ6B 2P5WB 1OP3K 4OLYL 3D39A 1V3JA 3TEUA 4ENED 4F58L 3S88H 4XHJC 3DSFL 3MRRB 3Q6FA 1Z3GL 4ERSL 3RTQA 3X12B 4AG4L 3CFKB 2ID5A 1DZBA 2I9LA 4JE4B 5EZLB 1FZMB 2ED7A 5I1AA 2R0ZL 1ZLUH 2WBWB 4ZFOB 5J3HC 3WIFB 1LEKA 2XKSA 3BPLC 1PLGH 1WIUA 4M1CD 1PEWA 3ZDXE 4HPOH 1QZ1A 3PWUA 4NQUA 4X0KB 25C8L 5ECJE 5E6IC 1AP2B 4OLZL 4PJBF 3L3JA 4ODTH 4BZ1H 2EH7H 3ZLQC 3EJZC 3TO4D 3VXUD 1ZSDB 1PX3A 3MBEA 5IFHH 3GSWA 1ZEAH 4ZUWA 4WEUD 2Y23A 1DDHB 4K7PY 4G7YL 1EHXA 5A1AA 2ZUVA 4PJDE 2IAMD 5CMAB 4UT7L 4YBHA 2Q3ZA 5FA4A 1N4XL 3QWOA 4H0HB 2JJVA 1LO0L 3MRQB 4LSRH 1QBML 2BOCB 4L29B 1LO5B 4MX7A 3L3HB 1U95A 1IGYB 4U1SB 3GK8L 3ARBC 1YEHL 1NGZA 2ICEA 1XGTA 4YBLC 4LLQA 2XWJA 5KG9B 3ULUL 1IC4H 2WAHA 2IEPA 5EU6B 2VZUA 4LPTA 4NQVA 4ONGL 3TN0A 5HGAB 3QI9A 4OQTH 1CYGA 4P5MB 3S8WA 2DF3A 1KEML 3L95B 3O3BA 1AO7E 4LEOA 3DVIA 4PGDB 4P48A 4CU8A 2O5YH 5CLWA 5ETUA 1MCEA 3RWGB 2XICA 5IB4B 1U8MB 3CFJA 3ALPA 3MRGA 4Q6IB 1RJLA 2ITCB 3U1SL 1A1MB 2E7LC 1JV5B 3EOBA 4P57A 3RTQD 4OD1H 3DO7B 1SYVB 1HH9A 3C5JB 3T2QA 1SY6A 4KKAC 4OB5H 3L5JA 2ATPB 2WZPD 4RCAA 1C08B 1A3LH 1RULH 1TZIB 3WFDH 4HIHA 4OSUL 5DT1L 1FZJB 2NLJB 5I1CL 3KYKL 5F9WC 2HFEB 3TBTB 1DN2A 3VDCA 3OAZH 4NZUL 3ULVC 1WCQA 4HIEA 4M7LL 1YECL 5IOPA 4HX1B 4KUCF 3MBED 3NH7L 3T09A 3GKWL 2H32B 5IJVA 1JPTH 4JHWL 5C0JA 2ATKA 4QCIA 1CFNA 3GUTA 2HVKB 2P47B 2E9JA 4RGMB 1CT8A 4AEEA 5D72H 2VDQL 3VCLA 4HWUA 4RA0C 1N3NB 1G9NL 3JWOH 1N59A 2CSPA 2B1HL 4IEFB 1MCWM 5C0AB 3F5WB 4LP4A 4D94A 4AL8H 5GS0L 3K0WA 3QI9D 4OAWB 4J7RA 4O4YL 3HRPA 2E27H 1Z9LA 1DQML 2GK0A 3MX0A 4EQ2A 4D0CB 4JLRA 3T1FB 4NYLA 1T03L 5T1MA 1MI5B 3ZTNL 1BD2A 3TBSA 1WFTA 2A9ML 3PIQA 3Q6GH 1MNUL 2AJZA 2C4FT 4WU7B 4PJ7A 4HS6A 2PYFA 3RUGE 1PZUB 3I85A 2NCMA 1IGCH 4NO2A 1X5AA 1K4CA 4NZTH 3N9GH 5C0IB 4KKCD 1I3UA 5KZCD 3HA0A 4PUBL 1L9MA 3H7BB 2CIIA 4GRMA 1HKLL 2OCFD 2ZSWB 3GJFH 1BGXH 2GCYA 5T33H 3KR3H 4K8RL 2PW1B 1CXIA 3O6KH 5EWIL 2AK4B 4M02A 4PJ8B 1T89C 1F02I 2O5ZL 2ZUWA 8CGTA 3ARVA 4WWKB 2R56L 4PD4J 4QHMB 1YEJL 5C7XL 1DP0A 3O6FA 4K94C 1KCKA 5IR1B 1NGYB 1MCPL 4NRXB 4QNPF 4MA8L 5CJ8A 5E9DB 2WANA 3EAKA 3S35H 2FHFA 3LN5B 4ZTPH 4AM0A 3WKMH 1NPUA 3BP7B 3KPNB 5I8EB 5DVLA 2X9WA 4YHML 4X5WB 2HFGH 3O11B 4XPBL 2YKLH 1WAAE 5KSAC 1BZ9B 2Y36H 3N1FC 1IGIH 2XXMB 2FSEB 2VZ1A 5JHDD 1OD9A 2GSIB 5HVGB 1V7MH 2VUOA 2W65A 1FVEA 4ZDHB 4KGJA 1KNOA 4ZPVB 5E8OA 1FP5A 3U2SA 1BF8A 3ZE0E 1NUFA 4LCYB 1XIWC 3SE8L 1OP5H 2ADJA 4KQ4L 3U4EA 5GRVL 3AROA 4XCEB 4MA3A 4JFQA 4ALAH 5SWQB 3I6GB 5FO8A 1EFXB 5D6DA 5GIRA 4BQ9A 3CC5B 5I8KH 2F5BL 1ZHLB 1XF1A 1I7UA 4WHCA 1RAMA 1NBYB 2VN7A 3LRSB 1D3CA 1UADC 3FTGA 1AGCA 4PJXE 2HN7B 4UOW0 3RVUD 4TVPH 3RWEB 2X4RA 2BNRE 1UJ3B 3QULB 3O2VH 4XAKD 3QNYA 3FQNB 4Y4HC 2EXYC 5H94B 3BDXA 3H9ZA 2WV3A 4M9OA 2R1YB 3RVXC 2PO6B 4X5XA 3VWJC 3GMLB 4DEPB 5KW9L 3VGBA 4OGXH 5DHYA 1OAQL 3LN9A 4KQ3L 3TBVA 2DJ4A 4NC1C 4JM2A 1QHPA 2IFFL 4GSDH 5C0CB 2VXQH 3PXHA 3UTTB 5IB1A 4HXBL 2VDKL 4GRWE 4Z5RB 4XHJD 4LDOB 2GFBB 1CS6A 1MHEA 2X41A 4P46A 4OIIH 2DQUL 5FB8A 2NY2D 3D0LA 2B5IB 5E7FA 4PJDA 1T2QH 2PNDA 3CCHB 4G3YH 3QH3A 5C9KA 5D1XC 4AEIH 2P7TA 3VFSB 4JHAH 1QFHA 5EFIB 1WBZA 3ME0A 1CLCA 2AP2A 3BWUC 4R26L 4P5TB 2A6IB 2RFXB 4MAUH 1MRCL 3RL1B 1FPTH 3VXPA 4XCFL 1AO7A 3A67H 3U30C 2MMXA 5D1ZB 4LSTH 2ZOKB 5JW5B 1OHQA 3QFJE 3RJQB 3O2DA 4QHLA 3GMPB 3D25B 4XVSL 2DICA 3F6LA 1DQJB 3WIHH 5BV7B 4ONHA 4WIQA 2P5EB 3PGFH 3PGDA 3JVGC 4YHNA 5CP3H 4OLYH 3BISA 2CGRL 4F58H 1RIHL 2J8UB 1KBGH 1N2RB 1ZVSA 3TNNB 1NBQA 4IDJL 4N0CC 3DSFH 3EYUL 4HKJA 5HDOA 4XT1C 5SX5H 1Z3GH 4ERSH 1T1WA 3RWIB 4AG4H 2VTFA 5J12C 1MY7A 2H3NB 2NXZD 3C2SA 1RHHA 1CE6A 1AQDB 4Z78B 1HXMA 4P46D 4QRQA 2R0ZH 1NCWL 5EDXA 1MCNA 1WEJH 1MVFA 1F3JB 3TO2A 8FABA 3LCYA 3QXUA 4LKXA 2XIDA 4N1CA 2VZTA 3LKOA 1QR4A 5DTFA 5D7IF 1B0GA 25C8H 1KACB 1RVFH 2VC2L 4OLZH 3KPMA 5FM5M 4MCYB 4ZSOE 4M6ML 4XC3H 5B8CC 1JYXA 3VRIA 4U6TA 4HK3N 3AM8C 3CU7A 1K6QL 4Y88A 4GG6A 4G7YH 3SJVD 1MRFL 1T20B 1MLBB 2Y6SD 3NIGF 4PY7B 5DJ6A 4UT7H 1N4XH 4PRBA 3TO4B 5I0ZA 1KJVA 3REVA 3VXUB 1JHTB 4LAJH 1T1XA 4BSVA 3WO4B 5BZWB 5IWLA 4D0DB 3KPLB 4PRHB 1S9XB 3C09C 3X13A 3T2NH 3GK8H 4Q9BA 1U2CA 1YEHH 3RUGA 2IAMB 4K3EL 4H25A 4QRSB 5C08B 1KFAL 1QR1A 3ULUH 4IS6B 3PNWA 1X5YA 3FB7B 4BH7A 4QRUA 2DWDA 4FXGA 4MWFB 1N6UA 5I1HH 1VGKA 1KEMH 3EDDA 4X6DF 4AQOA 1FE8L 3GMMB 1R5IB 3ARQA 1EJ6A 4MNHB 4R90L 3QUML 3U1SH 4HHAA 2DQDH 4JREC 5BO1H 3JV6B 3ZE1F 4OQ1A 3D39B 4U6HA 2I07A 1CGSL 1HSAA 1AHWC 3M17A 5CSGA 3ROLA 3MV7E 2X7LA 4NJ9L 3RKPA 3W82A 3RTQB 1CN4A 5F96L 1YEEL 4OSUH 5DT1H 2HLFC 2I9LB 1V3LA 5I1CH 3KYKH 3WUZA 1ONQB 5I1AB 1IAII 4BUHA 4NZUH 3ELAT 1F6FB 1LEKB 2R2EA 4M7LH 4BFBD 1F97A 1ULVA 5FCUH 4JN1L 3PWUB 2AJVL 4JO2L 1WAAA 1JJUA 3NH7H 4LLWA 5JW4Q 1EA9C 5D7SL 3GKWH 2FWOA 1E28B 3JWOC 4JHWH 4LGPB 3L3JB 2VLJE 3OKOA 3MV8E 3MBEB 1ZLWH 3GSWB 3FO2A 5EO1A 4ZUWB 1BEYL 1G9NH 3MLSL 2IADA 2B1HH 1NANH 4F15C 5FA4B 4JG0L 3QWOB 5I1LA 4MX7B 4O4YH 3C8KA 2J7LA 1U95B 3MJ8A 4M93C 1QTYT 1XAUA 1NGZB 2ICEB 2CKBL 1XGTB 3AREB 5IFJA 2XWJB 2O61A 1F58L 4NN7B 4NQVB 3TN0B 1UB6A 3QI9B 4EI5A 3PWLA 1NMCC 1VENA 3ZYOA 5I71B 4LRNL 3TIDA 2VWEC 3ZTNH 2V5TA 3FZUC 3O3BB 4LEOB 1MNUH 1OAXH 3AU1A 5ETUB 3I75A 3CFJB 3MRGB 1OTUC 5A16A 3EOBB 4P57B 3BP6A 5FIEA 5T3ZL 1G84A 4PUBH 5C0BE 4U6VL 3K2UH 4HFUL 1HKLH 5KSVA 4KK6C 4LCCA 4K8RH 4X4YA 2B20A 1Q9OA 1HCFX 4U7KA 1SEQL 4ZO6A 1TJIL 2OR9L 2Q7YA 4DUXA 2M1KA 5KZCB 2NY1B 2O5ZH 4JANA 4M4PA 2R56H 1YEJH 3VFOA 5C7XH 1NKOA 1X5JA 4Z7WA 3HAEH 3S37X 4HIEB 1HOCA 3V95A 1JWSB 3GIZH 5IOPB 2EXYD 4JZJC 3QDJA 5ITFA 4LIQH 2VAJA 2XKNA 4KRLB 4F37K 5IJVB 2X09A 4LHUD 4LOUC 5C0JB 4O58H 3IDYB 3NTCL 1CFNB 4QCIB 3GUTB 4Y4FB 1CT8B 3GSXB 4OCMC 4MNQE 4XPBH 3VCLB 4G5ZL 4JKPL 5E99L 1N59B 3OL2A 3WN5C 3QFJA 1WZMA 1HWGB 3GSOA 1XMWA 1MHPL 5F7LB 2MFNA 3RDTA 4N8VA 3STLA 1N5YL 1KIRA 1S7UA 3GO1H 2GK0B 2E9BA 4JKLA 3SE8H 4KQ4H 4JLRB 4NYLB 4JPWL 2DQGL 1JK8A 5T1MB 3RNQA 1ROWA 3SGDH 1BD2B 3TBSB 5HGGS 4DW2L 3PIQB 1BBJA 2AJZB 4WTXA 4PJ7B 5K9QG 3BI9X 2PYFB 4HS6B 5DF0A 4B50A 1FAIL 1WWCA 4JG1H 4NO2B 4CMHC 1K4CB 5TGBA 1JTOA 3NCMA 1GPOL 4KJWC 5IBUG 4Y19D 3R1GL 3ZHKA 1L0QA 4WUKL 3Q0HA 2GCYB 1BHGA 4CVZA 1ES0A 1RUML 3HE6A 1EO5A 1GC1L 2APVA 4HH9A 2E3VA 2ZCHL 4PS4L 5DO2D 2R0KL 4OM1L 3UAJD 4DK6A 5K59F 3RZWA 2C3WA 3HHRB 5KW9H 4PG2C 1B90A 1OAQH 4KQ3H 1XR9A 3QDJD 3LHPL 3KYNA 3WEXA 3KPPA 2IFFH 1DEDA 4ZSOA 3QPQC 2GTZA 4R6UA 3ARPA 3O6FB 4HXBH 2VDKH 4H88L 4GKNA 1HH6A 3K8KA 4X7TA 4YEFA 5DUPL 1U42A 2DQUH 1NGPL 1DUYA 4KROB 4AM0B 4JFDB 3BE1L 3CFBB 5CJ5A 3KJ4B 4JFXA 1KJ2A 4K3GA 4NQEE 3QFJD 1KTDA 2W1NA 3DJ9A 4I4WA 1TQBC 1YUHA 3GRWL 2M2DA 1RK0B 5EBGA 5F7KC 2UVFA 1ZLUK 5JOPE 4MHHI 4TUJA 3BRFA 1U8PA 1MRCH 2OJZL 2EYTA 3O4LE 4XCFH 2HT2D 3MGOA 5HYQA 2Z91A 2W65B 4XAWL 2IJ0C 2LFGA 5GRXG 4MAYA 1FVEB 1KOAA 3DWTA 3U79A 1MQKL 1KNOB 5E8OB 1BWMA 4WW2A 3WNKA 3U2SB 4XCNA 3OXSA 1Q9WA 1VKXA 2JE8A 3U4EB 5LG1A 3LH2L 2DQEH 4MA3B 4JFQB 4XVSH 5FO8B 5GIRB 3MV7A 4L5FL 3U4AA 2OXGA 2CXGA 1I7UB 4CBPA 3G5ZA 2HFTA 4IBLT 3HE6D 3VE0A 3QIWC 4U1NA 2Q6WA 5F7UA 3IDIA 3NCEB 3FTGB 4HGWB 5IVNA 1AGCB 1S78C 2CGRH 5F97E 4L3ED 4C4KT 1JGLL 1PX4A 5JZ7D 3IDJA 4R0LC 4MJ5A 2X4RB 3FB8A 3QEQD 3QNYB 3VI4F 1MAKA 4EVNA 5IIEA 4JVPA 4WI8A 3EYUH 2YUXA 1CFVL 3U0PA 3G6AA 2YRPA 4IMKA 3SDCA 3TYFA 2BNUA 4X5XB 2EE9A 3SGKA 2Q8AL 1YN7A 3G6DL 5DHYB 3TBVB 1AD9A 3CVHL 1NCWH 4PB0L 4JM2B 1FL6A 3VJ6A 2X40A 5CJXC 3LEVL 2JJTA 5CEXA 5IB1B 2K9UA 3BZDA 2VLJA 3MV8A 3UBXI 4FQ1L 5F9OH 4P46B 4I0PA 5FB8B 3D0LB 3DETD 2VC2H 4PJDB 3BUYA 1RY7B 2HLFD 3QH3B 2FJHA 5FYJE 2P7TB 4M1GL 1K6QH 1UZ8A 4HMEA 3DXAD 3RGVC 4MAYD 1WBZB 3C9NA 5T3XH 5I1DA 3F7RA 3RVTC 1YNKH 4A6YL 3MRNB 1CZ8H 1FCCA 3B9VA 3VXPB 4RAHA 3GM8A 1AO7B 4EUPH 2HTLD 4K3EH 1KFAH 1JNNL 2R2CA 4XC1H 5FXCH 4ZFGL 3S5LG 2IWGA 4HT1H 5ADOL 5DZNA 4FFYH 1ETZA 4L1HA 5C0BA 4KDWA 2X9XA 4QHLB 1J8HD 1FE8H 3FT2A 3HB3D 1RZKL 1VFAA 4R90H 1PSKL 3SQOL 4ONHB 3QUMH 3MRFA 4ZAKC 3PGDB 3SDCD 5H37G 4YHNB 2DMBA 5BW7C 1CGSH 1S5HA 1ZVSB 3CH8A 5A43C 3VMPA 4HKJB 1TJHL 1T1WB 5F96H 1YEEH 2FBJH 2VLJD 1IM3A 4UIKL 3MXVL 3MV8D 1RHHB 1CE6B 4EBQH 4YDLB 4LBEA 4M8VA 1HXMB 4K3DL 4QRQB 1JYVA 4WI7A 4I0PD 2V17L 3T0EC 2WLZA 1NMBL 1CR9L 4LARL 3TO2B 8FABB 4U0RB 4KK6D 2C5DC 3MOAL 4LKXB 3M07A 4JN1H 3LKOB 4MNQA 4QRRD 1LDSA 2AJVH 4JO2H 3ILQC 1U3HC 5DTFB 4YIQA 2C4FU 1ZWIB 1VEMA 3GJFK 4P2YA 1UA6L 5D7SH 2FBOJ 1G9NC 2XTLA 3KPMB 3G5XA 1KB5B 4OD3L 1SBSL 2HKHL 1N26A 5GS0C 1I1CA 5FGBA 5FHAL 2J8UF 1BEYH 3NA9L 3MLSH 5GRZA 4GG6B 2Z8RA 3BIBX 3A6OA 4Q74A 5DJ6B 1KLGA 4I5BA 4JG0H 4PRBB 5GS1A 3ZZ1A 1KJVB 3REVB 3SO3C 4HPYL 1T1XB 4BSVB 4WI5A 3EO1A 1IL1A 3X13B 3HG1D 4XPAL 1CF8L 3RUGB 2CKBH 2QLVB 1REIA 4H25B 4CN1A 1QR1B 1F58H 3PNWB 4BH7B 4XP4L 5DZLA 4QRUB 2DWDB 4LRNH 4FXGB 1VGKB 3CX5J 1RURL 2VDNL 1VPOL 3AS0A 4K8RC 5IBUB 3QUYC 2AQ1A 4HAGA 4HHAB 1U2HA 1UM5L 4L3CA 4JVWA 5I9QC 5T3ZH 4U6HB 4QOKD 4U6VH 1G7PA 2I07B 4HFUH 1HSAB 2JJUA 3M17B 4I18A 3PHOA 2X7LB 2UVEA 4NFDA 4NKIL 1SEQH 4NWTL 4ZFFA 2HTKD 2OR9H 5E2UL 1OP5K 1A9BA 1AY1L 2J8OA 3PWVA 4XNZB 4QGTA 2VIRA 3NIFF 3W81A 3WJJA 2OX5A 5FYLE 3MFGB 3TF7C 1T7ZA 2R2EB 4NQEA 5F93C 4ZODA 3BPOC 5HYFA 3BO8A 4I77H 1IRAY 3CXDL 4JEGB 3HNSH 4LLWB 3VXOA 1T1YA 1AC0A 2FWOB 3NTCH 3K2MC 4MD0A 2G9HA 4OTXL 1G6RL 3OKOB 3W0WE 4RAUA 1ZGLA 3FO2B 4GRLD 5EO1B 1QSVA 5BXFA 5EOTA 3MLVL 1F2QA 4G5ZH 4JKPH 5E99H 2APWA 3HC4L 4MB3A 5IJKA 1LGVA 4ZFZA 1XGUA 2IADB 5D1QD 3O0RL 5FV1L 1AXTL 3BD5A 1HHIA 3HZMA 3EOAA 5I1LB 3C8KB 5L8JB 1N5YH 3MJ8B 2V2TA 5IFJB 2O61B 1NCUA 4PJXB 1UB6B 2DQGH 2GW5A 4EI5B 3PWLB 3I3DA 2DIAA 2BNRB 3TIDB 2WIMA 5HYJE 1XF4B 4DW2H 5IBLD 3AU1B 3O8XA 4AEHL 3I75B 5BJTA 4YHYC 5F72S 5A16B 1DBAL 3JV4A 2OSLA 2MOVA 5BS0A 3BP6B 5JXEC 3R1GH 4WUKH 5HTSA 3E8UL 5KSVB 4LCCB 1RUMH 4X4YB 1C7SA 2LV4A 2ZCHH 1Q9OB 4QGYA 2R0KH 3KS0H 4GRWB 5IQ7L 3P77A 2YD2A 2Q7YB 5F7EH 1NH6A 5DGRA 5GSVA 5FKPA 4JANB 3LHPH 3FFCE 5K9JH 4MLIA 4NOFA 4QXUL 4FQXC 4EN3A 3VFOB 4Z7WB 5JOPD 4H88H 5JIKA 1HOCB 3MROA 1NGPH 3QDJB 5ITFB 5IMOA 2VE6A 1AH1A 2XKNB 3BE1H 4U1GC 5SX5K 2IANA 2UZIH 4YO0A 4JO3L 2UWEE 2I24N 3LKRA 1R3HA 3GRWH 4UMGA 5TF1H 4J12A 1CLYL 5C6TL 2E5EA 2DL2A 5TDPA 3I6KA 3NABL 3PHQA 2ICWI 3QFJB 1CD8A 3GSOB 4DCQA 1VEOA 1B88A 1VCAA 2OJZH 3HI1A 4GMTL 3RDTB 4XAWH 4N8VB 3STLB 1KIRB 1MQKH 1S7UB 1G7QA 3O8XD 5DMJB 4FZEL 5DRWA 4PJ9B 4MQ7A 4GW5A 1EHNA 3RGVD 3LH2H 5BS0D 3WNPA 3BKCL 4L5FH 1BBJB 1MLCA 5GGTH 5TGBB 3VGAB 4FNLL 3HKFA 1JGLH 5TE4H 1ZS8A 3UTQB 1J9CT 4LCIL 3UZVB 2MCG1 4CVZB 1ES0B 3HE6B 1CFVH 4HH9B 1G7IB 3CVIH 3R0NA 4MJ2A 4EN3D 3HRZA 4F9PA 3H9SD 5TQ0L 3QDGE 2Q8AH 4I3SH 5FYJD 2FB4L 3IYLW 3G6DH 1HSBA 2Q3AA 3BZFA 3F7PC 1XR9B 2X4PA 5D71L 3LQMA 3CVHH 5ICXA 1RV6X 3KYNB 4PB0H 3WEXB 1PZ5B 2ZOLA 3KPPB 4ZSOB 3LEVH 2GTZB 4J1UA 4IOFC 2DKSA 4XI5C 2IAND 4LVNB 4GKNB 1BQHG 1HH6B 4FQ1H 4YAQA 3FB6A 4X7TB 5EU4A 1DUYB 5CEZE 1S9WB 2HVJA 4PJ7F 7CGTA 1KN4L 5HJ3A 3L9RA 4JFXB 1KJ2B 3B9KB 1KTDB 4ETQA 4M1GH 1OARL 4I4WB 4OF6A 5EU3A 5KVGL 2J1KA 1YUHB 3GHBL 4YNYA 2AXJA 2BHYA 5CHNA 3R8BB 1UM4L 2F5AL 4TUJB 1HEZA 3RWJB 2QHRH 1U8PB 1BQSA 2EYTB 3WKNA 2MHAA 4HWEL 3MGOB 4O2CA 4OI9A 4Q0XL 2Z91B 1KELL 4MAYB 1ZHNB 3W2DL 1JNNH 4EI6A 4WW2B 4ZFGH 4XCNB 3OXSB 3THML 3T4AA 5ADOH 4JFYA 4PPTA 4YBQD 1Q9WB 1T3FA 1Q38A 2WWKT 4I9WD 4G9FD 1ZLWK 2NMSA 1RZKH 1FFQA 3MV7B 3ULVE 1PSKH 4YHKL 3G5ZB 2VL5A 3VE0B 1F90H 3WFCL 4U1NB 2Q6WB 5I8CA 2DLFL 2VXSH 3BESR 3D69A 3IDIB 1T7VA 1RUAL 3IDJB 5I75C 3FB8B 1LO2L 4EVNB 5F7MC 5IIEB 3U0PB 1RZIA 2KDGA 2W0PA 1TJHH 4YK4B 4XBGA 5SWZE 3SDCB 3TYFB 1CIUA 2BNUB 5FYKD 4UIKH 1YQ2A 2IBBA 3MXVH 1YN7B 4K3DH 1AD9B 3S6CA 4CVWA 5TE7L 1C1EH 1JPSL 2V17H 1NMBH 1CR9H 3VJ6B 4KKLD 5DFVC 5JHLL 2MQ3A 3QJHA 5CEXB 2VLJB 3MOAH 5T5NG 3MV8B 4OZFH 3W0WA 4KI5D 4I0PB 3KYMA 3ARDC 1UA6H 2D4FA 3BUYB 3EHBC 1A4JA 4GXUM 4Z77A 2CLZA 4OD3H 3GZKA 1SBSH 2HKHH 2R9HD 3VA2C 2FJHB 4Y2DD 4OM0H 3OV6A 5FHAH 3NA9H 5LJYH 4U1KA 3C9NB 5I1DB 4I0KA 4XRCA 1ND0A 2F8VA 1TLKA 4QTHA 5C3TA 4GW1A 5BQ7A 4HPYH 1A2YA 2VISA 5HYJA 3V0VA 5D2NC 3MCG1 4LSQL 4XPAH 1CF8H 4JM2F 1OSPL 5ACLA 3GDBA 4X6FA 3MCLL 1ETZB 1YEGL 5C0BB 4QRPE 3WDJA 3D85D 3K1KC 2A74A 1RURH 1NAML 3FT2B 9CGTA 2VDNH 1VFAB 1VPOH 5HDLA 3R8QA 5CGYD 5DMGC 2ARWA 1W72A 2EDYA 3MRFB 3KLHC 4KMQA 2AQ3A 3JWNC 1TFHA 1KPVA 5HY9A 4M00A 1GIGL 1S5HB 3ES6A 3FFCA 4IM8A 4DAGL 4NKIH 1I7ZA 4YFLI 5J4MA 2QADB 3QIUA 4WTZA 1NL0H 5E2UH 5FYJU 1AY1H 5GRVK 3PQYD 1IM3B 1PY9A 5FUOL 3W0WD 3N1QC 4LBEB 4GH7B 3ARZA 3WSQH 1FN4A 1NFKA 5JXED 3NCJH 4F8TA 3RL2A 2WWMC 2PXYC 5JORA 2UWEA 1KCUL 4D9QE 1OD7A 2OI9C 4LLUA 4OFPA 4MNQB 3BOVA 3CXDH 2ZG3A 3RAJH 4YIQB 4W4OC 2EDJA 4TOYL 3G5XB 2HG5A 4OTXH 3V4PL 2G60L 1G6RH 4CAGA 1FIEA 4JO1L 1OCWL 3MLVH 4PP1C 4AJ0A 1TIUA 3HC4H 1A14L 1FL5A 1PD6A 3C8DA 1KLGB 2EDBA 3OR7A 3O0RH 4I5BB 5GS1B 1QSEE 1MCKA 1JF1A 3CMOL 4HIJA 4ZUUA 2VLKE 1IL1B 1R3KA 5E00A 1D7FA 4DKAA 1QSFE 1ZVYA 4D3CL 2PYEE 3TNMA 1FAKT 1DVFA 5IW3A 2BXYA 2RBLA 3JV0A 1IC7L 5D96B 3QUZC 1K9TA 4G6ML 3C2AH 3ARGD 2NY6D 4QXGL 1J18A 1FZKA 3HC0A 1GC1C 4NUGL 3QDGA 1DBAH 3QIUD 5B3JE 3X11B 5DUMH 3TA3C 4YH6A 4L3CB 5CWSA 3VG9C 1II4E 1NCAH 1G7PB 3E8UH 3ILPA 2H41A 4V2BA 5L9DL 4I18B 3PHOB 1XGYL 4GG6F 3ZKXC 5FYKU 7FABH 4ZFFB 2XA8H 5IQ7H 3QCVL 3SCMA 1A9BB 3PWVB 2VIRB 4N8CL 3RZCA 1EIBA 2H2PC 1INEL 4G7VH 4PRPE 4QXUH 4GAJL 1FNFA 4XVUD 4L3AA 1U8KA 4NQEB 5DK3A 2EDQA 1WVZA 2RB8A 3BO8B 3KGRA 1FORL 2AEIT 1FLRL 1R3IL 4LFHG 4W6YB 1KCRL 3TJHC 3QUXC 1CGTA 1EVTC 1ZANL 1EUTA 3VXOB 4KXZH 5KBNC 1T1YB 2ZCKL 3KYAA 2IALA 3ZKND 4KJYB 2SEBA 4MD0B 2G9HB 5IG7A 1A3QA 5JO5A 4JO3H 1ZGLB 4RAUB 3MNZA 3RU8L 5BXFB 2Z31A 3WJLA 5EOTB 4ZFOL 4V1DE 5C6TH 3IJYA 4PJ5D 1CDHA 2CD0A 3P30L 3NABH 1QFPA 1DVFD 3MZGB 2KKQA 5K9KA 1J0YA 3HZMB 4GMTH 1HHIB 5KVFL 3EOAB 4XNMA 3T0VA 2Q7NA 5LQBH 3EJYD 2XI9A 1BFOA 2V2TB 4HMCA 2EIBA 4FZEH 1I1YA 3RFZC 3BKMH 3EYFB 4WV1C 4K9EH 1A02N 5EG6C 4X9IA 2FH6A 1X5GA 4OIBA 4LQFL 3WDIA 4NQDA 3O8XB 5SWZA 4WENB 5BJTB 5ELIA 3JV4B 2OSLB 5IUSA 5BS0B 3SCMD 5CIPH 3RZCD 4OD2A 4WU5A 2CR3A 5JMRA 4UIMA 1MCWW 3B83A 1ACYL 3P77B 5F9JB 4RQQA 2FB4H 4KGLA 4WTZG 5GSVB 5FKPB 5D71H 3B8SA 3VGDA 3G04A 3GI8L 2YUWA 3BQUC 3QRGL 4EN3B 4FTVE 1T7XA 2WMPA 2EO1A 3MROB 2AEQL 4G42A 1GYAA 1A47A 5IMOB 3FOMA 2Z31D 2VE6B 3SGDI 5JIPA 1LDPL 2HKFL 1KN4H 5SX4H 4XPHH 1BWWA 4MQXD 1RZ8A 4YO0B 1OARH 3LKRB 1R3HB 2JLLA 1NFIB 1CFQA 1UM4H 2F5AH 4BA8A 5TDPB 3I6KB 4U1LA 3W5MA 3PHQB 4GRWF 5DEGA 4UNUA 4QRPA 4DCQB 3ARDD 4XWOD 1X5ZA 4WHYH 3EHBD 4Q0XH 1R0AL 1OPGL 1YJDL 1RZKC 4JPVL 5C86A 1G7QB 3H42L 4NQDD 5HHOE 1WV7T 4QO1A 3THMH 4Z7WF 5DRWB 3NIDE 4MQ7B 1MAML 1Z2KA 4GW5B 4NFCA 4ODUA 4P59L 2O93L 3LZFL 5E1HB 1F3DH 3V8OA 3RKDD 5J89A 4ELMF 4YHKH 4TRPL 1MLCB 3BN9C 1N5AB 4Q97A 3WFCH 4E41D 2DLFH 4QKXB 1JI1A 1INQB 4KMTL 4M7ZC 3TYGL 3D1MC 3K4ZA 5KSAA 3K4AA 4BSWA 1ZS8B 3NN8B 2NY4D 4Y0GA 1LO2H 1TITA 1GAFH 2EKJA 3R4DA 4MS8D 4Q58C 5ESQA 2RHEA 3UBXA 2IPTL 3HRZB 3H3BC 1QUNA 1X4YA 1FV1A 4GJTB 5M7QA 1HSBB 2J3SA 3BZFB 3QZWA 2X4PB 4NBZB 1JPSH 5ICXB 5I1IL 2VDOH 1FNGA 2ZOLB 1A1NA 3FAXA 4J1UB 1G1YA 2J5LB 3V4UH 2VKWA 2FECL 3MLZH 3MACL 4YAQB 3FB6B 5EU4B 2VERN 2F9BT 3M8OL 5DWUL 2HVJB 5HJ3B 4MXWL 3L9RB 2A83A 2VLKA 3DX9A 4Y4HA 4C58B 1QSFA 5EU3B 3TM6A 3QO0A 5HI5D 1IQWL 4YNYB 3VWJA 2EIDA 5CHNB 4LRIC 5DURD 1HEZB 1CQYA 5EUOE 1OWWA 2R2HA 2CIKB 3T4YA 2MHAB 4O2CB 5ICZA 1U8HB 1TDQA 4EI6B 1OSPH 1FFNA 2EDRA 1PG7L 3QCTL 3T4AB 4JFYB 1LK2A 3MCLH 4JQXC 1T3FB 1YEGH 4XTRD 4WHDA 1BAFL 1X4XA 4OLWL 2VL5B 4JR9L 5I8CB 3D69B 2DLEA 2MSPA 5I1KH 1I8LC 1WFOA 3AB0B 1GIGH 3CD4A 4APQC 2P43B 4XPGL 1VESA 3H8NA 1RZIB 3GSRA 4XBGB 3PWPA 2VDPL 2E7BA 4IJ3B 1JGVH 4JKKA 4JRXA 3FO0L 4TTDD 2MQCA 2XWBA 4KK8C 3MA7B 3QJHB 4Z76A 3O9WC 3W0WB 1KCUH 2ZNXA 4LVOB 2VLKD 3MJ7A 5D4QA 4ZG1A 1G0XA 4V1DA 1AR2A 2GSGA 3KYMB 5DYOA 1JBJA 3IRPX 4TOYH 4MHHG 2OLDA 4Z77B 1GGYA 4M5ZL 2V7HA 2CLZB 3V4PH 2G60H 4JPIA 1N6QL 4TVPE 3UTPE 4JO1H 1OCWH 1J0KA 1HHGA 5L8LB 3FKUS 4Q9QL 2OR8A 5A2IH 1F5WA 4U1KB 1D9KC 4J3WA 1YYLH 2Y06L 3P4MA 3SDXA 1KPUA 3QUXD 4XRCB 1ND0B 4OCRL 4QTHB 5DQ9A 5A40E 4GW1B 1AE6L 3CMOH 5BQ7B 1H3UA 5L2KE 2VISB 4BJLA 5HYJB 3V0VB 3C60C 3G9AB 5GHWL 4IDLA 4JFZL 3OX8A 4HCRL 1IC7H 2XKUA 5KAQF 4X6FB 4G6MH 1FL3A 3A6BH 4ZS6D 5SWSE 2VLRE 2A74B 2EEBA 4QXGH 2WQ8A 3OKKA 4GS7C 4Y4KA 2Y9RT 4NUGH 1W72B 3MA9H 2ERJC 2F53E 1T66D 1KPVB 5HY9B 3PWPD 1CXKA 1F6AA 3ES6B 3FFCB 5L9DH 5FO7A 5BVJA 1XGYH 3LQZA 2NY0D 4FTVA 1I7ZB 4JRXD 3QIUB 1I1AD 4KRPD 3QCVH 1JVKA 43C9A 2BK8A 3O6LH 2X2YA 5H37H 4N8CH 1RK1A 1INEH 2XZAH 5BV7L 1P5UA 4V1DD 4WVRA 1FN4B 2WNGA 4R3SA 3RL2B 3MXWL 5E6ZA 4JQIH 5JORB 4LSPL 3UX9B 2UWEB 4Z7OE 1XCTA 4F7PB 5FFLA 4LLUB 1FLRH 1R3IH 4XPTL 1KCRH 2AK1L 4OCNC 1ZANH 3IFNL 3ABZA 2ZCKH 1XT5A 5D9SA 1LVEA 3V6ZA 1UENA 2HG5B 4JFPB 4GXVH 3HNTL 3PL6C 1HNGA 1BZQK 2VLLA 3RU8H 5DC0A 4N9GA 5HHOA 1OAUL 5GZNC 3G5VA 5F6HI 3P30H 1FL5B 4LK4A 3OR7B 4ZUUB 4HIJB 1JF1B 5AUMA 4X9HA 4OFYD 1R3KB 3C5ZC 3L5IA 3V52L 1T6VN 3EYOA 4DKDC 3TNMB 1DVFB 1WSST 5IVXE 1DLFL 4RWHA 4Y4KD 4YDKL 4BK5A 4HF5L 4NCC2 1D6VL 2CUHA 4LQFH 4KJPC 3HC0B 1FZKB 2IC2A 4Y16C 1BFSA 4FTVD 4PLKC 3HR5A 3QDGB 5C92A 3FHQA 2Q1EA 5L88L 1U8QA 5CWSB 2DAVA 2DD8L 4G6JL 4NM8L 2VRAA 3ILPB 2H2SC 2QSCL 4LP5A 1B0WA 4YHOL 1ACYH 2PTUA 3SCMB 2LABA 2GUOA 3BN9D 3RZCB 3CMGA 4GT7A 4R2GD 1GHFH 3GI8H 3ULUE 1QRND 1ORQA 1U8KB 2G75A 4UTAH 5I15H 3OBAA 4MB4A 2W9DL 5CD5C 2K7QA 5BOPA 5CGTA 2OTWA 3H2WA 2XTJC 4PREA 5TPWL 1C5CL 2ICWA 1B4RA 1YZZA 3EO0A 4FHBD 4HKZA 4UU9A 5HHOD 1EAPA 1LDPH 2HT4C 2IALB 5EUOA 2SEBB 5IG7B 1LNUA 2J8HA 5JO5B 3MNZB 2EDHA 4NO0A 2Z31B 2Z8VC 1FGNL 3JTTA 3SKOA 3P0VL 1BX2A 3IJYB 4K55A 4HLZG 5CP7A 5A2LH 5EB9A 1TETL 3X3GL 5K9KB 1T5XA 3FT4A 4XNMB 3MLUL 1R0AH 1OPGH 3PWJA 4JPVH 4P3DA 3H42H 1BFOB 2DLTA 1GGIL 1I1YB 1MAMH 3MMEA 3DHMA 2VXVL 3V6OC 3UDWA 4NGHL 5IEHA 5HVHC 1RD6A 5LKNA 4NQDB 1Z0MA 4TRPH 3LB6C 4PRDA 2CLRA 3TFKC 1K8DA 1X4ZA 1P2CA 3VD7A 1F4WH 2R2BA 5SWZB 4BZYA 4NCC1 4KMTH 1MFEH 3TYGH 3RA7L 4J23A 1OL0A 1JF6A 2JB6A 4J2XA 4FQJL 1GGTA 1P5VA 2X4NA 3WN5A 1YMMA 4OD2B 4P4KC 4WU5B 3DMMD 3QAZC 4GQ9L 2IPTH 1YC7A 4QT5A 1UXWA 4H20L 2LQRA 4RQQB 4WFED 3MOQA 2VR5A 5GS2H 5FOJA 4YDIL 4ETYA 2WLYA 4YHPA 3QHTC 1E4KC 4Z7VA 3G04B 1CICC 2QQLH 5I1IH 2OL3A 4YGAB 2V2XA 1NC2A 1W0VB 4OLVL 3P3YA 3MACH 4OF0A 3UEZA 1K85A 4G42B 3GHEL 1KLUA 4S1RL 3MO1A 3MNWA 3MGTB 2CMRL 4NO0D 2VJXA 3FOMB 3JWDL 3M8OH 1OW0C 1NJ9A 5A2KH 1NLDL 1OGAD 4HXAL 3B4NA 4YDVA 1UC6A 2JJSC 5H35A 1Q94A 4MXWH 2IGFL 1KN2L 4WI6A 1RZ8B 1RMFL 1UEYA 2DLGA 4LPUA 3DOSA 4HLJA 1S8DA 1IQWH 3QDHA 3O9WD 3VFTA 1CFQB 5MENA 3RIFF 4U1LB 4FZ8L 5DEGB 3RX8A 4QRPB 3OZ9L 5SWSA 2VLRA 2R69L 4IRSC 3TC9A 4CVXA 1E6OH 4BH8A 2NR6C 5CJOL 2J2ZA 4ORGA 5ACZA 5T5NF 2F53A 3IU3A 3QCTH 2GK2A 2YPVL 2Z35A 2D31A 4ODUB 1ADQH 4K07A 4NZDA 5C70A 2UZXB 5TH2A 4LIQE 5D70L 1BAFH 1YMMD 5CINH 4FXKA 4OLWH 3PABA 2R23A 5C0EA 1EMTH 3NFSL 1KGCD 4O02L 1ITBB 5DXWA 5KSAB 4BSWB 3H9HA 4KK5D 4K7PX 4KTYA 2XV6B 1DBBL 1LWRA 4PBVC 2W60A 4XPGH 3UBXB 2ADFL 5E1AA 1U41A 3P4LA 1NC2D 1A5FL 1KTRL 3RRQA 4J6RL 1FV1B 1KC5L 2VDPH 5I6XC 3T3PE 3WIHA 3CPLA 3QZWB 4KY1L 3FO0H 1FNGB 4P23A 3LPWA 1A1NB 5CP3A 1EEYA 1PYWA 4W6WB 2L4OA 3UZEA 1WWAX 4C57C 4DJMA 3MLYH 2CLVA 4U1JA 3QQ9C 5AYUH 3SN6N 1M71A 1EERB 3PDOA 3V79C 4MVBC 2CDEA 5MEND 4M5ZH 1YEDA 4R0LA 1FVDA 1N6QH 4EEEA 2VLKB 3DX9B 4Y4HB 4YLQT 1CGUA 1QSFB 5HHVL 3QO0B 2PYEB 4IIQC 4Q9RL 1QLEL 1A6VL 1I85A 2Y06H 3SKMA 3VWJB 5IVXA 1MIML 3EYQD 3LKNA 4R7DA 5HBBA 3WO3B 1AE6H 2R2HB 5J6HB 3RX5A 3T4YB 5B38A 3VD4A 2EEAA 3QG6B 3CFIC 5ICZB 1BPVA 1KG0B 4JFZH 1FFNB 4HCRH 4FQLL 3LY6A 5GZND 2VO5A 1FNAA 5J8OA 5CSZA 1URLA 1JN6A 1B3JA 2FDBP 4G8IA 4KKNA 5LXGH 3AY4C 5TJWK 3T2PA 3IKKA 3ARWA 4PRPB 4KI5F 3U4BL 3CFCH 4OI7A 1W2KT 3GSRB 4G8FA 4P23D 5I19L 4O51A 4FFZH 1NCNA 4LSSL 5BV7H 1WFNA 1BECA 2FX7L 3OKEA 1DUZA 3OMZA 4JRXB 4KRPB 5DC4B 1S5IL 1BQUA 1TQCC 3GNML 3MXWH 2ED9A 2HJFA 2H45A 4LSPH 2QEJA 4Y2OA 2QKIB 3MJ7B 4XPTH 4V1DB 3MYJA 2GSGB 5DYOB 4JM4L 5BW7A 1CDYA 1I9IL 1QFOA 4NO5B 4NP4L 1B9ZA 2V7HB 3HNTH 4JPIB 3H3KA 2ZUUA 1HHGB 4GW4A 3PJSB 2NPLX 4F7EA 1OAUH 3K8LA 2MTPA 3P4MB 5J12B 3SDXB 1KPUB 4LF3A 2BY1A 4EKXA 2IPKA 5DQ9B 3BUTA 5I17A 3IXAA 4R97B 4K3JL 1XF3A 4YXHL 2XY2A 5F21B 3V52H 2DMCA 1CDGA 2EE6A 5EOCJ 5A3ID 4MJIE 1DLFH 5BRZE 3OX8B 4YDKH 4HF5H 3OAUL 1U3HA 5LGJA 1EH9A 1D6VH 1FL3B 3BIKA 4XXCA 5ICYA 4ZXBC 3OKKB 1FNEA 5I18H 2QSQA 4WEBL 4UB0L 4NPYA 5L88H 1MCJA 3WFHA 4JQVC 2DD8H 4NM8H 3P4NA 4X80L 1F6AB 2QSCH 5FO7B 4F9LC 3MLRL 5BVJB 2X1XR 5T3XE 3LQZB 4FTVB 4CU7A 3DURA 4KAQL 4DQOL 1BM3L 4RMTA 3O2DL 3C09B 43C9B 2X4UA 1OTSC 5ISZA 2NW3A 3LB6D 4HJ0D 4HFWA 4WFHD 3VXTA 5ILTL 3MNVA 5F7NC 35C8L 1CLOL 4R3SB 3QXDA 1RZGA 2W9DH 5HYSA 1XCTB 2GJ6A 4R2GB 5TPWH 1C5CH 1YY9C 3DHJA 1OTTD 3BT2L 5D9SB 1WFUA 3V6ZB 4HH8A 3C6LD 1BOGA 4L9LA 2VLLB 3UZQA 3IXTA 1FGNH 4N9GB 3P0VH 1YPZE 1YJDC 5HHOB 3HAEA 1WIPA 3G5VB 1TETH 3HI6H 3X3GH 4RGMC 1DEEB 3MLUH 5AUMB 5LBSL 1MUJA 3K4DA 1KIQA 4NJAL 3E2HB 3EYOB 1GGIH 1HZHL 2DOCA 5JOEA 3NA4A 5F6HJ 1CDJA 2VXVH 3B9DA 5CSBA 2UWEF 4NGHH 4HIIA 3MRLA 5JA8B 4KXZI 1U8IA 1U8QB 1IGFL 5ISZD 5AZEL 1IGTA 5E4EC 1DSFL 3QWQB 4UAOC 4F15B 4GQ9H 1WZ1L 3C08L 1ZXQA 4H20H 4RMSA 2GUOB 4N8PA 5IHZA 3L3OA 4IRJA 4X6BA 5F1OB 2GJ6D 5CZXD 4JAMA 3DIFA 4ZOAA 1I8MA 3NVQA 1NMCB 4OLVH 1DTUA 1ORQB 4JFEA 1CBVL 2HWZH 2G75B 4PJ8C 3UJJL 1EFQA 5C09E 5DQDL 2R4RL 3GHEH 3N50A 4H1LA 3TPUA 3GJFB 5E8PA 4PREB 4R4NC 4S1RH 4Y1AA 2CMRH 3QR2A 2ICWB 3JWDH 1FSKB 4QWWD 1T5WA 3EO0B 4UU9B 2EXWC 1NLDH 4HXAH 4PRIE 1NUGA 5CEYA 3L6FA 5EUOB 1DBJL 1KN2H 5T3ZE 1LNUB 2ITDA 4G6FD 4O2EA 1KB9J 1X6LA 1EO8L 4YEEA 4NO0B 3FL7A 3JTTB 3SKOB 1INDL 1BX2B 5E94A 3ALXA 1WITA 5GGUA 5CP7B 4NKOA 4FZ8H 3HC3L 4XH2A 1OF2A 3E3QC 1T5XB 1FC1A 2ZZUT 3AXLA 3FT4B 3HS0A 3X12A 2MWCA 3TVMD 3VFVA 4KDTA 3PWJB 4P3DB 5CJOH 1AGFA 1UKSA 5GGVL 3VRLF 2YPVH 3WLBB 3HZYB 3IAPA 5MHSE 3MMEB 3QNXA 3E1F1 5DZOA 4AH2A 4L8SA 3SE3C 5IEHB 4I48A 4MZ2A 4PRDB 2CLRB 4M1DH 1K8DB 1P2CB 2CRMA 5FM4A 2R2BB 3QXTA 2FCBA 1BVLA 3NFSH 4FG6D 4O02H 3UJTL 5SX4I 3MREA 4FMFA 3S36L 4RDQF 3WLWC 2X4NB 3WN5B 1YMMB 4IRJD 4Y7MA 1DBBH 4Q7DA 1ZSDA 2UZYB 4K2UL 2ADFH 4J4PC 1A5FH 4QT5B 4OF8A 4JFED 4OKDA 3GSVA 1KC5H 5DD3L 3HUJE 2G5RA 3VW3H 4GBXC 4YHPB 4Z7VB 2IFGA 4KY1H 4Y1AD 2V2XB 1NC2B 5HSFA 1CDIA 3WMSA 2AKRA 4HBCL 5J13B 3P9LA 2R1XA 1OAKL 1KUMA 4Y5VA 1KLUB 5F7YC 1NEZA 4TUKL 3MO1B 3MNWB 5EOQL 4POYA 1NJ9B 2A6DA 1A7NL 4YDVB 5GZOC 1PEZA 5H35B 3W11D 1Q94B 1U8MA 3UTSE 1IKNC 1T04A 5E8DH 4XCYA 5HHVH 2B5IC 3UROR 3QCUL 1S8DB 4Q9RH 1A6VH 2MQ0A 3VFTB 1JGUL 4MJIA 2DJSA 1MIMH 5MENB 2PN5A 5JIHA 3HAEG 5K9QI 4HUKB 4N0YL 5SWSB 2VLRB 5JW4N 4NN5C 2X4TA 4KUZL 4CVXB 3VD5A 3K80A 4BH8B 4P5TC 4FFWC 4ORGB 5ACZB 3LMJL 2F53B 3IU3B 4NNXA 4K3HA 2Z35B 5AAMA 2R4SL 2D31B 1QG3A 2FHCA 3DX8A 1TZGL 2YD7A 5TH2B 5CBAA 4HX1A 2VR4A 5JOFA 4FXKB 3OAYH 3PABB 5D1ZC 1WF5A 2R23B 1AKJA 5C0EB 1X5LA 2V9TA 2BZDA 2ZWLT 4EUPA 5EIQA 4P5KA 4M61A 32C2A 3H9HB 3U4BH 3VFMA 5BV7C 5IMLA 1QKZL 2W60B 3WCYA 5E1AB 2F8OA 5FV2A 5I19H 4LSSH 2WBKA 3QDME 5IROA 2GI7A 4JRYE 2ZUTA 3U46A 3S37H 1U8JA 3QUMA 3FRPA 4U6YA 1S5IH 2AJ3A 4P23B 1EEYB 1PYWB 4ENEC 5LVEA 2ZJSL 1D6EA 5D6CA 2CLVB 4U1JB 3MLTA 4Z0BL 4DVBA 3QHFL 1M71B 1YPZA 1Z9SA 3DYOA 2EC9U 4TPRL 4YUEH 1I9IH 2CDEB 1A0QL 3N0PB 3QIBA 4MJID 4R9HA 1YEDB 4R0LB 1FVDB 4UTBH 3ZDZE 3IRZA 3L5XL 5GGSB 1Q1JL 1LO3L 2YD4A 2Z4QA 4ZTOH 1FDLH 3WXWL 3SKMB 4M1CC 1QQDA 5SV4A 1MFBL 4FP8L 5IVXB 5GGQL 1Z9MA 3LKNB 4R7DB 2AABL 3SE4C 3ARYA 2AV1A 1MCDA 4K3JH 3RHWF 5B38B 4YXHH 3IS1X 5T3XD 3CSGA 1KJ2L 3TO4C 1LO4H 3OAUH 1AKJD 3WO4C 3SGJA 1M7DB 1NGYA 1U3JA 4XCCH 5CSZB 2IAMC 4F37F 2YD6A 1JN6B 4POUB 4G8IB 4WEBH 1MIEL 2NZIA 3LN5A 3GEWB 4UB0H 3OGCA 4UNVA 4U0QB 1H8NA 2BJML 3L3KA 1CLZL 2BC4A 2CKBA 2FATL 1S7QA 3Q5YA 5CKGA 4DQOH 1T0NA 1BM3H 5AEAA 1AFVL 3O2DH 4G8FB 1RZFL 4O51B 3TZVA 5C09A 5E2VL 2I5YL 3LOWA 3V0WH 1DBMH 35C8H 1MEXL 3OKEB 4PRIA 1DUZB 3BPNB 1MI5D 3RTQC 1CLOH 4BYHA 4UILL 3QIBD 5B3JF 2HJFB 4X98A 1OAYL 2DIBA 1WCBB 1YQVH 3SDAA 1SMAA 3BT2H 1F6LL 1NEZG 3BHBA 3UPRA 2BOBA 3FO9A 2YN3A 1N0XL 4XMPL 2RCSL 4LGRB 1N8ZA 2W9LA 2NTSP 3SHSA 3TPKA 4P2OA 2BSRA 4GW4B 2QJDA 4YHZL 2AJYH 4F7EB 1H3WM 1UJ3A 3FQNA 4FOMA 4WWKD 2HLAA 3HNVL 4LF3B 4TSAL 2IPKB 3MBEC 5LBSH 1IEAA 5D93C 5I17B 1YY8A 3IXAB 3N1MC 3SPVA 2G5BA 1HZHH 5E9DD 1SQ2N 5F70A 5ITBL 1U3HB 4LEXL 5LGJB 3UTTA 4BM7A 3BIKB 2NYYD 1MCFA 1HNFA 1UXSA 5ICYB 4D9LL 1P84J 1FNEB 1X44A 4NN7C 3TN0C 3QI9C 4HUUA 4NPYB 5I71C 2RQ8A 3WFHB 1IGFH 3HUJA 3TZVD 2ESVE 1BFVL 5AZEH 2FYYA 4MA7H 1DSFH 2ZUYA 2GITA 4B0MM 4EUPG 3S34L 5I1JH 1WZ1H 3C08H 3BYTA 5DRZB 3SO3B 3DURB 3SDXF 1CVRA 1SJVA 3KPTA 1N0LA 5C3LD 5MP6L 2X4UB 5IBTH 2NW3B 4NKQB 3N85L 2BXZA 2ZKHL 3CZFA 3VXTB 2B1AH 3MNVB 5C2BL 3QUZA 3JWDC 1VHPA 3QBTB 1CBVH 3WLWD 3GSNL 4KKCC 3UJJH 4X4ZA 3QXDB 1RZGB 5HYSB 5DQDH 2R4RH 5FDWA 4RZCB 2GJ6B 2X89A 3I2CL 4P2OD 3QUYB 2CK0L 3T08A 4WFFE 1F45A 3P0YL 5FGRA 1BBDL 1EO8H 4OUOA 1BOGB 4L9LB 2PO6D 3IXTB 3TESA 4NQSA 4E0RA 3TCLA 3HAEB 3OF6A 3TNNA 1E4JA 3IDYC 3IGAA 1KTKE 1ZT7B 4YDJA 4AMKH 5D8JL 3UTTD 2IH1A 1MUJB 4PJBE 1KIQB 3JUZA 2FD6L 1AQDA 5GGVH 4YR6A 4P2RE 4X7CC 1Z6JT 1L0YA 3DV6A 2UY6A 1M05A 3P40A 4HIIB 3PGCA 3PP3H 3FQXA 5JQ6L 1NCTA 4WW1A 3MRLB 1UYWL 3UJTH 1U8IB 5IF0A 3QDMA 3T2OA 1RUQL 4Z7NE 1JWUA 1IGTB 4K2UH 1QFUL 5GGRY 4BQ6A 3PG2A 4ZO9A 3NIDF 4C83A 5CBEA 2FGWL 5DD3H 3IS0X 1JP5A 5IHZB 3L3OB 4IRJB 5FECA 1MPAL 5BZWA 4JAMB 3DIFB 5GGTA 1KCSL 1K4DA 4JFEB 1UEMA 3RVUC 4HBCH 2YD5A 5F7WC 1OAKH 4H1LB 3LN4B 4TUKH 5E8PB 2C1PA 2IQAA 2Y07L 4Y1AB 3MODL 4JHZA 4ONFL 5IGXH 1BLNA 2R8SL 1JRHH 1T5WB 1UT9A 2CRYA 1A7NH 1WTLA 3OF6D 1MHCA 1MJ8H 5CEYB 5IHBA 4RMQA 3EFDH 3L6FB 4QEGA 3IFLL 1FNHA 2ITDB 3FJTA 4O2EB 3CVHA 5EZIL 4ZO8A 1JGUH 5E94B 2MJWA 2BVEA 2J88L 5EN2A 3VA6A 3KJ4C 5GGUB 4NKOB 1AGEB 4QF1A 4XH2B 4KH2A 1QPXA 1OF2B 4OT1L 3AXLB 3HS0B 2NY2C 4KUZH 4LLDA 3VFVB 3M1BA 4NQTA 5EIVA 1AGFB 4XVJL 3IDGA 1ONQA 3LMJH 4GAFB 4PY8I 4UDUA 4HLZH 2R4SH 3QNXB 4GG8A 1QRKA 1FBIL 3S9DB 1JPST 2FECI 3B9AA 4AH2B 3QDMD 4GOSA 4U1GB 5CZKA 4L8SB 1K3ZA 4BUGA 4WEMB 3Q5TA 5HGHA 4I48B 3D3VE 5B39G 2DTMH 5EUOF 1BVLB 1E28A 3MREB 5IW6A 5D6DC 4PRNA 1XGQA 4IOSD 1S9VA 4PV8A 1GOHA 1D5ZB 1UKTA 3BKJL 2YRZA 4P99A 4PRHD 5JMOC 4MCZB 1OGTA 5JA9A 4ODBD 2DQFA 1A7BA 3GSVB 4L4VE 3JSSA 5C08D 4JGMA 1IC5L 1JE6A 3MUJA 2L0DA 2NX5A 4XP6L 1E0OB 5J56B 3GB7A 2AKRB 2ZJSH 3AREA 3P9LB 4Z0BH 1E4XH 2R1XB 3QHFH 4Y5VB 1NEZB 1L7TL 4JM2C 4TPRH 1PG7X 3D39D 1A0QH 2LU4A 5CCKL 2A6DB 2XACC 2NXZC 1DQDL 3L5XH 4OGAD 1MRDL 4BK4A 4RWYH 3Q1SL 1T04B 1LO3H 4P46C 4PRAA 1UGNA 3NCBB 2I27N 4XCYB 4N0UE 3GI9L 1HN1A 4QNPE 4YXLL 2I60L 4MJIB 4Z0XA 1MFBH 4FP8H 2HJKA 5FYJL 4O9HL 3BRGC 2AABH 1TJGL 3DTXA 4G6KL 2HMID 1CCZA 2X4TB 2A9NL 1QYGL 3TBYA 4Z7VF 3VGGA 1FO0A 2OS7A 3T1WA 2KZ1B 1IZKA 3JBG7 4XVTH 4NNXB 1L9NA 3V7AE 1RIUL 1U8LB 5F8QC 1Y6MR 4LCWE 1JWSA 2W38A 3DX8B 5I66A 3HE7A 2BVTA 2Y6SC 5CBAB 5JOFB 1F4XL 1MIEH 2HRPL 3DECA 1AKJB 4TVSa 2XTJE 1LP9E 2DQCH 1J1PL 4EUPB 3S4SA 4P5KB 4DZ8A 3HTLX 4M61B 4XHQA 32C2B 3L5WA 3VFMB 4Y4FA 4U1MA 2AJUL 2NX5D 2NY7H 5IMLB 1UACL 3GSXA 4V2CB 4HUMB 4GUPA 1AFVH 3A6CL 4XNYL 2IBZX 1RZFH 5E2VH 1C7TA 2I5YH 3U83A 3ARED 4LL9A 3VFUA 4HUNB 2X1QA 5IT2L 3U46B 3TN0D 1U8JB 1MEXH 3QUMB 5E6YA 1VACA 3DVGA 4JQXA 1T0MA 4U6YB 4WI9A 2F54E 3TJEH 2AJ3B 2YD3A 4UILH 4YX2L 2D2OA 2BVUA 5D6CB 1D6EB 4J3UA 2KL6A 3MLTB 3OB8A 1OAYH 4DVBB 2AGJH 1YPZB 5D7LE 1JI2A 5TQ2L 4ZD3L 1I8LA 2DQJL 1U6AL 1DE4B 3QIBB 1PGRB 1N0XH 4U0RC 4XMPH 3V6OE 4LGSB 4FABL 2XZZA 4WGWB 4GLRH 2ENYA 3VU2A 3RVWD 1CGXA 1UH2A 4YHZH 2Z4QB 5E5UB 2NY1D 5FYKL 4P2RA 1NCBL 1QQDB 2BRQA 5C0RL 3HNVH 2OJEA 3BPCA 3IDXL 4TSAH 4JDTL 2AV1B 2B7DT 4ODHL 2YD1A 1FNLA 4RMWA 1PKOA 3HE7D 1AR1D 1FGVL 3ARFA 3ZYZA 1S7RA 5ITBH 4XNQA 1OQXA 4WI2A 4Y5XA 2AV7A 3I6LE 3RPKA 5IWLC 1F11A 4HZLA 1I4FA 1VADA 4Y4FD 4UQ3A 4UT6L 5CJBA 1ZK9A 1SM3L 1FYHB 3OGCB 5H2BA 4JFDA 1CDBA 3RY6A 3CFBA 3KPSE 3BP4A 5TE6L 1A22B 3L3KB 2BC4B 3OB0K 3AS3A 1F4AA 2CKBB 1S7QB 2HYMA 3I3BA 1H3PL 1Q0YL 1WIOA 2YUZA 4H5SA 1T0NB 1RK0A 4UI2A 5IVXF 5MP6H 3TZVB 5C09B 1CTOA 1VB9A 3G08A 3PF2A 3UO1L 5C2BH 1JZ4A 4PRIB 1P9MA 2D7QA 3GSNH 1BD2D 3HMXA 3CXHK 4XNZC 4BFEA 1SJHA 1CI5A 2JF1A 4LSUL 5IVOA 5CAYB 4X98B 4YFLF 3SDAB 5C0DA 2CK0H 5I76A 4KPHH 2L7UA 3CU1A 3BHBB 3UPRB 2BOBB 4P2RD 3FO9B 1N8ZB 2FHBA 4P2OB 2BSRB 4HGWA 2NY3D 2CR6A 3QJFA 3ULUF 2DDQL 1ZHKA 1ZMYA 3FAWA 4MDIA 3ARFD 2COQA 2N4IA 4UBDD 2HLAB 3QPXL 5D8JH 2VN4A 1IEAB 4OZFG 1EEUA 1YY8B 3O6FD 5E2JA 3SPVB 4XMLL 4FQHA 2G5BB 1LK3L 4KROD 2NZ9D 3VG0L 1O0VA 4JFDD 1T4KA 1UB5A 1UXSB 5JQ6H 5TFSL 1TTUA 1UYWH 4OZGF 4WO4A 3NCCB 2WP3O 4HUUB 4L4VA 4EI5C 3HUJB 1RUQH 2X1OA 3TV3L 2FYYB 3UTZA 3ET9F 2GITB 2HH0L 3S4SG 4HK0A 2BSED 2XG4A 1WTGT 4X6DE 4PJEE 5DHVH 1N7ML 3E0GA 3Q48A 1MPAH 3MRNA 3CZFB 2HJLA 1W72L 3FQRA 1I8KA 3OAYK 3QUZB 1D5BA 1KCSH 4YHLH 1L6XA 4S0TD 4Z7QE 1IAIL 4ZS7L 3UTSB 5CIPA 4R7NA 4MNGE 3GMQA 5FDWB 1AQKH 5FKAA 4N0UA 4Y16A 2Y07H 2R8SH 1DN0A 3MODH 4ONFH 3UAJC 2ZUXA 5DO2C 3NACL 5DR5L 1B6DA 3RIAK 4P9ML 4G8EA 3SKJH 1F4YL 3X3FL 2W9EL 5KANI 5EZIH 2RAMA 3V6FA 4OF3A 4ISVB 4E0RB 4NQSB 3TCLB 2J88H 2LVEA 4F7CA 5T5FL 3IGAB 3BP5A 4YDJB 3CLFL 4FFVD 4JM2D 4LCWA 1NUNB 2IH1B 1P4BL 2MKWA 1L7IL 4XVJH 1KTLA 2P5WE 1EX0A 4YR6B 1D5MA 1LP9A 4WO4D 5AYQA 1FBIH 3RDTC 3DV6B 1M05B 3CIQA 3PGCB 3FQXB 4M48L 5GGSY 2YPKA 1S3KL 4WW1B 3VFRA 1ZWIA 2HT2C 1UQSA 2WINA 3F7YA 3IB4A 5IF0B 3QDMB 1KB5A 4JRYB 3BX7C 1JWUB 4CUCA 2DI8A 3BKJH 2X5PA 2F54A 1AO7D 1EGJL 4C83B 5CBEB 1GJIA 4P2QE 3RBSA 5D7LA 1LO0H 4JHBA 5FECB 1O7VA 1QBMH 1TENA 1Z0NA 3HE6C 4NN6C 3OKDA 3V6OA 2VYRE 1K4DB 5JZ7C 1EBAA 2PCPA 5H8DA 4ONGH 5J06A 1L7TH 1WWBX 2C1PB 1QPPA 2IQAB 2XQBL 1BLNB 2LTQB 5E56A 5CCKH 1C8PA 3OHXA 3F65A 1MHCB 4LVNC 1J0IA 1DQDH 4QHKJ 4RGNE 1RUKL 3QNZA 1MRDH 2CK2A 3Q1SH 4KK9D 5BCAA 3BKYL 3T3PF 3CVHB 4EIZC 2LU7A 3GI9H 1V7NL 1ERNA 1HI6A 3QT2A 4YXLH 2I60H 5FYJH 4PGZA 5EN2B 4O9HH 1CD0A 4QF1B 1S7TB 2CDFA 3DETC 5EU5A 2A9NH 1QYGH 4KRMB 4LLDB 3M1BB 2D7TL 3PV6A 1I9RL 4B5EA 5C07E 4UZGA 3FMGL 2FEDC 2ORBL 3IDGB 3QRFM 4BFGA 2NQCA 4L8DA 3F6IA 4UDUB 1RIUH 3KPSA 2VMFA 4OZHE 4GG8B 1H3VA 1YECH 4JGUA 4MAYC 2P46B 5HGHB 3KXFE 1F4XH 2HRPH 2YPLE 4NSKB 1SHMA 3CUPA 4PY8J 4B7LA 1J1PH 1UG9A 2J4WL 5IW6B 2HTLC 4PRNB 1XGQB 3MZTA 3S3PA 1S9VB 2AJUH 4KU1A 5JNYA 4PV8B 1UACH 1QSZA 3VFPA 2VDQH 3A6CH 1BOYA 4XNYH 4Q6YA 1VDGA 3D0VB 5JW3L 4IRSA 1OGTB 3HCVA 2Y72A 1IARB 1A7RL 2DQFB 2X10A 3HB3C 5GS0H 5IT2H 3FRUB 1SEBA 3IFOA 1MREL 2NX5B 4XNUL 1VGEL 5I1GL 3VI3E 2X4QA 3SDCC 3SDDA 4YX2H 1DQMH 3SGKC 3GB7B 3MJGX 2D03L 4X4ME 43CAA 5FA3A 4PJXA 1T03H 4WFGE 5EO0A 1UM6L 5TQ2H 5K59E 2X4OA 2BNRA 3UTOA 2DQJH 1XF4A 2A9MH 1U6AH 2JJTC 5DJ2A 4FABH 4HG4J 3O4OB 5AG9A 4RA3A 3I6LD 4PRAB 4YC2B 4I0PC 4P3WA 1I9JL 4MXVE 5FYKH 4Z0XB 2HJKB 5KSUA 2YS4A 4JDTH 3NAAL 4HMDA 3DTXB 5EWIH 3KPSD 2W91A 4KVNL 4ODHH 3V7AG 2UUDH 1MELA 5E8NB 3X17A 4H8WL 3TBYB 3U6RA 1FO0B 4ODWA 4M3KB 2H8PA 1FGVH 4KTEL 3F58L 1QEWB 1NGWA 3LEYL 2ESVB 1MCPH 3BDYL 3Q2CA 5I66B 1CU4L 2VOTA 3HE7B 4MA8H 1XH3A 5EULV 2QSTA 5F9DC 4BQ8A 1DCLA 2A1WL 4PJEA 4X6DA 1KYOJ 1SM3H 1T2XA 2VQ1A 2JELL 3S4SB 5TE6H 4DZ8B 1MF2L 4WHYG 3L5WB 1T1ZA 4U1MB 4YHMH 1KEGL 1H3PH 4HV8A 4GUPB 5DJDA 3RVVD 3SDDD 5KVDL 4PTTB 5JDSA 4MNGA 3S97C 5C8JA 5DA0B 4HQQL 3U36A 3VFUB 4QHUA 3UO1H 4DK3A 3IU4L 3KLAA 3PP3K 4EI5D 1EHLL 5KVEL 1VACB 2BNRD 3DVGB 1T0MB 3S5LA 3E3QE 4R4FL 2CKNA 3VI4E 4N68A 1NSNL 4LSUH 4NKMA 1I3VA 2CRIA 4PJ9A 3QEUA 2VLME 2EYSA 1V05A 3ZHDA 1NCCL 4NDMA 2AW2A 3AY4A 3TBWA 4J3SA 2HTKC 1EXUA 3RNKA 4M6OL 4PD4K 2F5BH 2P1YA 4OCWL 3M45A 1ZV5A 4PJBB 3WFBL 5I16A 2A6JA 2Z0BA 5AD0B 4KKBD 1YDPA 3O3UN 2V9RA 5GJTL 3UTQA 4P2RB 4URTB 4JY5L 5CILL 3QPXH 2OJEB 3BPCB 2YOCA 1G7IA 4QY8A 4BSJA 5FGBC 2NY3B 5J57B 5L7XL 1MAJA 4F3FA 4XMLH 3RQ3A 1FRGL 1IGJA 3ARFB 4PR5A 1S7RB 5GS1C 1PZ5A 4XNQB 4QYOA 4Y5XB 2AV7B 3VG0H 4GRLC 4C56E 3BEVA 1F11B 1Y6KR 4HZLB 4M3JA 2H1PL 1I4FB 3LRHA 1YPZF 3KWWA 5TFSH 1VADB 5D1QC 4UQ3B 2A73A 4B7IA 1S9WA 2NNAA 5H2BB 1A9EA 5T1KA 4AEFA 4P2QA 1YEKL 3BP4B 3TV3H 4AENA 5JDJA 4M6NL 4NO3B 3B9KA 4ELKA 2HH0H 4YPGA 1GZPB 5DD1L 1TCMA 5KOMC 3RDTD 3VDAA 4PTUA 2AXGB 4H5SB 4DN4L 4R26H 3N1PC 4HW6A 5IBLC 1AGBA 3RWJA 3G08B 4PJ9D 4I18C 1RU9L 5B22A 3BGFB 4RFOL 3X14A 2VDRL 4PJAE 4NBXB 4OFKA 2OZ4L 1ZHNA 4N5ED 4XP1L 5C2UB 4ZS7H 3CDFA 2A0LD 4NCDA 1SJHB 1ZTXL 4ZXBA 1TTGA 3BGAA 4GS7B 1P4LA 3WJJC 3KPRE 5DR5H 4R96A 5DDHA 5C0DB 4AIOA 5CZVL 4HULB 5I76B 5DI8A 3PV7A 1F4YH 3QXVA 3X3FH 1UKQA 3VFWA 2W9EH 3ZMRA 1PKQE 4HDIA 4YHIA 4QHNA 1EEQA 3B5TA 5C07A 1RIHH 3QJFB 5I1EL 1YYML 3MV11 1ZHKB 4IDJH 3OG6B