1UOWA

Calcium binding domain c2b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN I
publication title Crystallographic Identification of Ca2+ and Sr2+ Coordination Sites in Synaptotagmin I C2B Domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Glycoprotein
total genus 34
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1uowA00
2CHZA 2N1TE 4TV3A 4G11A 3RDJA 4OVUA 1TJXA 4IQHA 3QR1A 2FJUB 4OVVA 1RH8A 4V11A 2ISDA 3PFQA 1DJIA 2WXIA 3QK0A 4ICWA 4JPSA 2K3HA 4ANUA 2NCEA 1DJGA 1BCIA 1E8WA 2K4AA 2WXHA 3L13A 1BYNA 3HIZA 1DSYA 1W16A 2ENPA 4LCVA 4LT7A 5G2NA 1HE8A 5JHBA 4NP9A 2CJTA 2WXPA 2Y3AA 2K8MA 3ENEA 3TL5A 2A5UA 2NQ3A 3GPEA 4PS3A 3L9BA 3SD5A 1TJMA 4BGDA 2WXMA 3QAQA 4PS7A 5JHAA 4AOFA 4TUUA 4FADA 3L16A 5H4ZA 2DMGA 3APFA 3L17A 2YOAA 2DMHA 3KWUA 3QARA 3QJZA 3T8MA 2WXGA 5KJ7E 2CM5A 4F91B 4IHBA 3N5AA 3L54A 4J6IA 2JQZA 1RLWA 2FK9A 4FLHA 4KZCA 3R7RA 3ZW3A 2WXQA 4FJZA 1CJYA 4HVBA 3HN8A 1E8YA 2CJSA 4FHKA 3QR0A 1WFJA 4LDCA 2Q0ZX 3S2AA 4F1SA 3LJ3A 2A4ZA 1BDYA 1A25A 2X38A 3APCA 4TS6A 4WWPA 4WAFA 4XZ4A 2RD0A 2WXOA 4DK5A 4KZ0A 2ENQA 4FULA 1QATA 1DJXA 1E7VA 3F01A 3M7FB 1RSYA 3ML9A 1E8ZA 4NPJA 4A55A 2LHAA 4FHJA 3B7YA 2CHDA 4GB9A 3F04A 2KI6A 2CM6A 2QZ5A 2UZPA 2EP6A 3DBSA 5CCGE 4ICXA 3PYCA 4ANVA 4WWOA 1DJZA 1V27A 2WXJA 3IBEA 4XX5A 3NZSA 3TWYA 4DNLA 4MJJA 3L4CA 4ANXA 3JZYA 3W56A 2V4LA 1W15A 3FDWA 4URKA 3PS6A 3MJWA 4FJYA 1K5WA 1E8XA 1WFMA 2NSQA 2WXLA 3NZUA 4L1LA 3P2BA 3F05A 5EDSA 1DJWA 2ZKMX 5CCHE 3ZIMA 4L23A 1UGKA 2YRBA 2CHXA 3PRZA 1DJYA 1E90A 4XE0A 2WXFA 4KITB 2BWQA 4Y1SA 2WXNA 3L08A 2WXKA 5H4YA 2B3RA 3IM1A 4EZJA 3OHMB 3OAWA 1DQVA 4EZKA 3APDA 2Q3XA 4WEEA 1UOWA 5CCJA 2QZQA 3R7QA 3NSJA 4QJ5B 4HLEA 2WXRA 3CSTA 3DPDA 4WWNA 3TJPA 3FBKA 4GNKB 3RPBA 1DJHA 2CHWA 4QAMB 2Z0UA 4QJ4B 5T8IA 3KWTA 4QJ3B 1E7UA 3W57A 4ANWA 3HHMA 3ML8A 4BFRA 5G55A 1QASA 4EZLA 4F93B 4F92B 4L2YA 3CSFA 3ZVVA 2ENJA 2R83A 4NPKA 4L1BA 2K45A 4AJWA 2D8KA 3PREA 1GMIA 1UOVA 1YRKA 4PS8A 4Y1TA 4NS0A 3F00A 4FA6A
chains in the Genus database with same CATH superfamily
4L8CA 3B5HA 3MV8B 4AGMA 2BJML 4QUOA 1LJMA 3F58L 3MRNA 2W9EH 3GSRB 1FZKB 2R2EA 4P5MA 1JBJA 2YOCA 3CC5B 3PFQA 4WNQA 1PGRB 3U48A 3NZ8B 2EO7A 5EB9A 1MCLA 2Q7NA 3MNZA 2PCYA 5HYJA 1DQTA 2J5LB 2RB8A 3VCLA 3I2CL 4RQQB 4C8XA 4G9FB 2NMSA 5ETUB 7PAZA 3TT3L 4KZEH 2FEEI 3U2SB 1QMUA 3SE8L 4L4VA 2Q6WA 1SVBA 1YEDA 3CMOL 1EPFA 3FO1B 4TSAH 5IB1A 4XCYB 4H13C 3SDCC 3SDAC 1ZOXA 4H1LH 2AXFB 4BRVA 1SQMA 1DN0B 5H2BA 4GP5B 1ZLWH 1ECYA 1OB0A 1EDHA 2X89D 5DVNA 1PDKB 3F7RA 4WF7A 1D5MA 2EUVA 3EO1B 4ZW5A 1UZ6E 3CHXA 3P2DA 5D7IF 4FULA 4A2DA 4C83A 1XIWC 2CO3A 1SZNA 1Y18A 2D2CC 2QLVB 1G0DA 3WCYA 2QVIA 3QPKA 1Q0EA 5IQ9B 4OD3H 1UM4L 1KGYE 4R5TA 1BXUA 5EWIH 3DBXA 3NIGE 3S37X 4NUJA 2VDNL 1YC8A 3T0DA 2G0KA 1T1XA 2AK1L 4TVPL 3PP4L 2YKLL 4CC4C 4MJJA 1MRCL 4ZPTB 5AOZA 4JZOA 1MWOA 3GMOA 2VXQA 3BGMB 3RZCC 5IMMB 5IM7A 3BAIA 3WTXA 2AVFA 4Y4HD 1VZIA 2YPVA 5ESVA 3VQ1C 5DQDH 2DI9A 1LDPH 5IW1B 1I1CA 3VI3F 3J7HA 4E9TA 1BVZA 4G8FB 2V7HB 4URTB 3DX1A 5D2LA 1MFDL 4S1SH 4GQPH 2JSFA 3N1FC 1M7UA 3DETD 4HWBL 1JTPA 1JD7A 5C8JA 2BNUB 5K59F 1JDAA 3NJFA 1CL7L 5BMFH 5CJBA 1EA9C 4IOIB 2Y4SA 3X1BA 5D2NA 4YR6A 4OLZH 1AXIB 2W59A 3QDJE 1SQ2N 1ZWIA 3QXDB 3TVMD 3DX6B 2R9HC 1ULVA 3C5XA 1O6VA 3NSCA 4W1TA 5LBSH 3NSFA 4M8VA 1TQTA 1R3HB 1WA2X 5IIEB 5EU7E 2W88A 1AE6L 1ZT7A 3CZGA 1FNHA 5FK9A 3PGDA 2BP8A 2FUTA 3TYGH 5FUZL 4O00A 1ZVSA 4N2OA 3T77B 1JNHA 1T89C 3A4AA 3MCKA 1T21B 1SF3A 3DROB 4HHAA 4NQDD 2YD3A 4WCYL 3HNVL 3ZE1F 3RVWC 2DEWX 1QLFA 1DQIA 1KIPA 2ZUTA 4LEBA 2APSA 2JELL 3BP7A 4W9LC 3FQRB 1PPIA 1LVEA 3BYYA 4GIAA 4L5FE 4ELKB 1BQ5A 4LEXH 4GBXA 4S11A 4WY7H 4MZIA 3EH3B 1DVFC 1IO4C 3IDUA 4NRXB 4KKAC 3D39A 5BO1H 1N68A 1XF3A 1XEDA 1MJJA 2VUKA 2QMKA 2P46B 1T0NB 3BUTA 4AOFA 5INDB 4BZ1A 3TXAA 3NPSB 1TPXB 4BUGA 3HE6C 1L7IH 4PGBB 3ZX1A 3LX9A 3K6OA 3WEOA 1A4JB 3KLLA 3W37A 1I9JL 3LQAL 3DMMB 1AIZA 4XAWH 3P4OB 3C6LD 4QF1A 3TCLB 3S96B 1NBCA 5FCSH 5HDBB 3L7FB 5FUCC 3MV7A 4G3YL 1WFJA 5AG9A 3AS3A 2VW4A 3HG5A 2HWZL 4FLOA 4R8WH 3VWJD 2OW6A 3WKMH 5CKAA 3WIHH 1PSKL 1U42A 4FFTA 1RL1A 3ARBC 5SX5H 4OZIE 3BEVB 1IAII 4AEIH 2IAAC 2PPDA 3HFMH 4X5QA 4Z7VE 4AQEA 3QIBA 2TRHA 3KCPA 1PD1A 4NERA 1XGQB 4POYA 3CK0L 2ZNWA 1G84A 2OMZB 4HIIA 3E6HB 3GDCA 2VUYA 1FH2A 1NIAA 3O2WL 5E95B 1H3PL 1XGUA 1F4WH 3ILQD 3Q8CA 5FFLA 1F2QA 2VOTA 3O2VL 4MMZB 5D1QD 4HC1L 1ERNA 1DQLL 3ABGA 3GMNB 3PS6A 4UAHA 2BINA 4CU6A 3WTVA 4AZUA 1K3IA 1SY6A 2F7QA 5I1CH 3IXAB 2EH7L 3V9FA 3P4MB 4MASA 4ZS6D 1P6WA 2XG4B 5D71L 1VGEH 3J2PA 1UA6L 5H4YA 1JGUL 3QRFM 3LHPL 4X5WB 1A9BB 2V17L 3DRTB 4Y2DD 3EZ8A 3WIIH 2DD8L 3OC5A 1YEJL 5E2WH 3FHQA 4QY8B 4JFVA 2GY7B 3EOBB 2CIKB 4V2BA 1XCXA 2IIJA 4E41E 4P5RA 5G4OA 1FZJB 4KO5A 2I26N 4ELDA 4WFFD 2XNAA 2VDOL 1RZPA 4UQ3A 4ZZFA 1FLTX 1BZEA 4FMFA 4OZFH 1CLZH 3CN4A 3MA9L 4E9SA 3HZ3A 2QGEA 4LQFL 3QUHA 1QBLL 4QRPB 4EN3B 3VYPA 2FSDA 3LVEA 1J8KA 1GR7A 4NO5A 1U8JB 3SKMB 2VWEC 5A2CA 3K91A 4JO2L 4QT5A 4U7MA 4WTQA 3CZFB 3WDJA 4WW2A 4QYOB 4Y5XA 4R7DA 2NQCA 2OI9B 3TO4D 1RIUH 3L48A 4U6XB 1U6AL 5JOPE 4U3XA 1QO3A 2XA8L 3AWEA 2V8MA 1PLBA 3IS0X 4TNGA 3U0WL 3BPNC 1ZLDA 1SOXA 3OB0K 4QHUA 2GABA 4NPYB 1Z66A 2HCZX 5E1IA 3WLBB 2EACA 5ANMB 3CZLA 1RIHH 5DTFA 3T3MB 4P5TB 2A6KA 2JK5B 3LPGA 1ZD6A 1ZVYA 4WK0B 2Y5TB 2W9LA 1JMZA 5DHVA 4OU3A 3NSDA 5IB5A 3D08A 4XBGA 1JP5A 5GS3A 4GFXA 3BP5B 4FL4B 4XC1L 3L6FB 2WZ0A 3FU6A 4NC0B 2UXVA 3KGTA 5AVTB 1W6LA 1ZV9A 4ZTOH 4IMKC 4RFEA 1KJMB 4OD1H 1ETJA 4LXFA 3HE7A 1QSFA 4G8IA 4H5SB 3CLEH 1QNZH 2R51A 4F15C 3D2UA 1G7HB 3LOWA 2WQWA 2X1QA 1BD2D 3HC2A 1M2OA 2VL4A 5FUOH 1DZBA 2FEDD 1PF3A 4LASH 4KKLD 1NMBL 5F6IB 2KQNA 1S5IL 2VSDA 1EGJL 2JKJA 3UTOA 2X4PA 1VPOH 2ZCHL 4GLRH 4YHPB 4Y4KC 3FL7A 4GMSH 2VQ1A 4IBWA 5I8OH 4M5TA 3ZHNA 3ULVC 1S78D 3AQDA 1KF9B 4PRAA 1NCAH 4X83A 1JGLH 5IOPA 4ZUTB 3U36A 4CBPA 2NY1C 2XQYK 1IC4L 3B37A 3RLSA 4CAGA 3Q8BA 4PRBB 5F0PB 1OAXL 4XP5H 3VFUB 3WO4C 2C9QA 3DJSA 2QHRH 2CLVA 3GUFA 3NJMA 4J3OD 1S9YB 5T1JA 3APDA 4ZDHB 4MCYB 4QRRD 1F11A 3NJXA 1QEWA 3NSJA 3KPNB 1NGPH 5HGDB 4HLEA 5MENE 2VTFA 2GAZB 4FNLL 4N9OB 1KPRB 1WD9A 3QXTA 1CFVL 3NFNA 1AXSA 4LAQH 3REVA 3TNMB 4GXVL 2ZWYA 4O58L 4GW5A 5EEZA 3KYOB 2NY2B 2QBWA 1W2KT 4DFIA 1DVTA 4PCKA 1OM3L 2DIAA 5AEAA 1GIGL 4MWFA 1D7DA 2FGWH 4WHCA 1WEJH 2PO6D 1S7TA 2CKBH 2PXYC 3QHZH 1CBVL 1F58L 3VWKA 1PG7H 3AT9A 4KUCD 1ES0B 4XBEH 5ICZB 4PJEE 4XNQA 1HYSD 5E1HB 4CMMB 3V0EA 5JUEH 2NSMA 3H85A 3RU8H 1DJGA 1X7TA 4M00A 1RU9L 3UO1L 2FJFA 5DZOA 4MA1C 2F5BH 5GRXG 1O7SA 3VG0H 1L9PA 2QGCA 2O6FA 2NYYD 6FABH 4HW6A 2KZWA 4DGVL 2BY2A 2O30A 4HKXA 3FUKA 4HIEA 5F7DA 3MROA 1TJHH 1BZ9B 2VLJA 3QNYA 4M4PA 5MERB 3NACH 3QWRD 4NSKA 1KG0B 1CE1H 1IJNA 3GZPA 2CM5A 3D25A 3QUMA 1RIVH 3MLWH 1RV6X 2AXGA 1XHHA 4PJ9A 1QKZL 3FO9B 3M46A 3QI9A 2AAAA 3MMEB 3UFIA 1SN0A 1F8TL 1OPGL 1Z5LB 4XXWC 1CD1B 2JJSA 2XN9D 1RZJC 3TN0B 2EE3A 1KIRB 4YZFE 1L7TH 4HGMA 3P73A 3KWWB 2GJZB 3EADA 3O9WB 1U8PA 1NM9A 2HB0A 2A6IB 4YHLH 4HUVA 4A55A 3OKOA 4PS4L 1IJ9A 4FFYL 5DURB 1N0XH 3PGCB 5DZLA 2B4CH 2CM6A 3V4VH 1SLXA 3U7YL 4JFEA 5T1LD 1Z9LA 4M62H 5H35B 2GCYA 2Y0SA 4JY5H 2ARWA 4PJHE 1KCVH 5E2TH 1BJMA 4MLSA 2EUZA 4MJHA 4N24A 3W0WA 1U8OB 4L3AA 2WOBA 1QW8A 3FOLA 4PV8B 1YMMA 2JB5H 4JFYB 4QRTA 3V5HA 3NH7H 4MDIB 3KPLA 5HI3C 2H47C 1THCA 2CK2A 1E9OB 1P7KB 4PRHD 4N8VA 4Z78B 5HHOA 2NZ1A 5JDSB 5M7QA 1AIFA 5J13C 1A6WH 5LWYH 3M8OL 2IFFH 3HB3B 4LBEA 2RFXA 2PWEA 3VH8A 1B4RA 3DX4A 1NBVH 3IN0A 3RVTD 2H1XA 3CPUA 2X4TB 3LRSB 5IF0A 4JM2A 2EXWD 4I9XA 4L2YA 4PV9A 3RWCA 2XZCH 1L9RA 5IFHH 5MENA 1YRKA 1W80A 4MNQB 4DFHA 3M45A 4WKZB 1SYSB 3RY4A 2QKIC 2P24B 4WI7A 5C07A 3JVGC 3KYNA 2BSED 5GGSA 5GSRB 3ES6B 3V55A 1QTPA 1NMAL 4N5UA 3NRFA 5FM5M 1ETA1 2YEZA 1KUMA 5GISH 5IROC 1MW2A 4R7XA 3I9GH 5FA3B 2R29H 4H8WC 1JPSH 5IVOA 5KYYB 4YEFA 2FBRA 3KPPB 4GKLA 1FSKC 4HSAC 3ZKND 5IFAH 1XH2A 3QFGA 3UIZA 1U3HD 4EUPB 1JHKL 4NRYB 1CYGA 3ESUF 4OGXL 4AM0B 3BHBB 5CM1A 3ZR5A 4H88H 4OZHF 2Q3ZA 5K9JL 3HR5A 5GGRA 3X12A 1PVHA 1GAFL 2ZAHA 4GKNB 1CFNB 1G9NH 3X11A 2DKSA 2XA3A 1CDHA 1S7QB 1B0GB 1E4XH 5KSVB 1OAUH 4RWYH 5JIIA 1D5IH 1Z3GL 1U8HB 1ZE3C 3E80A 4NYLA 4Z95L 3DVIA 5EEVA 4DP7X 1MCRA 2YPVL 3IMRA 4WK2B 4NWTH 5IHUH 4FZ8H 3N40P 2JJUA 4LNVA 3AB0C 3C6SB 3ORJA 1BVKB 5DYFA 1TQCC 1Q1JH 3VX1A 1Z9MA 3LRGA 1E6JL 1AAJA 4X9GA 4K7PL 5ACLA 1FG2A 4XPBH 2MWCA 5E8PB 4QRSB 1FV1B 2YEVB 1ILSA 3UZQA 3MLZH 5CR1A 4U1JB 4AITA 1W6WA 5F88A 3EFFB 2BSDA 2CQVA 2VDMH 4QTIH 4TM9A 1W0WB 2NY0C 1PEWA 2ZSWA 4Y4FA 1VACA 2Q8BL 4YSUA 1TFPA 4TUOB 4WEEA 2WO2B 3AM8C 3MRLB 4Q0XL 4YSPA 4ZMXA 2ZXCA 3D05A 3Q9QA 2YUZA 5I76B 4O2FB 3OPZH 2I5YH 2WLJA 4DP2X 2FSEA 4XN7A 3GLAA 3VFGL 3ARDC 3NJKA 4EIZC 2I9TA 1XSKA 5JW4R 1H6TA 4Z7UE 2YMTA 4JKKA 1F4YH 1FBIL 2DS4A 3RGVD 1BLIA 4FNUA 3VX0A 2ZAGA 2YUXA 3GSNL 5DUBB 4B41A 4GUPA 3UTPE 4EIUA 4OJFH 1CK0L 4MA8L 4N90D 5J11C 1I9RL 2ZNXA 1NC4A 1NIBA 2ZP9A 1MCNA 2TAAA 2XRAL 3BKML 4PD4K 1ONQB 3QCTL 4PVMA 1NCOA 3ATBA 3OKKA 3O6KH 5CU9A 1XR8B 1DSWA 2OYLA 4X7DC 2AERT 1ED3A 1MPAL 2CUAA 2F1AA 1MLBB 3HIZA 5EIIA 1ET7A 2DQGL 4WW2F 5L9DH 4XPTH 2WOYA 2Y3AA 4D9QE 4UINH 5E08H 1RP8A 1BSIA 1ET8A 3NA9H 1L0QA 1SFDA 4M5ZH 2EIBA 1S9XB 4HULB 3MR9A 1WBYA 5IBLD 2D31B 2MKLC 4APQA 3L3JB 2R0KH 1JV5A 3MV8D 2XPYA 3Q7JA 1HXMB 3T8MA 5I6XB 3WS6C 1UQSA 3C5JA 3BQVA 3DETC 4TUKH 1T1WA 2FLMA 5I8KH 3CTTA 5HGGS 2WCPA 3IRZA 1R24A 1Q38A 2X88A 3TVMC 1UH4A 2DQFB 5DD3H 5FKPB 4E9WA 4BRJA 5CEXA 2DQUL 1OKEA 3EGDA 5IUCA 4G9FD 1OK0A 3QXUA 3ZKMD 3GHEL 4XPAH 5TH2A 3E8VA 4X80H 3FU9A 5DK0A 2TSBA 4PRNB 3D0AA 5T3XD 3EFOA 1LO3H 1WZKA 4NPJA 3ZL1A 2GT9A 1CGSH 4Y19A 2KT6A 1JK8A 3L3KA 3QXVA 4GG8A 2KUTA 3DBSA 2BP0B 5J0BA 1UM6H 3ARZA 2EADA 5EC1B 4JUSA 1AI1L 2LLLA 3QUYA 3GBNH 3MRMA 4JHWH 1RQ5A 3SKOB 2ZX5A 3BISA 4NJ9H 3O41B 3PG2A 3NGBC 3KVDD 4D9LL 2BFVL 3H9SE 4JQVC 4IRZH 4N8CL 2MQGA 2WKOF 2NSQA 3EYSH 1J9RA 4G7VH 1K4DB 4JQXA 5IHWA 3GQFA 3GSQA 1XZWA 2YRBA 2N0KA 3NYKA 5BQ7A 3OZ9H 3BO8B 3BPLC 4P2QA 1UCBL 5KYUA 3DOIA 1SXSA 5J6GB 4L29A 3ZZSA 4K71C 4Q9RH 3AMKA 2VXTL 2FECL 4YWGH 1EJOH 1GVIA 1NH6A 1PCSA 4NN6C 1WK0A 4YGVB 5EMYA 1OV8A 4ZAKB 3U7WL 2XWTA 1DEDA 1XAKA 3AT0A 2CHWA 1AD0B 3C6LC 3KEHA 4IKKA 1UKQA 3U82B 1GW6A 5K9KB 4QRFA 4JR9H 3ZHFA 4KK8C 4DP6X 2R69A 4FKHA 3LH2L 4KXZH 5DJ0A 5C6TL 4ORGA 3SGDH 1YMHB 3IU4L 3ETBF 2AK4B 4BFOA 1N19A 4UQIM 2GBVA 1AKJD 3KS0J 4XVJH 1RJYA 2D9CA 4IEFB 4A2FA 1V8HA 4G11A 3OWRA 4I3GA 1QWUA 1JUFA 1UXMA 4H1LB 2BIMA 4HU2A 4L5FL 3U4BL 3ILQC 2ZT9C 4PY8I 5EUOE 2BC4B 4G7SB 1KY6A 3GXNA 4JHBA 5D1QC 3UAEA 4JMXA 3BSZA 3STLA 4WSJA 4YDIH 1CZ8L 4PS7A 2P28B 5JYLA 4ZS6C 1J1PH 1QVOB 2EO9A 2XWZA 3A6CH 3BGFC 4Z7OE 3QJHB 4P9HL 2XVKA 1V54B 5I66B 4OLXL 2ZX9A 2GJ6E 4Y2DC 1MXDA 2CPCA 3IJSA 2Y6TE 3JTBA 3R7RA 5AB2A 3P0GB 3U0PA 4R83A 2FRGP 4WVRA 3QXAA 4F9PA 1JK9A 1OOWA 4Q2ZA 1PIGA 4PD4J 3VI4F 2YRLA 3SZKC 3ZMNA 4JFZH 2YWYA 4Z7AA 2A74A 3OKLB 1YPZB 4E9VA 3PPEA 1VZHA 4WUKH 3IF1A 1JRHI 5C0BA 5HGHA 3GLEA 3NBNA 3QGVA 1TQSA 2AQNA 3EYOB 2VMCA 2Q86A 2LHAA 2DQHL 3FRPB 3H7BB 2EYRA 4U1GC 2PKDA 3T9WA 4OJAA 1R46A 1AKPA 2IJ0C 2Z31B 3DMMD 4AV0A 4TUJA 2H6PA 3EJZD 3QA3B 4UILH 5F3HB 4O4YL 3WN5B 3DIDA 5JIKA 4JGUA 3WFZA 2XETA 3TPUA 3G3LA 1CVSC 1S7UA 4WHYH 4DO4A 5GIRA 3BP4B 5D7IE 4YUEH 4MZ2A 3PGFH 5BW7A 4H0GA 1ZGLA 2QT6A 4LLWA 3QDMD 5FHBH 2BWQA 3TYFB 4ETQB 4DPAX 3QRGL 3QPQC 4GXUN 4ZI8A 1GZQB 1NSNL 5TF0A 1MLCA 4RISL 3UC0H 4IIQC 5BV7C 1KLGB 1A7RH 4Z5RA 5E8DL 5CLZA 4G9DA 2EXTA 4BUHA 2R4RL 2WYTA 5EEWA 5GS0L 3HHMA 1B0RB 1PX8A 5EBMB 4YXHH 2B5IB 4FLQA 4K7PY 4TULH 1MCPL 1R5IB 3Q8AA 2D0FA 1A9EA 1BX2A 1WBXB 3OR7B 4ZSOA 2H0FA 3NN8A 5L2KE 2FEDC 4NT6A 4YBQD 3P3RA 4DAGH 2YD6A 4JVWA 1MJ8H 5FYLH 5AVRB 2Q8AL 2CHZA 1IGJB 3VG9B 3PLYA 4PWKA 4JM2F 1NQBA 4MCNA 4WDIA 3GMRA 2MNWA 4V11A 4WJG3 1XH3B 3B1UA 5MEQA 1HZHH 3SYOA 4FQCL 4ZFFA 4DOHE 3DX3A 1MJUH 5BZXA 3UOAB 4EDXA 4JFXB 1TEYA 3LNGA 4QRPD 2IQAA 2VJ0A 5KW9H 1HE8A 3BRFA 1NFDF 5F1IB 3SD5A 4L0PB 2J1WA 3X1FA 4HPOH 1NL0L 4XX1E 4HD5A 4M7JH 4YFLI 1HH6B 4P3DA 3W11D 4R90H 4LSUH 5KWYC 4HUXA 5D6CB 3IE4A 3SKNA 5IB3A 2W5PA 1RK1A 3QEUA 1KT2A 5G5DA 3I75B 4NNYA 5T5FA 2JVUA 4JM4L 4J3OC 4B3EA 3UTZA 1KJ2H 5C0DA 4H1LG 5KZCD 3DIVA 1NAML 4H0IA 1TG8A 3MCLL 3WGVB 3WXVH 1MAMH 4BSJA 1D7BA 2XFXB 4HXBH 4IGBB 2IV8A 5C0GA 1Q0XH 1TTUA 4UQAA 2J5WA 1XF2A 3GK8H 3KPRB 1C5DA 2A9BA 5EU3A 3BFQG 1H3WM 1RY7B 5B7MA 3LJ3A 3FN0H 5C2UB 2EIDA 4YL9A 5A2FA 3S8GB 3O0LA 3QE5A 4P5TD 2EDXA 4PEEA 3KR3H 3EOTH 1AJ7L 3QQNA 1AANA 4PVNA 1N26A 2F9BT 4GG6F 2PO6C 1RMFL 4Y16B 2VERA 4R97C 2ORBL 2R2BB 4JO3L 4JREB 1HYSC 3U46A 5IB2A 3ZDXE 1QA9A 2WLYA 1OSEA 2QFPA 4ODXA 3UG3A 1UFUA 2HA1A 4YAQB 5JW3H 1OTSD 2JKWA 4QXGL 5TQ0H 1KPUB 1DL7H 4OZFB 1K5WA 1I8UA 3SO3B 3NFSL 4HUWB 4ZBJA 2NYYC 1GTFA 5E1GA 5ID0B 2RGSA 2W0PA 3BZDA 3KPOB 5EU4B 5D1ZB 3ZUCA 3FRPG 2E5EA 3WENA 3OKMB 4Y7OC 2F1BA 1QFWL 3UBHA 3DDFA 1BM7A 4N0FA 2CPUA 4Y1AE 2RAMA 2UZYB 4ODTH 4WFGE 4HWZA 2BIQA 2ESVB 3MGOB 4XI5D 5ALCH 1KIUA 3MGTA 5JPMC 4UT6L 3UAJA 1R3IL 3O8XA 1A1NB 4RAUB 5E4OA 2P8LB 4NQCA 2IDQA 1GSMA 3HHSA 3LN5A 4XCFH 4U1SB 2VXVH 3ISWA 3P9MA 1RVFL 5GRJL 3ESMA 4OUUB 3OZLA 3SJVB 3QG6A 4MAUL 3WL9B 3ZDZB 3IFLL 9CGTA 1QX1A 3LEVL 3HPJB 1UA7A 2CIIA 1ACXA 4X7FC 2H0EA 1JXJA 4HK0B 2DBLL 3WIFA 1IC5L 1GS7A 5DXWA 5EO1A 5FGBC 2Y2YA 3AABA 4I2XA 2JTDA 4WGWB 5GGTA 5AOKA 2LU4A 1K6QL 3THMH 3VD5A 4M56A 1B2WL 1VF5C 2BJMH 3F58H 1FNAA 3PXHA 4L8SB 2NY2D 4GKSA 4BZ2A 1FVDA 1TJGL 3WKNA 1DVZA 4ONGH 1MREL 4YEEA 3L9BA 3UPCA 2WVVA 3O3EB 5JLZB 5JMRA 2YZ1A 3CLWA 5F44A 3KLKA 2DDQL 4JFQA 3TESA 3VXTB 1T4KA 3CFMA 3B7SA 1GGCL 4MKTA 3EO0A 3EH2A 3ME0B 2IDCA 1FHNA 3D0LB 3PWUB 1KFGA 4PJXA 3FTWA 5DRNB 2Q0ZX 2FX8H 5DI8A 5E2VH 3AG2B 4AIZB 3GBLA 4E0RA 3RVTC 2IADA 2XBTA 4HCFA 4CW1A 1S6NA 2EXWC 3VXRD 1G9MH 1E7VA 2IWEA 1GL4B 3UC2A 3CCHA 2ZX7A 2IAMA 1DDHA 1MIMH 3CVHL 3HMXL 3ULUE 2GY5A 3QFJE 4NZUH 4HWEL 5DJYA 5HI5D 1U2CA 4YGAB 5E8OA 1E5BA 3MKGA 5EZIL 2VDRL 4HWNA 1HINL 4ONFH 3V4LA 1V27A 2VDNH 4X6CA 3WFDH 1KXHA 2I60L 3TWYA 2FDBP 1BPVA 3MNVA 4LLMB 5DHYB 1URLA 1C5CH 2AK1H 4TVPH 3PP4H 4PG9B 2BIHA 4WIQA 2NY6B 3C60B 1MRCH 6PCYA 3O9WD 1FL6B 2F8VA 1Q9OB 2QMJA 4M7ZB 2G4GA 2BVUA 4K94C 3PWNA 1G7QA 3GXIA 5DURD 1KCRH 1NGWA 4KJYA 3OAWA 1RJLB 1RPKA 3PP3H 2CKBB 4M43L 2WUCH 3DHMA 1IAIM 1MFDH 1LE5A 3TJHD 3TH2T 3IMSA 3ZKNC 3LKSA 5GSVA 2DQJH 1U3HC 3MUHL 1L3WA 4PGZA 1WAAE 1YNLL 3P0VH 2PR9A 4LCWA 2YK1H 3FQ1A 1DEEB 5BRZA 4OZFG 4X0KA 5AW8B 1PY4A 2X6UA 3OHXB 1FPTL 1JI2A 4QI3A 3ZHLA 5AVQB 1GGTA 4Y1AA 4F93B 5BZDA 1XGPA 3DSFH 3N42B 4DN3H 2MOVA 5L4FA 1AE6H 1OAZH 3SGEI 5IHZB 4F8QA 4D0CA 2X53A 1YA5A 1CGUA 3ZDYF 1XMWA 4X6BB 2AS5M 3R8QA 1BQUA 5C08E 4WRLA 5KTEH 4KKZA 5F7EL 2EVHA 2BRRL 3HB3D 1JWMB 1JVLA 2JKRM 1L0PA 4JW3A 1ADWA 4UAOC 1BOGA 1S9WA 2EEAA 1R5WA 1PZSA 3WFCL 2ADIA 3U6XA 5FGCE 4PUBH 5HPOA 5IR1A 5JHAA 5A2IH 5LBGA 5A2JH 4MNQD 1IM3A 2V5TA 1U4FA 2FT6A 4I77L 3LRMA 4G80A 5I8CA 1AGDA 4MKMA 4KXCA 7TAAA 2V2TA 43CAB 2VISB 5I16A 3H9HA 1E27A 5HHVH 3V4VB 5DWPA 5B3JE 4KBPA 3B9KB 3OKNA 1IIKA 2WD0A 4IJ3B 1MEXH 1M42A 3LQAH 5I82A 4L4JA 4O51A 1LTXA 4GP8B 4XHJD 5IQLA 3ZSSA 2QEJA 3APCA 4K8RL 1I9EA 3VXMA 4NIKB 3D3VE 4NNPL 4YIQB 1NCWL 1U8IB 4QXWA 4BD4A 1PSKH 3QQ3A 2WQXA 4Z3HA 4WLCA 3NCYS 2FYVA 4NEHB 5DA0B 3CBRA 2CHDA 1SN2A 3SYQA 3WEBA 4LNRB 3QJQB 4DVRL 3AS2A 4W6YB 3GM8A 3LQZA 4DH2A 2V9UA 3CK0H 2GTZA 5JXAH 3K6IA 3VFOB 3IBEA 5IQ9A 3A0OA 2HT2D 2X4RA 1ZT1A 2JV6A 1IFHL 2WZ5A 3RWHB 4PJ8B 2WNXA 2Z8VC 3OLEA 1WH0A 2AV1B 2OV0A 1KDJA 3UBXB 2NW2B 4JO5A 5J6HB 3X3FH 4HH9B 5D7LE 2Y9RT 3BD4A 5IBLC 3T0BA 2EH7H 5BOPA 2Y69B 3UP6A 3M1BB 1YNKL 1ZGLM 2MSPA 3R19A 1F86A 4LRNH 1L3NA 1S7XB 1UA6H 2O26U 4YBLB 3BE1H 4N4YB 5E0QA 3V0VB 1CO1A 1N7ML 3LHPH 3UPRB 4YHIA 1KN4H 2DD8H 2WM0A 3V7AE 1YEJH 3PL6B 5D70L 1X5GA 3VMNA 1KN2L 3W38A 4UMSA 2JMRA 2QSCH 2YMXH 3CUPA 2A73A 4K9EL 2ZOOA 2GBTA 3QWOB 5CZKA 3ZKMC 3RNKB 3HJEA 1Q0YH 3MPCA 2C4XA 4ZX5A 1LWJA 3SOBL 4XN1A 1RXLA 3DX6A 1N5YH 1VAHA 4RMBA 3D9AL 2GC7C 3V4UL 3MV9E 1OWRM 3B2XA 2O6CA 4LSRH 1ZVHA 2JXMB 1JF1A 1XSIA 5F9OH 3JV0A 3AU0A 3PAYA 3UJTL 3AREB 4ESKA 2HVKA 4IBYA 5CINL 4AY0A 4JDZA 1N67A 4A2MA 1DBAH 5JO5A 1FIGH 2Y7NA 5MHSE 1U6AH 5FXCH 2OXHB 3LS4H 1KLUA 2GIMA 3OXSA 3HG1A 5KSBB 5FUCE 3ESVF 3II1A 3BZEA 4LHJB 1H9VA 3OAZK 1UJTA 2F5AH 3U0WH 3UJIL 1AZBA 2MQ0A 1FCGA 2PMZA 3HNSL 4UV7L 2MCPL 2BSRB 3SDCA 3SDAA 2J1KA 3GRWH 1MZZA 4WU5A 3OLDA 2E9IA 3FQXB 1SBSH 4HJUA 3GUTB 3T6VA 2FWOB 5I1GL 1UZGA 2WZAA 3MRJA 4ODVL 1OO2A 4B9YA 5IV2B 1I7TA 2BH0A 3LSOA 2FATL 4QRUA 1BXVA 4F8LA 5IKCA 4LGRB 3MTRA 1E2VA 4X98B 4R4NC 4XC1H 1KGXA 4YSRA 4RGMB 3ZT7A 3DV4B 2FB4L 1NEZA 2XTJC 4O02L 4TQEL 1XR9B 1ZS8A 2G9KA 3L3OA 4WV1C 1EZUA 1W72L 1ZA6A 2ICES 3CIQA 2VDMB 3S96A 2CWRA 4ZMAT 4ZW3A 1AZVA 1TUPA 3FTZA 1DBMH 1N6UA 3PHQB 4HKJA 1AC6A 4GRWH 4N0CD 5L0QB 1IZKA 1C12A 1LDSA 4JG9A 4AIXA 2HRHA 1EZVY 1CG9A 1YY9C 4M3HA 3CZJA 1EGJH 3EBGA 2D03H 4PGDB 3B2VH 3BPCB 1MNUL 1DYZA 2GI7A 4LPTA 4AGPA 4OZHE 4Z8FL 2ADFH 1BZOA 1CURA 1EO7A 3BQUB 1CFMA 1FFOB 4AH2A 5ACZB 1IGML 3MI6A 4XNXL 1X4YA 2RQEA 3Q8FA 3WBDA 5CZRA 3SDXB 2G9HB 4FAAB 3HCVB 4LEOB 1LEKA 5ABAA 3S3CB 5IVXB 4BQBA 4OQ1A 1B3IA 1U92B 4LSPH 3CZUB 4YHYB 4HUNB 4OV5B 3EKCA 1O9VA 2VWEE 3UGUA 4JHAL 4V1DA 1MFAL 2OCCB 1QAWA 5DC2A 3IXAA 5I30L 3RQ3A 3JBG7 2LAAA 4QJ5B 2NXYB 2CXGA 3BD3A 1T6WA 3NIDF 2VSCA 5B3NA 1NCHA 2NY5H 4CKQA 1A9BA 3CFEB 4QJ4B 4TN9A 3SCMC 1TENA 3OB8A 3ZLQC 1WICA 1C7TA 4FD0A 4PLOB 3AAZB 3RL1B 3UBXG 2VRQA 4O58H 1EO8L 5DUML 1JZIA 4F3FA 5A3ID 2ZUXA 3QQDB 2DV6A 1HSBA 2NQDA 4TSCL 4PV1C 1OM3H 3TV3L 3NPSC 2PETA 3BWUF 1TPXC 3U4EB 1QEXA 1GIGH 4NQQA 3KW7A 3KBPA 4TRPL 5CP3H 4ZAKD 4EN3A 4EI5D 3BH8A 3VGFA 1IZJA 3TBVB 4HSQA 1KBVA 3TEXA 4TYUA 4NIYE 4ENED 3O4LB 1Y6NR 3SDDC 4BXVA 3V6BR 2NZ9D 3EJZC 4OFPA 3MXWL 2D3LA 3FQTA 3Q06A 2Y36L 3NABH 5AOMA 3IKCB 3QEQE 3WFHB 4B0MM 3EJCA 1X5LA 2G75B 4ISVA 2D7TL 1RU9H 1V7NH 4U6XA 4CDGC 4DP8X 5IMOB 2X1WL 4L18A 5I17B 5FYJU 1L9QA 1TJIH 2AK4D 2GFBA 3VSUA 3G5ZA 3MJ9A 1QQDA 1Z1WA 3FFCE 4JRXD 3IB4A 4FI7A 4BE6A 5AG8A 2O93L 2KZKA 5HHPB 4P2OC 2KDGA 4I3SL 1T0MA 3QUZA 3KL5A 2XKNB 1ZJAA 5K39A 3V0HA 1A7QH 3ABMB 4TL5A 4N3UA 2IWGA 1XCWA 1M3JA 1IARB 3ULVE 5LAPA 4FQQB 1VZGA 3K6SA 4D8OA 1PKQA 1BYOA 1HU8A 4YZWA 5I2IA 5EDXA 4PMFA 2XWBB 3FCGA 3OKEB 2AJYH 3GHBL 4Z3IA 1KELL 3UYOD 5LN4A 2PCFA 2F54E 4YBQC 4H5SA 5DEZA 2UYLB 2F53E 5C0RL 1PLAA 2WTPA 3V6ZB 1J5OL 5CXPA 1G7HA 4FXKA 2AJUL 5EC2B 4FFYH 3K80A 3EOAB 3WY2A 1RKRA 3NTCH 3U7YH 3D85B 1U9KA 3OMAB 2I32A 4BDVB 4FQHB 5A6MA 4DN4H 2ZYIA 4JO1L 3ZXAC 1N6QL 3PHAA 2ITDA 3NCFB 5EBGA 1CS6A 3JT0A 2O5YH 3PRZA 1LGVA 2VLRA 3MYJA 4X8JA 5ALBH 4X6CF 2DM3A 2WV3A 3NIFE 2G4EA 3FFOA 3I84A 2JCCB 2R7EA 2Z8RA 2OI9C 3ATEA 2LQRA 3BMWA 1FL3A 3KYKL 5BVJA 3NK4A 1UOWA 3M17B 5GRYA 4OLWL 4W93A 1PZ2A 4HH8A 4HFWB 4I9WD 2KZBA 3US1A 4B9FA 4ZMQA 3BT2H 3EG9A 1HEZA 3ULSB 2GHWB 1S9YA 1AZRA 3DUSB 4QJ3B 2UZIH 3BDXA 3M8OH 2OLDA 2ROYA 1KGCE 3S8WA 3KPNA 4JBSA 4WFHD 5KBNC 1HH9B 4PWFA 1LQBC 2ZG3A 3SQBB 2Y07H 4P5TC 4BFBD 2XYCA 2CO6A 5F0MB 5DGQA 2XZAH 2VL5A 4X42A 2PYFB 3G5YB 1MI5B 3B43A 3D33A 4FL4C 3UIYA 4AT6B 4A7QA 3NAAH 4H8VA 2LE9A 1IBDA 2H1LM 3WFBH 4AVJA 5FYKE 3I9IA 1WP6A 2ZF8A 1P69B 1PNCA 1HQRB 4PRPB 4JG0L 5D6DA 2PP9A 3G08B 2IBZY 4V33A 5DU7A 1SDDB 3V4PL 2AEPH 3ZL4H 2ED9A 4BFIB 1NMAH 1S7SB 1SOKA 4ZK8A 4DK5A 5AFAA 1J86A 2A4CA 2ADJA 3MAWA 3KPSB 4W9FC 2VR7A 5DFTA 5I8EA 4N2BA 3CDGA 2AZUA 1UVQA 3CHSA 2Z91B 1DBBH 3GMLB 3L54A 2G2RA 1J87A 3D87B 2MPAL 2CRYA 3S36X 5FW8A 2X2JA 1JHKH 4GAJH 4LDLB 4LU5H 1CXIA 3VRLE 2EDKA 2NNAB 3NCYP 3L3DB 4JM0A 1SOQA 1JPEA 4XZ4A 4PB9L 1WWWX 3IWUA 2BDNL 2OP4L 3FUJA 4IU3B 4PWIA 1OCOB 4H7VA 2WTRB 4JN2B 2VXQH 2GBAA 2GITB 4Z95H 3O3BB 1R3KA 2K9FB 4GAGL 2CGYA 2YPVH 2GJZA 1X7SA 2B59A 3J07A 5D1ZI 4IGBD 5AOIA 3ZTJH 1HHGA 2QVFB 5GZOA 3I6LE 3KPRD 4FP8H 2KC0A 4DW2L 2KLSA 2C7UA 1E6JH 2ZOLB 2EDWA 4HS6A 1NWPA 4MXQC 3VI4E 2YFOA 5PCYA 2LGNA 4FJYA 3P11L 4L1SA 2P26A 1UJ3A 5C0IA 2Y6SD 3SE9H 3IE9A 3VU2A 4CC1A 4NHUB 1X4XA 1XO8A 4Y16D 1D5BA 1SVZA 1F02I 2WXKA 1RFDH 3VQMA 1JIBA 5B39A 4G6ML 4WI0B 2V37A 1CFQB 5CMAB 1U8CB 3KDMB 3AITA 3DURA 4JFYA 3S34H 3ZYZA 4M4RB 1HOEA 3FYEB 3IMWA 4JKWA 1OGPA 4BFGA 5DVLA 5DRZA 5JR1H 2GK0B 4HUUB 3TBTB 3DSNA 3UMNA 3JVFC 4Q58C 4W9IC 3VFGH 1M6OA 2A9ML 3RWGB 1W0VB 5D1ZD 4AKOA 1G7PB 3QJOA 5TE7L 1Q4NX 1IBBA 4P99A 1FBIH 1C8PA 5CEZE 1T22B 2V3FA 4Y1TA 1JWSA 3SY6A 2ESVD 1G1OA 3H1ZA 4DSYA 3OKDB 1KJ2B 4OLYH 3U1SL 1KGWA 5HI5C 1ODAA 4BSWA 2K6YA 4PP2A 3N1GC 3QCTH 4JPSA 1M71B 4R26L 3P2TA 4BZ1H 4HDIB 2IOOA 4U6YB 3DK2A 4QO1B 4XH2B 4AQAA 4F2ME 5KG9B 3SJVD 3C2SA 5JPNA 1MPAH 1BZ8A 3O9WC 2JNZA 3AU1B 4GLRI 1D5XB 4ZUSA 3TBSA 4NC2B 2AQTA 4NZRH 2WAQA 1AP2B 5C0AE 1J8HA 1NGZA 2NR6D 1EZSA 5EFIB 1INEH 1AO7B 1RUMH 5BS0A 4AMWA 1E5CA 1T7XA 3PDOB 3HI6L 3TJHC 2VABB 5DS8B 1IVLA 4ODBD 1X5IA 2MQCA 3W9DB 2C7FA 2WUBH 1NUDA 2VITA 2EH8H 3O3DB 5KANG 5KYYA 1UWEL 3EH4B 1FJ1B 3HI1A 4OCSL 4ZFZB 2JJVA 3MREB 4DQOL 4DCQA 4CUCA 1HI6B 1LD9A 1RZKC 5E5MA 1A6AB 3BXNA 3FH5A 2CNYA 4KZ0A 4LSQH 1OVZA 3GHEH 2NLJB 3T0EA 1UXWB 1UB6A 5AB0A 3QW9A 1EFXB 3MUJA 3ZOAA 3VD2A 1MCEA 3ULUL 2ZXWB 3VDAA 1GXEA 2KQMA 3IJHB 3HRZA 5F7AA 2J4WL 1SY6H 1JN6A 4UBDC 5SWSB 2UZPA 4B7LA 4YHML 3KL3A 3VDBA 1MRDL 4HEMA 4MQTB 5J3HD 1KB9J 3CU1A 3HB3C 5LCVL 3ZKSD 5HDBF 4PJFB 4WHYG 3TJEH 1IL1A 2Z8SA 3FDWA 3WELA 1Y6KR 3ZE2E 5D5MB 3H8NA 4D9LH 1IMHC 1KTLB 1KSRA 3R06A 4B9CA 3IGLA 2VSMB 4LSVH 4CSSA 5JZ7C 1FLRH 4FQXA 1U21A 4JQIL 3T0AA 4M6OL 1IIIA 1UCBH 3EFFA 3T6ZA 4OFDA 1VCAA 2OMUA 2UZXB 3B9AA 3EJYD 2EXYD 1CIDA 3L3HA 1VA9A 2VXTH 4NQSB 3SN6N 5BUPA 3QORA 3V6FB 4IKJA 1NBYB 4MXWL 3RL2A 4HPHA 1IM9A 2NY6D 3U7WH 3C60D 4TUOA 1TZIA 1HZLA 5TFSH 4HJ1A 2R1WA 4XHJC 3IDYB 4FFWD 4H40A 3ZVVA 1OGAB 5AZUA 2CAKA 4GIOA 4LARL 2OZ4L 4M29A 5DRWB 2QKIA 1X7QA 5ADOL 5F7KC 2OMYB 3IU4H 5GS1B 2ZXEB 4I0PC 4BKTC 3LZNA 2IWFA 3UDWC 4AMXA 3M1CA 3T3PB 1M7XA 4PRIA 5ENWA 1CLVA 4R6UA 4X6DA 2PPCA 2HT2C 2J25A 4X4XA 7CGTA 5JIPA 2AKRB 5DHVH 5ESAA 1N18A 1T2XA 4F8OA 5LAXB 1B4JL 4OGYL 4MDJA 5TE6H 4BH7B 3LAFA 4Y2OB 4A6YL 2E27L 4TXVB 5FCUL 1MWAA 2XVBA 5M94B 3DO4A 4MNGA 3JWDH 3QARA 5GJSL 4NQDE 5DJ2B 5E1AB 3HOGA 3W81A 4L3CA 3GRGA 2C3HA 5F1NB 1FFRA 2VDNB 1RZ8A 3BIBX 5C0AA 4EPSA 1Z5HA 1WISA 5FPIA 2CJSA 5JQ6L 4RIRA 1AZNA 1JZ8A 4LRIC 4J3TA 2JF1A 3CLFH 3OXRB 1TZOA 5D93B 3F12B 1EHLL 3M07A 4N0UB 1ZHNB 1S9KC 2KPNA 1OLZA 1ZLEA 4LK4A 3ML9A 4FOMA 2OTUA 2ED8A 4U4IA 5IG7B 4RNRA 3UBXI 2Y7QA 2K7QA 2YUWA 2DQHH 3B9KD 4KU1A 2XQ0A 4D0BA 3JV5A 1A7BA 4YFLF 1MFCL 2JKXA 5ISZB 5IBTL 1YEKH 1F00I 1PKOA 3GSXA 4ZUVB 3RP1A 4ANXA 5L88H 1AR1B 1FFQA 5KVGH 1NCTA 4MXVE 5DCCA 5AD0B 4OCWH 1XGRA 2UUDH 5F7LB 3KAAA 1TCRB 3LIUA 5CCHE 1UGKA 1BMGA 1SEQH 4LAJH 3DX9B 3SKOA 4MLIA 1IT9L 1G1KA 3CE1A 4FRWA 5G4MA 1VIWA 4XWOD 2QADB 1I7UB 3W9EA 2ADYA 3NRPA 1T1YB 4L37A 4PTTA 5FO8A 1G1CA 3QDGD 3DX2A 3ARDA 1PG7W 4JPKL 4MQ7A 3VXOA 1IKFL 2XPGB 3RWIB 3E9TA 4NQEB 2Z64C 1RZIB 3PWJA 1IU1A 3QH3A 5F7UA 25C8L 1OSZB 4ZXBB 4PJ8D 5SV3A 1LE9A 2W65A 1G87A 1HOCA 5ICYA 2YR3A 4NKDB 2LR4A 2IG2L 4Q9QL 2YAOA 3NCCB 3M6DA 1TTGA 5D1QE 1C9SA 2BVQB 1OE1A 1E5AA 4LSTL 2VQTA 5FB8A 1NDTA 1OARH 4BSVB 4MZ3A 5I6XC 4HFUL 3K8LA 3FCTB 1ZRUA 2ZUUA 1T20B 4Z7NB 3OAUL 5FA4B 1E4XI 1NGYB 1WZ1H 2V9TA 1HE7A 3PL6D 4HCRL 1TJXA 1JMXA 3QEHB 1XVSA 2DEXX 4WFFE 2C5DC 4IEFA 1DSYA 2D7PA 2V7NA 2DWSA 4TMPA 3D2TA 4K9JA 1DQDH 1P0SE 3QUMH 4PJBB 4G43B 5AOJA 4YSQA 4U7SA 4QAWA 3ULAB 3KYAA 3VQLA 4FADA 3UTTB 4A04A 2R23B 1WFTA 3ARED 1HHIB 3DXAB 1MVUB 1NCUA 5HVWA 2MNUA 4KTEH 1A1OB 1FO0A 4LCIH 4C58B 5IJBC 4HX1B 4OZ4A 4YSCA 1SMAA 3PWVB 3VJ6B 3B3IB 4NHCL 1JF6A 5L2JA 4UWQB 3T4AA 1RHHA 3RAJH 3HI5H 1PAZA 1QWHA 2XU9A 4UTAA 4U6HB 4OCLC 3C08L 1OAKL 4X8XA 3ETSA 5HJ3A 2EC9T 1RK7A 2HFTA 2W80C 3CSBA 2A9AA 4FE9A 3ZO9A 4ODWB 4YDZA 2X6AA 1J05B 4IU2A 3BWAA 2EIZB 4IOSD 4LKXA 4RBPH 2AI0L 3H53A 4YQXL 3IDNB 1NKOA 1KCWA 4FHJA 1S8DB 1P1ZB 3U9PL 1FGVL 1F4XL 1AJ7H 4EI5C 5AUMB 4MX7B 3JSSA 5EBLA 5GRVL 1RMFH 4QTHA 3RPIA 3UX9B 3WE6B 4F7PB 5IESL 5IWLC 4ENEC 3EO9H 2ORBH 4DPRA 1C1EH 3CPLB 3FRPA 4K2UH 2ZSVA 4PJDE 2A9DA 1YNTB 3W56A 4Z7WA 3IDMA 4RVBA 1KYOK 1YEHH 2Z31A 2WINA 4HETA 2QSTA 2CUMA 3OQRA 4HKZB 4QXGH 3FB8B 1JZGA 5F6HI 2IALA 3NFSH 1AR2A 1BD2E 3N85L 5HD8D 1NCBL 4J1UB 2H32A 1OD9A 2ARJA 2VM3A 5CCJA 3MJ7B 5HYFA 2PPAA 3U30B 1DP0A 3BZ4A 2JQAA 1PYWB 3NRQA 3BQUD 1PLGL 3C8KB 3Q01A 5B1BB 3X14B 4PGCA 4WUUE 4XMUA 5LKNA 3H9ZA 2ZG2A 3U0TA 5B1KA 4JCWA 3IJYA 2VH5L 4QXVA 1H3TA 1P9MA 1HCYA 5ERWB 1D9KA 2R83A 3GFUA 4P23A 4YDKL 3OVUB 4YFDB 5DD6B 3UTSB 3DGGB 5I1KH 2JB6B 5FKAB 4GQZA 1RUAL 5EBMA 3RJQB 4KPHL 3UG4A 2NXYD 2DBLH 5GXBB 3MQIA 4XP9L 3JWNE 1G7JB 3VD4A 1ETB1 1OB1A 1UASA 1EMTL 1T7ZA 2VC2H 2ISDA 1ZHBA 3HZVB 1SHWA 1XH0A 2FJGA 1BQKA 1DUYA 2W9DL 5I1EH 1KGJA 2XWJB 3BYTA 2VMFA 3LPFA 2VR5A 1G6RL 5BUAA 1MREH 3MODH 4A7TA 3NESA 1CDJA 3C6EA 1D7CA 2O6EA 3P02A 2MTAA 3VMOA 5BNXD 4GRWB 1ORSB 1V3LA 2VN6A 3O4LD 2DDQH 2X9ZA 1I1AB 1UT9A 3NJNA 3WN5C 4EOWL 4F80A 1GGCH 4BQ8A 4M5SA 1KCLA 1P7QD 3P77B 4R0LC 3H9YA 3ULVL 4QGTA 1RURL 3D07A 4JE0A 4L4TA 3NCJH 3RBGA 1E28B 3TZVB 4BZYA 1I3GL 4DUWA 1VHPA 3LPOA 2X41A 5AW4B 3I9AA 1DJXA 3JTSB 2TSAA 3FOMB 3CVIH 4F7MA 2NYZA 1D7FA 4FYRA 4NDMA 4E9QA 2E46A 3IVKB 1T03H 4DESA 4GB9A 4N0RA 3IGKA 4JFDB 4BQ6A 2ERJB 5BUGA 1B90A 1C08B 2DQCH 3IDJA 4FTDA 4KXZI 3OJMB 4KTGA 4UDUA 5IJKC 1UC6A 1BG9A 3ARFB 4I7ZC 2AW2A 1I8MA 2NX5D 3N9GL 4LIQH 5HHNB 5DS2A 2QSVA 2FIKA 2ICEB 1FVCA 2HH0H 2UY7B 3FRUB 4B96A 1DR9A 4OKDA 4HIHA 1M6UA 2I60H 4HT1L 2XN9E 2B5IC 2J1YA 3EBHA 3TBBA 4KGLA 2C9VA 3WKQA 1PZAA 5CJXA 3EXLA 2YPLB 3BPOB 4YSEA 4IIQA 5KSUB 1A22B 4KY1H 1ND0A 2EDLA 4XN9A 5LXGL 3OF6A 5AKRA 3N50A 1QTYT 4QHPA 1JPGA 4HUWA 5I1HH 5LGHH 1BFVL 3S3BB 4QHLB 3IJ7A 3QPXL 4FCHA 3D85D 1UYWH 3CSTA 2COQA 3WJMA 3L9RA 4YMPA 4JZNA 4GW4B 4WHDA 4Z0XA 5I71B 2ZUQB 3TA3A 2R0WL 3N3EA 3UXFA 1LP9A 2OSXA 5JW5B 4WWKD 1A6VL 3FQNB 1QLRB 4HUMB 5IEKB 4R7NB 3CSFA 1FPTH 2UVFA 3WHE0 3AW5A 2YQ3A 3QQ9D 4N1HB 2EYSB 5KANI 4HP5A 1JFQL 2OJ1A 2ATAA 4WUUA 4U1NA 2OMVB 4PRHE 1QBMH 3PWPB 4PBXA 4IGBC 4XN5A 5FYKL 1JD9A 2E56A 3FUHA 2C3VA 3NIDE 4BGLA 1KC5H 5IB4B 1E8WA 2H41A 3S35X 2BRRH 3F7QA 1GPOH 4NP4H 1RZJL 3PNRB 2DWDA 2L7JA 4AC4A 1KXQE 1F4AA 3E1F1 4YDJA 3MBWA 4G6AC 3WFCH 1BIHA 2ZWNA 4HHWA 3OC8A 2A6JB 1I3RA 2Y6SC 3P3TA 1I8LC 1MI5D 4Y16C 2IQ9H 5E23A 2DMHA 3U6RA 4BH8B 1MIEH 5I24A 2ZD0A 2R4SL 5CHNA 3RVUD 5F1OB 4F8PA 2XQBL 3S5YA 4HGWA 3TBYA 3EJRA 2I69A 3GXMA 5I15H 2ICCA 2JTYA 4LPCA 3CHOA 5L8LB 1A4AA 4I4WA 1B9ZA 4GO9A 1S7WA 5HYQB 1J1OL 1MJ7L 1RZQA 3LV3B 2K3TA 4BXSV 1FA4A 5D1XB 1K5NA 2F68X 3OJDB 3AQXA 2MNJB 3CXHJ 4KTDH 5D1ZC 2D3NA 5TDPB 4DEPB 3TEWA 2HMID 1QSEB 1INDH 4XNMA 1LO2L 1ET5A 2VJXA 1HVXA 3RX8A 1CICA 3C5SA 4GSUA 1R3JB 2DQDL 4JFFA 1CLOL 5TDOA 4F7KA 1FYTB 1MHCA 5KJRL 3L4CA 1PCXA 4K3DL 2ZCZA 5B1JA 3DUUA 4RFNB 5EO0A 3VMPA 4Z7QB 4FQLL 4L8CB 4ODUA 1YJDC 1IFHH 5CFAA 3MRNB 4RMWA 4ALAH 2ALAA 2K7PA 2R2EB 4P5MB 1Z6JT 4OFYD 2NR6C 4OT1H 5JPMA 4PG9A 5CEYA 3V0WH 1BP3B 2A83A 4QOKB 4Y5YC 3MNZB 5HYJB 3L45A 2HYMA 1AYRA 3VCLB 2R69H 4G8GA 3HC4L 4FG2A 4PJIE 4C56A 4L8SC 1LEGA 1MFEL 4L4VB 5F1SA 2Q6WB 1YEDB 2XX0A 4OGQC 5JDJA 2VAAA 2D7OA 5D70H 5E4IA 5LDSA 1GZHC 2HKHL 5DJXA 5IB1B 4ZRGA 3GF8A 4K9EH 5FGBA 1E3XA 2DICA 2HLFC 4DTGH 1AGCA 3VFWA 4AQZA 1TQWA 1DEEA 1U4EA 2VXSL 4L1BA 5H2BB 1KYUA 2RR3A 4OIIL 2QVTA 5FYLD 4OGZA 3PY9A 4H8WL 4WI9A 1MQKL 2FL5A 3SKJH 3D9AH 3V4UH 1UADC 3AG1B 3BSZH 1D5MB 3SEPA 1JZ4A 4ZO8A 2HJKA 1MWAL 4LPUA 2E0PA 1JXKA 2WBJA 3UJTH 5J3HC 5EORL 1RZ7L 2FHCA 4XBPA 1TCMA 4L05A 1ZSDA 5TTRA 2O61A 4NFCA 5E9DD 1KNOA 3DBXB 3F7VA 1N2RA 1DANT 2VR6A 1CDBA 2EDDA 1QG3A 1LK2A 1UWXH 1EQWA 4XVSH 3OSVA 4F1ZA 4XOBA 1T1XB 1HIML 3HNSH 2MCPH 1S5HA 2X4OA 4N90E 5DJ6A 1GGIL 3GMOB 4DZ8A 1SDYA 5IM7B 3K7UA 1PFCA 4J6IA 1OSPH 5ESVB 1LO4L 2EXYC 4FLSA 4Z7IA 2FATH 3LZOA 1J0YA 1ZLUH 2RCSL 3UTQA 3S37H 5AVUB 3V52L 5D2LB 2NY6C 5ICXA 2DW5A 3LMJL 2FH6A 3Q5OA 2XYBA 4AVIA 5K69A 3BKJL 4M7ZC 1U3ZA 2A9NL 4LOUD 4H20H 4WO4D 3ZKQD 5C8JB 5F9AC 4JDVA 2ENQA 3SYCA 1TU2A 2FB4H 3BVTA 4YR6B 2WJ5A 4TQEH 1AO7D 5D2NB 3JXAA 5KVFE 1ZWIB 3NZHL 2DL2A 2AJXL 4KQ4H 3SY0A 2XN0A 2FQGA 4FN0A 4G6JH 2DTSA 2HFGL 3X17A 5EEUA 4UQ9A 3FAXA 5FK9B 1ZT7B 4AQ8A 5CBAA 3L4TA 3PGDB 2BP8B 5K93A 5I6LA 1J18A 3BVWA 1T3FA 4L3EE 3INOA 1JNHB 4BHUI 5FC9A 2EUXA 3OHXC 3MHZA 4KNTA 4Z8FH 4HHAB 1ZV2A 2AEIT 2PCPA 1YPZF 4AVHA 1VCBC 2BX5A 2BS8A 5D9SA 3US9A 1EH9A 1QLFB 1EFXD 4KRPC 1KIPB 4HF5L 2D7NA 2WXFA 1ASPA 4KHTL 3BP7B 4FXGC 1GA2A 1KEML 2X3BA 4ZS7H 4N26A 4Z7WF 3MBEA 1MF2H 5SWSD 2F8OA 3TEZA 2DQ6A 4UB0L 4JFOA 1HQ4A 1GJIA 4JHAH 2AP2A 4NJAL 3D39B 4WWID 1M9WA 1XF3B 2N7BA 1MJJB 2WQUA 4LLQB 1PTZA 4UV4L 2Z0UA 5DYOA 3TGXA 1UTDA 4YSSA 1WUNT 4NQVA 4N86A 2VKWA 4R4BA 3QSKB 2EKJA 4PJIA 4U6VH 4QF1B 3FB7A 1N3NA 4TSCH 4HIJA 3TV3H 2B4CC 3O6FA 2BZ7A 1WE5A 1WFOA 4UZSA 3RKDD 5CP7A 3ZYJA 3TNNB 1YY8B 3GNMH 1N9PA 1JPFA 3MRDB 4AQEB 3QIBB 3KCPB 5T5FH 4MMYB 1ASQA 5G2NA 3SZ6A 2Y36H 5ICUA 1OGAD 3LZFH 4HIIB 2XTJE 2OL3A 1HC1A 3MRKA 4N1CA 2D7TH 1MY5A 5EBWA 7FABH 3JTTA 4OF7A 2ITEA 2E8YA 3BUYA 1UEMA 1MFUA 1XGUB 3T4YA 3M7OA 4AZ8A 3MLUH 1GJWA 2EC8A 2OMTA 4NCC1 4WEBH 3NIGB 4UIMA 5DZPA 5HDRA 4I3SH 3DV6A 1CF8H 4PJ8C 4EBQH 1UACL 4XCNA 2APWA 4LLDA 1BAGA 2Z93A 3STZA 4KO9A 3TH3T 4HXAH 5T1KD 2WVSA 4G71B 5CZVL 3GM0A 1U58A 4ODHL 3L1FA 3SE4A 4DKDC 5AL0A 2I24N 2ALWA 5EO9B 2HX9A 3F85A 3GHBH 4YBLC 4UQ3B 4NN5C 2EEDA 3SQOH 1CR9L 3C87A 3CVDA 1K72A 1WFUA 3ZTJG 4HJJH 5ACMA 5DD0L 2W0KA 3PL6C 1J5OH 4UM8A 1Q94B 3K4AA 1A3RH 2ZP0T 3B34A 1BG1A 2X1PA 4NNXA 4TVPD 4NO5B 3RWEA 3MACH 4F37F 3GS7A 1PY9A 4QT5B 4BM7A 4WW2B 4Y5XB 4R7DB 2DWYA 3C09B 3OMZA 5KOMC 4IM8A 4HZLA 1QO3B 1ZAGA 4MYPA 4J8RA 4CNIA 2H26B 3HA0A 3NOIA 3ZZLA 2BSCA 2X6CA 1O0VA 3AREC 4L3EA 3RI5F 4L3FA 4QHUB 1B6UA 4LKCA 5JTWA 4XNUH 5ISZD 4H8HA 1UXSB 4KH2A 1AR1D 5CNHA 4JPWH 4CBZA 3QZWA 4IBZA 4MZRA 1RUKL 5HDBE 5DTFB 1DQQA 4ZFGL 2GEEA 5EU5A 4NUPA 5LGYA 2A6KB 2G2NA 4W4OC 1G9NC 4DJMA 3DWTA 3WTWA 1U41A 4HSCX 5IB5B 5GGTH 2AQQA 4XBGB 2QADD 3FMGL 3O4OB 4PP1D 1S46A 4AYDC 1DO5A 3QDME 3FT0A 4XWGL 5HVFB 4RFEB 4BZ2H 1WT5C 4NS0A 4X6EA 4NQED 3HE7B 1QSFB 4G8IB 4OY9A 4JRFA 2Y06L 4Z3TA 4ZXBD 3SPGA 3KHOA 3D2UB 5D4QA 2AV7A 4HJSA 4RGMC 3WAKA 1CU4H 1YYLL 5HHXL 1DN2A 2ATKA 4GS7B 3HNTL 4S10A 3GXFA 5AYQA 3PHSA 3ZDZF 4ZOCA 2WKGA 2B2XL 3NCXA 1UXLA 2X4PB 4KX9A 5L8JB 3PFUA 3T2NH 4OF8A 1MHPL 5TE4L 2VQ1B 5HD8C 4UTCA 3K2KA 4KX8A 4PU2A 3MYZA 5I9QB 5IOPB 5HDQL 1P4IH 3U36B 4YX2H 4K55A 5E9NA 4ZD3L 2BNRA 2VLKA 5AYTA 2WYZA 3QJXA 1OE3A 4WV1A 3BQUC 1BBJA 4LOFA 4C4KO 2CLVB 2NZIA 1AKJA 1F11B 2EQDA 1QEWB 3IT8D 4LVHB 4WSKA 4I18A 3UTTD 4YHYC 2EVIA 3FT2A 3ZTDC 3Q1SL 4KI5F 4OCNC 3DXAD 5DMKA 2A1WH 1AXSB 3APNA 3NFNB 4NKMA 3REVB 2D0GA 2YS4A 3K8KA 5MP6L 4GQ9H 1F1DA 2BDNH 4GW5B 3ARGA 2X2HA 2DQTL 3FT1A 2NXYC 5BV7L 4PH8A 1OM9A 4XN2A 1UD8A 3S97C 1K8DA 4PLKD 2IBBA 3KBHE 4MWFB 2P7TA 2WTOA 3ZGIA 1S7TB 1NCCL 1QLEL 3WYRA 4URKA 2ENSA 2Z35A 3VWKB 3BKCH 3QS3A 1FGNL 2MJWA 3DO7B 3HG0A 1PU0A 3MUZ1 5ANME 3P11H 3EOAA 4L23A 4XNQB 1BGXL 5F96L 3T3ME 2QPUA 1P4UA 2HKAA 4EZJA 3OHMB 3CZEA 2FJFB 5GZND 4NBYB 4ZMOA 1T6BX 2NW3A 1E4WL 2FZ3B 2QDVA 3D0VA 3SCMA 1N6VA 1UD5A 4TNFA 4HKXB 4HIEB 5F7DB 5BVPL 2J3SA 3D4ZA 1J8SA 1DQKA 3MROB 2H2SC 4OB5H 2JIXA 1JHLH 2VLJB 3QNYB 4WFED 2P80A 4NSKB 4ERSL 4D94A 5T5NG 3X13A 1KCUL 3D25B 3UBFA 4D3CL 3VNZA 1XCTA 2AXGB 2P5WA 1WFIA 2OSYA 2Y7OA 2A9MH 2OCJA 4PJ9B 5E56A 2HUHA 2B7DT 3QI9B 4KNSA 5H37A 3UADA 1EHXA 1VADA 4KO6A 3SDDA 1AZCA 1ICTA 1X3DA 4CSPA 4FHBD 2AQ2A 4KK5D 5FO7A 3D30A 1URIA 1X5AA 3HZMA 1N4XH 1S9VA 1W91A 3P73B 4KKNA 2LTQB 1S2EA 3HBPA 5F7MC 1HDMA 1U8PB 3DX0A 1KXTA 3Q3GA 3QK0A 5KSAA 1YEFL 2FO8A 4HUVB 2PYFA 4GAYA 3OKOB 3FJTA 4R26H 4AT6A 5C9KA 1G0XA 1IQDA 4RGOH 2HLAB 4MAYC 1IGYA 1SM3H 4KVNL 1HILA 4XT1C 3VFMB 5C0CD 1UWXK 2AJVL 1W8OA 3N42F 3UTSD 4P2OA 1IFRA 5CILL 1ZK9A 2R0ZH 4JFEB 5LGJA 4YC2B 2GCYB 3K6NA 5D96B 4PRPA 2NY3B 3GKZA 2HJFA 1YYCA 1BWMA 5C3LD 3FO0L 4J39A 4X7SH 2HPTA 3GJFK 2JJWA 3W0WB 3L5WA 4WI5A 3GKWL 5LHDA 1LMKA 4ZW6A 3FOLB 1YMMB 1P4LA 1JYWA 3HI6H 2BVOA 5AB1A 3BIKA 2IV9A 2PYEA 1IILE 4QRTB 4W70A 3KPSA 3V5HB 1K9TA 3VXUA 2EDTA 3KPLB 5AKTA 3P9LA 5E70A 3MLRL 4WWKC 4TTDC 4N8VB 2EIMB 1IQWH 4DQOH 5EF1A 1ZT4A 3JUZA 3R8BB 3SDYL 5HHOB 5M95B 1AIFB 12E8L 1HL5A 4O9HL 2LLGA 4LBEB 2RFXB 2EVGA 3VH8B 3LTVA 2J88L 1OD7A 4K7PX 1I1AD 4XP4L 3EDKA 5IF0B 3ULUH 5DR5L 3HMWL 2DTML 2CUHA 4JRLA 4PV9B 4KFMA 1AYOA 2J4WH 4YQXH 4YHKH 1VB9A 4FQIH 3RWCB 4RRPA 2EINB 3TZVD 5MENB 3JZYA 4DP9X 2J2ZA 5AVXB 4HJEA 1IKOP 3S88L 5BOZG 3MJWA 5INCA 15C8L 1GW0A 2Z3FA 2FJHA 4G6KL 2LVCA 4JDEA 1EXHA 4ECNA 3VXRE 4DZBA 5I0YA 5C07B 2P5EA 4U1KA 1L9MA 4PG2C 4JFDD 4CGTA 3BAEL 3HLKA 3KYNB 4J4PC 3LQMA 5GGSB 4Q4EA 4IMLA 3QBTB 3ARFD 1F2XK 3RVUC 3FUFA 1ZLSL 2NDGA 3CH8A 3ZMRA 2VC2B 2YEZB 2BCMA 4KO7A 2AAVA 1WIPA 4N0YL 1M9SA 4MXWH 5CMAA 1AD9B 1KEGL 2IPUK 4M4RA 4OAWA 1PL3A 3RBSA 3WFEH 1HHHA 3WJLA 2H0JA 3KL0A 1O6TA 4L2LA 3MRCA 4U1HA 4P06A 3HR5B 5GGRB 3X12B 1F56A 1IEAA 1W0VA 5J9PA 5E4EB 3X11B 4ABWA 3GXUB 8CGTA 3LXCA 4KDTC 4NYLB 3L4XA 5F8QC 2XOTA 4K07A 3P69A 1CGVA 3B5GA 1ITCA 1QD0A 1TVDA 5DFWH 3ROOA 3FSAA 2WGXA 4JL2A 4M5YL 1H3GA 1U8QA 1FG2B 3R0NA 5LO7A 1FZOA 2NY4B 2E27H 4JO4L 5CCKL 5I1IL 1SJXA 3RHWF 3UZQB 3GSVB 1Y07A 4F27A 5F88B 5IHHA 1C5BH 4PWJA 3CVHB 1ZANH 2DN7A 3DYMA 1YLBB 4FJZA 1KCBA 2V5SA 3IFOA 4N2DA 1XSJA 3CGTA 3UL4A 5EZOL 3U2IA 5KSBF 2ZSWB 3PDOA 4TLUA 4KUZL 4Y4FB 1VACB 1YCSA 3ZYIA 5AQ0A 4QTFA 5JQ6H 2VABA 3UZEC 4K94L 3A67H 1JXFA 2CO7A 2PTVA 1G1YA 4FTVA 3RA7H 4OF0A 2FSEB 4F57L 4P5KA 2X42A 1KGUA 4M02A 2I9TB 4XRCA 1CWVA 2F19L 4JFSA 3QIWA 1XTLA 3OLGA 1F4HA 5DHDA 4OH2A 1K8IA 4B3VA 4GUPB 5DVPA 5D1XD 1CXKA 3WJJA 4ZMVA 1NC4B 1JWUA 1SMOA 1A6UL 3QULA 4N8VG 1MAKA 1VFBA 4YOKA 1QSED 4EI6A 2BRQA 3OKKB 1NFAA 4U31A 2ZOKA 2VDKL 2XIDA 4XTRD 4XE0A 5AOLA 5DEFA 1AHWC 2YAQA 5DSCA 5L6YL 3J27A 3B2MA 3VH8G 1SXNA 4XP1L 1ED3B 3CFIC 5EIIB 1EAJA 1FYTD 2CGRL 1IGCL 2QZQA 4JNXA 2CR6A 4MJIE 3MR9B 1WBYB 1IKFH 3WY3A 2WQSA 3Q2VA 1HNGA 4APQB 2ITFA 5BZWA 1JV5B 1DBKL 2PTTA 1E4KC 4GP4B 3ZU8A 3GBML 1UQSB 3TS8A 3C5JB 3SDXF 1T1WB 4WO4C 2IG2H 3DVGA 3QJRB 1XX9C 2FCBA 4OLVL 4N6QA 1PX3A 3A4EA 1UOVA 5HYJD 1OTTD 3QCUL 1IKNA 5CEXB 3U4AA 2CG9X 3EGDB 1PBYA 2D2OA 3KNBA 3WD5H 2AEQL 4JB9L 5T3ZL 2J72A 2PR4L 4L4VD 5DK0B 1ZEAL 3MJ9H 1OW0C 1MW3A 4J28A 3EFOB 2X4QA 5JOFA 1ZTXE 1NCDH 2GT9B 1RUPL 4AJ0A 4Y19B 2H0PA 1V7ML 1JK8B 5A2BA 4GG8B 4ZZKA 4K23L 2YXVA 3QUYB 4LMQI 4N5ED 3ABLB 3B4NA 4TPRL 3AQZA 3KWUA 1GGBH 1ODUA 2ROXA 3GXPA 4AW4A 3KJ4B 1OP3H 5EN2A 4U7KA 3F8UB 1KULA 2DH2A 5KN5A 3DPBA 3GSQB 4YDMA 5EV7A 4AEHL 3WGUB 5BQ7B 3VYNA 4WTZA 4HA1A 4P2QB 5KYUB 4MNHA 1WWCA 2JFCA 3VNYA 5IHLB 4WJKB 4JPQA 3E38A 1LO0L 2WXOA 4C47A 4L9LA 5KVFL 1RSYA 5ILTL 4GY4A 3PABA 2D9QB 3VRJA 3ZDYB 1RULH 1KCSH 4MQXC 5DJ0B 3VB9A 3PHOB 5BZZA 4ORGB 4CGUB 2XWDA 1T83A 4UIKL 1QUNA 3IDYC 3F7YA 3WXWH 5EIVA 5JORA 1RJYB 4KFZC 4DKEH 1JSYA 4V2CB 1JUFB 4HWBA 4Q74A 3SE6A 3FYIB 1QI5A 4KK9D 5IT2L 3EH1A 4XVTH 3H2WA 5LG1A 5GS1C 4GO6B 3N85H 1HKLH 3G6DH 4X4ME 3FO2A 4MSWA 5CJOH 5AAMA 3E1ZA 5HDOA 3STLB 1F1AA 1A6TA 1Y6MR 1CC3A 3F5WA 5E8EA 4B0MB 3QNFA 1I85C 3MU3A 4N3TA 3ASNB 1AHMA 2GC4C 4KQ3L 5ITBL 1K3ZA 5AVYB 1DDTA 3OKYA 5BCAA 4OM0H 4XXDA 4F92B 1G9MC 3VE0B 2ENJA 4I0PA 4XMLL 3U0PB 5IGXL 5FLUA 3QXAB 3KXFA 3O2DL 4MJIA 5EIIG 5I18L 1MY7A 4GBXD 4YDKH 3L1OH 1JK9B 2AVGA 3GB7A 4N85A 1I4FA 3D39D 3OZKA 3EHBC 2DM2A 3BLPX 3L3GA 2KERA 3S9DB 4M48L 3P0YL 3IF1B 5HGHB 3T09A 1XB6A 5SWZE 1ZIBA 1NANH 2ID5A 1FRGL 2ZAIA 4OBSA 4W6WB 2Q86B 1T20A 4TQPA 3IDIA 2EYRB 4K5OA 3B2PA 5J1AA 2P45B 2GEQA 2H3NA 2PPEA 1UT1A 4Q6IB 3RTQC 1E6OH 4TUJB 3WG7B 1MCOL 2H6PB 3ZE0B 1NPNA 1OLLA 3H6JA 4PIBA 3CSPA 3ZZQA 3MV7D 5F72S 4PIRF 1D6VH 5AAPA 1ZCRA 1MHEA 3TPUB 3BAYA 3VO0A 1S7UB 4RA3A 1NLBL 1QOKA 4ATWA 3OR6A 5GIRB 1HKFA 4N6RA 3QIBD 1I31A 1CF1A 1KYDA 4LLUA 4A2EA 1AR1C 1ZGLB 4LLWB 3GIZL 2FH8A 1QW9A 1OP5H 2DF3A 3MRRB 1LLAA 1KTBA 1XQ4A 1H3UA 1MLCB 2GB2A 2OX5A 3ULVH 1RURH 2FECI 3PWVA 1P4BL 3BVVA 1OP4A 1N64L 4Z5RB 2QADC 3TTYA 1I3GH 4L9DA 2AK4E 4PP1C 1BM3L 4XZUA 2WANA 4MD0A 3NT0A 4G9DB 4JRXE 5A2LH 5HYSA 2BIPA 2WWKT 2DB8A 3RDTA 4AM0Q 2EE6A 6PAZA 4FQJH 4XPHL 2COVD 1O75A 4RX4A 1U8KA 4HC1A 5FGSA 1EWHA 4JG1L 5HGAA 2EICA 3E8UL 4R2GB 4ZXBC 4FFZL 4DERA 3CFDA 3PYCA 2PP8A 1A9EB 1BX2B 1KBPA 4XMTA 2WO3B 1DUZA 4P59L 5AAWC 3NN8B 5E99L 4J3WA 5EHFA 2X2YA 3HUJA 4NT6B 4ABUA 2G3XA 5FM8A 4MX7A 3N1PC 4RSYA 4JHZA 4L1LA 4WDIB 3GMRB 2YXWA 3CPLA 3SBWC 5MEQB 3BSGA 5E2JA 4ZFFB 5TK4A 1P5UB 4EDXB 2HFFA 3RY6A 4GRLC 4PLJD 2IQAB 3O45A 2J73A 4P2RA 4LQ1A 5IQ7H 1BFVH 1P84K 4P3DB 3FFDA 1RJCA 3QJFA 3QPXH 4HUXB 5CWSB 4XPFH 3SKNB 5IB3B 1RK1B 3QEUB 1KT2B 5G5DB 4NNYB 3UJJL 3RPKA 1YPZE 5C0DB 1DVSA 3O6LL 2R27A 4EZLA 1I9IL 4Z6AT 1PZ5A 3C8KA 3NG5A 4U1IA 5D7SL 3B7TA 5C0GB 3RVVD 3ETTA 1XF2B 2RHEA 1QFPA 1C5DB 5EU3B 4Z7OB 5EZJA 1S7VB 3RFZA 5DD6A 1BQHG 2G2PA 1JRHL 1BOYA 4I9WE 2WP3T 4NLAA 2XQYA 4BELD 2YAPA 5AZEL 1R4XA 3MJGX 4FA7B 1TDQA 2GBUA 3T5WA 3DVNA 5C0FA 1EZVX 1RZJH 5I5IA 1TJMA 4WFHE 5GRZA 4JZJA 1WDAA 1M3IA 3I6GA 3U46B 3OWEA 1QA9B 1TETH 4LHUA 5GQBA 5LNEA 3HE7D 4ODXB 1QSFD 3EZJB 3CQQA 2R1YA 3FF7A 1O7VA 5SWZA 2WWMD 1SJEA 2R4SH 3FSWA 4NGHL 3EYFA 5C7ZA 1VERA 2F1EA 3AUWB 1A0QL 5KS9A 1LK3L 1X5ZA 4IHOA 4QXUH 1TVBA 1R9FA 4N0FB 2PW1B 2VQ4A 4FABH 3QWNA 4HWZB 1GC1H 1PZ3A 2DLFH 3MTXA 5BRPA 5L7XH 1KIUB 3MGTB 4G5ZH 3C9NA 4I3RH 3O8XB 4NLHA 4ZNCD 4NQCB 5GS2H 1Y1UA 4ZUUB 3HHSB 3LN5B 4KK5C 3II2A 3U30C 4YLCA 3P9MB 5TPWH 3QG6B 3JTSA 2CIIB 2KZ1B 3QNZA 5KJRH 4N2KA 3WIFB 5ABDE 3I6KA 4GSDH 1JZ3A 2J8UA 2Y5EA 4I2XB 3OJVC 5MEOA 1HL4A 4M3JA 4EKXA 3DECA 4KVCL 3K2UH 5C09A 1UM5L 1XCQA 3VD3A 3NEEA 5E7FA 3KPMA 4GKSB 2IFGA 4M1GL 2BXZA 4LL1A 1ZLVH 1FVDB 3GWJA 4A7GF 1EDQA 1Z3RA 3E6FA 1SDAB 2P42B 1Z5YD 2YPLA 2B1AH 5C7XL 1IEBB 4TLTA 5I74B 2WVVB 3DPDA 4FG0A 2FBOJ 2WQRA 1CPUA 1IE4A 3HC4H 2KBGA 3CHPA 4PJFF 3VWKD 3WNIA 5JHDA 5HYIA 1MFEH 3V0DA 3ZSTA 4JFQB 3O6ML 4MMXA 1Q72H 1T4KB 3K3QA 4ANWA 4BCXA 4NO0A 3EO0B 1TIUA 2YEQA 1F6AA 1NGQH 2V2XA 3DJ9A 1H5BC 2E7LC 4FMKA 2Q2EB 4I13B 3PUUA 5EA0L 3LXBA 4PJXB 4BKLA 3T0WA 4OIIH 3INUL 5DI8B 3B8YA 3K46A 4JLRA 4IRJA 1MQKH 4E0RB 1GZPA 4PJGE 2IADB 5EZLA 2VLJD 3A5VA 5DD1H 1MWAH 4HG4J 1E3FA 1UUSA 1QFOA 2IH1A 3CCHB 5BRQA 2IAMB 3QDHA 5EORH 3TZVC 4AK2A 2HVJA 2QVMA 4X9YA 1RK0A 3FZUD 5DVKA 4PJ9D 2TRYA 3IFNL 3QI9D 5DJYB 5E8OB 4P4RA 3B9DA 4X6CB 2WB7A 1BJ8A 5C2BL 3MNVB 2ERJC 5EF3A 4M6MH 2QTVA 4R0LA 4AVKA 2Z4QA 2ESVE 4C54A 1G43A 3TBWA 5HHMB 3T3PF 1G0YR 2ICEC 2WXQA 3PWNB 1OCWL 1G7QB 4OR1A 2NY5C 3QG7L 5E6IA 1C16A 1NGWB 4KJYB 3LYRA 4PWHA 4N2EA 3V52H 1HWGB 3AACA 3SJVE 3ZDZE 4LVEA 1AY1L 3BPOC 4JFED 1LE5B 2R0LH 2VM4A 3ECQA 3PXJA 3RIKA 2XTSA 3BKJH 3LKSB 5GSVB 2NY3D 3UEQA 4M1CC 1TVHA 5D7JA 4NUGL 4LCWB 3W0WD 3LV3A 2VZTA 5BRZB 2AQPA 3H2QA 3OJDA 2LU7A 4X0KB 5LLIC 1JNLL 8PAZA 1YMMD 5HI4D 4NX0A 3FSVA 3IDXL 4HQQH 2N7SA 4Y1AB 4FZEH 5BZDB 1XGPB 2F15A 5B1AB 2H9GA 2HFGH 4G7YH 5I71C 4AQ1A 2ZYHA 5CLTA 1H8LA 2IGFL 4P05A 3BCFA 1J1XH 4YXKL 4D0CB 2DYSB 1FCCA 1TO5A 5HHOD 3TEYA 1ZJBA 4JJ5A 3VRIA 1KTCA 2ZKMX 5C6PB 4OZGA 1DBJL 3LIZA 2IBZX 4PJCE 1BOGB 1S9WB 3BUPA 1R5WB 4HF5H 2P8MA 5EU6A 2R2HA 4JM2D 1DLFL 2ZJSL 1L9NA 2FO1A 2ADIB 1UFGA 3UO8B 5ADPL 5DLML 5MEND 2JI2A 3L5XH 4UB0H 2Y1ZA 5IR1B 4OM1L 1SF5A 4NJAH 4I87A 5F71A 2R2CA 4QOKA 1IM3B 4FLRA 5KOVC 5I8CB 4G80B 1CLYL 1QTSA 1AGDB 1MCSA 1WHOA 4YNYB 3S35L 3GO1L 4UV4H 3COOA 2V2TB 3UYRL 3WMPA 5HVHB 5C07D 5I16B 3H9HB 1E27B 1QSZA 2J8HA 3BAKA 1I8IA 3OKNB 4ZUWA 1CGWA 3CFCL 5E03A 4O51B 3HKFA 4AYGA 3BRDA 5IVZA 4F2EA 1FC1A 1QZNA 3TIEA 4M93C 3VXMB 4OI7A 1N8ZA 3GTTA 2OAAA 3QQ3B 1SVCP 4GUOA 4LPVA 1J0HA 1NDMB 2EC9U 2Q7YB 3PPSA 1I8LA 4YPJA 2GVYA 3WU1A 1FO0H 1JXDA 1RZKL 3LQZB 3I02A 2GTZB 3CH1B 4OJYA 3S3PA 1CDIA 4C4KT 4XXCC 5LB1A 4PJGA 2CALA 3L16A 5C6WH 2C3GA 3DYOA 4J3SA 4P9MH 4PJ7A 1PS3A 1ZT1B 2X4RB 4UTAH 4XB3A 3KH4A 4Z7NF 2NY7L 1KMGA 4LCYA 2LU3A 4S1QH 1BPLB 1J88A 1AFVL 4GSQA 4YN3A 1QFUH 3KM1A 4IYKA 4Z77B 4OTXL 4KTYA 3EIFA 2A7BA 5EH1A 1A3ZA 2D4DA 3X1GA 1UACH 2J6EL 4PJBF 2UWEA 4KROC 3GI8L 2NY4D 4YHIB 4JAMA 2BCKA 2ZCLH 1JCKA 5EOTA 4DT2A 5CZVH 2WSPA 5FFOA 1E5UI 3WE1A 1OTTC 3B7YA 3VXNB 4FQ1H 3CUPB 4PJAA 2A73B 1A7PH 1EBPA 1UHVA 4X9HA 2UVEA 2JLLA 3BEWA 3QISA 3EGSA 1A8JH 4YDVA 1HJBC 5GGVH 2IANA 4Y4FD 1LO5A 4UQDA 3L4WA 2VRKA 1JZ6A 1B0IA 2H32H 2HP4A 1JF1B 2V9RA 1V3KA 2HVKB 4Y5YA 1PEZA 3LZPA 4JDZB 2X28A 5JO5B 2VW7A 5GRUL 1T5WA 4Q6KA 1A6ZA 4B60A 1JZHA 1OF2A 1GKEA 1IEHA 4EQ3A 3ARRA 1KLUB 3C2AL 4N5EC 3OXSB 4PBVC 3FCBA 3V5KA 3HUJF 3HG1B 3Q43A 3BZEB 3H56A 1TZGH 2CA3A 1GZHA 4XNAA 4KMTH 1JYNA 4O5LH 5LQBL 1NC4D 3SDCB 3SDAB 2ZXAA 1YNTF 3GSNA 1KBWA 4WU5B 4W9HC 2VIRA 4F9LC 4AUUA 2QPDB 3MRJB 3EBAA 4MA7H 4PJCA 1I7TB 3LSOB 4QRUB 4ETYA 5IKCB 2X9WA 2ZWLT 3HFFA 1DVQA 1T66D 3AT8A 3TTSA 5TGBA 4LLQA 4M1DH 4JX0A 1A5FL 3MRPA 4ZMTA 2FHBA 3FMGH 3OG6B 1XIWB 4A6YB 1NFIA 1O9ZA 2OFQA 2PWDA 3MLVL 1S3RA 3QDGE 1TYEB 3L1EA 1NEZB 4GXUM 4EQ2A 2BMKB 4HUCA 4FNSA 1ZS8B 3L3OB 4APQD 1J5HA 1BZDA 1ZA6B 3FH7A 1WWBX 3G6JE 1ZTXL 1X5JA 3WNMA 3T6QC 1AH1A 5DEJA 2OW7A 4HKJB 2KMWA 2VDPH 3HN3A 4LDEB 2E6PA 4H25A 1WJ3A 4YDNA 1C12B 2MHAA 3TNNA 4WHTA 1YY8A 3FUEA 5D2NC 3MRDA 1CG9B 4OLUL 3TWCH 4KK9C 4MD5A 5H4ZA 1E2WA 3KE0A 4FGMA