1UOWA

Calcium binding domain c2b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycoprotein
molecule keywords SYNAPTOTAGMIN I
publication title Crystallographic Identification of Ca2+ and Sr2+ Coordination Sites in Synaptotagmin I C2B Domain
pubmed doi rcsb
source organism Rattus norvegicus
total genus 34
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1uowA00
2QZ5A 2WXKA 2WXNA 3GPEA 2ENQA 3PRZA 4ICXA 2WXHA 1CJYA 3ZVVA 2KI6A 4JPSA 4ANUA 3ML9A 1E90A 5H4YA 3M7FB 5T8IA 3SD5A 1QATA 3L17A 5CCGE 2CJTA 1RSYA 2EP6A 3PS6A 1E8WA 2CHZA 1W15A 4F1SA 4TV3A 2NQ3A 1TJMA 2DMGA 2WXLA 2CHDA 4LCVA 3KWUA 2UZPA 4DNLA 4FHJA 4QJ4B 4OVUA 1GMIA 4WEEA 2JQZA 4ANVA 3F04A 3FBKA 3L4CA 4XE0A 3W57A 1BDYA 1UGKA 2V4LA 1W16A 1RLWA 3P2BA 2B3RA 2NCEA 4NPKA 4WWPA 4FA6A 4Y1TA 2A5UA 4Y1SA 3W56A 2FJUB 3DPDA 4EZJA 3APDA 2YRBA 3QAQA 2K8MA 1TJXA 2CHXA 3L16A 1E7UA 3OAWA 1DJXA 2X38A 3OHMB 4IQHA 4J6IA 4PS7A 1DSYA 4URKA 1E8ZA 4FHKA 5JHBA 5KJ7E 4HLEA 1E7VA 4V11A 3CSFA 4KZCA 3TWYA 3QR1A 4A55A 4BGDA 1DJHA 2BWQA 3IM1A 4FLHA 2DMHA 3HIZA 1RH8A 2A4ZA 5CCHE 2N1TE 1DJYA 3APFA 1YRKA 1DJIA 4WAFA 4HVBA 3ZIMA 3L9BA 3FDWA 3L13A 3L54A 2WXQA 2RD0A 4LT7A 4GNKB 4PS8A 1DJZA 4EZLA 3KWTA 2K4AA 4NS0A 4EZKA 1K5WA 1WFJA 5H4ZA 3F00A 3L08A 4NPJA 2K3HA 3RDJA 5CCJA 2YOAA 1BYNA 3IBEA 3HN8A 3QR0A 4WWNA 2K45A 2WXJA 2WXFA 1BCIA 1DJWA 3QARA 2CJSA 5G55A 4OVVA 1E8YA 3LJ3A 3APCA 3ML8A 3ZW3A 4ICWA 4FADA 5EDSA 5JHAA 4FJYA 3R7RA 2Y3AA 1DQVA 4BFRA 4XZ4A 3NSJA 2WXPA 4L1BA 4QJ5B 4G11A 3QJZA 2WXOA 4XX5A 4DK5A 2CHWA 4LDCA 4MJJA 2CM5A 3B7YA 5G2NA 2Q3XA 2WXIA 2Z0UA 4IHBA 3RPBA 2CM6A 2WXRA 1A25A 4WWOA 2R83A 4FULA 3F05A 3QK0A 4L2YA 3PREA 4KITB 1V27A 3ENEA 2ENPA 2NSQA 3N5AA 4L1LA 2LHAA 4PS3A 4TUUA 3T8MA 3R7QA 3TL5A 4QJ3B 2QZQA 4ANXA 1DJGA 4F91B 3DBSA 1QASA 3TJPA 1E8XA 3CSTA 2WXMA 4TS6A 4L23A 3S2AA 2ISDA 3PYCA 4QAMB 3PFQA 2Q0ZX 4NP9A 1HE8A 2FK9A 3HHMA 3JZYA 4KZ0A 1UOVA 4ANWA 4F93B 4F92B 4AOFA 4FJZA 2ENJA 3NZSA 4GB9A 3NZUA 1WFMA 4AJWA 3MJWA 2ZKMX 2D8KA 1UOWA 3F01A 2WXGA
chains in the Genus database with same CATH superfamily
1SPDA 2BOBA 4P2OA 5I1HL 1NSNL 1NC4A 4X8GA 5KYXA 1MLCA 4L4VA 4KWUA 2ZG1A 2YBGA 3LZLA 3P77A 2OZ4H 1FC1A 5IHUL 4GMSH 1A3RH 3FL7A 2AEOA 3J2PA 2DQTH 4GUPA 3TPUA 4F2ME 1QQDA 1CDHA 4XBPB 4AT6A 4DO5A 4O02L 1CDBA 1DN0A 5EC1B 3OR6B 4HOXA 1MJ8L 3LZOA 3EXJA 1ZOXA 2E9BA 4QRQB 3TBYB 3BVUA 4BH7A 2BK8A 2G4GA 2PYEB 4BCXA 4HD5A 4BFOA 1G9NH 3NSXA 4NT6B 2EUZA 1R4XA 3WO3B 5C08D 2R0KH 2VXVL 3GTNA 3M07A 3ESVF 3EBIA 5KEZA 1N12A 5C0AD 1E27B 4LDEB 5D1XA 2W92A 1UM6L 1OP4A 1JDCA 1I7TA 4DEPB 2IEPA 3QPKA 5EU5B 3WMPA 3TC9A 4IHOA 1NM9A 4PREA 2FJHA 3IDGB 2KS0A 4JHBA 1JYVA 4EVNB 1LDPL 3FFCE 2OS7A 4KKCC 3EDFA 3O3BA 3ISWA 5EBWA 4A55A 1CE1L 1GSKA 1KELL 1MVFA 1CVRA 4LIQE 3ZDZB 4XODA 1NGZA 3LPFA 2G0KA 3B7UX 5CN2A 4LE8A 3K6FA 5ESAB 5JR1H 2K4AA 1J0ZA 4GAAA 5JW4Q 3HN8A 4TKWA 5FOBA 5DR5L 3DX6B 4XN9A 4AYFB 1NAKL 4WUKL 3IDMB 2JV6A 1ND0A 1PL3A 3IDNB 2ZWZA 4JS7A 1O0VA 5E8NA 4G5ZH 1C12A 3SODB 1UXWB 1KOAA 2WWKT 3HVNA 5JUEH 1SEQH 1Z6JT 4AQZA 4G11A 3OHXA 1I4FB 1NBZA 2VXQA 4FYTA 1PU0A 1XD0A 1O5PA 3C2AL 3CDYA 3LZFL 3QUMH 4ADGA 4MQTB 4F37F 5E8EA 5KBLA 4P2RA 1CI5A 3EZJB 3PP4L 4FMVA 1WRFA 4LDLB 4JLRB 4YDKH 1SHWA 3WIFA 2FX8H 2Q76B 1E8XA 4UUJB 1LMIA 1AP2A 4Z3IA 1QI4A 3P4MB 4FXGA 3RILA 1NQBA 3IJ9A 1J8HA 1VFAB 1TTRA 1L9PA 4DZ8B 5LN4A 1KB9K 1WA2X 2H6UA 2VB5A 3ZUNC 1MFCL 4JZOA 3MRMB 3PNRB 5FR3A 4K23H 4ZFFA 1IC5L 2ESVB 2YEZA 5DQ9A 3S3JA 1MJJB 1EJ6A 1CR9H 2UXGA 4QYOA 5IMMB 1DQLH 3FT0A 3RGHA 4O02B 3MDJA 3PS6A 4MNQD 3STZB 3VUAA 3WUWB 5I24A 3QXDB 3H6AA 3UO8B 1JK9B 1T3FB 2WZ6A 4PJ8A 2J4WL 4LHUD 5FYJL 3T3MB 3MI6A 2OK0H 1ZVNA 2IG2L 1ZHNB 3Q1SH 5A1AA 5SWSD 2VDOL 1UHVA 3LXUX 4NZTL 5B1JC 1S7XB 4NHUA 2FTAA 5HDRA 3GI8H 1MHEB 3ZDXE 2V4LA 3FKUS 3FB6B 4QRBA 1EZVY 2EYSB 5AOIA 2P4AB 2AABL 3QXVA 3W81A 5JQIB 5C0AA 5JHMA 2CU9A 4PJDE 5F6HJ 2YMTA 3O2WL 4M1GH 2HPTA 4XAKD 3LKRA 3WTTA 5T3ZD 2ZD0A 3B3BA 3BDBA 2G2PA 3EFFA 3GINA 1SY6L 3Q6FA 4GBXC 2Q6WA 4UB0H 2NUTA 3U9UB 3CFKA 4I18B 2WCSA 4XWGL 5D7IA 4Z77A 3CSFA 2J8OA 4EQ3A 1GW0A 4K9JA 5AW8B 1K4DB 3X11A 4OT1L 5EG6C 2WKGA 1V3MA 3NJJA 1UWFA 3FOLA 3RIFK 3VXUE 2R1WA 2E7MA 1XGUA 3Q2VA 5BUAA 3DOSA 3KLHC 3LB6D 1E4KC 3TLRA 3L08A 4ES8A 3TCXA 3DMMC 1PEWA 5TH2A 3HG3A 3HTLX 3VCLA 5C0EB 4LPVA 4R4ND 2BSSA 1KNOA 4FFVD 3C60C 3HEIB 1KG0B 3OAZH 3MACL 3LXAA 4ERSL 3KBPA 1NCWL 3U4EB 3SPVB 4DERA 2EICA 2WBJA 1R3JB 5HJBA 3KJ6H 2ZCZA 5EZIL 1BVNT 4G70B 4I85A 1CFVL 2FQGA 3B2VH 3RUGA 4FQLL 1UXMA 1MW0A 1YO4A 4PTUA 5FF6A 4KMLB 5M7QA 1WF5A 4WHCA 2V9TA 4MA1C 3GMNB 5GZOA 2CIIA 3QQDA 5F96L 3FSZA 5FYKU 4LOUD 2F15A 1XIWD 3HS8A 3HZ3A 4JW3A 4Z7UE 4OQ1A 1UENA 4X6FA 4AEIH 4BK8A 1E3FA 2LW3A 3K46A 1IJNA 3QUYC 1IEBA 4PRAB 5TE4H 4L3EE 5I1CH 3CLFH 3ZVVA 4E2OA 3X17A 5J4MA 1KN4H 1COBA 1S9VA 4MNQA 3HCVA 4HWZB 4E41D 4Q97A 4NLAA 4ZDHA 4YSCA 3CXHK 2CJTA 2MFNA 4RSVA 4I0PA 4PVBA 1CU4L 4AYGA 3VWJA 1MW1A 1UB5B 4KTEH 3DUUA 4YSAA 5LXVA 4ZX3A 3QQ3B 2VDOB 4D0DA 3OMIB 4PJEF 4RESB 2MOVA 3CDGA 5TDOB 1ZTXE 5SWSA 1UD3A 4G7RB 3SB3A 1O5DT 2OSYA 5EOTA 3ARFA 1JSYA 2ZXCA 1KCVL 4Y88A 1SVCP 3RI5F 3VA6A 3I85A 4HKBA 2E7LC 5KG9A 2FHCA 5HHXH 2E3VA 4PR5B 3FU3A 3HMXL 3PGDA 4UM9D 4DEWA 4UNIA 4AVHA 4RMRA 3T2PA 1N4XH 5BS0E 1KGCD 5I8CA 4JREC 3EFOA 5FUZL 4BZ1A 5ISZD 4NC0B 5F3BA 2K6ZA 3S96A 4DK3A 5A2AA 4FTVB 2M1KA 3SPGA 1PAZA 2H8PB 3CQFA 2HMIC 4BFGA 1KTJA 5LBSA 4YBHA 2VM3A 2WVVA 2B1AL 3HVDA 1J12A 4HCRL 4NQVB 2NSXA 4N2CA 4ZMOA 4PBWD 2IO5A 1T1XB 1IM3D 2FEJA 2GTQA 3RWHA 4M7LL 3UZQA 3DIFB 2F54E 3D0VB 2H3XC 4HMCA 5HJ3B 2OMVB 4P49A 2HFEB 1IZJA 2KQNA 1D2PA 3BAKA 5CP7B 3F62A 4ZTOH 5BMFL 3IE9A 4WW1B 4OLYH 5D72H 3RWDA 3IMUA 4JZNA 3QISA 1WHOA 4N2NA 2ZKYA 1MQKL 4XB3A 3UDWA 3LNEA 2BP8B 3INUH 3IVKB 1CD9B 2N7SA 3BEWA 2VR5A 4UZGA 3KYNA 5T1KB 4Q9QH 1GL4B 1UKQA 1G5GA 1S7QA 2NXZC 1AZNA 5GXBB 3HG2A 4HGWA 4DK5A 4F2MB 5TTRA 4XVTH 2D03L 1PD0A 2C9SA 1SMOA 3ARDB 3HBPA 3K8MA 3I6KB 1FFQA 3ZE1F 4CILA 4WNJA 1LL1A 4XVSL 4H88L 5AWNL 4ZMTA 4BKLB 2Z31A 2NXYD 5DJAA 1FNLA 1XIWA 3VG0H 3VG9C 3I02A 4YQXH 1U2CA 3LRMA 3ALPA 6FABH 3TT1H 3ULVF 3KGRA 3S34L 1QWNA 4P4KD 1SLUA 4MMXA 1SJHA 1IBDA 1LK3H 4P3CH 4FZEH 2B0SH 3QDMD 1QVOB 4MA3B 4HOZA 5KVEH 2G75A 3IAPA 3IPFA 2I7OA 1U8MA 3PWVA 1ZVYA 4NQSB 4ZXBB 1BFOA 4XP9H 5AW5B 4ADJA 3FFCB 1B0IA 5HI5D 3LPGA 3V52L 2V3FA 4FFZA 3UMNA 2ADFL 1BBDL 2VR4A 3CZLA 2XN2A 3K2MC 3RPIA 3L4CA 1T22B 4LP8A 2GKIA 3B1UA 1XSKA 2A9AA 3I75B 5D5ME 3PGFL 2QSCL 3GMRB 2Y3NA 1NUGA 3WEOA 5AVTB 1M3JA 2V9QA 2J88L 3O9WC 2FL5B 4N8VA 3ABZA 5IR1B 2C8NA 3QAQA 2K1MA 1N7ML 3IXTA 2R15A 5T3ZH 1JFQH 2BNQD 3IPBA 3LIZA 2VWEE 5IB5A 2KZBA 3RVWC 1F6AA 2QV2A 4GRWF 4X7TB 3GXPA 2TSBA 4OZGA 4WV1A 3CBRA 4K8RL 3L1OL 3RAJH 2HSIA 3Q7JA 5J1SC 1CL7H 3GBEA 4KZCA 5AW6B 5IHZB 4IU3A 1IM3A 1KGXA 1Y6NR 2OSWA 3VFVA 4BDVA 4U7SA 1I3RB 3W9EB 1UOKA 4AXWA 2COQA 5MEND 1B9KA 4PJFF 5DMGD 4ALAH 2CGYA 4ETQB 4UM8B 1P4BH 3X1BA 2HRPH 5LG6A 3VW3H 1E65A 5MHSD 1TJGL 1UD4A 3IDJA 1BW8A 1WCQA 4OFKA 3MVSA 1NDGB 3CCHB 3X3FL 1LQSR 2IPTH 2CNZA 1ZPUA 4UAHA 5D7LE 1E43A 1IAIL 1BBJB 1GMEA 2EXTA 2WBXA 1U30A 2WXPA 2WNKA 3DDFA 3LIUA 2PCYA 3MOAH 5E03A 3UJJL 2EACA 3IKKA 3MCYA 4GMTH 3G6AB 3AC0A 3TCLB 2NYZA 2Y9RT 3D50A 4L48A 2JKXA 4QGYA 3F05A 5IFJA 5GZNC 1HWWA 2D7QA 4FQHA 4AENA 5HYQB 1KLGB 2IQ9H 4XCFH 4Y9FA 5HGBA 1VESA 2FGWL 5AW2B 2IFGA 2R1XB 2F9BT 1EUUA 1F4WH 4RFNB 1BZ7A 2BSBA 4M9OA 2G5BB 1ZD6A 3B6SA 1L6ZA 1G7HA 5GIRB 4OD3L 4PGCA 4QWWC 3ZDXB 3EBAA 4P4KA 5DI8A 3KVQA 3OKOB 1EHXA 3GMQB 3FT4B 1TEYA 3BUYB 1OM9A 1O9VA 3TV3L 3F7RA 3GHBH 4JQIA 4J3UA 4EE2A 1KFAH 3WTYA 5IJVB 4J2XA 4F1ZA 3P1VA 4GXVH 2JKRM 1SM3L 3GEWB 4EIBA 3NFSH 3FPYA 1UFGA 1VIWA 4FHJA 3POHA 4JN1L 2F7RA 3MRDB 4HFUH 4XCCH 1Z3GH 1AY1H 5GHWL 1DVFC 1CICA 3B83A 1XH1A 3OKLA 4IRZA 2V6HA 1DANT 1B4JL 2DDQL 3IWVA 3QXTA 3VXUB 3VGHA 1PSKH 2W38A 2QGBA 4UILL 4R4FL 5GRUH 3ZRSA 1RLWA 1VLXA 3UYPB 1H8NA 4K7PX 5FA3B 2JKSA 5HPOA 2WWKO 1O6TA 4DGIH 4MMYB 1FAIL 2R7EB 4QLRA 5CZVL 2BNQA 3CVCA 3SPIA 2BCKA 2MCAA 1X6NA 3IDXH 3E38A 1FLRH 4N5EC 3S36X 3WKPA 5GGQL 5C2UB 2OMZB 4N2MA 3CVDA 2WJ7A 3FTSA 3C5JB 4FOMA 2I60L 2ORBL 1EEZB 4J6IA 4HJIA 5K9OB 1JZ4A 3BHBB 4Y19E 3LV3A 1MN4A 1N19A 4WHYH 1CBVH 4K3JL 3BW9B 3APNA 5DVOA 4FQQA 4GUOA 1ET5A 1SHMA 3NK4A 2Q8BH 3GSRB 5MENA 4MNGA 3OPUA 3J07A 1WIOA 3QE5A 1IAMA 5DU7A 2IGTA 1K8IB 5JO5B 1F1AA 2EZ0D 1GAFL 3D18A 2ZCHL 3I50L 3SBRA 4PBXA 1YUKB 2ARJQ 3CSGA 3BP5B 2ZX8A 2HTKD 4Z7UB 2B77A 4HHAA 3D48R 1M7DA 1E2WA 1S8DA 2WNWA 3U36A 3U2SB 1SF3A 2CJSA 1X9QA 4GQRA 3K6IA 2RH0A 5LAPA 1VJSA 4L3EB 3RWFB 1IKFH 3IAQA 3SZKC 2BP0A 1FH2A 1WFNA 4FQPA 3BAIA 3KH4A 3L4XA 3MODH 4M1DL 4YHMH 5EBMB 3TBWB 3N1GC 2X0VA 3IGAB 2SODB 3UEQA 2OMWB 4JPQA 2X9WA 1Q38A 3DURA 4PRHA 4I8DA 1M7UA 5J56B 5CGTA 3ULUL 4E9XA 2AVGA 4PY7A 4YSPA 3W0WB 2O4EA 3CQPA 4PGDA 5F7HA 1G87A 1KXQA 1A6ZA 4PS3A 1GA2A 1KT2A 1N8ZA 4G6ML 1WV7T 2AJSL 4HIHA 3T09A 1NUNB 3D39E 4L23A 1E3ZA 2VLLA 1LXMA 4WZ9A 1N0LA 3TT3H 4JFED 4Q52A 1E0OB 1QLEH 1GPOL 2A9CA 4Q9RL 1RHFA 5FGBA 5AVSB 5HDWA 4R84A 2VJ0A 1OCZB 5BS0B 5I8KL 4YBQC 3VFRB 3U6RA 1WAAA 1VPOH 5ADOL 1XGYL 4B9KC 2X6VA 1WHPA 2E9JA 5MERB 2YD8A 4N25A 5LNDA 3AQYA 3AU1B 1J05B 2ICEC 1HFUA 3W1ZA 2VDKB 3Q8FA 2XICA 4LBAA 3NT0A 4JAMB 2W81C 1ZLDA 3UZEA 1KCKA 2F8IA 4HD9A 4I3RL 4PJCA 5SX4H 4WKZA 1XGZA 1IGMH 1A7NL 3HJ0A 2F54B 1ZWIA 2EYTA 4Y2OB 3T6QC 3QVAA 4XGZA 3SKNA 4JFOB 4A2EA 4LRIC 5ADPH 1SYVA 4K4KA 4H8WH 4GP8B 4N68A 5B39G 3M7OA 2QL1A 3QQXA 4U1HA 5EF0A 3GUTA 1DLHB 1FZMB 3HNSH 1DP0A 2DYRB 5FKPB 2B1HH 3N91A 3CDZA 3AADB 1V05A 4ODSL 3EYUL 1G7IA 2DQCL 3GLEA 5HVWA 3BN9C 1KBVA 4JMNA 1QNZH 4F7TA 1AE6L 5T1LA 1ZS8B 1S7WA 3AFLA 3FUNA 5KJ7E 3EO9H 1HAUA 3KBEA 3PWPE 4KK9C 3LOWA 4URTB 3PPSA 4G8EB 2WVTA 3RWJB 4U1IA 3MNMA 4Z78A 4RZCA 2YJLA 1ORQB 2ZXWB 3IFNH 5I30H 1JGEB 3SDAC 2AJYL 3TBSB 5CFAA 4M6MH 3C08H 1KPVA 5FLUA 1QG3A 3RWIA 1I1AC 3SDCB 3OR7A 5DJ2B 3ZSSA 4I1NB 1TZHA 4FG6C 4OCNC 5I23A 1T7YA 1HHGB 3NSYA 1CGXA 1NPUA 2YD2A 3LMJH 5IB3A 1IGCL 3NZ8A 5ERWA 4Y9CA 1SXZA 4ZOCA 1WFIA 1NGQH 1R17A 3TA4D 1JZHA 2UV3A 4Z5RB 2FX7L 4I18C 4WDIA 1JPTH 4XCNA 5E5MA 1JPST 3HC3L 4FA8A 3QFJE 5KBPA 1FO0L 2VXUL 4PW9A 4N2AA 2ZOTA 3GT6A 2W9DH 4ZPTB 4L2YA 2D31B 5BO0D 1ZKAA 3P3RA 1I9RH 5IBTH 5JDSB 3SDXE 3PDDA 4A2DA 3KWWA 3QZMA 3WMSA 1N9PA 4YR6A 4DVBA 3WY2A 3D87B 2J5LB 3LNGA 3UL4A 2P9RA 3PFQA 4TUOA 4NP9A 3TO2B 4JPWH 2MQ3A 1BAWA 3HLAA 1TZIA 3RP1A 3Q06A 5JXEA 5EU6E 4WNSA 1ANUA 2RALA 1T83C 3COOA 2ZSWB 4JQVC 1WVZA 4NO0B 4YDJA 3MRJB 3P2DA 4PV8B 4ETYA 3GXNA 2ICCA 4KNTA 5B1KA 4PY8I 3GXFA 2RFXA 3V6ZB 1ZIAA 4HKJA 4EI5D 4LNRA 5DYFA 5A40E 5DUJA 3KYAA 4YE0A 5DVLA 4UOZA 3K6DA 4H40A 3GFUA 3RKPA 1QP1A 2NW3B 5E2VL 1NCAH 1OE1A 3JWOH 4U6YB 4FN0A 4EXKA 4GBXD 4H13C 2QPEB 4DCQA 5KYWA 5AB1A 1BZDA 1CWVA 1R3LA 5ID1A 4Z7VE 5EIIA 3VFSB 1BMZA 1GMIA 2EABA 2IAND 3MMEA 1IGTA 1YEWA 5C0GA 3D3VA 3ARGC 1GCYA 2VITA 4LDOB 1IM9A 3WJLA 3B7RL 3L3IB 5CD3B 2NYYC 5E94A 4R3SA 5LXGL 3RTLA 3JTTA 3KLHD 1EZUA 1DL7L 3CFMA 1YN7B 5B22A 1VDGA 2Y23A 4Y1AE 5DD3L 1TITA 4YHNB 2XWJA 1D7CA 3OQ3B 1MOEA 2W9EH 5EC2A 2EVGA 4N87A 2I07B 1T0OA 3Q8AA 5D7LB 5CLXA 3FT2B 3S37L 4PD4J 4NN7C 3NTCH 4X6CB 3NSCA 1BQHG 1HQ4A 5EN3A 3A0OA 5BZWB 3BGFC 2VMJA 1S7TA 1P84J 1UURA 4KQ3H 3QIBB 4HBQA 1NTDA 2BLFA 3BP7B 3LQZB 2QGCA 3HIZA 4GYBA 3MR9B 2GJZA 4HU2A 1R19A 3Q2CA 1SBBA 4NQEE 1UCBH 4OJFH 1JK8B 4RMQA 1OTSC 1SEBA 3VGEA 4NENB 4WI8A 1S9YB 4OJEH 1A9BB 3C75A 3BVVA 1MIML 2JB5H 3GTVA 5DJYA 4WI6A 5C0FA 1MCKA 4BA0A 4JG1L 4XNYH 3M1BB 4NFBA 2VUYA 3CE1A 4PJIA 4XHQA 1FGNH 1RP9A 4FGMA 4NNXA 1L3WA 4OGZA 5CEZD 4ZMNA 2WXFA 3NEEA 5GGVL 3G6DL 4JFQB 1J0HA 4PJ5E 2YLHA 3E80A 3QUYD 4H5SB 4V2BA 5F7BA 5A7BA 3TS8A 1ACZA 2DLEA 1NINA 2QT6A 4ZW3A 5ICXB 1NOAA 4JN2B 1MW2A 3VXQA 1GTNA 1HJBC 2XVGA 4OLEA 3L3KA 5IQ7L 3GO1H 1BD2E 4L8SA 4JZJB 2VDNH 2B9AA 4WFGE 5C0BB 4PRID 5C07D 2DLFH 2IF7A 1E5AA 2A74B 4RLDA 4S1SH 4D9QE 1I8LC 3NBNA 1P7QB 3NCWA 4LQFH 2ZCKH 4ODXB 4OZHE 1G7LA 1LO3H 2E4TA 5D7KE 3BPOC 5IOPA 1NCCL 4NOFA 4D8PB 2IDSA 2VR3A 3ZYJA 1CZ8H 3NRQA 3E6HB 4DP4X 4EI5A 1G1CA 1YNTA 3JV0A 4FNLH 2R8SL 4LESA 4ICXA 1UEYA 1YC8A 5E8OA 1MHCB 1MNNA 4OSUH 4MRCA 1HEZB 4WEUD 1BLIA 4Z3GA 1SF5A 4JCMA 2CHZA 3ATFA 2C9PA 3QQ9C 3JWNE 4Z95H 3ARDC 3BWSA 2HMID 2X4PB 2J57A 5EF1A 1T66C 3HZKB 3V9FA 2W5PA 5PCYA 1O6SB 3NCXA 1SOKA 1U3HB 1IE4A 5F8QC 2JKWA 3L3HB 3PUUA 1E5BA 4U1MB 5EUOE 3B2XA 4KK5C 4PVNA 3VGDA 1OGTA 3GBLA 4BFJA 1D7DA 1BWMA 4QRAA 1AXTL 2XWBA 2DD8L 4IRJB 2DQMA 2N7BA 4FEMA 1U58B 3MRQA 3JWNG 2FBJH 4FXKC 4L8BA 5KVFE 1XF4A 2C7UB 4C59B 1RULL 3O3DA 1PLGH 3GXTA 2ZPKL 3ILPA 3IMTA 3MKKA 4HCIA 4QHLA 4U3SA 4ZW5A 5DFVC 2CHXA 5DRXB 4FD0A 3GIZH 3RA7H 4ZXBC 2ZXAA 1EANA 4YXKL 1CF8L 3G3LA 3QDGE 4QNPE 1IAOB 5D2LA 4XP6L 4Y5XA 2UXTA 4WI7A 1A8JH 1XGRB 4NUGH 2NXZD 5IMKA 3HI1A 1RVFH 1CLOL 3FRUB 3KPLA 5KS9F 4PY8J 1IEHA 3MRNA 3QORB 3KGTA 4N0RA 5CU5A 3TO4B 1DUZB 2VUKA 1U0QA 2HVJA 4G7SB 4TVPE 4UZUA 2VDRL 1WBZA 3L54A 5DEFB 1NPJA 4Y7OC 3KE0A 5FECB 3WFHA 3H56A 1PZBA 1QFWL 5TPWL 3L3GA 1UXSA 3GQFA 5SWZA 1XZWA 1RUQL 3O3EB 2OXGA 3K4DA 3GMMB 4YX2H 1FC2D 4RFOH 5JQ6H 1HYSC 4HLZH 4R5VA 3SO3C 3FFDA 2CPUA 4JM2C 3AREC 5AOJA 4M00A 2GJ6D 4LSDA 5EOCJ 1FLTX 1FIGH 3MFFA 1AFVL 4RMTA 2Y5TB 5LDUA 2WKOF 3DBXA 2Y4SA 4LFHG 3DX7B 5FO7B 3QEUA 3F6LA 2Z0UA 4UCFA 1ZEAH 2H47C 4IHBA 3SY6A 5L9DH 4PRIA 1A25A 5C07A 4X6DA 2OYPA 1JZ6A 2DZEA 3QJUB 1D9KB 2FIRT 5GGTA 2F74B 2Y1AA 4Z7OF 3P0VL 4EN2A 3OC8A 4M93B 4HGKC 2EDDA 2WAHA 4LBEB 2OX5B 3TYGL 1UOVA 3EKCA 4OCYH 4EIGB 1KCBA 4IW4C 1YEFL 3LHPL 1BMGA 4MA8H 5BQ7A 1QEWA 5L2KD 4E9RA 4OGYL 1RZQA 2QGEA 2XZQH 5KVDH 4B0MB 1M53A 3MBWA 2BNUB 1BZOA 3O9WD 1RZPA 4ZOAA 1BX2A 2VLJD 3FQTA 3MA9H 4JHAH 2J8UB 4OF0A 5D8JH 4F80A 2QPUA 4UQCA 4NM4L 5HI4C 2W0FA 2MTPA 3CUPA 4LEOA 2WXLA 2R59A 4AMWA 2VC2B 2PABA 4IJ3C 3MV7D 3PWPB 3A21A 4M7KL 4MS8C 4N2FA 1DVZA 4AI7A 5K59F 5K33A 5EU3B 1Z9SB 3OG4B 3QH3B 4D3CL 1URZA 3FBKA 4F8PA 3K72B 1CFSB 4G9FD 4MJ6B 4MSWA 2H1LM 5E2UH 4W9ZA 3T65A 2R4SH 1FFRA 1GYCA 4GFXA 1E5ZA 3MNDA 2FATH 2WD0A 2VM9A 4WI9A 4YMPA 3AT0A 3HE7B 4GAJH 4CNIB 5BNXD 4DKEL 1O7DE 3ISRA 3SGJA 1Q4NX 2VXSH 4HEPG 1ZV5A 4OJYA 1YECH 4DETA 5J9PA 4RAUA 3E8UL 3LDBB 4NNPL 3ZKMC 1W72L 1BMWA 2NQCA 1T2QL 3F6JA 3QO1B 5D2NC 4NGHH 4XX1G 1U3NA 3CZKA 4KGLA 4ZMLA 1PD6A 1QA9A 3SJVE 5TGBB 2WUBL 3QFJB 4JGJA 5AW7B 5FCSH 1DEEB 2VDRB 2YPVA 3X1GA 4NQDE 4Z0XA 5HHOB 2WV3A 5TE7L 2E6JA 3DX2A 3FB5A 5B7FA 1ED3A 4HZ1A 3DV4A 3SGDI 2FYYB 2P5WD 2O30A 5I2IB 3SDXB 1C5BL 4G9DA 5DD5L 4OLWH 4CGUB 5C92A 1DO6A 5CEZH 2BP3A 4M62L 3UIYA 3IGUA 4M02A 4U1NB 3MRLA 5DZPA 2GJ6A 3F58L 5KJRL 4QI3A 4JQXC 3OKNA 3ZL4H 1AQHA 1E8YA 4QTIL 4RMWA 4IS6A 1EFXB 4FQIL 3V5DA 4UNVA 2GTWB 5JOFA 4Z7NF 4HDIB 2R9HC 4WUUB 3FB8B 2WGXA 3OLEA 4N1CA 5IUSA 1IT9L 1E9QA 4I4WA 4TSAL 1FYTD 1KTCA 2XWRA 4JRYE 4RFEB 4DT2A 4P05A 4Z7VB 3WXVL 1J1OH 1R47A 3QEGH 3RNQA 4KRPC 5F7EL 1UG9A 4KVNH 1W8EA 3H9SA 4PMEA 1BQHB 1W9XA 2R69L 1BQKA 4F92B 3QEQA 5JPNA 4DSYA 4E9SA 4F7EA 2HLEB 5IV2B 3FJTA 3V5HB 2HP4A 1P7BA 1T20A 1NCHA 4LCUA 2X6AA 2WXKA 2P45B 4AIXA 1CXFA 4XO3A 4UTAA 4YDVB 3O3AB 4Y16C 5KVFL 5AZEH 3RIKA 4YHPA 5DD0L 3FH5A 5AVRB 4JM4H 3VXTB 1CG9B 4WI0B 2IBGA 3Q44A 4ONGL 2P5EE 3BWUC 4HJUA 3MV7A 3SD2A 2NY5L 3T0EE 4OV6F 5CILH 3FONB 1INDH 3EJSA 1BJ1H 4RNRB 4NQEB 1E4XL 5DJDB 4ZD3L 4QF1B 1SQMA 1SMAA 4NFCA 1JZDC 3NZHH 3D4CA 2F7OA 3EGSA 3FN0H 1M57B 4TVPL 4GINA 4QHNB 3TURA 1W72B 5IG7B 3ZTCC 1MVUA 2YRBA 3T8XB 2GBVA 3CC5A 2FR4B 2ADIB 1KIQA 4PJ5B 3BIAX 3WKYA 2ZXEB 3CHOA 1RL1A 5AVVB 3P3SA 4YIQA 4ZPVA 4OV5B 4F7PA 4R9HA 4HPYH 1XF5B 3G6JA 3V4PA 5K9KB 1VFBB 3A4AA 4OIIH 2PYFA 2Y22A 2FH8A 5C9JA 1WFTA 4NDMA 1HXMA 4U31A 2H45A 1MWAB 1M6OA 4XOCA 1OGAE 1BD2B 2W0LA 2YPVH 3EJUA 3U4BH 1LO5B 2P5WA 3GB7A 2OI9C 4ODVL 3QHZH 2YA1A 4PG9A 4AQ8C 2A9BA 2OPCA 3QHFL 1JI2A 1E28B 1A4KA 2GUOA 4OZHB 5AYUH 3HAEA 5IMOA 4IBTA 1ORSB 2BIQA 3Q01A 4Q4IA 1QTPA 5EU4A 4X4YA 3C6EA 4HIJB 1I8MA 4K9EL 3GSVA 4G8GD 4N0FA 2IIJA 3RVTC 3I6SA 1MUJA 3BAWA 4HS3A 3SBWC 1BSIA 2ZUYA 4OLZL 2G3MA 4YBQD 4AEFA 3CH1A 4YHZH 2J71A 3RFZC 1JRHI 1D5MB 3AG1B 5KAQG 4E5XG 4XX5A 2ZUTA 4D8OA 3B2UD 1KXVA 1S78C 4IM8A 6CGTA 1K5NA 2NY7H 1JXFA 1FORL 1FZJA 1YQVH 3BO8B 1V27A 4K3DL 4GW1A 3KBHE 4HXBH 1KBKA 4LSTL 3ARQA 2UX7A 1MHPL 3DA0A 3QCUH 2F5AH 5EUOB 5C0RL 1U2YA 3QZOA 4JO4H 4ZUTB 5TQ0H 1UZ6F 4M5YH 5E6ZA 3SDCC 3FT3B 1ZT7B 1F4AA 4LAJH 5DS8A 3ROOA 4C55A 3MAWA 5I6NA 3AT9A 3ZR5A 1JMXA 4WHTB 1AGFB 4JPSA 1B0GB 2DH3A 2Y06H 1K8DB 2B5IB 3A4DA 4HJ0D 4E42B 2EDXA 3OMZA 2VR9A 4NZUL 2ESVD 4XPGH 5A16B 1WAPA 3QDGB 5D7SH 3BN9D 4XBPA 3ZTNL 1QSZA 1KWKA 3NA4A 5C1MB 3KGUA 3OR6A 5IROC 5MP6L 3VTMA 4LKCB 3OLIA 4J8QA 4KK9D 3IAGC 4QRRD 1C08B 2XETA 2CKNA 4FF9A 5ITBL 4QRQA 2VO8A 1NGWA 3TBYA 1CXIA 1YZZA 1KWGA 2PYEA 4TSCH 4NT6A 3ZHFA 2WN3A 4E0RB 5C09E 1D7FA 3SYQA 3APDA 3L5JA 1OZTG 3QJOA 3V4UH 4OCSH 4DP8X 1E27A 5C0JB 2CGRL 2BXYA 3X1FA 2DQUH 2WY3B 3C9NA 4MWFB 4U1KB 1A0QH 1N3NB 2XVBA 5EZLA 5EF3A 4PVLA 3DWTA 3ILQC 4R26H 4IMLB 3W2DL 4GIAA 3E3QC 2VDLL 1EQWA 2O6FA 1HC1A 3QDAA 1FUNA 2QLYA 2HJLB 2PR4H 1B6UA 3LKOB 3NJLA 3QS3A 5DUPH 1T2XA 3TF7C 4XNZB 2YXWA 1HNGA 2V8MA 3OZ9H 4IEFB 4FXTA 3SOBH 1JPGA 1SLVA 3ZYOA 4W1TA 3L9EA 4OM0L 1DCLA 2Y2WA 5DD6A 5IF0B 1QX1A 3FPXA 4PUBH 2C9VA 2UZXA 4ZFGH 5IESH 4I9XA 4O9HL 3HAEH 4FS0A 2BPBA 1GOFA 3SKUD 3BC9A 3VGAC 3O4OB 5DWUH 1OE2A 2IWKA 3DX6A 4P23A 4NZRH 2IH8A 3IDMA 2QFRA 4J12A 1XEDA 1PLAA 5EUKA 3TVMC 1MFNA 1B2YA 1G0YR 5KOMC 2V2TB 4L5FH 3PV6B 3TZVB 3IMVA 5JHLH 1DLFH 4HP5A 2EDTA 4I3SL 2BVQB 1ESOA 1I4FA 1UATA 4Y7MA 1LP9A 4EOWH 2WQVA 1RFDH 2BCMA 4MB5A 5AVWB 4HKXB 3WL9A 3MLSL 4FMKA 4F2EA 1KJ2A 1J1PH 2EADA 4RETB 4HUXB 3B56A 3TBVB 5K9JH 2V3EA 2BSTB 2Q76A 5T1DH 3SE3C 2OV0A 4P5KB 4S1DC 4PJEE 1SJMA 4B9JA 1VFAA 4PCTA 1GKEA 1P69B 2NYYD 3N40P 2BVOA 2WC7A 5I5JA 2G60L 2Y1VA 5LBVA 5DEGB 3CPLB 1OTTC 4GRMB 3AQZA 3MRMA 4YLCA 3GKZA 3ARXA 4E9YA 5IMMA 3TM6A 2WGNB 3P11H 1DQMH 3STZA 3RDTB 3WUWA 3QXAB 2GYSA 3OXSB 1S3KL 3QXDA 3NOIA 1KGWA 4CDGC 5K9QG 5HYSG 5FYJD 1JK9A 1T3FA 1MRFL 3FUEA 4JFUA 4NQDB 3ZX1A 4FE9A 1FG9C 2RBLA 2YK1L 2X3CA 1DFXA 1HQRB 1OTSD 4KOCA 1S7XA 5T5FH 1BGXL 3L3DB 5E00A 3IS1X 1YEHL 5C0NC 5I8OL 1NJ9B 1NGPH 5H37A 3MLXL 4OKVA 3QNZB 5AB9A 2E74C 3UBFA 4WNQB 2XPGB 1YCSA 3GBNL 3DGGA 4BE5A 2VDLB 4MD0B 5FWRA 4CVZA 3OKKB 4UNTA 2P7TA 1CLCA 3ZKSD 1SBSH 1NEPA 3U9UA 2DQGH 4PJ9B 1L7TH 2E0PA 3Q2LA 4W4OC 5AAMA 4FTVD 4FHKA 1MCDA 3GHEH 2A6KA 4LLDB 5EOQL 2VRAA 3BMVA 1XTLA 2NY0B 1CXEA 1CYXA 1KBPA 3KM2A 3VRJA 4AIZB 1K4DA 4F20A 3UPRB 4JRYB 4MA7H 4JPVH 3RWGA 2E7HA 4WK2B 2EO7A 4H26B 5EULV 4MHHI 5ESVB 1OCWH 2OSLA 3PQYA 4JDTH 1RV6X 3UTPD 2EC9U 4U1SA 3MXVH 2JCCE 3MV8E 5CCJA 2QR0A 4L29B 1TU2B 3NSFA 4YE4L 3PAZA 3A4EA 2JWYA 3EBGA 3GNMH 3ELQA 3C12A 5E4OA 4I9WD 5GS1C 3MO1B 3U4EA 3LKQB 4X2UA 3SPVA 1W0VB 2WLLA 1R3JA 5LO7A 3G7TA 4OFYD 1FZOB 3S88L 4TOYL 3GC3A 4LVHB 2P5EB 2ZSVB 3GTTA 1Y6KR 3QQ9D 1WWAX 3T0EB 1PNCA 4HWNA 2NY3B 1MXDA 1PS3A 3ARDD 3LXCA 3VTTA 3QJXA 3SKJH 5I6MA 5DRZB 1F18A 4KXZH 2MCMA 2XRAH 5BOZG 3V4VL 2XZCH 4U0RB 3F7QA 4KFMA 3QIUC 4FXLA 3VSTA 4OLVH 5I1HH 3WHE0 1E50A 1NSNH 4PRAA 2AAVA 4Y5YC 3PAYA 2BS9A 4GAFB 5E9DA 5IHUH 2XI9A 4OLUH 5DFVD 1N59B 1HKLL 4JRXA 1EZVX 2BRQA 4U33A 1J9RA 4AGOA 4O02H 1O7VA 2VRKA 3AJ7A 3ZHLA 5IHBA 1RUKL 4ZXBD 1GGTA 5HDOA 1I8AA 2E47A 3AU0A 2WSPA 3FFCD 4PJXE 1D9KC 1OGAB 1SXSA 2AI0H 3BQUA 4JL2A 5FYKL 1H6TA 5KTEL 1Z9OA 2I25N 5FM8A 4R7NB 4KKZA 1J5OL 1WLHA 3D5OF 5KVGL 1QFUH 2VXVH 4ODTL 1LTXA 4OZ4B 3V55A 4E5XB 2V33A 2JJTA 2EE6A 4PR5A 4TULL 2YUZA 4MGXA 4RRPA 5DA4A 5E6SB 4J27A 1X9RA 4AVIA 5DJ6B 1SY6A 2XFXB 2AEPH 1J8KA 5BRZB 2SEBB 4P5TB 1FDLL 2DF3A 2FJFA 4PGBB 2X9XA 5AALA 1HYSD 3QI9A 1URLA 2EAEA 4F7CB 3Q2WA 4DKFL 1BAGA 3BUBA 4MKMA 2R4RH 4W93A 1A4JB 1SYSB 1CE1H 1ZA3B 2CLRB 3Q3GA 1DQTA 3VFUB 5D1QE 5J12B 1K2DA 4KMTL 2ZYIA 1IBHA 1YYML 3MBXH 5BV7C 4NQVA 4XPFL 2QSQA 2B14A 1LE5A 3L3OB 3KR3H 4XPAH 4NKIL 3ZL1A 3D0VA 2FEEL 4NPYB 3WKML 1C1EL 2OMVA 4XCEA 4YOKA 1MELA 2HFEA 5DR5H 3CHXA 1NAKH 3MLRH 3HE7C 5CP7A 1VADB 3NIDF 4HISA 3A3YB 1BOYA 4OF6A 1A1MB 2BP8A 4BQBA 3IVKA 1MG3C 4DPRA 3UGUA 3HOGA 4ONHA 3WY1A 1UD2A 2WK2A 5T1KA 4EI6B 4OFYA 3K5RA 5JMOC 4C8XA 1IGFL 4LGRB 1W6LA 4TNWF 1XB8A 1C8PA 2NY1C 2QDVA 4F2MA 3TA3A 1RZ8B 5L0QB 3MCG1 5DF0A 5HI4D 1G1YA 4KJWC 2AK4E 2NY6C 3I6KA 4XP1H 4JGUA 3V4VB 4LPWA 4MS8D 4UDUA 4F91B 2ZUWA 2NRDA 2P8PA 2GBAA 3CTTA 4FNPA 3CX2A 2MNWA 1L0YA 1JWUB 2YSSB 4MDIB 2P80A 3MJWA 1I3GL 1IC5H 5C09B 2DEYX 4XC1H 4B27A 1AXSB 2J73A 4L8DA 1SJXA 3DX3A 5H35B 4A7VA 2ICWA 3V0JA 4MJIA 2ZF9A 4OIAA 3ZKMD 3OQRA 4NRYB 4NQSA 2DLTA 1ZMYA 4AJ0A 1BVLA 4LSPL 3EJJX 1NGXB 5TK4A 4DNLA 5IWLA 1MH5A 2WW8A 5JIIA 3MRPA 1YNLL 3VXRE 2W60A 2CBPA 4BUHA 2NCMA 2R0WH 1S3RA 1T22A 3HMXA 3AWFA 1JZ7A 2CLVA 4J3WA 2AABH 1NIEA 1LYQA 2CBOA 2EDQA 3GMRA 5HJDA 5FM4A 1A6AB 4FTDA 4MXQC 2B3RA 3G5ZB 4HCFA 3DYOA 2A5UA 3A5VA 2F53E 3DPDA 1MCQA 4JY5H 2FL5A 4LSSH 4DFIA 1PVHA 4EO5A 2VQUA 1PG7W 1MQ8A 3L5IA 1U8JA 2XA8H 4X7TA 2NNRA 1AG0A 4HCRA 4DGUA 4YJZL 2APWA 3N3EA 1JXGA 2R9HD 3IJEB 3VD7A 3NAAH 5IHZA 3ULVL 1HZHH 3AY4C 1DE4A 4X98B 1Q94B 4JO3L 1SLWA 3W11C 1ZHKB 2HX8A 3WS3A 5D7JC 4X7SL 1AO7B 2ODHA 2BSRB 2YA2A 3C6LB 3PDOB 4ETQA 3PP3K 1NCOA 2APFA 5LHDA 4Z7WA 3WTXA 5HYSB 4PJEB 1PIGA 1UA6L 2XG4B 1MNUL 1UH2A 3QW9A 3NPSB 2ZT9C 2TSAA 3GSNH 4F9PA 1XMWA 3I2CL 2ZIDA 2O1AA 1NDGA 1AHKA 3CD4A 2C3HA 2YJQA 3BZEA 4L3ED 3IEAA 2FVNA 4X7EC 5I1AB 1CFVH 1UJ3B 2R1YB 1IGJB 3KYOB 4FQLH 2ADJA 3REWB 5IMLB 3W5MA 4IIQB 3TCLA 4PJ7F 3CN1A 2FHFA 1NAMB 2XQBL 3WY4A 1HI6B 4KHTL 4PJBA 3BDXA 4KVCL 5HYQA 1F0LA 1KLGA 5ESQB 1BFVH 4ANXA 1LJMA 2R1XA 1MCLA 3G5XA 1Z5HA 3MV9A 2C4FT 4Q4EA 2I5YL 2G5BA 1A9EA 3WD5H 1DVQA 2WLNA 4I88A 5GIRA 5LQBL 1S7VA 2Y7LA 3L9RB 4BRJA 4QXTB 2ROXA 1Y18A 3OKOA 4OF8A 1T4KB 4DZBB 4JO1L 3GJFA 4AQAA 3GMQA 2X05A 1UA3A 3AWGA 4ZAKB 1YVLA 3BUYA 1OARL 3S7GA 5BS0D 1HU8A 2PTVA 4ORGB 4O58L 3SPHA 5CSZB 5IJVA 1YMHA 3LNFA 1OF0A 1A22B 4L4VE 5DLLA 3FU9A 3DX4A 5DK0B 5EFIB 5IQ9A 4FFYL 5IK3B 2PCFB 2HWZL 1SDDB 1NCTA 3B9KB 4AKQA 4LIQH 3X1NA 3VWKA 3P4LA 2E27H 3WHXA 4DPBX 4MZ2A 5I8EB 4WI3A 4C47A 4L0YA 2CGZA 3VXUA 1K4CA 3FB7B 4XPTH 4NUPA 2F54D 4KDTA 5F7LB 1OPGL 3UYPA 2JCCB 1VGKB 3MV8B 3AVEA 5FA3A 2WMPB 1QPKA 3BDYH 4QOKE 3S35L 4Y1SA 4MMYA 3W3BA 2R7EA 5KSAB 1A6WL 3JWDC 4B53A 2MCPL 4FL4C 1FBIL 3HG0A 3DVNB 2B5IC 5SX5K 3OGCB 4Y2LA 1EHLH 1M2VB 1NCNA 3RVTD 5B3NA 5HDLA 2I7SA 3C5JA 2ERJB 3BHBA 3BH4A 5I66B 3WO4C 1MFVA 4UMSA 3PHQB 4QTHB 1CD1B 4KVPA 3ORJA 3TTYA 4TQPA 2MPVA 3CFDB 4LSVH 3MRFB 3VAEA 3FUHA 4GQ9L 2NTSP 1KMGA 5HYFA 4Q74A 2G4EA 3L13A 4NXKA 1K8IA 1UJTA 1OM3L 2CRYA 5AKRA 4NOBA 1QO3B 1RZJL 3BP5A 4XXWA 2V2WB 4Z7UA 3QR0A 2EIZB 2C3WA 4C56E 3FU6A 1ZGLA 1A7RL 3SDCD 1X7QB 4TPRL 3U2SA 2FX9L 4JRWA 5E0FA 4L3EA 1GHFL 3BPCB 4IDJL 3RWFA 3MJ8B 2FZ3A 1O9ZA 5EB9A 3U2JA 2CJ3A 3TBWA 3U0WL 1EJFA 1DQVA 1EGJL 3GK8L 2DBLL 1A64A 5D96B 1EO8L 2OMWA 4XNDA 4F58L 1NEZA 3T3PF 2J6EL 1V10A 3CSYA 5IFHH 1KYAA 4H88H 5AWNH 4XNZC 4UYPA 3W0WA 3PREA 3D05A 4PJXB 3WN5A 5F71A 4Z76B 2X44D 3DSNA 5IROD 4P2RE 3T6WA 2WCPA 4HF5H 2J1YA 4TLSA 3VXSB 1EZLA 4ABWA 3ILDA 3FUKA 5I1JH 1ZT1B 4I7ZC 4AL8C 1BJMA 1N64L 3O4OC 1JPSL 4AITA 4Z3FA 3F3HA 5I0VA 2Q9OA 1NBVL 3HC0B 3NJNA 1OCCB 5BS0A 1J8HE 1T80A 5GGUB 2ZUVA 3VFRA 4NO0D 5F8RC 3GD1C 5KW9H 3HR6A 3DROB 5DYOB 3TZVC 5BCAA 4ZODA 2H5UA 1KEGL 2AGJH 2NR6C 1NGYA 3AU1A 2ADFH 5MEPB 1J05A 3Q6GL 5HHNB 1TJMA 4RGNE 4NCC2 5D1QB 3RX5A 5I1DB 3IMRA 3N40F 2CCVA 2MHAB 5IQNA 5I5IA 3BIKA 1CE6B 1NMCB 2C3VA 2VUOA 4JAMA 3M8OL 4AKPA 4PLNC 2CLZB 3LPWA 5I71B 2EDRA 4AUUA 2F54A 3BUQA 1UKTA 4MAYB 3UJTH 2MNUA 1OQOA 4G42B 4ZTPL 2N56A 2FJUB 3KPRD 4LPXA 5E08H 2KDGA 1FZMA 4XPBL 1JPEA 2DYPB 2I9LA 4R8WH 4TMPA 5FKPA 1H19A 2WOBA 1H15B 2IMNA 2K4WA 1ASPA 1B4LA 1KIPA 3GSQB 4O2EB 4EDXB 1C9SA 1MF2L 5D7LD 1ZS8A 5HYJE 3ARBB 2C9XA 3O3UN 5CUSH 4R7LA 5HTSA 1QRKA 1S9WB 3F7KA 1HHHB 5GRXG 2VN4A 5D7IE 4DHLA 5EEXA 3QIBD 2ODIA 5DMIH 4W6XB 4ZQKB 3RWJA 1FVEB 2PF6A 5DEZA 4P2YA 1T89A 3QG6B 1ORQA 2I9TB 3F7YA 3HR5A 3TCTA 1JGEA 1JN6A 2ZXDA 1T5XB 3P3UA 2K45A 1QLRA 4P2QE 4YL4A 4S1DD 1HWHB 4NQUA 1NCBH 1TZGL 4IMKC 1XH3B 1I8KB 4ATWA 4HETA 4U6XB 4YSEA 3T1WA 3UABA 1OTTD 3OGOE 4WWKB 1KCRH 4PJ9C 1F90H 4NBZB 3UCQA 1NCDL 2G3ZA 1AMYA 1UQSA 1B4TA 2A9NH 4TNVF 2NY0C 4GI8A 4URKA 1KULA 4ZPTA 2FGWH 2R2BB 2D31A 3RUGE 2MPAL 2V8LA 1KYUA 3ETBF 4RISH 1F8TL 1ZTXH 2Q20A 4OD3H 3MJ9H 5DQDL 1G6RB 5JDSA 2AITA 3QUXB 1L7IH 1XR8B 5JPMA 3BP6B 5HHME 3TO2A 3HHMA 5B4MC 3IJ8A 1TCRB 1RMFL 3BD5A 2R2HA 2IAMB 3EYOB 5C0ND 1F11A 3QB7C 4NO0A 4U1LB 2ZSWA 4P2CG 3TV3H 3MRJA 5ECGA 3ZK0A 4ZO8A 2K7PA 4R5TA 4BUGA 3ES6B 4A2FA 2WQWA 4HT1L 1JGUL 4NQTA 1W15A 4U6YA 3TBBA 4LVHC 2CHDA 2ITDA 5CN3A 5IQMA 3J7HA 3L5HA 4Y19D 2NY3C 4C57C 3WLBB 5FOJA 2VDKH 3EG9A 4OR1A 3VFSA 4YEEA 3WN6A 1UA7A 2OP4H 4Y4FA 3H2WA 4R7DB 4FQ1H 3HMWL 4PH8A 4X9FA 1U3HD 2R2EB 3RTQA 5CD3A 1RURL 5KS9E 2ZZUT 4P5MB 2E75C 4JFVA 1RZ7L 1AOHA 3BUPA 4XO9A 3AXLB 1RY7B 1YN7A 1OP3K 4QLWA 4NBXB 4Q6IA 3ZE2F 5G4NA 1DQJB 1PD1A 2AW2A 4RSYA 3CLWA 4BFIA 2YPLE 3DSFH 4RRPM 3V8CA 4M48H 3N41F 1RU9H 5GSVB 4YXLL 2GQHA 4OF7A 2X2YA 2H4EA 3KCWA 3EJZC 3KDMB 4X6CA 3DI2B 5BZWA 3S3CB 4LLQB 3N44B 1I85C 1U8HB 3ULAB 1S5IH 1XV8A 2X4QB 1FFNB 3QIBA 4KI5F 3UZVA 1QR1B 3LQZA 3IT8D 3HG1A 4FP8L 4PB9H 1N2RB 3MR9A 1H6UA 2BSED 1JK8A 1R24A 2V7NA 4NENA 1S9YA 4WENB 1SXNA 1KJMB 3TO4D 5DUMH 2DL9A 2YGNA 3C5XA 1OAZL 4R90H 3M1BA 3UGEA 3UACA 1DUYA 4YHOL 3NJKA 4DAGH 2YGOA 3D39D 3WEMA 2Q86B 2DIEA 2NNAB 4Z7OE 3HFML 3DYPA 4GI6A 4IKIA 4M1DH 3T4AB 3H9YA 1QSFE 3P4NA 4YBLB 2HKHH 3NSDA 2OMYB 3ML8A 3O0RH 1BVOA 1DZBA 1FO0A 4LOEA 5IW6A 1WA0X 1CYGA 5ICXA 2BOBB 5J3HD 4JN2A 5J12C 2EECA 1MLCB 4L4VB 4WTZA 1R46A 2F7IA 3EJQA 3V10A 2GBUA 4JZJA 4G6MH 4PRNA 2AJSH 4NZ8A 5C0BA 1CFTB 3TPUB 1QQDB 3T8MA 4C83B 1PZ2A 2C5DC 3EOTL 3DRTA 2IADA 1D9KD 1DBAL 1P7QA 3WYRA 5FUCE 2H0PA 1GPOH 2AF2A 3TEWA 1IC0A 4AQOA 1XMEB 3I6LD 3KXFE 3L45A 5K59E 4D8PA 5I8KH 4X8JB 1J5HA 4P0DA 4QOKB 3WFDL 4D9RE 3E6HA 5ADOH 1XGYH 1BM7A 2CPCA 3MA7A 4KV5F 2DQEL 1NANH 1EAPB 2FWOB 4G6AC 4M7JL 3CBJB 3F12B 5K1JA 3U9WA 2Z35B 1OO2A 2ZG3A 4R2GB 2KH2B 1HEZA 4HIPA 1YUHA 5DMKA 4JDEA 3T2OA 1I7TB 2HTLD 2OL3L 4IHOB 2D7TL 4PREB 1QD0A 1MY5A 2X4PA 1OAXH 2AZUA 1A7NH 3QUZB 3O3BB 1MCPH 3PWPD 1U3HA 3RL2A 5TDPB 4U1MA 1YA5A 1KTBA 1BJ1J 1S7UA 1CDCA 4NN6B 2FECL 2QHRL 1NGZB 4HALA 4IRJA 2VDQL 1T6BX 3MLVH 3FUMA 1U58A 1U93A 1E4JA 2JSFA 3TEUA 4C56B 4ODSH 1A3ZA 3MLPA 3HE7D 3X12B 2OMBA 1NFDA 3L4YA 5DRXA 25C8L 1KJ3L 1ND0B 5EWIL 1A7OL 1IAOA 4HWUA 2DQDL 5C3LD 4A2MA 1XGRA 5E8NB 4XT1C 1C12B 4X83A 3THML 1NLBH 1DJHA 1QUPA 2R29H 5F7FA 3FRUA 3QFJD 2NY1D 3U7WH 3NABL 3QORA 3TO4A 2J72A 3IJHA 3TXAA 4AEEA 1TCMA 3K4ZA 4D7PA 5E8EB 4PS8A 5DEFA 1ZVSA 2Y1YA 3K4AA 5FFOA 5FECA 7CGTA 4Z0BH 5TDNA 3O3EA 3AUVA 1LMKA 3HN5A 2HN7B 4A6YL 4OQTL 2Q3ZA 3NA9H 3GMMA 3WFEL 4JVWA 3ZDYF 1IGCH 1GZQA 3VGBA 4GEIA 3WNOA 4ONFH 1J8HB 2FX7H 5EU6D 1AS6A 3TASA 2XBZA 2WVSA 1QBMH 2ID5A 3GM8A 4LU5H 4MDRA 3DPBA 1LO0H 2VXUH 3C2SA 2VDPH 5E6IB 5F89A 2ZOLA 4ZFFB 2YEZB 3AS1A 2WXOA 5DQ9B 5F7NC 4N90E 5FO7A 5BW7C 1JIBA 4X9IA 4RGNB 1P4IH 2A0LD 1MREH 3ZY7A 3C8DA 2IWFA 3UTTB 3NP3A 2NX5A 4HKZA 2F74A 5EO0A 2QZQA 5DZAA 3RY5A 3C60A 5BOPA 4PJ8B 3QAZB 2XIIA 2CA3A 5CO1A 3S3SA 3W38A 1JYWA 2APBA 2WUCH 3BSGA 5I0XA 2J1XA 2R23A 3NJVA 2WTPA 3QG7L 4NHUB 3H7BB 3NPSC 4FQXD 4MXQD 2GI7A 2C26A 5JIHA 4K94L 2PW1B 4ODWB 4Y9BA 3EJYC 4WI4A 2VW7A 1KYOJ 2BNUA 4C54A 4WW2C 2OL3B 2NY2B 2X0UA 2J8UA 2CKBH 1UB6B 4JO2L 4Y1AD 5HI3C 6TAAA 1H5BB 2X4NB 2B2XH 2FUQA 3SYOA 2QQNL 3EFFB 4PIRF 1QEXA 5HYJB 2UZPA 3MLZH 4QXUL 3CFKB 1KGUA 3N43F 3V0GA 1WYJA 4K5PA 5D7IB 4N8PA 5EU3A 3M86A 3U25A 1AAJA 4Z77B 1CO1A 3QH3A 2VDQB 1Z9LA 1CFSA 3UXFA 4MHHG 3W11D 4MJ6A 4NQED 2YZ1A 1HCVA 1U6AH 5E0QA 5T5NG 1PQZB 3FOLB 1BECA 1JZFA 1CDJA 1R3IH 2R1WB 3LAFA 3QULA 4K07A 3RX7A 3DOSB 1QYGH 3A6CL 2QQQA 4P2QB 4CNIA 1FHNA 4BH8B 1T03L 5C7XL 1EBPA 2Z7YA 1Z7JA 4HQQL 4YHIA 2K8MA 5TH2B 5LAXA 2JKIS 2BSSB 1KNOB 1TQSA 4DH2A 5ABDE 5HHQA 5F9WC 1MRDL 5LVEA 1H3UA 4Q2ZB 1ZA6A 2HFGH 2IV9A 4GG8B 1OP5K 5TGBA 3X14A 2J56A 1DEEA 4DGYH 3DJTA 4XNUL 5HHOA 3B9KC 2KDYA 3UOAB 4WAFA 3NCEB 1SXCA 2CJUL 2FWLB 2JF1A 1BD2D 2WQRA 3HPLB 5E4EC 4JFZH 3WEBA 4HOWA 4WFGD 1CTNA 2FYYA 5I2IA 4A6YB 1MFAL 3SDXA 4MNGE 2IFFH 4D9QD 1AOZA 5E23A 5JHDE 5HHMB 4PMFA 2AQ1A 4OCRH 4U1NA 5D7KD 3OMNB 5EIVA 3FTUA 4X6FB 3SBPA 4L3CA 1ES0A 2VW6A 1EJOH 1UZ6E 1IJ9A 1EFXA 3FMGH 5CP3A 4ATTA 2ERJC 4O2FA 4HDIA 1SJEB 4WUUA 3FQ1A 1ZGLM 3BH9B 3FB8A 1CGSH 3UX9B 5AAWA 2VAJA 4X8XA 1KIRA 1J5DA 4Q56A 4ZDHB 2XKSA 4N24A 4I0PB 4KH9A 4PRHE 1OAYH 1MCJA 4RFEA 3VWJB 3WIHL 1GR7A 2OJ1A 3RNKA 1I9IL 1AZZC 3DUUB 4Z7VA 1YHPA 5I1EL 1SZNA 2DQJL 4D0DB 2GEQA 3CDGB 1J0KA 3VD4A 3G04B 3F64A 1DVUA 1BQHA 3CVHL 4WVRA 5F0LB 4WFFD 2CR0A 1SOQA 5EOTB 5KS9B 4H20H 3ARUA 5I6KA 5IV2A 3CN2A 1T1ZA 3IWUA 5KG9B 1UWGL 3PGDB 4KO6A 2H3KA 4MAUL 2ZUSA 3FU0A 5D70L 3TX4A 4MMZB 1MIEL 1QTSA 2Z8VC 4YDVA 4RGOH 2YPLB 3RZCB 3P9MA 5D96C 3ZL2A 5F3BB 3S96B 35C8L 1MZYA 5K69A 3G9VA 4XOAA 3IFPB 1SXAA 3QDGD 3MPCA 2BY2A 4GRLB 5CGYC 2EUVA 2EXYC 2VC2H 1ZANL 2VSCA 3JBG7 2RCSH 2GC7C 3SSGA 4G83A 2ZNWA 5BV7H 3FONA 1IFRA 3VFOB 4BELD 5DJDA 4QF1A 4TNWK 2PXYA 1DDHB 1D5BB 4TVUA 4TVPD 3U1SH 3LVTA 1UTDA 5T3XE 5JIKA 3L2NA 4LFHD 3UZQB 1XB6A 5FFLA 3RRQA 3IXAB 4QHNA 4Y1TA 2AEWA 1PZDA 1W72A 4AMKL 3IMBA 4Z7OB 5IG7A 3T8XA 4FG0A 5IVXF 2FR4A 1CLZL 4PJ5A 1QSFB 4NKDA 2CDEB 4Z9KB 4F2FA 2VR6A 1U8KA 4BZ2L 5DVKA 2WYIA 4OV5A 4KKRA 5AYTA 1KF9B 4DWHA 4EN3B 2HXAA 3CC1A 5D1QC 4DTGL 1YMMA 3OL2A 3SE8H 2H6OA 3GZKA 4X7FC 4C4KO 1BVZA 5HDQH 2DTML 1S7QB 4JRFA 4TTDC 2VDRH 3LS4H 4HGWB 3IE4A 3DTUB 3QIWC 1LO5A 1SOSA 4ZMPA 1QFWH 3WXWL 1LDSA 1RUQH 2ZAIA 1DQQA 4RWHA 1E6JL 4V1DE 1ORSA 3MUGB 4Z18A 3KXFB 3VD0A 2EDHA 1FRGH 2R2CA 2QVMA 3R1GL 3ARTA 2Z92B 5IUCA 4HAGA 1CIUA 5H2BB 2N0MA 1TQWA 5AKSA 3VFTA 4MMXB 3HNTL 5DD1H 3GYRA 1N6QL 3SDDC 5T1MB 3QQ4B 3TZVD 1D5MA 12E8L 1V7NL 3VRIA 3ARBC 2G75B 2NR6D 4M5ZL 1G7QB 5HHVH 4F33B 4TRPH 1JGVL 1AGEB 1BFOB 3BO8A 5I73C 3KLLA 4LRNL 2X70B 3CVHB 1QPXA 4BGLA 2CDGB 2H1XA 2R69A 5F1KC 3TJEH 3GLZA 2AVFA 3TJPA 2H2SD 3IRPX 4TS6A 4ZUTA 1YEFH 2DIBA 5FCUL 1M1XB 3VI4F 2JJUA 2AMGA 4ACPA 4ZW6A 4OD2B 3O8XB 1XGPB 3BP4A 3FT3A 2JTDA 5TE6L 4UQ3B 1NMAH 1X5HA 2ZWLT 3G9AB 5L6YH 1H0DB 4WHTA 4NWUL 4XPHL 2KERA 1B0GA 4LLUB 2N59A 4E42A 2QKSA 1WDAA 3IXTB 3HE6C 5A16A 1E8WA 1PZSA 3U1QA 1P53A 5IB5B 1JVOA 3QDGA 3U0TA 3RDTD 4PJHA 4WV1B 3M1OA 3WS6A 5I9QC 1M42A 1OT1A 2YN5A 3ASOB 4H1LA 4U0QB 5DQJA 3SJVD 4Z7NB 3ARSA 4LKCA 2DOCA 2KZ1B 3HG5A 4NQDD 4W9HC 1TTCA 4KI1A 1GIGH 3GPSA 1C08A 4OAWB 3QUXC 4K3EH 4I89A 3KPSB 3IB4A 2KYIA 3VFVB 1JHKL 4PYGA 3D3VE 4J3BA 2P46B 5IW3A 4DW2L 4DKEH 2ZAHA 4QXWA 3BKCL 5DRNA 1OVZA 1G0XA 2APVA 1KEMH 3L95A 3IU4L 3OAUH 4NNPH 4E0RA 2H1PL 3ZQXA 1HIMH 1W72H 3FTXA 1A3LH 3CXDH 3EYSL 4TSBL 3C5SB 5ALCL 4I2XA 3KPMA 4F8LA 3IDJB 4U1KA 4MWFA 1N3NA 4PB0L 5DCCA 5BO1L 1VAHA 1KN2L 4IMLA 5EIIG 3H42H 5MI0B 1SQ2N 4PJ9D 4B95C 2ZICA 5JHBA 3TWYA 4BK5A 3HRPA 4U6VL 4BGDA 3LKOA 4OM1L 1MWAH 5I18L 1YJDC 4IEFA 2NY0D 3QQNA 2F8VA 5GRJL 1WZ1L 4KDVA 3UBXB 1TQBB 3U82B 4JRYD 3SQBB 1GGBL 4PGZA 5DHVB 2F61A 5DHEA 3B4NA 3WSQH 5IF0A 2MEJB 5FB8A 1VRSA 4LXFA 4DQOL 4EZKA 3PJNA 5H4ZA 4NP4H 1VFMA 3F58H 2NY4C 1BZ7B 4PCYA 5HXMA 4PJIE 2ICWI 3B6SB 3QARA 2WIMA 5B4MD 1G7HB 4YDIL 1EAOA 3MOBL 1KYOK 2JJSA 3VACA 4W6YB 5D71L 3NCCB 1Z9MA 3T1FA 5AW4B 2V2TA 2H32A 3NP4A 2O5XL 5FC9A 5F93C 4ZO6A 5TJWK 2CUMA 5EMYA 1X44A 3BQVA 3FQWB 4P59H 5I1IH 5K5YA 2A77H 1WSST 1RIUL 4YDLB 5F9OH 2F5BL 2P5ED 1HILB 3OJMB 3T0ED 1XT5A 2QQLL 4EKJA 2NY3D 4DN4L 3C09C 4HUXA 1MWOA 1G43A 2BSTA 2QPFA 1TVDA 3B1TA 1A7PH 1T04A 3AG2B 4NUQA 4P5KA 1HTYA 3OKLB 3MLYL 1RCYA 2E56A 3F5WA 4ODHH 4XMZA 3GI9L 5T3XL 1MJUL 1HXKA 4GRMA 2X0WA 4GO9A 1ZLWK 1JTOA 3K80A 2D2OA 3ZZLA 4P2OC 2UY7B 3M1CA 3H0TB 1KTLB 5EBLA 2YAQA 3OBAA 5D7EA 3RDTA 1RAMA 1OKEA 3H2QA 3QXAA 4G7VL 3OXSA 2ZF8A 3ET9F 4GAGL 5LCVA 4CMHC 2XXFA 1WTGT 3EJZD 4J39A 1J1XH 3LV3B 4KZEH 1JE6A 1PGRB 1OGAD 4FQQB 4K7PL 1E9OA 4K5MA 1GOGA 1HNFA 4KPHL 4TVPH 1HQRA 3BT0A 3L3DA 3Q2NA 4TQIA 1W16A 2Z7WA 3FTWA 5JHDB 1DBBL 1QHQA 3MC0A 5E99L 3NFPB 3DIDA 3S36L 4EXPX 3ZZ1A 4LL1A 5GGSY 3R0MA 3T4YA 4AE1A 3HRZB 2ICEA 2X10A 2XPGA 4MCMA 4OUUA 5AW0B 3D06A 3TBTB 4MD0A 5INCB 1S8DB 1A6VL 3OKKA 4R2GC 3UEZA 5D1XC 4P5TD 3BAXA 2BP0B 4U3XA 1GYUA 3BZDA 3MXWH 4AG4H 3J8F7 1F4HA 2Y2TA 5D2LE 2EVIA 2EEBA 2IBBA 4AIZA 2WNXA 3DURB 1KPRA 2PPDA 3QHFH 4PRHB 4Y5VB 2FB4L 3UPRA 5B3JF 4AVJA 5CCKL 2WXQA 4PY7B 4NN6C 4H26A 4PGDB 4U05A 5ESVA 2DPKA 4TLUA 3K6OA 4ZQTA 1A6ZB 1JNLH 3ZKXB 4JBSA 3SE9L 2QKIA 4NPJA 3P30H 4KHXL 1ZSDB 4AUJA 3FH7A 4L29A 1UM4H 4UT6L 2ED8A 4KXDA 5CKGA 3W82A 1SGKA 4AL8H 1DFBH 4W9EC 1J10A 5SWZE 1N0LB 3ZT5A 4PN6A 3N9GH 4LQ1A 4L0ZA 4MCZA 3ME0A 2ED6A 3H3PH 4AV4A 4JKNA 5IVZB 4B9FA 2Y36L 2C9RA 5DFWH 1ADQL 2HLAB 1PYWB 3LKQA 4G6AD 3SN6N 3BSZL 3NN8B 3QJZA 3I74A 1FZOA 3SDAA 4LLMB 4WJ5A 2ZSVA 4HUNB 3T0EA 3OHXC 4B9ZA 2DY2A 3WGVB 1X3DA 2A38A 3DHMA 5DRZA 1UH4A 5DFAA 1JXKA 1AMXA 4X9HA 5I26A 3AM8A 5DJCB 4WKZB 3CHSA 3FQNA 2H41A 2Z6FA 1ZWIB 3KG5A 4FXGC 2E76C 2IBZY 3D34A 4LL9A 1GYVA 3D9AH 3SKNB 1RJLB 1CGVA 2QPDB 5C09D 2V5SA 4HZLB 4U1HB 4YH6A 4ZSOB 4KTGA 2X88A 2XJLA 4BSVA 4HWBA 4S0SD 4HJJH 2R56H 2DL2A 3CDZB 4I3GA 1J9CT 4B0MM 5BVPH 2QQKL 3QRLA 1OAQL 1I8UA 2ICWJ 5HP5A 3PAUA 1DBJL 1J88A 5F6IC 4JKPH 1K3IA 3DARA 4F7TB 5ITBH 5T1LB 4X9BA 3VM7A 5KUMA 1OAUL 3EH2A 3DRQB 1BAFH 2HH0L 4PJ8C 3QAZC 3WDJA 2FD6L 1T5WB 5E4AA 2BNRA 3EUDA 5C6TL 4OZ4A 1JDDA 1IAII 4U1IB 3I9GH 3HZVB 4V1DB 5JTWA 3P9LB 2P8MA 5CJ8A 4GG6A 5B3SB 2QBWA 1IBZA 1MCOL 4Q7DA 2YD6A 5DJ6A 3CMOH 1I3UA 1EAJA 3CX5J 3OKEA 5BRZA 3RWIB 2SEBA 1XL6A 4L05A 4P5TA 4IIZA 4OCWH 1TZHB 2I85A 3ZO9A 3N1PC 5AB2A 4WU7B 4BE6A 1HHKB 1BVKB 3L9YA 2CLRA 3DI3B 1A4BA 1XBDA 2EH7L 5AEAA 4S0TD 2KL6A 5F7AA 5C3TA 4AEHH 4XCNB 4LP5A 4QUOA 5ALBL 2FT6A 2A6JA 5KUKA 1F4YL 4ZS7L 3L3OA 5F3FA 1P6WA 4KKQA 4NPYA 1J9TA 3C6LD 2AANA 2LT9A 2MH4A 5M95B 2D9CA 1QFWM 3WUZA 5D9SB 4HJGA 2A2QT 3PAVA 1VADA 5BUGA 2XN1A 4MX7B 3FRPB 2FO1A 1VERA 1JS4A 4OZFA 1A1MA 4TL4A 2ZX9A 4EKXA 1U8PB 4I3SH 4RDBA 2DM4A 1NKGA 3O6LL 3EJYD 4EI6A 3QWRD 4X5WB 5CSGA 3WV0A 4Y2DB 5HI3D 4HS8H 4LNRB 2J8HA 4YXHL 1T0PB 1XSJA 2WBJC 1JF1A 4DN3L 1RZ8A 2LVEA 5IB4A 5D6DA 3VE0A 2XQ0A 3GEFA 2WLIB 3V4VA 2M8XA 4L1DA 4XMXA 2GY7B 5ID1B 1R3LB 5EIIB 1WPCA 3SDYL 1MRCH 2X6CA 3IFOA 3MMEB 5GZOC 3D3VB 3QHTC 2HRHA 1Q9LB 1JWUA 4NSKA 5FKAA 3H9SE 4AK1A 4N0CC 2YGVA 2P8LA 3UERA 2RMNA 4YEFA 5ICYB 2DH2A 3QEQE 5E94B 3U30C 4U4IA 1Q9OA 2ZUQC 1AXSA 5LGHL 4GUQA 5H35A 2X28A 4F8TA 4ZAKD 5CZKA 1RUPH 4L8CB 3ZE0F 2F58H 4KJYA 4NRYA 3RVUC 2XXGA 4X4XB 1A14H 2EDLA 1NGXA 4I0PC 4HGMA 3T5WA 2VQ4A 3VWJC 4GS7C 4DGVL 2Z34A 3O2DH 3B9KD 1XF1A 2DAVA 5FW7A 1A6UL 2ZKWA 3FTVA 4DP9X 3OM3B 1PW3A 3GZOA 3ARFC 1A6AA 2PPAA 2G2NA 3BOVA 3G5ZA 3V0WL 3FXIC 4NJ9H 1B6DA 3CVIH 32C2B 4XNXH 2A6DA 2PTTB 4FYQA 3MV8D 4PJIB 1HH6B 2OULB 4NNXB 4E9TA 3L4VA 1KB5L 4HBCL 4YPGA 3EJRA 4E9WA 1INEL 1A47A 3SQRA 4QRTA 4PU2A 4WJG3 3REVA 1WC7B 3GS4A 3N85H 1FE8L 3L4WA 2XNAA 4UT9H 4XAWL 3CFEB 3IJEA 3G6JE 5HBBA 2GIXA 4P07A 2XTJE 3VXQB 4X98A 1Q94A 2FQEA 1CYWA 1ZHKA 2M83A 3QRGH 1AO7A 1B88A 1IAKA 2BSRA 3C6LA 3EDDA 1LLAA 4PJAF 3T3PE 2XWTB 3U46B 5GISL 2XWEA 3IFLL 1MCRA 4YE4H 4ALAC 3NCMA 3NIFF 5CLZA 4PJEA 2Z93B 4MAZA 4CDHA 2XG4A 3F83A 4R4NC 3ECBB 4YHLL 4B7LA 3QWRA 2WIIB 3S88H 2A9ML 1N67A 3UDWC 3UP6A 5I1AA 1UJ3A 3IDYB 4XTRC 1IGJA 3KYOA 2AJUH 5E8OB 3JV5A 3REWA 5IMLA 2AJVL 2EDFA 4K2UL 2X4OA 5I82A 2XBTA 4IIQA 4CBPA 3UC0L 1IC1A 1IX2A 2R83A 4S1QL 1GJUA 4MJ5A 1HI6A 5D4IA 4JNXA 5JYLA 2QTVA 5CGYD 2EXYD 3UAFA 1ZCRA 1N70A 3V4VH 3HC4H 5FUCC 5IFAL 4P5SA 3V2AR 4ODBD 2BFVH 3HC2A 2Z31C 4N6QA 1OTUC 1XIWC 1EFQA 5EO1B 5EN2A 1SDYA 7FABH 4UQAA 3EH1A 4MZ3A 2FAUA 1DSWA 4PV1C 4QXTA 1IL1B 1I9JH 1G1OA 1NICA 1T4KA 2XWBB 3FO0H 3NQKA 4J4PD 5C0CA 3MCLH 4HOMA 15C8H 3BE1L 3BRFA 1OAKH 4OUOA 4LSRH 4ZAKA 3VYPA 3MRQB 4MMXC 1RIHH 4L8BB 1XF4B 5ID0B 5TFSH 3JTSB 4QHLB 4S0HA 4ORGA 5CSZA 5EU7E 1XBRA 2Q7AA 2YFOA 3K2UL 3RWCA 3VDBA 5J1AA 4OGQC 2HA1A 1E4HA 2X09A 5DK0A 4M5TA 5EFIA 3CWGA 3EIFA 3VMNA 5KTEH 5IK3A 2PCFA 5D1QD 2KC0A 1KXHA 5D2LB 2O5YL 3SZ6A 1SDDA 4KUZH 2XV6B 4M4RB 1J5OH 4A7GA 1F3RB 3QCVL 4XC3L 5I8EA 3BPNC 3QIWD 3FB7A 2VLME 3MRNB 4X6EA 2HVJB 2XX1A 3GMLB 2LU3A 2BVUA 5IB1A 2WMPA 4OCXL 2PYEE 4MAYD 1FGVH 4NKOB 1QR4A 1FDLH 1U92B 3WLWD 5KSAA 4UIKH 4JJHA 1UXSB 3HJEA 5I16B 3OWEA 3L7EA 1YAZA 4RA3A 3MTXA 3DVNA 1V7ML 5KWYC 2MOQA 1R5IB 2DYPD 2X38A 1M2VA 4BKTC 5GGRY 4KMTH 4YVNA 4QXGH 3SIKA 5I66A 1MCBA 3MFFB 3D12B 4QTHA 4WIQA 4WV1C 4YFLF 1KPUA 2IDTA 3CFDA 1C5CH 3CN4A 3RVVD 5HGDA 3ARBD 3MRFA 4RGMC 1OSYA 1ZV9A 5CM1A 3QEUB 4H8PA 4ZNEA 5JW3L 4LLYA 1OW0A 2AK4D 1T1WB 2VE6B 3LQAL 2AMUA 1AGBB 3AZUA 2DEWX 4EZLA 4UOW0 3VQ1C 2PN5A 5HGHB 1QO3A 1K6QL 1UACL 2RR3A 2V2WA 3B8YA 2Y24A 5I6XB 3EYFB 3PV7A 3FQRB 1X7QA 2AJXL 2CK2A 3BPCA 3KWXA 2PNDA 3T0VA 4JFSA 3MJ8A 1GYAA 5BQ7B 1QEWB 1XTMA 1N6VA 5JHAA 2PR9A 2EH8L 3MBWB 4WWKD 5MI0C 4QO1B 4PW3A 3FQTB 3HE6D 1TJIL 4UT7H 1WWWX 1GGIH 1NAMH 3CUPB 3OKMB 1LP9E 3V6BR 2YKKA 4AY0A 1WICA 3P54A 2ALWA 3DIVA 3VXRD 4BFEA 1LWHA 2NXYC 4JQXA 2GIMA 3VXSA 4WLCA 4F57H 4PRPD 3OJ2C 3QUXD 1GS7A 1OD7A 1ZT1A 4GXFA 2JIXB 4M43L 4KMQA 3V79C 1R0AL 2EVHA 2CAKA 4J4PA 3AUWB 5L8KB 2G5RA 3HUJF 2IAMD 3CX5K 1GY1A 3MYJB 4KTDL 4P4KC 5GJTH 4PJFA 3E2HB 4QRFA 4NZFA 2F53D 2UZYB 5T33L 3LRSA 2NQDA 2VZTA 3BVNB 2GJRA 3BYTA 4RVBA 2AXGB 2XZAH 1KB9J 3BKJL 1B90A 4LSPH 3K8LA 4FFYA 5J9PB 4RAUB 5CJOL 5MEPA 4GY4A 5HHNA 1A9VA 4N2DA 5I1DA 3ATDA 3WTWA 3UTZB 1DVSA 1RZFH 2MHAA 3IRZA 4MXWL 1WFUA 4H4NA 2AEQL 4XMUA 3IGLA 3D2UB 2Q7YA 5C0IA 1CE6A 1HHIA 3UTSE 5L4JA 3NPZB 3VDCA 4OGXH 5I1GH 4LMQE 2WKLA 1AGCB 2CLZA 2CMRL 2WLJA 2VH5H 2OTWB 1OB0A 4D9LL 1CICC 3WTSA 1G0DA 1Q9WB 3FB5B 4PJ7B 4X5RA 3JXAA 4MAYA 1R33A 3IPEA 3RLSA 3I9PA 1NPNA 3EZ8A 4JB9L 2GFBA 1ZXQA 2WO4A 3KM1A 5IY5B 3TFKD 3WUWG 1F3DJ 1PFCA 4ZS6D 2FUTA 2YAHA 2DYPA 4PRBB 3B9VA 2M2DA 2N3JA 4XN4A 1INQA 1Z5LB 1YLBB 4HA1A 4OB5H 4CA4A 2OZ4L 3OKNB 5LKNA 4GMSL 1WZMA 4IS6B 3V5DB 5JOFB 8CGTA 3D85A 1HHJB 2FH6A 4QEGA 4XVUC 1S9WA 1MVYA 4MDJB 1VEOA 5ABZA 3E9TA 1TO5A 4P3DB 2FLRT 2UXFA 2KZKA 1E9QB 4I4WB 4ZQKA 5F9DC 5H37G 1FVEA 4LARL 3PY9A 2COVD 1G9NL 3CQQA 4U6TA 2R0KL 3QT2A 3RNQB 3PQYE 1JOIA 4YZFF 2F19H 3K7UA 3H9SB 3OG6B 5KYYA 1KYFA 1BG9A 1IFHH 1I1YA 4W4NA 3QDJE 1EGJA 1XH3A 1I8KA 1RIVH 2HT3C 2ZOKA 3MRHA 3QEQB 4RMUA 2BWDA 1FSKC 3T77B 3GJFK 2J6EA 3E8VA 3K2IA 1T20B 2F1EA 4N2KA 1AGDA 4LCUB 4NBYB 4WWKA 4QRUB 3SY0B 1WITA 1BPLB 2Y07H 2XQBH 1DBML 3CZFB 3LEVH 2J55A 4KHTH 3BWAA 3MX0A 5E2WH 3O6FB 4YHPB 2CM6A 1NC4D 2CIKA 3QWNA 4L4VD 2R2BA 3DVGB 2KPNA 4TUUA 5HVFB 3NJMA 5FK9A 4G8IA 5DGQA 4AM0A 2PWHA 1HOEA 1GGCH 5JR1L 1HWGB 5ABAA 3SQOH 1XR8A 2KBGA 2RAMA 5DFTA 2CD0A 3CFNA 3S5ZA 1TCRA 5I19L 2OCJA 1PF3A 3B5HA 2IAMA 4ZK8A 3EYOA 3OPZH 3EGSB 3MRKB 4U1LA 5FGBC 1AIZA 2JI3A 4HIQA 5INDA 1ACCA 2Y7QB 4G5ZL 1QUNA 3ZTDC 1MVUB 5FO9A 4U6HB 5JUEL 2JNZA 1YY9C 2DM3A 4FFYH 5E9DE 4R2GD 1A5FH 4TM9A 1G7JB 3B43A 1QFWI 3DO7A 1HCZA 2VMDA 4JRXE 1WT5A 1RZKL 3L6FB 3QUML 4PSRA 4U3CA 1N5AB 1FH5H 1ONQB 3CZJA 3G6JB 4F7PB 3CXHJ 3O4LB 2XTJB 1N0XH 3N42B 3WLBA 2H9GB 4YDKL 2PYFB 5ACZB 5C86A 3FO9A 4NDMB 1HXMB 2FX8L 4R7DA 3EH3B 2AS5M 2C3GA 3UZEC 3T3PB 4C4UA 3S35H 3GB7B 4PG9B 2OMNA 4Q0XH 5B7EA 4O5LH 1OT4A 3ZDZF 3TWCH 1DHKA 1DQJA 4K23L 5I1GL 1HOCB 4WSJA 1CR9L 2DLIA 2OJEB 4NO3B 4PHZA 1DQLL 4X4YB 1Q1JH 1BQSA 2ZAGA 4H0IA 4IQHA 4AQ1A 3GSVB 4FABH 4HAKA 5G5DA 4HS3B 2CK0H 4G80B 4WJKB 4MXVF 4OU3A 3PL6B 5J11B 4V11A 4LLQA 4QHUB 1U8HA 1FL3A 1SVZA 1J18A 2OK0L 1QR1A 5HVGB 3Q1SL 2FNWA 4QKXB 1IIIA 3FDWA 4RRPG 1T6VN 1RZJH 4UOQA 3GI8L 4GW1B 4AQEA 4PCSA 1WFJA 4P2RD 4GSDH 3VXNB 2YAPA 1U95B 2Q86A 2NNAA 3CFQA 4M1GL 3OF6A 4LGPB 3T4AA 1HN1A 3CFCH 3GF8A 4LO9A 1BQLH 3U0WH 3BCDA 3HBZA 4XRCA 1LO2H 4ZUUA 2DBLH 3GGWA 5DS8B 3ROOB 1WEJH 3VM5A 2OMYA 1J8HD 1XX9C 4UB0L 5HDBF 1A65A 5LWYH 3FU7A 3SHSA 4HCGA 5E6ID 1YEIH 3B7YA 3ZIYA 4QT5A 1KBWA 1MFEH 4P48A 1CFTA 4NEHB 3JV4A 4HZAA 5B8CB 4JVPA 1BIIA 3JQOB 4C83A 1HXYA 4NIYE 5GS0L 3FO2A 4ODUA 3CSTA 1CTMA 2VISB 1G6RH 2HUHA 2D3LA 4PJ8D 5LDSA 1UYWH 1RJYB 4D2NA 1YEEH 4X8JA 2X6MA 1NGWB 2DMKA 1PG7H 3EYQD 3T3MF 4QOKA 1LO4H 3X3GL 3N6YA 1M7XA 5DDHB 5JXEC 2YZ8A 4APQA 1EAPA 2FWOA 3PXJA 3F12A 1G4RA 2Z35A 3B2PA 3QUMB 4DVRL 3S9DB 3WNKA 4M8QA 1QBLL 5DVNA 4MFHA 3V6OA 3C9NB 5EZLB 4TV3A 4MJIE 2GEEA 3MNWA 3SCMB 5DGRA 3S98A 3BPLB 1AI1H 1HL8A 4PBDA 3AB0C 4WY7H 3TJHC 5HYJD 4MZRA 3FC8A 1EHNA 3DV6A 5B1CA 3QUZA 4I0CC 1YJDH 4X0KA 4APXB 4HPOL 2Y7NA 4OD1H 5TDPA 4YFEA 1FJ1A 2IQAB 3PWNB 2CZNA 1JPGB 4AEIL 2QVKA 4NM8H 4N0YH 4KUCD 2IOIA 2B39A 2G9KA 2VJXA 5DD6B 3WJLC 3L5WB 2UZXB 5I1CL 4MYPA 4C56A 4PP2B 3CU1A 4FKKA 1ZXKA 2IJ0C 3X12A 5D4HA 2XU9A 3CLEL 3KLDA 2NYKA 4UDTB 4LASH 4P23B 2ITFA 1JNNL 2YXMA 4XBEL 4IU2B 5EUKB 4KTEL 4B96A 1L0QA 4RMBA 1LEKA 1NFKA 5BZDB 6PCYA 4POUB 4FLHA 3UYRH 1Y1DA 2WBJD 4U1GB 1LP9B 2XTSA 4PHXA 3WL9B 4TUKH 5FFGA 5BRQA 1KJ2B 5HHXL 2E7BA 1MAMH 4GG6F 5I6OA 3VJ6B 1KTRL 1ZE3C 2IPUK 1N4XL 4GKOA 4KNUA 2HN7A 5I15H 5GZOD 4Z7WE 5HHMD 3A6BH 1BLNB 3GSOB 3S48A 5AFAA 1G9ML 2ZWYA 4W9KC 4N0CD 2XSKA 2F8OA 1K3ZA 2J6WA 2BVOB 2HUEA 5J5EA 5J13B 2XIDA 1E4XI 4IBYA 3QBTB 4BFRA 1D2OA 3F8UB