1UOWA

Calcium binding domain c2b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
156
structure length
156
Chain Sequence
b'SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN I
publication title Crystallographic Identification of Ca2+ and Sr2+ Coordination Sites in Synaptotagmin I C2B Domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Glycoprotein
total genus 34
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1uowA00
2UZPA 3IBEA 4NS0A 4WWNA 3SD5A 2K45A 4L2YA 1UOWA 2NSQA 3ML8A 4JPSA 3S2AA 4URKA 4L1LA 1W15A 2Q3XA 4NP9A 2ENQA 4OVUA 3R7QA 2WXJA 5CCGE 4IQHA 5KJ7E 3DBSA 1DQVA 2ENJA 4XE0A 1BYNA 3CSFA 4TV3A 2A5UA 4GNKB 2CHDA 4HLEA 2JQZA 1BCIA 4EZJA 4FA6A 3LJ3A 1DSYA 3L13A 4ANVA 3HIZA 3W56A 4LT7A 4PS7A 3FBKA 4EZLA 2DMHA 3ML9A 4FULA 5G55A 1DJHA 2N1TE 4F1SA 2CJTA 3RDJA 1WFJA 4LCVA 4ICXA 4WWPA 3TJPA 1UOVA 2LHAA 3R7RA 3HHMA 2RD0A 3ZVVA 4Y1SA 4PS3A 2WXNA 5H4ZA 3F04A 2QZQA 4BGDA 2B3RA 2WXPA 1DJWA 1QATA 4XZ4A 4IHBA 2K3HA 2V4LA 2WXRA 3QARA 3M7FB 4KZ0A 3PS6A 2R83A 4WAFA 4NPKA 3DPDA 3L54A 1V27A 1K5WA 4ICWA 3L9BA 2FJUB 3RPBA 4L23A 4AJWA 2Z0UA 3NZSA 1GMIA 2EP6A 3PRZA 3F00A 3QR0A 4L1BA 5JHAA 3L16A 1CJYA 3APCA 3TL5A 2YOAA 1E90A 3N5AA 5G2NA 3HN8A 2NQ3A 1UGKA 3T8MA 2A4ZA 4PS8A 1BDYA 4F91B 2WXOA 2Q0ZX 4A55A 3MJWA 1W16A 4FJZA 4FLHA 2QZ5A 5H4YA 3L08A 3F01A 1DJGA 2BWQA 4MJJA 3TWYA 4WWOA 2ZKMX 3PYCA 4FADA 4F93B 4KITB 3JZYA 1TJMA 2Y3AA 2FK9A 3L17A 4QJ3B 3F05A 4FHKA 5CCJA 2CM6A 3QAQA 4TUUA 5JHBA 4J6IA 2WXFA 4ANWA 5CCHE 4QJ5B 2WXHA 1E8WA 2CHZA 4LDCA 3L4CA 3W57A 1TJXA 1A25A 2DMGA 2K8MA 1WFMA 2KI6A 4DK5A 3GPEA 3KWUA 4F92B 4BFRA 1RSYA 2WXQA 1DJYA 3PFQA 3APFA 3QJZA 1E8YA 3APDA 2CM5A 2ENPA 3FDWA 3NSJA 3IM1A 4FJYA 5T8IA 2WXGA 4OVVA 4AOFA 1E7UA 4KZCA 4EZKA 4HVBA 3ENEA 1RH8A 2CHXA 4FHJA 3P2BA 4DNLA 2X38A 4WEEA 3KWTA 1DJXA 1RLWA 2WXKA 2WXIA 4GB9A 4V11A 1E7VA 4G11A 3ZW3A 5EDSA 4ANUA 4XX5A 3QK0A 3QR1A 3OHMB 4TS6A 3B7YA 1YRKA 2NCEA 2D8KA 2YRBA 2CHWA 4NPJA 1QASA 4QAMB 3PREA 4Y1TA 2K4AA 1DJIA 1E8XA 3CSTA 3NZUA 1DJZA 2CJSA 3OAWA 2WXMA 1E8ZA 3ZIMA 4ANXA 1HE8A 4QJ4B 2ISDA 2WXLA
chains in the Genus database with same CATH superfamily
1A7RH 1J9SA 4H25B 5AOJA 5FYKL 2FAUA 1OSPL 4X5WA 3VVWA 4EDXA 4RMVA 3EW3B 1MRCL 2JWYA 5EZOL 4GAJL 3QUXD 4KX8A 3THMH 3Q8EA 3RWJA 1QO3B 3T77B 3QJFB 4LARL 2H2SD 1FZOA 4Q9RH 2YD1A 4YDKL 1G6RA 2EYTB 3O0RH 3DUUB 4OZFH 4JFFA 5DZJA 2FDBP 4ELME 3GHBL 3IETB 4P2CG 2LU4A 4UCFA 3RL1A 4XC3L 4MLIA 4P2QD 1CLCA 3ZYJA 4Y1SA 3A4FA 3FSOA 4LOEA 1X5JA 3OL2A 1D3CA 3GDCA 4Z3GA 3N06B 5L8LB 5FPIA 4JCWA 4X83A 1QLFB 5AZ2H 4G42A 4TOYH 3PQYA 3UP1A 5HHNB 3IVKA 1YEGH 5EIVA 2YRPA 2D9QB 3APCA 2VRKA 4OI9A 1PFCA 1U6AL 1V3KA 1U92A 5I19L 2UYLB 3QDJE 1M9WA 1GPOL 2QQNL 3FO0H 3KWVA 3WSQH 3CFUA 4GXUN 1ZGLP 2MQ3A 3QZBA 1JD9A 3BLKA 4FGMA 1L5GA 2B15A 4GAYB 4FADA 3UBHA 2AEPH 4Z95H 1MF2L 4JHAH 2X1PA 1ZS8A 3OGCA 5GRUL 5CCJA 4WO4B 4KXBA 5DD5L 5EN3A 4OV5B 2OLDA 2VDML 3EFOB 4WI5A 3JWDH 1WBZA 3NYKA 1PY9A 5IQ7L 2FD6L 5GGRB 1OAYL 3EBHA 3OZKA 4IJ3C 2LLGA 3P0YL 1FYTA 3KPRA 3KG5A 5GSVA 4JDVB 4ENZA 1NLBL 2HPTA 2EDNA 2WXQA 4MZ3A 3RGVA 4HLZG 3IXTB 3LH8A 3RWFA 4BQ9A 3EJTA 3KVQA 4ODUA 4DNLA 2YQ2A 1RULL 4QRSA 2CJ3A 1FO0B 2E7LC 1NGPL 1YNKH 1KPRB 3S3JA 2NY5H 2WKOF 2GK2A 3L3HA 4G6ML 4PJBB 3BMVA 3DGGA 2PR4L 4OJFL 4EO5A 4KRPB 4YJZL 4C56E 4LKCA 1TR7A 3T3PB 3DUHA 1J8HD 1N0LB 3U36B 3F7PC 2X4NB 4HIEB 2FHCA 3LXUX 4WNQA 4AK2A 3APMA 4QRFA 3ZTNH 3PHOA 4NUGL 1S78D 5EU7C 4EXPX 4ECNA 3D85A 4EUPG 4OZHB 1IEAA 4R7LA 4GSDL 4C58B 3HZYB 5DZLA 4ETQA 4JHBA 5AKTA 4EDWL 2X6BA 3L13A 4ERSH 2F0CA 4Z7QB 1IIIA 4L4JA 1TTBA 4Y4FA 2CH8A 3ZQXA 3C5JB 3L9RB 1OPOA 2PP9A 2XPYA 3VXQA 4B9GA 1EBAA 1G7PA 4YHPA 1ORQA 5EOCL 4ZTPL 1F6AA 3B7TA 2MTPA 4QI3A 1A7RL 2HRPH 3S6CA 3HI1B 4ZUVA 2BW5A 4F7MB 3E1F1 3SDAC 1UFGA 3HNVH 3CUPB 4NM8L 3THML 2GY7B 2D31A 4U7KA 3PJSB 5TE6L 5KSVB 3FTGB 3HG4A 3LKPA 1H3PL 3F00A 3QGVA 4Q9RL 2KMWA 3L16A 2ZJSH 4LQ1A 2R15A 4WSKA 1JRHL 3ARQA 3P11H 2HKFL 5GZND 2DYPA 2VDPL 3SSGA 5AW2B 4W9HC 5IK3A 2DMCA 4YHNB 4J4PC 3UEQA 3H4FA 1S9VB 4X4XA 1U8JA 3K1DA 5FYKU 2V7HB 1CXIA 3VRLE 3IDNB 3TCLB 1CK0L 2HFEB 4OQTA 1HCVA 4MB5A 4NKQB 5CCKH 5AZ2L 1NEUA 3I9GH 4XVJH 5J12B 2YQ3A 3VFSA 4TOYL 3QISA 2EEDA 2QV2A 4POUB 1YEGL 3H1ZA 2R2CA 5KOMC 2Y72A 5DYFA 3K5RA 5HYJE 2OYMA 2BNQA 3OKOB 5JORB 3VFOB 5JXEA 4M8QB 3WSQL 3CSGA 3VQ2C 2MPAH 4MDJA 4POYA 2CM5A 5DYOA 3HNTH 4DHLA 1RZGA 4B9YA 4QHKJ 1GGCH 5D7IA 4CUCA 2EILB 2AEPL 3TZVC 4G6AC 3KR3H 3WEXA 2CGYA 2GEQA 2RACA 4XNXH 1OAKL 4Q14A 5ITBH 1VFMA 2AV7B 3U4BL 4J3BA 3JWDL 2AXJA 2ZSVA 3QI9C 4M4RA 1R3KB 5LCVH 4FI6A 4NWUH 5INDB 2Y1YA 3OR7A 1XCTB 4YFDB 5IMLA 3M86A 4I88A 5I1JL 1T5WA 2BP0A 4YUEL 3IRPX 3IE9A 2CPCA 1JNLL 5L2KE 2D7PA 5F7DB 1BEXA 2WUCH 5T5FH 6CGTA 1S7XB 2WUBL 5FFLA 3AREC 1X5ZA 2XTSA 1IM3D 5HY9A 5CCGE 1KWKA 4UNUA 3K2UL 3KWXA 1UT9A 2NY5L 4WK2B 4YO0A 2QVTA 4M1GL 5GIRA 2F54E 4PJ7E 4NBXB 1FBIH 2DM2A 1C08B 2HFFA 3ARGD 4S1DD 3VG9C 3OKDA 4H8WL 5FGSA 4N0FA 1DFXA 4N2KA 2VC2H 5IVXE 3L4VA 3NCMA 2ATKA 4N2DA 3L1GA 4BQCA 5EU5B 3O4LA 5DQ9A 1FZMA 4W9CC 4OM0H 1O5PA 2VMDA 1NBZB 1OE1A 1QQDB 2PO6C 4N5UA 3L54A 1ZLSH 4A7UA 5JPMB 4G9FE 3ATDA 2J4WL 4RGMC 43CAB 2FL5B 1EHXA 2VLME 2CBTA 2Y4SA 4UDUA 5EV7A 1UWXK 4BH8A 4FQXD 2KZKA 1IT9H 1G7MA 5IV2A 2VKWA 2YZ1A 4KKLD 1SFHA 4P9MH 2WINB 1EDQA 3FUEA 3TBVA 3V6OC 4DP2X 3CN3A 5HXMA 4MQXC 3O9WD 7PCYA 2HRPL 3FC8A 1BXXA 5EIIG 3UAJC 3EOYG 3MRFA 4LSQL 4PRPA 2NX5D 2Y7NA 3GBNL 4K8RC 2ZUWA 4UV7H 5DI8A 5F7HA 2HRLA 5I0DA 3MRDB 3QG6B 2J12B 3HNVL 1UA6H 4GLRI 3MNMA 5J1SC 5I23A 2ZXEB 3BUQA 5GS0D 5CUSH 2G3ZA 1IKFL 3SDCB 4L18A 4JFZH 4UTBH 2K3TA 4NM4H 4WJ5B 4M29A 5DRWA 3T0XA 2Z91B 1WP6A 3S36X 1JBJA 4W4NA 2CDEA 1T0NB 2XWDA 4HS8L 5DO2C 5C6WH 3UIYA 3QDAA 2AK4B 5L2JA 4PW9A 2JLLA 2Z8WC 5AG9A 4PG9A 4OF0A 4HJGA 1ITCA 2IANE 3L81A 4B41A 2NY0C 1U21A 2W9EH 3C6SA 2AEQL 2VZVA 3PV6B 4RLDA 2EUXA 1EZVY 1BBJB 2VITB 4KXCA 4OJYA 3LV3B 4P57B 3P2BA 2E7LA 3I9GL 5AD0A 3QNYA 3CN1A 5J6GB 1AS7A 4MCZB 2NNRA 3H3PH 2VERN 1ZTXE 2BIIA 2HG5B 4ZMVA 4TS6A 1HKFA 2NCEA 1OWRM 2D8KA 3OHXC 4LHUA 1OP3H 5DRZB 3LB6C 4KVNH 2MPAL 3G5YA 1M1XB 3STLB 3TVMB 2QHRL 4R7DA 4BA0A 2G75A 1BD2B 5JIHA 1HE8A 4KC3B 4MJIA 4UTCA 2YPLE 4LP5A 4I5BA 2B2XH 4HFUH 1FGNL 5IHZB 3QSKB 4JAMB 5LBSH 1YMMA 2DJ4A 1HINH 5D70H 2E59A 4FYSA 2H3KA 4OIAA 3IKCB 5HDBF 2ADIB 2AJYH 2WQRA 2DDQH 3SODB 5A2IH 4M48H 4XX1E 5D9SA 2HT4C 4B9PA 1KELL 2F5BH 4PRHD 4HKBB 4PCKA 4PMEA 5DU7A 3EGXB 1PVHA 1FLRL 5H2BA 4AI7A 1K2DA 1QFWH 2P5PA 2VSMB 1X7QB 5M95B 1JPST 3FSAA 3SDAA 1RK0B 1QA9A 2WUCL 3GMPA 5T5FL 1AANA 3SDDC 4IEFA 1UM4H 1A6TB 1RIUH 2ED7A 2V5TA 3K5SA 5I24A 5KG9A 1K9TA 4QRPA 3PP4H 2X3CA 4HQQL 3CG8A 4KDTC 1VKXB 2CO4A 3BCDA 4ZBJA 4PD4K 3I9PA 3T8XA 3JWNE 2Y5EA 3S34L 1MJUH 3MRKA 2OP4L 1AC0A 1OSYA 5J3HC 5DJ8B 3L4TA 4NKOA 3T2OA 1WAEA 5F3HB 1JV5A 2QQLH 2BHYA 4J4PA 2VC2L 4I0CC 1V7ML 2OR7A 1G7LB 3FQWB 5DUMH 2B08A 3CX2A 3G7TA 4GW4A 5C3IA 4ZO7A 4WV1C 4WFED 3MYJA 1QLEL 4X8GA 4JFWA 1QMUA 1L7TL 5CU9A 5IKCB 4ILDA 3VXRD 3NACL 4JN2B 2DPKA 3ZDWA 3QWNA 1S7QB 1IT9L 3G04A 1DQQB 2YA1A 2WVSA 5C07E 4G8EA 4MMZC 3V5HB 3QRGH 1DQJB 2WVVB 2NYYC 4AIZA 4ISVB 4Z0BH 3SYCA 4BSWB 4GIOA 4QXUL 4YBHA 3NSXA 1G6RH 4D9LH 1UEYA 3FB7A 5BMFH 2L3BA 4HJJH 2ZKXA 4JRYE 4NOBA 1CUOA 3TZVA 4UV7L 4L4VB 1NGYB 4UWQB 1P84K 4R97C 2OZ4A 3QDHA 2Y7SA 3LIZA 4NQUA 1Z0NA 1Z9OA 3DI3B 1EBPA 5CUSL 1R4XA 3NA4A 4JFZL 4LEOA 5FOJA 4NM4L 3TJEH 3QI9A 5GRVL 3C8DA 2KPWA 4L1HA 2ARWA 1NDGA 2DJSA 2DLEA 2DQDH 3HE7C 4JFEA 4M00A 4KOBA 4PRBB 4WJKB 4XX5A 4QHUB 1RZKH 2EDTA 5F1KC 5AUMB 4NKIL 1PNCA 5JOFA 1PZ3A 1YRKA 1A6VL 3FRUB 3ZL4L 2ITDB 5E51A 4GINA 3BSHA 1K6QH 5KTEH 4KZDL 3HAEA 3DYMA 1QI4A 2L0DA 3IJEB 3HNSH 1UASA 1U8OA 1NEZB 1JN6B 1HJBC 3AREA 3CK0H 3L1OL 3UJIH 5PAZA 1CDIA 4AH2B 5HGHB 3RWHA 1M3IA 2N4IA 4B27A 1AR1D 1TO5A 4TUJA 3EOAA 4NPYB 5DK3A 5I66A 4RISL 4XMPH 2YOCA 2R7EA 2X2IA 3M1CA 3BN3B 3WTVA 1CLZH 3PAZA 5MENB 4R4ND 1CTMA 3GI8H 5AW4B 4Y2OB 1MI5B 5JHMA 5EIIB 3VI3E 4U1SA 2OMXA 2FGZA 4K7PL 4Y2DC 3EYUH 3MOQA 3MV7D 2C3VB 5D2LA 2B2XL 1KN4H 4HFUL 3CDGA 2IH1B 5MEPA 1FYHB 5LBSL 4U6YB 3IYLW 4LLUB 3L3GA 3RA7H 5I74B 1MEXH 4WAFA 3MKKA 1GCYA 3RWDB 5K9KA 2VYRE 1LE9A 2AJYL 2HP4A 4JFXA 3AGVA 5J9PB 3QR0A 3AS2A 5ECGA 2Y24A 2F5BL 1NM4A 3C75A 3V6OA 1I7RB 2YOAA 3TEXA 1NUDA 5JW4Q 1UT2A 2R4SH 1UB5A 4YHOH 1DZBA 4KY1H 3UTSE 3UAJA 3MV9A 4APXA 4FQ2H 5D7EA 3LZPA 4FTVE 1RPQA 1M53A 4FQJH 4XAKE 2DQFA 4ORGB 3HS9A 1IBDA 5GXBB 3S5LA 4FQQA 4JFPB 4L8DB 1JE6A 1MWAL 2WLIB 1RIUL 1E67A 3GM0A 2OSWA 2ERJC 1JSYA 3FU5A 4TVPH 5LAXA 4A2GA 1ZEAH 4YWGH 4RMRA 1G7HA 1SEQL 3NA9H 2WSKA 1MJUL 4A7SA 1J5OH 3CU7A 4P23B 4QIRA 3IB4A 2J2ZA 4ZPTB 1EZLA 4N8CH 2BCKB 4M03A 2PW2B 1WFMA 3V0WH 1FNGA 3QQNA 4LOFA 4N8VG 4P46B 3U7WH 4JHVA 1KB3A 4JLRB 2EIBA 1GOHA 2AI0H 5ITFA 3OQ3B 3CN2A 5D7KD 4EZKA 1TYEB 2IQ9H 4OGXH 4KDVA 1JCVA 3T1FB 3QULA 1LEIB 1FH2A 2VO8A 4X7CC 1CB4A 3FF7A 5GHWL 1BREA 1DUZB 2YGVA 3I50H 5DFAA 5CU5A 1J11A 4NQED 1EEYB 3OHXA 1NJ9A 2OTPA 3QRGL 1CD9B 1XQ4A 4GKSA 4L4TE 4Z0BL 4XP9H 1AXSA 2OJZH 1XBRA 5G4NA 4M93C 1U91A 5CS7A 1KSRA 4R9HA 2VR8A 3DTDA 1OGPA 2Y69B 2PWFA 5EBMB 1XH0A 2ZNWA 4JRLA 1C16B 4PLOB 4A38A 2YAPA 1AHWC 1CU4H 5CJQH 2QTEA 3QXAB 5DHYA 3HUJE 4DGWC 4O00A 1S9KC 4OQTH 3QEQD 1ET8A 3NFSH 1UXWA 1RERA 3EAKA 5AZEL 2DQDL 3VXSB 2MOVA 3BH8B 5CIPB 2YWZA 1RZKL 3HG2A 1F1GA 5A16B 1DN2A 2X3BA 4I13B 1K6QL 3DOSB 5KTEL 2YMOA 1DDHB 4PJHF 3X1EA 1DL7H 4NFCA 1E0OB 3GRBA 1S7TB 2OTUB 3SDDA 4HV8A 5HHOD 4XTRD 3CK0L 2CO7B 5D7SL 3GSRA 3B9EA 3WMQA 4YX2H 2VGLM 4H0LC 3GTTA 5FYKE 4KDTA 1OPGH 1KGCE 4XN7A 5C0BA 1XF2B 1U8HA 2H1XA 1PX3A 3L45A 4FQCH 3QZOA 5D1ZD 4EI5C 5CEYB 1PZCA 4PRNB 5F89B 1W9XA 2NR6C 5A43C 1UQSA 1U8QB 5CBEA 5AB2A 3GI8L 5J4MA 1NANH 2Y7LA 2XIDA 1GGBH 2BERA 4PJFF 2AQ3A 5KZCD 4L37A 3EGDA 1ODAA 4PLKC 4U1KA 3T8MA 5IHLB 1DTUA 3EYUL 4N4YB 3IU4L 4EPSA 1KN4L 4WV1A 1ZVYA 3OG4B 4NQCA 2CG9X 1TU2A 1QW9A 3B37A 5HVFB 2QSTA 3RA7L 4ELKB 2E6JA 5KSAC 1RP9A 5BZWA 3Q3GB 2LQRA 5C0AB 2AQ2A 2FK9A 9CGTA 3L1EA 2WIIB 5EC2B 3IJHB 3FO1B 3QG7H 4E68A 4MMZA 2Z1PA 2C3GA 1KIPA 4FEIA 3O6KH 4ZMTA 3TNMB 4YFLI 3G5XB 4WUUE 2YD0A 4YHOL 4KKZA 2ZOKB 3C12A 1E9PB 4GSUA 3OSVA 3P3RA 1OD7A 2WVUA 3ZKXB 1JNHB 2AJZA 3QJZA 3WHXB 5T8IA 5ICXA 5IMMB 3CV5A 2NZIA 3ILEA 4UQ2B 3GSXB 1ZEAL 2Y07H 2YD4A 5AYUH 1XGQB 5D93C 3NA9L 3KYKH 3HE7A 5I16B 1J5OL 2GTZA 2FX9H 4U1MA 1QEWB 1YUKB 3QJRB 4N8CL 2YAHA 1ZPUA 4DW2H 1CXHA 2F18A 3BDBA 4XCFH 2OX5A 1W0WA 2FZ3B 3V0WL 3QFDA 3I02B 4Y7OC 3E1ZA 4IKKA 2A3TA 4JMNA 5C08D 4YBQC 2AI0L 4KUCD 3S37L 1P0SE 4JL2A 1P7QB 4B50A 4OGXL 4HUVA 4ZUSB 5FGRA 4DEUA 1XF4B 3VE0B 3BGMA 3KYAA 4R26L 3FB5B 3U0TA 1MLBA 2BP5M 1MAKA 1NAMB 3FU3A 5HHPB 5CO1A 4R5XA 3H54A 1C1EL 1KLFB 3SEPA 4X6BA 3BEWB 1HH9B 1NSNH 3WFDH 2NY2C 5F9JB 4Y2DA 4ZMWA 4RGNE 2FIKB 1F3DH 1YVLA 2XU9A 2XC8A 3ZRCC 3FU6A 4MVBC 3VFPB 1QP1A 3LYRA 4JFOA 4XNYL 1MFCL 1WFTA 3EO1B 4TRPL 3N1PC 4XCEB 4G71B 4MNQA 1CU4L 3IMWA 3QZNA 2AF2A 4WJG3 4Y5VC 5CJQL 3F8UB 4GG8A 3UJTH 2A73A 1QWUA 2R29A 6FABH 2IFFL 1RU9L 2NY4C 4CU6A 3TCXA 3VI4E 2PXYD 1F4HA 4H0IA 3UG3A 3IMRA 4BE6A 3BVWA 4J1UA 4A1RA 2CR0A 1XGPA 4PB0H 4UIMA 2ZG3A 5SWZE 2OMYA 1ZMYA 3CPUA 4N8VB 1AHMA 3O6FD 3KPLB 1SOQA 1T4KA 1E3ZA 1UOLA 4CVXA 3F2LA 3TIEB 1C5BH 2G3NA 5DJ2B 3F01A 1KG0A 4ZMYA 1M42A 4Z18A 3GKWL 1OPGL 4HIHB 3TBBA 4LP8A 3KBPA 3PYCA 2GJRA 4FQCL 5DD0H 1KT2B 3NTCL 2R9HD 4U3CA 3NFPB 1T3FA 3WXVH 4CVZA 1S7VA 2XN9B 5JW5A 3MCKB 3DSFL 3MI6A 1USQA 4K5LA 1UVQA 3RWGA 4NAJA 3BVNB 2J5LB 4XN2A 3K2KA 3P0GB 1PKQA 3KH3A 4P2YA 4LSTL 1KY6A 3VXNB 1ZA6B 3Q5YA 1NOLA 43C9A 4AVKA 3QFGA 2DEYX 4Y19A 5D6CB 4PY7B 4L0ZA 2GSGA 3ABKB 2CIIB 2PYEB 2ZSWB 4YSQA 3AG2B 3H6JA 3D69B 1CLOL 2DWEA 4IYKA 4PGBA 4R4FL 3PWNB 4AGQA 1GGIH 2J88H 3G6JA 5C0EA 2BDNL 1JWMA 3AU0A 1NCGA 3F12A 1AE6L 1H3GA 2XXGA 2N7BA 3FHQA 4QHKI 5MP6H 3GRWA 3ZE0B 2VDRH 1WBYB 2WKLA 5ESAA 1S7SB 1TCMA 2PWGA 3KPSD 3RTQD 2F53E 2BVUA 2ID5A 4H13C 4U0RC 1IGJB 3C87A 4DQAA 2JXMA 1AHWA 4RDQG 3LRKA 2EYRA 3ES6B 2QSQA 4PJ9C 2DIAA 3MQIA 4AV5A 3E3QE 2Y07L 4YHLH 4PEEA 4AYMC 5FXCH 4HK3J 3S88H 1YJDC 5GGVL 3KYKL 1EXUA 2V2TB 4AZUA 3I9AA 1AKJD 2FX9L 5FYLH 3AABA 4G80B 4PWIA 3BIKA 4X0KB 4DW2L 1EANA 4JFDA 4N2BA 4JY6A 3EFFB 3SCMB 3RQ3A 3UABA 3CIQA 2DAVA 3L5HA 4GKZB 3KVDD 1WH0A 4APQD 1YO4A 2AFNA 1GCFA 1EH9A 4BFFA 3UFIA 4RAUB 4TUKL 1BM3H 5AOKA 2JVUA 4AE1A 1XCQA 5DVPA 5D5ME 2WTRB 2VXVL 2CCVA 3DOHA 1C7SA 2CIKB 3UTPD 5BV7B 4X5XB 4EI5A 3LH2L 3PGCA 4XI5D 4I3RL 4GRWH 2OZ4H 2NR6A 2QQQA 3LIZH 5HGDB 2Z31C 3KJ4B 2WOYA 3KLKA 1MCCA 1I9RL 1QR1A 2X0WA 5C0CA 1OAZH 3C6LD 3OX8A 1T6BX 4IRSB 2ZXQA 4S10A 1EQWA 4G9DB 2ZAGA 1Z9NA 5D96B 3CQPA 2A9AA 4F27A 1JP5A 5EBLA 3L5WB 2KBGA 1KCRL 2BWIA 4G59C 4WHDA 2COVD 1ORSB 4U6TA 2VAAA 2XY1A 3HAEH 4K5PA 5KSAA 3U2SB 4B7IA 3OKKA 5HHVH 4QHNA 5C0DB 2ZKMX 2W81C 3T6ZA 1S7RB 1AY1H 5ESQA 2AS5M 1O9ZA 1AGEB 4WUKH 1DVZA 3ARDD 3O3EA 4O2FA 4LESA 4PJHB 1R3LA 5C86A 1OOAA 3RVTC 3D3VB 3IMTA 1HL5A 4OLUH 2RQ8A 5C3TA 2ZD0A 5CEZH 3G5ZB 2QPUA 3KE0A 4LCWA 3WO4C 5AVQB 2GJ6B 3D0VB 1J1OH 2GJZB 4HJEA 2L7EA 4KVCH 1NFDA 4AIOA 1AIFA 2YSSA 3KXFE 4ZPVB 1A14H 4I89A 5CJXC 3FN9A 3L1FA 4LRNL 1MCQA 5AWNH 4QYOA 4DP7X 4EIBA 4OD1L 3GSVA 5EUOE 1Y7VA 1WISA 4WTQA 2ATAA 1ZA3A 3AROA 1KNOA 4H26A 2CCWA 4GUOA 5DJYB 1OGAB 2YK1H 2VM9A 3DHPA 1JWSB 2V2WB 3IDXL 4WW1B 2CNZA 2CJSA 2P48B 4LLQA 1X5AA 1K5NA 3RI5F 3MSPA 4AMKH 4CMMA 3BWUC 1I3RA 4K8RH 4YSTA 2A6IA 4ODWB 3WJJC 4U6VH 1GGIL 2J88L 2IQAA 3EYSL 5F1NB 3RKDD 3SY0B 5MP6L 4QOKD 2VDRL 3QCUH 3IK2A 5C6PB 1AOHA 4B3EA 2AEOA 4PGCB 4QO1A 3ZKSD 3ERXA 4R4BB 4DZBA 2CLVB 3SE8H 3QIUB 4YZFF 5KBMA 1CYXA 4LVHB 4Y5VA 4PREA 4NYLB 1OLZA 4AQAA 3TBYA 3K71B 1WA2X 1NH6A 2CGRL 2FJGA 3KS0J 1X5HA 1ERNA 3SQBA 1A4KB 1HEJC 2VXUH 5FGCB 3MBED 5EF2A 4M7ZC 4CA4A 2PF6A 4G8GD 1KBGL 5FYLL 2H7WA 4R96A 1V27A 2EIJB 2QR0A 1LO2H 1RQ5A 2J5WA 3STZA 4UT9L 4QT5A 1J1XH 1H8SA 1WS7A 4KAQL 3L7EA 4NQVB 3T3MF 4ADGA 3W2DL 3WHE1 4UM8B 4BINA 1P5VB 1JZ4A 2LAGB 2WXOA 2P28B 3IJ9A 1BM3L 2Y25A 3N1FC 4GIAA 4PM1A 1CCZA 1KYAA 4OKDA 3TV3H 3QNXB 1NBYB 5FFGA 1S8DB 1GL4B 1UG9A 4JGMA 3VJ6B 3WXWL 4LIQH 1KGWA 2YQBA 2RR3A 4P5KB 2CO6A 4F7PA 3FCTA 1KTLB 1OAZL 1URIA 1U58B 1GHFH 4KRMB 4AX3A 2UY7B 3FQTA 3GJEB 1I1YA 4ZFGL 1IAKB 3NIDE 3EH4B 3SPCA 1FNSH 2D7TL 4KFMA 4TLSA 2E3VA 2FSEB 1UURA 3IFNH 4TLKA 3QQ3A 1TJIL 5I1GL 3SKJH 3UYOD 2WCSA 4DEPB 4DAGL 1OT2A 5GGQH 5E8DL 1HVXA 5HHVL 5KJ4A 4JPWH 3FQ4A 2XXCB 1AY1L 4ANKA 3LEYL 5E8EB 2C9SA 3ZDZF 2VM3A 2GT9A 3CFTA 4WUKL 3LN5A 2X38A 4ONFL 4MNHB 3DX6A 5ALCH 3SKUD 3DX9A 3IJ7A 1MW2A 1FG9C 3FMGH 5JUEH 4KOCA 5C09E 4JCMA 2BNRE 1IVTA 4BZYA 2K6ZA 5GRJL 2Z92B 1J1OL 2XZQL 4HUXB 3AG4B 3QDJB 4PCYA 3OAWA 2R0WH 2ZYSA 4Z3JA 2H26A 4PJ9A 2XKNB 1UZGA 1OP5K 1FL5A 1RV6X 4JFTA 4AJVA 1EEZB 4AVHA 1FLTX 5FM5M 1FJ1B 2FIRT 3U4EA 3OXSB 5GSRA 3A22A 3Q6FA 2OBGA 2LLNA 1INEH 4PLJD 3QYNA 3FRPA 5EOCJ 1T5KA 3TASA 4G5ZH 4MX7A 3A23A 3ARUA 3W0WE 2AXFA 1G87A 3TPUA 3ZRSA 4W1TA 1VFOA 3QWOA 3UPCA 1UH4A 1ZIBA 1FC2D 3QUZD 3WDHA 2FBOJ 1CDYA 3W39B 3P3YA 2J44A 3QJHA 4AMKL 5HI3D 2ZOUA 2HLAA 4D7PA 1TZHA 4K8RL 2ZWNA 4IJTA 1HESA 3NFNB 3OKLA 2E8ZA 4U6VL 2GPZA 4X6DE 1OSZA 2GI0A 2Z31A 1BQHB 2OMUA 1JGUH 4S1RH 3V4PA 3VA6A 5I17B 5EC1B 2VWEC 1WAAE 3REWA 1JF5A 1W0VB 3TU6A 1JZDC 4YFEA 1BAFH 1A3ZA 3SGDH 3GNML 1NPJA 3NZSA 3NJLA 1A4BA 3T0EB 3DSNB 4WCYL 4C56B 3SE8L 2VLKE 4KKCD 1M7IA 4UQ3A 2DWSA 1C5CL 4M3KB 2K6WA 4ZXBD 2CWRA 2LTQC 3MN8A 1AYRA 4LF3A 4XVTL 1KPVA 3ZHNA 1PFOA 4OF7A 1IQDB 3C8KB 3IDMB 3OKMA 4W68A 2VXUL 3AB0B 5T33L 4XO9A 3GIVA 4FDWA 4ZMQA 3TBSB 1C12A 4K73A 1TETH 5ADPH 4U6HA 1SOXA 1LO2L 2ADJB 2WJ5A 1DE4B 4GKNB 4ZQTA 5FO8B 5E03A 1DFBH 2L7JA 4UB0H 2NY1B 3MV01 4I9WE 2YSTA 2IH9A 2Z9TA 3K1KC 5FYJH 5CEXB 1GYUA 3K6FA 5EHFA 2EXWD 4NZTH 1KYOJ 3TV3L 4UT7H 3WJMA 4JW3A 3OB0H 2J1KA 1OCCB 2V17H 5CJXA 1SJXA 1BZQK 1JF1A 1TNMA 2IPKB 3BKYH 3D12B 3B2UC 3EO0B 4LIQL 1SEBA 4YR6B 4TQ8A 2KZBA 2R29H 4DN4L 1OGSA 1FCGA 2BLFA 4AVIA 1ACYH 1NC2B 3MYZA 2ZP9A 3KJ6L 2JCCA 2DWDB 5IT2H 2V9UA 3UBXG 1FNSL 2DTSA 1NCOA 3TBTB 3R0NA 5GGUA 4OCXH 4XX1G 4DFHA 1QSFA 2CHWA 3PREA 1NIEA 3NJVA 3PF2A 3V0IA 1MJ7H 4WWID 2X7LA 2J57A 5GGQL 4MCYA 3V0VB 3WJJA 4C47A 3GKZA 5DZAA 2VDKH 1RJZA 3OKYA 2Z4TA 5T3XH 3GGWA 3M1OA 1PW3A 5ALCL 2NLJA 5DO8A 4WW2F 2VR3A 4YPJA 4H8HA 2IADB 1PSKL 4H7VA 4PJEE 5A2AA 3AMKA 4EI6B 1R3JB 2NXYC 2ZYHA 1FCCA 3JWNG 4YAQA 2X89A 5HYJB 1A6AB 4KHTL 3JSSA 4QY8B 1UATA 4GMTH 1AO7B 1ZVSB 5B38A 2K9UA 4DJMA 5F7KC 2XKSA 5D1XC 4JFFE 4Y16D 1BVZA 1A7OL 4JDZB 3TH2T 5IFAH 2W9DH 2PYFA 4PJ8B 3MBWB 3VXTB 4P2RD 1INEL 1AD9A 4B7LA 4PJAE 5IUSA 1P9MC 4OCRH 3SBWC 1RJLB 1UD6A 4IK7A 3T65B 4A68A 4RAVA 1YLBB 3LEXB 2Z6FA 2ZOOA 4HEPA 3AQZA 4OB5L 3GSNB 1PYWA 2AP2A 3PQYE 5DTFA 3T0WA 3UAAA 3VDAA 5CD3A 2RQEA 3GRWH 4JRFA 1KTJA 4LDLB 2I85A 1I1AB 1MFEH 4A7VA 2YN3A 4A7QA 3K81A 1U3HD 1SLWA 2G9HB 4Z78A 2FEDC 3N41F 5L2KB 1Y0LA 2D4DA 2P8PB 3NIGF 4FMKA 2WSDA 2ICCA 4Z7VA 4EQ3A 2P5WA 5T5NF 2NYKA 2BVQA 1QPXA 1HQ4B 2JCWA 3EG9B 2NXZD 3ATBA 3QH3A 4YDJB 3FL7A 4OJAA 2F7IA 3RZWA 2F54B 4N9GA 3FT2A 1KB5B 1PLGL 2PPAA 5J0BA 2YLHA 1S5HA 5BJTA 2W0FA 4B3VA 3KWUA 1FYTE 2VOTA 1FL6B 3DX7A 4HOXA 1WCBB 1P1ZB 4FC3E 4WHCA 3GRGA 1BF2A 1BZDA 3HZVA 4H4NA 5D2NC 2FCBA 1B3JA 4FNPA 3SGEH 4LL4A 4L8CA 4YIQA 3T3MB 3P9LA 5ADPL 4ODHL 3UBXI 4L5FH 4YMPA 2LE9A 2XV2A 3S3SA 2RALA 3B5HA 4G9FB 4MB3A 4QNPF 1DFBL 1KOAA 4UB0L 4B0MB 5CZRA 1AI1H 3CH8A 3SBPA 1MCBA 1OTSD 2FEEI 3K8MA 3ZX1A 3ARVA 1DSFH 4W6WB 5BXFB 3BKCL 5D7JC 2R23B 3AXHA 3L9EA 5K1VA 3L3KA 2AW2A 3R4RA 4ZNCD 2BP8B 4L9LB 3WN6A 4NZTL 2WXMA 3VD1A 3N0PB 2IDCA 2ZG2A 4R7NA 2OS7A 5JIKA 4YXHH 2AMGA 4NNXA 3QO0A 3QP3A 3ARFB 4GRLB 2VDQH 1FL3B 1NUNB 3SKNA 1XAKA 1YEHH 3VFVA 2R29L 1RHHB 1BVLA 3I3BA 1ACYL 1Q9LB 1KZQA 1U9KA 3BP4A 5K9JL 3QPQD 1H9DA 4KRNA 4XPGL 1TPXB 2B0SL 4HA1A 3RVXC 4HX1A 4M8VA 1MPAH 2QKIC 3A4DA 4NN6C 4OCXL 1IM3A 3UPRA 3E9UA 1J05A 2H6UA 3ILPA 4Z7OE 1A9EB 1MJ7L 4NKMA 1ZGLM 1SBSH 1X7TA 2IANB 2VZUA 5HDOA 5I1AA 3F84A 1X6NA 4JO3L 1WRFA 4Z76A 1A4JA 1Z3GL 2P24A 1UYWL 2EXYC 3MOBH 5C07D 4NHUB 5T3XL 4IHBA 1CE1H 2FB4H 1TQBB 3H42H 4X7EC 4YE0A 2PKDA 3FT9A 1JV2B 3IWUA 4BCZA 1N0XH 4BDVB 4FABH 4X7TB 4MQTB 1FWXA 2GFBA 4J8RB 4HWBL 3QO1B 1BLIA 3BRDA 2BSEA 1GJIA 3ME0B 3U30C 4QRRA 1G7JA 4K94C 5AOIA 4P4RA 4YDNA 2QVFB 3B6SB 1MHEA 2HAZA 4GMTL 4KGJA 5TQ2L 1AQDA 4R3SA 3S96A 4GRMB 1J8KA 4ZRGA 1OARL 4PV9A 5CGBA 3AUWB 1M2OA 5EN2A 1FN4A 1LNUA 1MG2C 2LGNA 3SOBH 2YPLB 1YNTB 1AS8A 5DVOA 2W9DL 5IFAL 1LQSR 1E2ZA 1ZGLA 4ZFZA 4ABQA 4O9HH 3NJMA 4JRXA 1I8MA 4MMYB 1OK0A 3INUH 4OCRL 4MJ6B 3ARRA 2B1HH 1EPFA 1OO2A 3LTVA 3L5IA 5LGYA 5FECB 3TESA 3RI5K 4DKDC 4K9JA 1N7ML 3OMNB 2NDGA 4RH4A 5FHBL 1PZ5B 2E74C 1V55B 3WKML 1V54B 2ATPA 3ASWA 3U1QA 2BNQE 3QHFH 3QPXL 5JDSA 4UU9A 3VWKC 1RPUA 4DF9A 3PWLA 1I82A 4BKLB 5DRXA 4AOFA 1QBMH 2HTLC 1SVBA 3GSWB 1MW1A 3VM7A 5D7IE 1A7BA 1JXKA 2W07A 3DHJA 3TA3D 2P46B 3NRQA 1PTZA 4ODBD 3VXPA 4PTTB 3Q2VA 2E4FA 3F58H 1KEMH 2WKGA 4NC1C 2BVPB 4KNUA 1IGYB 2QEJA 2QSVA 4FFYA 2X53A 3MHZA 5A2JH 4KMQA 4NUPA 4NLHA 2XIBA 4QEGA 2QPDB 4NZ8A 4QXGH 2JMRA 5AENA 3FB6B 5B1CA 2NUPA 3F64A 4ALAC 3L8QA 1KCUH 2BOBA 4GS7B 2O5NA 4PR5A 4UBDD 1NCWL 4KJYB 4L2YA 2G0LA 2HTKC 2Y5QA 4JM2F 4L5FL 2H1PL 4YEEA 5DVMA 1JWUB 3FH5A 4F8LA 4POZD 1AI1L 3K0YA 1OCZB 5L4MA 4MHHG 3QA3B 2AGJH 3M8OH 1R34A 1SXSA 4D0BB 4D9QE 5D1XA 2CLZB 1MHCB 3FFCE 4OZIA 4MD4B 1J48A 3MTXA 2MKWA 4LZKA 2VN4A 2UXTA 3BAXA 3VXMB 4GKOA 3SZKC 2F8IA 3G08A 2Q6WB 3FUMA 4YXHL 5CJOH 1D7CA 4JRYB 1XFPA 4PW3A 3WENA 2VDQL 1D9KD 1P9MA 1YEHL 4UINH 4QWWD 5AVRB 3SBWA 1XL6A 5BS0B 3QPKA 2IDUA 2X05A 3V7AE 4FXGC 1O7SA 2ZICA 3FN0H 2ICES 3IDYC 3ZXAC 3C60B 3EJZC 5HHQB 4JO5A 1E28A 2FJUB 4JR9L 1MPAL 4KHXH 1KLGA 5G4OA 3PY9A 2ZOLA 4FFWD 5DR5L 1CJYA 3Q8CA 2FQEA 4DVRH 4C83B 1IKNC 3U6XS 1TQCB 3RVWD 3JWOC 2HX7A 3MA7A 1OL0A 5D1ZC 1I53A 1NUFA 3SQRA 3U9PH 4JJ5B 3AXLA 3UIZA 2HVKA 3KYMB 4WW2B 5E8PB 1MCFA 4XP5H 3ZHKA 2CK0L 3S4SB 2FB4L 1G1KA 3KLQA 4PRPE 5FCSH 2C7UB 4GBXC 3LDBC 1L7IL 1YJDH 3V6FB 5DMJB 1N0XL 2HJKB 1PL3A 4Z3EA 1LEKB 1K8DB 3WS3B 1I85C 1I7ZB 3DV6B 4G7SB 3N50A 3P30H 3VYPA 4M61A 2YKLL 3A24A 3H3KA 2I27N 5C0ND 5E4EB 3VFRB 3VI3B 1HHHA 3B3IA 5T1KA 2AXGB 2OCJA 3SOBL 1YEKH 5D2NA 3RFZB 2P3YA 3OKEB 4XN4A 1LDPH 4HD9A 4MD5A 2B1HL 2CMRH 4HXBL 2EYSA 4LSUL 3CQQA 3FU9A 3V4PH 1HYRC 2VN7A 4F9LC 1QRNA 4FCAA 1HWWA 2WCGA 4N0RA 3BMWA 3BP6A 3TF7C 4KMTH 5D7JA 3QDME 3N41B 3MRBA 3NIGB 5FYKD 3KLAB 3UTSB 1JXJA 5IGXL 1F11B 5IBTH 2BIMA 4FTVB 1IGFL 3EOBB 1KFAH 3B4NA 1E5BA 1I8LC 5E6RB 3X14B 5EZLB 5ISZA 1QBML 2P7TB 4MJIE 4OCYH 2XX0A 4GKLA 3RLSA 3VRJA 3PIQB 4MHHI 1YUHA 1YMME 4X9YA 1CF8H 2H6PB 2ZCLL 1SMDA 2OMWB 2QKIA 4GQRA 3MLPA 2JQZA 1J5CA 1XSIA 2CKBB 3DDFA 4HHAA 4P4KD 1T04A 3VQ1C 3LKQB 2O4EA 4XCYA 4DGYL 2VJ8A 1RUPH 4GG6E 2FJHB 3IN0A 5CXPA 4QXGL 5JO5B 3WV0A 3GXUB 1WFJA 4JY5L 1CYGA 3L7FA 5J11C 1T1XB 3HLAA 4RDBA 4E41A 3GEFA 3RUGE 4MFHA 5LNGA 3LNDA 1U0QA 4WUUD 4KXDA 1SDDA 3FZUC 3NZ8A 2W38A 3BZEB 4PS4L 5D5MF 1Q1PA 5AAMC 2H3XC 1NFDF 2FX8H 1WA0X 1KJVB 1XR9A 4YHZH 3BO8A 4RMUA 3PV7A 3BQUC 5KVGL 3MRCA 2QV4A 1TXKA 4L4TB 4PJXA 1I3VA 2XTJD 3TGXA 4ABVA 1JPGB 1WO2A 3DWTA 3IBOA 4N0YL 2P45B 5CJOL 4OZFG 1A1OB 5AZEH 1NCCL 1MELA 3S36H 1DQLH 1X9UA 3MO1A 3GPSA 1XL4A 4WU5B 1DJGA 4XNMA 4HH9A 4UINL 2C9QA 2NY3C 2ZNXA 4ZFOB 3GBDA 3PHQA 3HA0A 3HUJB 3BVTA 3FN0L 2O72A 2OSLA 3WHE0 4XOCA 1HWGB 4NO0A 2OV0A 5FYLE 4PJ5A 3VSUA 4A63A 4YDVA 4PJGE 4NN5B 1WBXB 4LRIA 2KS0A 2ZCHL 2ILLA 2HJFA 3VWKA 2P5EA 4OZ4B 2G5BB 2AERT 3WUWA 1EFXD 2JF1A 4E5XA 1NCHA 2X4SA 2WMPA 2HJLB 4CJ0A 1EZVX 4GRWE 3BZFB 4ONHB 2YGQA 1PZAA 4YGVB 4IDJH 4PRID 1MI5D 2C8NA 3A5VA 3IGFA 4IBWA 3P30L 1KJ2H 1JGIA 1QPKA 2BY0A 4X99A 5CILL 3OJVC 2FYVA 1AGDB 1F45A 1BGXH 1BEYH 5DZ9A 1CWVA 1UT1A 5F9OH 3N3EA 5SWSA 4AGNA 3ROLA 2ZX6A 4LLAA 1U95B 2GBTA 1YEKL 2IMNA 2X4RA 1WZ1L 5KWYC 2ZX7A 2OCFD 1O6TA 4ZG1A 3L3JA 1CC3A 4WNSA 1ZV2A 3U1PA 1E9OA 2VLRE 1Q0YH 3UADA 3ZUNC 5SWZD 3ARZA 1T1ZB 3UYPA 3ALXA 2XWBB 2ZG1A 3PGDA 1WPCA 4IQHA 3EXLA 2JIXB 4RQQA 2XTLA 4JQIL 1KEGL 4FQLL 1U36A 3MVSA 3V2AR 5KYXA 2YD5A 1CFNA 3MFGB 3ZKMD 2OULB 4XNDA 3ULAB 1D5XA 1JPTL 4YNYB 5I76B 1NTDA 2H9GB 5IROC 5IBTL 3N1MC 2P8MB 2N0KA 2CZNA 1PX4A 3MNVA 2DJUA 4MCMA 1KFAL 3RBGA 1F3JB 3P02A 4R0LC 1SYVA 2E9GA 4NQDA 1S7WB 2XWTB 5JDJA 2ESVE 3CHPA 4FXGA 1MCSA 3LY6A 3QQ9D 1GY1A 5AAPA 5BUAA 1CF8L 4APQC 5GZOC 3QORC 4Y5YC 2ZKYA 2Z4QA 2R2BB 2VDMB 4D94A 1IKNA 3EJCA 4AQOA 3SB3A 3OPZL 1GA2A 1JRHI 5D1ZA 3FONA 9PCYA 3V6OE 3QIWD 5LDSA 2CO2A 1REIA 4DGIH 5DJ0B 4JM2B 5HD8D 1NDMA 1U8NB 3H3BC 3PDDA 2EIZA 3FFDA 1WEJH 5JYLA 4GBXA 3PFUA 4Z9KB 3OB8A 3GEWB 5IW6A 4NQXA 2B9BA 5HI5C 2DF3A 2LR4A 4IHOB 4UYQA 5IQNA 3S5YA 1I85A 4Z7UA 4U3XA 4MJ5B 3UTZA 4BH7A 4FNLH 2LLLA 1QFUL 2E7DA 4YHZL 4Y4KB 1UWGH 3OR6B 4ODVH 4WO0A 2B1AL 1CD8A 1E6OH 1A3LL 1MSPA 1ZT1A 3OWRA 2BVOB 3QC6X 3IPBA 4RGNB 4HCRA 5E4AA 5CHNB 4LGRB 3S36L 4BFJA 2J55A 2EJ1A 3OKNB 1AZNA 4U1GB 3DVGB 5CZVH 1RZIA 4JPQA 3QQ4B 1RD6A 5KVDL 1DBML 1RH8A 3GMQB 1TMCB 4F9LA 3MRJA 3EIFA 3ETBJ 2LU5A 2H5UA 4NIYE 2IV9A 1IGMH 5CMAA 1NFIA 4JPIA 3JV4B 2DY2A 4N0CC 2IPTH 3MACH 4PPTA 3BPNB 1XB8A 5I82A 5IM7B 3WFHA 1OAXH 4N6RA 3SKMB 1I8LA 4HUUA 1ZK9A 4DKTA 1LE5A 3IXAA 3OJDB 3KNBB 1ONQB 4JFYB 1YECL 4S2SA 3DETC 4U1HB 1CF1A 1DBAL 4OU3A 4UQCA 4XCNB 4IDJL 4MMXB 5HYFA 1T5XA 4LIQE 4NP9A 3KM2A 4U33A 4GT0A 3FNKA 1HNGA 1KJ2L 4V1DB 2TRYA 5LN4A 3EHBB 4HS6B 2VZ1A 2X09A 3BVDB 4HJ0D 1BGXL 3C08L 3WD5H 1AR2A 3W5NA 3ESMA 5DZOA 5BRZD 5D8JH 1G7QB 1AJ7L 2PWDA 5F9OL 1O0VA 5D7LB 2V8MA 1P69B 4BIKA 3O2DA 3M17B 2VDPB 3LQZA 5DFVC 3D50A 2DTMH 1HCYA 4K7FA 3O3AB 3PABB 5L9DH 2H0FA 2O1AA 3QXDA 1JZ3A 3B8YA 4HUNB 5CD5D 1V05A 3FCBA 5HVHC 5AAMA 1S2EA 2EDXA 3GZKA 3QRBA 3QARA 3QYCA 3PS6A 3U6RB 4G83A 1FZJB 4L3ED 5TDNA 1IC4H 3BQUA 4OLWH 5C0BE 5TPWH 3UTOA 1LK2B 3D9AH 4NRYA 4X6DF 1WD8A 3S2CA 1I8KA 2YR3A 2YD7A 5IEHB 5DEFA 1YSOA 4NT6A 5ACZA 2F53B 2HN7B 4ONOA 3MRLA 3TPKA 5K9QG 4FFYH 4HJ1A 4XB7A 1KIRB 2NW2A 4LGPB 3DX8A 1M7DA 5D72H 5E2VH 1MJJB 3CVIL 2CXKA 1UKQA 4UQ9A 1LK3L 3AACA 4NQCE 1FVDB 4D7BA 1XSJA 1ZE3C 5IESH 4PGZA 3EDEA 3HBPA 5IMOB 3UC0H 2AABH 5DWPA 5E08H 1JFQH 5I9QB 3ELQA 4Z7WE 2UWEE 3FT3B 3DXAA 3HZMB 2BC4A 4EN3C 3V0GA 2I24N 1A9BB 1CXFA 2E5EA 1ZLVH 4XWGH 5DS8A 5EG6C 3GZOA 5KOVC 3IFOA 4DGIL 5C0JA 4XE5B 1XIWD 1VFBA 4FEMA 4IGBC 1EXGA 5CBAA 2IAAC 1VEOA 2AITA 1P7KB 1ZDSA 1JNNH 5D5MB 4PJCA 5TFSL 3CHQA 5I30H 3DK0A 4X5LA 3AWFA 1GTFA 2KZWA 1NBQA 3ARBD 1F58H 4PJDE 4RCAA 1CI5A 4FNLL 4L0YA 1MAJA 4DOHE 3BFQG 2GCYA 4UM9A 4HGWB 2PWHA 3B34A 4ODVL 3B7RL 2A77L 3H2PA 4NN7C 5GS1C 1E6OL 3WMSA 3VB8A 3QK0A 4YSCA 2F7QA 4MAYC 1ADQL 4NPJA 1MREL 4XH2B 2QT6A 1BAWA 3IDUA 2WZPA 3CDZA 3V4VA 1P4LA 4Q7DA 3QUYD 5E23A 3O3UN 1PJ9A 1RZQA 4BWUA 1R5VA 3E80A 1N10A 4MWFA 5KSUB 1ACXA 2B7DT 2DI9A 3T6VA 1BYNA 2EKSA 2AQ1A 3GSUA 3RPIB 1HSAB 3HCVB 1XGRA 3KYOA 4Z7VF 3ZJAA 5IROA 1TSHA 2IPTL 5FLVA 2VLJE 4F9PC 3MACL 4MXQD 3M45A 4PWHA 1WGVA 1KYFA 4J3SA 3LS5H 5IHUH 4IBYA 1R6VA 1AKJA 3FUJA 4AJ0A 2Q7YA 4PLJC 2WV3A 2XNAB 4R0LA 4OLZH 3RDJA 4I2XA 1OT1A 1YEIL 1MRFH 4PCSA 1NCNA 4PCTA 4BRVA 4WFFD 5DJ6A 3VH8B 3GMOB 1OSEA 3KXFB 4APQA 4TTDD 1OOWA 1SJEB 1QBLL 3QORA 4Y5YA 4ZUUA 4HIJB 3WLWD 5BQ7B 5GZOA 1RIVH 1LO4H 5E6ID 3FFOA 3JBG7 5IEKA 5D8JL 4UZSA 1IBYA 3DIVA 1P6FA 3TN0B 5K9QI 3P9WB 1BJ8A 3BN9D 1YY9C 2NT0A 1OY3B 5DJAB 3V0JA 5GS0L 2R8SL 5HTSA 1SJHB 5L9DL 3MREB 4QLRA 2EC9T 3WN5B 3ARWA 4P2OC 3TO4D 3OD3A 4HKZA 4AITA 5C09D 3DVFA 1EHLH 3AM8C 5T3XE 2BNRD 3IPFA 5SV4A 3P0VH 1IC4L 5IOPB 2RIKA 4OLWL 2WBJD 5HGAB 1NIFA 4J2QA 4LLDB 5GISL 2JTYA 1P7HL 2I7SA 4QJ3B 4F2EA 3QFJB 5FX3A 2PP7A 3VW3L 1VERA 5DRNB 5KSBA 2WCPA 5LXGL 1LDSA 1E8WA 3QWRA 3LCYA 3FPYA 4D0DA 2IAMC 4FFYL 4DPBX 4YSUA 4L1SA 4K23H 4WKZA 3S0PA 4KTGA 5FW6A 5D72L 3RNQB 5KEZA 1PKQE 1GZPB 4G7YH 3RAJL 2G5RA 4Y19E 4MS8C 2IWGA 3DMMD 4NNYA 3SDYL 4WKXA 2V3FA 4C8XA 4KXZH 1KYOK 1CR9H 1R24A 3UC0L 1JFQL 4M6OL 5AAWC 5T1LA 4XNAA 3G6JE 1E7VA 3BAJA 5IW1B 2JI2A 5B39A 1FNHA 5DMGC 4MTMA 5KBNC 3MZGB 4K94H 4W9KC 4XWGL 1YN7A 5HYSB 3MV8A 5MHSE 4WI4A 4WFGE 4HJSA 5B1BB 4GPVA 3EYVA 3PL6B 3HB3D 2J8OA 1U8CB 2Y7OA 1MFVA 1NCJA 1MCRA 3LZQA 3MRRB 3DRQB 5F7EH 3WG7B 5C1MB 1MUJA 1SN0A 3EBGA 5LQBH 1WQVT 4WWKB 5F8QC 4D8OA 4KK8C 1JF6A 1MHPL 2DM4A 2C4FT 1KLUB 3B9KD 1F58L 3MRGB 3SOTA 1HWHB 2H32A 5HI4D 3ML8A 3ZKND 5I2IA 3T6WA 5I1DA 2VLKD 2BFVL 5DC4B 3JT2A 3VWJB 1YDPB 3DKHA 3VXUB 4FYRA 4ZAKD 2V5MA 1URZA 4CKQA 4DIXA 5LGJB 1T2XA 5J6HA 3GLAA 3ILQC 3MLTB 3NIDB 3Q05A 4LT7A 3WIFA 3K6SB 4JFDE 4EZLA 2I9LB 3BAIA 1DJHA 3WNOA 4AEIH 2E56A 4FQHB 4PJIE 3CFJA 4N2HA 4NHCL 2CDFA 3RPKA 2JJUA 5H4ZA 4I9WD 3QUML 3SPGA 1QLEB 4A6YA 3MUGA 1BZ8A 1UM5L 1D5ZB 4L5FE 2FO1A 3BP5A 3BW9A 1A66A 4D8PA 2G2RA 1XD1A 1CBJA 4H1LB 3BHBA 3MLXL 3ZZSA 2OAAA 3EJRA 3V6ZA 1HXKA 3VDCA 5I71B 5JZ7D 3H9SA 3DTXB 5IHUL 2WN2A 4G8GA 4UTAA 4WO4C 3BAEL 2ZUTA 3U2IA 1L4IA 3N5AA 3G6AA 5I1IL 4OLZL 4GW5A 3P40A 3VFTA 1EUTA 3CMGA 4IOSA 2FR4B 1U8IB 2BXZA 1JMZA 1TVHA 2VZOA 5FOBB 4ALAH 1BYPA 4LASL 3D39A 5K39A 1Q38A 3Q44A 3II2A 2VZTA 3AU1B 1JK9B 3NSFA 3G9VA 3TEWA 3U25A 5ANHA 1PQZA 1RIVL 4RMQA 2X4OA 1LL1A 2H3NB 4NRXB 1ND0A 5B1KA 4EN3A 3VCLA 5JLZA 1B6DA 1EX0A 3D2TA 4U2ZA 3L2MA 3W0WB 1HI6A 4OFKA 5DUJA 3D05A 5C71A 2BW4A 1VZIA 2VW7A 3D09A 3D4GA 3IJYA 4IGBA 5E9DD 4RNRA 3MRPB 4KRPC 2EDJA 3CFCL 4QXTA 5CLYA 4OFQA 4ELDA 2E7MA 1BSIA 1N68A 4X4ZA 3T4AC 2WM0A 4OZIF 1EGJL 1HOEA 3OG6B 1BBDH 3MLWH 2OXGA 1UD3A 4X6DB 1NCDL 1Y6NR 1K4CA 5E8NB 3ZE1E 1F18A 1YC7A 5GS1A 5EWIL 3EYFA 2YXVA 1KXTA 4JFFD 4V11A 2XXFA 1JZ8A 1CGSH 4F80A 3M46A 4MAYA 3RWCA 5I8KH 5KS9E 1MRDH 3SD2A 1CURA 2MOGA 3VD9A 4K23L 3JWOH 2IGLA 4AEEA 2NNAB 1IJ9A 5DHEA 1RK1A 2QVIA 2XZAH 4LAJH 2FQDA 3PAVA 4DVBA 2ZKHH 4BWWA 3NCXA 5EBWA 1BJ1J 4G3YH 3ULSA 3W9EA 3SJVA 3EGSB 3NBNA 3CU1A 4F9PA 1NMBH 5EUKA 3KDPB 3LRSA 4O02L 1FRGH 4AQEA 1L3NA 4WZ9A 4EIZC 1QVOB 4QGYA 5JA9A 2QFPA 5IB5A 1T6VN 4KH2A 3TS8A 1A1NB 2DD8H 3EJSA 1AACA 2J8UA 2HLFC 5SX5H 1NAKL 2AXWA 2HVJB 3FQYA 3HMXA 4HCRH 2OMVB 2O5ZL 3ZVVA 2RD0A 1L6PA 3QEUA 3NP3A 3PXLA 1NBVL 1MWAB 3ZKQD 1A6UH 3S98A 5TH2B 4I4WA 3L95B 3D8MA 1DP0A 4TKWA 1FYTD 2H2PD 3KPRD 2VZ3A 1ZLDA 1HHIB 3QQDB 2GAZA 4Y88A 3BJ91 5J12C 3RGVD 4TULL 2BSRA 2Y6SC 1OCWL 1IAOB 2P8LA 3NCJL 4U7MA 3L5XL 3CZLA 4AEIL 1MCWW 3DJ9A 3ZTEA 3DRTA 3GMNB 1FFOA 4P2OA 3UO1L 4FA8A 3AM8A 2OW6A 4P0DA 4P3CH 4X5WB 1TZGH 3D4YA 1P6AB 4MA1B 3L2NA 1T0MA 3TYFB 3GSQB 5DT1L 5LDUA 4PJEB 2AV1A 2Q2LA 4PG2C 2IAMA 3NK3A 1E27B 2VDLH 4PHZA 4PB9H 5KVGE 3MJ8B 4BSJA 4K71B 2OJEA 3D85D 5C0GA 2XQBL 1KCLA 3MRQB 4ZZFA 4TVPD 4QGTA 2ZWLT 1WD9A 3O2DH 1DJYA 2CGZA 4L1TA 5DLLA 4AJYV 2DI8A 2PP8A 1IILE 4G70B 1ZHKB 4PP2B 1PG7H 4KZCA 5LN8A 2Y7QB 4H25A 3VTMA 3MODL 5AAWA 4PJAB 4Q52A 4WI0B 1HYSD 5GRVK 2BK8A 4Y4FD 2EVIA 1NLDH 4DQOH 4OUOA 3BFOA 5I0VA 3GK8H 3CPLB 4G42B 1G6VK 3T77A 1QO3A 2QGDA 3PQYB 3QJFA 1R0AH 3ECUA 3WEOA 4UV4H 1R3HB 2EYTA 3FKUS 1DLFH 1LO5B 4TQHA 3WELA 1JS4A 2EABA 4Y1TA 4PJXF 3IETA 1SYSB 4LLMB 4AW4A 4OLEA 1KJ3H 3ZO0A 5HVGB 4G82A 3GC3A 4CDHA 4IS6B 4XMKH 5L7XH 4JHWH 1G94A 3ABZA 3NEXA 3V7AG 1IBGH 1WWWX 4BBWA 1QLFA 2DYPD 1CGSL 5I5IA 5I8KL 1PZ2A 4Y2LA 1JTOA 1IX2A 1MRDL 5HHNA 5JPMC 5IMKA 3WTSA 2XT1B 1IEBB 4I1PA 1HEZB 4O4YH 1RUAH 4AM0B 3KYNB 3KDMB 2UYLA 4OI8A 2F74B 2WXNA 3F04A 3TV8A 2B3RA 4G3YL 1HIMH 4GAYA 3WNMA 3HE6B 2AAAA 4X8JA 5HSFA 2BNQD 2OSYA 5AKSA 4A37A 1G9EA 3MCLH 4WO4A 3SDXE 5JXED 2Z0UA 5E99H 1ZV5A 4OV5A 2JKXA 3SDCC 3EFOA 1D9KC 3J7HA 2BPBA 3MXWH 1RZPA 2W0PA 1X5GA 2NUTB 2Z1KA 3CBKB 1LO0L 2YRLA 4NCC1 3B2XA 4HCRL 4JDVA 1LMIA 2VR9A 4OV6F 4WNQB 4O2CB 4KWUA 4LOUC 4YK4B 3RL2B 3IXTA 4J3OF 2EKJA 3MGTB 3ZSTA 3V4VH 1MQKH 4F7CB 5ILTH 1A22B 1B4TA 3DARA 1EAOA 3KHQA 4IK6A 4EXKA 1NANI 2GIYA 1FO0A 1KPRA 2ZX8A 1P4BL 4E0RA 4JPKH 1E40A 5A2LH 4PJBA 3ARYA 4P5MB 4Z7OB 3GS4A 3KLHC 4B5ZA 3T4AA 2KI6A 2FVNA 4QRUB 1N0LA 3U36A 4HIEA 2X4NA 4DWHA 2IGFH 2ICWB 3O8XB 3BT2L 5FCUH 4XRCB 1F6AB 1G9NL 4NBZB 4P3CL 3D34A 4KDWA 3TVMC 2NQDA 4OZHA 1TZGL 4P59H 4RETB 4P48A 3B2VH 1HHKA 5E1QA 1SN2A 3HZYA 2D7OA 1K3ZA 1BPVA 4K2UH 5K69A 2VDLL 4BKTC 2JCCE 2QGCA 5HYIA 2BOLA 2P52A 3X3GH 4DFIA 2X4PA 5I26A 3R18A 4HSAC 4IU3B 1AZVA 3ARSA 3NCYP 3WKNA 2MCPH 3L9RA 1F90L 3LH9A 3O4LD 5LGHL 3N44F 3DLQR 4CN6A 4ZMNA 3OLEA 4RVBA 4K3EH 4LMQE 4X4XB 1EAPB 1OB1B 5FWQA 1MW3A 3HI1A 4F7MA 1AZZC 5KVDE 3MLYH 1J8HE 1H5BB 1KZYA 2B1OA 3CUPA 1XEDA 2DIEA 2YA2A 4KJWD 3T2PA 3PJSA 5KSVA 4WI8A 5ENWB 5EZJB 1IQWH 1B2WH 3I3DA 4UV4L 3WE1A 1X4XA 4A04A 4PRPD 1DLFL 2BJML 3TYGH 4LLYB 3FK3A 2R1WB 4ONGL 3ULVF 1IO4C 2M1KA 5AYTA 1KJ3L 3FO9B 2GK0A 3RGBA 3V7MA 4A67A 4YHNA 4QF1B 4B5EA 3GXMA 3W3BA 5IB4B 1S9VA 2RA1A 4XMKL 5B21A 5L7XL 2V7HA 1N8ZB 4JHWL 3IDNA 4WDIB 4Z3TA 3DX4A 5CLZA 3TCLA 2XG5B 4NRZB 2Y5TB 1SZNA 2MCAA 3ZMEA 2DYRB 1WZKA 2HKAA 5SWQB 1X4YA 1YYMH 1DANU 4I1RA 3ZU8A 1Q94B 4LNRB 4O4YL 3WTWA 4BV1A 1OM3H 3OKOA 4N2NA 4HCIA 4KKQA 4B9ZA 4FYTA 5JORA 2BP0B 2H41A 3VFOA 4M8QA 2DKMA 1XXDC 1VGKB 2ARJQ 3QCTH 4AKOA 1I9JH 3QIBB 3TEZA 1H3WM 5BZXA 3E2HC 1LEGB 1BFOB 3ESUF 4NBYB 2XBZA 2H32H 4G6JH 5IB3B 4LHUD 1QAWA 4PG2A 4QRTB 4BFNA 1ETZB 2GG1A 2AV7A 4OF5A 4BD4A 1TT6A 2YBGA 3BGFB 4MJID 2FTAA 4YLCA 3MXWL 3FFCB 1R3KA 4GH7B 5INDA 2Q10A 8FABB 1XCTA 3OKDB 1JYVA 1YMMD 4FNTA 3R0MA 3V4VL 1LP9F 4C4KO 1MQKL 2ODHA 2WB7A 5ILTL 4JO2H 3HAEG 5F7DA 4F7KA 3T6QC 4FLQA 3FAXA 4G6KH 2BRRH 1S7XA 3DVNB 4A6YH 2E75C 3PWUB 3BUDA 4OCMC 2H1LM 1NC4B 3SDAD 2OTWB 4B6ZA 4DN3L 3OHMB 1J87A 1C08A 4UTAH 5EU6B 4KROB 5LJYH 2EH8L 1F4XH 1NA8A 2IGFL 2QPEB 3MBXH 1B2YA 2Q7AA 4QRPD 5FCUL 2HX9A 4PLNC 1G4MA 4ZW8A 2VN6A 1SVCP 2X9XA 4ZT1A 1ZE3H 4P59L 3QS3A 5E4IA 2Q3XA 5EU5A 3ZLQC 5F7BA 3FPXA 5CGYC 4K2UL 1NBZA 1QQDA 4HJUA 3GMLB 1NFAA 5DJXB 1KC5L 4J4PD 5JPMA 5I74C 43CAA 1ZVNA 2FL5A 2P42B 4ZQKB 2NTFA 2OQJB 1NKGA 2G0KA 5BVJB 4OSUH 2MCPL 3L3DB 5B1JC 2NYZA 3NABH 2WINA 1D7FA 2R69A 5CP7B 4CMHB 3DVIA 1AGBB 5FYLD 3DIFB 5CJ5A 1G84A 2WBXA 3B7UX 3TOPA 4FTDA 2XWXA 3V0FA 4OAWB 3QUGA 5DF0A 3S5LG 2DQCH 3MRDA 2VWEE 3QG6A 1AQHA 3II1A 4NQTA 4I8DA 4XP6H 5FK9B 3P4MB 3SDCA 1D9KA 3VGGA 3LNFA 4WJ5A 5JHAA 4B60A 2G60H 1BZOA 2Z91A 1JUFB 1MCOL 3QDMB 4QRRE 3TZVD 1T0NA 4G6AD 1YN6B 2F7RA 5AW9B 3TYGL 2AK4A 4P23C 1RUKL 5F70A 5DVKA 2JKWA 1PCXA 2FHBA 3LQMA 4JPVH 1YG9A 3QI9D 4P46C 5DS1A 4MDIB 3PV6A 1D6EB 4JFED 1BBJA 2VITA 2CDGB 2XHNA 4JRXE 4WSJA 1IZJA 3LV3A 4P57A 4X6EB 4ZUWB 1U8LB 4QHLB 1YYML 4NUJB 3NCWA 1QTYT 3QAQA 4MCZA 4M6NH 1AZCA 3TIDB 2BMKB 1OM3L 1XCXA 2HG5A 3ARED 4GG6B 2FUTA 2UWEF 3I6KB 1JI1A 4MA8H 4JQVC 1AD0B 1JVLA 2OL3B 1YY8B 4R7VA 5FDWB 1M1XA 3STLA 3GFUA 4FFZA 3TVMA 4F24A 1BD2A 3E6FB 3HMXH 4NAMA 3G6DH 5IREA 3RUGB 2HVBA 5IHZA 5CEZD 2BINA 4JAMA 2IWEA 1UD8A 2VQ1B 3INOA 4IRJB 2CAKA 4HP5A 5CGTA 4UNVA 4F15B 2CJUH 1HC1A 3IKCA 1GIGL 2ADIA 2Y06L 3LMJH 1T80A 4PJDF 4AYGA 1T22B 3QB7C 3BPOB 4G43B 4YXKH 4M8UA 2V9QA 5DHDA 5LBGA 2X0VA 2XG4B 4HKBA 3RVUC 1SQMA 3E6HB 2YUVA 1JVKA 2CBPA 1MH5B 1YYCA 1X7QA 2CXGA 4Y9BA 3L3OB 1RK0A 2XA3A 1FFRA 4G6KL 1M6OB 1Z2KA 1A6TA 1U41A 1W15A 1YQVH 2GW5A 4IW4C 4OVUA 4A6YL 2YBRB 1X44A 3OLIA 1VKXA 4A7GA 3UAJD 3MV9D 3RIFF 3LNEA 4PJGB 5IQ9B 3L5JA 2APXA 4J27A 4F33B 3CXDL 3F83A 5HJDA 1E65A 4H2CA 4DTGL 5E1GA 5DJ8A 3BWAB 5D1XE 1TKWB 1WSST 3L4WA 3MBXL 4L8SB 4UQDA 5DD1H 5F3HA 1U4EA 4P8QA 2CO1A 1PIFA 2PPEA 12E8H 3WIIH 3H55A 4AT6B 5KSBF 3D5OF 1ES0B 3PU7A 1T83C 4XMTA 1G7LA 3FQWA 4HH8A 3D4CA 1LGVA 2WYHA 4ZUTB 5DO2D 3OVUB 4PRHE 4XN5A 2EUZA 4G6FD 2IOMA 2MFNA 5IKCA 1R3IL 4EVNB 3C09C 3AWEA 4JN2A 2NY0D 3V0EA 2WAQA 5E6SB 1LD9B 2EP6A 1S7QA 1FV1B 1SJVA 2APWA 4NLAA 3DO7B 1DQQA 4KTDH 4OF8A 2ODIA 2ZYRA 4N20A 4PGEB 3V5HA 2VLLB 2I07B 1DQJA 2WVVA 1CD1B 4FI8A 3FAWA 3OAYK 4ISVA 2A4ZA 4W81A 4BSWA 3IJ8A 1SHXA 3DA0A 4UAHA 5I5JA 3MKGA 5CLWA 3MRIB 4PRDB 2E86A 4F57L 2VLRB 1NBCA 4TNVF 4GI9A 3N85H 3F65A 5F8RC 4L4VA 1NGYA 3U4KA 1N70A 3BUTA 3NDYE 3RWHB 2VAJA 3UXFA 1P4IH 4XP6L 5JQIB 1MCLA 3UJJL 3JYCA 3LB6D 3TH3T 4U3HA 4GUPB 3PXJA 5E2TH 5FKAB 3SZ6A 4ENEC 2VMFA 4PRBA 4WFEE 4DP8X 2KYIA 3GXPA 1D5RA 4JE0A 5EORH 1XGUB 4QHUA 5AUMA 2UY6B 1GTNA 4B95C 1I7TB 5JHDB 2HRGA 2ITDA 1MFMA 4K9EC 1J1PL 4F92B 1ZHNB 3I74A 1RJYB 1JZFA 2ESVB 4PWJA 3IJEA 2VH5L 1UWEL 5D2NE 3CDGB 3CZGA 4WIQA 1NEZA 4JG0H 1JN6A 4NZDA 1SMAA 5LNDA 1A7NL 5HGHA 4AH2A 4P9HC 2XV0A 2PO6B 2XZCL 4IKLA 1XIWC 1SXCA 4GP8B 4GXVL 4NPYA 5FUCC 4F8TA 1O7VA 2HFGH 2YD9A 1TLKA 1N64H 4JFSA 1QRNE 4LKXB 3ISWA 4M43H 3SDDD 5MENA 1NCUA 4IRZA 4Y2OA 1NGXB 3QJSB 1MI5A 2XVLA 4MA8L 3CIAA 3FT4B 4R7XA 1ZS2A 5EIIA 1DVSA 4UQEA 4BWTA 1KPUB 2D73A 5C0BD 4E9YA 4PTUB 2C3VA 1Z5HA 2ADFH 2HH0L 3WY1A 4AGMA 1CQKA 5J3HD 4WWNA 2EUWA 1XHHA 4U6YA 5T1JA 2FH8A 2YS4A 4LLUA 4ZSOB 4OM1L 3RWDA 2WZAA 4LVEA 1BMGA 4N3TA 3V52H 4OGZA 1HN1A 1AZUA 1ITBB 5B1JA 1HILB 1FO0H 5BZZA 5IJVB 5J9PA 5JR1L 3JTSB 4NQCD 1LP9B 3WFCL 3P54A 1I7RA 1Y18B 2YD2A 1JPSL 2J1WA 4TQIA 4OCSH 2MHAB 1FE8L 1KCWA 1GKOA 2X4TB 1LLAA 1AG0A 1DR9A 4ORGA 5ABAA 4JFPA 2R2HB 4L8DA 3GXTA 2WLIA 4E41E 1XF5A 4PJIF 2NYYD 2FYYB 1L6XA 1S9WA 1WWBX 4F2MB 2Z93B 1S4IA 3MV7E 4IKIA 2XFGB 2EEAA 3ZUCA 3BD3A 4S0SD 2RMNA 4GOSA 4TUOB 4XP1L 5FUOL 5L88H 5A2KH 4HZLB 1OT4A 3GT6A 4P23A 4Q4EA 4ZPTA 2BCKA 2PW2A 3WLWC 3CXFA 4PS8A 3VB9A 4P46A 1UWXH 2J5LC 3AITA 3EFDL 4JLRA 3HE7D 3KEHA 1OZTG 1G1OA 5E5MB 1EZUA 4DKFH 3HJ0A 3UTTB 1IC5H 4F58L 1A6PA 4FXKB 1ANUA 5TTRA 3T1FA 3W11C 5BW7C 4BFOA 4QKTA 1LEIA 2DQJL 4GMSL 1DUZA 3HKZA 1TUPA 4PJ5E 4KTDL 4BELD 4B9JA 1EEYA 3C5ZB 4JQVA 1MFAH 2WXHA 1XSOA 1BQKA 1MFBL 2G4EA 2XZZA 3NSYA 3UEZA 2P5EE 2WJ7A 3T71A 4XC1L 5EBMA 4HBQA 1C16A 5D4IA 5AVUB 2VUYA 3P69A 4I85A 4C59B 4O5LL 2XA8H 3GB7B 5FYJD 3V9EA 4Y2DD 5FA3B 3LZFL 5E2TL 3NCFB 4NC1E 5I0ZA 1GVIA 3VXSA 1HQRB 1BM7A 1DCEA 3BH8A 3PDGA 4K3DL 5CIPA 5D7KE 3UMTA 4ANUA 5A16A 4MNQD 3TCTA 2JKLA 2F9BT 2V33A 1FNAA 3DOSA 2NNXA 1DDHA 1L3WA 3GBML 2HWZH 3SCMC 5JW3H 2ZCKL 4Z8FH 1E5YA 1S7TA 4F8NA 2OTUA 4JG0L 4KZEH 3QE5A 2ISDA 2J1YA 1PZDA 1RZ7H 1A6WL 2CO7A 3MGAA 4Y1AB 1GYCA 4F7TB 3CC5B 1JZEA 2EE0A 4ORZC 1OAUH 2JTDA 3WLBB 4AYFB 1VFAB 2BHZA 1O6SB 2EE6A 3O4OB 4IIQB 3VMPA 1E2WA 5EEWA 5E00B 4Z7WB 1EMTL 5CEYA 4HLEA 2UWEB 1N64L 4PRNA 4NXKA 2Q76B 5F89A 1U8QA 3KJ4C 1YEJH 2B77A 2WTOA 4IRSC 3WFEH 5T3XD 2ZOWA 3ASNB 4FULA 2A9NL 3RIKA 1T83A 3QDGB 1BPLB 3NCCB 3KEDA 3IGAB 2YXWA 4ICXA 1SXZA 2WZ5A 3DX3A 3F7VA 4PQXA 3PNWB 5JA8B 2OZNA 3BD4A 1W72B 4PJDB 1F2QA 2N7AA 4LLVB 3QS2A 4ELKA 4DOHB 4KZ0A 3DO4A 3Q3GA 2RHEA 5ALBH 5C0AA 2VUOA 4ODSH 4JB9L 1FFTB 4YPGB 1TOXA 2WIIA 5EC2A 3ZT7A 3IJHA 3FO1A 3ZE2E 4Y19D 5I1KH 1HS6A 4KI5F 1Y6KR 4HMEA 5JIPA 2LAAA 2Q86A 3TNMA 3G5XA 2OMZB 4ZZKA 2GYSA 4OCSL 2ZOKA 3B9VA 4J28A 1E9PA 3CFKA 4HCGA 2PTTB 4XO4A 1JNHA 1WJ3A 3WHXA 2XYCA 2HRHA 5IMMA 4WFGD 1UACH 3CAFA 1S9XB 5CR1A 4XNQB 2JI1A 4UILH 4WFHD 1U8KB 2PMZA 4Z7UE 1MW0A 3RDTB 1OB0A 4F8QA 2Y1ZA 3LVTA 3D08A 5I16A 3U2JA 4XVSL 2VLJB 5L88L 2N7SA 4HU8A 5B3NA 2WGNB 1QEWA 3LPFA 2WXFA 1F97A 1WIPA 5K93A 5ESVB 4YC2B 1M2VA 4AEHH 3VU1A 2FZ3A 3EBAA 3E0GA 2KC0A 2IMMA 4YHMH 1K85A 1BMZA 1QWHA 2WPGA 3I02A 3D2UB 3MRHB 2RFXA 5D4QA 4CRPA 2R69H 4H40A 2KPNA 5HDQL 3IM1A 1IC5L 2MQCA 1P7QA 3O2WH 4KBPA 4ZUSA 1QUPA 4OF6A 5DK2B 1XF4A 4JFDD 1OP4A 3VE0A 1OF0A 2NRDA 3FB5A 1T7XA 4LE8A 4C54A 3LPPA 1DJXA 1NAMA 3WEBA 1NGZB 1ZSDA 1AZBA 1MIEH 1KLFA 2C4XA 2UXVA 2WQ8A 3BEWA 1HH9A 4ZW6A 2K9FB 5F9JA 1TZOA 2OW7A 2I69A 3CFBB 5CGMA 4YN3A 1NCAL 1X5IA 4OFIA 2FIKA 3OF6A 1SLXA 3VFPA 1Q9WB 3QIUC 5ACMA 4BA8A 2VXTL 2YA0A 3EO1A 3MROB 4I7ZC 1PLAA 4LVHC 4XCEA 4DEWA 5C0CD 2XA8L 1QNIA 1DBKH 4PLKD 4LAQL 2HKHL 2RH0A 3IDGB 3DBSA 5TD4A 4CVZB 5C08E 3QAZB 4I0PB 4KK6C 4LCYB 3LJ3A 3OZ9H 5C2BH 2CR6A 4HISA 3BWSA 1JZJA 1J0YA 2N0MA 5KSAD 1DQDH 4N8VA 3H85A 2VXQA 5JW3L 3KPLA 2HWZL 4LCCB 1PKQB 3DROB 2V8LA 2CJTA 3WMPA 3TIEA 1H6TA 3VGFA 5DJ2A 4F20A 2HUEA 4WGVB 3T3PF 4FFZH 2QZQA 1J9CT 4LHJB 4HIHA 2EDLA 2IJ0C 3VQMA 5DSCB 2XBTA 1KT2A 1HL4A 3NFPA 4LCWD 3VRIB 1UXSB 4M4PA 4OZHF 3KPMB 4KKRA 4MCNA 4MXVF 1EUUA 1PJWA 2XN9A 1YEJL 1HJCA 2VR5A 3ELAT 1CGUA 4E9TA 2D2CC 3H9ZA 3K0WA 3MCKA 1QPPA 4KO7A 4XBGB 2E8YA 2Y9RT 2VQUA 5G2NA 3U48A 3BVNA 3T0AA 4YQXH 1FZKB 1T2QH 3VXNA 1ZA6A 4OZGE 1AGFB 3TFKC 3ATEA 5D6CA 4PY7A 1DEEB 5BO0D 4YE4H 2A6DB 2CIIA 2PYEA 5BW7A 2HMID 1KXHA 2ZSWA 4DEPC 4RAHA 5EDXA 3D69A 2HT3C 3NAAL 5CSZB 3PWNA 5F88B 4ZTOH 3M88A 4LSRH 4NQSB 4FLRA 4OUUB 1BJMA 4YBQD 3JVFC 1BXVA 2OYLA 3BIKB 3AJ7A 2A6JB 2I7OA 2VDNL 1WBYA 4FG6C 1WLHA 1D7BA 2CRYA 2WIMA 4N86A 2CHZA 1S7SA 3GMRB 5I6NA 2QPSA 2J43A 4PJIB 4DK5A 3P4NB 4A39A 3OJMB 4WGKA 3RIFK 3IF1B 1I8AA 1IGJA 3U0WH 1SVZA 1CBVH 3ES6A 3PWPB 2WLHA 4PJCE 4EOWL 2NY2D 3NCEB 5I8CB 3OLDA 1VCAA 3QNZB 2EXSA 2OR9H 1KXQA 3PGCB 4KNSA 4UILL 5TK4A 2JKIS 4CADB 4Q97A 4ZI8A 1KTKE 1QUNB 2V2TA 4MVBD 1CYWA 3IGKA 1X5MA 4I77L 2A7BA 1PX8A 4TNFA 4G80A 1DVXA 4X0KA 2R2EB 3FRPG 1MNUH 2ZUVA 5HHME 4X7SL 3SIKA 4HUWB 2WWKO 3EFFA 2WO2B 2NY4D 4A2DA 4AEHL 3SCMA 4YHML 3TTYA 1FNFA 2VR4A 4Y4HB 4FLOA 1WC7B 4FD0A 1N59B 3CFNA 4XCCH 3AUVA 4N9OB 5AVTB 3UCRA 4RAUA 5TQ0H 2GITB 1COBA 2XPGB 4TN9A 2WTRA 3L48A 3P4OB 2CIKA 1TO4A 3KPSE 1VEMA 4X5XA 3FUNA 1I7UB 6PCYA 3GS7A 1HZHL 5HGDA 3F6LA 1B88A 1B0RB 1GW6A 1LYQA 1MIEL 4TNVK 4YBLB 3E8UH 4YDIH 1DSYA 1TCRB 4IRSA 1T1YB 3FO2B 2B16A 3WKPA 4G9DA 4HEMA 1ZLUK 2DWYA 2G5UA 4R2GB 2AJVH 1F02I 1L0YA 2CO3A 2PPDA 1EEQA 2H0JA 2X4UB 4RBPK 5IVZB 3L5WA 3T0EC 5BO1L 4HJTA 3JV0A 3HC4L 1ORSA 3Q0HA 4BCYA 1GS7A 5I6KA 3HHSB 2BP3A 2AAVA 4PUBH 1A6ZB 4R83A 3U2SA 5C0DA 3FUDA 3CHOA 1S7RA 4J7RA 5AVSB 5G5DB 3ZE1B 5I1HL 5JIDA 1ZLWK 3AB0C 1NFKA 3IFPB 1IM9B 1AGEA 4XPBH 3OZ9L 2DBLH 5C2BL 3NZHH 3IS0X 4PJHA 3UTPE 5IQOA 4ZX6A 4B96A 3ABMB 5KS9B 3D3VA 2I32A 3Q6GH 2OYPA 5E2WH 5EH1A 5D71H 4OD3H 4PVNA 4IRZH 4K3JH 2GJ6A 4XP4L 4QR7A 1W16A 2GJZA 3JTBA 4GUCA 4FFZL 3CZNA 1K5NB 4L29B 3UGXA 3HG5A 1U8PB 4XPFH 3K80A 2A6KB 3RU8L 2EE2A 4ZPVA 4N2EA 5KJRH 1ET7A 1KFGA 3WCYA 2WSPA 2HT2C 4ZS7H 1A21A 1EO8H 3VDBA 3HI5L 1CXKA 3ZPDA 4PJ9D 5KVFL 3HMWL 1CICB 1RZFH 3FHAA 5IVOA 3BVVA 4MQ7B 4DZBB 5DJYA 1OGAA 1UKSA 4BFKA 1JWSA 1T2QL 2V2WA 2VCOA 2EDEA 4HAKA 4WW1A 4Y7MA 5C6TH 3VXUD 3BAWA 2R39A 4YE4L 5E9DA 3NRFA 3WNIA 2WBKA 4ZTOL 5ICZB 4LSRL 1RHFA 3UCQA 3BSZL 5F1NA 5DLMH 35C8H 3T04D 5I73B 3ILDA 3SY0A 2Q8AH 3GXIA 2AEIT 4HMDA 4YDMA 5GGTA 2AK1H 4A2LA 2MNUA 3IT8D 3L7EB 3KW8A 3Q9PA 4N2CA 4PGCA 4W93A 5EO0B 4R4BA 3MV8E 5HDWA 1I9EA 3ZDYF 4QAMB 2HZHA 1QBAA 2CLVA 4W9DC 3Q06A 2Z31D 3MUY1 2EDMA 3QIUA 1T7WA 4ABUA 3JXAA 1DJZA 1CBVL 1ZV9A 4N0UE 4NYLA 2AJUH 7CGTA 1QYGL 3HVNA 5L0QB 3K71A 2GB2A 4J3UA 1JYXA 1XT5A 5FLUA 1A4KA 2R51A 2FNWA 4FKHA 4PJ8C 2YGOA 3UG4A 2J71A 1F4WH 3KGRA 2D03H 5INCB 1T7VA 2NY6B 4NQVA 3VVVA 4PS7A 2BXYA 3T4YB 4HEPG 3EJQA 4KQ4L 1UZ6E 4UM8A 1P5VA 1R33A 4UUJB 4XCCL 3F7QA 1YQ2A 1TFPA 4HUCA 4KJWC 4QOKE 1I1AC 4OCLC 3RVTD 1HDMB 1H8OA 2KL6A 1UCBL 2QADB 3ORJA 3QNXA 5JQ6L 3RE0A 5IFHH 1NBYA 2TRHA 1S8DA 4GQZA 1VADB 3SQOL 2O30A 3VJ6A 3ZZQA 1EERB 2VDOL 1MG3C 1HAUA 4TPRH 4P5KA 3L6FB 1KTLA 2FECL 1U58A 4HOWA 2UY7A 5L6YH 3GJEA 4U1LB 3T9WA 1IAKA 1F00I 3ASOB 1UCTA 5CIPH 3REVB 4JCLA 4G8GE 1TQWA 2KDGA 4XN8A 3O3DB 1MY7A 4HUMB 1DVFB 2FSEA 3U83A 4E9QA 5JHLA 1FPTH 4FFVC 4OLYH 4X80H 2D2OA 4JO1H 4WHTB 3SYOA 1V3LA 1AP2B 2A38A 1IC7H 4Z3FA 1HHJB 1ZPLA 1E3FA 2O6FA 3D39E 1OE2A 2IPUG 2Z0BA 1W0YT 5E8EA 4LSPL 4ZODA 2WLKA 3MR9B 1QSFD 4NGHH 2DBLL 1JNJA 4MNHA 3NZHL 4LXFA 3N91A 1GYVA 5LBVA 4AIEA 1XGYH 4YDZA 1MAML 4TMPA 3Q6GL 5E2WL 3DPBB 3EH5B 4F3FB 2OSXA 5KANI 2X5PA 3SBQA