4UINL

Crystal structure of quinine-dependent fab 314.3 with quinine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLTWYQQKPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTISNLEQEDVANYFCQQGNSLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB 314.3
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uinL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uinL01
4X9BA 3I3EA 3GBNL 4PRDA 3S5LB 3BPNC 1H3UA 1QFWL 3U46A 2GEEA 4GG6F 4O5LH 4O51A 2XZAL 3ELAT 3VE0A 3BGMA 1YEIL 2VDNL 3ZT6A 4HWBH 2FATL 2ICCA 4PYHA 4YE4L 4LBEB 1WVZA 3RFZC 4PGZA 2C4FU 3Q1SH 4OGXL 1MI5A 2Z0BA 2HLAB 3GSNA 1ZEAH 5DMJB 1T0MA 5LWYH 3V7AE 4JJ5B 1U8MB 3G5VB 5DRNA 1CQKA 1E27B 1NCDH 2CIKB 4PV8A 2GCYA 4WVRA 1U8OB 3WUZA 5MEPA 4KAQL 3BP7A 5T3XE 2B4CH 1LO0H 3QUYB 3KR3H 4NNXA 1S7WA 1WEJH 4YDKL 5FA3B 5IB5B 3I50H 5HYSA 5DO2D 1ZT7A 3SQOL 2NX5E 1LMKA 3ECBB 5IB4B 4KMTH 3OWEA 5KBNC 1T0NB 2CIKA 2NY1C 2RQ8A 1IGFH 2YUXA 1KJ3H 5IEKB 4X6CF 1EGJH 2VL5A 4LU5H 4I4WA 1IGIL 1K5NA 1MI5B 1FLTX 3QCTH 1TJHH 5K9KA 1MCNA 1TVBA 1FRGH 2X10A 3CZJA 5AUMA 1KV3A 3CK0H 2DICA 2ZSVA 5C8JA 4N8VA 4XCNB 4YHPA 3DV4A 3R06A 5TQ0H 3T0XA 2P49B 4KKAC 5IW1B 2VH5L 4FNLH 3VXTB 1WBYA 4UUJA 1OAUH 1LNUB 4Q2ZB 3ULVE 3BP6B 3QCUH 4OLWH 3U7WH 3G5XA 5JW3L 2GW5A 2F5AL 4NKQB 3O9WA 4QOKE 5ICZB 1WBXA 4RIRB 2HRPL 2ESVB 1WZ1L 3O2WL 1E0OB 1ITCA 1T0PB 4GAJL 4MJIA 1C7SA 1UA6L 2XA3A 4HT1H 3CUPA 2K7PA 2C1OB 4PRAB 3RWDB 5EUOE 5DMGC 2EYTA 3EYUL 1QRNA 2QR0A 1XCTA 3BZEB 1BQLL 1JNHA 2V7NA 5DJCB 2BY0A 2WP3T 4P2QB 3DX7B 3O6LL 5F8QC 4YHNA 3KLAB 5HHXH 5JXAH 3MLVH 3HPJA 3SN6N 5J1AB 2VDQL 1A7NL 2HVKA 3NZ8A 5CJQH 4CVUA 5C0JA 1G84A 3BMVA 1YC7A 2R56H 2WM0A 1YECH 5GGVY 3LHPH 5JPMB 2W92A 3RP1A 3QZWG 5DFWH 2I27N 4KQ3L 3QO1A 3HZVB 4N8CH 1TVHA 5DMYA 1RUPH 1A3LH 3FN0H 4DKFH 2XY1A 3MV8A 3EFDH 4Y4KC 1WC7B 2BFVL 4PJBA 1G6RB 2P47B 3LB6C 1FHGA 1LO2H 2ICWA 2H32H 3UTZA 3TCXA 3VFGH 3L95B 5D7KD 5J6HA 5FKPA 2Z35B 4YDVB 3VD4A 1MCFA 5I1GL 1RSFA 4ZUVA 1YDPA 3RDTA 1S7SB 1VEPA 3RI5F 4ZNEA 3F58H 4G6AD 2OXGA 1T7ZA 1D5XB 1MQKH 4NHCH 4OBSA 4L29A 4MD4A 2A38A 4M5ZH 1M1SA 5C08B 3B3IB 4JO3L 3MV7D 4XRCA 4XWOD 4YNYA 3BGAA 5HYSB 4P9ML 3BQUB 4RGOL 1GVIA 5I30L 2VZTA 3QXTA 2YBRA 1A9BB 5D2LB 5CGYC 2EZ0C 3MA7A 3TFKC 4LCCC 5DJDA 3KGRA 1OP3K 4PTTB 1C8PA 2PW2B 2BXYA 3MC0A 1VADA 1I8LC 4NC1C 4I18C 1C16A 4OSUH 4ELMB 4NNYA 2E7BA 3EGSA 1CLOL 2IMMA 1W72H 1IC1A 4P5TA 4PRIE 1L0XA 3JWNC 1E6OH 1BBJA 2BVTA 1NGQH 3UTQB 3HFMH 4KTDH 5EA0L 2PO6A 1G7MA 5J11C 1FFQA 4FFVD 4I77L 2DQDL 1MFCH 4M6OL 1FZOB 3SDAA 2VR5A 3V7AG 3RBSA 4HWZB 2K3TA 4XHQA 1XGYL 5C3TA 1R3KB 4FTVD 4MSWA 2CGRL 4TVPL 5JXEA 3U36B 5GSRA 5CJOH 5AAMA 3PGCB 1AGEA 1I7TB 5GS1C 3BKMH 3PJSB 2X4TA 4ODSH 2FRGP 3EFFB 4OBRA 2VC2H 3PP3K 4YHKL 4YXLL 2AAVA 4MNGB 1G7LB 2ENYA 3T0ED 3WFEH 2X4NA 1M7IA 5CSZB 3QUYD 5I6XC 4F80A 1N7MH 4Z7VE 3LH2L 3CXDL 5D5MB 3MOAL 5EO0A 2EE6A 1RZIA 5T5FH 4X6DA 5BVPL 1KTDA 4KZEL 5EOCJ 1FL6A 1H3PL 4K23L 3IB4A 5B3JE 2H1PL 3OJVC 1YEEH 1S7XA 3O4OC 3ZT7A 1P4IL 1KJVA 3X17A 3JV4B 5JDSA 4C4KO 1HQ4A 5L7XL 3O3EB 1CZ8L 2XOTA 4Z76B 1KT2B 4LNRB 3S37X 4HS6A 5TF1H 4LCCB 3DMMC 1OWWA 3F6IA 4JVUA 3WUWG 5BS0B 2R2BB 3LN5B 4Z7WF 4WFHD 1G7IB 1CBVL 2AJXL 4R7DB 2BK8A 2Q3ZA 1NBVH 2FYYB 3FOLA 4OLVH 4I18B 3TH2T 3L3OA 3WE6B 5D93B 2HN7B 3HAEB 1XZ0A 2AABH 4APQA 4OUUB 4BKLA 4GQ9L 1RK0B 3Q48A 5BVPH 1MJUL 4XWGL 2IH1B 2BNUB 3J8F7 1MFAH 4BQ8A 3RY6C 1YYLH 3GI8L 1JIBA 3BJLA 5IJKA 4F8TA 2VDLH 1Q94A 1G9NH 1J88A 1AD9B 1VADB 4ODVH 2BJML 2AVGA 1FZJB 3BPLB 2FDBP 3GRWA 4JM4L 2WK2A 4PJEB 4P2QD 1S9WA 1MFBL 2CKNA 5JR1H 4HAGA 1IGFL 3B4NA 3SGKC 3STLB 3TO2B 1BQHA 5D7LA 3LKRA 5D1XC 3GJFH 1DDHB 3ALWA 4LRNL 5HYIA 3RUGA 5TE4L 1FRGL 1DSFL 2FJHB 4QTIL 4U2YA 4LHJB 1J8HD 1VFAB 4FQXB 1FZKA 2Y9RT 4YFLF 1SBSL 5BS0E 4YE4H 3FQUA 3HMWH 1FORL 1GAFL 2N4IA 3NACL 3UPAA 5SX4I 3U4BL 4ZUVB 3B43A 2KZWA 2C3WA 3Q1SL 4CBPA 2D3VA 4UIMA 4OCLC 5D5MF 4PUBH 1N6QL 1FGNL 3OXSA 1URLA 4WUUA 2H32A 2KL6A 2G5BB 5MEOA 4HKXA 3VXUD 3V5KB 4HS3A 3SGKA 1WEJL 4YDKH 1H3WM 3FT2B 3HNTH 2DMBA 1UH2A 1WUNT 3BX7C 4X7SH 4Y4KD 5FUOH 3SKNA 3MLRH 2PW1A 2IAMD 3UC0H 4LOUC 3SDXB 3W9EB 1MNUH 4CU6A 3B5HA 4Z6AT 2IADA 1H0DA 1K3ZA 1GJIA 5KZCD 2FSEA 4RAUB 3RVTD 3SDDC 2EH7L 4U1SB 1J05A 2AW2A 4F7CB 5I2IB 5EORH 3T08A 5GS0C 5CJQL 4XBEL 4ZFOB 2Q86A 2VB5A 4F7MA 4EIGB 3MTRA 1JNNH 2J8UF 1BVZA 4F58H 3QNXA 3VFRB 3H3BC 2HT3C 6FABL 3MYJB 1AE6L 4JFDD 1S3KL 5EBWB 4MJIB 3ZKMC 4Y19A 1EDQA 1NGWA 2NY5C 3K8LA 1F3RB 4KRLB 3SOBH 2APFA 1AO7B 1MUJA 2EDHA 3CDYA 4BM7A 2ZWLT 1IGTB 3KNBB 1A5FL 5SWQB 4LSVH 4PJIE 2ZPKH 3DROB 3FQXA 1JN6B 5MEQB 4M1DH 2X4RA 1LEGB 1A2YA 2A6IA 4P48A 3LPGA 1LP9F 1NGYB 3NTCH 5FM5M 5FB8A 1MCWM 3GMNB 1UKTA 3RUGF 3C87A 4I0CC 3RGHA 3CCHB 4MD5B 2NXZB 4PLNC 4UDTB 4RGOH 3MV01 1PAMA 4O2CA 3ROOB 5CJBA 3TGXA 3CZFB 4V1DD 1NC2B 4XX1E 2XWBA 3G6JA 3S3JA 4GMTH 1S3KH 3TPKA 4HKBB 1TJIH 1YPZE 4PRHA 5FM8A 4ERSL 3BE1H 1T0NA 1TZGH 2EIZA 1I8MA 1UH4A 3U79A 4BZ1L 2QSQA 5I8CA 1P2CA 1TTGA 2ADIA 2X4TB 3I6GB 5IFJA 5ID0B 1LDPL 3EO0A 1LQSR 3HI5H 3JVGC 3UJIL 4OF3A 3CLFL 3MLWH 3U7YL 3MNVB 3GUTB 1CD9B 4JGMA 4TYUA 1ORQB 3NTCL 4DN4H 2GSGA 3ETBF 3NGBB 4PJ5A 2XNAB 3QCVH 3BT2L 2BC4A 1R3HB 4JCMA 1GC1L 2UWEF 4J2XA 2IMNA 3HR6A 2J12B 2FGWL 3VFVA 2QADD 4X6BB 3IF1B 3T0EB 3F58L 1I4FA 1BZ9A 2GFBA 4LSUL 3F7VB 4K3JL 2DD8L 2CLRB 4XVJH 1MCKA 2UVEA 3KPSE 5GISH 3EJYD 2ZCKL 4X9FA 1OVZA 4YC2C 4RMTA 3K81A 3DBXA 5I71B 2XZQL 1TETL 3ARPA 5D2NB 4HCRA 1SY6A 4DKEH 3QZWB 1WWCA 1MCBA 1OP3H 1PG7L 3ZDYF 1AQKH 4ZUUB 1BZQK 3MRKA 3WFEL 1N4XL 2NXYB 4OLYH 1AGFB 1HH9A 5GRVK 3PL6B 4DN4L 1RUKL 2XTJD 3QCVL 3BT2H 4G9FB 2HA1A 3PWPD 1NMCB 2F54A 5J56B 1HI6B 3GI9L 4TTDC 5TDPB 4B7LA 5ACZB 3CPLB 4YPGB 3RAJH 3D39E 1P69B 4ISVB 1OAKL 3RWFA 3P2TA 5IMLB 5ID1A 4I77H 2H1PH 1A4KA 4XXCC 3AROA 3MCLL 3QBTB 2EH8H 1MHEB 4XAKD 2VXTH 1JPSH 4ZPTB 4NKOA 1IEBB 1DQDL 3GSXB 3CFKA 5I8KL 3ULVL 3T0VA 4GAGL 2J88H 3H9SA 4UBDC 5IB3A 3CFIC 3GM8A 4MCZA 3DARA 4UT6H 5DMGD 3IDYB 4BSVB 1CDHA 3FN9A 3OKYA 2MMXA 4OT1H 4A6YB 3TNNB 4OZGA 5TFSH 4S1QL 1HCFX 1L0QA 1U3HA 5FV1L 3WLWD 1OQXA 4C83A 2FGZA 1CL7I 5KS9A 3BOVA 2D2OA 1GXEA 2AXFA 5FUCC 2CPCA 2FH6A 4S1DC 1RIVH 5IFHH 3P9LA 1NGWB 1A4KB 3DX7A 4GBXC 4P2QA 2H2PD 1I9RH 3CAFA 1X5ZA 2F58L 1ZVSA 3RL1A 1VESA 4HDIA 4NQCA 3HNVH 4WEBH 1H3PH 4CUCA 3TYFA 1HZHL 5D7JD 5D70H 4ONOA 2QHLA 2QQKH 4XI5D 5ETUA 2YPLB 4IJ3B 4I8DA 3DTXB 4PJDA 2VDOH 3IKKA 3WFCH 2X41A 4ODHH 1AFVH 1UC6A 5BOPA 4L3CB 1XGUB 4NQDE 2BNQE 8FABA 3WXVL 2HFEB 3V5DB 3MODL 3X12A 4EXPX 1C5BL 3UJJL 4YHPB 2AJXH 1CXEA 3S37L 2DKUA 4D3CL 4FXKA 3HMXA 3NABL 2Z91A 1T1ZB 1FSKB 4FHBD 1J8KA 2XKSA 1MHHB 2RGSA 5L2JA 2PYEE 4ORGB 4XPHL 3Q6FA 1Q72H 1SJHA 5HY9B 1VCAA 1KEML 4L8BA 2UWEE 5D1ZD 1P4BH 3DRQB 3MNVA 3GJEB 5I76A 4XZUA 5E2VL 5EZIL 1IAKA 1EXUB 2J5LC 2OP4L 5F93C 4PJDE 3VRLF 4RGNC 5KSBA 2HJLA 3GMOA 4NUJA 5ITFB 3VJ6A 3I6GA 2CIIB 3T09A 5LGHH 1E27A 2DTSA 4KDWA 4PV8B 3L5IA 5EU6E 4M9OA 5DJ8A 1P84K 5JIKA 3S8WA 4Y4FB 2B4CL 1MFDL 3GMQB 5J8OA 3KR3L 5IEHA 1MPAL 5C0AD 3ZKXC 5E94A 2IFFH 1ND0A 2Y36L 3PF2A 1YNKH 2XQYK 2FJFA 2WWKT 4D0BB 2RCSH 4FFYL 2BHUA 1A2YB 2A6IB 4LU5L 4Z9KB 1BECA 3S5LA 2HN7A 2ICWJ 3HAEA 2GIYA 2LAAA 3BDBA 1G6RL 1Q1JH 3IJSB 4XCEB 3MLUL 4FMKA 1RURL 4WHCA 1NMAL 3B2UC 2F8OA 1PQZA 3C8KA 4F9PA 3RVUC 4CL7A 1IGTA 4G43B 4PPTA 2PTTA 4M7ZB 4AEFA 4JFEB 3UMTA 4U49A 1O7VA 2Z31D 4J1UA 3Q6GL 4RAVA 4QF1A 3ARUA 4LCWE 4Z7OF 4ZS6D 2A73B 3MRMB 1B0GB 2FWOB 5I18H 4CVZA 2EDLA 1UT9A 2XG4A 3VGGA 2F5BH 3U6RA 2UYLA 1WZLA 4NQVA 3I02B 3RWEA 5FV2A 4IRSB 1A6VL 4NN5C 1EV2E 1CTNA 4X6DB 4JZOB 2DIBA 3MLPA 4JFYA 2Z8WC 1A9EB 2V7HB 1RURH 2AV1A 2FIKA 3U0PA 3OZ9L 4KK5C 5J06A 3GIZL 4QCIA 2X4NB 3LV3A 3BZFB 3FONB 2H45A 3MO1A 1N59B 3OKDA 4DOHE 4BFIB 1OGAE 3NFSH 1KC5L 2D7MA 3P0YH 1T6WA 2E7MA 2IC2A 3O2DL 4YDJB 2AJUL 2L0DA 4AT6A 5DQJB 5KVFL 5F7UA 3BEVA 4RGNB 4WWKD 1MCOH 1UWEL 2PR4L 1ETZB 1NGZA 5J11B 4XC3L 4L8SB 4LSUH 4R3SB 2AKRA 4WFGE 3OKLA 4NFDA 1IAKB 3BIBX 1HYSC 5KTEL 5D9SA 1R3KA 1E4KA 2IPTL 4DKFL 3U0TA 2DQIH 4IM8A 1H8NA 4YIQB 2FR4B 4H25A 1NL0L 3ULSA 3B9AA 2ATPA 2CRIA 4PRPD 5I1IH 3QDMB 1T21B 2NX5D 1PGRB 5IHUH 2BZDA 3VFUB 1TZGL 3UBXI 4EDXB 4YJZL 4JZJC 1BQHB 4BZ1H 5E2TL 3PDOA 4H1LB 1D7FA 3QB7C 3R8QA 2IALA 5E5UB 1S9WB 1CGYA 4LIQH 1OY3B 3PE9A 3MRLA 2B1HH 5FO7A 5AD0B 3L5HA 3T2NH 2DLFL 2FNBA 4KU1A 3BKJH 4G7YL 5HI4C 4WI3A 1GH7A 4NJAL 4AH2A 3DSFL 4RZCB 2M1KA 3QRFM 4ZOAA 2YWZA 3EZJB 3S6CA 2IPTH 2EDKA 1X5HA 3RI5K 5KSBE 5A3IC 4I0KA 1RZKC 3QJFA 2EC9T 3C5SA 1U8IB 3DVFA 5J1SC 4JDTL 3PV6B 5SWZD 4YFLI 1S7SA 4LSQH 2AK4A 4D9RE 1TLKA 4KTDL 4OT1L 1RZJC 3D85B 1ZLUH 5F7WC 4HUNB 3CMOH 4NGHH 5GS0L 4XVTL 3MGTA 4JQIH 4YXHH 4KZDL 3MV7E 3GKWL 3D39A 2NNAA 4Z7WE 4OCMC 1AQKL 3B6SA 1E4WL 2R0LH 2EO9A 3K74B 3OGCB 3MLZH 1QBAA 2Q6WB 2Q87A 3V8CA 2FHCA 1UH3A 1DBAH 3FO2B 3RU8H 4YWGH 3MA9H 4LLMB 1QBML 5D7JA 5GJSH 1ZA3A 1XH3A 4XNZB 1DCLA 1RUAL 4YH6A 1F4HA 1N8ZB 1OAKH 4J6RH 3HRZA 3WL9A 3FQRB 4H88H 4HK0A 1N5AB 2VYRE 4EXKA 3SJVD 1OL0A 5BQ7B 4BQCA 3QFDA 1RZGA 2DQCL 4MDIA 1G7LA 3V0WL 2FATH 5EBLB 4AL8H 1MRFH 2PNDA 3BKYL 5T1KA 5I8KH 2YR3A 4ODHL 2XTJE 4X6CA 1T83C 4Z7VF 3MV7A 1YNTA 3X13A 2FWOA 2LVEA 4WV1A 2PF6A 4H8WH 3RNQA 1KJ2L 4EI5C 3TP4A 2IG2L 4P57A 3X11A 2WQ8A 4JLRA 4J3VA 4XNQA 3GGWA 3HLAA 3E6FB 4ZAKA 4MSWB 4XP6L 4H20L 4HIJB 1ZLWK 1ACYL 4FOMA 2J4WH 2KPNA 1NGPL 4GKNA 1KJMA 4M61B 1T4KA 1EEZA 4IOSD 3OJDA 5HYJD 4JZNB 2ZJSH 5DJ6A 3QDGE 2NY1D 1I1AD 3ULUH 4DVRH 4P5KB 3AS2A 4L4TE 4X7TA 1LD9A 4M62L 4FQIL 4U1HB 3CDCA 2HVJA 3GJFB 2QQQA 3GSRB 2X70B 1BD2B 3QI9A 2FZ3A 1GC1C 3ARDA 4XB7A 5D70L 4G8GE 5B39B 1D9KD 3V6FB 5C0CE 1BFOA 3PIQA 3FO1A 5KVEL 3RZCA 4NM4H 4N1EA 4JPIA 5IFAH 4XWOC 2I9TA 5ELIA 4WI2A 1T3FA 5ESVA 3GMMA 4YDIL 1FCCA 3CVIL 3R0NA 1QLEH 4HBQA 3FO1B 1ORSA 5B22A 3S37H 5FM4A 3G5VA 2HJKA 5DRNB 5ALBH 1A0QH 5EBMB 4PFEA 5A16B 1DN0B 1S7TB 2J8UA 4BFGA 3NGBC 4K9EH 4MNQA 4PJ7E 5IHLB 1X7QA 1DJSA 4LRNH 5E99H 1JK8A 5DUBB 2NCMA 4R97B 2UWEB 1DSFH 2HVJB 1D5MA 1J12A 2OTUA 2FX8H 3NIDE 4KROC 4N9GA 3ZE0E 2BDNL 4ODWB 4R7NB 4LHQB 5K33A 1EO5A 2YZ1A 2MWCA 4A6YL 4K3HA 1KYOK 5I8OH 1FL3A 2Z4QA 3KPPB 3MLVL 3WLBA 4Z7WB 2H2PC 4PJAA 4YC2B 1FYTD 3T04D 1TVHB 4CNIA 3QQ3A 4PD4K 2QL1A 5I9QB 4S1DD 4X99A 3PWLA 4YDIH 1A47A 3KNBA 2APWA 4JFPB 5TH2B 3FAXA 5F6HI 3RA7L 1AXSB 5JLZB 1FGVH 2YWYA 3UPCA 3PWUB 2CSPA 3HC4L 5J13B 1MY7A 1MPAH 1A4JA 1YJDL 1LO2L 1ZHLA 1IAIM 1YNTB 5KW9H 1T5WA 4EI6A 1OGTB 1ZT4B 1GIGH 3AC0A 3ARYA 3OZ9H 5E4EC 5TDOA 1JPTL 3L3JA 5F9WB 5JHDD 1EERB 1YY9C 1T1YB 1KCVL 3ZYOA 1ZA6A 1QZ1A 3MUHL 2O5XH 1W0YT 4JO3H 1OAXL 3HB3C 3KPSB 3RPIA 4Z77A 2VLJE 3OX8B 1M7XA 1JNNL 5D7JC 5J13C 3W82A 2BSRB 3UTSD 4EDWL 2E8ZA 3RJDA 1JGEA 1I3RA 2JK5A 3T3ME 2Y7QB 3ZYZA 5IB3B 1KIPB 5HHNA 4ZTOL 1PX4A 2QHRL 3CFKB 3QDJA 4HX1B 1NLDH 2ZSWB 4XP1H 4XGZA 3GMRA 3ZTJH 1AQDA 4JJHA 1DBJL 2XT1B 3RZCD 2J6EH 1RUPL 3FN0L 1ES0A 3LD8B 3MRBA 4UIMB 2I5YL 2ZG1A 1Q9OA 5EU6B 4M00A 3HZYA 4L9LA 1AHWA 4OD1L 3BIKB 2DYPB 2W0FB 3E1F1 1NC4A 3KXFB 4AQ1B 4WUUD 1GZQB 3LKQB 5HGGS 2FJGA 5LXGL 3EJYC 4S2SB 5T5NG 4ODXB 4Z7NE 2F54B 1CF8L 1VEMA 1JYWA 3GNML 2VLMD 2NXYC 3GHBL 3PL6A 2R1WA 2V5MA 3MBXL 3JZ7A 5EN2A 3SY0B 4DCQA 1BVKB 2Q76B 3LN4A 4KK9D 2DS4A 1U93A 4LRIC 2VN7A 2VLKA 3MPCA 5DHVB 4XVSH 2PR4H 3BE1L 3N0PB 3RTQA 5DK0A 3P73A 1KBGH 1T2XA 3STBA 1IILE 2AK4D 1BD2A 1F4WL 1NCNA 4UTAL 4MS8C 5DJAA 4I1NB 4ODBD 2ERJB 4X6EA 4JRYE 1YPZB 1UJ3A 4XP9H 3FB8B 3GSNH 1UZ8B 5ANMB 5BRZD 2Y06H 1NL0H 5IVZB 4P9HH 2IEPA 1H8SA 4Y19D 3T0EA 5C0GA 1GYAA 5HDQH 2Y72A 4BFBD 5HHQB 4UB0L 3O4LB 4M5YL 1W8OA 3GIVB 4QRQA 3FHAA 4WU7B 1I1AB 1MCPL 3QWOB 1P9MA 2R69H 1I1YB 5GS2H 1N0LA 5DHYB 4QHNB 5HYJB 2CUIA 4HSQA 2COQA 2YD6A 4X4YB 1EUTA 2YA2A 3X13B 4N0RA 2W9LA 4U6XA 3TEUA 1KJVB 1PY9A 3MV9E 2EIZB 5CEYA 4ZUSA 2QLVB 4U0RB 2A6DA 3QEQE 3MLTA 1XGRB 5HD8C 5B4MD 4G5ZH 4AL8L 4LKCA 2CLZB 3ROOA 4L8CA 3SGDH 2V7HA 1RZ7H 2OCFD 3FQNB 4DN3L 4YXLH 1U8JB 1NAKL 4YZFF 2E9WA 4S0SD 4HFUL 1CICA 1YMMA 4LSQL 4LLMA 4KTEL 2HFGL 1YN6A 2IQ9H 5D6CB 3SGDI 2XZCL 4YEFA 4LPVA 3EYSL 5GRUL 3GSVB 1HSAA 5I1JL 3MOAH 2CR3A 3I6LD 3D39B 4MD0B 3TA3B 1IRAY 3E2HC 4DK6A 4KUCF 4U3XA 1I7UA 2VQ1B 3BN3B 4J3UA 4K07A 4GAGH 1CE1L 4ZSOE 1GSMA 2BOBB 2UUDH 4X8JA 1WGOA 2WSKA 2CKBA 1S8DA 4G42B 4DJMA 4FQ2H 1BFVL 3PXHA 1FFPB 3PHOB 1FNFA 3EYOB 1EZVX 1A3RL 2G60L 4PTUA 3PWPE 5DGRA 3PV7A 3RTQD 5C08E 5FGSA 1YMHB 3NAAL 3C09C 4G6ML 1T1WA 4BELD 3UTSB 3TESA 2AXJA 2JCCF 5IFHL 1T89C 1N64H 3IGAB 3ZTNL 2JJSC 5LCVH 3DMMB 3B8SA 3EYSH 4LLWA 4ZQKA 2BY3A 1CGSH 1XF4A 4LF3A 4EN3D 4HGWB 5TQ2H 4KGLA 1AKJB 1N6QH 4K7FB 3KHOA 4Y4FA 1PLGH 3WFHB 2ADGA 4WUKH 2HT3D 3QNZA 5D93C 1PSKL 3MMEA 5JOFB 3HNTL 4X7SL 1B4JL 4HWNA 4WUUB 5F7KC 1NKOA 1AGBA 3D87B 1T89A 5FXCH 3UYPA 3WFCL 4YHYC 2VIRA 1J0KA 2OZ4L 1AFVL 4XXDB 1V05A 5I74C 3F5WA 3ULSB 5C0CA 3GSQA 1KNOB 3TBWB 4BH7A 4XZUB 1N3NB 2P8PA 3D5OF 3FRPG 4L5FH 3WXWL 1EHXA 3HHRB 1CXIA 2RJMA 2IANB 5D9SB 5DQ9B 1Z3GH 3HCVA 4NWUL 4M7ZC 5EU6A 2AKRB 3NABH 5FYJU 1V7ML 1VDGA 3LKSB 5TQ2L 4D9LL 5I19H 3PGFH 5SWSD 2ZG2A 3OG4B 1TCRB 2EDOA 4FQ1H 4HLZG 5JOFA 3STLA 1TZIA 3GSVA 3ZKSD 5KANI 2PYEB 4LPXA 4TSCL 1FGNH 5MEND 3T3PE 3MRHB 1ED3A 3ORJA 5FYKH 4OCRH 2C7UB 4PLOB 4TRPL 3AMKA 4YXKL 4X5WA 3UTSA 3TYFB 5DEGB 4Y5YC 2C1PA 3L3OB 3WE6A 2CRMA 4APQB 4LLYB 1JGVH 1F00I 1PDKA 4I2XB 4I3GA 1L4IA 3RVXD 4UNTA 1IM9B 1RUQH 4FABL 4KV5F 4CMMA 4NQCD 4QF1B 4XT1C 4PJGA 5DK2B 2WUCH 3VDAA 3QCUL 2AV7B 4OLWL 4P23D 5ICZA 4K55A 5T1MB 4ZTOH 1VENA 4C59B 4HS8L 4QHLA 1NLDL 4JREB 5I1HH 4C83B 4G8GB 1VPOH 4JFHD 3I84A 2VN4A 5IP4A 3ARBA 1R0AH 4OZGB 1NPUA 4N68A 3BPOB 3TCLB 3EO1A 1L0YA 4X5XA 3O4OB 4WHDA 3CFBB 2XQBH 1JF1A 2HJFA 4NQDB 4KK6C 3DNKA 2DQHL 5FYKE 2YRZA 4MDJB 2CDGB 3IVKB 4KKAD 5EWIL 3N85L 2QSTA 5MI0C 5AUMB 3DETC 4GAFB 3KPOB 3O45A 4X6EB 1VGKA 2PCPB 1JTPA 5IEHB 3MBXH 1M7IB 5GZNC 1MSPA 5CZVL 5IMLA 2AK1L 1UVQA 3NFNA 5BW7C 2F53D 4NM8H 1QFUH 1CN4A 3MXVH 1HOCA 1WWWX 3FO0L 3LHPL 3VXOA 1CGVA 5E8EA 3EKCA 4O9HL 4H0GA 5I0ZA 1MRDL 1WFNA 4Z18A 3SJVB 2MSPA 4L3AA 2YSSA 1EJOH 3V4VH 4ODXA 3VD9A 1GZQA 3LKQA 2ZUYA 3A6OA 5B4MC 5C3LD 1HCVA 5HD8D 1RHHA 3VDCA 4Y5VC 5EWIH 4QT5B 1AHWC 3JTTA 2ITCA 5I1GH 4PB0H 1FLRL 1X4ZA 3GJFA 5FKAA 3PWPA 4OD2A 4LAQH 4Q9BA 3SDCB 1NCUA 1L7TH 2Z91B 4OCWL 3VWJC 2VLKE 5IGXH 1MCPH 1J87A 2Y5TA 3EYVB 5E5RB 5JIPA 2OK0H 1TCMA 4KI5D 3RWCB 2R0ZH 4PJBE 2YPKA 4MMZC 2IGFL 2OMNA 1NBZB 4LGRB 5CZXC 3RVXC 3X3FL 3TO4C 4GT7A 2BRRL 2Z31A 5ESQA 4OIBA 3IDXL 4N90E 3JV6B 3L9RA 1RJZA 4HC1A 5E9DD 3VXMB 4P49A 3DUSB 4JRYA 1JGDA 4NSKB 1EO8H 1QQDB 1QRND 2J88L 1S78D 5I1DB 4QHLB 3C6LD 3DO3A 5E6IC 4LFHG 4NOFA 1AO7D 3OF6D 1BWWA 4RFOL 4G5ZL 5AG8A 2XN9E 4GKOA 3VXRD 2GI7A 1N2RA 3SPVB 4X7DC 5JW4Q 4YHIA 4WI6A 3ILPB 4LSDA 4OZGF 4MB4A 4X6CB 1D5BB 5E2JA 4OFYD 3SQBA 3EAKA 3QXAA 1NGQL 1GGBL 5EA0H 4BSWA 2PYFB 3TJHC 1T22A 4B5EA 2VR4A 3K8KA 3P4MA 3WFBH 4OGYH 1UB6A 4U0QB 3G6JB 4ZAKC 4LHUG 3G9AB 1TMCB 2F58H 5LGJB 1VGKB 1YJDC 2PCPA 5JQ6H 5IESL 1M6OB 1VSCA 1RQ5A 3IVKA 3UYOD 5CP7A 1UM4L 4G9FD 1WAAF 3MRDA 4HG4J 1EVUA 3B2VH 2DQTL 1P5UA 3T8XB 3V6OE 4XPBH 2IQAB 3AXLA 1FL3B 1BBDH 2Z4QB 4YHOL 1GGYA 1Q0XL 3QXVA 4LGSB 5I9QC 4QGYA 5IMKB 5E70A 3K4ZA 4AG4L 5DVLA 1LE5A 1YEFL 4N0FB 1DR9A 2DWEB 1MI5D 12E8L 3HE6D 1KUMA 3KJ4C 4PJCE 4FTVE 4CMMB 4BSWB 2EC9U 4KRPD 3QHZH 1HYSD 3NIGF 4NZUL 5JPNA 4PJ8C 3SE9L 1I9IH 4HMEA 4XVUD 4ZFZB 1INEL 1JHLL 1BM3H 2CDFB 4Y16B 1E6JL 3N1PC 5AG9A 2IQ9L 5ESVB 2HRLA 3H9SE 1CFNB 2ZCLL 1ZVYA 4P3DB 4RFEB 1A1MB 3HZMA 3FT3A 4GXVH 3BKYH 4PJXF 3B9EA 1HHJA 1MH5B 2OZ4H 3SDXA 3W9EA 5IROC 1SYVA 3BGFC 4AM0B 5CKAA 1OGAB 1FG2B 4KPHH 2GJZA 4R96A 2ITDA 4MQ7A 4O2EB 3AFLA 2GJ6A 1VFUA 1FNLA 3MCG1 5E6IB 3WLBB 5DGQA 5IK3A 4HBCL 5E95B 4ZQKB 4FZ8L 4L5FL 1LK3L 2P45B 5GXBB 2X89D 3CX2A 4OM1L 4L1HA 2D4FA 5EOCL 4KTYA 1T21A 4J12A 1NJ9B 2X4SB 4H25B 5IWLA 3ARFD 5MENA 5BCAA 3SCMB 3MV8E 1VA9A 2E7HA 3VFWA 1TIUA 1BHGA 3O6FC 4KKCD 2GK0B 1PLGL 5D6DA 4QRUB 1T04A 2H6PB 4J4PC 4JO4L 5MP6L 1OARH 3QIWD 1QKZL 1V7NH 4TNWF 3IXTB 4IOFC 3LQZA 4TRPH 3UTPD 1IAIH 1U8MA 2OP4H 3GKZA 1TXKA 4BFIA 3DX6B 4NN6C 1LK3H 1I7RB 2NW2A 2IBZX 2W38A 2ARJB 4F7TB 5LAXB 1GL4B 1CVRA 1LE9B 3E3QE 5IFAL 1Q94B 2NY0B 3TO4D 4QHUA 2YD1A 3Q2CA 1FORH 4L8DB 5HPMA 4KI5C 3UBXG 4RCAA 5D7JB 1CLZH 1BPVA 3VH8B 2FEEL 3OJDB 2EYRA 3V6BR 4IRSA 4JY5L 4NZJA 5F3HA 1FNSH 4IDLA 1T4KB 3WO3B 4GKNB 2VMFA 3EDDA 4FFWD 2BDNH 5TDNB 5C0BB 2CKBB 1J8HE 4XPFH 1RJLA 4Q97A 1IAIL 4TPRL 3M8OL 3LKOB 4P5MB 2ZUWA 1I1AA 3JV4A 4JFZH 5JDSB 1NCWL 1PQZB 5FUZH 5E8PA 4WW1A 1K9TA 3LCYA 3MZGB 4AEIH 2EYRB 4HIIA 2V2TB 3QIUC 1PYWA 3NCFB 2FO4A 3HC4H 5GJTL 4RWYL 5E9DE 1ZSDB 1YUHB 1T7YA 5E0QA 1BAFL 4OCYH 1ED3B 5E7FA 5KSAD 3OSKA 3NCEB 3N9GL 3CDFA 5ADPL 3MRLB 1T7XA 1EJOL 5BZWB 1K8DB 1BVLA 1AO7E 1UKSA 4TPRH 4JKMA 2NLJB 1MAML 5D1XB 4RFNC 3GRWL 2X09A 2L7UA 3SO3C 1MRCH 3A0OA 5TE7L 1OWRM 2R0KH 4P4RB 4LSPH 5IBUB 3DURB 4PJDF 3TA3C 4KGJA 1JI1A 2HLFD 3TNMA 4MJ6B 5J12C 2GK0A 3NCBB 4YBHA 4EUPH 4MXQC 5E08L 4OCWH 2UY6A 3DSFH 2FX7L 3BESR 4JHWH 3TPUA 4HJJL 4S2SA 2BSSB 4HUVB 1WAAE 4H1LH 4Q6IC 4NN6B 2W07A 1XGQB 3Q0HA 1IM3A 2X4PB 5F7NC 2QHRH 3OKLB 1JUFA 4NZTH 1Q9OB 1CXLA 1UG9A 4OV6F 4NRXB 3C09B 3ZE2F 1EO8L 5IHZB 2GTWB 1MCSA 4KVNH 4HHAB 5HHNB 4OD1H 3MMEB 4OV5B 4JHZA 4HQQH 3TO2A 1Z9MA 4NNYB 1FVEA 1W8NA 1EH9A 5EO9B 1OP5K 1MRCL 2F15A 4MA8H 1M71B 1CT8B 3F12A 1WZKA 1SYSB 3IU3A 1DBMH 1UCBL 3EDEA 6CGTA 2HWZH 3QWQB 2JB5H 3JWOL 4XMKH 3GDBA 5DS8B 1ODAA 1QBMH 4PIRF 3T2OA 3T2NL 1DEEA 1OD9A 1G7HA 4R26L 4HIIB 5IG7B 5C0FA 1AR2A 4N0CC 4U7MA 4K3JH 5GGSY 1L7TL 1A7QH 5TDOB 1DBBH 1ZVSB 1X5XA 3BIAX 2ORBL 5A2FA 1OF2A 4R7DA 1C1EH 3QEUA 2B7DT 3Q5YA 5D8JH 1S8DB 2GSIA 1SEQH 3K7UA 3HZYB 4YLQT 3P9LB 4O58H 4DZ8A 3ZKXB 5IMOB 1IT9H 4I5BB 4HS6B 3MJ6A 4YDVA 4ZUWA 5CLWA 5C86A 4NRYB 5DI8A 4EQ3A 1U3HC 1EIBA 3TZVD 3C8KB 5ITBH 3T1FA 3T65B 3MREB 5GGTH 2DIAA 5EU7C 3F7YB 5KSAA 5ISZA 5INCB 5MHSD 4GBXA 3BJ91 4G3YH 1JHLH 1M6OA 2QADC 3FRUB 2CK0L 4EBQH 1IQWH 4U1LA 4TSAL 2HVKB 3LEYH 3RIFK 1BX2A 2ZOKB 4YWGL 3D2UD 3MLTB 5GJSL 4J3WA 3GSUA 1VFBB 1T22B 4WFED 4XCFL 4ZD3H 3I02A 5ADOL 2XA8H 3DVIA 1M7DB 3MJ8A 4DAGL 4UV7L 3BDYH 4DVBA 4M1GH 4HUUB 3CUPB 4PJCA 4RAVB 1RPQA 4XPBL 4YHOH 4DKAA 5GGTL 5IMMB 4PLKD 1UJTA 4G6FD 4ZUUA 3R1GH 4LKXB 4HG4K 3EZ8A 3VXSE 4XBGB 4WTZG 4K94H 3O4LA 4G8IB 1MWAL 1X5AA 1G7QA 3MOBH 1LP9B 4G8FA 2XTLA 3QFJE 1U92A 1UYWH 3DETD 2D31B 3MSPA 4IMKC 4RX4D 4Z7NF 1N0XH 4H20H 2A1WH 1PD6A 2MJWA 3FB6A 3O3DA 1MIML 5LWYL 4XCFH 4ACPA 1Z2KA 2NY0D 4LCYA 1BM3L 1KPRA 2I9LA 4XPAH 5HVFB 5DA4A 4PGEA 4WEBL 3QUXA 8FABB 1HZHH 1QFWM 1YEGH 4JPKL 3UYRL 2BC4B 1CFVH 1HHIB 3FHQA 1ZLWH 2VL5B 4M62H 2X40A 3QXDA 1LGVA 4POZD 4JANB 3FT3B 4MQTB 5DJDB 3HLAB 4YUEL 4RFEA 2HMID 1V3KA 5EZLA 2EKSB 3VJ6B 4K94L 2NMSA 1EO7A 3NH7H 2DWDB 1K4DA 2GJJA 4DUVA 1GHFL 1AY1H 1IKFH 3VXOB 1U8OA 4MJIE 3O8XD 3H9SD 1G1CA 2WZPD 2A9MH 1D9KB 3TZVC 5FFLA 2NY4C 1NANH 2VL4A 4XPAL 2ICWI 3H3PH 4KMTL 5ANME 1IMHC 3RKDD 3WL9B 2EYSB 5GIRB 1GGTA 1CQYA 1KG0A 4TUJB 3QDJE 1FO0H 2WW8A 5I15H 1KIPA 4FQLH 4O51B 4JE4B 4M7LH 3DXAE 5ILTL 1CGTA 5E99L 4OAWA 2WINA 5EZJA 1V5JA 2HFEA 4JHAH 1G0XA 1JGEB 1I3RB 2P7TB 5LG1A 2BSTA 1JWMA 1OARL 1QA9A 5IKCA 1J1PL 4X4XB 2FO1A 2V9RA 5BVJA 2NNAB 1MWAA 4NQXA 5T5NF 3OKNA 2QKIA 4ZPTA 4Z77B 5MI0B 1PG7X 5FK9B 3QPXH 4WEMB 4P57B 2G75B 4F33A 1YQVL 4ZFGH 3QUMA 2P42B 1FQ9C 3KYMA 3TN0B 1DLFH 4LAJH 2W9DH 4OI9A 1GGIL 1KIQA 3ULVC 5DFVD 1NFIB 3TV3H 4WEUD 1QRNB 4P59L 4HJGA 1ZHLB 4G6AC 2R1XA 2LABA 4K7PY 5HHPB 3WJJC 5D1QA 5BQ7A 5D4QA 5JW5A 5FO8A 1F13A 2QKIB 3GNMH 4W6XB 1MCHA 1DFBL 5JO5A 4OB5L 1WFTA 2M2DA 2C4FT 4RMQA 4XPFL 2IPKA 3VW3L 3TNNA 4IBLT 4FN0A 4PV9A 4XBPB 5T3ZH 2XI9A 1A21A 5IW1A 5IBTH 5D1ZA 4GRWH 2D03L 2YPKB 2G5BA 2QTEA 4M93B 3D3VE 3E8UL 4P2RA 1LEKB 3NN8A 4TTGA 5C9KA 4P46B 3KJ4B 4JG1L 4MNQB 4NOBA 5BMFH 1R3HA 1XCQB 2J8UB 1OAYH 4HWEH 2O26U 5DQ9A 5T1LD 2XY2A 5L2KB 1CDGA 4HQQL 1JF6A 3TZVB 1P4LB 1B88A 1CFTB 2G9HB 5C0IB 1U8IA 2J6EL 5FO9B 3TPUB 2BVPB 2BVOA 5FYKU 5KS9E 1TQCB 5GRYA 1FC1A 2FJHA 2DLEA 1OT1A 1JFQL 3QSKB 3FQWB 1CIUA 3HG1A 3GRWH 2WWMC 3QG6A 4Y4HD 4WFHE 3LKRB 4OSUL 5T3ZL 2J3SA 1BFOB 1MY5A 3MXVL 4RRPG 3FO0H 4PJEA 5DMKB 3IETB 3MFFB 3P4LA 4GO6B 4KJWD 1J0HA 2FBJH 2X70A 5I1EH 4GOSA 3HI1B 4BSJA 5FYJD 3SHSA 4JM2A 4LCYB 4X6DF 1FE8L 3NCYS 4O58L 5DD1L 3AGVA 2HJFB 1F4WH 5B39G 5MENE 5CEXB 4X8XA 4LFHD 1RZ7L 2Q20A 4XP9L 3LKNA 2WUBL 3ARGD 5E2UH 4EOWH 1T7WA 3A67L 2MTPA 2V5TA 4G8GA 1IVLA 5T33L 4OZHA 3RWHA 3O6FB 4KRPB 4S1SL 1FZMB 3GBNH 4YO0B 2M26A 3G04B 4M6OH 4RA0C 2X9XA 4FFZH 4QRRB 3E6HA 2JJWA 2LU3A 1A14H 4JFXA 1YEJH 4M3JA 3O6KL 1IM9A 1UCBH 4AMKL 3O3UN 5I1EL 2NY7H 4HUWB 2R69L 1RV6X 4JR9L 4GW4A 3GSUB 5GGRB 3QIWC 1O7SA 2BVYA 4F7CA 2IAMB 4MXVF 3ALXA 4R4ND 1DBBL 1RZIB 2ZOKA 3T2PA 1VERA 2Y4SA 5IJKC 1WCBA 1J86A 1CL7H 4X98A 5DQDH 5F7FA 4NQEE 4BH8A 1EHLL 4P4KA 4OGZA 5AYQA 4G8EA 2DYPD 3WJLA 1A6TB 1GGBH 5CSZA 1LE9A 3QRGH 1ZMYA 5C07E 3WUWB 2MCPL 4NGHL 3F6LA 4R4NC 1HKLL 4CVXA 4NNPH 3BPCB 3IFNH 5F7DA 3B5TA 4P2OA 3WFZA 1GGCH 2NY3D 1E4WH 2R0LL 1G0YR 2OI9C 2XKNA 5B8CA 3KPRB 4KY1H 3E6HB 3MOBL 4OQ1A 1MUJB 2HKHL 5KS9F 2NX5A 3DYOA 4Y4FD 1RK1B 2NY2B 1IL1B 4Z0XB 5C09A 4R4BB 5EU5B 4KJYB 4L4VA 4EI5D 3KG5A 1P4IH 1WK0A 2IANA 5ALCH 1LO3L 3V4UL 5L7XH 43C9B 1S9XA 2VNCA 4C56A 2IJ0C 3PWVA 3VXRE 3FO9A 4I0PD 1FIEA 1E4XL 4R6UA 4GKSA 3X14B 3UBXB 1CFVL 4OD3L 2GITB 1G9NL 3I6KA 3NMEA 1G7HB 1A64A 4N1HB 4ODVL 2PO6B 3LQAC 5L8LB 1BFVH 5ADOH 1PKQB 3BISA 1BJ1H 1KPUA 3U30B 1HEZB 4ODTH 5DRWA 1X5JA 2E9IA 5JXEC 2G60H 2ZCHH 5HYFA 1WZ1H 3HI1A 2AABL 2AQ3A 5E94B 4WHYH 4K3DH 5M94B 5F7EL 1FH5H 1M71A 4GQ9H 3GMQA 3CC5B 3C5ZA 1CD1B 4NO2A 4TSBL 2X7LA 3IDJB 3GHEH 2VLKB 2ZCLH 3CVHB 1KCKA 5F9JA 4HXBH 1A9BA 1EMTH 1I3GL 3SO3B 1XIWD 1HNGA 2Q76A 3H9HB 4Z7QE 4YBQC 5IJVA 4HKJB 3X3GL 4OF6A 4PTUB 2ATPB 1MHCA 2FCBA 3Q5OA 2FYYA 2UVFA 2BVOB 3FOLB 2R56L 2OQJB 5CILH 1YECL 2ICES 5C0IA 3DX8A 4P2YA 3BWAB 4FG6D 3VWKA 2YEZA 3JWOC 8CGTA 3GBMH 3MOQA 4ZYKB 1JPFB 3VFTA 4JPKH 2XYCA 5IQ9A 2KUTA 3C6SA 4Z76A 3JV5A 1UWXK 4KRNA 1S7RB 2ZUVA 3SE3C 4M03A 5CBEB 3CSYB 2IPUK 2R2CA 4XMLH 1YN7B 3MV8B 3K3QA 5F3BA 3NH7L 1CS6A 3FONA 5IW3A 3D18A 3HZVA 3O3AB 1EMTL 3U9UB 3BKCH 5F1IB 4XVUC 3S88H 3KWWA 4Y4FC 1QPPA 1PW3A 2OM5A 25C8H 4FS0A 4JO4H 3EIFA 4OM0H 3PP4H 3DTXA 1RZ8A 3L3DA 5E6ID 3ULUD 5FDWB 1EJ6A 3QULA 3ZKQD 3MJ7B 1UB6B 3S4SG 5DJCA 4HF5L 4OQTL 1ZHKA 2V2XA 3QFJB 4OB5H 5DJ2B 2D4DA 2IAND 1A6WL 1WLHA 4JN2B 4WWKA 5L6YL 1KB5A 2EYTB 5EFIB 4DFHA 4IRZL 4UILH 2ZUXA 2ZKHH 3DGCR 5JA9A 5HYJA 4NKDA 4LSTH 1B0RB 1YYMH 1JV5A 1YEHL 1F8TL 4PRNB 4F3FA 2AXFB 1NDMA 4Y2DA 4JO2L 1L6XA 5BVJB 4O9HH 25C8L 1NAMH 4Z95L 3PABA 1A7PL 3ARDD 1H8OA 1T03H 3MFGB 4IRSC 3ET9F 5GGUB 5I1HL 4UINH 3MCKB 2ZSVB 3NFPB 3OKMB 2AJVL 4ELMF 4R90L 4HGKC 1UJ3B 1I1CA 4K7PX 4NPYB 4KUCD 5CLTA 3TIEA 5C2UB 2BMKB 3BKML 3WKNA 1X7QB 2ITCB 4ODSL 3RKDC 4UILL 3MACH 3KPTA 1I7RA 1OPGH 4NYLB 5EBMA 3ARFA 4GUPA 1NH6A 3H42L 4P2RE 3LQZB 5DT1L 5T3ZE 5ACZA 2H26B 4D0DA 5BJTA 4HIXH 4Z7UB 3IJYB 5D2LA 3QUZD 1O0VA 3DYMA 2RFXB 2VKXA 2Q8BL 3R4DA 5A40E 4GRLC 1KLUA 5E7BA 4OZFB 4YNYB 1X5GA 3DUUA 1UJ3C 5F9DC 1T2QL 3QJHA 5I76B 4KKLC 3WFDL 3LAFA 4PRHB 3W5MA 2DM2A 4MA7H 2DD8H 3MZTA 4UINL 2X4OB 4F7PA 5HY9A 1OSPL 1XCQA 1CIDA 1RIUH 1XT5A 4NQED 4WU5B 3D85D 2Q7YA 3HI5L 5L2JB 2BVEA 4LMQI 5KSUB 3M1BB 4P23C 4PGEB 2VQUA 5CSGA 3NIFE 1UWGL 3R0MA 2AJYL 1UQSB 3QT2A 1FYTE 3BVNB 3EOBB 1ZHNB 1AH1A 4GAYB 3H42H 4WW2F 5E6IA 3VFVB 3V5DA 3D3VD 5CJ8A 4G8FB 1JN6A 1D6EB 2DLTA 4NJ9L 1BQUA 2OK0L 1WBZB 4OLEA 3EDKA 3O41B 3WSQH 3VD5A 1FFOB 3CIQA 1C5CH 4U3CA 4WY7L 4JLRB 1RMFL 3MUZ1 4F2MA 4KMQA 1KBGL 4ONFH 5IIEA 2DI8A 1KN2H 2R1XB 4DVBB 4TULL 3MV7B 1JNHB 5FCSH 4LLUB 4GKZA 5GGQH 3QO0B 1DBML 3MLSH 4MWFA 3THML 5IB2B 3SE3A 5JR1L 4JVWA 3P77B 3RWJA 1AXSA 5DR5L 3CXHJ 1I9IL 4EI5A 1A6ZA 4QYOB 2YD2A 4DKDC 1MWAB 4NQXB 1RAMA 3KLSA 3QHTC 2ORBH 4V2CB 1DVFA 4ENED 4X4XA 4C56D 3DI3B 1KEGH 4UIKL 3BP6A 3S35L 5IT2L 3MCLH 3JBG7 2BSTB 2PYEA 1XFPA 4PY8I 4QHKI 2Q6WA 5CMAA 4FZEL 3MROA 1UFUA 4M02A 4CN4A 2OR9H 1JTOA 2AEPH 4GRLA 3AB0C 2NTFA 4U1IB 4PBVC 2DQTH 4YDLB 2Y07L 3H8NA 5C07A 4WI5A 1G9MH 1QSFB 4XI5C 3ULUF 4OJFH 1FV1A 1JZ8A 4I4WB 4AY0A 4ZYKA 2V5RA 1W0WB 3KLHC 1TJGH 4LK4A 4HCRH 1M4KA 3O11B 5FM5O 4LLQA 5HHMD 4U1MA 5GQBA 3OV6A 1A6AB 5IM7B 4UTBH 2JLLA 3FQTB 2N7BA 2BNRB 4PREB 3ARBC 3I85A 3LEYL 3T0DA 3RUGB 1ZGLP 1N2RB 4TSBH 4WJ5A 1JHKL 2AGJH 4U1SA 1WBXB 4RIRA 4CN1A 5ABDE 3C60C 3STZB 4GFTB 1KB9K 1ZS8A 4DGIL 2FHFA 4KK8C 3BYYA 1OM3H 4XBEH 1CE1H 1JGDB 3CH1A 3KPNA 1IBGL 3AU1B 3BXNA 3CFEA 4U1NB 1AD9A 3ZSTA 2NR6C 3DRTB 4GAYA 2D9CA 4OFKA 1AGCA 2H32B 2XFXA 4K2UL 5EO1A 3UO1L 4JY6A 4PGBA 5K9OB 2JB6A 1WFUA 3T4AA 3TT3L 1IGCH 1NFDE 3UBXA 3MODH 1CXKA 4DQOH 1C5BH 4C4KT 1SM3L 1K5NB 5EC1B 2FR4A 2Z9TA 5HI5D 1RHHB 4XBGA 4Y5VB 3OTTA 2X44D 2ZCHL 1FZKB 4GRMB 3U4EB 3CJJA 2APVA 2KH2B 3IDUA 3RNKA 1NGXA 3QUZC 2XWTB 4MAUL 3WHXA 1LO5B 1LDSA 2D0GA 2YMXL 5LJYH 3TN0C 4PB9H 4P2OC 3IJYA 1K2DA 3KPLA 2EIBA 1HOCB 3VWJA 5I0DA 1HSAB 5BS0D 7FABL 5L2KD 2NLJA 4JJ5A 5F96H 1NLBL 5EBLA 3V4PH 5K9JH 1KTLA 3SE4A 2RCSL 5SX4H 3TWCH 4K8RC 4AJ0A 1CE6A 4MYWB 1WWBX 4TN9A 1BX2B 4O2CB 2D9QB 3TT3H 4BH8B 1A9EA 5I17A 1ZSDA 1HHGB 3K46A 3QFJD 4MDJA 4PJHF 1Z3GL 4NWUH 4LEXH 1OB1B 5D7SL 5HGAB 4CU8A 4MX7B 4NQDA 4JFFD 1XGRA 2Z92A 2WBJB 3IFLL 4U6YB 2X4RB 3S34H 1DTUA 4WO4C 5C0RL 1XR8B 4ZTPL 3GSOA 3VRJA 1KIRB 4UT9H 1B0GA 1DZBA 1DQTA 5T1MA 1IAII 4DGYH 5E8NA 2I07A 1KT2A 1UM6H 2UZIH 3OR6B 3LS4H 5E00A 5FYKL 1CR9L 1FNEB 3D69A 1G7JA 1FFNA 5KG9B 3QXUA 2P8LA 2CKBL 3QIWB 2BNQB 1BWMA 3MRIB 1TQCC 3WNLA 1NMBH 3BH9B 2FL5A 2Z92B 1OLZA 3BZDA 3QEGL 1Q9KA 3U9PH 4ZFGL 1OB1A 3GO1H 1MVUB 2VDKL 4JFDB 5EO0B 5IW6B 4OGAC 1ADQH 5KVDL 1FL5A 1N4XH 1HHKA 1QLFA 2E27H 3MUY1 4K9EC 3IU3B 4HKZB 5IROA 3NBNA 4ZDHA 5DMKA 5DXWA 5F97E 3L3GA 1SVZA 5KZCB 4WNQB 4W68A 4OFIA 3WFDH 4Z7UF 1JPGA 3LQAL 1ZT1B 5H2BA 3WD5L 3FCTB 1U93B 3CSYA 3U0WL 2YBRB 5KVGL 2CIIA 2W0LA 3GIZH 5DJZA 1U8PA 1HSBA 1II4E 2VXTL 4M7KH 5C6PB 2E9BA 1MHPH 1CDCA 1MFNA 1IAMA 3OQ3B 2B1AH 1PVHA 4R0LA 3RDTD 1JL8A 3U7AA 4CMHB 3VXUB 5IHUL 4LGPB 2FJGB 5TE7H 2LFGA 5GSVB 1KN4L 1E6OL 1S7UB 4FQXA 3NCJL 4HWBA 4R3SA 1JZ3A 4JKKA 1U8LB 3RY5A 1ES0B 2PO6C 5KTEH 1LEIA 2XZZA 4F7EB 1ULVA 4YX2H 2DDQH 4P5TC 1WZMA 3W0WA 4QNPF 4IIQA 3ZDZF 1FAKT 3CFJB 5D1XA 2O5YH 4M6MH 2DJSA 4NBYB 5DLML 3RVWD 4O2FA 4WI9A 2ITDB 4MQ7B 4CMHC 1X5FA 3K8MA 3SKMB 1F11B 1YY8B 3SCMC 2WBWB 4TVSa 3SDXE 2IAMC 3DIFA 3EO9L 2DN7A 2C4XA 5D72H 4P0DA 4Q0XL 1OTUD 4OCSH 4XAWH 4CU7A 3SKOA 1YUHA 3THMH 1HEZA 5DRWB 5ETUB 4HXAL 3J7HA 3L3KA 4O00A 2KBGA 2MCG1 3FB7A 1MLBA 4Y5YB 5E24E 3LSOB 3DVGB 3C9NA 3MRIA 2Q1EA 3PNWB 3L3JB 2BNRA 1D6VH 1N7ML 1OTUC 5INDA 5DURD 5EOQL 3S3SA 2JJTC 2R0ZL 3ARBD 4FQJL 5FYJL 2ZNWA 4YHLL 3KYMB 3TN0A 4LCIL 4KJYA 4L4VB 3ZDZE 1AKJD 2ESVA 4QNPE 2BOBA 5BXFA 2D0FA 5JLZA 4NJ9H 4Y5XB 5FKPB 2OR9L 1TNMA 4DAGH 4U1IA 5ICYA 35C8H 1CLYL 1Y6NR 4O02H 3TJEL 3OKKA 1IGMH 5ESAA 4I2XE 4RFOH 4IMLA 2ED9A 4S1SH 1IC4H 4HV8B 1NSNH 3I3BA 4Z7QF 3U83A 1HHGA 4P4KB 5JMOC 3ZKND 1MWAH 3GSXA 5HHOB 3RGVB 1CBVH 1RY7B 5DMIL 4R2GD 2A1WL 3W9DA 4XH2A 5AZ2H 2A6DB 4U3HA 4UV4H 5DJ8B 5IEKA 1GZPA 1SJEB 1RZKH 5CEZH 4JG0H 2AQ1A 4N0UE 4PJFE 4QHKJ 3MRJB 5I8EB 2YZ8A 5E8OB 1X4YA 5FA3A 1T04B 1DE4B 1NFDB 5GS1A 4JM4H 5T3XL 2VXQH 3RIFF 3ME0A 3FFCA 3S35X 1PZ5B 1BD2E 2NQCA 3QZWA 2H3NB 2UUDK 1RZFH 1RUML 4QRRD 5JZ7D 5FGRA 3VFPB 3VXNA 2YUZA 1TPXB 2FIRT 4V1DA 2F74A 5DVKA 3MXWL 1Q9WB 5FECB 2B5IC 3T4AB 5HGHB 3G5YB 3TBTA 1LD9B 2VLJD 3BVNA 4GG6A 5C8JB 2EIDA 1S7QA 2ICEB 1UXSA 1EEUA 1VACB 5GHWH 5K93A 2D31A 4OIIL 4O2EA 1LP9A 2VWEE 3ARFC 4AK1A 1EEZB 2DTML 5HBBA 3HNSL 2BNQD 4QT5A 1SYVB 2XNAA 1HILB 1X5IA 5CCKH 3WNMA 4POZC 3DUHA 2KQMA 2DQEL 4QXTA 5F88B 3FFCB 3LRSB 3QG6B 5T3XD 3TWCL 4OLZL 1IBGH 3HG1B 2C3XA 5HHME 2XN9B 2EDDA 1RUMH 3CMGA 3W11D 4YHYB 5IVNA 2GKIA 1F3DH 4Q6YA 3QEQA 3OKOA 5KVEH 2PUQT 4I3RH 5FHBH 3REVB 5JORA 3SBWA 5CJXA 1D5XA 1QVOB 2XZAH 5JOPE 1S5HA 3IFLH 5IB1B 4TOYH 2XWBB 4NFCA 2OJEB 1QSFA 4XNZC 4N0FA 2Z35A 2DQFA 4HK0B 4P46A 1AQDB 1OAUL 4R9HA 4P2OD 2ZSWA 5EUKA 1FNAA 2PXYA 4ZODA 3B9KD 3TIDB 5CMAB 2D7PA 4JY4B 4CKVX 5DJ0B 1U8QA 4MCYA 2YMXH 1H9VA 5C2BH 5I15L 5ENWB 1T1XB 15C8H 4JQVC 5C0JB 4I0PA 3H0TA 1IC7H 1WICA 2BHZA 3MUGA 4M6NH 4QOKD 4WIQA 4Y19E 1MHEA 3HPJB 3ZZ1A 4CJ1A 3TFKD 2WLYA 5DUML 1BQLH 3NCMA 3OAUH 2QQNL 4HIEA 2HFTA 4CW1A 4L4VD 3EHBC 5GGTA 5DFVC 4OIAA 5CINL 3I6LE 2V7NB 1KB5B 5FCUL 3C5JB 1C12A 3ZT5A 2O5XL 3PG2A 5DD3H 2R1YB 4U6HB 1T2JA 4YHZH 2WIIA 4FXLA 3PWUA 4M1CC 2W9DL 4LPTA 2Q8AH 1OTSD 4N8CL 2DM7A 2EC8A 5CGTA 2JIXA 3N1QC 3ULUC 4L9DA 5D2NA 3T0EE 5AD0A 2XWJA 3AM8C 3MYZA 1CICD 1YMMD 3IS0X 3TYGH 1J10A 3HUJF 4PY7A 2YRLA 4LSTL 4XC1L 4PJAF 3CFJA 4JM2D 2E7CA 1ZHNA 4Q9QL 4J8RA 1DBKH 2VZUA 2Y5TB 4EDWH 5CINH 3QYCA 2YA0A 3EYUH 5DJYB 4E0RB 2MNUA 4LCWB 2OSLA 3PWNB 4MXWL 1CF8H 3C6SB 1U8LA 2MQ0A 5HDOA 3NA9H 5B3JF 4NN7B 4FXGB 1DN0A 1ORQA 2XKUA 4NO5B 1NCBL 1KGCE 1PZ5A 1FAIH 4F9LA 4OZIB 3S5LG 1BJ8A 3BPNB 1R5IA 3VRLE 3VXRB 3IAGC 4LLDB 5E8DL 1MCCA 1AXTL 5F7YC 1MFEL 3PHQA 2VITA 1QSFD 2GUOB 4Z7UA 3R8BB 4JANA 2OZ4A 4XC1H 4GMSH 5HI3C 4MZ3A 5C1MB 1CD1A 4NO2B 4HIXL 5DUPH 1EEYB 3OB0K 3TN0D 4R4FL 2BOCA 4QHMB 1MHPL 4CDHA 1A6PA 4Z0BH 5K59F 5MERA 2FD6H 4RISH 5B38A 2OTPA 1JTTA 3CCHA 4MD5A 4MXWH 2W0PA 3AAZB 2PN5A 4PJ7B 1UXSB 4XCYA 4RBPK 3GMNA 2HG5A 1P7QB 4PJGF 5B8CC 1NGYA 4M5YH 4P4KD 4RDQG 5E2WH 5JMRA 1R5VA 3BD5A 4KFZC 3G5YA 2IG2H 4HV8A 2DI9A 5HI5C 1PYWB 1GCFA 3AS1A 1U92B 5FGBC 4U0RC 1CL7L 5DQDL 3WNNA 1CTOA 3BHBA 5IF0B 1F3JA 3UTTA 1HXYB 2Y06L 1AP2B 5BV7H 5ICYB 4JQXC 2VLJB 3HG1E 1UWGH 5C70A 5HHMB 5E00B 3VH8G 4QRSB 2YK1H 5IMMA 4TQEH 3IDGB 2OR8A 3A67H 4DW2H 1U42A 5C0AA 3QUZB 1NEZA 2OTWB 4D2NA 4Q0XH 2K7QA 4ZOEA 5EFIA 2P24A 3G6AA 4BA8A 4X4ZA 4B50A 3WSQL 4P2OB 2OS7A 4XCEA 2OBGA 5HVHB 5JQHC 1C5DB 3L7EB 1B4RA 4OKVB 4P3CL 1J05B 4K71B 3WBDA 4MX7A 3HMWL 5C0BE 4RGND 4JAMB 4JEGB 4KKLD 2C7UA 3FQRA 2V6HA 1QD0A 2H8PA 3FFCD 5I1JH 1F45A 1XH3B 3HI6H 3JV0A 4KKBD 3VXQA 4QWWC 1U2CA 4GH7B 1OGAD 1A7OL 4P2QE 3WHE1 5JIHA 2WBJC 3QQ4A 2YK1L 2DRUA 1U41A 1U3HD 3AREC 3T65A 5C0DA 5FUOL 1TCRA 5F7EH 2UY7A 5I6XB 5DD5H 4I3SH 1XF2A 3QRGL 4K9EL 3QUZA 3GMOB 4LPWA 1OT2A 1ZGLA 3IFNL 1AJ7L 4HMCA 3U4EA 1JE6A 1GGCL 2GSIB 2EH7H 5KAQF 3ABZA 3QEUB 3IU4L 3DHJA 4N0CD 4HWZA 3VGEA 4IDJH 5EOTA 4JFOB 1RVFL 1IC5H 3V8OA 3DVGA 1CWVA 4YHML 1AGBB 1Q72L 4RDQF 3UTQA 4B41A 1CDYA 5I74B 4HH9A 4LPUA 5FHAH 4HCRL 4XCYB 3LN9A 4UV7H 1RULH 4K3EH 4NWTL 5IK3B 3BDYL 3UZQA 1C16B 1YJDH 5DD5L 5L0QC 4HFWA 4AM0A 2XV6B 1B9ZA 2IALB 3QH3A 4GG6E 3O6MH 1MVFA 3V0VA 2YC1B 4AIOA 4U4BA 1CDIA 4C55A 1PKQA 1C7TA 2E6QA 2ZUQB 3AY4A 1JCKA 3ILQD 1P1ZB 2Y25A 3H9ZA 1B2WH 1A7NH 2BY1A 4GG8A 5HTSA 4EUPB 4QOKB 1R5IB 2ZUUA 2BRQA 5ERWA 1P53A 2OLDA 4YIQA 3S96A 2WP3O 5GSVA 4GW1B 1XF3B 4PJEF 3EJJX 3IJHA 5KAQG 2P4AB 4FQPA 5D7IB 4FQ1L 4HZLB 1X9QA 1YPZF 4L3EE 4X8JB 2YUWA 4LCCA 4FFYH 5J4MA 3HNSH 3U7WL 2DWEA 3PQYD 3QNYB 2VQ1A 4JZJA 1XIWB 3UDWA 1EX0A 4HX1A 1XF2B 3CFCL 1MNUL 4YUEH 1OSZA 2I5YH 3GZKA 3V9FA 4LVNB 4CVXB 1BVLB 4D9LH 3U7YH 1T66C 4JO2H 1MQKL 5KSVB 4YK4B 2XTJC 3OMZA 1DVFB 2IPKB 5JO5B 2R29L 4TNVK 2JIXD 3FQNA 3BMWA 3P4NA 2ZOLB 4M43H 5IR1B 3ZMRA 2DQGH 2VISB 2RBLA 1KGCD 2DKMA 3B83A 5JZ7C 3MJ9H 5DD6B 1AE6H 2WIIB 2Z8RA 5ID1B 4GW4B 5IB2A 3C2SA 1G6VK 1VB9A 5FYLE 3QXAB 5H35B 4LASL 3BW9B 3L5WA 1Z5LA 2I25N 5F1NB 2FEEI 4XTRD 3OXRA 2HH0L 1MI5E 2VDRL 2MHAA 2OTWA 1VPOL 3CFCH 2A73A 2R4RL 3MRMA 4CW1B 1R0AL 2I07B 4LEXL 4J1UB 1TFHA 4DKEL 3LKOA 1PEWA 1PG7H 2BFVH 5DJXA 2KZ1B 4LLVA 4PP2B 3IYLW 3NFSL 4S1RL 3C6LB 3GIVA 2DBLH 3O41A 1UCTA 3QI9C 1XR8A 3N85H 2R29H 3VXMA 3QQ3B 1FC2D 3DXAA 1UWEH 4MHHI 4JFQA 4XAKE 2DQGL 4F37F 5E1AB 5JHDB 4JY6B 2HT2D 1UQSA 3RRQA 1NBYB 2YN5A 4D0BA 4GLRI 4P59H 2V17L 4EVNB 2A9NH 4NQSB 4X80L 3M1BA 1JBJA 3S3PA 5IVXE 3RGVC 4ZFFB 4QGTA 1P6FA 4RQQA 2DAVA 1CDUA 3ULVH 3HR5A 2DMKA 5A16A 3LQMA 1AGDA 1K4CB 1NCAL 5F89A 3IT8D 5KVDH 3DUUB 2EDEA 2P5WE 5GS1B 3NPZB 1BEYH 1CG9B 4LSVL 1S7WB 1V8HA 4PREA 5IBTL 4KI5F 3C2AL 2BVPA 3PQYA 4OZIA 1DBKL 5SX5H 5AYUL 4NJAH 5L2KA 5L88H 1PZUB 1T0MB 3WYRA 5C0EB 5GS2D 2ZUSA 4JFFA 4X4MA 4ETQB 3RL2B 2DQUH 3QI9D 3NA9L 4NQUA 1MHHA 3V0AC 3L95A 4NQSA 1XGYH 5K9OA 1S7QB 1S7VA 4PJBB 3KPSD 3HAEG 1BIHA 3M17B 4GS7C 3GJFK 4HK3J 3TBTB 3MROB 4K94C 3MRRA 5I75C 1Q9WA 1LEGA 2GJ6B 3UX9B 2F74B 2VDPL 1MFEH 2VZVA 3FQXB 5KN5A 3KLDA 5GS0D 4U31A 4IHOA 4OF0A 2VC2L 1A6UL 4OQTA 3OX8A 1U8HA 4UQ3B 5GGSB 4KQ4H 3GGWB 1KB5L 4ZMAT 4P3DA 1MJ7L 1KLGA 5GS3A 4X6DE 5I16A 3D2UB 4WRLA 1MFAL 3PXJA 1H5BA 5E8OA 2J2ZA 4HK3N 4PJ8D 4D9QE 3B5GA 3MYJA 5GRXG 2CDFA 3P9MA 4Y16A 4ALAL 2VZSA 3LVEA 3MRJA 3OXRB 5I71C 1RIHL 43CAB 1TENA 1ZWIA 1LK2B 3KAAA 3KXFD 5I75B 5SWZA 5DD1H 1YNLL 1T5WB 3JWDH 1JHTA 5CD5C 1CD8A 1W0WA 2A83A 3QUMB 3LSOA 4QXGL 1FV1B 2ZCKH 4F33B 4NKIH 4KROB 3B2VL 3QPQD 3K2MC 3E0GA 4W4OC 4ONHA 4Y4HC 4I0PC 2O5ZH 5CUSL 3I75B 2AP2A 2I24N 3O4LD 1ZLVH 4JQVA 1B3JA 1U3HB 4H5SB 5IOPB 4YGAB 3NPSC 4ZOBA 1QA9B 5IKCB 3ULVD 2PW1B 3ZKMD 1P7KA 1IFHH 3FO2A 4GJTB 1WBYB 4UUJB 3F7YA 4HS3B 4QKXB 3ZYJA 3QUKB 4MQXD 4BZYA 1HDMB 3WNKA 1YEJL 4NC2B 4PG2A 4DUWA 4KKNA 1OSZB 3OKKB 4N8VB 3W0WB 2XACC 2AS5M 4IDJL 3H7BA 1MFDH 2NY3C 1RVFH 1RIHH 4GXUM 3ZO0A 2GAZB 3RL2A 2VAAA 3HG1D 3HCVB 1QTYT 4L3ED 1YYLL 3GI8H 1HN1A 3CU7A 3VXSB 2A6JA 2CH8A 4ISVA 4AG4H 3C5SB 2AEQH 2C3VB 1HI6A 1YEFH 3QEQB 4UNUA 4XPTH 2FECI 4R0LB 3G6DH 2B0SL 5C0FB 5IG7A 3SDCC 2IWGA 3C9NB 1I75A 1IKNA 4AENA 3O6ML 4KPHL 5J9PB 3IDNA 4PG9A 1OP5H 2AJSL 1EBAA 4GUPB 4JRXD 5DD0L 1V3MA 3UJJH 1NCDL 3D25B 2JE8A 4Q6IA 2DLIA 5JOEA 5ICXA 2ZNXA 2FZ3B 3TBYA 2BMKA 2F5BL 1KJ2A 2ILLA 3KPMA 4GRWB 3T4YB 4B0MM 2BNRD 4Y1AE 1R3IH 4OLXL 1MCRA 2CMRH 4OV5A 3VWJD 2ATKB 3W0WE 2YD5A 3MRCB 3U4BH 3BO8A 1DANT 5H8DA 4AIZA 1QFWI 5ALBL 2WQRA 4G7VH 2WANA 1A7RL 3MRFA 4NO0D 2O61A 1A7BA 2YPVH 2X4UA 2Q7YB 1EA9C 5DC9B 3OR7A 3MBEB 1G7IA 3F7PC 5F72S 2H3NA 1JZ7A 3BUYB 5DF0A 1EHAA 2IF7A 2NY0C 3E6FA 3QJHB 4ZAKB 4PGJA 3P4OA 5CD3A 5E8NB 2AJSH 2N56A 3X11B 5CWSB 4IOIB 3L3IA 4DQOL 1RK1A 2IBBA 1JV5B 3UROR 5I1LA 3GEWB 3EUUA 1ETZA 1J8HA 1NGZB 1BREA 1T20B 3EO0B 3QUYC 4LCWD 2MHAB 3KPRA 5ACMA 4ZOCA 3V6ZA 5I8EA 5IBLC 2H26A 4D0DB 5BJTB 3O81A 1Z5LB 5EUOB 4DGYL 1S7XB 3BPCA 1OLLA 4PJAE 1YEKH 4HUXA 4LARL 1WCQA 4MAUH 3FFDA 1HHHB 4MNQD 4XH2B 1JWSA 4HJ0C 1ZTXH 1U8NA 3VXPA 4HKZA 3WN5B 4JY5H 3Q3GA 3BRDA 2A2QT 5K9JL 2G2RA 4OLUH 3HZKB 3DMMD 2CXKA 3SE8H 3QQ9D 1Q9KB 1J18A 2IAMA 3U9UA 4PJEE 3U2SA 1EGJL 5E2VH 1KCUL 3CFBA 5EZIH 4HJ0D 1MEXH 2E8YA 4NP4H 3REWA 4RNRB 1YN7A 3T1FB 1U0QA 4TUOB 5T1DH 4CRPA 4ZUTB 5JW4N 2P1YA 3KPRE 5DK3A 2PKDA 4QRRA 3IDGA 3PGCA 4QRPD 3C08H 3WN5C 4C54A 1MLCB 1A6VH 1DQQA 4U6TA 2VLJA 3TM6A 4ZO7A 1QSEA 1ZANH 3PV6A 1KIRA 2L4OA 3QNXB 2IFFL 3BH8B 5HVHC 1KCLA 1MHCB 4GRWF 2B1AL 3T0EC 2D7TL 1UM6L 1CLCA 2D7OA 4JPVL 5DUMH 1MCLA 5IVZA 2BCKA 3VGFA 4GAJH 2OL3A 4RZCA 1UM5H 1MEXL 3SGEI 1G6RH 1Q1JL 4JFHE 3T4YA 1I9EA 4OCNC 1HH6B 5GZOD 5C6TH 1QYGH 3N1GC 3EHBD 3DYPA 4LSPL 4ENEC 3IDMB 3B9KB 3BP4B 5HGDA 4NT6B 3WIHA 1G1YA 4YQXL 4B53A 3RWIB 4LRIA 4ZNCD 2R2EA 4OCYL 2R4SL 5CBEA 5I18L 3LPFA 4DGVH 1BVKA 3LN4B 5ITFA 3VFUA 1SMOA 1LO5A 2KQNA 1QBLL 2VWEC 3KYNA 1HE7A 4KDTC 4XNXH 1QO3A 1Z0NA 3GMPA 3X14A 5KJRH 3FQTA 1JZ2A 2LTQB 2X4PA 2G9HA 3GJEA 4JPVH 1VFMA 2ARJQ 4XP4L 3O6FD 2H9GB 3OKEB 1SJHB 1CICC 3L3HA 1G7PB 4EN3A 5EBGA 3F5WB 2XZQH 2OMBA 5EB9A 2VUOA 4HKJA 5DJYA 3U4AA 3NZHL 2YD4A 1U91A 1T1ZA 1YZZA 1HNFA 2Y6SC 1W0VB 1L6ZA 5JW4R 4RWHA 4J8RB 5F7LB 3UJTH 2R8SH 2VLRB 2R2EB 5F6HJ 4NHCL 1WTLA 1RIVL 3PUCA 1XGTB 4F9LC 4HPOH 4DWHA 5GRVL 4J3OC 1BEYL 5D7LE 4OCXL 2DB8A 3BZFA 3AU1A 3BXNB 3CFEB 1WSST 4DGVL 1ZVHA 3UZEA 5CZKA 3MGAA 3CX5K 4LPYA 1T66D 3GI9H 4L4TD 1KPVB 4XB8A 4X98B 3ARSA 2VLKD 2R9HD 4LLWB 1WCBB 4KI5E 3RPIB 2FLBT 1E4JA 1NKRA 3RZWA 4JDTH 3HMXH 2X6MA 4PRIA 3WEXB 3SJVE 3HC0A 5HYQA 1RK0A 1DEDA 5T3ZD 3QISA 2JCCA 3BAEL 3MJGX 3G08B 4Y0GA 2CO7B 3V52L 4NQVB 4WENB 3VRIB 1J1OH 1U58B 4NQCE 4Q9CA 1J0IA 3RVVD 2F53B 3H7LA 3G6JE 4LLQB 3GKWH 1PG7W 1MF2H 4FG6C 4KV5E 3WS6C 4KRPC 4HBCH 5I16B 5D6DC 2ZUTA 4IJ3C 4PS4H 5DRZA 1VGEH 1E28A 4ZXBA 5GRUH 3TC9A 1BF8A 1QEWB 1XIWC 4YHLH 1RU9H 3VXUE 3VRJB 2EE2A 3I50L 4A6YA 3ESVF 3EDJA 5DSCB 3QAZB 4IS6A 4ELKA 2A74A 5DO2C 3WNOA 3U2SB 4TULH 1DVFC 3NA4A 3S36X 1A6TA 4XCNA 4LDEB 5CP7B 4KK6D 4WCYH 1B6DA 1U8JA 1TJHL 3W11C 3QHFL 4QYOA 2CLVA 4E42B 4FFWC 5KSUA 1A1NB 1JK8B 5DUBA 3CK0L 3BP5B 3HKFA 2X4OA 1S5IL 4F7PB 5TQ0L 1EPFA 4YPGA 2VR9A 3CXDH 1JRHI 2NY6B 2AJZA 1EEQA 4JQIL 4U6XB 3W2DH 3PHQB 4ZO6A 3SPVA 1A22B 2OI9B 5J57B 4QHNA 3KPQB 1FFRA 1I1YA 5JW3H 3TBSA 2DI7A 5IBUG 5I1DA 5E6YA 3TBVA 3V6FA 4DVRL 3OGOE 4FQCH 3C6LC 3EDFA 3GSNB 5BO1H 3ARDB 4NDMB 5HYJE 3VMNA 1G7MB 3OBAA 1JWUB 2AERT 3RGVD 5HDBF 4FXKB 5IVXA 1DL7H 3H3KA 2PXYD 5ANMA 3WJJA 1IGIH 1KXQE 4LVHB 3PP3H 3D0LA 1TZHB 5FECA 1X5LA 5F8RC 1CI5A 5AAWA 1JHKH 3MFFA 3VMOA 5EIIA 3KPNB 3MLYL 2NY4B 2GSGB 1I1RA 4YK4C 5TGBA 3CVHL 4QRPE 3TBVB 4PP1D 1OOAA 5EIVA 4JCLA 1NDMB 2ADFH 4PRNA 5FHAL 4F3FB 2YSSB 1RULL 2B4CC 4K3EL 2B2XH 3RNQB 2NZ9C 1W72A 3M45A 4MQXC 2YRPA 1MELA 3BQUA 2YPLE 1FJ1B 3ARRA 1G9MC 3HE6B 4M7JL 2OL3H 1P2CB 2ADIB 4XP1L 2ENSA 2R1YA 3FAWA 4POUB 3KYAA 2X9WA 5FO9A 3SKUD 1ZHKB 2B8OT 3UO1H 1MCJA 3MUJA 3NFNB 4HGMA 1MJ8L 4HKBA 1I1FB 1I8KA 3ROLB 1FN4A 1J5OL 1AHWB 2VXSH 4MB3A 4HWBL 3W9DB 4HUMB 4IRJD 4M7LL 3GB7A 1K6QL 2GAZA 5E9DA 4AEHL 3MRBB 2HTKD 4M5ZL 5J6HB 5T1DL 1A3QA 2AJUH 5KVFH 3GMRB 4IOFD 3OHXA 4WDIA 5CD5D 3FT4A 1MCOL 3DV6B 4F8QA 4GS7B 4F58L 4LDOB 3KWWB 3MRQB 5DA0B 1U8KA 1XR9B 5EU6D 2IQAA 3AXLB 3QUKA 4G6KL 3BRFA 3QPXL 5MEQA 4OAWB 4PJIF 2VLLB 4TUKL 3BSZL 5SWSA 5I1KL 1ZANL 5CEZE 1MCDA 4PRHD 2HTKC 4UAOC 4TUJA 3VD3A 3KS0H 2X5PA 4Y2DB 5D5ME 4JHAL 4OZ4B 2WWMD 5SV3A 4X9HA 3IXAA 2J8HA 4Z7UE 1UM5L 5EG6C 4P9HL 4EIZC 5SWZB 5KSAC 4WWKB 1XCTB 4HULB 5TDPA 2QR0B 3BZEA 3SCMD 3CDGA 1KIQB 4FQHB 3HUJB 4UMGA 1QYGL 3LOWA 4G9FA 1TTUA 4ZSOA 2DLFH 2VKWA 2RB8A 3D3VB 4MAYD 1LILA 1DEEB 1HH9B 4X9IA 1F97A 2VH5H 4FNLL 4RAUA 3MRKB 4X83A 32C2B 3SDYL 4G6KH 2FX9L 3WKMH 3MLXH 3ILQC 3O9WC 3IDJA 1FO0A 2IADB 2VZ1A 3OG6B 1SYSA 1IEAA 1WBZA 4OFPA 5KJRL 4CNIB 4JKLA 1LNUA 1S9YA 4O2FB 1KULA 3WS3B 3MRRB 5T1KD 1AD0A 3GK8H 4QXUL 9CGTA 3V4VL 1KACB 2NY3B 3CNKA 1OD7A 1W0VA 3CLFH 3MLWL 5BRZE 1JYNA 4ODWA 4R7NA 2DM4A 2GFBB 1HIMH 5HDBE 4NHUA 2AXGA 3RX5A 4IMKA 3LKPB 4DN3H 4OFVA 3QEGH 1Z9SA 4H26B 3VXNB 4JFOA 1JUFB 5JUEL 1G7PA 4M1CD 1NCTA 4M1DL 1JPFA 1S7UA 1KXVC 3U0TB 4LAQL 5F71A 4NO3B 5HHXL 2P5EE 1VKXB 3SDYH 2FX9H 1CGXA 1ERNA 1MFCL 2VLME 4DTGL 1YEEL 1IL1A 3MQIA 4X80H 4XXDA 4G7YH 4Q74A 4OF5A 5FIEA 2I9TB 4KJQD 1YQ2A 3KYOB 2P5WA 1IQWL 1MAKA 3FCTA 2P46B 4HIHB 4NCC1 4NN7C 3RY4A 3GK8L 4NQDD 3EFDL 1KF9B 2X7LB 3CFDB 3C5ZB 3PQYE 4OLYL 4XNXL 1BLNB 5DRXB 1FNGB 4PJ5E 3VXQB 1HH6A 1RUKH 4M6AA 1NBQA 4LBEA 2JJSA 1HHKB 3VGAB 5HHOA 1MCQA 2AEIT 1OW0A 3UJIH 1B0WA 5LBSH 3BGMB 1F90H 1RZJL 3U46B 4J7RA 2FL5B 4WO4B 2DJUA 4JZNA 1KOAA 2R0WH 5KSAB 4XVTH 4DTGH 4XP6H 1QFOA 3DI2B 4A2LA 3T1WA 5J6GA 5CAYB 1S78C 2APBA 1SBBA 5T5FL 1KCSH 3C6LA 3HAEH 1QSEB 43C9A 2DF3A 5DI8B 4LKXA 1AO7A 5DLMH 1WV7T 5DJXB 4ZUWB 3MRPA 2I60H 4P5MA 5IMOA 4R97C 5DK2A 1PSKH 4ODUB 1QHPA 5BV7L 1BBDL 5TDNA 4WFGD 1M7DA 3BHBB 3MBED 5IF0A 5TF1L 4MZ2A 3V6OA 5D6CA 1KB5H 5DD6A 3FB7B 1X44A 1D6VL 3KS0J 4PRIB 3WEXA 3WXWH 3WDJA 2JJVA 5DS8A 2G2RB 1I3VA 5D5MA 3L7FA 1UZ6E 2Z8SA 4LQ1A 1PKOA 3VXPB 2H2SD 4G80A 4MJ5A 3DIFB 4P3CH 4Y8AA 3ARVA 1E6JH 1EZVY 1NDGB 3JWDL 4QHMA 5EU3B 5LAXA 3KLHD 1FVEB 5DZLA 5MHSE 3UXFA 2I60L 4ZUSB 1TZIB 3HB3D 4OFDA 1OTTD 5E4EB 2XPGA 3MNWB 1QNZL 1KCRL 1LO3H 4IIQC 4JFXB 1FPTL 2H6PA 2YN3A 3LKSA 4GW5A 4UOW0 2BP3A 1I7TA 2NW3A 4KUZL 1GRWA 3CX5J 5KSBB 2CK2A 3LY6A 5DYOA 5IQ9B 4YHKH 4YAQA 4ONGH 3QDAA 5CWSA 1P84J 4GRMA 4YO0A 4XNUL 5D96B 2P5WD 4FQIH 2J8UE 1Z9OA 4D3CH 1INQA 1ZV5A 3AREB 1UKQA 1H15B 1NAKH 1R24B 2AXHA 1SEBB 5HPOA 2HP4A 4E0RA 4K3DL 4HFUH 2VIRB 3D9AH 5LQBL 5ALCL 3DURA 4D0CB 4CGTA 3EYQD 1H3TA 1RUQL 2DLHA 2C9AA 5I73B 2F54D 4X5LA 3TH4T 3SGJC 5HYSG 4D8PB 2B2XL 3DRTA 1AR1D 5DJAB 4PUBL 3IDMA 1KCRH 2ADGB 1FG2A 2HKFL 1FZJA 5HGBA 3EW3B 4N5EC 3G6DL 3HNVL 2SEBB 3TV3L 3CH8A 5EO9A 3VFMB 4KMLB 3QDGD 1I8IA 1MJ8H 3H9YA 4EDXA 2VXSL 5J9PA 5FOJA 1NQBA 1CXFA 5DTFA 5IHZA 2WBJD 4OUUA 4BKLB 1SY6L 4PY8J 1SEBA 1QLRB 4LDLB 5DC4B 4K8RL 5J1TC 4GKSB 4Y16D 3B3IA 4G6MH 4EN3C 1EVTC 1NC4B 3KVQA 3KXFA 4M8QB 3FB5B 3OR6A 2EXYD 3VMPA 2RIKA 1MLCA 3UPRA 4W4NA 1MCIA 4TUKH 2VDLL 3MLYH 3QDME 4LNRA 1WT5A 3QR2A 3IS1X 1XEDA 3SGEH 2HH0H 6FABH 1HQ4B 1UADC 3EYQC 5C6WH 2R39A 3GSOB 1MCEA 5KANG 5D1ZB 1ZLSL 5F3HB 4RMRA 4PGCA 5EZJB 4MCZB 4BSVA 1Z9LA 3NVQA 3H9SB 4WTZA 3MRQA 5HGAA 5LVEA 4MJ5B 3NCYP 5IOPA 1I3UA 1I1AC 5DC0A 4WDIB 2EO1A 4PJCF 5I17B 3LD8C 1IJ9A 3S4SA 3NZ8B 5IVXF 5E9DB 4TOYL 3VXMD 2OJEA 3RWJB 5FA4A 4UDUB 3OAZH 4NQEB 1ZK9A 1HHHA 4P2CG 4FABH 1UZ6F 5D96C 3P4MB 1AI1H 1I1FA 1I8KB 4OZGE 3A6CH 1YYML 5CIPA 5BZDA 2A9NL 3WLWC 3EYFB 5H37H 1WIOA 5J0BA 1F6LL 1PKQE 2YPLD 1BZ7A 2P24B 3G6AB 1CDJA 4MNGE 2CDEA 3MJ9L 4K71C 2XWTA 2R2HA 1SJVA 4H0IA 4HF5H 4OQTH 3K1KC 4PRPA 4IRSD 4OKDA 3EJZC 3GSNL 5JOPD 1KCUH 2HTLC 5BRZB 2HLFC 1NUDA 3ZDXE 4BUGA 1O5DT 2EDWA 3PWLB 1F42A 3OR7B 4DEPC 5DVMA 5EC1A 3DUSA 4JRYB 1JWMB 4X6FB