4UINL

Crystal structure of quinine-dependent fab 314.3 with quinine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLTWYQQKPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTISNLEQEDVANYFCQQGNSLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 314.3
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uinL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uinL01
3U82B 2NXYB 4K8RL 4JANA 1OGTB 2HLFD 2BCKA 5L2JA 1MHCB 5FOBA 3NCFB 3RAJL 4TVPH 4OZFH 5D2NE 1LD9A 2ADGA 1EO8L 4DCQB 2ZG3A 1RULH 1CFTB 3QP3A 3G5XB 5JLZB 2OTUA 1GOHA 4YUEL 3V0WL 3DOSA 3CMOH 4M7LT 3MCKA 2YD4A 3VXSD 3S97C 1MF2L 5D7IF 1UWGL 2DLGA 3EHBC 2Y36L 4U3CA 1X5FA 5CILL 1NCTA 4JKMA 1AR1D 3JWDH 1QTYT 1LE5A 3TJHC 4LASL 4S1RH 1ND0B 5E6IB 2EXYC 3UMTA 1T1YB 2R2EA 1N64L 3KPOA 4F33B 4M62L 4XP6H 1O0VA 1JNHB 2VXUH 5I19L 3FAXA 4ZSOE 3AU1B 2FWOB 2GSIA 1DANT 1TZGL 3DWTA 1D9KD 3D18B 4L1DA 4X7EC 5DEGA 1UA6L 1U8NB 1VGKB 5EBLB 5AD0B 4GFTB 1ZEAL 1DBMH 3VRJA 3PIQA 3QO1B 1ULVA 2YZ1A 1CL7L 1JIBA 2NY0D 3CX5K 3MLUL 5DQ9B 2VDOH 1QFWL 4KPHH 3RX8A 1T4KB 4WCYH 1NLBH 4CKVX 1MY7A 4LSPH 3C2AL 5TH2A 3H3BC 1ZA3A 4PP1C 1NCNA 3P0VL 3HC3L 2VLRA 4RMSA 1RAMA 2H2PC 1G7MA 2ATPA 2BXYA 4FQXD 3KLHD 4MJIB 5FHBL 4RZCA 5JQ6H 4ORGA 4Z7UF 3TLRA 2YD9A 1CQKA 1G9NL 1FV1A 4OKVB 4R90H 2NMSA 4Y4KA 3NZHH 3AC0A 4KQ4L 5C09B 2FEDC 3RVWD 5C0AA 2XT1B 2PXYA 3FONB 1F6FB 1Y0LA 1JMZA 1DLHB 5L8JB 3HE6C 3K3QA 4PJAB 3VMPA 5F9AC 2WIIB 1XH3B 1A5FL 3S3SA 1P9MA 2JIXB 3PWPA 2PUQT 2FX7L 5FCUH 3RTQD 4L8SB 3DX6A 4XNYL 3NTCL 3I6GA 3F8UB 4IRZH 3IYLW 1AI1H 4YE4L 3MJ8B 4WO4B 2NY5C 4NM8H 4AL8L 3GGWB 2R56L 4TTGA 4L3EE 5F1OB 1N6QL 3EJJX 1H15A 1BFVH 3LDBB 4JO3L 4PG2A 5L0QC 2C7UA 1XF2A 3VWJA 3C6LC 4N0UE 1HEZA 4UILH 2DQUL 3GO1H 4OUUB 1SJXA 4MXQC 1AR1C 4X4YA 4WY7L 4XNXL 2APVA 1CXIA 3GBML 4FZEH 4WGVB 4N0CC 3U0PA 2VXTL 1MFDH 1LEKA 5JA9A 5IVOA 3ARDD 4NJAH 4NSKA 3WHE0 1RK1B 5DTFB 1C1EH 4GMTH 5HPOA 4J1UB 3CLFL 1UM6H 2AXHA 3S36X 4GAGL 3QXUA 1WC7B 5T5NG 4LLYA 4HZAA 4XBEH 2YWZA 1KIUA 2VR5A 1MHEA 4L8CB 1IQWH 1NCCH 4ESKA 3WFHA 4PJDA 4ZD3H 1OWWA 4LHUD 5DQJB 2WWMD 3D39A 1MAJA 1L9MA 3QXAA 3SGJA 5LXGL 2HAZA 2HTLD 1SBSH 2AEPH 2E8ZA 2QSVA 1NGQH 1OAYH 1NGZA 2RFXB 3T0DA 1KEMH 3KYMA 5IW6B 4XP4L 3SKJH 4IHOB 3PQYA 4TSBH 2BNQB 4KJWD 5D71H 4NQSB 5DJYA 1RIUL 3WFEH 4K8RD 1CL7I 1NCWH 1R3LB 4GH7B 5CJQH 4PY8J 4O00A 3MLXH 1HZHL 1QFWI 2XQBH 1F00I 1VACB 3OF6A 4JHBA 5HHOB 4EI5D 4A2LA 2OJZH 3EYSH 5DVOA 2BC4A 4OZ4A 2Q20A 4P9MH 1YJDL 3IKKA 5E9DE 2D2OA 1YPZE 1SY6H 4HGMA 4YHYB 5I1CH 5IQ9A 3ZMRA 1AKJA 2WINA 5E56A 4NJ9H 2AXGB 2F8OA 5IR1A 1FO0L 3MRQA 1T7YA 3TV3H 4LFHD 1U95B 2Z4QB 5D5MA 4GBXA 5DMKA 5C92A 3V6FA 2JCCB 2Q8BL 1H3TA 5J9PA 3HFMH 4YFDB 3X17A 5K9QI 5EORH 3X3GH 4OQTA 1I8KB 1F3JB 3P11L 5EA0H 1YEFH 3PP4L 5CMAB 3ARDC 3OBAA 3DHMA 4F80A 1WITA 3QEHB 2FIKB 1FL6B 3G08B 5DK2A 3GIVA 1EGJL 4I0PB 2ZP0T 1RZGB 2CIIB 1JGEA 1BZ7B 1YMMD 2BHYA 4JVWA 4JPVL 1A7RH 4RNRB 3QZWA 3V4VL 1N4XH 4X4ZA 4HEPG 4WHTA 2G5BB 4LLQB 2NY4B 3FQWA 3UPAA 1ZHNA 4K8RH 4GKNB 2XN9D 1XIWA 4RMUA 3WJJC 3GSVA 3RAJH 5I2IB 1VFMA 1TQCB 1U8PA 3TN0A 3H9SD 5KG9A 3O3BB 1A6PA 3RVUC 4WFGD 1EO8H 1K2DA 1N6VA 1LGVA 5HY9B 3RA7L 1EFXA 5D2LE 3QIWD 1BQHG 3MZGB 3ARBB 5ADPL 3U2SB 1F4XL 3FB6A 4ZXBC 2HT3D 3QDHA 4YUEH 3V0WH 5DJ0B 3VE0A 3ZKXB 5B8CA 4IS6B 4U1MB 2Z35A 3LN5A 2YWYA 1I8IB 4MD0A 5MEPB 1MF2H 2PYEE 1UWGH 1CFSB 3NA4A 3UPRB 2BJML 3VRIA 2Y36H 4UAOB 4NZDA 5CILH 4CADB 4ETYA 2XWTA 3DNKA 3EW3B 5T1MB 4EKXA 2NR6D 1YQ2A 4OZIB 2R8SL 2NW3A 4LASH 3V5DB 1ZVYA 1N64H 4D9QE 1NDGB 4M62H 2YUVA 2GI7A 5I19H 2E27L 2EZ0C 5IBTL 4EEEA 1TZGH 4G8FA 3MV7A 4HH9B 1UA6H 4NIKB 4QRRA 4Q9RH 1MCWW 1ZEAH 4MCZA 1CL7H 3MLUH 5D9SB 3C87A 4BM7A 4HAGA 2WUBL 4RFNB 2VLKA 5CWSA 3DX9A 1QFWH 3DECA 1IEBA 1HSAB 1LP9F 3ZDXE 5GRJL 1I7ZB 3C2AH 3G04A 4QOKA 4S0SD 2QL1A 3P0VH 3HC3H 3U1SL 5EU7E 1KEGL 5BJTB 1FVCB 3U36B 1YA5A 3CFJA 5FHBH 5IB4B 3DBXB 5EU6A 4QNPE 1MCNA 1MUJB 2ZOKA 3KPRB 4JAMA 5TFSL 2R0WL 3BPLB 1U8OA 1G9NH 1KIPB 4NCDA 2EDQA 1G7PB 2EKSB 4KQ4H 4K94L 3CSYA 5FB8B 3ARGA 5E5RB 3M1BB 1JZ2A 1FNFA 5C0CD 3E1F1 1IM9B 1LEIB 3AMLA 4LU5L 4P46A 3D85D 1BF2A 1WJ3A 3VH8A 1SYVA 1A5FH 3S37L 2C3WA 4M43L 4M48L 1WTGT 4U7MA 2FX7H 3FZUD 2GITB 1U3HD 3N9GL 3NCYS 1IZKA 4KKBD 4PJXB 2D7TL 3NTCH 4XNYH 2VLLA 3L3GB 2VLJB 4BH7A 4YE4H 3FOMA 3CD4A 4AL8H 4G6KL 1D6EB 1H3UA 2R56H 3BGMB 4LCWD 4WI2A 4YHPB 3SE8H 2FO4A 4BELD 1N6QH 4JO3H 1VFOA 3RPKA 3O3DA 3RKDC 4PJGB 5CEZL 4FA8A 3IDNB 4YX2L 4YDKH 2DQUH 5CFHA 5I76A 2V9RA 4N9GB 3RZCC 2HFFB 4WY7H 1CI5A 4XNXH 2FJGB 3GBMH 1MI5B 3NPSB 5HHMD 1PY4A 2VXTH 2H32H 1FL3B 3O2DA 2DICA 1TPXC 3VXOB 2BSSB 3BZFA 5GSRB 2AXJA 1U6AL 3CLFH 3BPNC 5BS0B 3LN4A 4GAGH 3O3EB 4JEGB 3WIIL 5D7IE 1MCIA 4YK4B 4Q58C 5C0GB 2Q76A 2HKHL 5IVXA 1HCVA 1DE4B 1DQDL 3BZ4B 4IJ3C 5LXGH 2O61B 5FA3A 3DGGA 5FM4A 2P45B 5BRZA 4KGLA 5E0QA 3W9DA 3P9LA 3S5LG 1WCBA 3ULSB 1R5IB 5HHQB 4XP4H 1HXYB 3LQZB 2MJWA 3OR7A 4K3HA 1V3LA 3L7FA 3ALWA 3G6DL 1RIUH 4Z7OF 1QSEA 3MYZA 3ARWA 4FXGA 3DIFA 1I1YB 3VXUA 1HZHH 4ZPTA 1ACZA 2NYYD 4ZUUA 4Q2ZA 5HDQL 1B4RA 1N59B 2VL5B 3MRNA 4RSVA 1X5LA 3NZ8A 1T1XA 3JWOL 1WBYB 2FGWL 3CVHB 1RPQA 5F7EL 4ERSL 1KPRA 1UJTA 5DJ2B 1S9XA 1YJDH 1MRCL 3CZFB 4MZ2A 3O45A 4NBXB 3RU8L 4OBSA 2R4RL 2Y5TB 4PJ7A 4G8EB 2KZWA 2GHWB 4CVXB 3EYFA 1FO0H 3U83A 4O2EA 5GIRA 2FECL 1T89A 2X7LA 1I1CA 1OCWL 4P3WA 3QI9C 1K8DA 5FO9A 3SDDC 1VFAA 2R1YA 3VFVA 3GMQB 4XAKD 5HVWA 1DQJA 2BERA 2Q8BH 1CBVL 1AGEB 2EH7L 4P2QB 5C6PB 2GJZA 5JPNA 2C1OB 3X12B 4R97C 2LFGA 1D7FA 3P11H 2VLRD 3MRMA 3PP4H 3KR3L 5HYSA 3QFDA 1EPFA 2YS4A 2VZ3A 1D5MA 1MRFL 1G7JB 5IF0A 4I0KA 3TJEL 1EGJH 4PV9B 1EZVX 1QVOA 4QHMB 1LK2A 5KJRL 3MLPA 2XQYG 4KRPB 4Y4KD 4BQ6A 1S7XA 4JPVH 5EC1B 4Z78A 5F9JB 1DVFC 5C0AD 3V4VH 2PXYD 2ZUUA 4XMKL 5SWZE 3GSWB 2ZCKL 1FFPA 4QY8A 2IALB 3K46A 2N4IA 1S8DA 3L3JB 4L8DA 3PWPD 1II4E 5T3ZE 3SDXF 1KJVB 5C07E 1A02N 5F9DC 1B90A 3IDXL 5DJCA 5C0JB 5TQ0L 3WXWL 3KAAA 1PEZA 1TJHL 1C12A 3LEXB 5CAYB 3RA7H 3BD4A 5BZWA 2XTJC 1S5IL 3HE7B 5ADPH 1MCBA 1YNKL 3FQTA 1F4XH 4ISVB 4J4PC 5HI3D 5HGBB 2NXZD 1MFAL 2X09A 3HZVB 2FZ3A 3DUUA 3BP4A 3VWJD 2ADIA 3QCUL 3VFUB 4H0GA 2RBLA 1X7QB 5ISZA 2XI9A 2BJMH 4LLMB 5TDNA 3M17A 4BUGA 4RGNE 2Y7QA 1R3HA 3BKYH 2R8SH 3MBEB 5F1IB 5D7JA 2VZTA 1XGYL 3BDXA 2E27H 2W0KA 5IBTH 4H0IA 4XXCA 5EZJA 1NC2A 1D5BB 4XPGL 3QNXB 1RMFL 3VGHA 5CEZD 1TDQA 4X6CA 3RX7A 5HYJB 3EO1A 4YDJB 3MREA 1CWVA 4OGZA 2WUBH 5I18L 5IMKA 3MJ7A 3T0XA 4JDZA 4F7MA 3E3QC 4AK1A 2LU3A 1UYWL 1NAMA 5GRJH 3C5JB 4HIEB 4Y2DC 2P44B 2ICWB 3ARTA 2X4OB 3U1SH 1KEGH 1EUTA 3VFSB 5DD1L 3L3OB 4IMKA 4X8XA 5CIPB 1MJJB 5TFSH 4HHAA 2R0WH 3QIUA 5DXWA 1ZT7B 1BIHA 3DI2B 1P7KB 3DURB 1OGAA 2PXYC 3QSKB 3GRWL 1FYTE 4K94H 3R06B 2GK2A 4V2CB 5DWUL 4F15C 4N0RA 5IROA 1YC8A 4LU5H 3TA3A 1QRNB 4M4PA 5KSBE 2VXSL 3CXDH 1VGEL 3S37H 4CVWA 4M43H 3OF6D 4M48H 4GG6A 2YC1B 3N9GH 4MMXC 4M7LL 2D7TH 5E5MA 3RBGA 3GMRA 1IEHA 5JIHA 1AKJD 4MQ7B 3L7EA 5D7LA 3JUZA 1IILE 5JHDB 4G6KH 4PRIB 3WE6A 4PG2C 4TUOB 2ED8A 3STZA 3V5HB 4L4TA 5H35A 4GBXD 3EIFA 3QUZA 2ZSWA 4JHWL 4B53A 5MEOA 3DRTB 3UYOD 2ZSVB 5CEZH 2BY3A 3MOBL 3BYTA 4YX2H 1EHXA 2PTTA 1ZWIB 2GJ6E 4IRJB 3T2OA 4S1QL 2CDFA 5FYKU 2JJUA 5KSAD 1HQ4A 3MR9A 4CNIA 4ETQB 1NEZG 1PQZB 1U6AH 5KBNC 2OBGA 5D96B 2YRLA 2NZ9C 5IHUL 5DK3A 4RA0C 2DI8A 3WIIH 1F42A 4HIJA 1HHGB 5F70A 5INCA 3MRIB 2HKHH 3TIEB 5IGXL 2XNAA 2QADB 1DQDH 1XIWD 4RQQB 2WWKO 3QUYA 2W38A 1QFHA 2YR3A 1OTSC 1KB9J 2I9LA 3ARZA 2C4FU 5BMFL 1JTPA 3VD4A 4JPIA 4MCYB 2VABB 3J7HA 5JXEC 2X9WA 1EFXD 1B9ZA 1QNZL 3GMOA 4DW2L 1WUNT 2YKLL 2SEBB 3G6DH 1JGDB 2H26B 3MXWL 1MNUL 1A1MA 4YO0A 3BKJL 3C8DA 4EDWL 5HDQH 2W65B 3ECBB 3O9WA 2ED7A 5ESAB 4L9LB 2BNRA 1FRGL 3JWOH 2FGWH 5J6HA 4UNUA 5F7EH 4ERSH 3QCTL 5I1AB 5ANMA 5FGCB 5JO5A 1GZQB 1WWBX 1MRCH 3K81A 3X3FL 2W91A 4NKIL 4A6YA 3RU8H 1AO7A 2R4RH 2W1NA 3L3KA 5BV7C 3B83A 1J12A 4QRRD 1L0QA 2VYRE 4QYOB 2JB6A 1KJMB 1U93A 1AD0B 1OCWH 5JOFB 3C6SB 2VLKD 1IEAB 2WANA 1I3RA 4NWTL 4PJ5B 3GUTA 4U6YA 1KTRL 1CBVH 5JW4M 2EH7H 4Z7WB 1T7WA 4QOKD 4AJ0A 2JLLA 4D0BA 3KR3H 2GTZA 5LVEA 1MRFH 2HJFA 3TJEH 1W0VA 3ES6A 3ZSTA 5KJRH 1WFNA 2B4CC 4R7NA 2B0SL 3HPLA 1N0XL 1CICC 2RB8A 2VKXA 1XIWC 5MENB 4XMKH 2LTQC 2ZCKH 2CR6A 4PGEA 2YPLE 3K8MA 1NKOA 2DF3A 5C0DA 5EFIA 5DHVB 3TN0C 2UZIL 5EBLA 2HT2D 3B8YA 2ZUQC 4NRXA 3IDXH 5DA4A 3P9WB 1QSZA 4LCCB 3SGKA 5TQ0H 3WXWH 5F8QC 1RI8A 3MRPB 3P0YL 2APWA 1TJHH 1LO5A 3M07A 5MHSE 1EXUA 1S5IH 1OAZL 3BVNB 4A2MA 1YNKH 3L5WB 1MFAH 5EUOB 4XNQB 3CLEL 1EEZA 3PDDA 4JM2D 3QCUH 4KK6D 1C16A 4Z5RA 4Z8FL 1F11A 4AENA 2R9HD 1NCBL 4MQXC 5E8PB 5GGVL 2CKBH 2Y6SD 3HZMA 3RGVB 1OOAA 1SVZA 1N6UA 5GS2D 2ICEA 1J1XL 1P4IL 1NAML 4PJAA 3BP6A 1XGYH 1PBYA 4PREA 1T2QL 1Q9OB 3EOYG 3MJ6A 4XPGH 1R3KB 1RMFH 2F74A 3BHBA 5C8JA 1W2KT 5CSGA 2Z91A 1L7TL 4KKCD 2E7LA 4WWKB 5BO1L 5I18H 2IFFL 5BQ7B 4GKSA 5HYIA 5IP4A 4UV4L 1UYWH 4LRIC 3PWNB 2WWKT 4DOHE 2ESVA 4JO2L 3FQNA 3G5ZB 2H3NA 3RIFK 3O6FA 3O11B 3HG1A 4KK5C 1VESA 5DD1H 3KXFE 1IGJA 3GMPB 2CSPA 4IIQC 1W72B 2WNGA 4YJZL 4JY4B 4NKMA 3ARGC 4WI6A 5C9KA 3GMLA 3D1MC 3EYVB 1MEXL 4P46C 3GRWH 3RVTC 1QSED 3VXUD 5DWUH 5D2NA 4L4VB 2Y72A 4PRHB 1IT9L 2VXSH 1ZHLA 1PKQE 1HXMB 1VGEH 2HT2C 3IJHA 1I3GH 3VWKB 5D70L 1SEBB 4B41A 4QCIB 4X4XB 1TTGA 1YYLL 4M7LH 2PW1A 4ZQKA 5KW9L 1OVZA 1CTOA 4JPWL 5KVMC 4U49A 5GS2H 1E4KA 5DA0B 3BH8B 3FRUB 3OL2A 3AM8A 3P4LA 2W9EL 4HUWA 1NCDL 5DQDL 4JRYB 5L9DL 1CFQA 4KI5E 3IU3B 1J0HA 4JHWH 2R9HC 1XGUA 2QKIB 4PY7B 4WUKL 5DO2D 4YC2B 4KKAD 1K9TA 4XBGB 1XF3B 2ILLA 1V05A 3MOBH 4OLXL 3QWQB 4ZSOA 2WUCL 4OZGA 3RWFB 3D0VB 2DRUA 5F1KC 3UTZB 1JZ4A 5DRZA 1K8IA 4S1QH 1QFUL 1EDQA 3GSNL 4PJ8B 1T04A 3UCRA 2O5YL 5I1LA 5HJ3A 1T5XB 5IJVA 1RK0A 3K4DA 5IHUH 4L3CA 3CH1A 4G7YL 1YEGL 2WV3A 3MPCA 4X9HA 3W2DL 4K3GA 3KPSE 3W0WB 4XB8A 3HR5A 4P5KA 1ZHKB 4WEUD 1YN7A 1INDL 5IGXH 4ZS6D 5E08H 2OQJB 5D6DC 5KZCB 5TDPB 4XCCL 4PRNB 3TVMD 3ULVE 4P2OB 4LQ1A 2JCCA 2HN7B 3DMMA 5BMFH 4HD9A 3CU7A 4OBRA 1ES0A 2DM2A 3HZYB 4F9LA 4MJIE 4DW2H 1QNZH 3HC4L 3V4PL 4DQOL 5F7HA 4HJGB 2DWEA 3J8F7 4A6YL 2AJZB 5BVJB 2YKLH 3QUXB 4HG4K 1Q38A 2NTSP 3MXWH 1MNUH 2V5SA 4GAYB 3QXVA 4MDJB 3QG6A 3O41A 3BKJH 4MNGB 4EDWH 3K0WA 5ISZD 2CIIA 4TSCL 2H9GA 1FRGH 1CXEA 2X1OA 4L3EA 3QCTH 1AD9A 3OKEB 1RIVL 4EQ2A 3X3FH 2VKWA 3OKMA 4NKIH 5D7JD 4N0UA 1HYSC 3MA9L 4M5YL 2ZUWA 3VDAA 4TPRL 1Q9WB 1NC2D 1O5DT 3EFFB 4G42B 2A6JB 4U1NB 3HC0A 1RURL 4KKAC 2APBA 1UVQA 4NWTH 4NO3B 4BKLA 3D2UA 4P2RB 1X5GA 1FNEB 3MOAL 4AYFA 5I8EB 3BIAX 3OKDB 3KHOA 1KTDB 3D69A 5GRVL 3CC5B 3QXDB 2X6MA 4X7CC 1PAMA 4MJ5B 3QIUD 4WDIA 2DQFB 5A2FA 1OGAD 1E28B 2OTWA 4ODUB 1F4WL 2B0SH 1M6OA 4CMHC 2YSSA 4OCNC 3D48R 5GS0L 1N0XH 4ZS6C 1G84A 3TA3D 2PW2B 1FN4A 5I71C 1KT2B 3VXRD 1GL4B 5GZND 1M7IA 3IFNL 4X8JB 5DJXB 2BVOB 4JZOA 3F7QA 2P5WD 2KZ1B 2UZIH 3NGBC 5ERWA 3BYYA 1M7DB 5EN2A 1I1AA 2ID5A 2Z8WC 3BEVB 5D7LD 3P0YH 4P57B 1EEYB 5FA4A 3N50A 5T5NF 1OAZH 1P4LB 4L4TD 3QYCA 1JZ5A 2BNQE 4X0KB 3CLEH 3QUZD 1FVCA 1FNSL 5E9DA 3IRZA 4GW5B 3KPRA 4LCUB 4Z8FH 1WZ1L 1QPXA 1NEZB 5GGSA 3EJZD 3OB8A 1NCBH 3B5HA 2FBJL 5GGVH 1KJ2A 4XX1E 2ENYA 3X11A 1J1XH 1P4IH 5I1IL 4JFFE 1LEIA 1NAMH 2ICES 2Z8RA 4MNQE 5CZXC 2X4QB 4WFHE 4JFOA 4XXCC 4YPGB 5KANG 2P5EA 3SCMA 1IAKB 4JY6B 4WV1A 2D0HA 1T2QH 4KUZL 5F3HB 2DD8L 2DS4A 4KRLB 3T4YB 3QIBB 1L7TH 1ORSA 3L3GA 2BVUA 2VLJA 2YMXL 1F8TL 1FC2D 2KKQA 1KULA 5IB5B 5BO1H 2IFFH 3EGSA 4R4BA 4UV4H 3IFOB 3QUYD 3BGMA 4L5FL 5IM7B 3Q6GL 1KYOJ 4JO2H 4IMKC 1BECA 1GGUA 2OI9C 2E7CA 4B50A 5FK9B 4DKFL 5FV2A 2D31B 5HXMA 3C08L 3UTTA 3G5YA 2YA1A 5KN5A 4PJFA 5T1KA 2NY1C 5HVFB 1ZVHA 3CSPA 3SKNB 2EC9T 5IROC 5DC4B 3TA3C 1MEXH 3VFTB 1FVEB 4PJHA 4HCRL 4OD1L 3IXTB 3MTRA 5FDWB 5GZNC 5IEHB 4LNRB 4X98B 1U8HA 1YN6A 5EO0A 3O9WD 1EBPA 1IT9H 2DI9A 3S96A 2BNRD 2I07A 5DK0B 5D70H 4Y4HB 1CFBA 2XWJB 2MCG1 3ARPA 1IM3B 1ORQA 1YYLH 4W4NA 2HMIC 5KW9H 2LU4A 3CDYA 4JPWH 4X7TA 1G7IA 1PZ5B 3HMXL 4HMCA 2A83B 4MS8D 5GJTL 1AO7D 3CXHK 1G6VK 5AEAA 1NCDH 5DQDH 4H0HB 2DLHA 1P7HL 35C8L 5L9DH 3P2TA 4NWUL 3KJ4B 2X4NB 4M1DL 4JVUA 1BFOA 4WUKH 5JNYA 3SDAC 2DIJA 5KS9A 2BY1A 4XWOC 1XGTB 4OLXH 1BFSA 2A73B 3WFDL 3S37X 5MI0C 2WUCH 5IB1B 5B21A 2ZUSA 2CPCA 5HPMA 4JQIL 1QFUH 1JF1B 4ZS7L 4OZIE 3GSNH 3OG6B 3VXQA 4BZ2L 3QRFM 1INQB 3BEWA 2O5YH 2X70A 3SGDH 3FO1B 3MV8B 5FM8A 3CVHA 4OFDA 5IMOB 4GRLC 4G7YH 1YEGH 3GJFK 3W2DH 4BSJA 1ZS8A 3QCVL 5ALCL 3GB7A 5CZKA 1ZGLP 3QUMB 1OAUL 2Z93B 1N5AA 1HHJB 4V1DD 4Q6IB 4XHJC 3QUYC 3A6CL 1INDH 1KYOK 1SJEB 2X40A 3VFWB 2DQJL 1MIML 2ZOLA 4XCCH 4WI5A 3LKRA 3FQRB 2IBBA 4GT7A 3QPXL 1A6ZA 1LMKA 2CIKA 3QISA 5FFLA 3WHXB 4NNYB 3RNKA 5GS0D 3HC4H 3V4PH 3C8HA 4DQOH 4A6YH 3U46B 1FFNB 4PG9A 4KY1L 3K80A 3MNWB 2R69L 4ZUVB 5SV4A 1KXVC 4N5EC 1U8KA 4TSCH 1RZ7L 5CLWA 4N8VB 1BBJB 1YQVL 4XBPA 4ZAKA 2NXYC 2VUYA 1RIVH 1JWUA 4PJXE 1P7QB 3O4LE 4U2ZA 4DUWA 1NANI 3TGXA 2EIZA 1DUYB 3L3JA 4Z7WF 5EU4A 5ICYA 1OB1B 4H25A 5B4MD 3LKPA 3MA9H 4M5YH 5DRWB 4TPRH 1A9BA 2GIYA 1T1ZB 2CLVB 4HWUA 4RDQG 1RURH 1S3KL 5M95B 1AXIB 1ZSDA 1PYWA 3MOAH 2ESVD 4CL7A 2K1MA 3ZKQD 2AABL 3O6FD 5D7IA 2DKSA 3HG1D 1AIFB 4HS8H 1MI5E 2BSED 3TCLB 5B39B 1NBVL 3H9YA 2KL6A 2DLIA 4NQDA 3ROOA 1JPTL 3FFCB 2FJHB 3DVGB 3OR6B 3T2PA 1K3IA 5E6IC 4HGWA 3CFIC 1F4WH 4I48A 5BS0E 1N8ZA 4JO4L 5GS0H 1FP5A 1IFHL 3MBEA 3TF7C 5F1IA 1JGLL 1VKXB 5IBUB 5DUBB 4H20L 4UB0L 4G6AC 1OP9A 3IFNH 1CXFA 1TNNA 3QDGB 2NY6B 4PJEF 1KJ2L 3W39B 4C56B 2OTPA 4NQCE 5GS0C 5EZOL 1NC4A 3JXAA 1T22B 4BQ9A 3QT2A 2AXFB 3MGOB 5LWYL 3QDMB 5IW1A 5B38G 3HN3A 1H3PL 4QWWD 5IK3B 4Z7UA 1FNSH 1YNLL 5ID0A 2EYRA 4NRYB 3JVGC 3FHAA 3N1PC 4G8GA 1D5XB 1D6VL 4N0FA 4PJIB 4BSVB 1WZ1H 2FBJH 1RV6X 4O5LL 3NFPB 1YECL 3IF1A 2VH5L 5KVGL 1JPFB 5I1IH 2AKRA 3V4UL 3LS5L 3UBXG 4S1SL 4G6FD 4Z0XA 1X5YA 3O4OB 1RJYA 4RGMB 2EDKA 5L8LB 1F45A 4NHUB 4DKDC 2FGZA 4KUZH 1CQYA 4G9DA 2E7LC 4I2XA 4W70A 3TFKD 5DJ6B 4WO4C 1SQ2N 1TZIB 4YIQB 1KOAA 4OZFB 2YMXH 2ZG2A 1F8TH 4U1LB 1F58L 1AQDB 1QSFB 4Y5XA 4KUCF 1A1OB 3LDBC 1MELA 3IGAB 4L5FH 3Q6GH 4P2QE 1CGYA 2WLYA 3DMMD 4DKFH 4RRPA 1ZT4B 4PGZA 3C08H 5SWZA 1NANH 2V7NB 3SJVB 3HCVA 1G6RA 5AZ2L 2OR7A 1BFTA 3TZVB 1TFHA 5C07A 3ISWA 1ZA6B 4HCRH 4OD1H 3N06B 3TBWA 5MEQB 3AGVA 4ODWB 3F12B 5F88A 1PQZA 2WP3O 3FL7A 4H1LG 3BX7C 4X9GA 4PBXA 4L3ED 1CFNA 1CDIA 1KLFA 3HMXH 5BW7A 5GJTH 1NFDB 3NVQA 5D1XD 4O02L 3QNYA 3PDOA 1R5WB 2F19L 35C8H 3Q2CA 4FQQA 4M1DH 4KDWA 3DRQA 1G9MC 2IH1A 3WKML 4ACPA 2D7OA 4DUXA 3BD5A 4MVBC 5IKCB 1NGPL 3D2UD 1EERB 1BOGB 4POZC 2V9QA 3D25A 3LRGA 2YD6A 1PX3A 2WW8A 4KC3B 3TEUA 4BFIB 3KYNB 3AB0C 4F2MA 4W4OC 4JQIH 2XYCA 5JR1L 1T5WA 1INEL 3IKCA 4ZS7H 3EZ8A 5J1AB 4BZ2H 1K4CB 2P24B 2I60L 4UDUA 5FYKE 1T3FB 1NGXA 4K07A 4CW1B 5IHLB 5JUEL 1EJ6A 5HI4D 3VXSB 4YHYC 3QCVH 5ALCH 2UYLB 4D2NA 3X13B 1OAUH 2O5XL 4MAYA 2RJMA 5HYJE 4FFWC 4HPOL 3A6CH 4JQVA 2YEZB 4PB9L 2NNAA 2DQJH 1MIMH 4U1HB 3GBNL 4F9LC 2P8PB 1D9KB 3DROA 3KG5A 1VERA 2AK4E 3S3JA 1P2CA 3QPXH 3AVEA 4OCXL 3QJHB 1X3DA 3B9VA 1BVKA 2NY0B 4NC1E 6CGTA 4KY1H 2ZNWA 3OB0K 3GSUB 3BFOA 3KPMB 5E9DD 1M4KA 4LCYA 2R69H 1KNOB 3ZKMD 1N7ML 2ITCB 2FHBA 2OSLA 4NQEE 1RZ7H 3FKUS 3RRQA 1I7RA 4F58L 4FQXB 1YQVH 1A7NL 2NY4C 4F37F 1EK3A 1ZVSA 1WSST 4KMQA 3LSOA 3SEPA 1HH9B 3BJ91 2P5ED 4U1SA 3SCMD 2DJUA 1TQCC 2GJ6A 5HI5D 3OAZH 5EG6C 4Z77B 3MYJA 4M4RA 1JPGA 1Q0XL 4DUVA 2QQQA 2XRAL 3ARBC 3DVNB 3BWAA 1S3KH 2AJUL 2GT9B 4MHHG 3TM6A 5FECA 3P77A 4X5XB 3VFNB 1U8JB 2H2SC 3RUGF 4I5BA 2L4OA 4GW4A 3V0VA 5GGRB 1S7UB 1MCHA 4IMLA 1UXSB 5EUOA 4OZHB 2AABH 1S7QB 1XGPA 5DJZB 1NBQA 1NBVH 4UAOC 4Z76B 4UQ2A 1FG2A 2Z31A 1JPTH 4UMGA 1WT5A 1X9QA 1HSBB 1MFBL 2HA1A 3QDAA 3SBWA 4JO4H 5DHXB 3KWWA 1IFHH 1JGLH 1FNGB 4OCSL 2VN7A 3P4OA 4H20H 3BESR 3B3IA 4UB0H 2WP3T 1OT2A 2X44D 1KIRB 2G9HA 3RI5K 1HHKB 3MRKA 3ARDB 3WNOA 4RFNC 2CJUL 1OSZA 1I1AC 2RCSL 4QHKJ 5KSUB 3ILQC 2G75A 4CN6A 1LP9A 1S78D 1KJ2H 3VGAC 1V3KA 4OI8A 5EZOH 2UWEF 5I66B 5LWYH 1H3PH 1F3DJ 3K4ZA 5KOVC 5K9JL 2Q3AA 3V9FA 4LHUB 3HLAA 3ALXA 3ZKMC 5J4MA 1YNLH 3LD8C 1G9EA 4HK3N 1D6VH 4D9QD 1TCRA 5F89A 3CUPA 3FAWA 3FB7B 4NYLB 3SE9L 3OJDA 4JJ5B 3C5SB 4O5LH 4R96A 4PGJA 4W6WB 3RX5A 1YECH 25C8L 1CDYA 2VH5H 5MERB 5EOCJ 5KVGH 3LPFA 4L8BA 4R3SA 4UT7L 4U1IB 1DBJL 4WV1C 5KTEL 3V4UH 3LS5H 4MD4B 5FGCE 3I84A 3PL6A 3HUJF 4S1SH 1UKTA 1OD7A 1FFOA 4ZXBB 5HYFA 1IVLA 3CDCA 5T3ZL 1IE5A 3FO9A 3N85L 3SDCA 3OKLA 1T0MA 3CFCL 2EDTA 3I9GL 3BH8A 3UTSE 1F58H 3VD7A 3OAYH 5E4IA 3JTSB 5C0FB 3QAZC 4Z7WE 1SYSA 4LLWA 5E8EA 3RWHA 3KPNB 4PY7A 1TVDA 4NBYB 2Z8VC 1H9VA 4OLYL 4GRMB 3AY4A 5AZ2H 3NPSC 3RWDA 1QP1A 4G80A 5D1ZA 2YPLA 4P3CL 1NQBA 2OL3L 2GSGB 1HH6A 2DJSA 3WLBB 4PJ8A 2JK5B 3QXWA 4NO2A 5JIKA 3VD9A 5MENE 4CMMA 1A6AB 4YK4C 3WBDA 4IOFD 1Z9MA 3QA3A 3MRGB 1S78C 3FN3A 4HKXA 3HI1A 3HTLX 4ZAKD 2OMNA 1QA9B 4NFCA 3GI8L 1YMMB 1WISA 1BZ9B 5IG7B 5L7XL 4D94A 4O02H 4K9EC 1YEDA 3QH3A 1F2XK 3QQ3B 4GAJL 4QXTA 4Y19A 2F19H 3RY4A 2GAZA 4L29B 2XN9B 4PJBF 4D3CL 3WKMH 5HGAB 4X6BA 1NGPH 4PJEE 1SMOA 2O5ZL 3UEZA 3PP3H 4Z7NF 5CP7B 5DEFA 3IDUA 4FTVA 1NJ9A 2F5AL 3EOAB 4GAYA 1DSFL 5E94A 5JR1H 1INEH 3QIWB 1KPUB 4J3OC 3LQMA 4NQDD 2VB5A 2VXVL 1QHOA 3V5KB 1GRWA 2I60H 3GHEL 1U9KA 1S9WB 4JR9L 4BZ1L 3TH3T 1SJVA 5JUEH 4LLDA 1TQBB 4GW1A 4OQ1A 1G1YA 1A64A 3HAEG 4JM2F 4HWBA 4Z6AT 2O5XH 4HSQA 2NLJB 2R39A 5ICZB 1TNMA 4HPOH 4JFYB 5GGUB 5L2KA 1GJIA 3RZCB 4M61A 4PB9H 3DO3A 3ZE1E 4G42A 4NZRL 2HT4D 4M3KB 1P1ZA 3QHFL 3GBNH 1HHHA 4WW1B 3TBVB 2CDEA 4OTXL 1MFEL 4ZFFA 1NC4D 3RVXC 4PLJC 2NCMA 1M1SA 2OM5A 1XEDA 5CJXA 4PRDA 3VXPB 1PKQA 1I7UB 4OCXH 1KCRL 2IBGA 4U7KA 3B2UC 5F7YC 3S88L 1FIGL 1X5AA 3ZT5A 1JBJA 4HJ0C 2AQ3A 3TPKA 3REWB 1EO5A 1N7MH 2IAMA 2VJXA 4RMWA 1EA9C 4HF5L 2CO7B 3FHQA 4F58H 2IH3B 1BD2B 3EYQD 1A7NH 1ZANL 2X4PB 3PNWA 3SDXA 2CGRL 3QPQC 5EOTB 3TO4D 4ZNEE 3IDJA 4HDIA 5IHZB 2V2WB 2K7QA 3PHOB 3AAZA 4X8JA 1WBXA 1CLOL 1KPVB 3TC9A 5C0CB 32C2B 3KYOB 1RZKL 3ARFA 3I02B 4KGJA 3D85B 1FVDA 2L7UA 1Q0XH 2P8MB 3BKMH 2MTPA 2XRAH 3CFKA 2AJUH 4GRWB 1U3HB 4PB0L 3O3AA 4O2CA 1HNFA 4P5MB 1S7WA 4XVUC 3WUWA 3VH8G 3GJFB 2VDLL 5IV2B 1ADQA 3KPSA 3I6KA 2J8UF 3CFBB 5SWZD 1I8MB 4LCWB 4NKOB 1QQDB 3MRFA 5FGBC 5F1NA 4YDKL 5DF0A 4LL9A 2VQUA 4HS3A 5T3ZD 2XZAL 4JRWA 4NQXA 4M93B 2EIDA 3MBEC 3EOBB 5DT1L 1F13A 5C07D 1AJ7H 2CXGA 3UDWA 1MFBH 3PGCB 1XF1A 2VIRA 4GOSA 1RZIA 1P6AB 2BVEA 3SDDB 3UZEA 2BVQA 4YPGA 4OCSH 4JLRB 2HLAB 4YBLC 3W0WE 4G8IB 2HT4C 5GRUL 5LGJA 5HHMB 4R97B 1IL1B 5T33L 1FO0B 2CJUH 3DLQR 4FQIL 2ZZUT 2RCSH 4XNMB 5IFJB 2FLBT 3AFLA 3CK0L 4ODXA 5F6IB 5IB5A 4UDTB 3P4NB 4OGAD 4CAGA 3H3PL 2HTKD 2EYTA 1QBAA 5K9JH 4JANB 4RGND 3IXAA 4X99A 1S5HA 4Y16A 3BW9A 5E8OA 2BCKB 5L2JB 4LAJH 4OM0L 3S4SA 4JFQA 3ROLA 5FOBB 3AMKA 4LQFL 3RGHA 1Q1JL 3TBSA 4HXAL 3SE9H 1LD9B 3O8XA 3T08A 2ADGB 2ARJB 4FQ2L 2F8XC 25C8H 1RJLA 4UT7H 3C09B 1DBJH 2VQ1A 5KTEH 4ORZC 2OTUB 4QGTA 3F7RA 2C5DC 3WEXA 1RHHA 1DFBL 3G6JB 4TNVK 3VGFA 3HI5L 3MCKB 4XI5C 3SY0A 1ZOXA 5T3ZH 4MAYD 2EYSA 3N85H 4JREC 4DTGL 1A2YA 3CFCH 1BVLA 3DI3B 3I9GH 4M6ML 4FHBD 3S6CA 1LE5B 1E4XI 4RX4A 2H41A 5GRZA 2R2EB 3KPOB 3IDYB 5IT2L 1MCEA 1LHZA 3VA2C 2GSIB 5DEGB 5E5UB 1ED3B 1FNHA 4KK9C 4OLYH 1IGYA 2A73A 1CDUA 4LMQI 4PLKC 3BISA 1I85A 4P3CH 3PIQB 3VRJB 3BN9D 3UZQA 3AS2A 3S36L 1CXKA 4M6AA 2OL3H 5C2BL 3F65A 5TH2B 3T3PF 1QKZL 1ZA3B 1INQA 4ZFOA 2VLRB 2AGJL 3ULUC 2ATPB 4P4KA 1UKSA 5EOQL 4RZCB 5BW7C 4ORGB 2GQHA 5CCKL 1FV1B 5ILTL 3GI8H 4Y4KB 4J6RL 1Z6JT 1IGFL 4OCMC 4I8DA 2HTKC 5L7XH 5C0AB 3G6AA 3S9DB 2PXYB 1BPVA 1Y0LB 3SKOB 4I18A 2GJ6D 2OXHA 1FNAA 4GAJH 4AIOA 4JFFA 3PWPB 4NNPL 1JNNL 4MNQA 4D3CH 3T0EA 1EUUA 3DX6B 2CDGA 5IB2A 4TNWF 2WLZA 1I3UA 3I6GB 4LOUC 5HDLA 1UG9A 2O5ZH 4ONGL 4HWBL 3V6OE 5F7DA 3A67L 1AY1L 2JE8A 2UWEE 3QHZL 3RHWK 5I1JL 2F5AH 1YY8A 4Q7DA 1DSFH 5I8CA 4EVNA 4IOSD 2NXZB 2VXVH 1YMHA 2JKXA 1H15B 4FG6C 2CRMA 3GHEH 3B9KD 3RWEA 1XF2B 2YXMA 3VWJB 4BZ1H 4JR9H 1HEZB 5DGQA 3C60D 2VUOA 2YD2A 4JQVC 4MD5A 4Y4FA 2DBLL 2J6EH 2W59A 1OWRM 1CVRA 4X4YB 1HKFA 1OB1A 2C4FT 1B2WL 2FEEL 5CKGA 5GRYA 3U0PB 4X4MA 1LEKB 2DM4A 1JV5A 2I5YL 3HUJE 4NZRH 4NSKB 3OXSA 3PV7A 3QHFH 3LN9A 4HFUL 4EUPA 2LABA 2GUOB 3P73A 4MJ4A 2KUTA 4OTXH 1MFEH 1FGNL 4LLYB 4WUUA 4JO1L 3SE3C 4RIRA 1U8MA 2HYMA 1MHEB 2DN7A 4HGKC 4NKDA 1KCRH 1LEGA 5SWSE 5JORA 3FJTA 3WFHB 3R8QA 4PJDB 4HXBL 3S88H 4S0TD 1FIGH 3D39B 1S9KC 1OTTC 5I30L 4JFEA 4LEXL 4U6TA 4WTZA 3LCYA 1AQKL 4RFEA 4HF5H 3MRHA 4QGYA 1NGZB 1UEMA 4BQCA 1G7LA 1ZANH 3KYMB 4XNZC 1BM3L 1B6UA 5DLML 2CGRH 4MJ6A 3PL6D 5GQBA 3H9ZA 5DJYB 2P47B 1ADQL 2YD8A 4OB5L 4ODBD 1QLEL 3Q1SL 3MBXL 5GGTA 1CLOH 4ELKA 3H0TA 4LCCC 1C8PA 1RZKH 3UYPA 1ETZA 2F15A 4HMDA 2VZVA 3VG9B 3SDCD 5J6GA 4JCMA 2BC4B 3L5XL 2MHAA 4OZ4B 3C2SA 3DV6A 3H42L 4PB0H 2AS5M 3MGOA 1R0AL 4MLIA 5EO9A 3FN9A 2E7HA 5IQ9B 2VDLH 1C5DA 2A0LC 1AKJB 2WINB 1CGSL 1FAIL 5IR1B 1D5XA 2HH0L 2Z31C 3MRQB 1WT5C 4UT6L 4JQXA 5BV7B 2B1AL 3DGCR 5D1ZD 3U7YL 3GK8L 4GBXB 2YPLD 1UM4L 1R5VA 4PJBE 5D5MB 2DQTL 5F6HI 1U2HA 2XZAH 3QO0A 2OP4L 5LAXA 5DMKB 3V6FB 2D7PA 5DT1H 3LPWA 1MH5A 4FP8L 5J9PB 2DKUA 1EJOL 4Z7NE 5CSZA 2F53E 3IJYA 3CDFA 4ZOAA 1RUAL 3LS4L 5GRUH 3CGTA 5C6TL 5MHSD 1CLZL 2PO6A 4KDTA 5T33H 5DK2B 3GIVB 4WWKC 2BSRA 2XIDA 4FQIH 4YIQA 3ZE2F 1BWWA 2ADJA 1LVEA 3CK0H 3VFPA 1JGEB 1PLGL 3VXTA 1FSKB 3TBTA 3QZWB 1WICA 3IGAA 4WHTB 3H3PH 3FQWB 3PG2A 4Y19D 1ZHNB 3WXVL 1XIWB 1ZT4A 4F7TA 3O4LA 2VERN 4OM0H 2FEEI 3MRCA 4DGYL 3F5WA 3GSVB 1NUGA 4LQFH 4X7DC 1U8PB 1Q1JH 3TN0B 4E41E 4HXAH 5F44A 2ZUQB 5KG9B 2LVCA 1K2DB 3WFZA 4FQ2H 4BA8A 1KCUL 3PL6C 4WI9A 3ZLQC 1EFXB 3VWKC 3KLAA 2J2ZA 3FB6B 4Y1AE 4NT6A 4E42B 3VE0B 2YK1L 4LSUL 5B8CB 5HVHC 1DFBH 1FL5B 2EDRA 5IWLC 3LN5B 3HI5H 3SDCC 4YBQC 4M1CD 1MCPL 3JV6A 5I1DA 3VRIB 1Q9KA 4DTGH 1CGTA 4F9PA 4M6MH 5L2KD 3QQNA 2XWTB 4XPHL 2W0LA 2NW3B 2COQA 5DFTA 4XB7A 5IT2H 3MV11 1T1WA 3WO4C 4G8FB 3MV7B 4GKOA 1OP3H 4C83B 4QRRB 3V0AC 2BMKA 3IDMA 5A2JH 5AUMA 3G5VA 1BZQK 4MCZB 5C3LD 2IANE 1JI2A 2VLKB 3PDGA 1EAJA 4PJ8C 3DX9B 5CWSB 1NBZA 3S36H 2DDQL 1IEBB 1YEEL 3NAAL 4RDQF 3CMGA 2Q87A 5C2BH 4HH8A 1WWCA 3VFMA 4NQCA 3G04B 1QKZH 2X5PA 3PHQA 4QOKB 2EDBA 2AGJH 4K3EL 2YHGA 3PABA 4CW1A 2M1KA 5L6YL 3CFJB 3WNNA 3QQ4A 2L0DA 5EOQH 4PTTB 4I77L 5EU6B 1VADA 4ZNCD 2ZOKB 5F7LB 4FZ8L 1H8OA 4N8CL 1GC1C 1U8OB 5CCKH 1V7NL 4NUJA 5ILTH 1HHIA 4BH8A 4J6RH 4C57C 4C56E 1IGFH 1ITCA 3F62A 3LH2L 3CSYB 4P2OC 3ARFD 4P46B 1E0OB 3PHSA 3VH8B 2DQGL 3QDME 2P8PA 1XGQA 1J10A 4NNPH 4U7SA 1JNNH 2J4WL 5F72S 4YQXL 3F6LA 1NEUA 4X6DF 2QR0A 2DTMH 3QJHA 1JZ6A 2A9NL 4PJIE 2DL2A 4ONGH 4HWBH 2VLLB 3A67H 4BH7B 1AY1H 3FTGA 3QHZH 4KRMB 1IMHC 5I1JH 3KPSD 3FOMB 5J3HD 2BVPA 1P5VA 4FMFA 4FQHA 3EDJA 5F7FA 1ACYL 1T66C 2FO4B 3NCBB 1IBGL 3O3DB 1J8HE 4M1CC 2OK0L 1A4KA 4HLJA 4S1DC 5I76B 5FKPA 3WNPA 3GZKA 2HRPL 2DBLH 4E0RA 3V7AE 1B2WH 2WM0A 4MJID 3T4AB 1JVKA 2I5YH 2MFNA 2XZZA 1RJZA 1ZK9A 3BZFB 4HFUH 1BOYA 5C08E 1B0GA 3RTQA 5JHLL 3LN4B 2DI7A 1FGNH 3TYFB 4JO1H 4XP1L 3QJFA 2Q76B 5IVXB 1CE6A 2X1PA 5CUSL 4HXBH 4Y16D 1PEWA 1XGRA 2IAMC 2Q6WB 4KJPD 3WD5L 5I30H 5FA3B 1W8NA 3DGGB 4HUVA 2PCPA 4LEXH 5BRZB 3L6FA 1RUPL 1AQKH 1CDHA 3W9DB 3LRSA 1WCBB 5TE7L 4PJ9A 1BM3H 5DLMH 3OR7B 4JPKL 4KJQD 2MQ3A 3GI9L 2ZCHL 1SY6A 1KBGL 3L7FB 3ARFC 1ADQH 4OB5H 1QLEH 1QSEB 3Q1SH 1NFDE 3MBXH 3QG7L 4FXGB 3T3PE 3DIFB 3U7AA 4KFZC 3VXUB 4ZPTB 2BHUA 5KSUA 4RMTA 4Q2ZB 4ZUUB 3ARVA 4KKLC 3MRNB 4PLOB 5CEYA 3NZ8B 2BVYA 1T1XB 3VFRA 3L5XH 5FYJU 1KPRB 4ZMAT 2IPTL 1S9XB 2D9QB 3H42H 5I66A 1R0AH 3GMMB 1N26A 2F58L 2GJJA 3CH8A 3NFNA 4PJ7B 1MHHA 4KI1A 5IVNA 1FAIH 3OQ3B 2HH0H 3EYFB 2QQNL 3UO1L 1KN4L 4O2EB 2V5MA 4UT6H 5GIRB 2B1AH 4ZOEA 2X7LB 3U7YH 3GK8H 1UM4H 3MRJA 2DQTH 1K8DB 5BOZG 2OP4H 5FO9B 1VFAB 2R1YB 3OV6A 5E1AA 1OT1A 3VFVB 4FP8H 1DQJB 5I74C 1X4XA 1EJOH 5JPNB 4MD4A 2PTVA 1RUAH 3LS4H 1KB5A 3MRMB 5HYSB 5C6TH 3QFDB 1CLZH 1DCLA 4QLRA 2KQMA 4BUHA 4P4KD 1D5MB 5IF0B 4DVBA 2CMRL 5ID1A 1QVOB 3H3KA 1LK2B 1WIPA 4EI5A 1PLGH 1S7XB 4Z78B 5CS7A 2V17L 5CGTA 3RJDA 4NQEA 5GRXG 3QXTA 4Y16C 4HLZG 3PWVA 4H26A 1ZLWH 4QY8B 2ED9A 12E8L 5J1TC 4JFFD 2HG5A 4ZOCA 3WXVH 4MNQD 5I71B 3T0ED 2KQNA 4XGZA 2EIEA 4JG1L 2J5LC 1AFVL 3O8XC 4DGYH 4Q0XL 5DJCB 2XV6B 1T7ZA 2N1KA 3MV01 2GY5A 4JRXE 5GISL 1C7SA 1C12B 1KCUH 3BUYA 4ZG1A 5BZWB 2VSDA 4F7EA 1FHGA 4M9OA 3FQTB 1JNLL 1PX4A 5J89A 3ZKSD 1WFTA 3BKCL 2FZ3B 1MCJA 2YK1H 4LSUH 3DUUB 3BP4B 2ADIB 2QLVB 2HJKB 1E27A 5LCVL 4OV6F 4K2UL 5ISZB 1MCPH 4BK5A 3FB8A 5TDNB 1ZGLA 5ENWA 1YPZF 3M17B 4XPHH 2Y7QB 4I0PD 1R3HB 5CGYC 4LVNB 3VXNA 1IC4L 5D7JB 3DX8A 5T1LA 5AYUL 1MCDA 5EZJB 3WLWC 1NC2B 1I85C 3L3DA 3HB3C 1OL0A 2OX5A 4X6CB 4XZUA 3H9SA 3EO1B 5CP7A 3MREB 1A3RL 5JPMB 2RHEA 5IMKB 1X5XA 1DDHA 3T65B 3MJ7B 5D7SL 4JDZB 2DDQH 4F7MB 4JFDE 1YEEH 1CVSC 3NAAH 1ZLUH 1KLGA 1NAMB 1KPUA 4XWGL 5KSVA 4QF1B 5F3BA 1U58A 4F3FA 1G7QA 2ATKA 2NY2D 4K3EH 5T3XE 5L6YH 1XR8A 4I77H 1FZJA 4FZ8H 5C0EA 4N8CH 4HHAB 4G3YL 3QIUB 4H8WL 3T1FA 1V7NH 1OGAB 1D3CA 1DJSA 3WDIA 4I18C 1RFDL 2BP3A 2NY1B 4LSQL 3LH2H 4XC1L 5FGRA 5C0BA 1R6VA 3TA3B 3PWUA 3T0EC 3TBVA 2DQGH 1ZT1A 4HT1L 4APQA 4CGTA 4HPYL 4GG6B 2J4WH 5IEKB 1QUNA 4YQXH 3ZE2E 4X5WB 5E5MB 4LLUA 3PWJA 3K1DA 4LPCA 4W6YB 4AEIL 2A9NH 3LKQA 2VDPL 1EAPA 2VTFA 5D2LF 9CGTA 3GMRB 5I6XC 2ICWJ 5DSCA 3OJVC 4Y89A 3L7EB 4YR6A 5D7LB 2AI0L 1WV7T 4PV8A 2H32A 3WE6B 4NPYA 1OLZA 1MQKL 4WIQA 4L4TB 3UTSA 5H35B 4WW2F 1ACYH 1LNUA 2AV1A 2ZSWB 3QUZB 1IBGH 1A7QL 1FZMA 3NA9L 4Y4FC 3GDBA 1KV3A 4U0RB 4XMLL 1N5YL 2OK0H 3SKJL 2X4PA 4U1KA 1NGYA 4HUMB 4C55A 2HRPH 4DWHA 2PTTB 4QTHA 4EN3A 1HINL 1MWAA 3EZJB 5H37G 2CDFB 2PO6D 2R23A 4PJDF 3I02A 3VCLA 2VLMD 3SO5A 1HQ4B 3MR9B 4CNIB 5CBEA 1H3WM 1TENA 5TJWK 5JHLH 3UJJL 4MWFA 4U4BA 1U3HA 2OR8A 3BIKB 4XP1H 3ZDXF 5JOPD 2MKLC 4H5SA 4QEGA 5CUSH 2XNAB 1MPAL 2EECA 5CEXA 4KAQL 1J0ZA 3O4LD 3WD5H 3QUYB 4RAUA 4NKOA 1MCWM 1SBBA 4R8WL 3OX8A 4DKAA 3RVVC 1JHLL 1RUPH 4JPIB 3LY6A 3PGCA 4PGBA 3E2HB 3QEQE 5TE7H 5FYKL 3GMOB 5K93A 4JPKH 1BLNA 3GI9H 2ZCHH 1IGCL 1KBGH 4PJEA 2VR9A 2C3GA 2NY6C 4KWUA 2EDXA 4OF7A 3UTQB 3QG7H 1T0PB 1A1MB 4YO0B 4PGDA 4LVOB 1DBAL 3E8UL 1X5HA 3O9WB 1HIML 2BNRB 4J3WA 5J6HB 4UDTA 5ANMB 2IPTH 5JO5B 1QHPA 5AYQA 1KB5L 3ZTJG 2F58H 4A6YB 4WHDA 4Y8AA 2DQCL 5BS0D 1AO7B 3L3KB 2QQNH 3UO1H 3VMOA 1V7ML 4QRSA 1KN4H 1EGJA 4Q97A 3RDTA 3CFDA 4MA7L 2JB6B 1U93B 5J06A 4X6DE 5L8KB 2ARJA 3MCG1 3S5LA 1I3RB 3HRZA 3GUTB 4U6YB 5CD5D 4HV8A 3O4OC 3ETBF 4RGMC 1CIUA 4NQCD 2CUHA 5C0ND 5CD3A 1B0RA 1X5KA 4KDTC 3DPBA 3MV9E 4D0BB 4Z7VA 3G6JA 2GTZB 1YY9D 3MMEA 1QYGL 3LHPL 3FCTA 2HJFB 1W0VB 3ES6B 3FO2A 2CMRH 1FPTL 4PP2A 3IDIA 1KG0A 3SGEI 5CZVL 15C8L 1A4JA 4R7NB 1WBZA 5JIPA 3TO2A 1H5BA 3HPLB 2XXCB 1RHFA 3BZDA 4NC2B 2E9BA 2V17H 2C26A 3BP5A 3VGGA 2NY7L 5JDSA 4DGVL 3W9EA 3V7MA 4X6EB 5F71A 3RL2A 1UADC 3M8OL 2E6QA 4EXPX 12E8H 4PGEB 1S9VA 2QSTA 3WIFA 1ED3A 5C0DB 5EFIB 4Q9RL 4QHNA 5INDA 4JG1H 4ZNEA 1AFVH 5IFHL 4NRXB 3TZVC 4Q0XH 5KOMC 4URTB 3JWDC 3KVQA 4Z0BL 5FXCH 3V6ZA 5LJYH 5GISH 4EI6A 1LO5B 1BD2E 1EXUB 5HYEA 3ZTJH 1JNLH 4ZO6A 4NGHL 3BKCH 2K9UA 3LQAL 1TZHA 5GSVA 1EEZB 4U2YA 5F93C 5FDYA 4P2QD 1C16B 3FQUB 4Z5RB 1F11B 4AENB 5LCVH 5C2UB 3FT4A 3JV0A 3MX0A 4K2UH 3HZMB 4N8PA 2ICEB 1JUFA 4Y5VA 3UYRL 3SKOA 4GRWE 4G6JL 2YRPA 3MLZL 2CD0A 3RWJB 1IC4H 4KRPD 3BP6B 2HLFC 5TGBA 1N3NB 5SWQA 5AYUH 4PREB 3KPPA 4WFFE 2F74B 1T7XA 3NABL 3BHBB 5C8JB 1LO0L 2Z91B 5HDOA 1ITBB 4FNLL 1YZZA 1GXEA 1A3RH 4GO6B 5D7SH 3BRDA 4GKSB 4LVHC 1CT8A 2CK2A 1QEWA 5BZDA 1K5NA 4XWGH 2ESVB 3SE8L 4NN7B 3FQNB 4WU5A 1YY9C 1WGOA 1ZV5A 2H3NB 2G2RA 3O6FB 1H8NA 3HG1B 5D1QA 3VGEA 3BGFB 1H3VA 1F4YL 1IGJB 3HE7D 1PSKL 1CD1A 3JZ7A 4PJ9D 1XZ0A 1R24A 4G3YH 4H8WH 4NKMB 3TBYA 3ZKND 1FDLL 3GMLB 5HSFA 3N1MC 1NGWA 3F7PC 1RFDH 3BSZL 3MROA 4LSQH 4XC1H 3CJJA 5D2NB 5EPMA 1D9KC 5FUCC 5A2LH 1ZHLB 2GUOA 3IJHB 4U1JA 3NCJL 4HT1H 4P5TA 3OPZL 4HPYH 4ELMF 1IARB 2NY0C 4HFWA 3ET9F 4KROD 4JVPA 2PW1B 4POUB 5D93C 4ZQKB 4AEIH 5DI8B 5FYKD 2VDPH 1MWAL 4DFHA 4EXKA 3O6LL 1XT5A 1HQRA 1OM3L 3OAUL 2AI0H 2EDHA 5GZOD 3SGEH 4HUWB 5C70A 5HYJD 1J8KA 1MQKH 1CFQB 2A6IA 4FQXC 3KLHC 2DTSA 1UGNA 4WJ5A 5E7BA 1A7QH 1XGUB 1ONQA 2XTJE 5EU5A 3NA9H 4EBQL 3NIFF 4XMLH 1N5YH 1Z2KA 4ZSOB 3RVWC 2N7AA 2YD7A 4FQCL 2AK4D 5ACLA 4OZGB 1HINH 5HYQA 2ARWA 2EH8L 5DRZB 1K8IB 3EAKA 2VZSA 3B5GA 3EDEA 3AB0B 1JJUA 3RTQC 1T04B 4O2FA 1S7RA 5I1LB 3RUGA 3U4EA 5HJ3B 1OHQA 3ARUA 5IJVB 1RK0B 3UJJH 4L3CB 3CH1B 1FLRL 4NQED 1OLLA 1VCAA 4J7RA 2X10A 3HR5B 4P5KB 2Y07H 1YN7B 1MPAH 4YBHA 4KAQH 4S2SA 4C58B 2PKDA 4R8WH 4NO5A 4FS0A 2YUXA 5IIEA 3E3QE 1JHLH 3DMMB 4HK0B 4PJ9C 3I3BA 1ES0B 4D9RE 3ZDZF 4FQJL 4HKBA 5FYKH 1Q0YL 2DWEB 5IQ7L 4NCC1 1IGCH 5KSBF 3MNVA 3EO9L 3OXRA 2Y9RT 5KSAA 3QG6B 3O41B 5CHNA 4FXKA 4HAFA 4FRWA 5J0BA 1DBAH 3E8UH 3LB6D 1HIMH 4IRJD 1OAKL 2H9GB 4NUGL 3B8SA 1U2CA 4L3EB 1AD9B 5K9OA 3QFJE 4LPYA 2WWMC 3N1QC 2PF6A 3OKMB 1KB5H 5T1LD 5SX5H 4N0UB 2DQCH 3I85A 2HTLC 4ODHL 5CIPH 4ZTOL 5IW3A 1V7MH 1A8JH 5EUKA 4ALAL 3HC0B 4MA7H 1KFAL 4TSAL 2A6DA 1C08A 2C3XA 3HUJA 1UVQB 2W92A 4KJWC 1BJ1J 2EIBA 4BKLB 3D2UB 3I2CL 4K8RC 1JL8A 4E42A 3MLRL 3D69B 2FNBA 4L1HA 1FL5A 1CK0L 2IGFL 4LBEA 4QXGL 5TF1L 3T0AA 1QYGH 3LHPH 4N1CA 5SWSA 4EI5C 3H6JA 1Z5LA 1OF2A 1FPTH 4WDIB 3UTPE 5CZVH 2VITA 4YXKL 2VXQL 2OTWB 3TT1L 15C8H 3WN5A 1M6OB 2YSSB 3BQUA 3ALPA 1TVBA 2NTFA 3BKYL 5C0BD 5CP3A 4DGVH 2NY7H 1WFOA 1FN4B 2XPGA 2FB4L 1MSPA 3M8OH 5EBWB 1S7SA 4AIZA 1HK6A 2PN5A 1M7IB 4PJDE 4APQD 5TDOA 3TH4T 4JZOB 3D39E 4C83A 4AIXA 5IFHH 3VD5A 2XACC 4ZODA 5ERWB 2CKBA 2VDKL 5EN2B 1I1AB 4Z0BH 4PJCA 3KS0H 3VGAB 2R0ZL 2I9TB 3Q6FA 5FA4B 2JJTC 5SX4I 3GKZA 2NY3D 4RFOH 5KAQG 4C59B 3MRDA 1UXWA 4S11A 3UTSD 3PQYE 4NGHH 1WF5A 3LQAH 5E9DB 5EIQA 3PV6B 4PTTA 4GKZA 2IJ0C 3BJLA 3LD8B 5GGSB 3EDDA 3JBG7 1JWMA 1KJ2B 4U1GB 5I8KL 4EN3D 3X11B 2D7QA 1A7OL 5DC9B 3UYRH 4CN4A 4UTBH 4PJBA 1SEQL 4NC0B 4G6JH 3MLZH 4JFOB 4Z18A 3CXDL 2P5EB 4AM0A 3DVIA 3SCMB 4KDVA 4WV1B 4UV7L 1M05B 2F53A 1G9NC 1UWXK 3NABH 1LO0H 5MEND 1ORSB 2MSPA 4FNLH 1C5BL 1XAUA 5D5ME 3QIWC 2Y5EA 3EGSB 3GRWA 4GG8A 4R4BB 2HT3C 4JGJA 5F9OL 5ESQA 2VMFA 1AE6L 1TQBC 4JM2A 3D3VA 1G0DA 3QAZB 4JN2A 4D9LL 4LSVL 2Y25A 1F4YH 4JZJA 3UTTB 3G5YB 3K7UA 4PBVC 5KN5B 4PJFB 1PSKH 5T1KB 5I0DA 4QRPA 3VXME 4YFLI 2NR6C 1FDLH 3IETA 1Q94A 1RY7B 2XY1A 3BSZH 4YHNA 2FX8L 3T4AA 4PJHB 1G0YR 4E41A 5DRXA 3RGVD 1U8HB 1YN6B 5EO0B 1I1FA 3S96B 3BRGC 3NCJH 1IRAY 2I07B 3WKNA 3OPZH 3TYFA 2MOVA 2FR4B 5DURD 4Y1AA 2GTWB 1ORQB 1CGVA 4PY8I 3EO0A 4LDLB 4X7TB 3SOBL 4PRPA 4OGXL 1G7IB 1MWAH 1IGTB 2PYFA 3O6LH 1OM3H 1YEJL 2Q6WA 3OAUH 3GSOA 4OLVL 3RDTD 1JF6A 4RBPH 1SHMA 5I9QC 5FKAA 4UIMA 1A9EA 4EBQH 1BFOB 5FOJA 5JNYB 2WBJA 3SQOL 4HKZA 5KS9B 4HJJL 2FSEA 2FL5B 4FQCH 4JHAL 3T8XA 2EH8H 3VDBA 2H8PB 5HPMB 4ZPVA 5F1SA 3VXQB 2IANA 4KUCD 3FZUC 5J7CC 1RU9L 4LDEB 1U3HC 3BEWB 3PJSA 2X70B 4KKBC 3BDYL 3CDGA 5SX4H 3S35L 3U0WL 5EH1A 3MV7E 1ZS8B 1FLRH 1SMAA 3AREA 3RIAF 3GB7B 4R4FL 4CU6A 2J8UA 3GMMA 1N5AB 1F5WA 4J8RA 5DYOA 2P42B 5GXBB 1JYVA 2D4FA 2GEEA 3FQXA 4M93C 3LKSA 3SN6N 2ZOLB 1G7HA 3LKRB 1YJDC 3KPTA 1AHWA 2DLTA 1A6TB 1A6ZB 2CIKB 4FQJH 1WFUA 4KK8D 3RNKB 5EU6E 3SE4A 5K9KA 1Q0YH 5IQ7H 4JM4L 2VDRL 4PG9B 4F57L 3EO9H 4CVUA 3PWLA 4XPFL 5DMJB 5F6IC 2X4RA 1J11A 4OJFL 4CBPA 8CGTA 5D7KE 2EXWD 3IVKA 1U8KB 2EEBA 5HGHA 4N1HB 1OAKH 3VGBA 4NUGH 4OFIA 1WTLA 4XBPB 4ZAKB 2VAAA 1IAIM 1PFCA 3NCMA 2H6PA 1JWUB 5DD0L 1JGUL 4MB3A 1L6ZA 3SDYL 5FYJE 2EIZB 1J8HA 1NMBL 2FATL 5ICYB 4KI5F 5EU4B 4H25B 3SKUD 3B9DA 3LKPB 4ODHH 1U8QA 1I9EA 3DTXB 4NDMA 4P48A 1A9BB 3TVMA 4ZTOH 3W0WD 4ALAH 2YPKA 1YUHA 1RVFL 4JKPL 1KFAH 4TSAH 3C09C 4ELME 1DLFL 1RUML 2BXZA 1ZLWK 1L9NA 2FDBP 2WSKA 3OKOA 1ZSDB 4PGCA 1PYWB 3DX7A 3I2CH 4I13B 5C08A 1ZAGA 2NYYC 3MLRH 5D7IB 5D1QD 2MQ0A 1CK0H 1NDMA 3ILPA 2IGFH 4QXGH 5TF1H 2HJKA 1F3RB 2Q86A 4U33A 2CKBL 4NQDB 3ROOB 3AROA 1KACB 2R1WA 3NIFE 4HGWB 1DN0A 2HVKA 2VXQH 3FMGL 4OIIL 3IDYC 1Y18A 4YXKH 3TT1H 4I48B 1N8ZB 1YDPA 2FB4H 4YPJA 4LKCB 3ULVF 3MO1A 1BHGA 4P5TD 4YBLB 4PRAA 2X1QA 5ESVA 1X6NA 3WO3B 1J88A 4LDOB 2VDKH 4ZTPL 4CU8A 5JPMA 1JYXA 4KK8C 1IAOA 1NC4B 3T65A 5BRZE 3DO7A 3I75A 4MNHA 3QUKA 1AP2B 2R0ZH 5ELIA 4QF1A 5IW1B 2M26A 1UB6A 4GUPB 5K33A 4Z7UB 4YDLB 4PJAF 5ID0B 2EYRB 3ZT7A 4G8GB 1GGYA 3DHJA 4Y4KC 1QSEE 2B5IB 2F9BT 4N0FB 3MRBA 1KELL 1ZLUK 5EO1A 5I8KH 2BSTA 4P9HL 2FECI 3ZDZE 3IF1B 2DLEA 4TTDD 1A7OH 1BAFL 4OLUL 1P9MC 1RUQL 1SEQH 4JJHA 2AKRB 2FYYA 3VXRA 1D5IL 4S10A 3WSQL 4Z0XB 1HI6A 1I3GL 1RJYB 2R0LL 4UV7H 5IEKA 4Z9KB 4PJ7E 2P5WA 3MUZ1 4G9DB 4X5WA 1U92A 4I2XB 3C6LA 2FD6L 1FORL 4G9FE 4YHIA 4K94C 1MIEL 3T3MF 1C5BH 4HIHA 4BYHA 3UAJD 5MP6L 4PTUA 5HI3C 4Y5XB 2NXZC 5DMYA 5DR5L 4JREB 2OJEA 2EEDA 4KJYA 5F9OH 4MYWB 2ZKHL 4IRSA 4YZFE 2HP4A 3VWJC 4ZUWA 1S7TA 3O6ML 3LMJL 4KHXL 1AE6H 1YEHL 2G5RA 4GXUN 5F7MC 5AG9A 4D9LH 4LSVH 2BVTA 5DGRA 5J11C 5JW5A 5SWZB 3HCVB 3NIGF 1G6RB 4G7VL 4KVCL 1PDKA 1DQML 3RNQA 1EH9A 5C07B 2FX8H 1A6WL 3TBWB 1J0YA 4P5TC 3C8KA 1RZJL 4JRXA 5F88B 3FT3A 4KV5E 3X14A 4HC1L 4DZ8A 5EWIL 4LKXB 4P59L 1U8LB 3DV4A 3BIKA 1CFNB 1IC7L 3T77A 2E5EA 5EBMA 3SOBH 4BFGA 3SGJC 4OGXH 2CLZA 4G43A 3ZSSA 5E08L 1YEJH 1QR1A 4OLVH 3MRRB 3QIBD 3GSNA 3QNYB 3PDOB 4FQQB 4LK4A 5JIIA 3GIZL 4RWHA 2MNUA 4RGNB 3DRQB 2IH1B 1TMCB 1MRDL 5DEZA 2W9DL 3SQOH 3D25B 4HJJH 4AT6B 1KLUA 4TTDC 4P3DA 4YLQT 1ERNA 2VAJA 4JHAH 3QDJE 3UTQA 4F2MB 5JZ7D 3RPIA 3RY6A 3VG9C 1T5WB 3U7WL 3IKCB 1JTOA 3IJSA 5SWSD 2QSQA 2Z92A 4E5XA 2E9IA 1RU9H 5DHYA 3WYRA 2VISA 3QHTC 4JFDA 4UDUB 1MHPL 4X80H 3LEYL 1CFVL 5F8RC 4F7PA 1NGXB 3BDYH 4YNYA 3RKPA 1UH2A 2OS7A 3S35H 3U0WH 3BQUD 4AZ8A 3REVA 4K23L 1MVUA 2JCCF 2J8OA 4LP5A 4X6FA 3UAJC 4R4FH 4MAYB 4J3TA 1EX0A 4Y4HD 4OCRL 1BIIA 4GBXC 2P8LA 2NNAB 4OV5A 2ARJQ 3HPJA 3JWOC 3C9NA 3ZZ1A 3CNKA 1R3JA 3LOWA 3DROB 3GSRB 2IWGA 2WBWB 1P2CB 4PR5A 2EE6A 1UWEL 1MLCB 4Q9QH 1BVKB 5E99L 4JM4H 5KSAC 2VDRH 4F57H 2IBZX 1J86A 3QQ9D 4LCYB 4XPFH 4OJFH 1FSKC 5EZIL 4YDIL 2OSLB 4DK6A 1QLFA 1FFRA 3I3EA 3RWCA 2R15A 1I7RB 2F54A 2DWDB 2P1YA 3NN8A 1HWHB 3P9MA 4GG6E 2WZPD 4D0CA 1ZVSB 4JZNB 5DD0H 3DETD 1JGUH 3LSOB 4V1DA 4X6EA 1A3LL 5E2JA 3C5ZA 3HS0B 4U1SB 3SDYH 1NMBH 2FATH 3A6OA 4XNZB 4K7FA 5DRNA 2F53D 2V5TA 5D7LE 4ZOBA 2GJ6B 3TIDA 1RVFH 3MYJB 4JKPH 1JPGB 1OY3B 2AEQL 3LV3A 3UZVB 1DLFH 3NIDF 1RUMH 3BWAB 4XCYA 1BGXL 5C71A 5FECB 3P77B 3L3IA 4MLSA 5CP3H 3VJ6A 4QRUA 5B8CC 4I5BB 3Q5OA 3BMWA 4GW4B 3V0VB 1WWWX 3FRPG 3O0RL 4IMLB 4OZIF 4KMTL 4LGPB 3IRPX 4GLRI 3DXAA 3D3VD 1XGPB 1RD6A 2KDGA 3H8NA 4O58L 4MGXA 4CJ0A 3DYOA 4OI7A 3FQUA 4OM1L 4UQ2B 4QRPD 1FG2B 2Z31B 3BQUC 4MSWA 4R6UA 2GK0A 3MA7A 4L3AA 4OIIH 3FMGH 1JI1A 3DVFA 3UROR 3P4MA 3KWWB 1HNGA 4E41D 5HTSA 3RWJA 3P4OB 1N3NA 2RQ8A 3B3IB 4N8VG 2G9HB 1OARL 3MRKB 2HFTA 4Y1AD 5E8DL 1OSZB 4RMQA 1PVHA 2G75B 1LP9B 4PRPD 4ZTPH 4PRBA 2NX5E 4J2XA 3QNZA 1MAML 4XRCA 2NY5L 3VRLF 4EUPG 3QQ9C 2QQLL 3HLAB 3KYAA 2XWBA 5C9JA 5I73B 3VDCA 2WBJD 1TCRB 1UENA 5F89B 3CUPB 4K55A 2AEIT 1KELH 3E0GA 4PJXF 1Z3GL 3OJDB 4R96B 4P9HH 1H0DA 5IB3A 2BNRE 1BAFH 4OLUH 4L8BB 4R3SB 5B39G 4HG4J 1GZPB 1RUQH 1D5ZA 2GCYA 2IAND 2IQAA 1B3JA 3PL6B 1D5IH 3WSQH 5HHVL 4D0DA 2R0LH 1FFOB 2FH8A 3I50L 2E8YA 2HJLA 1A0QH 5HVHB 3ARED 4ODTL 2FD6H 4PJGF 5DI8A 5IBUG 1EVUA 2Q7YA 1FORH 3FO9B 1MIEH 3SDCB 3OKLB 5CBAA 1T0MB 4GMSL 4PJFF 2I27N 3NCEB 4N90E 5MP6H 1FE8L 2X4TB 5DR5H 1F6AB 3EYOA 4HCRA 4OT1L 5EU3A 5B38A 2ZKHH 4JM2C 4KK6C 5HHPA 3IDGA 3O6MH 1SYSB 4IM8A 3LMJH 4ZUSA 4KHXH 4LLWB 1YEHH 5E8EB 3RWHB 1KCLA 4TUJA 1JWSA 2Y6SC 1HKLL 4QT5A 3V8OA 3QDMD 3WO4B 2IBZY 3RWDB 4G7VH 4G80B 4OD2A 5D1ZB 2YPLB 1JFQL 4KVCH 1DQMH 3HMXA 3LKOA 3PXHA 3GEWB 3AS1A 3TESA 3P3YA 1MCSA 2D0FA 1A6WH 5D6CA 1QBML 1HH6B 3UBXA 3V2AR 2XFXA 1K6QL 1RZJH 4NO2B 4CMMB 4HC1H 5EWIH 3QA3B 1T21A 2R29L 4P59H 4HKXB 3HI1B 4ZYKA 4KKCC 1IC7H 1I4FA 4GLRH 4JDVA 4TUKL 3UJTL 5EC2A 1J8HD 5IMMA 2YUZA 4ZO8A 2ERJB 3KNBA 4QO1A 1PZUB 4IOIA 1YEDB 2IADA 4DZBA 3QH3B 1I1RA 4QXTB 4Y19B 3V7AG 4OZFG 1QG3A 4QRTA 2WBJC 1K3ZA 2C3VA 3GIZH 2GAZB 3H7BA 4HK0A 1FZOA 3EHBD 4UUJA 1AGCA 5LKNA 5DVKA 1MRDH 1NBYA 4X6BB 1CTNA 2W9DH 5C1MB 2W0FA 1UZ8A 1IC5L 4C54A 4HZLA 5C08D 4WFEE 5CGMA 5T3XL 5DFWH 5DEFB 4DEPB 4FTVB 4FQ1L 1NJ9B 3MUJA 43C9A 5C09E 3D0LA 5E94B 5A2KH 3U7WH 1CIDA 4PJAE 2LAGB 4H1LA 1TLKA 2X89D 1MHPH 3LEYH 1CFVH 4DOHB 3QI9A 1P69B 4LLDB 2YD3A 4GW1B 1JPST 4HX1A 4K23H 4B5EA 2QJDA 1EHLL 2B20A 4NP4L 2MKWA 2YBRA 3E6FA 3L95B 5D1XA 3THML 3U30B 5L2KB 4OCRH 1T89C 4J23A 4M61B 3FT2A 1PD6A 1P1ZB 1AHWC 1CG9A 5DO2C 1NAKL 1HHHB 1WZMA 2CDEB 1Z9SA 1K85A 4ZFFB 4LLVA 1UJ3A 2KBGA 1UWEH 3LPGA 3T3ME 4PRDB 3VI4E 1PKQB 1DVFA 1VENA 2FEDD 2YA2A 1EEUA 5E99H 2FHFA 4KH2A 3HE6D 1KIQA 4M6NL 4HS8L 1FFQA 8FABA 1NCAL 3AXLA 1PKOA 2IAMB 5EZIH 4YDIH 5C86A 2X4SB 4FQLL 4XXDA 5KANI 1CF8L 5FF6A 1MREL 3NIGE 4MXVF 2EE9A 4TULL 1FZKA 3SPVA 3PNWB 3SDXB 1UCBL 4YXHL 1A3LH 3IDJB 4HDIB 3OHXA 5EBWA 3TVMC 4J4PA 3AAZB 1WBXB 3K2UL 5I75B 3ARFB 3MUHL 5CJOL 1X6LA 3C6LD 5TE6L 1FVDB 4TYUA 1V8HA 4OF5A 2AEQH 4MXQD 5E6YA 4XH2A 2RR3A 3CFKB 5D4QA 3SGDI 2I9TA 3B9AA 3FB5A 1BGXH 2CK0L 5HHNA 3VFGL 3O3AB 4O2CB 3CXHJ 4N0CD 4BFEA 4IRSD 1S7WB 3WUWB 3O0RH 4KMTH 4OZGE 3HNSL 3KPSB 3I6KB 1QOKA 4O58H 3S7GA 3PV6A 4OFYA 1BP3B 3MZTA 1YPZA 4LPXA 4OM1H 3L3HA 3MRFB 5F1NB 5C3TA 4HS3B 1DUZA 4NQXB 1VEPA 4QTIL 5HHOE 4LVNC 5D7JC 4HS6A 3WIHL 2VIRB 1RZIB 2AJ3A 4KXZH 3SQBA 1X5IA 2BVQB 4LEOA 4JRXD 4Y2DA 5I74B 2A74A 1M05A 5LGJB 5A16A 1OARH 2BOBA 5E8DH 1VB9A 2D3VA 4UU9A 4ODXB 1NPUA 3MLYL 1GGIL 5I15L 1MAMH 1FIEA 5IMLA 3BAEL 2JCCE 4ONHA 1AGFA 2NY5H 5I1EL 3BH9A 4DN3L 1IKFH 5FHAL 5L88L 2R1XA 2EYTB 5AWNL 3TH2T 2QQLH 4Y16B 3IXAB 4X99B 1S5HB 3BW9B 3QFJA 3NPZB 3QIUC 5E8OB 1Q9LA 3S4SB 4JFQB 3ROLB 3CU1A 2AV7B 1IQDA 4MA3A 3TBSB 2P7TA 2J5LB 1Z3GH 4NO0A 3O8XB 1RJLB 4MAUL 2EDEA 1XR9A 2G60L 2VQ1B 3OKNA 3W81A 4LCIL 4P4RA 4JFDD 4AEFA 5HHVH 3K74B 4U6XA 5D2LA 3WEXB 1RHHB 2FR4A 3BP7A 3VFOA 2GTWA 3I50H 1FH5L 4X5LA 5ITFA 5F7UA 3SY0B 4ODTH 3ZT6A 2FJFB 1BVZA 1FBIL 2EYSB 1A2YB 1IGTA 4XNUL 5T3XD 4GMSH 1EHAA 1BVLB 4IRSC 1FE8H 4WW2A 2PYEA 2I24N 2DQEL 3QUZC 4OCLC 4OT1H 5GGQL 4U0QB 7CGTA 4U0RC 1NSNL 3HRPA 3JV5A 4QXUL 3EJZC 3FOLA 1HKLH 4YGVA 2Z8SA 3BGAA 3KPLA 5D72L 1IGYB 5J12B 1KTLB 4OUOA 5IVZA 2FL5A 3NIDE 1JFQH 1EVTC 5HGDA 4LHUG 3ULUF 2H8PA 4RBPK 3WS3A 4JKKA 4RAVA 1QBMH 4YHML 2VWEC 2UY7A 4X7FC 1K6QH 4ZFOB 43CAA 2ZCLL 2ZNXA 2F54D 2R29H 4P4KB 4K7PX 3RVUD 2ZG1A 5JXEA 3C5ZD 2J88L 4TUKH 3UJTH 2B2XL 2X9YA 4LVEA 2XY2A 4ZXBD 1UB5A 4D8PA 3OGOE 5E1HB 3G6AB 3BZEB 3LAFA 3JTTA 1QBLL 2DL9A 4J3XA 4I18B 2IMMA 4E9LA 5ETUA 1UZ6F 1EBAA 4JFXA 3E2HC 1KC5L 3OGCA 4JFFB 2X4UA 3OZ9L 4MNQB 4RCAA 1QR4A 1A6TA 3T0EB 2CDGB 5IB2B 4YDVA 1IC5H 3KPRE 5F7DB 4DVRL 1Z0NA 3RY6C 5T3XH 4AH2A 3RWGA 4GXVH 4ZFZA 3LKNA 3DXAD 4FQ1H 4LVOC 5I6XB 4WNQA 3O9WC 1U41A 2EZ0D 1YY8B 2IPKA 3VRLE 5I8CB 4LFHG 4EVNB 1YMHB 2P5EE 1K4DA 1AGDA 1KJ3L 3RWEB 3TNMA 5KAQF 4M00A 4R7DA 4EZMA 3MACL 4MS8C 2ITDA 1NUNB 1TCMA 4MD5B 4Y4FB 1EHLH 2V7HA 4NP4H 2GYSA 1TJIL 2H1PL 2NW2A 2VLJE 2RAMA 5B22A 3THMH 3QEQD 1HILA 3DTXA 1WZLA 3VXMA 1JV5B 1ZXQA 3OXSB 4EUPB 1NAKH 4XMPL 3P73B 4M3JA 2ZUVA 3TPUA 3MLTA 4WUUB 4PJGE 2VOTA 4RIRB 3V6BR 1U8MB 3UTTE 2HRLA 4NKDB 4PJFE 1LEGB 1CICA 4UOW1 5JORB 1UACL 1YNTA 4MA1C 4M6NH 3S35X 1NCAH 4OGYL 1MCQA 2NPLX 2XZCL 4PJHE 4JFEB 4LP4A 3K4AA 3UBXI 3GSXA 3MC0A 4FQLH 5H2BA 1JGVL 5DS8A 4RFEB 4XCEA 4F7CA 2NY2B 3MRHB 1CF8H 4AEHL 4QRQA 1MREH 3C5ZC 1G7LB 2VC2L 4TULH 1OAQL 3MFFA 2DBJA 4GJTB 3HAEA 1UCBH 4LSSL 1VPOL 4MJ6B 5JOEA 4YXHH 2A6KA 4LKCA 4EOWL 3GSQA 5F9WB 1DEDA 1T20A 4ZDHA 1CYGA 6FABL 3MRLA 5K9QG 4ELKB 2V2XA 3H0TB 3K2UH 5EUOF 3SGKC 3BO8A 3MLVL 4WI8A 1ETZB 3RKDD 3DSNA 5CJOH 5TE6H 3MV9D 5DUPL 1LO4L 4OIBA 3CFEA 5J6GB 3RZCD 2Y1VA 4YHLL 2MHAB 1AP2A 3DV6B 1IAMA 2CK0H 3AUVA 3VFGH 4EDXA 5FO8A 3B4NA 5KS9E 3W5NA 5EO9B 4QHLA 1JTTA 4GUPA 4M02A 2BOCA 1C5DB 2C9AA 2R2HA 1AXTL 5E2UL 3HNSH 2XQYK 4FQPA 4WTWA 1IKNA 3S98A 1R5VB 2WBKA 2DMBA 3QO0B 3CIQA 5LAXB 4O4YL 4QTIH 1MH5B 3WIHH 1QSVA 5B4MC 1JE6A 2E7BA 3ZE1F 5CSZB 4M7KL 3TO4A 3IJYB 4HWNA 2VDQL 4K7PY 5DD6B 1SVCP 4LRIA 3Q48A 5EDXA 1J9CT 1BD2D 2EE3A 3TT3L 2PO6B 1SJHA 2BSRB 1JN6A 3RWIA 4IIQA 2ADJB 3VFPB 1WK0A 3MLYH 1GGIH 5I15H 4YFLF 3VXTB 3TBTB 3BAEH 1KN2L 4I4WA 4NN7C 3O6FC 4DN3H 5I1EH 5FHAH 5L88H 3BGFC 3JUYA 5AWNH 4OAWA 4LPTA 1NMAL 1E6JL 4F7TB 3O4LB 1AC0A 3MRCB 3FN0L 3F5WB 2BRRL 3KJ6L 1CDJA 1U8IA 4TQEL 5D2NC 4Q9CA 4WFFD 1ZTXL 5EIVA 3DUSA 4MAUH 1NLDL 2G60H 3KLAB 2CRYA 4YEFA 4ELMA 5DJDA 3L5IA 1FAKT 2ZJSL 4L9DA 4LCIH 4NT6B 5F97E 4LKXA 3QI9D 1U8LA 4MB4A 4HQQL 3SDDD 1E4KC 1FH5H 4MDIA 5E00A 1CLYL 3AM8C 3JV6B 1FBIH 5I1DB 1Q9KB 4XNUH 4LPWA 4MXVE 2PNDA 3ZDYF 1VFBA 4F37K 4QWWC 2OL3A 3F7YA 3MRRA 5A40E 2DQEH 1P4BL 5GGQH 2A9ML 1NSNH 1T1WB 3B6SA 5I0ZA 3EKCA 4QXUH 4KMLB 2LV4A 1B0WA 2QV2A 1BX2A 5D72H 3QR2A 3KDMA 2BMKB 3IDMB 4AT6A 1DVFD 1LE9A 5AUMB 3G5VB 4OCYL 4NQDE 2BNUA 4ODSL 1ZLVH 1NBZB 4YAQA 1P5UA 2VE6A 3RFZC 5D6DA 4HULB 5ADOL 1GYAA 3VFMB 4NQCB 4YHMH 3PHQB 4Y0GA 4LVHB 3TNNA 3TFKC 3FFDA 4GRWH 1M71A 2ZCLH 3PABB 2IQ9L 3QQ4B 5I17A 1VADB 4YHKL 2GW5A 2DJ4A 3GJFH 1WQVT 3QEUA 3R0NA 4NUJB 4RAHA 2XTJD 5TF0A 2J88H 1HHIB 4I1NB 3UXFA 4BH8B 2B2XH 2GFBA 3CPLA 4J4PD 4WU7A 5KVFL 3DJ9A 4WVRA 1QLRA 2FX9L 4MHHI 4XVJL 5BV7L 1QBLH 3DMMC 1X5ZA 4H1LH 1FYTA 4OCWL 5ICXA 1XGQB 5DDHA 1KC5H 2UVEA 1UEYA 3GSRA 3OZ9H 4KQ3L 1A22B 2VN4A 4Z7UE 5E24E 3NMEA 2QR0B 3JV4A 1MLCA 4G8GE 5KSBA 4OQTL 3ORJA 2J6EA <