4UI2A

Crystal structure of the ternary rgmb-bmp2-neo1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
201
structure length
201
Chain Sequence
TPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NEOGENIN
publication title Repulsive Guidance Molecule is a Structural Bridge between Neogenin and Bone Morphogenetic Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ui2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ui2A02
1B4JL 1JZ2A 1HNGA 3P30H 4KV5F 5INDA 4KK6D 4Z7OF 4DZBB 3X11B 3QUZB 2X44D 3GSUA 4KQ3L 3RFZC 4DQOL 2LVCA 4FQHA 3ZYIA 3F7QA 1LWRA 2H32H 2WWMC 5FM5O 4E42B 5CGTA 2ZCHL 1KGCE 3WFEH 1OP3K 1NCNA 4NQUA 1NCWH 3FOMA 2Z93B 4X6EA 4N0UB 3OL2A 3GJFA 3ECBB 2KPNA 2ZOLB 3PJSB 4MA3B 5HGHA 4KPHL 1X7QA 5IHZB 5DRNB 2Z91B 1CXLA 3SDAA 2EXYC 4KRPB 4X98B 2CIIA 2X89D 5DK2B 4PJ9D 4WJ5B 1GZPA 3GBNH 1V5JA 5BO1H 3UXFA 4L3CB 4U6VH 3MYZA 4XCEB 3DXAE 5CKAA 4NQDD 4HDIA 1A6TB 3UX9B 3H9HB 3O6FD 4YHYB 1XR8B 4XVJH 5MP6H 4C4KT 3CAFA 3UTTD 2VQTA 1FJ1A 1EA9C 2PW1B 3MNVA 1J5OL 4OFIA 4ZS6C 2P7TB 1T21A 3GJFH 3PDGA 3TCLA 1G7LB 3FN0H 3VDAA 4EVNB 2H2SC 3IJSB 5HYFA 1OTUC 2D7OA 1KTDB 3P0GB 2XACC 5EOQL 3FAXA 2YPKA 2R15A 2BNUB 1KV3A 1X5HA 2ZG1A 3F5WA 3MV8A 3U1SH 2W9EH 5CP7A 1INDH 3RPKA 3EUUA 5F7MC 3RWEB 2E7LA 1TTUA 4IRZL 4TSCL 1LO5B 3QUXC 1WISA 4GAGH 4KDTA 3EYFB 3V0WH 5D2LE 3FO2A 3S4SG 5IBTL 3V0VA 4XTRD 5MEOB 2EDDA 5AYUL 4YWGH 1XR9A 4Y1AB 2VAJA 1FVDA 3EOTL 4H25A 2EZ0C 4NM8H 1QHPA 4KQ4H 2AJYH 4P59L 1A7NL 1MCPL 5FKPA 2HTLD 3U82B 3OJ2C 4Z7WB 1FNHA 5H2BA 5C9JA 2GTZA 1FZMA 4JFFD 4U1HB 5KVGH 3OAZH 1KC5H 1WFUA 3SCMD 1T7YA 3A6BH 4BSJA 2FBJL 1KYOK 3C8KB 5IVXF 5JZ7C 2F9BT 2YC1B 2NTFB 4X7TA 1RZIB 3ZTJH 5C6PB 5CP3A 1P53A 2R29H 5BVPH 5K59E 4J3XA 5M94B 1CDCA 4NO2B 4GOSA 5E9DD 5J1AA 3KYKH 2VDOH 1KEML 4UILL 3N50A 1HYSD 4L8SB 4PGBB 4WV1C 1MCKA 4QOKA 5E95B 1NAMH 1UCTA 2X4NA 4XC1H 5EBLB 4YHNB 4Y16D 3MCKA 1ONQB 4HIEB 4PJGA 4AG4L 4CMHB 1XZ0B 5IF0A 1DQQA 4EIZC 5DQ9B 2CK0L 2HFTA 3MV9D 3CGTA 3PWJB 5F93C 5CEYB 2HLFD 1Q9OA 2X09A 3R0NA 3PWNB 4U0QB 1FDLL 1TVDA 3CJJA 4TNVK 5D71L 1CGVA 2NR6D 4HXAL 4LCYA 5CP3H 2PTTB 1MY7A 5I66A 5JHDA 1FFNA 3LQAC 2GAZB 3GM0A 4WFFD 3VFWA 1MHCB 4G43A 3BWAB 3VXRD 2F5AH 4E0RA 1YEEH 1SM3L 4NKIL 3T0XA 4KKCD 1J05B 1UJ3B 5T1KA 5CLWA 3REVB 5HVFB 1U8NB 3BO8A 4O2CA 4ZPVB 4WV1B 2Q20A 4XXCA 2HFEA 2HT2D 4M6OH 1JP5A 4Z95L 1SJEA 4OM1L 1S3KL 2F53E 4BFIA 1E4XI 3ZHLA 3X3FL 4F8TA 3GNMH 4OZHF 3C6LC 4TTGA 4N8CL 4NUGH 1OAQL 4OLZL 3A6OA 4UQ3A 4XMKH 1BIHA 1QBLL 1FH5H 4K8RL 1QD0A 3ZE2E 3TJHC 1P1ZB 2PUQT 4FQ1L 4PRIE 5IW1B 1X5LA 4OZIE 4HK0B 3NAAH 3PV6B 5ALCH 1DQJB 3G9VA 5JA8B 4MNHB 1NCBL 1A4KA 3CFDB 5J9PA 2ZP0T 3IKKA 4IS6B 4CW1B 4CVWA 1LEIA 4M9PA 3HKFA 4DOHB 4Y5VC 5HGAA 4GRWH 3VI3E 1ZLSL 4M6MH 5EN2B 1XIWD 4ETYA 4LRIC 2A6KA 1D6VL 5C0AD 3T04D 4I2XB 2Y06H 2EEBA 1I8LA 1WWCA 2V9RA 5DZNA 4OCNC 5IQ9A 1M7IA 2APXA 1RIUH 1UVQA 1JPTL 3OR7B 3QDGD 4KTEL 2NPLX 3C08L 5CINL 3IF1A 2FIKA 5HXMA 1DQDH 3BE1L 5MEQB 3X17A 1D5BB 2EDEA 2LQRA 2CMRL 2HWZH 4HBQA 5IOPB 5EWIL 2Z35B 3FFDB 4L8BA 3EYVB 4CU6A 1MFCL 1JGVL 4IOFC 2OI9C 1IL1A 2IANB 2NY1C 3NZ8A 5CEXB 1KT2A 2D7QA 3EOAA 5E94B 1TPXB 4YHPA 2F19H 4OKVA 2DMCA 1X5KA 3IDJA 2KDGA 5D7SH 1RZKC 3H7BA 3CVHL 2GJ6B 1A14L 5CJQH 1IGML 1CDYA 1DBKH 1BZ9B 2BOCB 4PJIA 2IMNA 2VLJB 4AENA 5A2FA 4G8IA 1EUUA 4IBLT 3UJTH 2PKDA 3I85A 2FCBA 5E2UL 3JV4A 1MJJB 4WU5A 5KSBA 3VD3A 5F7EH 1F4WH 1S7VA 5CLTA 3FQUA 1QFWM 5HI4C 3KJ4C 1JMXA 5DQDL 2NYYC 4NO0B 4JRXA 1WIUA 3QO0A 4NUJB 2XG5A 2VDNH 5DTFA 3SJVE 1HHHB 4M7LT 4G42B 1DJSA 1RUKH 5F3HB 1T66D 1M4KA 1AIFB 2P1YA 4P3CL 1F2QA 4K07A 4Q6IA 3SGDH 3T65B 5TE7H 2A77H 4HH9A 3WIHL 2MSPA 4ETQB 2PNDA 5F7UA 4OGAD 4R0LB 4YH6A 5ICZB 3QXUA 3X12A 3IGAA 3OPZH 4Y4KA 2APWA 4LCUB 3MROB 3BJ91 1A47A 2QBWA 1J0JA 3VXTA 1NC4A 3O3AA 4DKEH 5EZLB 4OD2A 2ADIB 2F5BL 3RUGA 1VSCA 4YQXH 1K4DB 1G0YR 3BPOB 4UINL 5C0JA 1YEHL 1MFNA 4PUBL 5KZCB 1BMGA 1HHGB 1U41A 1RK0A 3BQUB 1SYSA 1CLOL 3MRFA 3QDMB 5FDWA 5AWNH 2YK1H 4I4WB 4Z5RB 1RZGB 4AZ8A 3IFPA 1N2RB 3H42H 3QFJD 1FG2B 2HN7B 2X4QA 2C4FU 2CDGB 1U6AH 1VB9A 5EZJA 4X6DB 1MRCH 5CIPA 1XF4A 3BGMB 2C5DC 3JUZA 3W0WB 5FA3B 4WO4C 4GKOA 3MRLA 3KYMB 1FFQA 1AE6L 2YXMA 1DLHA 3T08A 1ZMYA 5HTSA 2HJKB 4G8GD 1UH4A 5E6YA 5ABDE 2OK0H 4ZS7L 5DA0B 1IGJB 3QZWA 4HS8H 4QT5B 3U46A 3HE7A 2EDLA 3H3PH 3HUJA 5JPNA 2ICEB 2Y07L 2W0PA 3BPLB 4POUB 2VZ1A 4EQ2A 1YYMH 3RX5A 3ZDYF 1UJTA 4NM4H 3SE8L 4RNRA 1NC2A 2BOBB 1LHZA 5CIPH 1A6PA 1FLTX 2E9WA 1Q9WB 1C1EL 5BXFB 3LPWA 1QBBA 1INEH 3KPTA 4OF7A 5BRZD 3RWJA 1T7WA 1JPSL 2DYPB 1FNSL 4XRCA 4QRTB 2QHRL 3K74B 4JQVC 5JHLL 4MJ6B 3MREB 5HYQA 3WNPA 5D7IB 3RTQC 2NY6C 1G7PA 3KYOB 1Q0XH 3T3PE 1TZIA 3GSQB 5BJTB 4PJ8D 3V4PH 1BJMA 1BAFH 4MJ2A 4RX4A 3FB7A 3BZDA 3B9KD 4AYFA 3MGOB 1R3KB 4L4TB 2J8UA 5FYKD 1BJ1H 2X1QA 2FSEA 2V2WB 1MRDH 5FM4A 3SEPA 2DLFH 4ONHB 4ZUTB 3LDBC 1U8IB 1EMTL 4U1NB 2RFXB 3NPZB 4WWKA 2X4OB 3TYFA 2SEBA 1AHWC 1RZKL 5E7BA 4LLVB 2AJVH 1BGXL 1U8OA 1R5IA 2Q86A 1BEYH 5FF6A 4AEIH 2DQGH 2ED9A 5AZEH 3L3DB 4C59B 3T77A 2F54D 3MJ8B 1AP2B 2YXFA 5FGCE 2H26A 2YUWA 1QVOB 3OKMA 4YNYA 5D7IF 4ZTPL 3ARBD 2ESVD 4PP2A 3L1OH 4GAYB 4G6JH 4PJHF 3QPXH 5I71C 4GRLD 2WUCL 3H9ZA 4Y4FA 2FZ3B 2HVKA 4UT6L 4YHLH 1RMFL 5C0IA 1B0GB 4CUCA 3HZKA 2K9UA 1HH6A 2W38A 4RFOH 5I17B 2FO1A 2ZSVB 2NY7L 4P2OD 4YO0A 1JHKH 1C16B 3HI5L 3B3IB 1QPPA 3OKEB 2DLGA 4OCWL 5DD0H 3NN8B 4RSVA 3U9PL 3V4VL 4NQCE 4UI2A 4CNIA 4PRHD 5HHMB 1ZSDB 1W8NA 1FE8H 4PY8I 5EIIB 3OWEA 1NFDB 4HIHB 4J7RA 4P49A 5JIHA 5IMKA 1M7XA 4ERSL 4ZXBA 3STZA 1A3RL 2N7BA 4G3YH 5F88A 4HIIB 1BWWA 2W59A 5DYOB 4LAQH 5J8OA 4GG8A 3QG7H 1QLEH 2DBLH 5EH1A 1QA9B 3CVIH 4DFIA 4IRSD 1PYWA 5I71B 1NFIB 5C6TH 4J3OC 3TH2T 1QZ1A 1ZA3A 3MA9H 3P9LA 4LPUA 3O6KH 3D87B 5F7LB 3CDYA 3HMWH 5D6DC 2O61A 1VEMA 2IC2A 2PXYC 4TTDD 2YBRB 3R1GH 1C12A 1I8KA 2HJLB 3VH8A 1NBZA 1YEDA 3X13A 4APQA 1AGFA 1EO8L 4KZEL 1MLCA 3HNVH 4RFNB 1ZWIA 5EO0A 5HDBF 4MXQD 2ORBL 4XXDA 4O2EB 1JV5A 2KZWA 5I1KL 2YUZA 4AH2B 3TIEB 4PR5A 5IHLB 4DVRL 3NGBC 4KMTH 3F7VA 4LU5H 5C0NC 4LBEB 4OV6F 2DWDB 4F7CB 4WI2A 4TSBH 1WGOA 5EC2B 3KPLA 3GEWB 2XQYG 3QISA 5EORL 4MVBC 3K2UH 1AGDB 2VLME 5E99H 3FHQA 3D3VB 2WBJB 3CDCA 3HNTL 3DOSA 3MO1A 4G6KL 1KCUH 3RWCB 3ZDXE 1T0PB 3ARDA 5IB2B 3K7UA 1I4FB 3VWJA 2P4AB 1S9WA 2YD3A 1AD9B 3KPPA 3QDJA 1JYNA 3DTXA 4UB0L 2WUBH 2CKBL 2B0SL 1EBPA 4IIQC 3QEQE 5CD5C 5HPOA 3O4LA 1S7QB 4HKZA 2CLVB 5EIQA 5ANMB 2X4UA 4JHBA 3T8XB 3P11H 3O3EB 4G5ZH 3TO4C 3VXUE 3T0EC 3K80A 4YHIB 4XWGL 5EU3B 5GGQH 3U0TA 2YZ8A 2VR4A 5EU5B 5GS1B 1TJHH 1SBBA 1UQSB 1OTSC 3VGAB 1ZVSB 2DKSA 3I6LD 5JMOC 2W9DL 4OD3L 3C6SA 3UJJH 4X6BA 3C9NB 2JCCF 1EK3A 4FFYH 3VA6A 4YK4B 4V1DA 2HAZA 4NWTH 2W0FA 4AY0A 2H1PL 2CRZA 1A2YB 4DN3H 3K4AA 2KUTA 3HUJE 2X4RA 1F6LL 1C7SA 1I7TB 1RFDL 2R4SL 5K9QG 1NCDH 3HI1B 5C07D 4D9RD 4LCIL 3O3DB 4YE4H 1HYRC 4KMQA 1IM9A 4IIQB 4OF6A 3WN5A 5L0QB 2AXHA 2D0FA 5DA4A 1IAIM 4ZAKD 1TNMA 2ZG3A 1IGTA 3MV7B 3HAEB 3QI9C 5FGBA 3S98A 5GGTH 4PB9L 1SJHA 4S0TD 1MJ8H 3KAAA 4OBRA 2W65A 5KN5A 5HGDB 3MLXH 1ZLUK 5KJRL 2NCMA 2AEPL 4KJWD 3RL1A 4U2YA 3OZ9H 3RWGA 3E8UL 3KJ6L 5ADPL 1KEGL 4LEXL 4F33B 1T22B 1WZKA 5ID0A 3RWDB 3ULVD 2G2RB 1KPVB 3BX7C 4BYHA 3JZ7A 1QOKA 1D9KC 4EI6A 5DJ0A 3H0TB 4M7LH 1QBAA 2R0ZH 3OKNB 4R7DB 3TVMB 1OT1A 4LHUB 1N3NB 4H20L 5ELIA 2R1WA 4BELD 5E8PA 1NUDA 3FQTA 1IC4H 2VLKD 2KQMA 1YECH 2H8PA 3VFOB 4RQQA 1W0VB 4HKXA 4QXWA 3BKCL 1NEZG 5FO7A 3ARFB 3TPKA 1A7PH 1MREL 3BUYB 3H2WA 4P2RE 3T2QA 1T3FB 2ZCHH 2F74B 4M48H 4G6ML 5DFTA 3GSOB 4U7KA 3WD5L 1PG7H 3DV4B 4WU7B 4X5LA 2Z4QA 2BCKA 1W72L 1BVLA 5C3TA 3V6FA 4JN2B 5D7LD 1HHKA 4AK1A 2JK5A 1JGLH 5MENB 4FZEL 3MODH 2EIZB 2GITA 1FSKB 3HZVA 3D69B 3O4OB 3N1MC 5MERA 4PRNA 1UWXH 4LCWE 5JORB 1KLUB 1MFDH 2LTQC 4XNZC 5JMRA 3S3SA 3O9WC 2FLRT 4PP1D 3T4YB 3DIFA 3MJ9L 5ESQB 5KVDH 1EZVX 3TO2A 3JWDH 1CBVL 4X83A 5JOPD 3UTQB 1K5NA 4BQCA 5F3BA 3WIIL 4HCRL 4TVPL 3LD8C 4F8QA 1OW0A 4F7TB 2LU4A 1CU4H 2ITDB 1D5MB 4HQQL 3CCHA 1IJ9A 2FH6A 5AYQA 1FLRL 2OMNA 1A6WH 3SDDC 3MLZH 3UAJC 3L3HB 4G8FB 4M43L 3S5LG 4XI5C 2HKHH 1MRFH 2FO4B 4M1GH 5SWSA 3AREA 4JZNA 5IHBA 3AC0A 1KPRA 4HIJA 4PGJA 2IPKB 1JNNL 3INUH 4OV5B 1IM3A 4HV8A 1TETL 3E0GA 3RZCA 1FVEB 2DKMA 4XHJD 3CFKB 1P7QB 32C2A 1DE4B 3QFDA 43C9A 3MRBB 3N1QC 5J12B 3T0BA 1G7IB 5EO1B 1R5WB 4DZBA 4ODXB 1OAUL 1LO2H 5ITBL 1D3CA 1A0QL 2BNRE 1CXIA 1BLNB 2BVOB 5HI3C 4WEUD 3KWWB 3AS3A 3QIWD 2GFBA 4LPYA 3EHBC 1KYOJ 1JYXA 4MAYB 1IEAB 4MWFB 3EO9H 3I6GA 3BXNB 1QSEE 1CG9B 2P5EB 2Z93A 3WIFB 3ILPB 3TIDB 5L2KB 1LE5B 2VH5L 1YUHB 1YJDC 2GUOA 4DUWA 3PJSA 4MA3A 1RZJC 2OBGA 4X0KB 1BZ7B 5D2NE 4KY1H 2VXVH 5L7XL 4ZD3L 4M1CD 1IARB 1EJOL 4WHYG 1WTLA 1CVSC 4OFVA 2AK4B 1TVBB 4P5TB 4RMSA 1A9BA 4TRPL 3VI4E 4UNVA 2YSSB 1ZHKB 5HHOB 5C0BE 4X6CB 4C55A 1KIPB 4JO1H 1VESA 4MJIB 1DBMH 4WHTB 2MHAA 4AG4H 3U2SB 3D6GA 1RJYA 4ZDHA 2DDQL 5KS9B 5CS7A 1JPFB 3QIUB 3V6OC 3GHBL 2VWEE 4JFEE 3BPNC 1KELH 1MJ7L 2OJZL 3QDJE 4J3VA 4WI8A 1NBYB 3QG6B 1ZLVK 5AEAA 2NXYD 3QUYD 3KG5A 1UA6L 3VDBA 2IG2L 5IVXA 5SX4I 2FDBP 1WV7T 1KTDA 3RKPA 5F7DB 1AXSB 1OGTB 4JDVA 3KR3H 3GBMH 2Q3ZA 2GTWB 1HILB 4K9EC 4ZUWB 3H9SE 1KB5L 3SOBH 1EH9A 5ISZA 2OYPA 4OLYL 3VW3L 3AB0B 3OKKA 1MLBB 3FTGB 2NZ9D 4V1DE 4MQXC 5T3XD 1SBSL 5HVHC 1G7QB 3GI8L 5I74B 2VO5A 3ZE1E 5GIRA 5DUMH 2YPLD 1D5IL 3BPNB 3JUYA 4HWZB 3EJJX 3C60D 3MLWL 3QEHB 2DD8H 5GS2H 2DJ4A 2O5YL 2BRRH 3MLVL 4CVUA 2AXFA 4PRBB 3GMPB 5C2BH 2R1YB 2IAMB 1PJ9A 3EOBB 15C8L 2J2ZA 4GBXD 6FABL 2E9IA 1RZIA 4XP4H 4WFEE 4I9WD 4HHAB 2YRLA 1NDGA 2VXSL 1XEDA 3W2DH 4Y4HB 4GKSA 3VFVB 1OARH 4B53A 3JWNC 1SJXA 4U1IB 3PDOB 2ARWA 3QUXA 4NNPL 3MRRB 3E6HB 4I5BB 1CDGA 4E41B 1U42A 1MJUL 4X80L 5IW3A 5IB5B 3BZEB 5K93A 5I18H 1K9TA 2ZUUA 1I7RA 5D1ZD 4OZHA 4YFLF 3NBNA 1OSPL 4QTHA 1XZ0A 3SE9H 5I76A 4UAOB 3A0OA 3O8XC 5GRUH 2CUMA 5F9AC 2ZKHH 3G6JE 1GYAA 1PX3A 3DUSB 3CSYA 3H3KA 3EYQD 4DTGH 1IC1A 3CVHA 3WXWL 4POYA 5DVOA 4KTEH 1A3LL 2RCSL 5CEYA 4HGWB 1HWGB 5GXBB 2NXZB 1GIGL 1CS6A 3ALPA 4DAGL 2HT3D 3ET9F 3MSPA 4Z76B 4D0BB 3CFJA 1MF2L 5ESAB 1UEMA 1WK0A 1K4CB 3HPLA 1EBAA 1MHCA 3BWAA 5FCUL 5E8EB 1MFCH 4XMLH 4HWBL 5ETUA 1Q9LA 5J6HB 1IQDB 3KXFD 3MBXH 2D7TH 3WFDH 2EICA 1VGKB 2LVEA 4WV1A 3GJFK 1FCCA 5C7XL 4ZOAA 4OI7A 4YC2C 2P5WD 1Q9KA 3ZHDA 5JW5B 3GGWA 1U8MA 5LGHL 4NBZB 4AEEA 1JGDB 1NGYB 1WBYB 4Y5YB 4KK9C 3WIHA 1RJZB 4XAKD 2HRLA 5LWYL 3EGSA 1ORQA 4EOWL 5I1GH 3O2WL 1YNTB 2YD8A 4X9FA 2JJTC 4KK6C 1VENA 1JZ3A 1IRAY 4BM7A 1YJDL 1KLGB 4L3EA 4LOUD 1RZJL 3HA0A 1F6AB 2OR9H 3QRGL 1FAIL 4Q9QH 4X8JA 3MRNB 1OM3H 3PV6A 3TYGL 1NL0L 4XP1L 5JW4Q 4N9GB 3TN0D 3ULUD 1CYGA 1F3DJ 4MNHA 2DICA 3HC4H 3ARGB 3U30B 2I9LB 3OAZK 1JZ7A 3JWOL 1XGPB 2MKLC 1CL7I 4IS6A 3G5YA 3QWQB 3GSXB 4TULH 2D0HA 5E8OB 2ENYA 1A9EA 2XKNA 4GUPB 4JVUA 3VFRB 5B3NA 4Y19A 3HG1E 3Q1SL 4BSVA 3QCTL 2K7PA 3CC5B 1N5YH 3NCCB 5I16A 4OIAA 5FO9B 4PJ9C 3LQAH 1KJ3L 3TEUA 2OTUB 4G9FB 5DSCA 4EBQH 3KLAB 4YDKH 2R23A 3O6FC 5SWQB 1D5BA 1GGUA 4LNVA 3V7AG 1BWMA 5IOPA 1U8QA 4K9EL 1NCAH 1A1MB 2Y23A 3SKJL 2JJSC 2A1WL 4L4VD 4HT1L 2PR4L 1U2HA 4NO5B 1YC8A 2D31B 1EAJA 4N0UE 5CEXA 1IILE 5DT1H 5I1DA 5E2VH 3BH9B 3DUUB 1MCOH 4Y5VA 4WW1A 4K7PX 4DJMA 1AXTL 3IKCB 2XTJC 5J11C 4NNYB 1CT8A 1S5HB 3RVUD 4Q0XL 4MQ7A 4LRIA 4WFGE 2MMXA 1CFTB 2VB5A 4X4ZA 2PO6D 4R96A 2FD6L 3B83A 1AQDB 2ZJSL 3IFOA 5HHNA 1EZVY 4CVXB 3DRTB 3FCTA 1N7ML 4B50A 1KCRL 1QSFB 4L1HA 4XTRC 1ZT1B 4J2XA 3ZYJA 4AQ1B 4XVUC 4TSAH 1I1YA 2OL3B 4YGVA 4R97B 2H9GB 3QA3A 1LO3L 2C1OB 4RMRA 3PGDB 1AR1D 2HTLC 5DJZB 1UENA 5L2JB 4OGXL 4UQ2A 4NO0A 4OCRH 3C5ZD 3UBXI 4HUKB 3B43A 2IPTH 4NUJA 1FC1A 2CLZA 3SCMC 1ZT4B 5CUSH 3O81A 1HHHA 4FTVD 2E3VA 4G42A 1ZGLA 4XCNB 5D93B 1IEBB 2EC9U 5IESH 4RAUA 3T65A 4ETQA 4Z7NF 2CPCA 1X5YA 1FIGH 4RMWA 3SGEH 3L3KA 3AMKA 4BFEA 1QYGL 4PJ5A 4WCYL 4U1SB 1G7JA 3K8LA 4QRRB 1HYSC 1CVRA 3S88H 4NFBA 4PJDB 3MBED 4HKJA 3SHSA 4OLWL 4LMQI 4Y1AE 1MVUB 1QFHA 3CXDL 5ICXB 2GJJA 1MCNA 2B2XL 4Y16C 2VN7A 3BP6A 3S7GA 1K4DA 3FHAA 4Z7WE 3QH3B 5FOJA 2HJFB 4OFPA 1KJ2B 1OPGH 3U79A 1AKJD 2HLFC 5C1MB 1OB1A 1RHFA 4HK3J 1AJ7L 1CF8L 3DBXA 4NHUB 3DX7B 1KCVH 2NR6C 3MXWL 4I4WA 5TDPA 1RZGA 1G0XA 1CD8A 4LVOB 4OAWB 4JHAH 1XF5B 2CDGA 4K3JH 4EN3B 5GJSH 4NSKA 3DMMD 4NQVA 4DKDC 4KKCC 4XBPB 5M7QA 3R8QA 3VXMA 4DFHA 3W0WA 3KYMA 3FT2A 3KPSB 2HT2C 3JBG7 2Q7YB 4PJXB 5IBUB 1T1XA 9CGTA 2WUCH 3T0VA 5D1QB 1IGJA 5C09D 3IDNB 5FUZL 2HRPL 4GH7B 1EJ6A 4QT5A 5CMAB 3MV9B 3FOLB 2XI9A 1CXEA 3Q6GL 3ROOA 3QNYB 1GH7A 2E8YA 1CLYL 1OGAD 5JLZA 4P3DA 4UBDD 1T89C 1N6VA 3QXVA 5TF1L 3VWKD 2DM7A 1B88A 5DK3A 4HMDA 2BOBA 4ONFL 5CBEB 4MDJA 2J1KA 3HS0B 5IHUH 5HHQB 1MAML 2ARJQ 5BS0A 5ID1A 4JFDA 2W07A 4QRTA 1RUPL 1T6WA 1UH2A 2ED7A 4CBPA 4CMMA 4JZOA 3GHEL 3MLSH 3MREA 3S35X 1TQBC 2B5IC 1KTRL 2PYED 4GMTH 5D7IA 3BZFA 3LCYA 4PJXF 5FA4B 3BYTA 3KYOA 3P0VH 4PJHA 5BJTA 3TBTA 1XIWC 4BQBA 5FYJD 1NGWB 4PLKD 3CMOL 4OZGB 4OLUL 4L4TA 4MNGB 2XZQH 5DEGA 4ZOCA 4MCZB 3OKOB 5I1LA 1JUFA 5AAWA 5IT2L 3D0VB 5JR1H 1SY6H 1E4XL 1XGRB 5CCKH 4RRPG 4U1NA 3LQZA 2G5RA 1D6EA 3MOQA 2Q3AA 2I60L 1UKTA 2X1WL 4JDZA 4NC0B 4U1MA 3IFNL 3TBWB 1L7TL 1YYLL 3BDYL 4NQTA 3RIAF 4JQVA 1I1AB 1E27A 2DL9A 2ITCB 2R2EB 3MJ8A 3PL6D 4Y8DC 4CRPA 4ZTOH 2B5IB 1G7MA 4DOHE 3RTQA 4HUNB 1U93A 3MLYL 5E1HB 3J8F7 3RJQB 1XGUA 5BQ7B 1Z9LA 1F4YL 4PRDA 1VA9A 4I2XE 5C0AB 2XZCL 5F1SA 2VXQH 3IETB 5EORH 1HXMA 5J1TC 5D5MB 3QCUL 2R0LL 3QDGB 2V5SA 1FORL 1GZQB 3B3IA 3HTLX 4LSVL 1ZTXL 4ZFFB 4XNYH 4HF5L 3MFGB 3QXDA 3WKNA 1LP9F 1DQML 3PWUA 5KSAB 1AHWA 1ZSDA 4OT1L 4LLWB 5EIIA 4XZUB 4HIHA 5I8CA 1GGBL 3CIQA 2IANE 4FZ8H 1EFXB 4XX1G 5IFHL 1P4BH 2NX5D 3DGGB 1JTOA 1T66C 1OCWL 1QA9A 4K71B 1ZHNB 3SDXF 3PWPB 1KF9B 4Y88A 5ESVA 3WEXA 4XBGB 2E7MA 4NNXB 3VFUA 4OGAC 2GJ6E 2R0KL 4MZ3A 1D5XB 5JDJA 5BOZG 2VLJE 5TDNA 3UMTA 1VFMA 2YBRA 1UWEH 4M8VA 3WMSA 6CGTA 1EEYB 1GJIA 1UB5B 1W8OA 5J57B 3MOAH 4X6FA 2HJLA 2ADFH 4H1LG 3VXSB 2M8XA 1U8HB 5HYSB 5I73C 4AT6B 4OSUH 2AJSH 1RFDH 3MGTB 4GKZB 5SWZA 4QRUB 1K3IA 3P9MB 1XFPA 2VLRD 2QQKH 5BZWA 4AH2A 2YMXL 5JTWA 1YEJL 2G75B 3MLPA 2L7UA 4KKNA 4LBEA 4L9DA 3QJFB 4YUEH 5E03A 2DWDA 4Z77A 1LK3L 5DHVB 2XPGB 3ALWA 4YIQB 2CR3A 2EKSA 5DJCB 4F7CA 5FHAL 2AVGA 3WUWG 1A7BA 1LK2B 5B8CC 4I1NB 2R1XB 1BD2A 2NY5C 5D6DA 1IGFL 2PXYA 1W72A 2B1AL 4RWYH 2JCCA 3C2AH 4CKVX 3W39B 1R3IH 1IEHA 3ARUA 5JQHC 5EA0H 3PUCA 3VFNB 1SVCP 4ODVL 5IB2A 4LRNL 3T2NL 4I0PB 4KC3B 5F9JB 3WHE0 4RISH 2PCPB 4LNRA 5C08B 3QDME 5IK3B 3V52H 5JA9A 3MJ9A 4K7PY 2ZUWA 1M6OA 3D2UD 3PF2A 4A6YL 2VZOA 2EDOA 3OG4B 2EH8L 5ANMA 3QFJB 3LKNB 3T8XA 1MHPL 1X5ZA 3O3EA 5I9QC 4X6DE 5CD3A 4YHIA 4EUPB 5C0GA 5EU6B 2BHZA 1AY1L 2IPUG 5B8CB 5B39B 1Y6MR 2BVPB 4PV9A 3W0WE 1QLFB 1RIVH 4LAJH 3FMGL 4XBEL 3NCJH 5IFJB 3U36B 1HCFX 5TH2B 4HUVB 4YAQA 2XT1B 4PJ8C 3NPSB 4XNMB 4PD4K 2IQ9L 3B9KC 3IT8D 4Y2DC 1AGCA 5L9DL 3RDTB 2P24B 1OSZB 1S78D 3OKDA 4IIQA 1IAMA 2BNQD 2XWTB 4LIQL 4PTUB 5TE4L 4UIKL 2FR4B 4JRYD 1AD0B 3KPOB 2ZOKA 5EOTB 1ACZA 1DANT 3MV7A 1BF8A 3TO4A 1KJMA 4X99A 2UYLA 4ZSOB 3TESA 3T0EA 1A5FL 4QO1A 5FB8B 1SJVA 2F8VA 3MACH 1J7VR 4M43H 4KUZL 3G5ZB 3TGXA 4N8PA 1CE1L 4M61A 2Y72A 2MPAH 3KNBB 2ARJB 1T1ZA 4NQSB 4F33A 3ARBC 5TPWH 3REWB 4D8PA 4ODTL 1CFSB 3BEVB 4S2SA 3EO0B 2E27H 4GRLC 1KJVB 4Y89A 3KPNB 1YMMD 1ZOXA 4L4TE 3V5HB 1N3NA 3CPLB 4HWUA 1HI6A 5DVLA 3NCBB 3WHXB 1FZJA 2PN5A 4BZYA 4LARH 4P2OC 1U3HD 1MI5B 2I9TB 4R26L 1CGYA 4F7MA 5T1LB 1B2WL 1CZ8L 5HPMB 4QGTA 3QI9A 4NIKB 1EGJL 4NGHH 5I75B 5T3ZL 3GSOA 5F6IB 1G6RB 3DV4A 3TCXA 1R24B 3FQRB 3MRJB 1DLFH 1FGVH 3X3GL 3C87A 1IGIH 1DL7H 3QXWA 4YXKH 2VXUH 4H26A 5E6IB 1CDUA 3WNKA 5HGBA 5JIIA 5MENA 1JGEA 2EIZA 4AL8H 4TPRL 1J8HD 5IMLA 4ZD3H 3WE6B 5KSVB 4IRSC 1EHAA 4HS3B 3MA7B 4GRLB 1LEGA 1D9KA 1XF2A 4HS6B 2OP4H 4GW1A 3PHSA 1VFAB 2K3TA 3IFLL 2MWCA 5J56B 3Q5OA 3FFCA 1YNLL 5IB1B 1ZT7B 3PABA 3LRSB 1CFNB 3MNWA 4TTDC 2HLAA 1U8LB 3LB6C 3IAPA 4MNQA 3RKDD 3O0RH 1DEDA 4Z0XB 1CWVA 1KULA 1QFOA 2DIJA 3BRDA 1AGBB 3SQOL 5GSVA 5HHME 3MLRL 25C8L 2YWZA 4QRQA 3O11B 1WF5A 3U4AA 1GHFL 2YKLL 1JN6B 1NFDE 2ITDA 4MXQC 1D5MA 4HMCA 3F12B 3RU8H 1U8KB 2NY5L 2CRMA 4QHNB 3WLWD 3MMEB 1JWUB 2IG2H 3PP4H 2A9MH 1OQXA 3I2CH 3P4OB 4WTZG 1QRNB 1NEZA 1MFBH 2ENSA 3S8WA 4P2QD 3CFKA 1DE4A 1DSFL 2Y1VA 1DUYB 5GRJL 2VXTH 4FFWD 1R5WA 3A6CH 1FFOA 4P23B 4NWUH 4DGVL 1D5IH 5AAMA 1JI1A 3SN6N 3OR6A 4L8DB 3IRZA 3SDDA 5F8RC 3SE3C 2P5EA 1CG9A 2E7CA 1ZS8A 3WIFA 3OJVC 1F58L 2D3VA 1GGCL 5L2KA 4RGND 1H8NA 2HKFL 1YUHA 1P84K 4O2FA 1NCCL 1BZ7A 5EZIL 1YDPB 3TZVD 3T3MF 3OBAA 4U6HA 4BH7B 1BQLH 3KDMB 4X9BA 3E2HB 5TQ0L 5GGVY 4WW2C 4XPFH 4XVTH 4HWBA 3D0LB 3CFEA 4MB5A 5T1MB 5GRWA 1TVBA 3IDGA 4GQ9H 4C56B 5HHOA 3P73B 1Z3GH 3S5LA 3D3VE 2GKIA 4LEOA 1I9IL 1TDQA 3U2SA 3NA9H 1PKQB 5J3HD 5GJTH 2GIYA 5FUOL 1UWXK 2NY3D 4L9LC 3IJHA 1ES0A 2RCSH 1VDGA 4KHXL 1YN6B 4PGCA 3G08B 4UDTA 3MRPA 1J0KA 2R69L 1NBYA 4NYLA 4N90E 4FQLH 5EZOL 3U6RB 3MOBH 4JANA 1P4IH 5C0DB 4ZAKC 4PBXA 5ANME 1P69B 3M1BA 4ODSH 4ZFOB 3S97C 3CZJA 4LSQH 1AXSA 4Z7VF 1GPOH 3ABZA 3C5JA 2ZUXA 1NGPH 2GTWA 3MXVH 4K23H 1I1CA 4D9QD 4Q2ZB 4KJWC 1MCDA 3L3OB 5F6HJ 4KRNA 1KB9J 1CLZH 3ULVC 3VE0B 1JZ4A 1T1WB 5HYJD 1BVKA 3V6OA 3WNLA 3MQIA 3UJIL 1BQUA 4F7EA 4LLAA 4F37F 5GGSY 5IUSA 4XCCH 1NLDH 4PJBB 5KVEH 4YHZH 4HH8A 2X42A 5C07B 4N1EA 4LCCC 5C6WH 3GIVB 4P46D 4S1QL 4J3UA 5BV7B 3ILQD 5EOCH 4KK8D 4FQJH 4ZAKB 3MV7E 1NL0H 5F96H 3EOBA 1XGYH 2Q8AL 2D03H 4XH2B 2N7AA 3VFVA 1UM5H 4F7PB 1RURH 4WW2F 4ZYKB 5L6YH 4HZLB 3GMOA 5CSBA 3MRRA 4YHOL 2X2YA 3I9GL 5DR5L 1ZVHA 5IP4A 3V5DB 1JZ8A 1FYTA 1KGCD 1R0AH 1O0VA 2WP3O 4QXGH 1ETZA 1ZEAL 3BZEA 2XNAA 4E5XB 1HQRA 1X6LA 3SO5A 2D2OA 4NKMB 1NQBA 2H3NB 3QCTH 4M1DH 4IM8A 5HGGS 3MC0A 3ES6A 3UTSA 2WIMA 4I0CC 3SDCD 1DCLA 1MIEL 43CAA 1EHNA 4PP1C 1EV2E 1H15A 1NCUA 2R2BB 2EDTA 3QUMB 1Y18B 2VLKB 2WQ8A 4GG6B 4K8RD 3RNKB 1IBGL 4NJAH 4RFEA 4Z76A 1JNHA 1C5BH 1TFHA 2Y7QA 3EYSL 1LDSA 4O9HH 1F3RB 2WSKA 4UT7H 2VSDA 4DW2L 1K4CA 3LHPH 3TA3B 5ACLA 2BMKB 3DXAD 1DN2A 4JFHE 4LSTL 35C8H 2Z31B 2Y4SA 1KIQA 4EXKA 4P9HC 2O5ZL 4KAQH 1VGKA 4DKFL 2EXYD 5IJKA 4QYOB 1P6AB 1WZ1L 1T20A 2JF1A 2DQDL 1AXTH 5MENE 4XPHL 3KPRB 2BC4A 4FQQB 3ULVF 1UYWH 1J10A 2Y36H 2LABA 3AUVA 3MLUL 1I1RA 4XHJC 3O8XA 5LQBL 3BIKB 2N1KA 5CBAB 2R8SL 1OF2A 3G5XB 1XGQB 4NT6B 1YNTA 1Y6NR 4U6XB 2VKXA 4FQXB 3KLHD 4MJ5A 3T4AB 1A1OA 2Z8VC 4GW5B 2YR3A 2A6DB 2NY2B 4JM2B 2X4TA 3QIWC 4JO3H 1CGUA 4DCQA 5IMOB 2EXWD 4N9GA 2FYYB 1AI1L 4FNLH 3S96A 4HZAA 3DRQA 2I9LA 3RWIA 1OL0A 4LSSH 4MB3A 2C7UB 1T7ZA 3BP5B 4JFXB 2VUYA 4JGJA 4U1GC 3ARXA 1U91B 1BQHG 5E8OA 2CKNA 4EDXA 4YXHH 2VIRA 4GUPA 5DRXA 4M1CC 1WBZB 1YQVH 4OTXL 2VDPL 5I8EA 3WHE1 4HFUL 1JRHH 4S1RH 4S1DD 3CC5A 5SV4A 5D72L 3BAEL 2JJTA 1ZV5A 3DUHA 3MUGB 1NPUA 3P4MB 2OTUA 4S1SL 2G60H 1EVUA 3PV7A 4S0SD 3GMQA 2J4WL 3BKYH 4I3GA 4QY8B 4ZUSA 1FGNH 3HI6L 3VFTB 3CUPB 3VFGL 2APTA 2QJDA 4C54A 1JF6A 3BT2L 3U4BL 2Z92B 2P5EE 5LBSH 3MXWH 2D31A 4K7PL 2NXYC 3QUYC 5DI8B 4P5KB 5L2KE 3ULVL 3DUUA 4XMPH 2EYSB 4ODHH 2AGJH 4K7FA 4U1GB 1RU9H 2MQ0A 5D1XD 4NNYA 4ODBD 4KROB 3P4LA 4YDIH 1CFTA 4QHKJ 3WS3A 4EZMA 3K0WA 2AK4E 4JPKH 3UC0H 5CSGA 3VJ6B 3ZDZF 1BIIB 2QQNL 2Q6WA 2H6PA 5HHOE 2VL5B 4X6CE 2X89A 3BRGC 1XGTB 4PJ9A 1JIBA 2DIBA 4MJIE 4P5MA 1C08A 1FVCB 1ZT1A 4TQEL 2FX7H 2NZ9C 1JPGB 2OL3A 4NQDA 1YPZB 4M93B 4ZNCD 1UH3A 1PD6A 2C1OA 5KS9E 1HQ4A 3NTCH 2F53D 3ZTNL 3UTTA 1FBIH 3WNOA 3B9AA 3C60C 3O2VL 4PJCB 3MR9B 2JJSA 1UXWA 1ZT4A 5C0CB 4LPTA 2XQBL 3MRCA 4P4KC 4MMZC 2DQFB 4I48A 4XCNA 3BPCB 5ACZA 1IEBA 4GBXC 2X1XR 1OD9A 5D7JB 3GSWB 1MAMH 4PRID 4AMKH 1RUPH 5AUMB 3HPJB 4R6UA 4KVNH 5HHXL 4QRRA 2E8ZA 3BZ4A 2Z0BA 2OL3H 4UU9A 5INDB 3HB3D 1JYVA 1MVUA 4O58H 1IGCL 3LS4L 2XKUA 4QEGA 3GSUB 3O3BB 4EEEA 2DLHA 2RHEA 4FQHB 3CX2A 1NMAH 2YPLB 1I9RL 2FHFA 3EYQC 4P9HL 2HJFA 2XXMB 3K2MC 4UT9H 5DD5L 1J8KA 4JFFA 4IRJD 4OJFH 5D7KE 3SCMA 5AG8A 5KVFL 1U9KA 2FX8L 2HT3C 4LDLB 4X6EB 1J1PL 1RZFH 1QFUH 2GCYB 4X7SH 4HJJL 2WINA 1X7QB 1FPTH 1MPAH 3HLAA 4GBXB 1XF5A 2COQA 4EDWH 3T1FB 3UBXG 2X70A 3SDAB 4XBPA 5E9DA 2B20A 5D96C 4DUVA 1S9XA 4JN1L 1V3JA 2CIIB 4E41E 2IGFL 4H8WC 1GZPB 1J1XL 4PJXA 3A67L 5GZND 2V7NA 2AP2A 5A43C 1N5AB 2GY5A 4Y16A 5D1ZB 4HDIB 3ETBF 1KJ2H 2YA1A 2BSTA 3B6SA 2WV3A 1R6VA 5ALBH 5E8NB 5CMAA 1F45A 4O4YL 4ZMAT 2DIAA 3MV9A 1FJ1B 1YY9D 3MNVB 4IMKC 4WNQA 4KFZC 3UPRA 5DVKA 3TCLB 2Y9RT 2NY1D 3WFBL 4ENED 1AFVH 4LOUC 5DRWB 5JOEA 3AXLB 3B2VL 5CBEA 2XKSA 3LV3A 2EC8A 2YPKB 3MRGA 3VXRA 5IG7A 2FJHB 5L88L 1JGUL 2WQRA 3MV8B 1GGIH 4N8VG 1Q8MA 2ADGA 3TN0C 3ULUC 3LY6A 5E5MA 5BMFL 3S35L 1YEGL 4KWUA 5IFHH 4JFZL 5JXED 3FO2B 1V8HA 3IDXH 3RBSA 3V0VB 3VXNA 2VJXA 1RSFA 3NH7H 5FA4A 3HZYA 3HRZB 1XR9B 3SJVD 3W11D 1FVDB 1SQ2N 4H25B 2H2PD 3PGFL 4LKXB 2ZCLL 1U58A 2V9QA 4JY5L 1UZ6E 1A64A 3VG0H 1FL3B 2AEWA 4HAFA 4JJ5A 1JWSA 4MNGA 5H2BB 4QF1A 5C9JB 4Q97A 2GTZB 1FZMB 3O2DH 4PGDA 4MCZA 4X7EC 3L9RA 5I15L 1IQWL 2FHBA 3GO1H 3FRUA 1EHLH 4PGEB 1HNFA 3O6MH 1LP9A 1ZANH 2EDQA 4TYUA 4PRAA 4X7TB 5DUBA 1G9NL 3PWLA 3HC0A 3MRMA 1G1CA 3TJEL 3VFSA 5J1AB 5KG9A 2UY7A 1YEJH 4QOKB 2O5XH 2RBLA 2X4NB 1LK3H 5T3XL 5A2JH 3HMXL 1RZ8A 3SDXA 1NUFA 3NABH 4PJGB 5IGXH 3KVQA 3RVUC 4RGMC 1XIWA 1TITA 5GGVL 5E8DL 5C0AA 2PO6C 2AJXL 3K3QA 1LE9B 1Q9OB 1QACA 3BEWA 4IHOA 1R3JA 2NY4D 3ISWA 4CN6A 3QDGA 2LU7A 3HE6C 2VDKH 3FO0L 4G9FE 2CUIA 1ACYL 5I66B 5D9SA 4LCYB 1S7XA 3I02A 5JHDB 4Z7UF 5K9KA 1FFNB 1FNEA 3VFWB 1AR1C 4G43B 3GDBA 4XZUA 4E0RB 3C5ZC 3ULUF 3UDWA 5I1HL 3OGOE 1PEZA 3BO8B 4K2UL 4QHLA 2HFEB 2ICWJ 1SJEB 3WXVH 3DGGA 4BFIB 1PSKL 1EXUA 2FLBT 1ZHNA 4RGOH 4Z7NE 4RRPA 1A7QL 4XBGA 2LAGB 1AY1H 4GRWB 2UUDH 5IIEB 3RVWD 4JQXC 4UQ3B 4EXPX 1LO0L 4U1LA 4M7ZB 2WBWB 4ACPA 1RJLB 5T1KD 1QSFE 3MBEC 1BQSA 1UB5A 4NZRL 5TDOB 3D85D 4EI5D 1TQCB 1MFEH 4GRMA 2DQCL 4YFDB 5E4IA 4PJEF 2JJUA 4J4PA 4NN7B 1NMBL 4AEHH 1KN4H 3QUKB 4OFYA 4QRUA 1F6FB 3BD5A 1A4KB 2IFFH 1WFNA 5ADOL 4H8WL 1G7HB 4M03A 5J9PB 2G75A 1E4WH 5FK9B 5HGAB 1WWWX 3MUY1 5DC4B 4FFZH 5F21B 1A7OL 1CE6B 3ELAT 4YIQA 4Y0GA 5JW3H 2A6KB 3UTOA 3DMMC 4MA8H 2ZZUT 2GSIA 2R1XA 4QRRE 5IM7B 3KLDA 4PJDE 5IMMB 4FQCH 5IQ9B 1M7IB 2VLLB 3IXTA 1UVQB 2EH7H 3MBEB 1UWGH 1UGNA 3UO1H 5DEFA 3IF1B 5F1NA 2FIKB 4GS7B 1JK8A 1J1OH 3CSBA 1X5JA 1YEKH 2WMPA 1OAZH 4W6XB 2YD4A 4R2GB 5KOVC 2YS4A 3UEZA 1TJGL 5IK3A 1IL1B 1NFKA 4UBDC 4WHCA 1RUAL 3NZ8B 5DHVH 2EDNA 1Z9OA 1KT2B 3IU4L 3EOAB 3VWKC 1M71A 4YHPB 1DVFD 3OAYK 3QFJA 3IDJB 3H7BB 4KZDL 4GXUM 4Z8FH 4NQCD 5B8CA 5JPMB 1L9MA 2DM3A 2VL4A 4PJIB 1SMOA 3JSSA 2VDQL 3DARA 1QLFA 5DD1L 3G9AB 3KPSE 3WO4B 4AENB 1YNKH 2VAAB 4G8IB 4PJXE 3SQBA 3U36A 5DWUL 4G8GA 3JV4B 4F15C 4WU5B 5TE6L 5KSBB 1S7VB 1UM4H 1ZKAA 3WFHA 3FQUB 5CHNB 4W4OC 4PLKC 3MV9E 4CADB 3WUWA 4JRXB 2BERA 3QO0B 4LVHB 2CH8A 4KUCD 5DTFB 1AR2A 4BUGA 1VFBA 4DN4L 4NBXB 4LGSB 4R8WL 1UB6A 2FR4A 1UACH 3KPOA 2YKLH 5EOTA 5C9KA 4Q6IB 2NY0D 4HH9B 1DZBA 4ONGL 3SE4C 5FB8A 5BRZA 2FBOJ 3PIQA 1DBBL 1QSZA 3AM8A 3BGAA 3G5ZA 5K33A 4HIXL 2I5YH 4L5FL 2CJUL 5T5FL 3IGAB 4Y4KB 3PL6C 3UP1A 3TBVA 2ARJA 4NFCA 4X7FC 3REWA 1NC4B 3O3AB 4YXLH 3VGFA 3BEVA 1S7SA 3EO0A 4U0RB 3AFLA 5EB9A 4OD2B 4PJ8A 3RUGB 3QQ3A 5CILL 5C0JB 3MRDA 4OZGE 2B4CC 2W91A 3B9KA 4MNGE 5CGYD 5GRJH 5EBMA 3SO3B 2DQIL 1RK0B 4Q9CA 1SYSB 2ERJB 3MRFB 5FDWB 3DVIA 1MI5A 5C0ND 1MNUH 3IFPB 3IYLW 2QADB 4BK4A 3VGDA 2X4QB 1TZHA 1NKOA 1FRGH 2YUXA 5EZJB 4YBQD 4XP6H 1TVHA 4UV4L 5FHBL 1XF4B 1T0MA 1P84J 3QJHA 4XPTL 1K2DA 3QHTC 2F54A 3MRLB 3PL6B 1DBAH 1IC7L 2CUHA 3U0PB 3ARBA 5EZIH 4NP4L 2ESVA 5HDQH 3IS0X 4BA8A 4FMFA 4GSDL 3WE6A 4GRLA 2WIIB 4PJAB 1IZJA 3QEQD 5I19L 1A6UH 3QZWB 5FYKH 5C0AE 3GM8A 5EUKB 3NFNA 1MHHA 5E2TL 3U46B 3HE7B 2BVTA 2J5LC 1GC1L 2CGRL 2V7HA 5D5ME 2WP3T 3VXUD 5JPNB 1TCMA 1EPFA 1ZT7A 3MV11 3DVNA 3NCMA 2BDNL 3QDGE 4P2OA 1MEXL 2YD6A 4M7JL 4I13B 1CN4A 4RNRB 5E0QA 4PRHA 1G6RH 3L5XH 1LDPH 4KRMB 3SGJA 1CDJA 5F7HA 3U83A 3RWJB 3TT1H 1MY5A 4JKLA 3SGDI 3MMEA 4N0FA 1OTSD 4Q7DA 3TBYA 5E2WL 4F57H 4JB9L 5HYQB 1LD9A 4FQIL 1G7PB 2KBGA 3PWPE 4CN1A 4IRSA 4PJAF 1OAKL 3OHXA 2AJUH 3FB7B 4JPVH 4QTIH 2BVYA 2J8UB 5T1DH 3CFBA 1HSAA 2FSEB 1DFBL 1KTLA 2HFGL 3WBDA 5GGRY 4OB5H 1H3XA 3SDYH 2FRGP 4P23A 2F58H 3VXSE 2A6JA 4WWKB 1PW3A 3TYFB 3VRLF 4C57C 1DUZA 2OZ4L 2SEBB 3F7RA 1I3RA 1U8OB 3U0WH 1R5IB 1CQYA 2XQYK 3IDYC 1OP5H 2F8OA 2Q86B 4HC1L 3MFFB 5FF6B 1H3PH 1ULVA 4UNUA 1SMAA 4OZFG 4UTAH 3T77B 2OR8A 1NGQL 4M5ZL 2XRAH 2H26B 4W4NA 1WAAE 1KXQE 3OKMB 2P48B 4YNYB 2RJMA 4HWEL 5FM8A 4PP2B 1UC6A 4MXVF 3L5JA 2J88H 1QLRA 2Q8AH 4XP9H 1X5FA 1MCLA 4BZ2L 4F58H 4BH7A 2IBZY 3QO1B 4GKNA 4Y4FB 4Z7VA 1VPOH 5FO8A 5IFAL 1J11A 4Z78A 5C0IB 3HZKB 4O00A 4P2RD 2FL5A 4YO0B 3B9VA 4TUKH 2JIXD 4XPGL 2ILLA 4DVBB 4BFGA 4F3FA 4Y5XC 1RV6X 3GSNL 4UOW0 2P8MA 1V7MH 4CNIB 3MUJA 1HE7A 3DLQR 4HGMA 4WTZA 1N4XH 3HFML 3ZYZA 3LEYL 4WFHE 4H88H 4NCC2 3QAZC 1YN6A 5IMKB 4LCWD 3STZB 5C08E 2OXGA 3QP3A 3U4EB 5F88B 1Z2KA 3LKOA 3SE3A 3QCVL 1S78C 1F3JA 3E3QE 4UIMB 3C8HA 4GG8B 3OAUH 5E5RB 5C0DA 3QFJE 1QBMH 3RL2A 1XMWA 1A8JH 4NZDA 1PYWB 2B4CL 4ZFOA 1ZA3B 5HDOA 5EU6E 3P9LB 2MCPL 4WW2A 1IT9L 3O9WD 2A9NL 5HBBA 2O61B 4OZFB 5D8JH 1C12B 1I8KB 4YDJB 5DJ2A 3VH8B 1NBZB 3VE0A 1YEDB 1SEBA 4G8EA 3X13B 4APQB 1AGFB 2I07A 3FT4A 5JUEH 3PP3H 4L9LA 1QTYT 1ZWIB 3FO9A 3TT3H 5EO0B 1B0WA 4XXDB 3QAZB 1Q0YL 1JV5B 2EE3A 2VZVA 4PY7B 5C07A 3V4UL 4Y2OA 1F4XL 4PR5B 4C58B 1OAYH 1S7TA 4WI3A 1U3HC 3F7VB 4LL9A 2Q8BH 3OGCB 4ZAKA 1N6QL 1JHLL 4OLXH 2C9AA 1ZK9A 1L9NA 3GMNA 4XH2A 2C26A 4ZSOE 4QXUH 1RUQL 4XNUH 3GIZH 2BNRD 3OXRB 1RJCA 1T2QH 3MV01 4OD1H 4B7IA 3RHWK 4N0CC 1QNZL 5FV1L 5I1EL 1E6OL 3V5DA 1J0HA 4GFTB 3HR5B 1JI2A 1UKQA 2ATPA 3LH2H 4HPYH 2BSRB 1QSED 3NOIA 3MO1B 3CLEH 4ZFGH 4OM0L 2NZIA 4MDIA 3ARDB 4CL7A 3ZZ1A 5FYKE 5BV7H 3VWJB 3BAEH 1S9WB 3GI9L 2VLKA 3KPPB 3RKDC 4JFOB 4X8XA 1BFVH 1MI5E 1PLGL 3DSFL 4MMXC 3WJJC 1JYWA 3O4LB 2VDRL 1DP0A 3QIBD 5C0BD 3FKUS 4HKZB 4TUJA 2X4UB 4G6FB 4IJ3C 3PE9A 5EBWA 3RA7L 5EUOB 3U0TB 1NANH 3WLWC 4JFED 1K8DA 3W5NA 1OAXH 5JXAH 5D7LA 3N9GL 5J1SC 3C6SB 3LEVH 5FAAA 3BP4A 3G04A 4LFHD 4P0DA 1J8HB 5GISH 3QUMH 1CXFA 4RIRB 2X4RB 5ITFA 5CBAA 4FFWC 3JTSA 4LASH 3H9SD 3WL9A 3WN5B 3HC3H 1ADQH 2O26U 2VDLH 3OB0H 1FL6A 1IGTB 4PLNC 2FEEL 5DRZB 4WGVB 2EDJA 1SJHB 4J6RH 5IMOA 2W65B 5KN5B 5EUOF 1FO0L 5DJ6A 4OCYH 1I9JL 4YPGB 1ZXQA 5F44A 3RWGB 3BP5A 4OLVL 1KCSL 4JFXA 4ELMB 4O5LL 4LSRH 1L7IH 2FB4L 3BKJL 4RGNC 4G7VL 3X14A 4BZ1L 1QRNE 2UVEA 3EOYG 3PG2A 3TZVC 3RX8A 1ORSA 4JPWL 4EI6B 4I77L 5DJ0B 1WBZA 2QV2A 2DS4A 4P2QB 5TGBA 3ESVF 5B4MD 3TPUA 3AS2A 4H5SB 4D0CB 3WSQH 4WFED 1WWBX 3FQTB 2AEQL 3FONA 1QO3A 5DJAB 3S3JA 4DEPB 4RQQB 4HKXB 4RBPK 1OTTD 1T1YB 1Z6JT 5FO7B 4R7NB 4URTB 1X6NA 1WCBA 1J0YA 2FX9L 2NY3C 3GB7A 3K8KA 4DWHA 1PZUB 3QIWA 3NIFE 2AXGA 2Z4QB 4O02H 2BCKB 2Z92A 1BVLB 3GKWL 2GYSA 2JELL 3T1WA 4ELMF 4P5KA 1HHKB 1INQA 2JK5B 1DQLH 2GITB 3HZVB 4D3CL 5MERB 2PTVA 4OIIL 4OCSL 4XVSH 4GMSH 1IC5L 3VJ6A 3C09C 4XC3L 3DIFB 4C56E 1XGTA 1ZVYA 2DM4A 5CEZL 1PKQE 4Z7QE 1FCGA 4KTDL 5F3BB 2QQLL 1YPZA 1FP5A 2CXKA 3F62A 1CICD 1BQHA 1MCSA 3EZJB 4P3WA 5DD3H 5IB4A 3LS5L 2DM2A 3CCHB 4YDLB 1JTTA 3GMLA 3DPBA 1BBDL 3LMJH 5SWSB 3ILQC 2J8HA 2L0DA 3QUYA 3FB5B 1NGZB 2DQFA 1EERB 3AREB 4JZNB 4KK8C 4XPAH 4JHWH 1B9ZA 3BPCA 4OQTH 3JTTA 4PS4H 2GI7A 3P77A 5L88H 1N6UA 2PF6A 1IM3B 4HV8B 4PV8A 4KK9D 3S35H 1YEGH 3IS1X 32C2B 4R4FH 3HPJA 4D2NA 43C9B 4FXGA 4PJFF 4M6NH 4XP5H 5EC1A 1S5IL 2IJ0C 1F42A 4PPTA 1M05A 3PGFH 5DLMH 5GHWH 3QHFL 4OGYL 3O3BA 5HYJB 3OKYA 2MCG1 1WIPA 3IRPX 1WQVT 1J9CT 3SDCC 2YPLA 2X1PA 5ENWB 1ERNA 3DYOA 2GFBB 5E6ZA 4WI7A 4PJBE 3C60A 1IQWH 4LDOB 3HG1D 4K8RC 3I6GB 4P46B 3MZTA 2GCYA 2XZAH 3GRWH 2GUOB 1N64H 3R06A 4HUWA 1A7RL 1HINL 5KANG 4GBXA 3QUZD 4JKPH 1CGXA 4ZQKA 3T1FA 4WDIA 1DDHB 2R4RH 1RZ7L 3NACL 2PTUA 1A9BB 5T3XH 2NW2B 3O6LL 3BKMH 4HLJA 4XCFH 3THML 5I8KH 2BZDA 2I24N 1CIUA 2DOCA 2MHAB 5HDLA 2AV1B 3L3GB 4HPOL 3S37H 1N5AA 1HZHH 5D1ZA 1RJYB 4ZDHB 3M8OL 4MA7L 5E8NA 4JVWA 2Y5TA 2AERT 4HGKC 2VLKE 4WFGD 4GG6E 1MWAL 1T03L 5DMGC 3CDGB 2X5PA 4J3WA 3KLHC 2OTWA 1PAMA 4KRPD 4NKOB 5DRWA 5IVXB 3U7AA 2HFFA 4KJQC 3AXLA 4X4MA 2XTJD 2NQCA 2FNBA 4MA1C 1QEWA 2FJHA 3OJMB 4PY8J 2EXWC 1TZGL 4JDVB 3P4NB 2FATH 2P46B 3KXFA 5DFVD 1V7NH 4XPBH 5ISZB 3D18A 2QSVA 3TV3L 3KPRE 3OKKB 3HNSL 2P5WA 2YD1A 4XVUD 3HRZA 2XN9D 4KI5E 2R56H 4LKXA 5C0EA 3DWTA 1NBVL 1UCBH 4CN4A 1FL3A 5GIRB 3VFMA 2AI0H 4Q6YA 1Q72L 4IMKA 3CSPA 4S1DC 3UBXA 5I1CL 4J8RA 3ZKXC 5KW9H 3ZL4L 1R3HA 3NFSH 3WFCL 3GK8L 2AXFB 4IDLA 4PGEA 4U3HA 4Z7UA 4LLQA 4L4JA 5CSZA 4LSDA 3LN9A 4MA1B 5CZKA 4Y1AD 1N0XH 1NDGB 4GLRH 4GKSB 3TN0A 4AIZA 4G7YH 5J0BA 4MXWL 4M6AA 3QUXB 1I3GH 2B39A 4B41A 1CFVH 5DHYB 1IFHH 5F9OH 4OF5A 2UZYB 4M7KL 5E24E 5D1XC 1I7RB 4OZHB 1XCTA 4QTHB 5E08L 5I76B 1UM6H 3LN4A 4YEEA 4NO3B 3CSYB 3DVGB 3CVHB 4N8VA 3V6ZA 1LE9A 3S36X 5T33H 1VACA 3RIFK 5JW4R 4GAJH 1X44A 3S4SB 4HLZG 2HG5A 4R4BA 1HIMH 3CFJB 5J6GA 5D2LF 5GSRA 5E4EC 3ULUH 3HPLB 4HX1A 4PJEA 3R4DA 4UTBL 3EYUL 5ETUB 1Q9LB 1TJGH 3TF7C 4L4VA 4S10A 2B1HL 4WY7L 3UYRL 1Q9KB 1DN0A 3GGWB 1U8MB 5LGJA 3SKUD 1T4KA 5FECA 3HZMA 4KZDH 1BM3H 4GXVL 1WITA 5C0FA 1IAIL 2PO6A 1R3LA 5IIEA 3OXSB 4NZTH 3EGSB 1ORQB 1NLBH 1RJLA 5K59F 1ITCA 3HB3C 1NAKH 3AU1A 4D9LL 1IE5A 5TDOA 2XY1A 1HN1A 4L3EB 3FAWA 1YPZE 5I8OL 4X8JB 5DUPH 3QUKA 4HXBL 3C5ZA 3QYCA 2R0WH 4PJCE 4ZOBA 4IRJC 1MCEA 1X9QA 2DLTA 2ZPKL 3LPGA 2VC2L 4LQFL 5C0CE 3T0DA 4FQ2L 1G7HA 4WUKL 1M7DA 5FK9A 4FTVA 3G5YB 1MCRA 3SY0A 1CE6A 1P4LB 4XAWH 1ZHBA 1A9EB 2EDYA 3D9AL 2OS7A 2XKNB 3U9UA 3C6LB 3UTZA 1FZOA 4Y19B 5C3LD 4BSVB 4I3RL 4JQXA 5IM7A 2P43B 3RVXD 3FJTA 5IMMA 5I16B 2VLLA 3MBEA 5J13C 4OGZA 3B2UD 2H41A 4NJ9H 5DSCB 5GZNC 3QEGH 1AQKH 2DQUH 5CILH 2R23B 1B4RA 2C1PA 4QHUA 5HY9B 2YPLE 4I3SL 4OCXH 4R90L 5DEZA 1CK0L 1YY9C 2P8LA 1U8QB 3FN3A 1UADC 3FT3B 4YDVB 4EQ3A 5AD0B 3IB4A 4JG1L 4LVEA 2WNGA 1JFQH 5INCA 4NHCH 4ENEC 5I1DB 3MRHA 4Y5VB 3CDFA 4WW1B 3EDFA 1RVFH 3ZE2F 4CDHA 1CT8B 2IQAA 3MPCA 2DQTL 4K3EL 4MQ7B 4YX2L 2HMID 1BOGA 2XA8L 4R96B 5DXWA 5JPMA 5IB3A 4OZIF 1A6VH 3IFOB 3B8SA 5HHNB 2YPVH 5JXEC 3HR6A 3FCTB 5DMIH 2VAAA 1HDMB 2A73A 1H0DA 4V2CB 3W11C 2IAND 1I1YB 5I19H 4YGVB 3QA3B 2H2PC 3VXPA 5C09A 2C4XA 1PG7X 5CHNA 4PLOB 3WNMA 1AO7D 5IVNA 1SEQH 4LSPL 4CADA 4UQ2B 4HEPG 1VKXB 4MZ2A 1OHQA 3VI3F 1RIHL 2CLZB 2OI9B 2GJ6D 1OGAA 3GUTB 2NY1B 4M7JH 4K3DL 2Z9TA 1ZGLB 2VLJD 4M62H 3U7WL 4AIXA 4RAUB 1KNOA 2BY3A 1ZE3C 3MV8E 2QSCH 3L3KB 4PJ5B 4NZJA 2DWEB 3QHZH 3S34H 4QRPD 1G7JB 1CCZA 5FUCE 3CK0L 2EEAA 5T3ZD 4HC1A 4NO0D 3G6DH 2EO1A 2UVFA 2PYEA 4HKJB 1F8TL 5MEPB 5EPMA 4WI4A 1LO4H 1RUML 1MFAL 2PW2A 1CIDA 3B5HA 3UROR 5A1AA 3BP6B 4JKKA 4NC1E 1HSBB 2HH0L 1TJIH 3KJ4B 1G9ML 5LXGH 3V6BR 1QKZL 1OB1B 2NY4C 4ISVA 1EFQA 3DBXB 2UZIH 4FP8L 3WJLC 5MI0C 2IADA 1KG0A 5TDPB 3MNZA 4LF3B 3GSNA 3P30L 4NN6C 1X4YA 3W82A 3ZKNC 3SE4A 1B0RB 4NQVB 4NSKB 3JVGC 1NGQH 3QBTB 3VXMB 4QOKE 1X5XA 3FT2B 3PL6A 5KZCD 2P44B 3D5OF 4JKMA 3U0PA 1HK6A 3BQUD 1D7FA 5FYJH 2ZUQC 4BZ2H 1T1XB 3QDMD 4PJGE 3WFEL 5EU7E 2WIIA 4PJAA 1NCWL 4BQ6A 5IVZB 2AK1H 5GS0H 5EUKA 2XOTA 2LV4A 4JGUA 4X9GA 3U7YL 4DGIH 1U8JA 3RVWC 4ZNEA 2GW5A 2PYFA 3ROOB 2BRQA 5JLZB 4P3DB 4YBHA 4KDWA 3W0WD 1H5BC 5JHDE 4PFEA 1NSNH 3VD7A 5I1JH 4EI5C 4JO4H 3HFMH 1L6ZA 4MDJB 2NNAA 3EFDH 3UTPE 1MCBA 1KBGH 5BO1L 4U6VL 1WEJH 4ORGA 3PHQA 5BS0B 5ID1B 4JFDB 1S9VA 3DROA 4JDTH 3N85H 4CMMB 2EDRA 2ZUSA 4JZOB 4KKBD 4WO4B 5MP6L 3SGEI 4JFPA 1RULH 2NX5A 2AJ3A 3BZFB 1EIBA 4KU1A 1NMCC 4PJHB 3OTTA 1YN7A 3TBTB 4FN0A 2GY7B 3LIZH 4GRWE 3VGEA 1MELA 2C3WA 4MQSB 3OG6B 1ED3B 4Y2DD 3M17B 5DEGB 1LEKB 5K9JH 4IDJH 4YBLC 4GT7A 1WUNT 1LQSR 2IH3B 1S9YA 5I1LB 1JUFB 4KJPD 2DYPD 4H0IA 3U1SL 2W9EL 5TQ2H 1INDL 4HKBB 2VDMH 4GAGL 3V0WL 3LQZB 1D6EB 3KGRA 1IKNC 4YWGL 3NIGE 3TH3T 3BWUC 4ALAH 2A0LD 3MFFA 4JDZB 4NM8L 2VLRA 2AJYL 2NMSA 4KQ4L 4U1MB 3I50H 3VRJB 1E27B 4YEFA 3ZKMD 1G7MB 4MD4B 2CKBB 3RTQB 2NY6B 1DVFC 1U93B 4FA8A 5KVGL 1KC5L 1XH3A 2BFVH 1XGUB 1WBXA 3A6BL 12E8H 4P9MH 2AKRB 1JNLH 3QO1A 2WLYA 4PRDB 5TFSH 2CO6B 5DMKB 1GXEA 1HXMB 2DQJH 3V9FA 5DGQA 4HUUA 2R29L 4JO2H 2BK8A 5BVPL 3LDBB 4DVBA 4PB0L 3KYKL 2VDOL 3QXDB 4AQOA 3PWUB 1U95A 1AHWB 3ARTA 2FGWH 1NAML 4XC1L 5C92A 5I8CB 3P0YH 2X4PB 3U4EA 1JWMA 2XWBA 1JHTB 5DURB 1K6QH 2AABH 3V5KA 3D2UA 2MQ3A 4UIMA 4XB7A 5FYLH 2NY0C 5ESVB 3WEXB 4JCMA 1QFWH 3VFUB 2BVQB 4GXUN 3EYOA 5HHMD 4PJIE 1L4IA 4FMKA 4LVNC 5I1IH 5TDNB 1FO0A 3RAJH 3LB6D 7FABH 4OZFA 2F5AL 4N5UA 1YEEL 3CLFH 4YDJA 4X6FB 5KSBE 1AXIB 2HYMA 5HHVH 3IVKA 3CH8A 3MYJB 4JVPA 1KOAA 4M6OL 1WICA 2HVJA 4JRXE 5CGYC 5SWZB 5F9WC 4MLSA 2XZZA 3MCLH 2AQ2A 4PY7A 3GNML 5H37H 4NUGL 5BZWB 5I30H 3LKPB 1TXKA 3U48A 5CZVH 2BNQA 3OGCA 4XMKL 3W9DA 4UMGA 4JRYA 4JY6A 1FH5L 1Z0MA 2GK0A 4Z77B 2V17H 5EFIA 1VGEH 2EKSB 3CXHK 2AEIT 3IDIA 4YBQC 3OXRA 3JV6B 4OZFH 1OP5K 1BD2B 4JR9H 3ZO0A 3NAAL 2PXYB 3OMZA 5ALCL 1W72B 4W81A 4MHHI 2JCCB 3HR5A 4WEBH 3ULSA 3BI9X 5B21A 5KTEH 4KK5D 2BSRA 3RUGE 3L5WA 5FYJE 3C5SA 2J6EA 2X1OA 1IZKA 4RMVA 4X9IA 1YMMA 1MIMH 1Q1JH 3ROLA 3T0WA 1BX2A 4NQEB 4KKLD 2RB8A 2AEQH 4YHKH 4LNRB 4J12A 4JFOA 4KUCF 1DR9A 3MRQA 2Y06L 3NGBB 1M6OB 1U3HA 5IQ7H 2KQNA 2V6HA 1RIUL 3D3VD 2WBJD 5CAYB 5CD3B 1CR9H 1IKFH 1XF1A 4Z0BH 5C0GB 2D0GA 5EUOA 4X9HA 1DQDL 3GSRA 4GO6B 2VITB 3CD4A 4M9OA 4PV9B 5DDHA 1P7KA 4R4ND 1CGSH 1NCTA 4LHQB 1D5ZB 1DBJH 2VR9A 1HEZA 2J6EH 4D3CH 4JQIH 3EO1A 1VADA 4YAQB 1J86A 1J8HA 4N90D 4PJAE 4UV7H 4XB8A 5E70A 5A2LH 4OUUB 1BPVA 5H94B 3H9YA 4QRSA 3EJYD 3BHBA 2F19L 4RIRA 1AGCB 2W60A 3JV5A 4KVCH 1OLLA 5D7SL 4DGYH 3OKDB 4JZJC 3NIDE 5CJQL 3WJJA 1DBKL 3DV6A 2ZOKB 4F37K 1U3YA 2ZCKH 3TO4B 1KJMB 1GAFH 4X99B 3PP3K 3UJTL 2UYLB 5DRZA 3T0EB 1KIRB 2BJMH 1I7UA 2DTML 5F7EL 1F4WL 4BJLA 3EW3B 4YPGA 5KSUA 3WKMH 3ZDXF 5HI5D 4ELMA 4M61B 1MHEA 2Y6SD 4MXVE 1T1ZB 3CFCH 5A16A 4D8PB 4S2SB 2VDNL 4QNPE 3CH1B 2ICCA 1TNNA 1RUKL 4P2QA 1K85A 1B4JH 1Q94A 2J8UE 4H5SA 1HI6B 4D0CA 5TE7L 2A77L 1FZJB 4KTYA 4RZCA 1BBJA 1HWHB 1JVKA 2J12B 1I8MB 5DJAA 4RDQG 3P2TA 4KQ3H 1T1YA 1PX4A 3K1KC 4F7MB 4DQOH 4R7NA 2E7BA 3OPZL 3QI9B 4U1JA 1KXVC 2B8OT 4DKEL 4ONOA 3TVMD 4HULB 4YQXL 1T7XA 4LHUD 1FNGA 2A74B 3OX8B 1E28A 1TTGA 3HUJF 5HGBB 4H26B 1P5VA 3OSKA 4KPHH 1JGEB 1WFOA 4U49A 5IMLB 3LZFL 2UY6A 5C86A 3Q2CA 3TZVA 1CDHA 1LEGB 2VQ1A 4OF8A 1D9KB 1XF2B 5AWNL 3SKMA 3ARFD 5FYLE 4GW1B 2YK1L 3D39D 5I6XC 2R2HA 3NACH 4X7CC 3H42L 3FFCB 4PJFA 3RVTD 3PABB 3MNWB 4JFHD 1QG3A 2HLAB 1U6AL 3MJ7A 4MNQB 1KB5B 4ZXBC 1MRCL 3ARSA 1JPST 1PY4A 2ICWB 4GAFB 3BGFC 3FL7A 5EBGA 5GSVB 4LKCA 2V2TA 5MEND 4QRQB 2JLLA 2AQ3A 1J5OH 3BIAX 3Q0HA 3PWVB 2OK0L 3O45A 2NLJA 4HS8L 1REIA 3NCYP 3VCLA 1YEIL 3FB5A 1NGZA 1YA5A 3K46A 3H3PL 5EOQH 4HWNA 3OB0K 1NEZB 1DEEB 5JDSA 4IRZH 4K55A 4XNZB 2LTQB 4TSCH 3BH8B 4MLIA 4NM4L 3O9WB 3NZHL 5CWSA 5IBTH 1J0ZA 5AYUH 1INEL 5E00B 3EOTH 5A2KH 1FFOB 4P59H 1A7NH 1MCPH 4HW6A 5HYJA 3LD8B 5DS8B 1FNFA 4X5XB 5ENWA 4F9PC 5I1CH 1RQ5A 1Q0XL 5D2NC 3V4PL 3ZL4H 3OR6B 3FQNA 1P7QD 2FBJH 3SDDB 2FHCA 1BAFL 4P46A 3L5HA 1ZS8B 4LFHG 3L7FA 5ERWA 4RDQF 3QIBC 4OUOA 4O2FB 1MRDL 1UT9A 2DLFL 4U6HB 5DO2D 1KEMH 4UILH 2C3GA 4MXWH 4M00A 1T7VA 1T80A 3CFEB 1DDHA 3IDGB 2VWEC 2W9LA 2NW2A 2AJVL 2FJFB 4MAYD 4A2LA 3Q5YA 3S5LB 3JWOC 4LEOB 3T2OA 4NN5C 1J87A 4AEIL 2AV1A 2DQGL 2P5ED 3L3GA 5AZEL 4BQ8A 4F9LC 2CK0H 1F00I 2VABA 3IJHB 1U92B 1ES0B 1HHJA 2VZTA 3SDCA 3VG9C 3ZT7A 3L1OL 4PGCB 4G6JL 4UDTB 3MRPB 3QPXL 1FDLH 3CDGA 5D71H 4HXAH 2DKUA 4NYLB 5B38G 4YHLL 2AK4D 4P5TD 3DECA 3RPIA 2A6IB 5K9QI 4NKOA 3O4LE 1FC2D 4JANB 1B6UA 5JIKA 3OV6A 4NDMA 4MJID 3M1BB 1SM3H 1JHKL 4NKIH 3DXAA 5EUOE 2V5MA 3RY5A 1CDBA 1EAPB 1P9MC 3C5JB 5DD0L 3P4NA 4WY7H 3QIUD 5CJ5A 1CLCA 4Z95H 4OM1H 1S3KH 1K8IA 4FOMA 3PQYD 4N0YL 2P47B 3X3FH 5DMYA 1J8HE 4N8CH 4G3YL 2OCFD 1IAIH 1T04B 3VU2A 1BVKB 4X5WA 1OAQH 4OLZH 4XNQA 4F7EB 1QBLH 4LAQL 2ED8A 2DBLL 3QG7L 5I1AA 3RBGA 5B4MC 1WIOA 4K8RH 3CVIL 3I3DA 4M8QB 1UEYA 5IEHA 3NA4A 1S7UA 1IVLA 5C6TL 4FQ1H 3VA2C 2BY2A 4P4KD 3DX6A 3O6KL 1OTTC 1OVZA 5D2LA 3HMWL 3VI4F 1EVTC 3N1PC 3ZYOA 1OOAA 3R1GL 4D94A 4JREC 1NCBH 3OF6D 2YEZA 3GMOB 4YZFF 4ELME 4N5ED 5E56A 5DHYA 3HNVL 3BVNA 1VEOA 3MRKA 2X6MA 1FYTB 1RI8A 5D7KD 1ZLSH 4NPYA 2R9HD 1EEZA 1ETZB 2XNAB 1D6VH 1MQKL 5HVHB 2ZSWA 1HQRB 4P2QE 4KMTL 2IAMD 4LU5L 3GZKA 3UTSB 3ES6B 4NO3A 3ARPA 3JWDC 4U6YA 1SVZA 3DVGA 43CAB 2FEDD 3S36L 2IMMA 1H15B 4WUUD 1JPTH 4HAGA 4Y4HD 3C08H 5CINH 4TSBL 4RFEB 3S4SA 3BE1H 1JNHB 3QNZA 2Y7QB 4D0DA 4E41D 1I8IB 1CICC 2CMRH 1CK0H 2CR6A 5EWIH 3DGCR 2IEPA 3G5VB 3K2UL 5E99L 1JGVH 1KIQB 1GGYA 3F7YB 4CVZA 4WRLA 3ZE1F 1T20B 3UPAA 3LKQA 4W70A 3MCG1 4ORZC 2BC4B 1EO5A 5D1XA 3CVHH 2WUBL 3O8XB 1A14H 1WZLA 4JKWA 1IGMH 3OXSA 3GFUA 4KV5E 2OJEA 5HVGB 1OF2B 3P11L 4G5ZL 4P57B 4Z7OE 5E2UH 4WHDA 5GGQL 4MJ5B 1TJHL 1A1OB 3RY6C 5DQDH 3QQ4B 2F53A 3VXQB 3ZHKA 2X4TB 5BZDA 1S7RA 3P3YA 4QCIA 4DCQB 2A2QT 4FFYL 5GRVK 3S96B 3RZCC 2YD9A 2QHLA 4NWTL 3IJYA 3DRQB 3GMMA 3RWIB 4K3DH 5EIVA 5SWSE 3G6JF 4DN3L 4P3CH 1BFOB 4YC2B 3RX7A 1KUMA 4ZFZA 3WIHH 2DMBA 4PTTA 1P4LA 4POZD 1FZKA 4EDXB 2VIRB 4YE4L 5DRXB 3QUZC 3C6LA 4PRIA 5I8EB 3CK0H 4OZIA 5IW6A 4FABL 1N59B 4ZOEA 5JNYB 5GGTL 1MJ8L 3ARGD 1C5CL 2F5BH 3MLXL 3WLBA 4UINH 3GMQB 1E6JL 5HYJE 1YEHH 3FB8B 3OZ9L 5HY9A 3SPVA 4IMLA 4ZUSB 4PUBH 1A3QA 3KHQA 4MX7A 3FT3A 3K4DA 4YDVA 5AD0A 1CLOH 2V9TA 4IRJA 2YZ1A 5BOPA 2ZNXA 4M7LL 3LN5A 1V3LA 1H9VA 2R0ZL 4KRPC 4KXZH 1LMKA 5HYEA 4K7FB 5DZOA 2C3VB 1IC4L 1YECL 4G9FD 4M5YL 3RRQA 2APBA 3WS3B 2GT9B 4YHYC 3RWHB 3DO7A 1A7PL 5DFVC 1S7WA 1AE6H 2ZUYA 2Q6WB 2H6PB 3CMGA 4PJ9B 2EE2A 5MHSE 1HDMA 4M48L 4P5MB 4ZS7H 1C08B 3HE6D 5A2IH 1PG7L 2XA3A 4NQDB 2IALB 3DI3B 4MD5A 3U7YH 1HQ4B 1LNUB 3O6FB 3IDMA 1TCRA 1JGLL 1VKXA 3UTTB 2Y07H 3MODL 2YA0A 5GZOC 4NCC1 1UXWB 2X40A 3GUTA 3GJEB 5F1IB 2WANA 3RNQA 1MFDL 3MRCB 4NKQB 3SE8H 5IVXE 4I48B 5ACZB 1C1EH 1QSFD 2XTJB 2WK2A 5J89A 4W6WB 5J11B 5KVDL 4PRPD 3LKSA 5IKCA 3JWDL 1JPSH 1FNSH 3HHRB 2X4SA 2DWEA 2QHRH 5JHLH 1G6VK 5ISZE 3BZ4B 5JXEA 4UU9B 3P9WB 3EKCA 1CU4L 3B8YA 1VFOA 5MEPA 1JRHI 3SJVA 5ICYA 2XN9B 1A6WL 3MLZL 2DN7A 2HKHL 1MRFL 1QSVA 4M1GL 1HSBA 2YWYA 1CDIA 3INUL 4JFFB 3SCMB 5GRYA 1EMTH 4QRRD 2BP3A 4L8SC 1I3UA 3G6AA 3GMRA 1RZKH 2WINB 4LF3A 1B3JA 3LAFA 5C0RL 1BGXH 1RK1A 3HLAB 4B0MM 1C5DA 4MGXA 1B0RA 1LO2L 1NAMA 2X70B 4CMHC 5E9DB 3SBWC 1S9XB 4WIQA 4ZTPH 1OT2A 5FOBA 4HBCL 5A3ID 3CX5K 1IGYA 3L6FB 2V7NB 4BKLB 4OZHE 4Y16B 2XTLA 3EO9L 4UT6H 2BSTB 3B6SB 5IVZA 1RMFH 3WDJA 5IV2B 4WNQB 2N4IA 2NY7H 4EN3D 4TUOA 1WC7A 3HI5H 4KY1L 2VXVL 1UJ3C 3UPRB 4PB0H 3WJLA 4OCWH 3V4VH 4NFDA 3U9PH 3S3PA 1QQDA 3KPSD 2X10A 3LV3B 3MRGB 4JO1L 4ERSH 5IG7B 3VXRB 3TBSA 5D1QD 1DBML 2Q7NA 1A3RH 2ADGB 2RAMA 5F1KC 3JVGA 5E5MB 2APVA 4Z7WF 4WO4A 3VXNB 5CJXC 1KELL 2Z8RA 3HZYB 4MB4A 3KS0J 5L8LB 1CFQA 1U58B 1F13A 1ED3A 4JJ5B 1JWSB 4WI5A 3M17A 4QF1B 3DYPA 1LEKA 4PGDB 3RVXC 2IH3A 3L9RB 3B2UC 2W0LA 3FRUB 4L3EE 2GK2A 3KR3L 3GBML 1H5BA 4HKBA 3D85A 4KJYA 1UKSA 1EO8H 1LP9B 3SOBL 4KZEH 4EI5A 4ZG1A 4QLRA 2ORBH 4PRAB 5DUBB 3PWLB 4X7DC 4UZGA 4QHMB 3HC0B 3MRMB 1F11B 5I1KH 5JW4N 3VFSB 5KG9B 5DC9B 4DVRH 3CXHJ 3VRJA 1MH5A 5DUML 1TQBB 4MD4A 3WS6C 2CKBA 3KLSA 1RZ8B 5F7YC 3SDXB 4A6YB 2DD8L 3ZKSD 1XIWB 2BRRL 4DZ8A 2AKRA 2HMIC 4Y19E 5DMKA 5E2JA 5C2BL 4YHML 5I0DA 2E5EA 2AJZA 2CRYA 2YN5A 4IHOB 3BEWB 4QXTA 1R3JB 4XP4L 1NGXA 4G80A 3EZ8A 3W2DL 3HNTH 1OARL 1MSPA 1U2CA 4N0RA 5D9SB 1S7XB 4G6KH 3I02B 1I1AD 1P2CA 5K9KB 1FNEB 1TPXC 5D6CA 3OJDB 4JRWA 1IKNA 5H35B 3RGVD 1HOCA 4UB0H 5I18L 2CKBH 2B0SH 2X4PA 3SE9L 1JHTA 5GRUL 4QHLB 2ZKHL 4DTGL 3WV0A 1DVFA 1O5DT 2VZUA 1EXUB 3D25B 4XWGH 1FV1A 5KOMC 4NCDA 2BVQA 4JLRB 5KSAD 4NQCA 1J88A 2JB6B 1CI5A 4U1LB 2OQJB 2W9DH 4OD3H 3GSVB 4MCYB 4ZPTA 4XMLL 5DVNA 4P2CG 4NKDB 1YY8A 1V3MA 1O7SA 3MBXL 2D7TL 3WFDL 1EFXD 3BFOA 2H1PH 1Y0LA 3ALXA 4U3XA 3MYJA 3DHJA 4GRMB 1AO7B 4RAHA 2R4SH 2DI9A 3PWPD 1HCVA 3C8DA 3EAKA 2KZ1B 4LCIH 4R0LC 3LOWA 3LKPA 4LDEB 3H8NA 3E6FB 5F89A 1J0IA 1RPQA 5I1GL 2Y5EA 1T5XA 4PB9H 2I26N 5GRXG 4CAGA 1RHHA 2DTMH 4PJ5E 4MD0A 3VXSD 5K9OA 2VQUA 3JV6A 3BPOC 5KJRH 2GSIB 2OR9L 2AEPH 4QRPB 1DQTA 5FGSA 4J4PD 4Q9QL 3E8UH 3KJ6H 5ADPH 1KEGH 2D9CA 4LEXH 1OM3L 4OFYD 5JIPA 3MLTA 3WO3B 3IXTB 5DEFB 5F1NB 3N1FC 3BQUC 5IEKA 1JK8B 3HC4L 4P4RA 5F97E 2AV7A 3LQMA 2OLDA 3O41B 4H20H 5I73B 2C4FT 5LVEA 4TULL 2BSSA 4NQEA 4OBSA 1H3WM 1IAOA 3L5IA 3BKCH 3GBLA 3ZDYE 3QPQD 1M71B 1MREH 1N5YL 3QWOA 3LPFA 4U1KB 4H1LB 1UZ8A 4TNWK 3LQAL 4G6MH 4HCRA 3WD5H 2EYRB 1T83C 4EBQL 4YDKL 3VGHA 1W72H 3VXME 2VITA 3ARQA 5CKGA 3KPQB 5LCVL 4WFHD 4I0PD 4KKBC 4FZEH 5C8JA 2AXJA 1D5ZA 4B5EA 3BPLC 4F2MA 1NCAL 3LZFH 2CDEA 4G8GB 5C08D 4RCAA 4JFYA 3WFHB 3O3UN 3QEQA 4OUUA 5H94A 5DT1L 5E2VL 1MCOL 3DX9A 3WUWB 4ZUVA 3MJ9H 5EO9B 3VXUA 5T5NG 4L8CA 5EU6D 1CBVH 4KJPC 1VFBB 2PETA 2G5BB 4MHHG 3WIIH 4HCRH 4TVPH 1UB6B 5CZXC 3VFPA 4HQQH 5I9QB 5CFHA 2E6QA 1FLRH 4TSAL 1KIRA 2A0LC 3PIQB 5BRZB 1KENL 1MCIA 5BS0E 4JFDE 1YEIH 3F6LA 4ODUB 3L3JB 5SX5H 3ZKMC 5D7IE 3TBVB 3MRIB 4OCRL 1JNNH 3RDTD 4PJHE 2IPTL 4N9OB 1S7SB 1TETH 3TNNA 4PJ8B 3CH1A 5CUSL 5DVMA 3AY4C 3QQ3B 1ODAA 3MRDB 3NZHH 3B9KB 5E1AA 4Y2DB 4PG9A 5EBMB 1CGTA 5IESL 2A38A 4X6DF 4X4YB 1FFPA 2DTSA 3QWRD 1MCHA 1FIGL 1OAUH 4MS8D 1I8MA 5ITBH 1A0QH 3ARVA 5J4MA 2A83B 4JZJA 3RI5K 1B6DA 4NOBA 1BREA 2JE8A 1HHIA 1BECA 5CEZD 3S88L 4RWHA 3QRFM 1TZHB 1DANU 4LLDA 1TVHB 3FB6B 2VMFA 3V7MA 4CJ0A 1T0MB 1CTOA 3QJHB 4NRXA 1K2DB 4N0CD 5DJXB 2F54B 4HUXA