3OAYH

A non-self sugar mimic of the hiv glycan shield shows enhanced antigenicity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
217
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2G12, light chain
publication title A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 217
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oayH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oayH01
4GS7B 4XCCH 1VFOA 1QYGH 1F6LL 4HLZH 4PLNC 3RWGB 3UXFA 1HYRC 1NAKH 2AV7A 3MJ7A 3THMH 5C0AA 4KHXH 1MELA 4NKDB 1EERB 43CAB 3OJDA 5BRZB 1VACB 3QUXC 3U83A 3LQZA 1D6EB 3GSVB 3O2DL 3H2WA 4LSPL 1I1YA 2DQDH 4RFOH 2AI0H 1BVKA 2B0SL 3DLQR 3G6AB 4KK6D 5TE4H 3T65A 1KCVH 1CTOA 4MA3B 5SWZD 2XZAL 4AENA 3RL1B 1LD9B 3AY4A 2XQBL 3BISA 1M6OA 5GZOD 3CFJB 1K6QH 3GBLA 1CFVH 4UIMB 3T8XB 1I3RB 4OLEA 4PJBF 2WWKT 2ADJA 3OKDA 1PZ5B 3G5YB 3L6FA 2UZIL 3O3DB 3KJ4B 3WJJA 5IMMB 2XY2A 4DCQB 4OF8A 1I8LC 4KTEH 2R4SL 3ELAT 1ODAA 2DD8L 5FCUH 1BEYH 3MLZL 3WIFB 4YBLC 4H20H 5GGVY 2QQKH 3LS5L 5FOJA 1QSEE 3BH9A 4PJEF 3AGVA 3WFDH 3ZSTA 5D8JH 5EOTA 2IWGA 5MI0C 5C09E 5DQDH 3BW9B 5K93A 5ITBL 4N9OB 1MHPH 2F15A 2R0KH 2VYRE 5B39B 1JNNH 4LQFL 2IH1B 4L5FL 3LSOA 3RDTB 3DXAA 3PP3H 5KSAA 2G2RA 2BNRA 4OI8A 1BBJA 5C09A 5I1IL 4ELKB 3X11A 3LIZH 4ETYA 1E4JA 4MJIE 5FF6A 1ZGLP 1ZA3A 1IGIL 3QQ3A 3WHXA 5HYIA 3BWAA 1JNLH 3BPNB 1CDHA 2VSCA 4PS4H 5BZDA 4PREA 1F3JB 1JZ4A 3LEYL 2APBA 4XP5H 3GJFK 2X4UA 4PJBE 4NZUL 4OF3A 4PJGE 5I75C 1MHCB 4WW2A 1QSED 3VCLA 4Q0XH 5C09D 4LCCB 3O0RL 4Z7VA 4GXVH 4PP1C 3EYFA 2HT4D 3FB5A 4PRAA 5C3LD 2X4RA 2A9NL 4EI6A 2X4TB 4DAGL 2CO7B 4I1NB 4PJGA 2VUYA 5ANMB 2PYEA 1IAOB 5JOPE 1CZ8L 2R2EB 1YYLL 3P0GB 2DKSA 4EDXB 3C8DA 4PJEE 5ALCH 5E8EA 4R7NB 4D9LH 4F57H 5ID0B 1PKQE 4GAGL 5DJ2A 3VRIA 4JZJA 4MNQB 3PWPB 5J9PA 2A0LC 4HIHB 4GKOA 2OX5A 3KDMB 1NEZG 2VDNL 3CCHB 4TYUA 4HK3N 1DANU 3M1BA 2W07A 5GRVK 4ZUUA 5B22A 5DFVD 1PKQA 1CGWA 3H7BB 5D71H 4P3CL 3CLFH 5GGRA 2XNAB 4R96A 4R90L 4KRPD 5H37G 1GZPB 1WFOA 1ZT1A 3EOBA 3GKWH 5C6TL 4JLRA 5JOPD 2NXYD 4PJ7E 3L1OL 4XBGA 4QRUB 4FS0A 5EFIB 1EAJA 3OXRB 4XX1G 4OSUL 1EH9A 2OZ4H 3GSWB 5C0BB 4UDTB 4JFEB 4GMSH 5HY9A 1JF1A 2E6PA 1DQLL 1HKFA 5CZKA 3DECA 4PJ7A 3CSPA 3U0PB 3LKNA 1E28A 3ARDA 2QV2A 4Z78B 5DJAB 3L3DB 4ZNEA 5JDSB 4WHYG 1OARL 1HILA 2CDFB 2BRRL 4QHNB 1NGZA 4S1DC 3REWB 2NY1C 1EDQA 1ZVYA 4ZYKA 1M05B 2Y36H 3MBXH 2VZSA 1DQJB 4ISVA 3ARDD 1JJUA 2Q8BH 1JPFA 3KPLA 4IIQB 4XMLH 3FN0L 4QRRE 4KHTL 5TGBB 3QUMB 5LG1A 1UA6L 3L5IA 2R39A 1A7BA 3VWJC 1F3RB 1QFUH 2ZJSL 5KJRL 4PV9B 3UBXI 4G9FE 3LVEA 4M3JA 1G0XA 3HC0B 4M1GH 3QJFA 1WCBA 2ADGB 4XPAH 4UTAH 4QRRA 4XWGL 4YWGH 1FGVH 2L4OA 3QIBB 3DV6B 4G9FA 3K0WA 4LLDB 1H3VA 5KS9A 1TNNA 3F65A 4RZCB 3MA7A 5SWSA 3RA7L 4RFNB 4HC1L 4LFHG 3WXWL 3NCCB 4XVSH 3BUYA 3KYMA 4TVPE 2EE6A 1AI1H 1ND0B 5C0ND 2ICWA 5F3HA 1JWUB 2DBLL 3ZKMC 3O6LH 1F6FB 2CKBL 1CLYH 2VKXA 1S5HB 1WQVT 4QRRD 1XGRB 3C5SB 2DM2A 4MA7H 2ZG1A 3REVA 4U6HB 2EYTB 1NKOA 4OLVL 4G9FD 2YD1A 3MRGB 1CTNA 3E3QE 4GOSA 2E7LA 1QFHA 5IJKC 5DD1L 5HHMB 12E8H 3GDBA 4DKAA 3HLAB 3SE3C 3X14B 4XXDB 1S7VB 2F54B 5C0RH 3HE6A 5IQ9A 4HWEL 1B90A 1YMHA 4U3HA 3GSRA 3ZT7A 2NY5L 1WICA 3W2DL 2HFEA 4M61B 4P2OC 3N1MC 4NHCH 3ILPA 4PJ9C 3WS6C 4ZFFB 1NBVH 4RAVA 4WUUB 1MJ7L 1RK0A 1MRCL 3WLWD 5C2BL 5CGYD 1P6AB 2DQGH 4HCRH 3VXME 4JAMA 4YEEA 3V0AC 3IJYB 4TVPD 2CXGA 5EBLB 2R1WB 1IM9D 5TQ0L 4IBLT 5FDWB 4ELMF 2JJTC 4G9DA 3KLAA 4CJ1A 4P49A 5CSZA 3I3EA 2VLRE 3K74B 4S2SA 1QPXA 5KW9L 2F5BL 3QFJB 4R2GC 4YDIL 1XCTA 5IVXF 4LNVA 5GGQH 3VD9A 5BVPL 5D7JC 5AD0A 1I4FB 1PBYA 5E24E 3BSZL 3SO3C 5FECB 2VLRA 1LE9B 3TPUA 3RKDD 4OZGA 4WV1C 5T3ZE 2IAMC 2N1KA 1MUJB 1K8IA 1MFAL 2X89A 5JOFA 1KBGH 3IFOA 4NGHH 3IDNA 5I74B 1B4RA 5D1XB 3E6HB 4DGIL 2GTWB 4EBQL 3RY6A 3VXMD 1G6VK 2BZDA 3SDXE 3Q3GB 5FGCE 1OTUC 1W0YT 3UX9B 1IBGH 3C9NB 4OQTH 4H1LH 2VLRD 4OLXL 3BRDA 5T3XL 3IKCA 3TCLB 2BMKB 2LAGB 3DUSB 3QPXH 1HHGB 3IDJA 1MF2L 2IQ9H 4EQ3A 2IPTH 3BN9C 1H5BB 3SDXA 3HZMB 2X89D 4GAJH 3GSOB 4UB0L 3W39B 5L9DH 2EDNA 2OK0H 4IM8A 3E1F1 5DHVB 4XPHH 3PV6B 4ODHH 1IKFH 4ELME 3K7UA 3ARSA 3CFIC 3O11A 5SX4H 5T3ZD 1Y18A 3V0WL 4KKCC 4JRYB 4JG0L 4XP9L 3ECBA 1FNFA 3KPRA 4J3VA 5IVXE 5L0QC 3ETBF 5GJTH 5KTEL 3O6KH 2G60L 2XZCL 4HXBH 5GGVL 1MJ8H 4YX2L 4OZ4B 4Q9RL 1UM4H 3P4OB 5IKCB 3EO1B 5F93C 3MLXL 4FNLL 2DTML 3S35X 1U8LA 1I7UA 1JGLH 2IMMA 2OBGA 3INUH 2PETA 5L6YH 1TZHB 3SJVA 4ODSL 5HGDB 4XNUH 2HJFA 5LQBH 3F7QA 1S7TB 3MLSL 2Q76A 1XGYH 3CXDH 4Z7UA 1E4XH 5HYJB 4AEEA 4QF1A 5HXMA 4YHML 1HH9A 1CR9L 4QTHB 5B3NA 5FYKE 2F74B 4HJGA 4V2BA 3MOBL 2YXFA 1KELL 1HKLL 1JHTB 5IBUG 4YLQT 2KZWA 4MQXD 1VESA 2FATH 2J8UF 4KAQH 4V2CB 3FCTA 3NCJH 5MEOB 3NIGE 1G0YR 2R1XB 1XGTA 1NCAH 4W4OA 1XGQA 3JZ7A 5E4EB 4UAOB 1OP3H 4Q2ZA 3CC5A 3IDGA 1QSEB 3QH3B 1FDLL 4LLYA 3IU4L 3RWJB 4ZOAA 3NA9L 4ZFOA 3EHBC 1T20A 1MFEL 5DRZB 4Z0BL 5ECJE 4YR6B 4M5YL 5AWNH 3FTGA 2LU4A 1SYSA 4MB4A 1P5UA 2VSDA 4U1IA 1AGBB 1JK8A 5IHZA 4HPYH 4EOWL 3HZYA 4MJIB 2Y23A 3D5OF 4QY8A 1CGYA 1MWAB 2WBWB 3T0EC 3VWKD 2YPVH 1I1AC 2PXYD 3IT8D 5DA4A 5GRUL 4KY1L 3DHJA 1DJSA 4XMPL 4YDLC 3MRBB 4MAYB 3QEUB 1V7MH 3SDCA 4HV8A 4DEPC 3O8XB 4HUVA 3MO1B 2GTZA 2JIXB 2C1PA 5K9KB 3Q6GH 5DRWA 3FB7A 3VXUE 5TH2B 5FHAL 2PYFB 2JB5H 3MJGX 3O6MH 1FJ1B 1AE6L 3BPCB 4XBPB 5JLZA 5E8PB 4RA3A 2Z35A 1YYLH 2ATKA 1KTLB 1MQKL 5JORA 4UIKH 3FFDB 4LSTL 2PUQT 2R2CA 4PJEB 1GIGL 1Q0XH 2ZSWB 3BP5A 3CH1B 2ZUQB 2PO6C 1ZTXL 5D1ZA 5JHDE 3KYNA 4WENB 5BXFB 1OAXL 1AXSB 3GBNL 1RJCA 1DQDH 1XF2B 1U8NA 3MRLB 3BD5A 1DBBH 3S96B 3O2VH 2AJVL 5L8JB 3VXUD 5F1SA 4FQ1H 2A38A 3V6OA 4M7JL 2D03H 5IMKB 1GJIA 3TN0C 2VITA 1U93A 1SJXA 3FO9A 3PXJA 4TSCH 3TBTA 1ZGLA 5DEGA 3SKJH 1C16A 5HVGB 5FOBB 3I2CL 3WE6B 1YEFH 4KJYA 1QUNA 4LAQL 4P5KA 4X6FB 4KJPC 4X99B 5EO9B 1MCPH 4F7TB 4XWOD 4PJAE 1OTTC 3O4OC 1RJLB 4LLVA 1CFQB 1NFDA 5D6DA 1AGEB 4U1KB 1RUKL 3P4MB 4XI5C 3BP4B 3QQ9C 3NGBB 5DWUL 5IEKA 4PJAA 1FL5A 3CVHB 1RI8A 2UZXB 1EHXA 1IFHH 5F7WC 1ZT4A 1EJ6A 2C3HA 2I9LB 1KEGL 4WTZA 1D9KC 1WFUA 2CGRH 1WFTA 3P11H 5DUML 3T0WA 1KIQA 5I8KL 3GMOB 3CDCA 1QBAA 4YC2B 3L3KA 4WO4A 3OR6B 4JFQB 5C0FB 1J1XL 4QHLB 1F4WL 2QLVB 4CBPA 4G5ZL 4Q58C 2A73A 2ZKHL 3C2AH 1CD1A 4R4NC 5C6PB 4GG6E 2GIYA 2EXYC 4OI9A 2A6DB 1EO8L 1PYWB 5DHYB 3L5WB 3S6CA 4ZODA 1DEEA 4XGZB 5F21B 3U6RB 4P3DB 3GSNL 5JW3H 4Y88A 1J0HA 1JHLH 2VWEC 4FA8A 4GG6A 4GAYB 3RVUC 4O9HH 5DSCA 5I8EA 1KOAA 3RWDB 3BGFC 3HG1B 3SKMB 4RGNE 5D2NC 1EHLH 4EN3B 1WBXA 5JPNB 3M8OL 1UB5B 1Z9OA 4R7DB 2FNBA 1WISA 1INDL 3MRKA 3QRGH 2V17H 3GMPA 25C8H 3QBTB 2EEBA 1OT2A 4L8DB 2LQRA 1J05A 5HHVH 4JPKH 4BYHA 4F9LC 4Q97A 4UTBL 1I9JH 1IEBA 2P8PB 3AUVA 3C6SB 4KVNL 4OLYL 3R0NA 1KTKE 2G9HB 3DO7B 3KXFE 5HJ3A 2PTVA 4OZHF 3MLRH 5JW4R 2ZUTA 5C70A 4PJFF 3VXQA 3CPLA 1BZ9B 2GJZB 5I15L 3OAUH 3LKPA 5E08L 4OM0H 3E0GA 3MRQA 2XV6B 1EUUA 2IPUK 3AS3A 5I9QB 4HW6A 4LSRL 1MRCH 4RGND 3KXFA 3FONA 3EJZD 3HC3H 4XCEA 3PWJA 2DI8A 3RZCD 1BIIB 2H1PL 4XC3L 1DE4B 3DNKA 4R8WH 1F8TH 2AEWA 2NY2D 3UMTA 4L8CA 1EFXA 3DMMC 3E2HC 4P4KC 3OHXB 1FH5L 5IF0B 1LQSR 1U8JB 1AD9A 1L0XA 4M7LH 1KLGA 4Z7NF 1VGKA 3LPGA 2FH6A 1C5BH 4NUJA 4D0BA 1GC1L 1I8IB 3E6FA 1NCUA 2D7PA 2Z93B 3KXFD 5T5NF 5BS0E 4HUUB 1PG7W 1T1ZB 4X7EC 2F5AL 1TZGL 3HMXL 4X7DC 1RJYB 4QTIH 1EFXD 1FV1A 3WFCH 4G8GB 4IMLB 4M93B 4ZPVB 3OKEB 1VGEH 3MBED 1QG3A 3A6CL 3IJSB 4JN1L 1A4KB 5EB9A 1D6EA 3EFDL 4HF5H 4CN1A 1NCDL 1NLBH 2ZOLB 5D72H 1BWMA 1TTUA 1GOGA 2BNUB 4HKZB 3G6AA 4W6YB 3KPNA 3D39B 4OB5L 4X80L 4NO2B 3SDDB 4MA3A 1LO4L 5FGCB 3SDYH 2BHUA 4DKEL 3S5LB 4MA8H 1KJMB 3KWWA 1JMXA 1JGDB 3RL1A 1LD9A 4R3SB 2CDEB 5T3ZH 1R3IL 1K9TA 4U2YA 1RIHL 3MQIA 2Y9RT 3UJJL 2DMBA 1YY8A 5IBTL 3X3FH 3GZKA 4UIMA 5BS0D 3LD8C 3T8XA 1JVKA 1I3RA 3DX7B 4HG4J 1MHHB 3B2UC 3SDAB 2OR7A 5A43C 4ELMB 1PZ5A 3FL7A 1A1OA 1QVOA 1H8SA 5HVWA 2DM3A 4IEFB 4YJZL 4Z7NE 1G9MC 4G6JH 5IMOA 4DCQA 1MCWM 4NUGL 4L29B 1YEDB 1LK3L 3FRPG 2R9HD 2NY4D 4M02A 2ADIB 5DMIH 5GZND 2MSPA 3BT2L 3WIFA 4M7KH 3SOBH 4DKFL 3ZE2F 3QG7L 1A9EB 2IBZY 4OM1H 3HNTL 3C08L 2VZTA 2DQUL 2AK4E 4YZFF 1QSZA 4UV7L 4Z95H 2LTQB 4CN6A 5HI4D 2R29H 4GUPB 5B39A 2I60L 4F2MA 2IH1A 2V2WB 1LO5A 3GMLB 3ALWA 5DS8B 2BOBA 3BGMA 4NCC2 3UTTB 1K4DA 1U95A 2P4AB 4Q9BA 4WI4A 4ELKA 2X9YA 3O3EB 5EZIH 2HFTA 3NH7H 4Z7QF 3HZKA 1A3RL 3LN4B 2Y06H 4YHIB 1MFBL 2W9DH 3H9YA 3F5WA 4NM8H 3VGHA 1F3JA 5F1OB 3LB6C 3DI2B 4MDIB 4EUPH 2FL5B 1MHCA 3L5XL 1RULL 3F12B 1U3ZA 3S4SB 3I6KA 2AK4D 4IDJL 4YH6A 1JFQH 4Q6IC 4FN0A 5B3JF 3FQXB 3QCVL 4ODVH 3H3PL 1Q72H 2R69L 2CR6A 3GGWB 4XVJL 2ZZUT 4O02H 1G7HA 4GRLC 4HLZG 3RVWC 1TITA 2R2EA 1YEJL 2W0LA 5GS0H 1HWGB 4RCAA 4EDXA 5J6HB 5HI5D 3QUXB 1XF3A 5ID0A 4C83B 3PQYE 1FRGH 1JNHA 3PWPA 2JE8A 1HCFX 4HIHA 4XMKL 1OM3H 3KDMA 3CCHA 3QEGL 4JG1H 3VFOB 1YEEH 5DRNB 3VFSB 4KKLD 1KIPB 3BKML 4MS8C 2MMXA 2YEZB 2O5ZL 1GAFL 1FNEB 2XNAA 3T0VA 4JR9H 1AC0A 3WJLA 2FBOJ 3QIWC 1KPVA 5E1HB 1T6WA 4O2EA 4O58L 1UM6H 4D8PA 5SV4A 3VXUB 2PW1A 4ENED 4ZMAT 5FKAA 2J8UB 4F33A 4QRUA 3OXRA 1AKJA 3GSWA 2V2TB 2HWZH 4UDTA 4JFEA 3QJHA 4WFFE 1XF1A 1IAIH 1L7IL 4FABH 3PQYD 1G9NL 2AEQL 4YBLB 5EORH 4DK3A 5KBNC 5DVNA 2EH8L 1PSKL 3MJ9A 1N2RB 1R3KA 3BIKB 5MI0B 5JHDB 1AGFA 4DN4L 5DJAA 3L3DA 4BUHA 5HGAB 1W8OA 1M71A 1UJ3C 4NZDA 1NJ9B 1KLUB 1FYTE 2IG2H 2CDFA 4BSWB 1PGRB 4RRPG 3QA3A 3TO4D 3TYFB 3HS0B 3MJ9L 3REWA 1J1OH 2LV4A 4TRPL 1V3JA 3U7WH 2AQ2A 4NRXB 1KB5A 2VZUA 3KLSA 4LAQH 2A1WH 2RCSH 5TDPA 4X9GA 5TPWH 3TNMA 1LP9A 4WFFD 5DI8A 5TGBA 1GGIH 3UDWC 1YEKL 4WFHE 2RB8A 5I75B 1X44A 5CBEA 4OV5A 4PV9A 4JM4H 4ODXB 4XC1L 3ARUA 4LSQH 3NN8B 3TPKA 2XYCA 4HZLA 5GISH 4U1LA 4MA1C 4BELD 3UBXB 1FYTD 3QUML 5F1NB 4RMQA 4DZBB 3QI9C 2A74B 3NCFB 3TBSA 4OAWB 4ZSOE 1K5NA 5GSVA 5CJBA 2GJ6E 4RZCA 4AMKH 1IMHC 3ILQC 4XAWL 3C60D 4XP4H 2OSLB 5DO2C 2WZPD 5GS3A 4Y19B 4TNWF 4ZSOA 2D9CA 3OKOA 3K4ZA 3DARA 1GGBL 3VXTA 1S5HA 2ERJB 3ULUL 5KSVB 3C5SA 5FFLA 2XWBA 4NKMA 4NZRL 4RGMC 2OLDA 4P5MB 4J2XA 4Y4FC 2EYTA 3EYVA 5I8CB 3RTQC 4TOYH 4M03A 5IFHH 5A2FA 3GFUA 4L1DA 4XXDA 1S7VA 2F54A 4I3GA 2NZ9D 5K9OB 1CXFA 5FO9B 4X7FC 1AR1C 2CK2A 4M61A 1KCLA 5JHLL 4GRMB 2WUBL 4H8WL 2GJ6D 5JXEC 2DQEH 4JFDB 3ARGA 1Q9KB 3ZKSD 1HSAB 1DBJL 2Q7YA 2R1WA 1WBYB 5DFWH 2BDNL 2DQCL 4LQ1A 2NY2B 5AUMB 2I07B 1JRHI 1XGPA 4ONGL 3QFJA 5BO1L 1QO3B 3LQAH 3GMRB 1F11B 2PR4H 4KPHL 3ULVC 4GKNB 4LU5L 5T1KA 1I4FA 5BMFH 4R97C 1FFOB 1P5VA 4M62H 1LE9A 4XHJC 4QOKB 3ARGD 3FZUC 1G0DA 4YE4H 4Q9QL 2NY1B 4FQXA 5CWSB 2H45A 4QEGA 2GTWA 3I9GL 3LKQB 3MBEB 5T1KD 3X13B 4JFXA 4APQA 4K9EC 3C09B 3PWUB 4NP4L 5L88L 2NPLX 4GQPH 5EOCL 3TCLA 1TTFA 3DO3A 3DUSA 4LVEA 5DJXB 3CUPA 4HKBA 1NGQL 1ITBB 3HI5L 1H5BA 3W39A 5J13C 5FUZH 3IYLW 1TCRB 1AJ7H 3TIDA 2R0ZH 3WKNA 3QG6A 4NNPH 1EMTH 1BX2B 4NM4L 2X1OA 3CFDB 4U1MB 5DF0A 4NOFA 1CE1L 4APQD 3WL9B 4BQ9A 2ZCHH 2ENSA 4GBXD 3ZT6A 5CBAA 1MJJB 3BEWB 5KVEL 3QHFL 3NPSC 2ZOKB 2FIKA 4YHKH 3V6FA 4OZIA 5D9SB 2BVOB 1OD7A 3QXWA 4OZ4A 4W68A 4P2RE 5HDOA 5IKCA 3EO1A 2FGWH 3GI8L 1NMAH 4OZHB 1YEHL 1KNOB 1P2CA 4ZPTB 5KOMC 4PJFB 5EULV 1URLA 3C6LC 4FG6D 4QCIB 1TQBC 5HGDA 1BREA 1J8HB 3QULB 1IGCH 4P2RA 1AFVH 3ZDYF 2B2XH 3U7YH 5E99L 4JY4B 5HYJA 1CIUA 1ORSB 1Q1JL 3EOTL 1T1WB 2VTFA 1VKXA 4P2OB 4PJ9B 5HHOA 5BOPA 1SJHA 3N85L 5FM5O 4BZ1H 5JDJA 1CL7L 1KFAH 2HT3D 3QNXB 2FX9L 2ZUUA 3ZHDA 5I2IB 5J1SC 1A6AB 1HZHL 5MEOA 3K4DA 1DQML 4G6KH 4P2RD 2AGJH 2R1XA 4X0KA 1D5BB 4LF3B 3B5TA 3MXVL 4N9GA 4R2GB 3VFGL 5I1AA 1AXIB 1N0LA 3D85B 5ERWB 4OFVA 4ODTL 3RWJA 5D7JB 4KH2A 3ARZA 4U3XA 5JW4M 2AK4B 3BE1L 3V52L 3SO3B 4UQ3B 1LDPH 4KUZH 3WFZA 4WV1B 2IAMB 3DRQB 3QAZC 1MCJA 2V9RA 4YR6A 4CU7A 4K3DL 3ABZA 2FJFA 1YECL 2XKSA 2H9GA 1JTPA 4G8EB 4PLKD 4GT7A 1HQ4B 1NQBA 2JJUA 2H41A 2AJSH 4HKXB 3HR5A 4YHPB 5IOPA 2RAMA 2APWA 3N1FC 3GJEB 3LEXA 1MCOH 1SM3L 4MXQD 1T21B 5EUOB 2ICEA 2H3NB 1RFDH 1WIPA 3ORJA 3TBWB 4FMKA 1NGYB 2AJYL 1U8MA 4WUKH 4Z6AT 4XPBL 1RHFA 4KQ3L 1N64L 3O8XA 3MO1A 2FLRT 2XN9B 3TJHD 2JIXA 2VDKL 1MWAL 1QBLL 1BGXH 4IRSA 5TH2A 3T4YB 1OCWH 2DM7A 2PYFA 5AAWA 1V8HA 2GT9B 5TQ2H 4R26L 5GGTA 3H9ZA 3KLHC 3U2SB 3FQUB 3P0YL 4NQDE 4B5EA 1RZIB 5CIPB 3RVVD 1HHJB 5L0QB 1LO2L 1GGCH 4WI5A 5DJ6B 2ZSWA 3CH1A 5EBWB 3GK8L 1NBYB 4NQDA 4YBHA 4IRSD 4OIIH 2D9QB 1T1XB 1AXSA 5HHNA 1KENH 4KZEH 2WP3T 4YDVA 5ICYB 1CLOL 3MRLA 4ZTPL 1R3HA 4IJ3C 3S96A 3VXSA 3MSPA 4X6DE 3TBVB 1F90L 2OTWB 2ZPKH 4LHUD 2YMXL 3JVGA 1AD0A 2I27N 1QFPA 4WCYL 3U0TB 3TO4B 4RX4D 2VH5L 5T1MA 4XXCC 1DL7L 4GSDH 4U1GC 1X5FA 4OLZL 4LDOB 1OSZA 4NQDD 1GOFA 1UCBL 5F9OH 5FOBA 4L9LA 3S37H 4X6FA 5I1HL 1WIOA 2YS4A 3UO1H 4AEIL 1MRFH 1O7SA 2D7TL 2FDBP 5B4MD 5I6XC 1OSPL 1YY9C 1ZWIB 3IAQA 4K7FA 1NCCH 1RJLA 1ROWA 1CFQA 3IRPX 3ZYZA 4JZOA 1AGEA 4U1KA 5E7BA 3P4MA 3FQWB 4QRTB 5I19L 1I9RL 1RIUL 5EU4A 3K1DA 3V6BR 3GHEL 1P69B 1NDMB 4HFUL 3B83A 4G42B 3UJIH 5ENWB 1BFVH 3L7FB 4ZS6C 2DLFH 1YN7B 4G8IB 4MXWH 7FABL 1JZ3A 1J7VR 1FYTB 5IQ7L 3KJ6L 3IAPA 2MFNA 1ZMYA 3WS3A 3GMOA 4TNWK 3BX7C 2D31B 3OR6A 2GUOB 5L7XL 3MLYH 2HJLA 4DZ8A 1JHKL 1YNLL 1MVUB 1I7ZB 1I85C 3CVHL 3V7MA 4QHLA 2GKIA 1IJ9A 3AB0C 1AO7E 1VFUA 4NQVB 4FQPA 1V5JA 5DMYA 3T0EB 2OL3A 1I1AB 2EKJA 3KHQA 2CRZA 2EE9A 3FO2B 4QT5B 4UU9A 4DUXA 4YDLB 1UB6A 5T1LA 2A6DA 3BQUD 1KB5H 1ACYL 3MZTA 4DEPB 3O3BB 1NGXB 4MWFB 3U6RA 2R8SH 3PV7A 3ARVA 4LAJH 2MQ0A 4YGAB 4QXUL 5I18H 2XT1B 4OD1L 3S34L 4JY5L 4TSAL 3NIFE 2MPAL 1IEHA 3T1FA 1GZQB 4DN3L 4EIZC 4R0LC 1K85A 4NKOB 4XAWH 4EN3A 3MV7B 4PD4K 3B9VA 5JPNA 1RZJL 4R7DA 2JKXA 4WJ5A 4F7CB 3WXVL 1AO7D 3QP3A 3AAZB 3DYPA 2XXMB 2I5YL 2PO6B 4H25A 1F6AB 4YHOH 1TJIH 5C0EA 4FXKB 5TE7H 4I48B 4U1NA 1WITA 1L6XA 4N1EA 2P8PA 4I0PC 3ZKQD 1OW0A 3P0VH 1I3GL 3CGTA 1WZKA 1CU4L 4F7MA 3HNVH 1RZKH 3CK0L 1Y0LB 2FWOB 4TVPL 5FA3B 1I7RB 2GJZA 1FL6A 1H8OA 1QOKA 3OXSB 3VXRE 2FHFA 5T1DL 1A6WL 1U42A 4OJFH 2WINB 1WC7A 2FEEI 3TN0B 1B88A 1V7NL 3ESVF 1F4AA 4UQ2A 2XA8H 3MYZA 3T4AB 1U3HC 1PG7H 1DE4A 4DQOL 4DGVL 2V5SA 3ARWA 5F97E 1IGTB 1H9VA 1F2QA 2WIIB 1P1ZA 4QRQA 1LEKB 3U4EB 2XRAL 3OHXA 5EPMB 2KBGA 5EOCJ 3O4OB 5IF0A 2FX8H 4LLMA 1XR8B 3MLTA 1JZ8A 2ITDB 1UACL 1QPPA 1C08B 4KPHH 4PRPB 3EAKA 1BM3H 2B4CH 3H3BC 1RZ8B 1IKNA 3UZVB 4LRNL 2Y6SC 2DLEA 1I8IA 2WBJA 3A6BH 4NQEE 3WD5L 3S9DB 4C59B 2EE2A 4HUUA 1QLEL 1MCSA 5E03A 1D9KB 1ADQH 3ULVF 1IC4L 4U6XB 3VXRD 1FVCA 4ZS7L 3WKMH 3VG0L 4G8GA 2JCCE 3SEPA 4NQEA 1C12B 3IJSA 1A4KA 3I9GH 4KVCH 4GBXB 4JHWL 2ZOLA 3FO0L 2QADD 4DGYL 5DD0H 1FAIL 5ESAB 4HIJA 3D39A 2WBJD 4XZUB 4Z18A 1DLHA 4NO2A 4KDTA 5D96C 5FK9B 4PRHA 1KJMA 2AJZB 2QQQA 4JFOA 1MPAL 1A47A 4ZXBD 2GITB 4CUCA 4OD3H 2P45B 4HIEA 1MCWW 4NQED 3AVEA 5DK2B 5HGHB 5EWIH 1AHWA 4HS3B 1JZ6A 4PR5B 4D9QE 4G6MH 2PCPB 1A2YB 4I3SH 2CRMA 3BGFB 35C8H 4GH7B 4QWWC 4LBEB 4Y5YB 1A7QH 4E0RB 1S9KC 4JQXA 3HAEA 4XNXL 5FYLE 1YDPB 2ADIA 1RZGB 2UV3A 1T66D 4DTGL 4YAQA 4KTYA 3ULVE 3IXTA 2OI9C 4TPRL 4DKDC 2CXKA 2ATPB 4FQJH 3MFFB 1ZSDB 3D2UA 3MA9H 1MCBA 1Z3GH 4Y5VC 4GUPA 5DR5H 2NY6C 4GW4B 4TTDD 1SY6H 3TNNB 3OL2A 1TTGA 1P84K 2F19H 5CP7B 1OF2A 1QQDB 3EOAB 2Z91B 5CZVH 4B0MM 5LGJA 4D9QD 3H42L 1NC2B 4ZFZA 5MEPB 2EDHA 5K59E 4GFTB 5EBMB 1A0QH 2YWYA 5E56A 3PABA 2V2XB 4BQ8A 4DOHB 3WN5A 4C54A 1O5DT 3LN4A 3MOAH 4YHIA 2VB5A 3CZJA 4GKZB 5D70H 5EC2B 3RRQA 1UYWL 5FYLD 3CJJA 3L3HB 3GKZA 3E2HB 3DMMB 4P4KB 2VXVH 2X10A 3SGJA 4WEBH 4A6YB 4XCFL 1DTUA 1U8PB 2FL5A 1DBML 2A83A 3MRDA 3MRRB 4KK8C 3EJJX 5FYKL 3S4SA 1FL3B 1YMME 3QDMB 3M17B 5MEQB 4HH8A 2RFXB 5INCA 4P23C 3FZUD 3U46B 4LLAA 4D3CL 1G7QA 1FORL 3Q48A 2HG5B 3WSQH 5DYOB 5F7EL 2NY7L 5DQ9A 4LCYA 5J6HA 1OD9A 2XG5A 3IFNH 1FNSL 2RGSA 1OL0A 2X1WL 1OAQL 3B9DA 3GSQB 4G3YH 2EDQA 2XZQL 2G5RA 3VFOA 2EIEA 2Y07L 3FOMA 3QXAA 4NQTA 5DRNA 3VFSA 4MDJA 3GSUA 3HC4H 5F3BA 2NY0C 5JIHA 3UROR 3WMSA 2YEZA 1CK0L 1IGFL 4HAGA 3SE4C 1YMMD 1FZOB 32C2B 4X9HA 4MXVF 3VXPB 2GYSA 2JB6B 4JRWA 4EXKA 4HS8H 3DX9A 2NW2A 5BW7C 2F53A 5DURD 3VW3L 1QFWL 1SEQL 4YK4C 5CEZH 1RZFL 2IEPA 3QEQE 3TGXA 4KXZH 1HDMB 2J8UA 2X4QA 3F7RA 4PRIB 5D7LE 2Z31C 1UC6A 4XTRD 1RHHA 3ARFC 2V2TA 4N0UE 1I8LA 4L3EB 2FZ3B 4LARH 1MEXL 5C08E 3QEQA 4OT1H 3GK8H 5E4IA 1FFNA 4J23A 1FZJA 4X5LA 6FABL 5J8OA 4LKCA 5D7LA 5GGTH 1BWWA 5DGQA 2F53D 1CGSH 3KPQB 2VXSH 3HRZA 1FIGL 3W81A 1N2RA 3Q6FA 3BIKA 1MHEB 1T0NB 2R2HA 4POZC 2DQHH 1MFCL 4FZ8H 4K3JL 3BZ4B 4ORGA 2XIDA 1RIVL 1QA9A 5FEBA 4PJXF 3TBYB 3PJSA 4NQSB 4POUB 4BSWA 1J87A 1OPGL 3RWFB 5F7DA 1QKZH 3QEQD 1IEAA 1JPSH 1Q0YL 1U2HA 5DJCA 5D7LD 1G7LA 4RQQB 4NRXA 3GB7A 3JV0A 3QDGE 3B3IB 5C07E 3UPRA 4P9HC 5CJQL 5HPOA 1CI5A 4L4VB 3S8WA 3D25B 3H9HA 3HE7A 1NEZA 4QHMA 4PRNB 1FE8H 4YUEL 4PUBL 1JYNA 4UZGA 5F1IB 2EYRB 4EDWH 2GCYB 4I2XE 1N26A 2P5WA 1N8ZA 3RHWK 5MERA 4G7VH 5TDOB 4ODXA 1CVRA 2B1AH 4YPGA 1XGUB 3UTSE 5EU6E 1MAML 2EICA 2XA3A 1NC4B 3VG9C 4Q6IB 3WFHB 2VDRH 1EEYB 4XX1E 5HHPB 4I2XA 4DZBA 1O0VA 4OAWA 3HE7D 4GRLB 3BDXA 5EU6A 4ESKA 1Q9OA 4OFIA 1MY7A 3AMLA 5JA9A 4NWUH 2OSLA 3QDGD 5C07D 1H0DA 2FBJL 3EDEA 4PJXE 3ZKND 1J0JA 5KSVA 2ICWJ 3ESUF 5KOVC 3QNYB 4P5MA 3FO1A 5I8CA 5EA0H 2YA1A 4E42B 2QKIA 2HKFL 1WT5C 4YXKL 3UTSD 1G84A 15C8L 5EU6D 4RA0C 1OTSC 4UILH 3AS0A 1TQCC 2OL3H 5J1TC 3EFFA 2A6JA 3QIWB 2X4SA 4JJ5A 3WIHA 3MRNA 5FO9A 1DBKH 3QWRA 1QRKA 1R5VA 2GK2A 4HWBL 2OJZL 5KSBE 4G6AD 1ZT7A 2P8MB 4NJ9H 1A5FH 3MRIB 2YD4A 5K9JH 4IRZH 5KVFH 1RU9L 4DW2L 5CD5C 4ERSH 1KEMH 1RK1A 3AS2A 1Q9KA 1HSAA 4OLWH 2C4XA 1YJDH 1J11A 1HSBB 3VXNB 5AUMA 1FLRH 5GJSL 2C1OA 4PTUA 1A6UH 2AK1H 1F11A 3QWRD 3RFZC 4GKNA 2BK8A 2AXFB 3S36H 5GRWA 4RMSA 1UJ3B 2PTUA 4JY6A 1FC1A 1FFOA 1P9MC 1YEGH 2XACC 5E1AB 4M6NH 1GPOH 9CGTA 5DHXB 4QOKA 3C5JB 5AYUL 1BIHA 1X4ZA 3EYSL 2CIKA 5BV7C 1KCRL 2DQTH 1P4BL 3DBXB 3VXRB 3SGDI 2FSEB 4U1SB 1JTOA 3GNML 2DQIL 3MYJB 3C5ZD 1B0WA 4L4JA 1QRNE 1XH3B 1T2QL 2QADB 5D1QC 4LPCA 3PWUA 4UT7H 3V4VH 4J4PD 4PP2B 4OTXH 3VWJA 2CO6B 3BKJH 3VFWA 1OGAA 1P4IH 3B5GA 4KMTL 3GBML 1XIWC 3SCMC 3G5VB 3RIAK 4MVBC 4MA1B 1TCRA 4XCYB 1IVLA 1JWSB 5FXCH 4LFHD 1UKSA 2D7QA 4CVWA 4K23L 4S1RL 3WNLA 1BX2A 3QI9B 4E5XB 2A6IB 2VDQL 4GKSA 3GO1L 4N0FB 5JW5A 1IQWL 3CFDA 4IRJC 4U1MA 5INDB 4YXLL 2AXGA 2KPNA 4FFVC 1SBBA 3O9WC 1L7TL 4OLUH 2NZIA 1A4JA 2ZOKA 2DAVA 4P4RB 4Z7WA 1OGAD 3FMGL 3LCYA 2MHAA 4P46C 3G5ZB 1VFBB 4LEOB 4JZNB 3T3PF 4WTZG 1K4CB 1D5MA 1QRND 4YIQB 1BP3B 3W11D 1PQZA 3KPSA 1EGJA 1KC5H 4ZPTA 3QB7C 4PJFA 1W0VB 4Y4FB 3MV8E 5TFSH 3RTQB 1J8HA 1LO0H 2EEAA 2CK0L 3JV6A 3W9EB 3WUZA 4Y4KA 4PRDA 3SKUD 5DK0A 4A2LA 1AQKH 1ZAGA 4ODBD 4IOFC 4FQQB 1EGJL 2R0WL 4P57B 5IWLC 4N8PA 1A7RL 4OUUB 3SGKC 3PDOB 4PJ9A 3WS6A 2BSSB 3VA2C 4AY0A 1JI1A 4K8RD 1E6OL 3SE9L 3LN9A 4MNGB 1HCVA 1EUTA 5H2BB 1ETZB 1FPTH 2NX5B 4XPTH 3RVXC 4KK5C 3L3JA 3D0LA 4EVNB 4M8QB 5EIQA 4Y4KD 1P7KB 1F3DH 2NYYC 3P3YA 5EG6C 3ME0A 4NQCE 4LF3A 4EKXA 1S7QB 3EYOB 3CSYB 1S8DB 2ZUSA 1HN1A 3TC9A 3HAEH 3D85A 4NPYA 2YSSB 4I4WB 4R97B 2EO9A 5F9JA 1C7SA 4JKLA 1RUMH 2VJXA 4OKDA 3HTLX 1BVZA 3BPOC 5DUBB 3T3PE 4PJ8A 3LN5B 4Y16A 5I1JH 3ARBA 4J3OC 1YYML 5FYLH 2BSTA 4JPVL 4ZTOL 4Y1AE 2BVYA 4HFWA 4G80A 3BGAA 3P4NB 3F8UB 1AGDB 1T21A 1CFNB 2H2PD 4JPWH 5EIIB 1IGML 5EUOA 5IMLB 5F7KC 4R4FH 2P8LA 4Y1AA 3VDAA 3TBWA 4PJCE 4LSSL 4NQCD 2FX7L 3HZVB 4PJ8D 1CFTB 1KCUH 4U1HA 4Y16D 5CCKH 4JVUA 5J13B 3T08A 1EJOL 1YMMB 3NVQA 5F8QC 1JUFB 3DHMA 3T4YA 3QXVA 5LKNA 2R23B 4K2UL 3QUKA 4HMDA 4OCRL 4UT9L 5E0QA 2F58L 4WWKC 1WFNA 3U2SA 3FQUA 2VDMH 5CIPA 1HHJA 4H88L 4PYGA 4WVRA 4JHAH 4Y0GA 4Y1AD 3TWCL 3FOLB 3RJQB 3NPSB 4O4YH 5DJ6A 2W38A 4OGAD 3RIFF 4PPTA 3FT2A 4XP1L 2BSRB 5HYEA 3MRPB 3KYOB 3V5DB 1NBYA 3LKRB 4PGZA 3K8LA 4YBQC 3C6LB 2ED9A 1BOYA 5L2KA 4CVZA 3RWCA 1IGFH 1TQBB 4K3GA 3MLVL 4EI5C 5J7CC 5ICYA 2VXQH 3SO5A 1WF5A 2UWEB 4KKNA 3H3KA 2OTWA 2VN7A 2YWZA 3QO1B 4PJDE 4FQ2H 5IT2H 4XNYH 2ZUYA 5DVLA 1CDUA 1KXQE 3KR3H 2QSQA 4RBPH 3JTTB 3NMEA 4LSUH 1JPGA 1BMGA 1JP5A 3SHSA 4CRPA 4PJDA 3KPOB 3E8UL 5I17A 3T2OA 3I50H 2IANE 1DSFL 5JA8B 1TVBB 5K9QI 1F4HA 5EZJB 5C08B 4LP4A 1F97A 3FQWA 4QRTA 3S3SA 4TN9A 3MRCB 4WWID 3TT1H 5DD3L 4N0RA 1BZ7A 4G42A 1CDJA 1KJ2A 1KTDA 5ICZB 4MD0B 4WIQA 4C4KT 3L7FA 2R2BB 3P30L 5BQ7B 1PY9A 5F89B 3NTCL 4O51A 1VPOL 4PJ5B 3QAZB 5DDHA 2IFFL 2BNQB 1CDGA 5J1AB 3IDYC 4RWHA 4LCCC 2D31A 2QHRH 5IV2B 1FN4A 1MVUA 1AGCB 1MREL 3QQ4B 1CXIA 5B39G 2XPGA 4AEHH 1JCKA 1KACB 3QIUD 4TQEH 5E2UH 2QQNH 3T0EA 2IAND 2V9TA 4KKAC 1OAZH 4GMTL 5TJWK 4W4NA 5E7FA 3FO2A 5J56B 5FKPA 4N5ED 4KZDH 4K3EL 3VMNA 4X5XA 1LO3L 2MKLC 5IJVB 3O3BA 5FUOL 4MWFA 5HDBF 2W59A 3GMNA 3MRHA 3W0WE 1GHFH 1IGJA 1TLKA 3UTSB 5EU7C 3OAZK 2XWJB 4H5SB 5ADOH 5KN5B 1ED3A 3VJ6A 5CZXD 3GRWA 2VIRB 4K94L 3TZVA 1HEZA 3BKYH 2EDKA 1S78C 2AJ3A 1ZLWK 5M7QA 3A67H 4U7KA 5CKGA 5ISZB 3C8KB 1LK2B 3MGTA 1CICA 2VAAB 2EDWA 3RGHA 4F7EB 1RUAL 5IFAL 3TH2T 1RUPH 3GRWL 2OR9H 1MFDH 1UVQB 4FXKA 2E5EA 4PJXB 3Q2CA 4ZUSA 3QO0B 4KGJA 3RVTD 5MP6H 3TZVD 4X4YB 4JFPB 2XXCB 4CMMA 4IJ3B 3DIFB 1T03H 5C0CB 1I7RA 1D5ZB 2HH0L 4HUMB 1CICD 3L3IB 3OR7B 2WINA 2X4NB 4YDJA 2YD2A 2YA2A 3QDAA 4AG4L 3TN0A 2H2SD 4WHDA 4U1GB 1JPTH 5GGUB 2P7TB 5D5MA 3T4AA 1G1CA 2AV1A 3GIZH 2Q6WB 3BOVA 5HDBE 5CHNA 5IROC 3WIHH 5FM5M 2WIIA 3KYAA 5CINL 1LEKA 2O5XL 2VMFA 3NFPB 2VLJA 4LK4A 1MRDH 4CL7A 2NNAB 3NABL 2ITDA 4NC1E 1WSST 1C08A 3BIBX 4O2CA 5TF0A 4BFBD 1H3TA 1OAUL 1RZ8A 2CMRL 1CDIA 3IVKA 5KSUB 1KN4L 1QBML 4DVBB 4PBWD 4I77H 1QLRA 1TETH 5F7HA 3CFCH 1RJZA 2FYYB 1FNLA 1N5YH 4PB9L 1YPZF 4KRNA 2X6MA 4ZO9A 4KROD 3R1GH 3S88L 5LBSL 4IMKA 4LASH 2B7DT 3VD7A 4WHTB 3AB0B 4J3XA 2HRPL 4Q7DA 4M1CC 5ESAA 3CMOL 1BQHB 5C0IA 4XZUA 1E4KC 5JXAL 2DYPA 5FK9A 5GSRB 1A3QA 4IOSD 1K8DB 3NFSL 4RFNC 3RUGE 3RKPA 4JKPH 1UCTA 1SMOA 2AABH 3H9SB 4M9PA 4NSKA 8FABB 4ZAKD 1OB1B 1SYVB 4HAFA 4QXWA 4Z7OF 5IVZA 5DK2A 2VLKA 3MCLH 4PR5A 2HLAB 3HI6H 1A2YA 4R0LB 1Z2KA 2FCBA 5D2NA 1YNTB 5DUPL 4OD2B 2DYPD 5JZ7C 4WEMB 1YDPA 3OAZH 2B1HL 4Z77B 1RZGA 3I6GB 5JR1H 2X40A 5ITFA 4F9LA 3OBAA 4HT1H 4XNMA 4KU1A 4I0PB 3RGVC 3FFCE 5EU3B 4XVUC 2HJKB 3MV8B 4K8RH 1A7OH 4JQVC 1RVFL 5CP7A 5IFJB 1G6RL 4OFYD 5EZOL 2IALA 2BVEA 1JGUH 1NC2A 5MEPA 2OJEB 1KG0A 1BFOA 5E8OA 2FGZA 4KRLB 3O6FC 4MJ4A 3BVNA 4TUOA 3V4PL 1KXVC 1U3HB 2Q3AA 1BJMA 3MRMB 2ZUWA 4ORZC 5EC2A 5E94A 4I3RH 1IT9L 5GRXG 3DMMA 2FR4B 4P4KA 1QD0A 4A6YA 3GHBH 1YA5A 1AH1A 1QR1B 1FAKT 2VOTA 1PEWA 1Z0NA 4JFFB 4PJHF 4HKJB 2M8XA 3WFEH 1FL3A 3QDMA 1T89C 1B0RA 1MNUL 3FFCD 4NQCB 1UWEH 3M17A 4GXUN 3VFUB 3O45B 4U6VL 1YNKL 1OAYL 3JWOL 3MMEA 2J4WH 3U46A 4A6YL 4KK6C 5GS1C 4JE4B 1T83C 1W2KT 1K3ZA 1LMKA 1NSNL 5D2LB 4KJQD 3RIFK 4LIQE 5D7IE 3X12B 1BF8A 5C7XL 1C5CL 1UXWA 3T1WA 4YFDB 3TYGH 3Q1SL 5DJ0B 5GZOC 3GM0A 4LEXL 3U48A 1SJVA 1T5XB 3H7LA 2ORBL 5D96B 4OBRA 5ADPL 5D7IA 2E9WA 1DUYB 1N4XH 4F58H 3VFVB 3G5XB 1GOHA 3FQTA 3VXPA 2JB6A 4IOIB 4NO5B 3F7VA 2V7NB 4LSDA 4GW5A 4UDUB 1E4WH 1RMFL 5GHWL 1FGNL 4M7LT 3VFRB 1RPQA 3VFPB 4PRIA 3QCTL 4G43B 4ZQKB 3MRFB 1YUHB 3K4AA 4NNYB 4L3EA 4N0YL 5HYSB 1MIML 4YDKL 2V5MA 1JYXA 2EKSB 5ABDE 3PL6A 2GY5A 5LCVH 3LH2L 3KPPA 5E2JA 1Z0MA 3MREB 1AY1H 1CS6A 2OI9B 3KPQA 4URTB 3G6DH 1G9ML 1T0NA 4OCWL 4Y5VB 4LCWB 2NY6B 4MAUL 3OJMB 5GRZA 2NXZD 4LCIL 1NL0H 4NQSA 5AZEH 3UC0L 4S1QH 3WEXB 4MJ2A 1NKRA 2FJGA 2VC2L 3F7YA 3ZTJH 5I1KH 4B41A 3PL6D 2DB8A 2APXA 2F8OA 4J1UB 3TT3H 3MJ6A 1HINH 1KT2B 3MUJA 1E0OB 4FMFA 5IB2A 5FYJU 3JWNC 3V5KB 2XKNB 5EIVA 1AXTL 2HT4C 1XZ0B 3D25A 4LGPB 1I1CA 4JQIH 3O4LE 5F1IA 5MHSE 5DJ8B 4N8VB 2IANB 4QNPF 4Z76B 5TDOA 1RUQL 4X7SH 4WGWB 4E41B 4NCC1 2MCPL 3HCVA 4XP6L 4P2QE 4ZG1A 5DTFA 4Q6IA 4WW2C 1UWGH 2BY2A 3MROB 4I18A 5EH1A 4XH2A 4P23B 5ILTL 4F3FB 5HHPA 4WI3A 4JO4H 3SKNA 1A6ZB 2WLYA 4GQ9H 1D3CA 1Q94B 3S3JA 4RNRB 4RWYL 1AQDB 4GRLA 1J5OH 5M94B 5D93C 2W92A 3OMZA 3DGGA 1KJ2H 1TJHL 5DFVC 3RU8L 1ZEAL 2IADB 3GIVA 4LDLB 5CAYB 1I1FB 3BZDA 1CBVL 3N9GH 4FQLH 2X7LB 2YD5A 1DFBH 1CN4A 1MVFA 1FO0L 1E4XI 1XR9B 5FCSH 4G7YH 4KRPC 4WI9A 3O4LD 4PGDA 1P7HL 3QNYA 5MHSD 2OP4L 3IU3B 4ALAL 2AJXL 2NXYC 4U33A 2NY0B 2AEPH 2HFFB 2VL5B 5IB3A 1KN2L 5F1KC 5FM4A 1DLFH 5AZ2L 4P2QD 1PY4A 2MOVA 3PDGA 2ZUQC 3EDFA 3X3GH 1CLZH 4NFBA 2FECL 1MCFA 4LLQB 3W0WB 5B8CA 4RIRB 4RRPA 4XCNB 4YK4B 3TIEA 4GG8B 2DIAA 1H15A 1SBSL 3MV11 2IGFH 1IM3B 2Z31B 3ARQA 3OZ9H 1UM5L 5I1DB 2ARJA 3LHPL 4JM2F 3ARFB 4X7CC 4MMZC 4J3WA 1JI2A 1QEWA 1E6JH 3LMJL 4FQIL 4NYLB 4FFZH 5LJYH 5KVGH 3CLEL 3HUJE 3LS4H 2VDOH 3NFNB 5LGKA 5FUCE 2XTLA 1BBDH 4UNVA 1TJGL 3JSSA 4X9FA 2VXUH 4LRIC 4EEEA 2FH8A 1UJ3A 4IS6B 2HVJB 3ARDC 2AW2A 1FNGB 3V2AR 4AL8H 4M6OL 1DQQB 3DUUB 1KIRA 3H6JA 1T04B 4L8SC 1ZANL 2ZCLH 5CSBA 4HPOL 4CDHA 3TA3D 1S7UA 5B38B 4PYHA 2GSGB 3ZTNH 5DLMH 1NAMA 2FSEA 1X5ZA 2YRLA 4ONFL 1JRHL 4U1SA 2OTUA 1S7SA 3MYJA 1B4JL 1VFMA 2JELL 3CX5K 2YPLE 3IF1B 1MLBB 3DSFL 1ZLSL 3WO4C 3KPMB 5DRXA 3NCMA 3UDWA 3TVMD 1NMBL 4PP2A 5HGGS 4YC2C 2O61B 3BAEL 5TE6H 1P6FA 1U8KA 1WAAA 1QSFB 3QXTA 3G5VA 4FQCL 3D3VA 4OCYL 4XCYA 5C0NC 4ZAKB 3MXWL 1H3PL 3QI9A 2A6IA 3OB0H 3SGDH 1X7QA 1KSRA 3MNZA 5ID1B 3PGFL 5TF1H 4X4MA 4JREC 1U9KA 1IZKA 1CGTA 2ZG2A 4MJ5B 2YPKA 5FYJE 5GRJH 3HHRB 1G7IA 3S35L 2X4PB 3B6SA 4LEOA 3ZLQC 2HTLD 2VUOA 4JZNA 4PD4J 3ZHLA 3D3VD 2DQJH 4L1HA 3LKOB 3RPIA 3L3OA 3HB3D 1W0VA 4Y4FA 4WY7L 3PNWA 2DBJA 3WLWC 5CGYC 3PF2A 2MQCA 4GRWH 4N68A 3WIIH 1TQCB 4JM2D 4UNTA 3BKCL 4BM7A 1U8OA 5C9JB 5GS2H 3B43A 4FQQA 2VISB 3NZ8B 3MLUH 2P24A 3JV4A 3VFNB 1HNFA 3PDOA 3BIAX 4QRPB 4NZTH 1LNUB 4O5LL 1NCWL 4LGSB 1D5IH 3ZO0A 3VI4F 4D0CB 4QHUB 3E3QC 5FYJD 3HNSH 3BESR 4EVNA 3NAAH 2K9UA 2EIZB 2MJWA 3SY0B 1F4YH 5F96H 3RKDC 5HDQL 5E2VL 2NY3D 4Z8FH 5I1CH 1NBQA 2P49B 2BOCB 1S7QA 1JN6B 3JWDH 3S37X 3MR9A 2YUZA 3UYRH 2YSSA 4I4WA 4WHCA 4JO3H 1YPZB 3FFCB 1MCIA 5BJTB 4Y5XA 3BFOA 3KG5A 3WFBL 1JTTA 3O3AB 5BV7B 5J57B 1K2DB 3MUGB 1BD2B 1FNHA 3ULVL 1A02N 2AXHA 1HHIB 2ITCB 5HVHC 4QXGL 1CXHA 3BZFB 2R56H 5A16B 1CFNA 3VH8B 3G6JB 3MLWL 3VGDA 5JIPA 4G8FB 5D1QB 1Q9LA 5IMLA 3RY6C 4M6MH 2DN7A 4LPUA 3MODH 5F88A 1B2WL 4LP5A 2BERA 3U9UA 1DN2A 4ETQB 3MGAA 5H94B 1CFTA 5FGRA 1XIWB 2QSCL 4N0CD 3SCMB 3KYKH 1FVDB 1FNAA 3QQNA 5IHUL 3GSNB 4Y2DD 1BECA 1JF6A 4K9EL 4MD4B 1LEGA 4TUKH 3PWNB 3RNQB 4IRJB 2KUTA 3WBDA 3QFDB 4KMLB 2XFXB 3B9KA 2WWKO 4JN2A 3CSGA 4LEXH 2R4RL 2AXJA 2ICWI 3BDYH 4P46B 2BSRA 3JUYA 3OX8B 3MRPA 3L5HA 4JKKA 1MCEA 4ZUWB 3LKRA 3WHE0 3C6LA 5KG9B 4QXTA 4L4TE 4X9IA 2UWEA 3L9RA 1BOGB 3PP3K 1R3JB 3B9KD 4MQXC 5T33L 3U4BH 2EDOA 3PUCA 2NLJB 3FQRB 4LIQH 1F4XL 1P84J 3V95A 1ONQB 4P9MH 5I8OH 5JZ7D 3IXAA 1PDKA 2I9TB 5JIIA 4LDEB 4M5ZL 4PJHB 3KPOA 4S10A 3HFML 1IGYB 1ZHBB 5F9DC 5J6GB 4CMHB 4M4PA 3SE8H 5EZJA 3IDXL 5FGBA 2BHYA 3RX7A 1XFPA 4LCUA 4UI2A 1PG7X 3LRGA 1KYOJ 2ESVB 4BH8A 5ICZA 1A6PA 4L4TD 4MD0A 1G7JB 3F58L 4NRZB 5BQ7A 5F89A 3ALXA 3FQNA 3BPOB 3VWKC 4JJHA 2PXYC 3MV9A 1UWXH 2HLFD 2YK1H 2OTPA 4O2FA 5C0AE 1MAJA 4OGXH 2EIDA 1A14H 4X6EB 3O2DA 3QQ4A 4EJ1C 3CZFB 4XPFL 2G5BA 3MNVB 1CQKA 4X6CA 5FO8A 4P5TD 1JYWA 5IW6B 3V79C 2W65B 4XNQA 2DTSA 3BH8B 5DMGD 2VKWA 4RISL 1D5XB 3K1KC 5I66A 4Z5RB 3MV9D 4NO0D 4MD5A 2D2OA 4XBEH 4WTWA 1NLDL 3DURB 2QQLL 4GO6B 2FEDD 3IFPA 1DQTA 4P2QB 5JNYB 5LXGL 5I76B 1CDYA 5LWYL 1C1EH 4YHNB 5E8DH 4WWKB 1W72L 4QO1A 1TJHH 4WW2F 4AJ0A 2VR4A 3OKYA 3S4SG 1GH7A 5C0AD 4NJAH 3CFBA 4JFZH 4Z7VF 5ISZA 3C8KA 2BCKB 2IQAB 1LK2A 2YD3A 2JLLA 1KUMA 5D7KE 4F7EA 1IC7L 3C8HA 4PJGF 2HTKD 2W0PA 2W9EL 1UVQA 2OP4H 4QGYA 3AXLB 5EN2A 3CDGA 4ALAH 1NH6A 1U0QA 2YBRB 4F7PB 4YQXH 5CLWA 1WWAX 3QO0A 4U6TA 4EI5B 3TP4A 1YC7A 2IBZX 4X4YA 1DN0A 1W0WB 1F58H 1ORQB 2VDLL 3ZDZF 3HMWH 3DXAE 4XWOC 4JDVA 4ZD3L 1NCBH 5ESQB 2BNRE 5FO7A 2NW3B 4XXCA 2YKLH 1KCSL 5GGUA 2ADFH 2P7TA 1IL1B 4HK0A 1CE6B 3IJHA 2FB4H 1A7PL 5DK3A 5E6IA 5D7KD 4HIXH 3NFPA 4HJJL 4JPIA 5SWQA 2NNAA 4KFZC 1GSMA 2EH7H 3QUZA 1MLCB 5JUEH 1C5DB 1N6QH 4JANB 3PG2A 3BZEB 1JV5A 4LSVL 1ZLUK 5IGXH 2FEEL 4MCYB 5AYQA 2R1YB 5D6DC 4DJMA 2BJMH 4Z7VE 5FV1L 4UOW0 1NGWB 1BVLB 5ALBH 4M48L 2P5EE 3TH3T 5A2LH 2CJUL 2Y5TB 3ALPA 4PJ7F 3DXAD 1NCTA 4GJTB 5CSGA 5KSAD 5MENA 2PYEE 3IDYB 5E6ID 5IEHA 2BNRD 3ZL4L 1FCCA 1GL4B 2VE6A 5LGHL 1I85A 3QUZD 3PWVB 3ROOB 2P5EA 2RBLA 1A3LH 2GFBB 3U36B 3PP4H 1H3GA 3JBG7 4QRSB 2QR0B 2YPLB 3ZDZE 3IFLL 3LZFH 3DVNA 4Y4HA 4P3WA 2X09A 1NAMH 4MX7B 5T5FH 3TV3H 4K7PH 4L3CA 4OF6A 3D69A 1M7IB 4PJIE 1RZ7H 1MH5B 8FABA 1OB1A 1SYVA 2DICA 1HIMH 5JW4Q 3GI9L 2HYMA 1A64A 2ERJC 4JM2B 1IAII 2ED7A 2P5ED 4X8JA 3SQOL 4HBCH 3MJ8A 2Z92B 4PJIA 2FLBT 1LE5B 3TJEH 2PYED 3QDJB 1BAFL 4JB9L 2G75B 4OD2A 2WWMD 2CDGB 4JRXB 3U0WH 4NDMA 1F3DJ 4Y4HD 4ZUTB 3BN3B 3UBXG 3I6GA 4I5BA 2BVPA 2VZ3A 5DQJB 4X7TA 1S7RA 4I0PA 5KS9F 4RGNC 4KQ4H 4C56A 1MI5A 1GGUA 3DETD 3EJZC 2HJKA 1YEIL 4JHBA 5CFHA 2WIMA 3RZCC 1S7XB 4ZFGL 5E9DB 3K81A 4ZNEE 2EDTA 5IFJA 1CT8B 2NY2C 3MC0A 3BYYA 1UFUA 1S7WB 1HK6A 3QXDB 5FYJH 3T09A 5HHQB 3D87B 2WV3A 1OAKL 2WUCL 2J3SA 1AP2B 1FBIH 1U3HA 3VXOB 4U31A 1QHOA 4YHZH 4OCSH 1A22B 1NANH 5IG7B 5SX5K 2FR4A 4JKMA 5I30H 4LL9A 2EXWD 4A2MA 5GIRB 3EGSA 5BVJA 3QHZH 3HPLB 1I7TA 4JFFA 1YQVL 1MIEL 2J12B 1U91B 3MBEC 1GYAA 3KS0H 3GJFB 3O45A 3RWIB 2CLRB 3C09C 3D18B 5CGMA 2W0KA 4QYOB 3P4LA 3QHTC 1Z5LB 1ULVA 4KMQA 2NTFB 3K3QA 5CILL 2LE9A 4LLWA 5H35A 4NT6B 4ZOCA 1D6VL 4NHUB 5D2LA 5IESL 4UV4H 5KS9E 3UTZB 2CUMA 2GJJA 4HC1A 4NRYB 5SWSE 3TLRA 3X12A 4QXGH 4DVRL 1ZLUH 1EXUA 1HYSD 1LEIA 2FD6L 5DT1H 3CFEA 1QNZL 1A6VH 1T5XA 1L4IA 1MCDA 2CKBA 2ICCA 3CVIL 4OZGF 5I1EH 1BQLL 2JJVA 2J88H 4WW1B 4XPGL 1UZ8A 3DUHA 3DX8B 1U92A 3UJTL 1XF5A 1IC5L 4LNRB 1KPUB 4NO5A 4TULL 5E2WL 1ZOXA 4CVUA 2R9HC 2NY4C 1N0XL 1EEZB 1X5KA 5GZNC 1B0GB 1J88A 4N90E 4S1SL 3FB6A 1IAKB 2NQCA 3EYQD 4HIIB 1U36A 5E5MB 5I1LB 4Y8DC 4G43A 3QCUH 1YUHA 5SWSD 3KNBB 3EO9H 3SDXF 5HI4C 5IR1B 4YFEA 4FP8H 5JQ6H 1CF8H 4LKXB 2YRZA 3TFKD 4MNHB 3G9AB 2AERT 2C3WA 5C0GB 2JTDA 1P4LB 1FHGA 1OP3K 3RGVB 2F8XC 2C3GA 3PDDA 3U1SL 4Y5VA 3NZHL 2UY7A 5I0ZA 3TO2B 4NWTH 1J1PH 2XG4A 1S5IL 3HPJA 1JGVH 4OZGE 2UUDK 3HE6D 4N90D 2ZCKL 4BK4A 4BKLA 4J1UA 3S36X 1HI6A 3O6FB 3WUWB 5HYQA 4JO1L 3ZZ1A 1NGPH 5DEZA 5LAXB 5F9AC 1CXKA 1P7QB 1ZKAA 4H1LB 4Z7UF 1XZ0A 4RGOL 1KJ3H 3R06A 1X9QA 2VQ1B 3ISWA 4J6RL 1A6TA 4N8VA 2MWCA 5DJ8A 5DZLA 4E41A 1KPRB 2K1MA 3V0VB 4HEPG 4TSBH 5HI5C 4OGZA 4M1DL 4P23A 5SX5H 3SKOA 3DOSA 3ROLB 1WZ1H 1A6ZA 1Q94A 3PIQA 2EDJA 4YHLH 5GS1B 1AQDA 4GW1A 4JFYA 3BP6A 3RI5K 5SWZB 4KKLC 2H26A 5I1GH 1I8KA 4KDWA 3MJ7B 3KPRE 5E6YA 4V1DA 3NIGF 5EU5A 3OJDB 2YC1A 5DVKA 3LQZB 2RIKA 5FHBL 4HJ0D 1I1YB 3IU3A 3O2WL 4ENEC 1IRAY 3B2VL 1BVKB 4JDZA 5EO1A 3O2DH 2VL5A 4UT6L 3STZB 1ZA6B 1PLGL 4LSPH 3SJVE 5DD5L 4JO2L 2Q8AL 3DWTA 1INEL 4JDTL 3U4AA 2B0SH 5BW7A 4Z7UE 4S11A 4KTDL 4XCNA 3V7AG 1WIUA 1FC2D 3DX6B 2VXTL 4F9PA 2XZAH 4GG8A 3D9AL 2XWTB 1QP1A 2XQBH 5CUSL 4W70A 4M8VA 4OCXL 5I1DA 2ADJB 3ARFA 3IS1X 2A77L 3KPRD 1OLLA 4L9DA 3CFKB 3BO8B 2AAVA 4NYLA 1WJ3A 3MZGB 2W9EH 3R8QA 1CXEA 1S9XA 1U3JA 3QUYA 3TO4C 2UZIH 5DFTA 1R0AL 5EOQL 2DIJA 2R4SH 2ARJQ 3SJVD 2DD8H 3BH9B 3MLZH 4IS6A 4RAUA 2COQA 2ZNWA 1FNGA 5EC1A 3DUUA 3LS5H 3QPQD 1QSVA 1N7ML 3QDHA 3UCRA 2AJUL 5C2UB 3LSOB 4AT6B 3DXAB 1F5WA 3ZTJG 2KKQA 5ITBH 5KSAB 2BNRB 3QUYD 3ARPA 4LQFH 1BBJB 4PB0L 5C09B 4L5FH 4HQQL 3T77B 2VR9A 3PHOB 3FRUB 5FF6B 1B6UA 5I1IH 3V4UL 1ZA3B 3WHXB 2RHEA 2UUDH 2O5YL 5IIEB 2O61A 2VDPL 1Y6MR 3PXHA 1MCRA 3QWOA 5BZDB 1I75A 4P2CG 1MCQA 2VABB 1IGIH 2DJUA 4PREB 1DDHB 1QSFA 3P77A 3C60C 4OGYL 4AK1A 3U79A 3VE0B 2X4UB 4P9HL 2QJDA 1AC6A 1R5IB 1FP5A 1RV6X 5GS0D 5C0DA 4WW2B 5J4MA 3LEYH 3NACL 2EDLA 1TMCB 4NZUH 4PY7A 4Z7VB 4UINL 2HKHL 3EYFB 4KKBD 4K94C 4PRAB 2X4RB 3RY4A 1NFDF 4EI6B 4PJBB 2PKDA 4PJGB 5D93B 3M45A 3O0RH 3VFTB 1I3UA 2A9NH 2HMID 2WQ8A 2HN7A 4DAGH 1VADA 3U30C 4PJAF 5A40E 5E8EB 1CZ8H 1GCFA 1I9IL 2NZ9C 4EZMA 4KRPB 1JPST 3LKOA 4J3SA 2MCG1 3VU2A 3BRGC 4HEME 1FSKC 4X4XB 5DMKA 3QISA 2NXYB 1E27A 1RZKC 2Y7QA 4YXHL 3T2NL 5HI3D 1PX4A 4GAGH 3T0XA 3SDCD 2PNDA 1R24A 3OG6B 2X5PA 4ZUUB 2VDNH 1PKQB 3GSXB 4PTTB 4ZO7A 2HFGL 1UKQA 3NZ8A 2A9ML 1BQSA 3LRSA 5GGRB 3AREA 4R96B 5LVEA 4EIGB 2X9WA 1NPUA 3RNKB 3V6OE 4P3CH 1REIA 1LNUA 1NDGA 2D3VA 2IPKA 1ZT1B 3EOBB 3VA6A 4R90H 4JLRB 4HDIB 5J12C 5E00B 3O81A 4HXAL 4XBGB 4PGBA 1S3KL 5IB5A 4X4ZA 2MNUA 4Z0XB 4LHQB 2EIZA 4WFGE 5C6TH 2B4CC 4GG6F 5BZWA 4QHKJ 3ARGC 3L1OH 5HY9B 1NFDE 5D1ZD 1HOCB 4OSUH 4PJ7B 3ARED 1OWRM 4RFEB 3LKNB 1DQLH 4Y2OA 3ARDB 1P9MA 5BJTA 1MJUL 3P73B 2NR6D 4MZ2A 1WCQA 1M7DB 2R0LL 3O3AA 4L8SB 3RAJL 4FZEL 1HILB 4FTVE 1HHIA 2PTTA 2DDQL 1NGZB 1OARH 3EYUL 4NNXB 3Q5TA 1IE5A 5A16A 4HX1B 3WO4B 3VH8A 3G6JA 2BRRH 4KRMB 5E2TL 3TH4T 1QFWM 4G8FA 5D1QA 4LLUA 2CQVA 4WFGD 4ISVB 5BV7L 4FTVA 1JPFB 4ETQA 3MACL 4APQC 3GMMA 3SCMA 4GBXC 1ZVSA 3AM8C 3GSNA 3FN0H 4KHTH 1WCBB 1UA6H 4BQCA 1A7NL 4CNIA 2ZJSH 5KJRH 3PWNA 4QRRB 4IRJA 4PGEB 3QFDA 4KI5E 4FG6C 1RURL 1WEJL 4JREB 2XFXA 3O9WA 4FTVD 4M43L 4G9FB 3K2UL 4CW1B 4XWGH 4WO4D 3OPZL 5CJOL 5KS9B 4P46A 4FFYL 5HHXL 5ELIA 4ZUWA 3BUYB 3KYMB 4PG2C 3RA7H 1VEMA 2ICWB 1Q9WB 5F3HB 4HC1H 4Y5YC 2BFVL 3WXWH 5D7SL 5JPMA 2OM5A 4X8XA 3LEVL 2DBLH 2HT3C 2OQJA 2Q3ZA 5GRYA 3REVB 1XF4B 2XTJE 3H0TB 2CKBH 1DVFA 1HXYA 3DVFA 4JEGB 1SJEA 1IM9B 3OGCA 3OKMB 3CH8A 4BFIA 2B8OT 3FQRA 5IWLA 3SGKA 2EE3A 1ZVHA 4OLVH 3CAFA 1ONQA 5IQ9B 4KI5D 5C6WH 4J3TA 5DD1H 2I9TA 3GSRB 4PRBA 4YFLI 2HFEB 5HGBB 3ILPB 4RAVB 5KVMC 3AC0A 4HWEH 1IGYA 2ZSVA 2NY5H 3W2DH 5J6GA 3LRHA 5F7FA 4NQXB 4JAMB 1MJ7H 4K07A 1DVFD 5C2BH 2J6EL 4G9DB 3KLAB 2ESVA 4PLKC 5CSZB 1J18A 1INQB 2WK2A 3A0OA 4HZAA 5TQ0H 3WLBA 2LU3A 3VXMB 1XCTB 2XTJD 3JWOC 4MXQC 3KGRA 3U9PL 4D9RE 5KW9H 2F5BH 5AD0B 4YDIH 4ZUVA 3HMXA 2VLRB 4XCCL 3TPUB 5BVPH 1QYGL 3EDKA 2H8PA 5HPMB 5HVHB 3BSZH 5BRZE 3MLPA 1BLNA 1NAKL 5JOFB 3IFOB 3TJHC 3THML 3MNVA 3IDNB 3RWGA 1MFAH 3BH8A 4YEFA 1TCMA 4NKDA 43CAA 5BRZA 2DQDL 4RFOL 1PD6A 1VACA 4DGIH 4EBQH 5TE4L 3GSVA 4F37K 3RVVC 1KCVL 3IKCB 2RQ8A 3DURA 2O26U 5JNYA 3TF7C 1BJ1J 4QGTA 5I76A 1T7WA 3SDXB 4CAGA 4OLXH 5T3XH 4D9RD 1OGTB 1K6QL 1MF2H 4IRSC 2CLZB 1CFVL 1EAPB 1Z9MA 4UB0H 3MFGB 3CFJA 3K8MA 1Y18B 5BRZD 2BCKA 2P46B 2IQAA 1VFAB 3V0WH 3N06B 4JG0H 4XP9H 4PLJD 3AXLA 3O2WH 5M95B 1AR2A 3T2PA 3G5YA 4UNUA 3O3DA 2YBRA 5FCUL 1BEYL 1NEUA 5IMMA 5KTEH 2G60H 4H20L 4EI5A 2XZCH 5GGVH 2QQKL 4YX2H 1I7UB 1NUNB 1SQ2N 3MOQA 4Q9RH 5IVXB 1W0WA 1ORQA 3WFDL 3MLXH 4FNLH 3QWQB 2DTMH 5D8JL 2HJFB 5DQDL 5B4MC 5E5UB 5ESQA 1MHPL 2BX5A 2R0KL 1JNNL 4ODSH 3ULSB 4QF1B 4PBXA 3BW9A 3MLSH 5C86A 1HH9B 4NFCA 2K3TA 3R0MA 4TNVK 3B8YA 3RDTA 3LIZL 1CE6A 4YHMH 4EUPB 3K46A 1CR9H 3NIDE 2X9XA 4L9LC 2ZUVA 3MCKB 3MOBH 5HTSA 1KELH 1J8KA 1JNLL 1HKLH 3FCTB 4PS4L 2EDRA 2UYLB 1XGTB 4XP5L 3WDIA 4HMEA 2GK0B 3UEZA 3NCYS 1BVLA 4Q2ZB 3CC5B 4Q0XL 1Z9SA 3VMPA 1BHGA 3VWKB 4LLYB 3RDTD 4OFDA 4GXVL 2PXYB 3CNKA 5ANME 4ZFOB 2DL9A 4XB7A 1FDLH 3BQUC 4LCCA 3IU4H 4JKWA 2DRUA 3NA9H 1CYGA 3D48R 3PWVA 1AIFB 2X4TA 3HA0A 2X41A 1MFEH 4U1IB 5ALCL 1JK8B 5ANMA 2QR0A 4Z0BH 4MNQE 5IHZB 1IAOA 3PWPE 5IB1B 1IARB 1B9ZA 4M5YH 4AIZB 4D9LL 3HZYB 4HULB 4F57L 3UPAA 2QSVA 4QY8B 4MX7A 4KXZI 4EOWH 4R7NA 2WAHA 2EIBA 1M7IA 1ACZA 1PKOA 4MNQA 1B6DA 2YN5A 1M4KA 4WI2A 4UOJA 5GRUH 1LP9F 2V7HB 4DUWA 4KY1H 5D71L 3CLFL 4HUVB 4XMPH 5J3HD 2C1PB 3FB7B 4ONHB 3QDJA 3H7BA 2G75A 2B39A 1V3KA 2CDGA 4JRXA 1YJDC 1DCLA 4RMWA 4ZUTA 3GKWL 2Z35B 4MYWB 2AKRB 1CDBA 5FHAH 5C0BE 2ATKB 1NUGA 4JFEE 1AE6H 2X2YA 1GZPA 5HD8D 4MNQD 2R15A 3PWPD 5DQJA 2OZ4L 2DMKA 1C8PA 1HHHB 1MQKH 4GMSL 3BP5B 5EFIA 2MQ3A 4LSTH 2CLVB 5C0BA 1R6VA 1GIGH 4N1CA 3KYNB 3RL2B 1MY5A 3VGBA 3OV6A 1S7XA 3BDBA 1TXKA 5E9DA 1ZTXH 1CT8A 3U0PA 1U8NB 1S7WA 3QXDA 4K71C 4F8TA 5HHQA 4Z78A 1OAXH 3GBNH 2DI9A 3P9MB 4GLRH 2Z0BA 5JDSA 2AJVH 2VITB 5IROA 3BXNB 1AKJD 5C0BD 2Y36L 3MBXL 4QHNA 4JFED 3ZMRA 1JIBA 1LP9E 4M7JH 2E8YA 4KJYB 3CX5J 2Q8BL 4LGRB 1M05A 3HPLA 3I2CH 3B5HA 1U91A 1MFNA 1DQJA 2W91A 1NFDB 4YFLF 3DVGB 3UTPE 3GJFA 4IIQA 1QFUL 3RWIA 2QADC 3QUMA 1Z5LA 4M1GL 2NTFA 1RUKH 2WBJC 4XPAL 4PJAB 4UTAL 2ZNXA 1BZQK 1U8IB 5HVFB 3ULUE 4YWGL 1FGVL 1ZT4B 3HR6A 3HC0A 5DWUH 2ADGA 4MQ7B 3UTZA 4ZXBC 3P9WB 1KEGH 1VDGA 1FQ9C 3QIBA 4WO4B 5DUMH 1YQ2A 4BSJA 3DV6A 4LLDA 2ID5A 1E4KA 4XVSL 5I8KH 1AI1L 5CLTA 4WW1A 4HUWB 3QZWB 1J1XH 3O6LL 5CJXA 2A73B 3DX8A 1F4WH 1CLYL 1CD1B 4KDTC 4G5ZH 1ND0A 3NOIA 4LNRA 3UTPD 1JWUA 4MA7L 5HHME 2X70B 2ZKHH 1XMWA 3DJ9A 1B0GA 4UMGA 1XGRA 1DEEB 2F54E 1T66C 2DOCA 12E8L 1EO8H 3QIBD 2GAZB 1NUFA 4U6HA 3FHAA 3MRGA 3ULUD 4GG6B 1AHWC 5E5MA 5C0RL 5FA4B 4F80A 1VA9A 3GSNH 3HLAA 5I8EB 3X14A 5GRVL 4NHCL 4TTDC 1NBVL 1WBXB 4LKXA 1T1YB 5F7NC 5F8RC 4MNHA 5C0GA 2DQGL 4HCRL 3ARRA 4UBDD 1T22B 4ZFFA 4WUUA 3MRKB 3QFJE 3M8OH 4RGNB 2OXHA 4OUOA 1INDH 3UYPA 3IJYA 4OZIF 5EBLA 3RZCB 1IEBB 3QR2A 5FDWA 4L3AA 4JQVA 1ZHNB 5HHMD 3TO2A 5GGQL 2XTJB 4UTBH 1IILE 4S0SD 5HJ3B 2F54D 2X42A 4OZFB 4OLYH 4KVNH 2OS7A 2AS5M 2HT2D 2IC2A 3CPLB 5JO5B 3LKPB 1VENA 3O6FA 3WUWA 3MRQB 5FECA 5E08H 4MCZB 5I15H 4H1LA 1KBGL 4NGHL 3KXFB 4WU5B 4XCEB 1MUJA 2VQ1A 3WN5C 3TCXA 4LSRH 2XZZA 4XRCB 1PX3A 4L8CB 1CD9B 1EFXB 3QFJD 5D1XA 2H1PH 2WSKA 3E6HA 4XC3H 2VR5A 1IBGL 4OQTL 1AD9B 3Q3GA 1FH5H 3QPXL 1VGKB 2IQ9L 3V5HB 2IPTL 1V05A 3C9NA 4NUJB 1JZ5A 4U3CA 4GAJL 5L9DL 5GS1A 2OK0L 3E6FB 2BMKA 1T83A 1HHGA 2C5DC 5SWZA 4XPHL 4JRYE 4ODHL 1IKFL 1GC1H 3HZMA 2DWDB 3GSOA 5E6ZA 3VDCA 4FQXD 1FV1B 5DHVA 4OZIE 3PV6A 5D1XD 2F5AH 5BS0B 1TZGH 3HMXH 1JYVA 4JRYA 5GJTL 3O6KL 4HXBL 3CDFA 1MJ8L 3EKCA 3A6CH 4JN1H 1UM4L 3STZA 3EFDH 3KPNB 1ZA6A 1NCDH 4XTRC 3KWWB 1JGLL 3INUL 3OWEA 3P4OA 2NY4B 2WP3O 5L6YL 4HWZB 4OB5H 4X80H 5HYJE 1EIBA 4XNUL 5LQBL 1LO4H 4DKEH 3DX6A 5CGTA 1YY8B 1XGYL 3CXDL 2XWTA 1E4XL 3I75B 1TZHA 3SQBA 4W6XB 1R3IH 1S7TA 1RIHH 4JRYD 3UJJH 5HHOE 5IBTH 4R4BB 1A1OB 4KJWD 2IBBA 2AEIT 1QVOB 3CFKA 3BO8A 4Y8AA 3LOWA 5IMOB 4QTHA 5ACZB 2F74A 5ACLA 2DLTA 2FATL 5DXWA 4KAQL 1JHTA 3NCJL 4NUGH 1LK3H 3OQ3B 1ZLVK 1NUDA 1NCAL 3BT2H 4DKFH 3QG7H 2RR3A 4RDQF 5HYJD 2ENYA 3C08H 3HNTH 4XNZC 2DQUH 4F2MB 1LO5B 2DLGA 4AT6A 1WBZB 4DFIA 2BOBB 5EUKB 3BGMB 4UV7H 1K4DB 1QSEA 3QH3A 1U95B 2I60H 5F7LB 5HHOD 3T77A 1K3IA 3PHOA 5AWNL 4FRWA 1CVSC 3FRUA 4UUJB 5DRZA 2A2QT 3HZKB 4HPYL 5IIEA 2IFGA 3HE7C 1II4E 2C26A 3F5WB 1AGBA 5CEZE 2VABA 4PG9B 1DDHA 2YPVL 1A3RH 2DJSA 1CD8A 4R9HA 3VE0A 4MJIA 1MFBH 1R5IA 4X6DF 1MWAA 3Q0HA 2EZ0D 1V7ML 3I6KB 4F8QA 1LGVA 4X9BA 3ZKNC 3L5XH 1RULH 2CUIA 3MRBA 4MAYA 3Q6GL 2DI7A 3QEUA 4PJBA 3S3PA 4IDJH 4CKVX 2JJSA 3VFTA 2JB5L 3O6ML 2ED8A 5K9KA 1G7HB 3QCVH 4P0DA 3H3PH 4X83A 2R69H 4HMCA 4OIAA 1H3WM 4XVJH 1L0QA 1FJ1A 4MJID 3BPCA 4XBPA 3T3MF 5E8PA 4UIKL 1XF3B 1QFWI 1YEJH 1T7VA 1JNHB 1KTLA 1Q0XL 2EDEA 4G6AC 4X4XA 1WWWX 4XT1C 5CEZD 3F62A 3FFDA 4PJEA 4MAYD 5GGSB 3ZYOA 4R6UA 3O41B 1SEBB 4XMKH 5K33A 3O8XD 3QEGH 3GSXA 3EO0B 4PTTA 2JIXD 5KANG 3VXSE 3PQYB 1ZK9A 1DQDL 3BKMH 4KK9D 1DBBL 3J8F7 2WW8A 1KPVB 3RNKA 5BXFA 1ITCA 3O2VL 4CGTA 2O5ZH 2YOCA 1GAFH 4O2EB 4D8PB 3FKUS 1PVHA 1XF2A 4KI1A 2PW1B 4FQ1L 4HDIA 3K8KA 5FKAB 4F33B 5E00A 1R3LB 1UT9A 2D03L 4O58H 4Z0XA 4TSCL 3SKJL 1AKJB 2V5TA 3KS0J 1FIEA 5IMKA 1YEFL 1CG9B 3QJHB 3QNZB 1HOCA 3EJYD 1MCPL 2E9BA 3WE6A 4RFEA 3UZEA 4LRIA 1L7IH 4BK5A 1G9NH 2AEQH 3C5ZC 4X99A 5EO9A 3NIFF 1R3KB 4F7TA 3P73A 1AGFB 4RAHA 3DGCR 1M7DA 3VXSD 3T3ME 1M71B 2EH8H 2OR8A 4L8SA 5EZLB 1PSKH 4GXUM 4J4PC 4U1JB 3BP4A 4DN4H 1IFHL 2C9AA 2WM0A 2CGRL 3QA3B 3P11L 1X5HA 1ZLVH 3CVHA 2KQMA 5BOZG 4NNXA 3SGEH 2EDDA 4HX1A 2I9LA 4NC0B 4WI8A 1KB5B 1EBAA 3MJ9H 5TDPB 4TRPH 3TNMB 1LP9B 4JFQA 5DI8B 5C0FA 2YXMA 3C60B 3C2AL 3DTXB 5CBEB 4OV5B 1ZE3C 1YEKH 1XEDA 1MCCA 4HZLB 4U1LB 3W11C 4HSQA 4XC1H 4PGEA 5JW3L 4IHOB 1PYWA 5DHYA 1JHLL 2BHZA 3L5WA 3HG1E 3RHWF 2AQ3A 4XGZA 4O9HL 3GJFH 3TBSB 4P3DA 4CW1A 2EC9T 1K5NB 4C58B 5GSVB 4BH7B 3QUMH 3U30B 5FYKU 3PGCB 4GAFB 1EHLL 4GAYA 2V5RA 3RWDA 3HG1A 3SKMA 5KVDL 1Q9WA 1FSKB 2UVFA 4ZSOB 3OKOB 3QRGL 2V17L 25C8L 4K8RC 1FVEB 3VXTB 2GJ6B 1UB5A 3VI3F 5T1LD 2XWBB 4NKMB 2J8HA 5HHVL 4JPKL 2E8ZA 1XF4A 3H0TA 1GGBH 3EYVB 3ULUH 1I9JL 1TDQA 1BQHG 1IM9A 3OKMA 4L8DA 4AYFA 4NZRH 4Y4KC 3V6ZB 2JCCF 3C6SA 3MLRL 3OAUL 4OM0L 2G9HA 3DRTB 3HG1D 3DO7A 4EN3D 5HGBA 5J12B 1BZ9A 1L9MA 1B3JA 3DROB 3HC3L 5JHLH 3ARGB 4NQXA 2WUBH 4H8WH 2Q7YB 4R8WL 1F8TL 3DI3B 1G1YA 5A3ID 2YZ8A 1S9WB 2BXZA 3IGAB 1BIIA 1INQA 1XGPB 4WNQB 1DBJH 2LVEA 2BDNH 2DQCH 2N7BA 3VXMA 4M7LL 3WCYA 4PBVC 2H2PC 2Q86B 5T1KB 4LOUD 4ONGH 1C5BL 1U8JA 5BO1H 3JXAA 1UXSB 2EEDA 4FFWD 4HUKB 4M3KB 2DS4A 3WO3B 2GSIB 4LU5H 3ARXA 4PJ8C 1EK3A 4G8GE 5HPMA 4Y16C 4HWUA 2Z93A 3ARBC 3VI3E 1FZMB 4QTIL 1IZJA 4FQXB 3WFCL 1T1ZA 1VGEL 4Q9QH 2X4OB 1EHAA 1RJYA 5A2JH 4HF5L 3D39E 1WK0A 4I9WE 1NLBL 4IMLA 5D72L 4ZPVA 3OKEA 4JFXB 4PRHE 4APQB 3BMVA 4CADB 3SDYL 4HUNB 4MA8L 2APFA 2BNUA 3AROA 4HKZA 4OGAC 4NP4H 5L88H 3CUPB 4HKBB 3RQ3A 5EOCH 3SDDA 3IRZA 5T3ZL 2GHWB 3S5LA 4K7PX 5K59F 1OGTA 1JGDA 3X3FL 2CLZA 1NGQH 3TIDB 1EAPA 3HI5H 4R3SA 3QG6B 2CDEA 1CGXA 4M9OA 1JZ7A 4G8GD 2BSED 2C4FT 3DX7A 3JV5A 3CX2A 4NM4H 3RIAF 1VFAA 1MHHA 4BQ6A 5CBAB 3ZDXF 3SDAA 4G6JL 3UAJD 1UGNA 2FIKB 4OZIB 3V6FB 1CE1H 1EO5A 4ELMA 3D39D 4I9WD 1I8MB 5KVEH 5DMIL 3SDDD 2QEJA 3QHFH 4AH2B 4PRHD 4M7KL 3SOBL 5I16B 5DHVH 4L29A 1YEDA 4J7RA 1P2CB 4X98B 5IVXA 3IDUA 4OM1L 1MCNA 2CKNA 3ES6B 4HH9B 3GI8H 1QHPA 2E7HA 1YEHH 1A9EA 3IB4A 1G6RB 4Z95L 4HLJA 4P2RB 1PW3A 3UTTE 2R29L 5HDLA 3EZ8A 2BVQB 3ULSA 4OF7A 3SDAD 5IW1B 5E99H 1VKXB 2V2WA 3GMLA 1Q1JH 5DS8A 3EOTH 4QHKI 5HHOB 1SJHB 1J12A 2E7MA 1KTRL 3UTTA 4EUPA 5EZIL 3VD3A 3NH7L 1WV7T 1JNJA 3MCKA 3O3EA 3G04B 2Y06L 1MSPA 3N85H 2W9DL 1CL7H 4NM8L 2V6HA 2UYLA 2D0GA 2FX9H 4X0KB 3D2UD 5HYSG 1HZHH 4N9GB 2GK0A 1DQMH 1MCHA 3QIUC