3OAYH

A non-self sugar mimic of the hiv glycan shield shows enhanced antigenicity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
217
Chain Sequence
b'EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12, light chain
publication title A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 217
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oayH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oayH01
2HJFB 3MNVA 4HEME 2BSED 3PHQB 3GSQA 3SE3C 1D5XB 4RBPH 3VXUA 3BKMH 5I17B 2Q3ZA 2P46B 3RU8H 4PJFB 5F9JB 5DUPH 3RWEA 1A4JB 2AJYH 3TYFB 5J6HB 3GIVA 5EZJB 2YS4A 1M6OB 1C16B 5FYJD 4ZTPL 5FGBC 2AJSH 1FPTH 2KPNA 2XQBH 2ATKB 1MLBA 3EYQC 5BVPL 1JF5A 1MCBA 1H3VA 3L9RB 2IBZY 1WVZA 5GGTH 3SDCA 5DTFB 1IAKA 1IT9L 4GKOA 5IMMB 1MQKL 1KB5B 1KN4L 5E2UL 1VPOL 1F13A 1QQDA 2MKLC 3OZ9L 4PP1D 1FJ1B 2AK4E 3QDME 5GHWH 5IGXL 5IQ7H 5JQ6H 5GRZA 3LZFL 4U1LB 3FAWA 1DBJH 5DJ8B 4Z76A 4LVNB 4XCCL 5I1KL 1IARB 3Q2CA 5AG8A 5C71A 4OF0A 1ONQA 3L3HA 5C6TH 4B53A 2X4QA 1GGTA 2CDEA 3DOSA 4JDVB 3MC0A 4RNRA 3GMNA 4M6AA 3ZYOA 4FQLL 1U8KA 2Q6WB 5F71A 1KJVA 1A1NB 5E9DA 3CSYA 4HIHB 1B88A 3RDTA 1RZKH 3B5HA 2XZAL 4ONHB 4XPTH 5DS8A 4JG0L 5CBAA 4Y1AE 1OGTB 3TWCL 4HPYH 2F54A 1LNUB 4BKLA 4FHBD 3U36A 5FA3A 3T0AA 4BSVB 4X6DE 5E9DD 3RDTD 5KW9H 4A6YL 4BYHA 2CK2A 5BV7L 1BECA 1HINL 4XC1L 2DMBA 3MRGB 1B2WL 2ED8A 2F54D 4MSWB 1X7QB 5L7XL 5J56B 1NEUA 3ULUE 3WL9B 3QDGA 3H9ZA 2UWEB 5C1MB 1HSBB 4J8RB 5I9QC 2FBOJ 2MPAH 4WW2C 2IPUG 4YFDB 3PP3H 4NGHH 4XPAH 5LWYH 3QDGD 2WBJB 3BP6B 5D96B 2H26A 4YUEH 1X5GA 4JO2L 5D1ZC 1GHFL 3KPRB 3HG1B 1RZIB 5SWZB 1YMMA 3VXSA 1A4KA 3N06B 4ZSOE 5DJ2B 2CO7B 5FHAL 1RUAH 4RX4A 3EYFB 1JWSA 2EDEA 4NZDA 5KTEH 2DKUA 2Z35A 3DX6A 2E6PA 1A6WH 3TVMC 3UXFA 1YMMD 2X44D 3QCVH 4G8FB 4TSBL 4RX4D 5CINL 1HCFX 1UH4A 5CEZE 2R2CA 1YEHL 4ZDHB 3W82A 1AE6L 1LK2A 1MCFA 2JJTC 1UT9A 1QFWH 3G9AB 4OLZH 1JHKL 3W5MA 5DRZA 1I1RA 1ES0A 2BOCA 1IAOB 1XMWA 2G60H 4GRWE 3RNKB 4RDQF 1DBBH 2MMXA 2Y36H 3FT2B 5IW6B 5DUML 4YFLF 3Q3GB 4GOSA 3G5VA 3DETC 1R3HA 1YEFL 3B2UC 1KB5L 3PXHA 3LKPB 3HN3A 4O58L 3WD5L 1EGJA 1U8OA 1R6VA 4RZCA 3CFJB 2I60H 1HKLH 3L7FA 5I18H 4G6AC 5A2FA 5E8DL 3H9HB 1Z6JT 1I7UA 3R0NA 4QRTA 1PAMA 1A3RL 2IQ9H 1PW3A 3QDJB 4LCCA 4ZAKA 2WBWB 3HMWL 4UU9A 5D7SL 4JRWA 3L3OA 3VXQA 1A6TB 1IC5L 3LKRA 1KCRL 5DI8A 3W9DA 4DTGH 2BK8A 2MCPL 4WENB 4XGZB 3OV6A 5FAAA 1F5WA 4GRLA 3SDAA 3X3FL 4ZAKD 5J1AB 3SCMA 3JWOL 5FECA 3SGKA 2I9LA 4PLJD 2A1WL 4YHKL 1EUTA 1CG9A 1KYOK 2VDNL 1WUNT 2BNQA 4GRLD 5IR1A 3SCMD 3ZHLA 4NO3B 1MCWW 4X8XA 3H3BC 3PNWA 1F4HA 3LKSA 4RFOL 3FTGB 1OD9A 1JZ5A 5D6DA 4QRSA 2BNQD 1KNOB 1NLBL 1YEGH 2VXTH 3WS6C 4HT1L 1HKFA 1G7QA 3MRFA 1FGNL 2Y5TB 1QZ1A 6CGTA 2P49B 1XGPB 4MWFA 4P2RD 5ISZA 5DVNA 2JK5B 1VDGA 4KAQL 4ODHH 3C6SA 1YECH 4PJ5B 2HKHL 3C6LB 3LEVH 3CFEB 1NGWA 1HIML 3GSOB 1HWHB 3O4OC 1I4FB 3KPSB 5J06A 1FZMA 2JB5L 4L8CA 3UTSA 1JWMB 2AK1L 5ISZD 2X4PB 1KEMH 5DEGA 3MSPA 2BVOA 5ALCH 3LN9A 3CFKB 3S36X 1HE7A 5FKPA 5AZ2L 3K8KA 1IFHH 1KCSL 1KCUL 1AGCA 1NJ9B 4JE4B 4P5MB 4KRNA 5DUBA 2HTLC 2VSDA 2AXGA 3UTSD 3PQYB 4K23H 2N56A 3E8UL 3QUXB 1G9ML 2X1PA 3MRDA 1KENH 4NQEA 4R4FH 1XIWC 5CUSH 3VW3L 1ZA6A 3QIWB 2J8UE 3EOYG 4ELKA 1DUZB 5F1IA 1OAKH 2YN5A 4BELD 3HCVA 2GJJA 3KJ4B 4I2XE 3H9SB 1Q1JL 2DTSA 5IB4B 1NL0H 4NQED 1BOGA 2P8PA 1FC1A 5EZIL 3TZVA 2PYEA 3A6CH 3GHEH 3TH3T 1FFPA 4Z8FL 3RI5F 1S7XB 3U6RA 4ZPVB 4J1UB 1M05A 4MJIE 1YY9C 3VI3E 2X9XA 5ADOL 4XWGH 4M7LT 2PYED 2BDNL 4KMLB 1CXKA 4FTVA 4KUZL 2GCYB 4FXKB 1S9YA 1KELH 1AC6A 5HI3C 2Q7YA 1KF9B 5JZ7C 4GAYA 3VFUB 1QSEE 4ODWA 3DXAA 1JGUH 1NGPH 4U2YA 3EYUH 3AROA 4K7PH 3QXWA 2FBJL 4DOHB 2Y7QB 4FQIH 4FTVD 4NN7C 1X5IA 3D69A 5IVOA 1PZ5B 3CNKA 4M9OA 1JGEA 3DXAD 4KGJA 3SPVB 3V7MA 5EU3A 1B4JH 3UO1H 4AG4L 5HHVH 4XCNB 1NQBA 1W72B 2YZ8A 3BUTA 5CHNB 3PDOA 2BSSB 2DMCA 1F4AA 1OGAA 1N6QH 3OG6B 1A7QH 1JPST 2ARJB 3UTTE 1ETZA 3T2QA 4MB3A 4BJLA 3V0WH 2GJ6A 2B1AL 4PB0H 5HYJE 3NH7H 5EBWA 4MLSA 4XVTL 2ADFH 4X0KB 3TBYB 3P4LA 2J4WL 5DYOB 5DJ0A 5JHDE 5JNYA 1KJ3H 2GJ6D 2F8XC 1JPTL 1H3XA 3I6GA 1NANH 1ZSDA 2B39A 1EXUA 4P3DB 3C6LC 2WK2A 1J0IA 4JKPL 2ZCHH 1J05A 3QI9B 4M5ZH 1JNHB 4O4YH 3FO0L 4GO6B 5D1XB 5F9WB 4RRPG 3VGAB 3NVQA 1MHCB 4U1IA 2X4UA 1GGIH 1U8IA 4R97B 4HXAL 1T0MB 4CKVX 2A9ML 1QSFB 2FIKB 2ADJA 5IOPB 5KVDH 15C8L 5F9AC 3MLRH 3QUXC 2EYRB 4NQXB 4DEPB 5DD6B 1CL7L 3EJYC 3HTLX 3EAKA 1FQ9C 1N5AB 4FG6C 1P4BH 1QSZA 3G9VA 1EHLH 2APVA 1RU9L 1H3PH 1DQML 4TUJB 1Q9WA 1YEEL 4JPWH 3KJ4C 3RL2B 4X99B 1NGYA 4OUUA 4JDZA 5BZDB 2V17L 4PRHE 3GSNA 1ACYH 1Q0XH 5DVLA 1EAPB 1UB6B 2FEDD 3TJHC 3ZYZA 4WI6A 2X2YA 4JKLA 4PJEF 4R4ND 3V95A 5E6ZA 2HMID 1A5FL 2HLFD 1ADQA 1I8MA 2YA0A 1NCUA 2YD5A 5IEHA 2P4AB 3FO2B 2W38A 3RGVA 5JIIA 4WFEE 2R1YB 5KJRH 1WZKA 2ZOLB 1A7PH 5IIEA 4U2ZA 1KB9K 4DQOL 3CCHA 4F2MB 1OSZA 1RUKH 1U3HB 4ETQA 1T1WB 3RGVD 3C8KA 2NY5C 4HZLA 2FD6H 1LEKA 4JG1H 4JFDB 2R15A 3ZMRA 1U93B 1WAAE 4X6EA 1JK8A 5HVHC 4YFLI 1AKJA 5FO7A 3WLWC 4JREC 1C08A 3IDIA 2R0LH 4Q9BA 1NBQA 2HA1A 2OTPA 1ZLWK 4XMKL 4KI5D 2FDBP 3IJSA 2R23A 3ZZ1A 4Q9QH 1J1PL 3DIFA 3IETA 1OTUC 2LABA 1CGSH 5CP3A 5D8JL 1FNFA 3JUYA 1NBYA 5DDHA 3VG0H 3FRUB 3CK0H 4PJEA 1DQLL 3JTTB 2XG4A 1W72L 2Y5EA 3BP4A 4YEEA 2PTUA 4KXZH 1IQWH 4MS8C 1TXKA 3CSBA 4NRXB 3FO9A 5CZVL 1FGVL 4LSSL 1AGDB 1MSPA 4HDIA 1TJHL 4Z7UF 3DX8B 4XPFL 1ZOXA 2QLVB 3CIQA 3OKOA 4XVUD 2CDFA 4LPTA 4HULB 5A2IH 1EHAA 4LIQH 1FE8L 1U95B 4MHHG 5DLML 4GLRH 4MA1C 2YPKB 5L0QB 3NIFF 4NRYB 3SKJH 3E6HA 5HVGB 5DZLA 3VGAC 2Q3AA 4OF7A 5KANI 5B8CC 1KBGH 3MA7A 4NFDA 1FO0B 2EIZB 2EKSA 4JPKL 3NCCB 5ERWB 4FFZL 2XKSA 3TIEB 4M1DH 3TV3L 2DOCA 1TLKA 1FVEB 3BKCL 3SO3B 4PB9L 4WTZG 3TFKD 3BIKA 4LLVA 2H45A 4Z7OE 1M71A 3ILPB 4ODVL 4HUKB 4LCWE 1CS6A 4KY1H 4Q0XH 4JO1H 1CICA 4QRUA 2CGRL 3QWOB 5GRJH 1T3FA 4Z7UA 5E5MB 1OAXL 3HRZB 3VXPB 1ZA3A 4JRXB 1KFAL 5BXFA 1VA9A 3KLHC 1CICD 1DBMH 3MLWL 5EN2B 1GZPB 2SEBB 1CD1B 3MLSL 3MRIA 1L0XA 3B3IA 3OAUH 4JFEB 3D48R 3FQTB 2VABA 4OQTA 3ZO0A 5AAMA 5KSBE 3MRCB 1RJCA 2PTVA 3VD5A 4JB9H 5CKGA 1GYAA 1U8HA 2B7DT 2IAMA 3OXRA 1WZ1H 3DUSB 4RFEB 1HZHL 3V6OA 5K59F 1DVFA 3KPOA 1U3HC 5JUEL 3KXFB 3O0RL 3WO4B 4HV8B 5ID0A 4L9LB 2NLJB 4L8DB 2HRPH 3BJ91 1BJ1J 2IAMD 4J6RL 5C0CA 2DQIH 5IJKA 1DVFD 1QA9A 2YD6A 1J0JA 3S3PA 1U91B 4MAUH 5JHLH 5EBMB 3SGEI 2B4CH 4ZUUA 3L6FA 4PLOB 2AEPL 3FCTB 4YX2L 3W0WA 5CKAA 5GGSY 5I1EH 5C0CD 4LCUA 1KOAA 3Q1SH 4PJ7E 1AY1H 3BZEB 5FM8A 1G7HA 2ZKHH 3PV6A 4AT6A 4JM2F 4BFBD 4OV5B 4XP6H 3D0VB 2F74B 1UM6L 1OCWH 1AJ7L 1FORL 1A14H 3D3VE 2CD0A 3TYGH 4BSWA 4OD2A 4GW5B 3DO7A 5IWLA 2APTA 2VSCA 4UDTA 4L4TB 4P49A 1REIA 5CBEA 2HT4C 3V8CA 2CMRL 1XF3A 5DD5L 5FCUL 5L0QC 1YEDB 3BAEH 2EEBA 4FQJL 1AP2B 5D7IF 3IF1B 3RWGA 5HHQB 3MV7E 2NPLX 1CK0H 3MV9E 5JW4N 3VD3A 1T04B 1OTSD 4NCC1 1ZT1B 4DGYL 3OKLA 4CMHC 5A43C 3MXWL 1OQXA 1NGQL 4NOFA 2IANA 43CAB 4Z7VB 1WFTA 1E28B 4JM2A 1FO0L 3LS5L 4PJGF 3NA9H 4C56A 4OLUH 5TE7H 4DW2H 3KHQA 1J5OL 1B9ZA 3ULVE 2IAND 3WLBB 4MDIA 1SMOA 4R90L 3GDBA 2V5SA 4MA8L 1KJ2A 2AI0L 3QT2A 4UUJA 1IM9B 5F6IB 2PO6B 4C56D 3C60A 43C9B 3MLYL 4S1QH 2D9CA 3VGBA 1H15A 2V9QA 5D7JA 3VGEA 4U7SA 1AD9B 2PETA 5BJTB 3HC0B 1DLFH 4LEXL 3BP5A 1ZGLA 1ED3A 3LHPL 3OXSB 4XZUA 2YXFA 3KYNA 3MNZB 3MGOA 3C60D 3CDGA 1U42A 5D7JD 3KYKL 3HR5B 3DI3B 3SJVE 3WO4C 1C5DB 1DSFL 1FL6A 1I1FA 5IKCB 2DLGA 4UV7L 3ULUH 1D5ZA 1O7VA 2NY3D 4Y4HB 5IW1B 5TQ0L 1AGFA 1WWCA 3PWNB 5EU6A 3GK8H 4HCRH 1K6QH 4PRPA 4Y2DC 3MRPB 4DKFL 2J8OA 1BFSA 5EBLB 4CGTA 3VMPA 3CH8A 1D9KB 3MODL 1S3KH 1BJMA 1A6UH 2ORBL 4IM8A 2LTQB 4RGNC 1JNNH 3DV4B 3TPUB 4NM4H 3VFWB 4PRPD 4LOUC 4HPOL 3U9UA 2AS5M 4I9WD 3RWIA 5E4EC 3VXOB 4N5UA 5CCKH 3V4VL 1G7LA 2DQHL 4LHQB 3LIZL 2P44B 1TPXB 1MF2L 4D0BB 1DQDL 1DQQA 1M4KA 4F33A 3SKOA 1RK1B 4WU7B 4U1MB 3T77B 3C2AH 2FECI 1I9JL 5CEZH 4HKZA 3T3PF 4EUPB 3WUWB 3V0AC 1RIVL 3LQMA 2ZSWA 4LFHG 2EKJA 1J9CT 4FQ2L 5FYJU 2AP2A 3C8HA 3GI8L 2VZUA 2XZQH 4JHWH 4Q2ZA 3H42L 3HZYB 5BS0B 1T22A 4KRPC 1JUFB 2MCG1 3DVIA 4H88H 4ZNEE 1I75A 3IU3A 2NNAA 3WMSA 4NQCE 1BIHA 3K4AA 4GRWH 3A67H 3F12B 3LSOA 5ETUA 1X5JA 2HJKA 4EXPX 4XTRC 1RHHB 3LEXB 4I0KA 4OZGB 2R1XB 1K5NA 2Q76B 4LLUA 1WICA 2X1WL 4H20L 3HB3D 4K71C 1DE4B 1PVHA 3VA6A 1N26A 2CLRA 1EJOH 1F6AB 4PRNA 2QQKH 3MGTA 2CSPA 4BK4A 1FNEB 1SHMA 4ZYKA 1PG7X 1AXTH 3GMPB 5B39B 2X1XR 5IEKB 1OY3B 4PJ9B 4M7LH 5KS9B 3VRIA 3OPZL 1I8LC 2W60A 3M45A 5I71C 1SY6H 1ZV5A 3UTOA 3SGDI 4G5ZH 3CDCA 5IB3B 3CH1B 5I19H 2JIXA 2CRYA 3MNVB 3V4UH 2CUHA 1MUJB 2P5WB 1NMAH 3NFNA 4KHTH 4OZFH 3I3DA 1MHEA 4XNUL 5L88H 3FQRA 4Y4HC 4HG4K 2JIXD 2MTPA 2HVJB 4IMKA 5D70L 5I16A 4LSPL 3G6DH 4R8WL 5I30L 2EIDA 2ICEA 3AM8A 1F11B 5IHUL 3GIVB 4BFEA 2ZPKH 4E5XA 3TO4A 5ID1B 3C5JB 5HHME 2AXFA 4IOFC 3RA7L 25C8L 4X5WB 4ZS6D 4X8JB 3ZT7A 4GG8B 5JR1L 4K2UL 2DF3A 1I9IH 1CGYA 4AEHL 5DJDA 1CZ8H 2LTQC 4NDMA 1OPGH 3TO4D 4NC2B 4NQSB 1BM3H 3WJLC 1NC2B 3BFOA 5ICXB 3GJFA 4EOWL 1TIUA 5F1KC 4I77H 1IAKB 4HJJL 4JO3L 4X5LA 1IEAA 4IHOB 4RMQA 4X6BA 4PJ8C 2O93L 2YRLA 3GNML 3NTCH 4PTUA 1FVDA 1MAJA 3HFMH 5CSZA 4Z0BL 2VKWA 1L6ZA 4WFGD 3HE6C 2FX7H 1RZJH 5J6GA 2LV4A 5MHSE 1URLA 2IBBA 3OAYH 2D9QB 1AGBA 1L4IA 5HDQH 5IJVB 1ONQB 1VKXA 2X4QB 2W65B 4MNGA 4RNRB 4Y4KB 2D2OA 3GMNB 3HMXL 5C07D 1EO8H 1KJVB 2DQUL 5E9DB 3RDTB 3QBTB 4LLWB 4Y19A 3MV8D 2GAZA 4NHCL 4DGIH 3EHBC 5LJYH 2F54B 4BKLB 5DURB 5JOFA 3T09A 5GGQH 4JFXB 4K7PY 1SJEB 2DQFB 4Y19D 1RZGA 1I3GH 1HCVA 1T66C 4MVBD 5IVXE 3ROLA 2CUMA 1MCLA 3QUZA 1CFTB 2NY6C 3NCBB 3HNTL 2PTTA 3RL1B 1TETL 5DFVD 3QDGB 1QNZH 5C08B 1UJ3A 3MUZ1 1QBML 2VLJE 5IK3A 1U3ZA 1KC5H 5SWSB 3HPJA 3QUZD 1WBXA 3UJIH 3OJVC 1I3UA 3QULB 3VCLA 4PJ9C 5JIKA 1KGCE 5I1IL 3PL6B 2DLFL 2HVKA 3VD7A 2H26B 4QHUB 4WGVB 4MXWH 4K8RC 3IFLL 3BIAX 3MROA 3OR6A 3CLEH 2HFEB 4Z0XA 3RWCA 3LN4A 5T5NG 1JWSB 1P2CA 2HT3C 2E7HA 5HPOA 1INDH 1IAIM 3SKUD 4UV4H 1ZT4B 1FDLL 4ODTL 2DWDA 4ZUSA 4M61A 4NZRH 3QP3A 3BKJH 5FYJL 2R0WH 4RMTA 1IMHC 3BZFA 3B5TA 1LK2B 4Q6IC 4PP1C 2V5YA 4MJ4A 1A1MA 4OF3A 1AXIB 5DD1H 3GGWB 4FFYH 4DN4H 2VXUL 1TQCC 1T5XA 2ZCKH 4MXQD 4UBDC 5EOCL 1CD8A 3LN5B 3LY6A 3LDBB 2EO1A 3BQUA 4FFWD 4OTXL 4BUHA 4NBXB 4PYGA 3SKNB 5EO9A 4HLZH 3VFVB 2G5RA 1U8OB 4Y4KC 5I1HL 1QSFE 2X4SA 3BQUD 4LLDA 5E8NA 4K3EL 4GXVL 2BERA 1BGXH 4QRTB 3AB0B 4M62H 2NX5E 5ITFB 4K94C 2C9AA 1JE6A 3UTZB 1OHQA 1YMHB 4YXLL 3G08B 4LKCA 2H1PL 4ERSL 3O9WA 2J6EH 3RPIA 4ONFH 5I75B 3FZUC 2H2PD 1WZLA 2D7MA 3LQAC 2V2XA 1FFNA 4IIQA 2NR6D 4XPBH 4YJZL 4MA7H 1KACB 4LVOC 4ZUWA 3DWTA 2ZUUA 2I9LB 3ALWA 3I6LD 5ACZA 3SBWA 5IVNA 1UG9A 3TO2B 3UCRA 3BP7A 1OARH 4NM8H 4Y5YB 4DK6A 4P23B 2XACC 3BD3A 4N0FA 4OCSH 4UDUB 4MNQB 4RWYH 4XBEL 1WEJL 8FABB 3PL6C 4NJAL 3LKSB 4MA3B 4LCYA 2BNUA 1EVUA 2R0KH 5E7BA 4P2RB 3T0EA 4QRSB 1C7SA 3NAAH 3FQWB 1TTUA 2W9EH 2DM7A 4JDTH 4MB5A 4N9GA 4TPRL 1I1YB 1G7QB 3MRFB 2PCPA 3HI1A 3BT2L 2ZUYA 3ZTNL 1B6DA 5GISL 1F42A 4MWFB 3T0ED 1FZOA 5ISZB 2HT2C 3C6SB 4P4RB 3V6FA 4PJCE 3O2VH 5EUOE 4WCYL 1NGWB 4XBPB 5C0BA 5EPMA 3BD4A 5INDA 5DJYB 4LQFL 4L8CB 3UTSB 4YHLL 3WE6B 3HPLA 1OTTD 3ZE2E 2BFVH 4BQ9A 5E8PA 2BVOB 2NY7L 4HWUA 1AGCB 2Q1EA 2AERT 5F88A 1HHIB 1XCTB 3QA3A 5C0BD 3GMOB 2DQTH 2AXGB 2GI7A 1KIRB 3LEYH 2GSGB 3BZDA 2RJMA 4NQDE 3U9PH 4M6MH 2FWOA 4CW1A 1IKNC 3S35H 4B0MM 1HNFA 1SYSB 4NQEB 5FYKD 2O5XL 2Z8WC 5J12B 3LDBC 4LLYA 4FQQA 1INEH 3ME0A 5F1IB 3NFPA 4DFIA 2FH6A 4OBRA 5GRVL 3GMQA 3AU1A 3HCVB 2GEEA 4I18C 4YHOH 4EEEA 5SWQA 5DHXB 2P8PB 4XMLL 3OX8B 1P4IH 1T2JA 3DUUB 5IMLA 3MX0A 3QG6A 3QPXH 3AB0C 3UPRA 1MCHA 1M05B 5GRWA 1LE9B 1KPRA 4HUUA 3IFPA 1EGJL 2DLEA 4NZJA 3VRJA 1BQLL 4U6VH 3QNZA 3OKNA 5GS0H 1EDQA 2VAJA 2Q7YB 4GAYB 1BP3B 5LCVL 3ZTJH 4ODWB 3DXAB 4AH2A 5C9JA 2Y07L 4HUXA 3BH9A 3MLXL 1K4DB 5IBLC 5CWSA 5HYQA 3K2MC 4YNYA 3D69B 2C1OB 2XTLA 1HH9B 4H26A 4LDOB 4D8PB 5JXAL 4TVPD 1SVZA 4Y5YC 4X9FA 4NPYA 5EU3B 4P23C 2NZIA 5C86A 5D71L 4GG6F 4CADA 3PDOB 4L3CA 3MRKB 1DBAH 5JW3L 5EH1A 1AD0B 3S3SA 2GJZB 2XPGB 1ETZB 3HUJF 2GJ6B 2IEPA 5EBWB 2COQA 3OR7A 4QOKB 5HGAA 1U6AH 3U48A 3T1WA 1A6PA 1Q94A 5DSCA 5DJ0B 4KMTH 1AR2A 1BVLA 1IGCH 4ZUTA 4PGZA 5JNYB 4Y5XB 3K3QA 1PFCA 1ZSDB 2FJFA 3G6JF 5EBGA 3SGJA 4KVNH 5EU4A 3OG4B 1JPGA 4XPHH 3G6AA 4IBLT 4RGNE 1EFXB 4NO0D 3RVUC 4HIEA 2XXMB 5ICYA 2JCCF 5I1GL 4C83B 4L4JA 3KR3L 3VWJA 2H8PB 4U1IB 2X4UB 2P47B 2OBGA 1RD6A 3EZ8A 1KULA 5EULV 4Y88A 4KZEL 1WT5A 5F96L 3GB7B 4X5XB 3PV7A 3BRGC 2FX8H 1T83C 3W5NA 4JN1H 3MR9B 3MZGB 4S1SH 3VWJD 1B0RB 3BN3B 4X7CC 3SKMA 5INCB 5A3ID 4M6NH 1NGXB 3HUJA 5T1KA 2OP4H 3FRPA 3VFMB 1K4CA 3MCKB 1FBIH 1Q0YH 5F3BB 1KG0A 1MH5B 4Z7QF 1NGYB 4OUUB 4JDZB 1FN4A 4DAGH 3QHFL 4NUGH 4YXKH 1I8MB 3SE9L 2GFBA 3QQ9C 5IEHB 1FNAA 2YUXA 1XF1A 3KYOA 4CUCA 5HHXH 3BSZL 1RY7B 1GGUA 2JCCA 5H35A 3TBSB 1GZQB 2VXVH 3DTXB 1U0QA 1QFPA 2FB4H 3C2SA 4LKXA 4ETYA 4L29A 5TGBA 3PHOA 1E6JH 4ETQB 4KFZC 4P9ML 4ZFFA 4PD4K 5CMAA 4H8WC 3C8KB 4B50A 3QCUL 2A6JA 1R0AH 1C1EH 2ZNWA 3ULVH 3FN9A 3QHZH 1JI2A 4CN1A 1T0NA 1LEKB 1YPZE 1MPAH 4ORZC 1FFOA 2WUCH 5LXGH 5K9OA 4POZC 3RTQC 3GJEA 5FO7B 4WY7H 1H9VA 1XGYL 3V7AG 3U46B 1QFUL 3IJSB 3QPQD 2R23B 2FIRT 3EOBB 3EFDL 4D9QE 5FGCB 5GJSL 2JTDA 3F7PC 3P0VH 3JZ7A 4OM1L 5IVZA 1NBYB 4Z9KB 4WHTB 1YYMH 1LP9B 1CDUA 3BP4B 3V4PL 5I8OH 1HHGA 3FO9B 3DMMC 4KH2A 3EDDA 4OCRL 4QRPA 3TEUA 1JN6A 1V3KA 1MI5E 4Y5XC 3BEWB 5DRXA 3D39A 4JZNA 3STLA 2BZDA 5I73B 3BKYH 5C0AE 3MXVH 3WSQL 1W2KT 3BYTA 4ZTOL 4QRPD 2OZ4H 4LARL 3E6HB 3MRHA 3QNYA 4Q58C 3HC3H 3D39D 3IDYB 4D9RD 1LO3L 2DM2A 3ET9F 1B0WA 3MA7B 4PRIE 3HLAB 5MP6H 2DQGH 5C6WH 3FN3A 4PJAE 4PJDF 1AQKH 5D2NE 3AY4A 1NBVL 5LBSH 5EC1A 5B21A 2VL5A 1M71B 4U6YB 4R3SA 3K8LA 4NCDA 2NY1D 1E4XI 3R1GL 3PJSA 3UDWA 1LO5B 4QRUB 1EHXA 3KPMB 2OLDA 1T3FB 2ZUVA 1QG3A 4KC3B 4WDIA 5LGHH 4Z95L 5CGTA 2AK4A 2ZUTA 3B43A 2MHAB 4TYUA 4N0RA 3ARGA 1OT1A 3B2VH 3ULSA 4PG9A 1ZA3B 5DQDL 5E4IA 1OP5H 2G2RA 1LO0L 1AHWA 2VKXA 2IH3A 4B41A 5AYUL 2AK4D 2EDRA 4NP4L 1CE1H 3GSNL 5SV3A 3ARGD 4LLAA 1NUFA 2VABB 5EU5A 2XG5A 2BJMH 1U8HB 1MFBL 2IAMB 1ADQL 3OXRB 2RFXA 3SY0A 4FQXB 5IP4A 2RB8A 2XY1A 2NW3A 1MJ8H 3G5ZB 1HWGB 2A6IB 2NTFB 1SJHB 2HFGL 4NNYA 5C8JA 1RULH 4O9HL 3DPBA 2HH0H 3H7BA 5IFHH 1K3ZA 3N9GH 1D6VL 1LD9B 4N1EA 2QQNL 2NY0C 2XICA 4ZUUB 2W0FB 4PJBB 4Y1AD 2P5EB 4XNQB 2XKNA 3T3MF 2CKBH 3VH8B 1QO3A 4HF5H 4LCUB 4CVXA 2P5WE 3AFLA 1G7HB 4YDJB 2EC8A 1AGEA 4P9HC 4HQQL 4HCRA 2XFXA 4G8GA 1J8HA 4OLEA 1GGCH 1NFDE 5AZEL 3CLFL 4H25A 3BVNB 2Y9RT 1JPSL 3DO7B 1VFAB 4UIKH 2NY2D 3F5WB 3GBMH 4BFIB 1HHKA 3NIGF 3B4NA 4OLXH 5IROC 2K1MA 4UINL 4G8GD 1J8HD 1C5CL 4MD5A 4R96B 3ARFA 3INUH 1SVCP 3IXAA 1WWWX 1TJIL 1OB1A 3DVGA 5ESQA 3IDYC 3JWNC 4O02L 5HGHA 1MRFL 4FP8L 2DWEB 4NYLA 3VE0A 3NFSL 3QEUB 4PREA 1HILA 1JYNA 4OT1L 4ELMB 1F8TL 3RWGB 3ARFD 4FFVD 4MMXC 5F70A 3EGSA 5J3HC 4DGVH 1HYRC 3OKLB 4G9DA 3WIHH 4ZD3L 3QUKB 3DECA 1A2YA 1RJZA 4KJYA 4YHMH 4ZXBB 5IFAL 3BGMB 3WKMH 1I1AA 5EIVA 2FGZA 5D93C 1DJSA 2XT1B 2CXGA 5CEZD 4PJXE 4C56B 4NKDB 1Y6NR 4UAOC 4MDIB 1TNMA 1GOGA 5E6IB 1TTGA 1QRNA 3FN0H 4UUJB 2UY6A 1I8IA 4N8VA 3C60B 1BQHB 1H15B 4UTAL 4XCFL 3WFZA 1WJ3A 1IC7L 4ZS7H 2BHYA 1MREL 3BP5B 1NAMB 5DZOA 1OAYH 1KTKE 1ED3B 1QRND 4KJWD 2WAHA 2NY3B 1N3NA 4HKBB 1NGZB 1ORSA 3KYNB 4NHUA 3MGOB 3DYOA 4F9LA 4YHYB 1AO7B 3RBSA 3DSFH 4FQXC 2OR9H 3HNVL 1KN2H 4MLIA 1N5YL 1RZ7H 1GSMA 4GRMA 4MD0A 3GMLB 1QKZH 4PGEA 1FL6B 3LRHA 4HKJA 1D5ZB 3MJ9A 4LEOA 3UBXG 2CK0H 4D3CL 2ZNXA 4RA0C 2DQDL 1SY6A 4HWBH 4AIZA 4LSTH 4G80A 4LSVH 1IZJA 5E2WL 4OI9A 1XGUA 4OZIB 5IBUB 4Q9RH 1NH6A 1IJ9A 1S7WB 2NY5H 2VZ1A 5ITBL 3LH2L 5L9DL 3ALPA 3U9UB 1VGEL 35C8H 4ZFGL 3PABA 3T2NH 1U8MA 2E7LA 5ICZA 3L3DA 4PS4L 4NQUA 3RWIB 2ICWA 2Q20A 1IGFL 4U1KA 1BFOB 3L5XH 3QIUC 3V5HB 1BLNA 2Z31A 3G5YB 4QXGH 5GZOC 4TUOB 2EDYA 3T0WA 2VZSA 5E2TL 4FZ8H 4M6OH 3WFBH 2MFNA 3WDJA 3IDNA 3TJEH 5JA9A 3S36L 3BZ4B 1PYWB 5GGSB 2EIBA 2MSPA 1RVFL 4TQEH 3S9DB 1I3VA 2Z31D 2RIKA 1OTSC 3S5LB 1EO5A 3CXDL 3C08L 3WHE1 1FYTE 2XWTB 2LAGB 5BQ7A 5F97E 2NNAB 1MY7A 1DZBA 2EDXA 5ETUB 3KLSA 2BSTB 4D9LH 1HDMA 4JZOA 4ENEC 2ARJQ 2FLRT 5AWNL 4ZXBC 1G84A 1QACA 4FQ1L 3MJ6A 2FEEI 1MJJB 5EO0A 1A7NH 1YC7A 4RMWA 4UIMA 5FGSA 1U8LA 3U7WH 3SDDA 2GTZB 3H6JA 4R26H 1D5IH 4PRNB 3MGTB 2N1KA 1JJUA 1N0XL 5EIIA 2Q7NA 5E6IC 2E27H 5FIEA 4OJFH 2W59A 5C0DA 3UZEA 2YPLE 4OLVL 1INQA 4OSUL 1ZMYA 1GGYA 5E8EA 4I2XA 4EUPG 2ZOKA 4F7CB 4MAYC 3NOIA 3AS3A 2XZCL 5IQ9A 3EBAA 5A2LH 4YHYC 3C5ZA 4OGAD 3O3UN 4MJIA 2CJUL 3NFNB 1I9RL 3WXVL 4OCXL 1NAML 2EYSA 1RK0B 1MHEB 1QVOA 4GW1A 4TUKL 4X7SH 4F15B 5I16B 2W9LA 1GPOH 4MNQE 5BRZA 2PXYA 3QIBA 4PGDA 3O3DB 2ICEB 2CLVA 4NNPH 3I9GL 1QSEA 32C2B 3CUPA 4MJID 1T4KB 2W0KA 3LRSA 1X6LA 4RMRA 2R69L 3WN5B 4AENA 5CLTA 4BZ2H 1J1XL 2DICA 3CFCL 2PXYD 4NSKA 1RIHH 4NDMB 1ZANH 1X5XA 1QSED 1A6AB 4HX1A 5DK2B 2LQRA 3D0LA 2X4OA 1IEAB 4JRYE 1JPFA 4PTUB 3BKML 4YIQA 4DVRL 1BX2A 1U92A 5GSVB 5CSZB 3X3GH 3NMEA 3UTTA 5DUPL 5J6GB 5C07B 5HYJA 5D7LE 2C5DC 1AGBB 2ZG3A 2AGJH 2QTEA 5KSAA 3MLPA 4UQ2A 2AJSL 1FPTL 3MV8B 1EBAA 4MXVE 4MNGB 3UTTD 2GHWB 3L5WA 2EYTA 5HYJD 4QNPF 2VXQH 4L4VE 5GGTL 4HXBL 1AH1A 4WI3A 1UACH 1IAMA 3X17A 5KSAD 1FNGA 1LO2H 2QJDA 2W0PA 4U31A 1NSNH 4Z7WB 1U8JB 1DN0A 3GKWH 2V9RA 5FV1L 5FHBL 3VWKA 1CU4H 5D72H 2ITDB 5IQ7L 5JQ6L 3DX9B 5BW7C 1V7MH 4NKMB 4QRRB 1G7JA 3JV6B 4APQD 4S1RH 1G6VK 3PXJA 3V0VA 4XPGH 4CU6A 1RZKC 1YN6B 4KTEH 5EUKA 1AXSA 1FYHB 2PTTB 3AREB 3VWKD 3W9EB 5C6TL 5J1SC 2GITA 4YDKH 3K1KC 5M94B 5L2KA 1Z3GH 1IRAY 4XX1E 3LKOA 1F2QA 2Q8BL 1RZKL 4XPTL 3D2UA 3VCLB 3I3BA 5MERB 1CQYA 1IGJA 2PW1B 4LNVA 1JRHH 2HVKB 4HPYL 1Q9OA 4M7ZB 4PRHA 3M07A 5L2KD 2DJSA 2NXYD 2WINA 5KW9L 2CKNA 3EO1B 3D2UD 4Z0XB 3LN4B 1OAQH 2GY7B 1G1CA 2VLRE 5J7CC 1W0WB 4PRHD 4ZS6C 1FZKA 1DFBL 4F15C 1BIIA 1G0DA 4LBEA 4P48A 5EZLB 4YBHA 4P2QE 2MPAL 2DWDB 2O5YH 4ZUSB 4M61B 1P53A 2VN7A 3R4DA 4WFED 1PQZA 5CJOH 2FR4B 4JFOA 4NGHL 3U30C 4XPAL 2O26U 3WN5C 3BZFB 5CJXA 1MEXH 3E1F1 5I2IA 2XA3A 4YUEL 2D4DA 3GMRB 1P9MA 1TZIB 1WIOA 1UH3A 2ZUQC 2A6DA 5FKAA 2ICWI 1UA6H 1MCSA 4GS7B 4WNQB 6FABH 1RUAL 4UT6H 1T5XB 1II4E 1L9NA 4MHHI 3SE3A 3V5KA 1A6WL 4RAVB 5DEFA 3U0WH 1BEYH 5E8OB 4M1CC 1XEDA 3KLDA 5FUOH 4HWZA 4P57A 4M48H 3QCVL 4ODSH 3K2UH 1XF5A 2C3VA 5C7XH 2X41A 2AQ3A 3P77B 3H7LA 5FGBA 4G9FE 1P4LA 4I5BA 3VFTA 1HXYA 2VAAA 1QFWL 4OLZL 3CC5A 2OK0H 4F7PA 5HSFA 4LRNH 4K9EH 1BJ1H 2C4FU 4LKCB 5GS2H 2G60L 4TVSa 5GJTL 3RPIB 1X5FA 3QQ3A 1DBBL 3EYQD 4P3CH 4TSCH 4TTDC 5FYKU 3R06A 4NO2B 1FFNB 3K74B 4ZUWB 5EU7C 5ELIA 5AYQA 3WEXA 3AREC 3TT3H 4WW2F 1J10A 3BP7B 1BVZA 2I60L 1HKLL 3LV3A 5I18L 4N0FB 4PJHB 4ZOAA 1T7VA 1A9BA 2IQ9L 5TDNA 1U58B 5DVOA 1IGMH 4A2MA 1QPPA 3VXNB 4XBGA 4KKNA 1CE6A 4M7ZC 2CIIA 4YDVA 4LCWD 5E7FA 2E9WA 2OXHA 4DTGL 2QSQA 1K8DB 3HE7D 3DLQR 4PJFF 2DTMH 4LLQB 4KQ3H 1N64H 5SV4A 5KSBA 1HQ4A 3V6FB 1IC4L 5I1LB 1YEJH 2A38A 2WQRA 2X1QA 3HPLB 5E99H 4OCNC 2VB5A 2W91A 3QZWA 4Q6YA 3PWJB 5E8PB 4WW2A 1ZVSA 2QBWA 1UGNA 4GAFB 1CR9H 5I1CL 4RDQG 1CIUA 5TFSH 3QA3B 1VEPA 5E70A 1BD2A 1YEGL 5IHZA 3RUGE 2BXYA 2VXTL 5D1ZA 3F7VB 4OGYL 4L5FH 2HJFA 4MZ2A 3TIDB 1QYGH 1TNNA 4PJ7A 1XR9A 1D5XA 3GI9L 2FL5A 4LLYB 3WIIL 5D1ZD 3LEVL 1FAKT 3GMQB 3TVMA 3ROOA 2XQYG 4PJFA 1A4JA 3RVWC 5SWQB 3RFZC 1F58L 3TYFA 5J6HA 1KEML 4NQVA 4I48B 1IFHL 1M6OA 4OZHE 3X11B 1PD6A 5IMLB 3QRFM 2H2PC 3AAZB 2IGFH 3QG6B 1MVFA 2ATKA 3TVMD 3UPRB 1W8OA 3D3VD 1KPRB 2JJTA 4K23L 2NR6C 3I02B 4N0UB 1YA5A 1PLGH 5DTFA 3OKNB 2WLZA 3MFFB 4JLRB 1KENL 2ZZUT 4R4FL 5CUSL 3CDFA 1BFVH 1VENA 4CNIB 3MV7A 1Y6KR 4AH2B 3EO9H 4Q9CA 4Y89A 2UWEF 3DURA 1CXIA 5HYQB 4U1LA 1NL0L 5DJ8A 4V1DB 4LSQL 4E41B 3A6CL 4OCYH 3WNOA 3PDDA 3GHEL 4NPYB 4WI4A 3MV7D 3IKKA 2WM0A 3MV9D 1X5ZA 3UYRH 3BIBX 4YR6A 5J89A 1XF4B 1OAZH 4L3CB 5K9JH 4XWGL 4OI8A 4DCQB 1A1NA 3B2UD 4HIHA 3ZKSD 4L8SB 5HHOB 1ZGLM 4ONHA 4OKDA 3D5OF 5GGUB 5IMKA 1KELL 2ZSVB 4OD3L 1OGTA 1LNUA 4G6AD 1JGUL 1NGPL 5DHVH 3OQ3B 3EYUL 3NZHH 5GRVK 4K7PL 2FNBA 4NO0B 4FQIL 1F4YL 2CPCA 4W68A 4R0LC 3RHWK 3GSUB 3MRGA 3RY6C 1BOYA 3NIDE 4MSWA 1GC1L 1B4JL 4I0PB 3UO1L 5HHVL 1JPGB 2H41A 3Q6FA 5LG1A 3WL9A 3SJVA 2UWEA 4HIEB 5ICYB 1JNLL 1OVZA 4Y4FB 1SBSH 1N6QL 3U7YH 2FHCA 4J8RA 1A7QL 1P1ZB 5IFJB 5F8QC 2WIIA 5GRUH 3NH7L 3SJVD 3ARDC 4O2CB 3BP6A 2ADFL 3KPRA 2IALA 1RZIA 3HG1A 1MAML 5SWZA 2H3NA 2OZ4A 5FO9A 1YUHB 3DHMA 1I85C 2BVQB 3SKMB 3WS6A 5FYKL 1KJ3L 2OJZH 3T8XA 3CGTA 2UZXB 3IJYA 3KDMB 2AQ1A 1TVDA 1FH5H 3EYFA 1PX3A 4RIRA 2H32H 3WYRA 3UYOD 1KG0B 4O4YL 3CVIH 1XGRA 3ARBB 4G8FA 1ZHLB 3D9AH 4ZDHA 2GFBB 3EYOA 1UCBH 2AJZB 5KVDL 3MLRL 4NWUL 3QUMH 4LKXB 4BUGA 2YUWA 3ILQD 1S9WB 5IMOB 5TGBB 1IAOA 4X4ZA 1P4BL 3S4SB 2HN7A 3S97C 4RQQA 1EHLL 2XQYK 3BUYB 5KG9B 4OKVB 2B2XH 2A6JB 1OSPH 1H3PL 4NQCA 4L1DA 2HTLD 1XIWA 2Z93B 4JPWL 4UTBH 5F7MC 5IW6A 5D1QC 1TCRB 1WITA 1JMZA 3Q3GA 5I0DA 1FFOB 5DT1H 4K94H 3QO0A 1Q0XL 2HFTA 4TVPL 4JN2A 3V52H 1VFBA 3RVVC 5E00A 2DDQH 4NQCD 5SX4I 5MENE 4XXCC 1XIWD 4RAUB 3CFJA 3LQAH 4G8EA 3QJHB 4P46C 5TE4H 5KJRL 5CIPH 1P69B 3UTPD 4XMPH 4L8SC 1A7PL 3PGFH 3OAZK 5E94A 1RUKL 4V2CB 3ARUA 2E8YA 2FX9H 3P2TA 5EZOH 4P2CG 1HHGB 3UX9B 5T3ZE 1A6TA 4CJ1A 1A47A 4HK0A 5B3JE 2FD6L 4QRPB 1DBKH 1YY9D 2CKBA 2IH1A 3PIQB 4XGZA 5DRXB 3D39B 4JZNB 3I75B 3REVB 2IG2H 2VWEE 3CMOH 3STLB 3E3QC 4N90E 4I0PC 2R0LL 3T4AA 1KV3A 5HI3D 5T3XD 5JZ7D 4Q9QL 2DLIA 4Y4FC 2XWBA 3MRHB 4Z6AT 4LHJB 4UQ3B 1B0GB 1MRCH 3VG0L 4X4MA 2XNAB 1S8DA 3CK0L 1CFVH 2O61B 4OBSA 4F8QA 4A2LA 1IQWL 4HD9A 1KNOA 1B90A 5EC1B 5LKNA 2VL5B 3QB7C 2N7AA 2Y5TA 5HHMD 5BVPH 2YRZA 4LIQL 1XGPA 3PJSB 2JK5A 1VHPA 3BPOB 5KVGH 1QFWM 3SKJL 3BPCB 3C6LA 4WDIB 3ARBC 2AK4B 3CFEA 3QDMB 1I4FA 1IT9H 3ARGB 1MQKH 1D7FA 4PG9B 1VPOH 1IVLA 5E95B 5A40E 4R4BA 1KBGL 2X4PA 1ZLUH 5BOZG 1PGRB 3H9YA 3CFKA 2KH2B 3C6LD 4HS3A 1NJ9A 5I76B 4M1DL 4P5MA 1QOKA 3B9AA 1SJXA 4U1JB 5EU5B 3TC9A 1F4WL 1UWXK 1OT2A 3QUXA 2RFXB 3SY0B 3B9KD 2FJGB 5F6HI 2YMXH 4KY1L 3WXWH 4IOIA 2BY2A 4LNRA 4PR5B 4JO1L 4QRQA 1S5HA 3QPQC 4Y1AB 3P30H 5GRJL 4F80A 3PP4H 5C8JB 3BW9A 1DUZA 3ZL4L 3MUGB 3CX5K 3QUXD 4X6DB 4P4KC 4AM0A 3ZKND 3EJYD 5FYLE 5IB4A 3TWCH 5I8KH 1ITBB 4M02A 4JY6B 4FG6D 2AVGA 2XKNB 4Y8DC 2G75A 4U6HA 3OAUL 4A6YH 1HINH 4XC1H 2NY2B 4JB9L 4HWBA 1WZ1L 2A83B 2VLJA 3VD9A 2W0LA 2D31B 1MVUB 2BHZA 2GCYA 3AS1A 3VFPB 4FXKA 2B4CC 2NTSP 4H25B 4PJIE 3HI5H 2HRPL 5ANMB 4I13B 2VLJD 2DQIL 2Y7QA 4P5TC 4UT7H 4ZSOB 5JHLL 1WGOA 4OAWA 5CD5C 3ARFB 5KAQG 1KGCD 1GHFH 3IXAB 1O7SA 3EZJB 3ZE1E 3EDJA 3MRBA 3DVGB 4JM4H 1T7ZA 4XCNA 4I1NB 1KIUA 3S6CA 5HGHB 3MFGB 4NYLB 1CIDA 4PREB 1AY1L 1HILB 5CHNA 2BSSA 2ZKHL 1CGXA 2YD3A 4J4PC 1A22B 1NAKH 1UC6A 1OCWL 3EGSB 2ARJA 1R3IH 3UC0L 3WLWD 1A14L 1K85A 4KJYB 3LOWA 3VH8G 2E8ZA 5CINH 1EMTL 1OTUD 4X0KA 2PKDA 4B5EA 4P99A 1WQVT 1MLCB 1UM4L 4EI6A 5C0NC 4GRWB 4MS8D 4F58H 4FXGB 1BMGA 3BAEL 1JHKH 4HEPG 1JNHA 4UOW0 1I8IB 3RNQA 2MJWA 3IAGC 1MHCA 5F7UA 5B8CA 1T0MA 4QRRE 1QSFA 2FIKA 1HXMA 4NQXA 2EYRA 4NT6A 4XCEA 5DD6A 2NX5A 1RIUH 1WC7A 4GRMB 4MD0B 2WANA 5IM7B 4OLUL 4PGEB 1N5AA 5TE7L 1DQTA 4DW2L 5DJXB 3M1BB 1QSFD 1NCCH 1NC4B 5H94A 4YHIB 3LKQB 1A3RH 3L1OL 1AC0A 4AIZB 4PUBH 3ISWA 5L8LB 2JJSC 2NX5D 3RL2A 4G80B 4X99A 4JFFE 2QQLH 3HMWH 1I7TB 5D7SH 1JZ3A 1XGUB 3O4LE 4S1QL 5BZDA 5FM5M 5TQ2L 1EAPA 3ZE2F 4GMTH 1KCRH 1DLFL 4E9LA 4OZFB 4JFPA 4EVNA 2MCPH 3ULUC 1NMCB 2G5BA 2YWYA 3ARRA 5JDSB 3TBVB 2ARWA 1K9TA 1U8MB 5ICZB 3L3DB 4NBZB 4O51A 5C2UB 4TNWK 1X9QA 4U1KB 3KLHD 2Z31B 2F8OA 4JHBA 1U3HA 1PSKH 4RMUA 4MCYB 4G6KL 2ZJSL 3GK8L 3I3EA 4HCRL 3TA3B 4RFOH 1VADA 3QFJE 4XNYH 3MLTA 1RMFH 1S3KL 1A6UL 4J7RA 1CF8H 1RZ8A 3WIFA 5BQ7B 5EUOA 1D5BA 1XCQA 2E9IA 3CFBB 3FRUA 5CCKL 3C09B 4UB0L 3JTTA 2HKHH 4KKLC 5IBUG 1HDMB 1HIMH 5HY9A 4JZOB 2ZUXA 1MHPH 4PGCA 2JB5H 5D9SA 3NCMA 2M1KA 1EJ6A 3NCYS 3C2AL 5DC0A 2KKQA 3RP1A 5CEZL 5AZ2H 1H8SA 2NY4B 1U8LB 1OAUH 3LS4H 1RSFA 3PDGA 5EIIB 3S98A 1DLHA 3WCYA 2YPKA 2X4NA 3LKNA 1G0YR 2J8UB 4NRYA 4X7EC 5GGRB 4YHPB 5GRYA 1G9MH 3BE1H 4JO4L 3R8BB 2AABH 2HT4D 1WK0A 2EIZA 4X6CB 2YC1B 3RWDB 4MJIB 3VGFA 4YFEA 1MCNA 4GW1B 4URTB 1QVOB 5DZNA 3ILPA 4Z8FH 2R39A 4KGLA 1EJOL 2QQKL 4PGDB 3ARTA 2CLVB 5ADOH 1QSEB 3QWOA 2QKIB 1AXTL 1NCBH 1VEMA 2ZP0T 3ZKXB 5E5MA 1FRGL 3HRZA 4NO5A 3MJ9L 4C4KO 4PBVC 1SY6L 2BY1A 4NSKB 1BF8A 4G5ZL 1NMCC 5EN2A 2O5ZH 3V4UL 4HJ0C 1XH3B 1UXWB 3D0LB 4JFEA 3FQTA 1NMAL 1E0OB 3IGAB 1JPFB 3MZTA 4KHTL 4YIQB 4AG4H 5L88L 3OBAA 1NLDH 3KXFA 3UTTB 3G6DL 2FATH 3VXUE 4HV8A 5M7QA 4JFED 5HYJB 2NLJA 3TA3C 3UAJD 4L8DA 1H8OA 4DJMA 4DKDC 3NCYP 4P9HH 5TPWL 4X9GA 5JHDB 1I9IL 4Y2DA 1MY5A 3IRZA 4KVCH 5EBMA 1CZ8L 2EYTB 2K9UA 2EO9A 4YO0B 3FCTA 1BM3L 1RZJC 4LGSB 3RVXD 1FNGB 1Z0MA 4APQB 5K33A 4Z7VF 2WWMC 4Y2DD 1MCOH 3C09C 4OV5A 3NTCL 2JKXA 1DN0B 3HFML 3D0VA 4JKPH 4JFHD 3GEWB 1IKFH 4CVZA 3BXNB 4GAGH 3FO0H 3FJTA 4RGND 4GW5A 4JQXC 3V0VB 2UZIH 1N4XH 3EW3B 2Z4QB 4LOUD 2NY4C 5JPNB 5EUKB 5HDQL 4L4TA 1AXSB 5MEPB 4YE4H 1NEZB 5C0RH 1UM5H 2OM5A 5MEOA 2Q8AL 3LVEA 5MEQA 3O8XB 15C8H 1YEDA 2YBRB 5F9OH 3LKOB 3S34L 1CL7H 4Y16B 1AP2A 4OGAC 4DGIL 1IGJB 4RBPK 5GS2D 5ADPH 4FQHA 4LPUA 4HUVB 2YD8A 1T04A 3RAJH 1ZT1A 3HC4H 5I15H 4PTTA 5F1NA 1I3GL 4PLKC 3MA9H 4E41E 5F7FA 4KRPD 5HDBF 2L7UA 5JOPE 1FZKB 4HC1H 1MCCA 1BHGA 4Y7MA 4DZBA 1QNZL 4LBEB 5DMKB 4XTRD 2DN7A 3OKEB 3K46A 3WLBA 4JPIB 2IADA 3ZKXC 5HHOE 3UJIL 3IU4H 2X4TA 4JFOB 4OCMC 3IKCA 3PWVA 4DQOH 4QXWA 1IM9A 1YPZA 1PX4A 4MGXA 1KTDA 3DVNA 4KJPC 2X5PA 3D1MC 4MXWL 1AD9A 5DA4A 1I8LA 5BJTA 2I24N 3HC0A 3CAFA 4CVUA 4IMLB 3O11A 3OXSA 4LP4A 4WUKH 5GS1C 3MNZA 1YMME 3E3QE 3VXSE 4GUPB 1CXFA 5T5FH 2F53E 5EWIH 4LSUH 1INDL 3HR5A 4XMKH 5DEFB 1J1PH 4UV4L 5D8JH 4Y4HA 5IW1A 1L7IH 4U1HB 3FQUA 3L5HA 2EDWA 3JBG7 3BKJL 4D9QD 2R0WL 1DQLH 1FC2D 4ZOCA 1G0XA 4QHNB 1JBJA 1MI5A 1LDSA 3E0GA 1CBVH 4I5BB 4Y4HD 3VFTB 5C0AA 5DD1L 4F7PB 4JHAL 5H2BB 4FFYL 4OZGF 5F8RC 4APQC 3TPUA 3VFWA 1P5UA 4MX7A 3WJLA 2ZCKL 1MI5D 1SYVA 4X83A 3O81A 3QQ3B 5FM4A 4RAHA 4GMSH 4KDVA 4H1LH 4PJ8A 5C0AD 5DMIH 3U0PB 5HI4D 5F1OB 1GIGL 5LGJA 4D0BA 3HE6A 3PP3K 1G9NH 1BBDH 3SDXE 5GXBB 3ZDXF 1RK1A 4PJAA 4WU7A 4E42B 4PJ8D 3WUWA 4FFZH 5KS9F 3O8XC 4LF3A 4YLQT 3TV3H 2YSSB 4LCWB 4M62L 3BKCH 3HE6D 4PB9H 4PRID 4Y16C 3HZYA 2VXSH 3HE7B 1CE6B 3P4OB 5JW4M 2APBA 1EZVX 2D03H 4ONFL 4HKXB 2CIIB 1BREA 1J11A 2CGRH 2R4SH 3F12A 3GFUA 3MRQB 4ZPTB 1N6VA 3RWHA 2Z92A 4MA7L 4OZGA 5J13B 1ERNA 3K0WA 2GK0B 4OI7A 5IHBA 3EHBD 5KSBB 1DE4A 4HUNB 3THML 4M4RA 4OCSL 4RWYL 5DHVA 1T66D 1X5LA 5F9DC 1FNEA 3S37H 2YR3A 1HZHH 3B6SA 2MOVA 3IS1X 2BNQE 1ZVSB 2WZPD 1YZZA 2IJ0C 2NY6D 2R0KL 5B39A 3NAAL 5IEKA 4PJ9A 2W9EL 2OQJB 4JDTL 2YD7A 5T3ZH 5D1ZB 1Z9LA 5IB3A 4MQTB 3CH1A 1YJDL 2EDDA 5B3NA 4YBLC 2F8VA 2VLKE 2APXA 3DVFA 4QHLB 1MUJA 4PJ9D 2P5WA 4PJ7B 5CJ5A 3VFNA 1EIBA 4H0HB 1XR9B 2AEPH 2FJHB 2FL5B 4YX2H 1IAIH 3O2VL 1ZT7B 1MCPH 3TVMB 3ROOB 2HVJA 1NFDA 3D3VB 4K8RD 3QYCA 4C58B 4C54A 1F11A 2P5WD 5ID1A 2CDGB 4NQVB 1UM6H 3C5JA 2HT3D 2IBGA 4X5WA 2VDKH 4BQ6A 4X8JA 1KLGA 4GG8A 1Y18B 2OJEB 4MD4A 4OF5A 2DQTL 4C55A 4Q6IA 3U2SB 3LEYL 3SOBH 4FABH 2H32A 3U9PL 1A6ZA 4K3DH 4OLYH 4NQSA 5CJQH 2WP3T 1NC2A 5ICXA 3S35L 2B0SL 1JTPA 2WUBH 5FCUH 3MMEB 4HAGA 3IFNH 2DJ4A 3U1SH 2RCSL 4IHOA 4MCZA 1INEL 3MV7B 3QDAA 3WO3B 3MV9B 4M43L 3DURB 4WEUD 1NC2D 4YHOL 5HYEA 1EFQA 1JZ8A 1ULVA 2VDMH 1OW0C 1EBPA 3QUMA 3BMWA 1P4IL 5GS0C 5IJVA 5TH2B 4UBDD 2W65A 3QPXL 5FCSH 4Y4KA 4YR6B 2PYEE 3PGDB 3O6KH 3HE7C 1L0QA 1MFAH 4U6VL 4HLJA 4LLWA 4XP9H 5IMKB 3UBXI 1DUYB 4JFZH 1G9EA 4Y4KD 5SX5H 4WI8A 1KTLB 4X7DC 4FTVE 4MA8H 4JFXA 1SEBA 3C5SA 5AG9A 1M7DB 1SJEA 2DQFA 3VRLF 3AMLA 5CD3B 5J13C 3RX5A 5I1AB 4H0GA 5FYLH 4XP4H 5I1JH 4M8QB 5DURD 1CFTA 1JGLH 4LEXH 4AEEA 3WDIA 3FZUD 3Q6FB 4X7FC 3RL1A 3LHPH 3SJVB 1N7MH 5C08A 5HTSA 2XN9E 5SWSA 3QULA 3NZ8B 2BXZA 2WIIB 1OGAE 1JZ2A 4UV7H 5HYFA 3PL6A 2R9HC 4OFIA 5C08D 4QHUA 5ANME 1U6AL 2VIRB 3RHWF 4I3RH 3C8DA 2HJLA 2IALB 1WCBA 1BF2A 2H3NB 5SWSD 4FN0A 4KMTL 1IGCL 5FO9B 2F5AH 1F45A 3BGFC 1FLRH 2HFEA 3T8XB 3PL6D 2KL6A 3IJYB 1UWEH 2GY5A 3MODH 4RIRB 2ORBH 4U3CA 4XPHL 3ZKMC 1IGIL 1XGRB 3MPCA 3NPZB 1EZVY 1RUQH 1ZT4A 3O4OB 1VACA 2Y23A 2F19H 4UT9H 3FFDB 1J1OH 2CXKA 1Y0LB 2YA1A 5EOQH 4WUUE 2HT2D 2VDLH 3MUJA 3EYOB 3LIZH 4G6MH 3CX2A 1OD7A 2FX8L 1N59A 3RWJA 4JN1L 4S1SL 2EE6A 3GGWA 3GIZH 4X80H 3TCXA 2QSCH 4M6NL 2HN7B 4CRPA 1IE5A 4RQQB 1IKNA 2OP4L 1VB9A 5B38B 1FBIL 4NQCB 1Q0YL 1E27B 1XIWB 3FHAA 3LN5A 1U9KA 1P7HL 1YY8B 5JLZB 3FFCE 2HKFH 3QO0B 4EXKA 3SKNA 4JN2B 4DAGL 1VFBB 3VFVA 3OKDA 4I18A 2EZ0C 4NUGL 5E00B 4YXKL 1BBJB 5TJWK 2BVUA 3FRPG 2MQ0A 5ESVB 3V6BR 5C0GB 4G8EB 5C6PB 3ULVC 5HHXL 3V6ZB 2GW5A 1ZKAA 2VXVL 5ITFA 4ODXB 3UTZA 5TF1H 1YMHA 1YNKH 5E94B 4KK9C 3G08A 1E6JL 5E56A 3ZHDA 4M00A 1QRKA 2OR8A 4R7DB 4D0DA 1R0AL 1C1EL 3KPNB 4KROC 4HK0B 1KTRL 1MPAL 2CKBB 2IH1B 2WUCL 2E3VA 5LXGL 4L3EB 2P1YA 2VJXA 2YPLD 3OPZH 4NN7B 3TCLB 1EA9C 3NACH 3T4AB 3S4SG 4K3GA 3ZHKA 3TO2A 3JSSA 5KSVB 4Y5YA 1UCTA 2XWBB 4N0CC 4P23A 2YN3A 3P0VL 4UDUA 5IBLD 4MNQA 4M7JH 1S8DB 1YYML 1GXEA 8FABA 4XNUH 1KYOJ 4MA3A 5HHMB 4J3SA 5I8OL 4P23D 4P2RA 4IJ3C 3FQWA 5I30H 4PJEE 1JV5B 3EYSL 4G6FB 4MNQD 4B7IA 3UP1A 3JVGC 4G8IB 3SE4C 1I1YA 3RA7H 1FG9C 4X7TB 1T0PB 1LMKA 3BKYL 3MXVL 2EC9T 3AGVA 3M17A 4P4RA 3WFHA 3MRNA 2OZ4L 3B8SA 4XBPA 3HC3L 5IB2B 4HJJH 5DJYA 4POYA 4HMCA 3WE6A 5I0ZA 1H3WM 3ILQC 1OOAA 3V9FA 3VG9C 4P2OC 4R4BB 5D7LA 4JRYD 3B9KB 1CLZL 2GTWB 4HS3B 2J88L 5MP6L 1HHIA 4OB5H 1XCTA 3GMOA 4R9HA 1AQKL 1H3TA 2NQCA 3HAEH 3RVUD 1KIRA 2BP3A 2GSGA 3MYZA 2V7HA 1T83A 5D7LD 1JI1A 1FG2A 5CFHA 3PHSA 1SYSA 4IOIB 4M7KH 4LNRB 1MRDH 4QRQB 3P4MB 1S5HB 4KTYA 4E0RA 3BW9B 5LGHL 2OS7A 2F5BH 2VR5A 3QRGH 3PG2A 4L4VD 4MNHA 3B2VL 4AM0B 1S7TB 1ZS8B 5IVXB 3MOBH 3OX8A 4QCIA 4QY8B 1EHNA 1PKOA 4Z7UE 2G75B 4X6CE 3DUUA 4U6HB 5H8DA 1SJVA 4WJ5A 3T4YB 1CE1L 1XR8A 1RQ5A 3QSKB 1LE9A 2BJML 5FDYA 2VLJB 2R8SH 1TETH 4HIXL 2VLLB 4NOBA 4HBQA 2UYLA 3FKUS 4HGKC 1GJIA 1DTUA 1CDCA 1QBMH 3QQ9D 4KQ4L 2XOTA 1VFOA 1RULL 2HH0L 1T7YA 1K4DA 3MRJB 1JFQH 4HUWB 2C1OA 4OAWB 1HH9A 4D8PA 5T3XL 5C0CE 3RTQA 5HVHB 3MRBB 3T1FB 2CKBL 2X09A 4JREB 4FA8A 4HF5L 4HGMA 4JQIH 3MRKA 3W0WE 4P2QA 2VLRD 4POZD 1WZMA 3RTQD 1AD0A 2GJZA 2XPGA 3QEQE 1YEIH 5JXEC 1GGCL 4KKAD 5GGVH 4KWUA 1V7NH 2YRPA 5DHYB 4QOKA 1VERA 3GBML 1H5BB 2A0LC 3DSNA 4P2QD 1HH6A 3DMMA 4OLXL 4YGAB 4RGMB 5IBTH 4Y5XA 3INUL 1PEZA 3IDGA 4EI6B 3H3PL 4PY7B 2GKIA 4PP2B 5FF6A 4QOKD 3GSRA 5K59E 1I7ZB 4MA1B 3DMMD 4JJHA 4ONGH 3JWDC 1EFXA 1UZ6F 2VXUH 3EOAA 1QTYT 3FOMA 3RNQB 1A3LH 4C83A 2CO6B 3SDYH 1UWGH 4OGZA 3B9KC 2H8PA 4TULH 5B8CB 3QUYD 2NYYC 5BOPA 2XY2A 2VL4A 1EFXD 4TTGA 4YHML 4WEBH 4O2EB 3K7UA 2LVEA 4KK8C 1DL7H 1HXMB 3GB7A 4X5XA 3WKML 4KI5F 2E7CA 4G9FA 4NT6B 4XCEB 3MR9A 3KJ6L 2NX5B 3LD8C 5I1HH 3GM8A 3ZKNC 2IANE 1B0RA 1WC7B 5IHLB 5INCA 4LRIC 2OI9B 5FXCH 4HGWA 1NGXA 5H94B 5K9KA 3FQNA 2LE9A 4FNLH 3VFMA 3MCKA 3JTSB 3QXTA 4G9FD 4ZYKB 5F3BA 1MH5A 5ABDE 3QR2A 5J57B 4WHYG 3KPLB 2ED7A 3IS0X 1LP9F 3O2WH 4XB7A 2B1HH 3TH2T 4ZQKA 4JFPB 4EVNB 1OAYL 5J11C 2G5BB 1U8PA 1WFUA 4U3HA 3WDHA 5I6XB 3PE9A 3DSFL 1DDHA 3TBSA 1GZQA 2B20A 1KN2L 3DTXA 4N8VG 3VFGH 4O51B 1VFUA 2VERN 1CWVA 5CGYC 1LE5A 2DBLH 3CU7A 2AEQH 5D7IE 5DD3H 3ESVF 2XYCA 4HWBL 5HDOA 3G04A 4DVBA 4HJGA 5C0IB 4NJAH 1VADB 3CDYA 4LSVL 2PF6A 7FABH 3MLTB 1MCEA 4PV9A 4WTWA 4EDWH 1KIPA 4Q9RL 1TZGL 1YDPB 5EU6E 3FMGH 4RFNC 1QEWA 4PRPE 1RZ8B 3WIFB 3U46A 2NY5L 4PJGE 4TNWF 3Q5OA 3EOBA 4PJCB 5GISH 5EUOB 1D5BB 1XCQB 3T2NL 2R0ZL 2M2DA 1LEIA 4WHTA 2NY0D 1LP9A 2V5MA 2C3WA 3L5XL 3IDXL 4QXGL 3FT3B 5HY9B 5JW5B 4PGCB 3OKMB 3WFBL 2P8MA 3CFDA 4FZ8L 4LQFH 5D9SB 4OUOA 5T1DH 4YHNB 1H5BC 2EDKA 1U36A 1FSKC 3TJEL 3OMZA 3RUGA 4RGMC 4OIIL 4XP1L 1J0YA 1TENA 1E4KC 2K7QA 1KLUB 3BEWA 4NQDB 4TQEL 1Q9KB 4HZAA 1B3JA 2WWKT 1OL0A 5IROA 4LPWA 1DLHB 1FHGA 4JCMA 3T0VA 2X4NB 3HZMB 3EUUA 3LKNB 3X13B 2OXGA 4HFWB 3PWPE 5IB5B 2AEIT 1PZUB 1I7RA 1E4JA 4DUWA 3ARPA 3AXLA 4D9LL 1TJGH 5KAQF 4XXDA 1J87A 1W0YT 4YZFF 3HLAA 4CMHB 1EH9A 4XMLH 3MLVH 1A7NL 2VQ1B 1ZHKB 1HEZA 1CVRA 2OI9C 4U6YA 4R26L 3QWRA 1F2XK 1D5IL 5J3HD 1LO5A 1QBLH 4PJBF 3NIDF 4WV1C 1CT8B 2I26N 3P9WB 3MBEC 4LVEA 3KPMA 5H37H 4OJFL 1T5WA 4W6XB 4WEMB 2MHAA 4NO5B 2OSLB 3QWRD 1RJYA 2H2SC 2DIJA 4HC1A 3FB5B 2V2TA 1G7MB 2EH7H 3T3PE 3MLXH 1CN4A 5I6XC 3UJTH 2GK2A 5JXAH 5CSGA 1BZ9A 4CL7A 1IQDA 3WFEH 1P5VA 4X7SL 4FQXA 1R3KB 5D71H 1GPOL 2YPVL 4AMKH 3G5ZA 2KQNA 5F89B 1MIEH 2A6IA 4NNPL 1F4XH 2NTFA 1SJHA 4ZMAT 4FQXD 1LD9A 4ELMF 2WMPA 1ZTXL 4Y2DB 1VCAA 3I6KA 1RIHL 1ZANL 2W0FA 4PJBA 4FXLA 3RKPA 2P5EA 4XNQA 3VH8A 3O3BA 4RGNB 4LMQI 3QO1B 4ONOA 4YDJA 2NZ9C 2DLHA 4CVZB 2RAMA 2P5ED 5E4EB 4KHXH 3X3GL 1R5VB 1LILA 3FONA 4ISVB 4X9BA 3QIUA 2B8OT 3BVNA 3DARA 3KR3H 4JANB 1VFAA 1LQSR 3F5WA 2AGJL 3TT1H 4BFIA 1CGWA 5E2VL 5E1HB 5DJCA 3IRPX 2E6QA 4R96A 5MEOB 3QIUD 5MEQB 4GAJL 2VDQL 4KTDH 2VXQL 5GZOD 1UACL 3LMJL 5TE6H 3MACH 2DWEA 1MNUH 3QEUA 4KRPB 2V7NB 1NSNL 4ELMA 3NCJH 3U4BH 2EEAA 4FQHB 2D3VA 4OD1H 4Y19E 1ZLSH 3B9DA 1CU4L 4YDIH 1KT2A 5D72L 3S88H 2Z91B 1V7ML 3QUKA 4PTTB 5F1NB 1T1ZA 2UY7A 3TN0B 4JAMB 4MQSB 5EB9A 4XPGL 4ZXBA 4HIJA 4KTEL 3BGMA 5B3JF 5FK9B 2EE3A 4FOMA 4PY8I 4DZBB 3MGAA 4YDKL 3VXMB 4NKDA 4OZIF 4K71B 3BSZH 1Z3GL 2ICWJ 4ENED 4D94A 1RAMA 4ZXBD 2IADB 2VZTA 5E6IA 2X4TB 4C4KT 3P9MB 3IKCB 3PWVB 5D2LE 1AI1H 4OIBA 1F3JB 2HTKC 1YPZB 3UTQB 3HI6L 3RKDC 4YAQA 4P59L 1KTDB 3DVNB 4NWTH 1BQHA 5KN5A 1NEZG 2MKWA 2DL9A 3F58L 3QH3A 5I71B 4MAYA 1NAMA 5E6ID 4RSVA 4FMKA 3OAYK 3O11B 4RMSA 3UAJC 4HKBA 1NGZA 3MCG1 2AJVL 5JW4Q 1AO7A 4G43A 3IYLW 3MJ8A 5E03A 3GMLA 4EI5D 4MAYD 2HFFB 1MAKA 3EFDH 5MEND 4KRLB 1TZHB 1LWRA 2N7BA 2O5YL 4W4NA 3FQUB 4QTHB 3RVXC 1AO7D 4W70A 1HSAA 4K7PX 4QXUH 1MEXL 2BNRE 3SGEH 1MI5B 3NA4A 1FFQA 4OZIA 3QXDB 3MRMA 4DK3A 4JFQA 5FOBA 3O6FB 5C0AB 1GAFH 5T3ZD 1S7WA 3GHBH 1UA6L 1WF5A 6FABL 2BVPB 4UT6L 3BEVB 2OCFD 4MX7B 1U2HA 1VSCA 1SYVB 2E6JA 5HGBB 4KU1A 3ZKQD 3VFSB 3WSQH 1NPUA 5EFIB 2DKMA 3U0WL 1A64A 1BEYL 4N90D 5B4MC 4PJ8B 4NNXB 4Z18A 2QHRH 4LARH 1BFOA 5FUOL 3V5HA 4NKOB 3G5YA 1T80A 4M48L 5LGJB 4TUOA 4ODSL 3K2UL 3HE6B 4PRIB 2KZWA 4K9EC 1M1SA 4PJAB 5C7XL 5D2NB 3BZ4A 1PYWA 5GGTA 5GGSA 2UV3A 1R5IA 4LF3B 2PYFA 2EECA 3S5LA 2OR7A 3DHJA 8CGTA 1NBVH 1A7RL 2OK0L 4K9EL 1J12A 3BESR 4ALAH 5I8EB 2XWTA 4RCAA 3SE8H 4P3CL 2VLMD 4TSCL 2BSTA 2JJWA 2P45B 1G7IA 1S5IH 3RWHB 5L2JA 1T03L 4Z95H 4U1SB 2BX5A 3TN0C 2Z92B 5HHNA 5BW7A 5F7DB 1MJJA 4KDTC 5DJ6B 3WHXB 1KPUA 4IRSB 2NY6B 4J2XA 2GT9B 2GTZA 3GSNH 2QL1A 5DHVB 1IGML 5FB8A 3A6BH 3KYMA 3B6SB 5TDOA 5FO8A 2P42B 5F7HA 4GQ9H 1FCCA 4F7CA 3W2DH 2W9DH 4AY0A 4X6FB 3IDJB 1TVHA 4L3EE 3ZTJG 3T0EE 2DTML 1UENA 4GW4A 3RZCD 4JHZA 4KQ3L 4LAQL 2VTFA 3MNWA 3VFNB 5FYLD 4G3YH 2XTJE 1RK0A 4WU5B 5AUMA 2JLLA 1YEJL 3K4DA 5T33L 1NFDB 4XVJL 5E99L 3O3DA 3ARZA 4PJIA 32C2A 5KVEL 1T4KA 3F62A 1O5DT 1CR9L 1KLGB 5TFSL 5CP3H 3WN5A 5DQ9B 4MD4B 4HG4J 3EYVB 3O6FC 4Z7WF 1JPSH 4IDLA 2ERJB 4Q6IB 4M5YH 2H32B 5HI4C 1A6ZB 1HI6B 4L5FL 5FYKE 3GBNL 4XNXH 3P4NB 1A6AA 3BWAB 5DK2A 4B7LA 4UINH 3QZWG 3CZFB 4IRJC 1QYGL 4LL9A 1TQCB 1AFVL 3EO0B 4F7MB 4MCZB 1HQRB 1QHPA 1TJIH 3V5DB 4AEFA 4KK5C 5GSVA 4O02H 5C07A 2VDOL 1ZLVH 4JZJC 4M3KB 4OT1H 5DFTA 4F3FB 2AJ3B 1DEEA 5D2NC 2AKRB 1CDGA 3RGHA 1CLOL 3QUMB 3I2CH 1ZVHA 2IGFL 3MV8A 3VXTA 1KJMA 4PJXB 4ORGA 4M1CD 4K3JH 4IDJH 4TRPH 1HHHB 5CEXB 5ILTH 1NCTA 2IFGA 2B5IC 1ZAGA 5FUZH 2EH8H 3GUTB 3CSPA 4Z7WA 1U8JA 2C1PB 3EO9L 4JY5L 5DXWA 1SEBB 3C5SB 2ITDA 3VGGA 2IQAB 3DX9A 4OCWH 4TVPE 4OGXH 4NKMA 4QRRA 3BI9X 1T6VN 3JV6A 3KG5A 1VGKB 5CIPB 5F7EH 1QLRB 2HG5A 4XCFH 4LVOB 4WHCA 1YN6A 1W8NA 4IRSC 5GIRA 3AREA 1MREH 3W9EA 1YNTB 4ODBD 3UYRL 4TTDD 1TITA 3L7EA 1OAZL 4QRRD 2DKSA 3WFDH 3ARED 1QLFA 5MERA 1YN7A 3PWLB 3H0TA 2PW1A 5GGVY 3SGDH 4JFFA 4M93B 4OQTH 4D3CH 2Y1VA 2EIEA 2HJLB 1WCBB 2QR0A 3QDHA 3EO1A 4DUVA 5E5RB 4U1GB 3OWEA 2BMKB 1NFIA 3OB0K 4JFFD 1W0WA 3WFCH 2A73B 3O4LD 5CILH 5DRNA 5CLWA 2Y6SD 5ITBH 3LH2H 3Q6GL 4Z5RB 4M8VA 1CFQA 4K8RL 5EO1B 4HIIA 5EZLA 3U7YL 5CZXC 1VACB 1Z0NA 4MQXC 2FR4A 2C4FT 4IOSD 4Q7DA 2F15A 4CDHA 2DL2A 1T20B 2BY3A 2ERJC 3VI4F 3GMRA 1N59B 1D6EB 1TZIA 3RWJB 3S36H 2ESVE 4U33A 4NZTH 2VRAA 1FYTB 4WNQA 4GG6E 5EA0H 3MLUH 3QFJD 4XVSH 2D0FA 3NN8B 1JTTA 4XNZB 4RAVA 4XI5C 4JPVH 5E8OA 3CVIL 3HUJE 2FO4A 1IL1A 3REWA 4PJHF 3P11H 1C12A 1JMXA 4S2SA 3HAEA 3OKDB 4I18B 3KYAA 3D9AL 4LLMB 5JIPA 1UCBL 1E4WH 5AWNH 5TDPB 3P77A 2DI8A 4FQ1H 1JHTB 3G6JE 4F57H 4R7NB 3P9LA 3QUML 5IW3A 4NRZB 3CXHK 3RVWD 3SHSA 2X7LA 4OFVA 5F72S 2JCCE 2YPLB 3CJJA 2B2XL 5ALBL 4D0DB 2VC2H 4Y5VB 3VMOA 1KCLA 4NO2A 1A7OH 5DT1L 4K94L 3O6LH 4A6YB 4NZUH 5JIHA 3EOTH 4YPGB 2DDQL 2XZCH 1KJ2H 3C87A 3LQAL 4PBXA 1AIFB 1CD0A 1H0DB 3I50H 2FHBA 2IWGA 1DN2A 4PJHA 3F6IA 4XMPL 5BZWB 2F58L 1U58A 4Z77B 2CJUH 3PGFL 4OCXH 3DYPA 3VXNA 2EEDA 1Q72L 2ADIA 4Z7QE 1NKOA 3DBXA 4AIXA 4M93C 5EZOL 2FX9L 3SQOH 4N0YH 4PBWD 3I9GH 1DBKL 2WW8A 1K8DA 4JY4B 4U1GC 1T6WA 4LLQA 2IG2L 4EZMA 5C09E 3U7AA 4R0LA 2VQTA 1BAFH 3KS0J 3M17B 4JRYB 2HLAA 2VH5H 3WFHB 2BSRB 3RY6A 3MRNB 2XV6B 5T1LB 5I1LA 4LU5L 1A1OA 1MRCL 3VJ6B 2ITCB 1OP9A 1CFVL 5F6HJ 2DM4A 2I9TB 4DVRH 1GL4B 5D7LB 3PWJA 3TP4A 3S96A 2EE9A 3ARDA 3TF7C 1E6OL 2X9WA 2IMNA 3VXUD 3F7VA 2V7HB 1XZ0B 1FG2B 4L4VB 1T2QH 4FZEH 2ICCA 3QFDB 1LHZA 1I85A 1MCIA 3TIDA 4WFFE 4XNZC 5LGKA 5FGRA 5J9PB 1NCDL 5KVGL 4E0RB 2P7TB 2R4RL 3ARDD 3ZDYF 4HXBH 1NCWL 1CD9B 1QFWI 4FQCH 1MIMH 3BX7C 4MNHB 3WJJC 3QWQB 4XWOC 5FHBH 4ZFOA 5HI5D 1MFEH 4I48A 2EC9U 3OB0H 4QCIB 3OB8A 1TMCB 3SDCD 3X11A 1BWWA 4WJ5B 3AAZA 4QYOB 1XR8B 5DVMA 3LB6C 3I02A 4N0UA 5FA4A 3CSGA 2YD1A 2YMXL 3WXWL 2UYLB 3MFFA 4JLRA 5GZNC 3OKYA 4Y5VC 1XF2B 2CIKB 3VFRB 3QISA 4Z7NF 3P30L 3PP4L 2JF1A 4CNIA 2Q8BH 5BV7C 2GUOB 5D1QA 4WTXA 3DJ9A 4PJDE 4V1DA 5GPRA 5I8KL 1ITCA 4E41A 4DKEH 2VLRB 4YWGH 3RTQB 4O5LH 1KSRA 5CGMA 4XXCA 2AJXL 2R2EB 5D1QD 3M8OL 1XF4A 2DM3A 4P46A 4V1DD 5E0QA 2VR9A 4P2QB 4E41D 2EXWC 2VZOA 1DFBH 2VITA 4DCQA 4L8SA 5HHOA 3RVVD 5JOPD 5GGUA 2ZSVA 4HWNA 3HI5L 2A9NL 2CRMA 2A2QT 3HS0B 4P46D 2IMMA 4G8GE 1J8HE 5AD0B 1HH6B 3DMMB 4NO0A 5L8JB 5HHOD 4LPVA 4UT7L 3QQNA 3IDGB 1OP5K 1B4RA 2Z8RA 3GSUA 3SDXF 4L8BB 12E8H 3WNMA 1R5WA 5FF6B 3QUYB 3GSRB 4I0PA 2F53A 5C3TA 4JM4L 4PG2C 3EOAB 3FOMB 3VFOA 4Y4FA 4PV8B 4I8DA 2DQCH 3RIFK 1NAKL 2DD8L 3V8OA 4QLRA 4KKBD 1R3IL 3VXSD 1P1ZA 4I0PD 2F53D 3GJFH 4M3JA 5DEZA 5IFJA 4QWWC 2X4RB 4O2CA 4Y4FD 5DD0L 4G9FB 3BH8B 3T3ME 2IPKA 1YUHA 3MRRA 2BVQA 4HHAB 1QR1B 4HGWB 4U1NA 4OIAA 5K9KB 3KDMA 1JVKA 3FQNB 4F58L 1JIBA 1YYLL 2ZCLL 3DROB 1N6UA 4NN5B 3TESA 4LSRL 3ARBA 5GJTH 2H9GA 1ZHLA 1QRNE 5IG7A 3NIGE 3SDXA 4ZQKB 1L9MA 4N8CL 4LVNC 1CLCA 3Q5TA 5D5ME 2R2BB 1U8PB 1ZEAH 2X05A 3GSVA 2AJZA 1MJ7L 3ARBD 4DZ8A 1A0QL 2IPTH 3ZE0F 1DDHB 2BOBB 1AR1C 5BVJA 4WW1A 1RIUL 2AW2A 2IFFH 4XNMB 3VXME 1S9WA 1LE5B 4OZ4B 5IMOA 1SM3H 4KI1A 4LAJH 3S4SA 1NCCL 1A8JH 3BUYA 5KG9A 4WFHE 4OKVA 4NJ9H 2E7MA 4PUBL 3G04B 5LQBH 4DVBB 4AQ1B 5E24E 2Z93A 3GSXA 4HJGB 3VXRE 1TCRA 1IEBB 2QQLL 3JWOC 2P8LB 3K80A 4PV9B 1KIPB 4PD4J 4P4KA 4GMTL 2OMBA 2NY0B 3MOAH 1F00I 4H8WL 4N1CA 1QEWB 4KKAC 1MFDL 4RAUA 4XP5L 3U82B 4GXUN 3QJHA 2E5EA 1RUPL 4W4OC 4Y2OA 5C0JB 4KZDH 4P4KD 1LEIB 5C0FB 1DANU 2BRQA 1IC4H 5DWUH 2BVEA 3SDAD 1PSKL 2P8MB 3CFDB 1P84J 1MJUH 1IILE 3T65B 3OJMB 1HOCA 3RUGB 2Z0BA 2WBJC 3O45A 5D96C 1RFDH 3PIQA 4RWHA 4XNYL 5I1CH 3I75A 3REVA 1RMFL 2ZUWA 1P7KB 3QUYC 2VLKA 4P5TA 1CF8L 3B83A 1N8ZB 4OGYH 1S7QA 3RVTC 1OF2A 5JMOC 1I7RB 4UQ3A 1C8PA 2ATPA 4P3WA 3T0BA 1K8IB 5F3HB 1B0GA 1RHFA 3AXLB 2XNAA 2VLKD 1NANI 3GI9H 3JV5A 4P5TD 2IPUK 2YEZB 3WIIH 5E1AA 3ZT5A 4XXDB 5CD5D 5IF0A 2O61A 4J4PA 5EC2A 1MHPL 1MWAH 1XGQA 4OZHB 3P73B 1GH7A 2YUVA 3N1GC 4TNVK 5JORB 1X5KA 1F58H 3GRWH 2PUQT 2BVYA 5BMFL 1HEZB 1G9MC 4X6DF 1MHHB 2Y06L 5CP7A 2DB8A 4J4PD 1OAUL 4QKXB 2H6PB 5D93B 5ECJE 3LS4L 3TPKA 5HPMA 4XC3H 2X9YA 4GSDH 4HS8H 4UAOB 5ACMA 3WNLA 3CVHH 3FOLB 1KIQB 4NN5C 2JJUA 3U4EB 3BPCA 3ULUF 1T5WB 2OL3H 3QDMA 3TNMB 3BE1L 2QSVA 1XGTB 4IRZL 5C9KA 2AABL 3TGXA 1CQKA 1RJYB 1MFCL 2VDRH 3MBXH 1X4XA 3DRTA 1YQ2A 2V2TB 5C0ND 5I76A 3N1QC 3QDMD 3DX7A 4LSQH 4MDJB 4U1JA 1BZ9B 1IQDB 3RZWA 2FJGA 2UVEA 2WBKA 2BRRH 3A6OA 4PR5A 4N8PA 3TZVD 4Y1AA 5DR5H 2J1KA 1BPVA 4ZFZB 1NCBL 3MUGA 5BRZE 1X4ZA 4X6DA 1CCZA 2DIAA 5DJAB 2JJSA 4OD3H 4MJ6B 3I6KB 4JY6A 2QEJA 3UROR 5K9QI 5D6CB 1LDPH 2VUOA 4FMFA 1F4YH 2O5ZL 3O3BB 5EORH 3FO1B 3O2DH 4YBQD 3O41A 1GC1H 2XN9A 1WBZA 1EX0A 2A83A 2D31A 1MVUA 1NLDL 3VFPA 3FONB 1JNLH 4JGMA 5F7YC 2FATL 3QIUB 3ULUD 1ZHNB 4GRWF 3N85H 1UADC 2JELH 1MQ8A 5ANMA 2XN9D 4KDWA 1S9KC 4P9HL 1HHJA 5DJCB 1QP1A 4ZSOA 4KVCL 4KXZI 3RX7A 1OGAD 1YNLH 1MAMH 4H1LB 2A77H 3BHBB 5IB1B 5FYKH 4OF8A 1NMBH 3HZVB 2YA2A 1MCOL 3N1PC 2APWA 4L1HA 3EIFA 1IKFL 2D7TH 4GLRI 1KT2B 3X14A 4GAGL 4GT7A 1QBBA 4WUUA 5GGRY 4EBQH 1T1ZB 4J3WA 5KSUA 3JWDH 2HRLA 4QGTA 3KGRA 2UZIL 1N4XL 4GBXB 4Q74A 4HIJB 2DQEH 4WWKB 1U8QB 3TBTA 1ZK9A 1E4XH 4YE4L 5ESAB 5C0RL 3DNKA 1UM5L 4WUUD 3S35X 1MLCA 4ZG1A 4KKLD 4RGOH 1CTNA 3VGDA 5F9OL 4NWUH 4PRDB 1EEZB 2QADD 2XWJB 4FXGA 1KXVC 5HYIA 5L2KE 3QIWC 3BISA 5ADPL 4YAQB 3FFCA 5KN5B 1WSST 3VU2A 1A9EA 3UZQA 3MCLL 3RAJL 1PG7H 3QH3B 3HC4L 5I15L 4EI5B 4MAYB 3P0YH 5DRWB 4NIKB 5MENB 1CLYH 3MA9L 1T89C 1UQSB 1YQVH 2CR6A 4TVPH 4DN3H 2G9HA 3FFCD 3MUHL 4KJQC 4LASL 4QNPE 4HC1L 4G43B 3MJ8B 4LCIH 1ROWA 1SMAA 3NABL 4M03A 5IM7A 5DJXA 3M1BA 2HWZH 4F37K 1NC4A 4YHIA 3LKQA 4MQ7B 5AAWA 2FZ3A 3IU4L 4N5ED 1HSAB 2OTUB 1X3DA 1I7TA 3RQ3A 1PKQE 4XT1C 4IEFB 4CU8A 3LAFA 3MRMB 3RWFA