4L4VE

Structure of human mait tcr in complex with human mr1-rl-6-me-7-oh
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Recognition of vitamin B metabolites by mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vE02
3EBAA 3T4AA 4QHMB 2BSSB 3EJJX 3QG7H 1YPZE 5DHVH 2BK8A 3L6FA 2B7DT 3K8MA 3VXPA 5JMRA 4GKZB 2PCPB 1AD0A 2YA0A 5E94B 2ITDB 3R4DA 4O4YL 2QSVA 1CE1L 4OFVA 5CBEA 2O61A 1HQ4B 1NBQA 2CGRH 5F96H 4A2LA 4D94A 1FYTA 4N5EC 4PJIA 1W72L 4YE4H 2XZAH 2C3VA 3UYRL 5IESL 1A6ZB 4R97C 2R69H 4YXKL 1HDMA 3FQXA 2YPKB 4XBEH 1QBLL 2R8SL 1N6QL 2XN9B 3QEUA 4LLUA 4KWUA 5F7MC 5DQJA 4GBXB 2YPKA 2X4QA 3SJVB 3GSXA 3VMOA 2XN9A 4EN3C 3GIZH 3VFRB 2XFXB 4GBXA 5IWLC 2H3NB 3L3IB 1GZPB 3HZYB 3VFRA 3NIDF 5M95B 2XFXA 4Z7VE 5T1MB 4CN4A 4FNLL 5IBLD 1GZPA 3HZYA 4MS8C 4O58H 1SBSL 4K07A 5EUOA 2A6JB 2IPUK 2LAAA 4P3CH 4LVHC 3ROLA 3WN5C 4JY4A 3WNPA 1I7TB 4PUBL 1JNHA 3QI9D 1FVEB 3CFBB 5J7CC 4EXPX 4TTGA 3HPJB 4D9LH 3VFWB 2PW2B 5BV7B 4TRPH 1ZEAL 2NXYB 3FOMA 4PJ7F 4K3JH 3PWJA 2YPLA 1RY7B 4DWHA 5BOPA 2VXTH 2Y07H 1HWHB 3O6ML 1I85A 1T21A 3LKPB 4P2QE 4JLRB 1QFOA 1AC6A 4JLRA 3L5XH 5E6ID 1NC2A 1ZHBA 4CJ0A 4Z76B 4IRZL 1Z9OA 4XNZC 5E0QA 1QUNA 5FKPB 3P0VL 3WFEL 3PDGA 4MXQD 4JREC 1IM3B 4XVJH 5D7JD 1K3IA 1LE5B 4Y5VA 1JV5A 3AS1A 4N1CA 3D69B 1N2RA 1IM3A 3FCTA 1HK6A 3GMLB 4JHBA 4MSWB 3D1MC 2ZSVB 2C3HA 2NX5B 2DTSA 3VFUA 2W65B 4ZAKD 3D3VB 3RVXD 1UQSA 2ZSVA 4M4RA 3UTTD 2J88L 5E4EB 2W65A 1U3HD 1KCUL 2J8UB 2MMXA 5ILTL 5AWNH 5I74C 3EAKA 1PKOA 1JYWA 4UT7H 3UTSB 2HWZH 5I8KH 1QRNE 2H2PD 2MQ0A 3UTSA 2CKBH 2R29L 4X6BB 1CD8A 2BSRB 2CIKB 1IC7H 5CP3H 3BVNB 4OM1L 1JF1B 2IPKB 3BVNA 5GGTH 1IGJB 1NEZA 1JF1A 2IPKA 3QUZA 2A6KA 3TO4B 3MUZ1 4ZTPH 2YD5A 1IGJA 3LDBB 4LNRB 4HIIB 3H42H 5I75C 4HJJL 3GKWH 1L9MA 3E3QE 4OD2A 2ZOKB 1JGVL 4QOKB 3WUWG 3UJJL 4QOKA 1K8DB 1MH5B 1OVZA 1OAXL 4FQLH 4LCWB 2Z9TA 5E8PB 4UB0H 3ZYJA 3CFEB 1ULVA 3FO9A 4Y16A 4LCCB 1JGLH 5E8PA 1YPZB 2YXFA 3CFEA 3DO7A 4GXVH 4OJFH 2MQCA 1BQSA 3HE6C 4EIZC 5FDYA 4WUKL 5IG7B 3NCFB 3UPRB 2I27N 1UCBH 1JRHH 1YN6A 2F53D 1UKTA 1E28A 5INCB 5JUEH 3UPRA 3VGGA 5INCA 5LGHH 3VXRD 3I9GL 4G6KL 4HGWA 1TJHL 1T66D 2FL5A 3TVMB 3DWTA 3TVMA 3T2PA 1J1OH 3G5VA 3OJMB 5KZCB 4P46B 1OGAD 1FFQA 1EPFA 2A73A 4XPHL 5FYLD 2FX9H 4M3KB 3L7EB 4XP5L 3O6FC 2L0DA 3H3PH 3RIAK 2CUIA 4Z7VB 4EN3A 3HE7B 5DSCA 4JHAL 1EMTH 3O2WL 3BGFB 5IWLA 2CLZA 5D2LE 4YX2H 5JIPA 3HE7A 1EK3A 3P0YL 1RUPH 3F62A 4HZLB 5ACZB 2EZ0C 2CDGA 4ZO7A 2YPVL 4HZLA 4YHLH 2XKUA 1OAZH 5ACZA 1S5IH 2GY7B 1EVUA 3DNKA 5T3ZE 2RHEA 3IDMA 3EYSL 1IZJA 3IJHB 1VGKA 2A9NH 1SYVB 2R1XB 5DUMH 3WIHH 4LIQE 1JF5A 2W9LA 3ZKND 3IJHA 4OGAC 5BRZE 4C56D 3ROOA 2DQDH 3U30B 3LKOB 4KZEH 5MEQB 4XAWH 4U1LA 1HI6A 5D93C 5D72L 4I3SL 4AT6A 5ANME 2VQ1B 4JB9H 1JI1A 1XGUA 3E6HA 4YK4B 4LMQI 3QDAA 1RZ7H 1EFXB 1OTSD 2VQ1A 2X10A 4GMTH 1HSBB 4TSBL 1XCQA 5T1LB 5FHAH 4WJ5B 3GBNH 5DRXB 2Z93B 2R2BB 1OTTD 3LHPH 1F5WA 3LQAC 2C7UA 3MRBB 1H8SA 4KI5C 1NCWL 2JKXA 4Z8FL 5CJOL 1K4DB 3QHZL 3PABB 3E2HB 4KY1H 1FZJB 3P4MB 1QSVA 5CIPA 2ZNXA 3QHFL 1VKXB 1V3MA 3V4UH 1Z9MA 3B9AA 3OKMB 1YEDA 1OAQL 1MHPH 1C7SA 2GTWB 3CH1A 4TVPL 2VZTA 3OKMA 1RUAH 2VLKA 4TUOB 2GTWA 4HH9A 1GGIH 2FEEI 2HJLB 2NY4C 4YEEA 4WHYG 4WW2B 4MLSA 4H5SA 2HJLA 3FQNB 1ZT4A 4TOYL 1AE6H 1T80A 1UJTA 3C8KB 25C8H 2R1WA 3VD7A 1HILA 3C8KA 4FQPA 3KNBB 1C16A 3UO1L 3VWJC 3E0GA 1RZ8A 5KSBE 1V3LA 1OHQA 5F8QC 3FB6A 5GS2H 5KANI 2WWMD 3LEVL 2FGWH 4G8GA 1HXMA 5EUOF 4XPGH 1KCRH 4Z7OF 4BUHA 5EO9B 2N4IA 2IEPA 3S3JA 3IAQA 3QQNA 5GGVL 3K2MC 3LKNA 1NDGA 3KDMA 3PQYB 1TTUA 1T04B 3TF7C 2ZP0T 3BN3B 3QCTH 4BM7A 4R2GD 3PQYA 5FHBH 5I8OL 2KDGA 3FOLA 1EHAA 2PO6C 1CL7L 5H37H 1WQVT 3FRPG 1MAKA 1YQVL 4FFZH 3HE6A 1A3RL 2Z91B 4UIKH 1JRHI 4OB5H 1B2WH 1ZLUK 1RZFL 1N59A 1CLYL 3VCLA 1RMFL 4FQ2H 5EN2A 4YC2B 4P99A 5HDBF 5SWSA 2X09A 1TQCB 3TC9A 3BKCH 3EYQC 1H0DA 4WY7L 1JVKA 2AQ3A 2YMXL 1G7IA 3WKMH 1R3JB 4PLKD 2IQAB 4O5LL 3Q0HA 2Q8BH 4J3OC 4MB4A 3QRGH 2ADIA 1KIPB 3T8XB 1R3JA 3KYOA 1OAKL 1NGQH 4PRAA 3SKMA 1KEGL 3L3OA 3VFOB 5DD3L 3WXWL 3VFNB 3KLAA 3MNWA 5D2LB 5DJCA 3E6FA 3HR6A 1J88A 3O6FA 4HH8A 1A8JH 3MOBH 1RI8A 3RVWC 5ACMA 3QR2A 4GRLC 4LNVA 2X9XA 1JPFA 1U92A 1ZTXH 3NFNB 2FATL 5BZWB 2VLRE 5L0QB 1J1XH 3BP4B 4Y2DB 5K59F 1YEEH 2EYRA 1QSFA 4M4PA 4Y4FB 3SQOH 3ALWA 2PYEE 5EOCJ 5GGRY 5BRZB 2FIRT 2APTA 1KPRB 4Y4FA 3QUXC 4OT1L 4WWID 1BQLH 4ERSL 3SGDI 3T3ME 3T09A 5TF0A 5DS8A 4G9FE 2IAMC 3K4AA 3OKDA 1L7IH 5F93C 5ANMB 4L8BB 1KCVL 4KRPB 2HJFB 1ZT1A 4WFGE 2DQIL 3ZHKA 4OZFH 4LSUH 4GOSA 2HJFA 3QJFB 2Y9RT 1A7NL 4P5TB 4ODHL 4Y1AD 4M48L 1HHIB 1FAIH 3RWCA 2KL6A 2DIBA 4JFZH 1MCQA 1HHIA 3BGAA 4J4PC 3VXSE 2MCPH 3NTCH 5B4MD 3TZVD 4XNYH 1UWEH 1CGSH 1QA9B 4POYA 4P57B 1D5BB 1TNMA 3VXQB 2DQHH 4XPFH 4RA0C 1QA9A 4X80H 3MRJB 1D5BA 1TIUA 1BHGA 3V6BR 4FABL 2AXJA 1RU9L 4GSDH 1YECH 5C1MB 4KUZL 1IGIH 5F7FA 1YPZF 5I8CB 3DUUA 4G3YH 4HX1B 2EC8A 4F15B 4BKLB 1XF5B 1D6VH 5I8CA 4QRRD 3KPPB 1M71B 1U9KA 4HX1A 4V2BA 4UU9B 3KPPA 1M71A 3GNML 1OW0C 1A4JB 4DTGL 4GAJH 1UVQA 2Y5EA 2NXZC 5FXCH 4OLZL 1KIQB 1HNFA 1S7VA 1WBZA 2F8OA 3QAZB 1OTUC 3JV6B 3PHQB 4NQCD 4E5XB 3S36X 43CAB 2MWCA 3LMJH 1P2CB 2CO6B 3PHQA 4E5XA 2XT1B 3LQAL 3SE8H 1RJZA 4X8JB 5KSBB 4TN9A 5F3HB 4MQTB 1A4KB 1BZ9A 2NY5H 4JM4H 4JHWL 4JPWH 4LBEA 2VWEE 5EU6D 2PKDA 3KPOB 1LEGB 2VDQH 5F3HA 1FLRH 1ZAGA 4HIXH 1PDKA 4W81A 1HH6B 2GT9A 5DMGC 3V8CA 1LEGA 5AZ2H 2F74B 1UM6H 5ID1B 2WQ8A 3K3QA 4Z5RB 4I77H 4KHTH 3QWRD 2F74A 5F1OB 3VD3A 4JANB 2WUBH 2ED8A 1LDSA 1A14L 4M7JL 3ZSTA 2DOCA 4HUUB 2FLRT 1QSEE 4KRMB 2B5IB 2OMBA 3FRUB 2H1PL 1I7RB 3WS6C 1DP0A 1HHKB 3FRUA 4NQDA 3TP4A 3VI3E 1MOEA 3VFSB 1CGXA 5D1ZC 1HHKA 1YEKL 4HKBA 1F3RB 3ARZA 1TETL 2MHAB 2NNAB 4BK4A 1BQUA 1KPVA 1N6UA 1TZGH 2ZCLH 3QXWA 3GSNA 4QRPA 4DW2L 4F7CB 1W0VB 3ARED 1A21A 4DK3A 2PXYB 4F7CA 4GS7B 3T65A 1IKFL 1CDJA 4K71B 4QRQB 5JA8B 3IFPB 2W0LA 4FQXD 3FHAA 4QRQA 1Q9LB 2VIRA 4XCCL 2RFXB 1Q9LA 5E9DE 1XF3A 3KPSB 1MRDH 1RIVL 2RFXA 2J8OA 3KPSA 2WMPA 3WUZA 3DSFH 1S9XB 3P3YA 1Y6MR 1IT9H 4X9HA 1UH4A 3HMWL 5IVOA 1S9XA 1NSNH 3JUZA 1T22A 3BW9A 3AY4C 3OPZL 4FS0A 3GSNL 4LU5H 3VRLF 3QISA 5E70A 1LDPL 3LRSB 4M5YH 1SYSA 2AJUL 1F3DJ 3W2DH 5IQ7L 2DLFL 2HVJB 1OB1B 3VGHA 3X3GL 2CO7B 1EHLH 3U4BH 4MNGE 2NLJB 2VLRB 4U0RC 3TWCL 3CVHH 1JZ5A 1HQRB 3OKKA 2XRAL 1T03L 1NLBH 4KZDL 1FSKC 3SOBH 4D0CB 2PYEB 4R3SA 2VDPL 4AEHH 1D3CA 4D0CA 2EC9U 3IXTB 2HFFA 4JFFE 4EOWL 1GCFA 3IXTA 3MJ7B 4G9FB 3TBVA 4F58L 3QUXA 4LP4A 2GUOB 1DR9A 2YRLA 4K94C 1X3DA 4QHNA 5D1QC 3MNVA 2GUOA 5H2BB 2IAMA 1CD0A 1NCBH 4EJ1C 3NZHL 4V1DD 3P4NA 5H2BA 5I2IB 3C60C 3U9PH 1A3LH 1FH5H 3V5HB 3BRDA 3EOTL 5D6CB 3ET9F 3N85L 2GJ6D 3PHSA 3S35X 1U36A 3DYPA 1G7PB 1NCTA 1A22B 5BCAA 3LN9A 4G6FB 4U1NB 1QKZH 3MXVH 4DKFL 2EE9A 2QKIB 4LSDA 4RQQA 5C7XL 4KHXL 1RULH 1FGVL 4PJ9C 2QKIA 3GJFK 1SQ2N 3OR7A 2VAAB 4OF3A 4F9LC 1AHWB 4ELME 4X98B 1EIBA 5T5NF 2J12B 4BSWB 4LSPH 1AHWA 3HLAA 5CUSH 4RGOL 4CRPA 3KPNA 2ZSWB 1WTLA 4NN5B 1NC4D 4L5FH 1JGUL 3UJTL 4IRSD 1OW0A 2ESVE 2CDFB 1E4JA 4XPTH 5CCKH 4M1CD 5AZEL 2P8LB 1KYOJ 4LHUD 6CGTA 2YC1B 1B6DA 2IPUG 2EYTB 3F7VB 2P8LA 1YMHB 5E8DL 2H41A 2BNUB 1MI5D 2EYTA 3CX2A 3F7VA 4CNIB 2IH1A 1YMHA 1KYOK 5ESAB 3WFDL 3DXAA 3MBXL 3JSSA 3O4LB 5T1DL 4PJ8D 5GHWH 5TFSH 4HPOH 1DE4A 3BQUB 3O4LA 1QNZH 1FN4A 2Q3AA 3PDOB 3BT2L 1DL7H 3P11L 3PP4L 4LLVB 4LK4A 2CMRH 1BQHB 1UFUA 2F58H 4XMKL 1CBVL 5JPNA 3U7WL 3HB3C 4LPVA 1HHGA 1G6RB 4TSCH 4MD4B 4FQQA 2DQCL 4MXWL 5F9JB 5E5MB 2AJVH 3GK8H 3DECA 3FQWA 4KKBD 3HCVB 4JKPL 4MD4A 3NAAL 5E5MA 3WS6A 2JJSA 4NFCA 3HCVA 1JZ7A 1LP9A 1SMOA 2BVOA 3P4OA 5HHVL 5D1ZA 4F3FA 1ES0B 5CD5C 1U8MA 4EI6B 4J6RH 1KGCD 4LSSL 4P9HH 4Q74A 1QEWA 1ES0A 1FFRA 1AKJA 5DMKA 1WIPA 4YNYB 5F9DC 2XKSA 1BF8A 1LGVA 3RVXC 3NH7H 2I9LA 4KAQL 1ND0B 4JRYD 3VGDA 4OCSL 1FL5A 3ZYIA 2DWDB 3NPSB 1DBJH 3UTTE 2FR4B 4HMEA 2O93L 4M6NH 5I73C 3ZTJH 1U8NB 1QHPA 5I1CL 5HYJD 4EUPA 1PZ5B 1BZ7A 5C2BL 5GRUH 1T1YA 5HY9B 1MHHA 1AH1A 2XPGA 1YEFL 2OQJB 3V4PL 5HGBB 1N8ZB 5T33H 4K8RD 1AO7D 5HY9A 2A9MH 5DI8B 4Y19D 4OD1H 4PRDB 1N8ZA 5DYOB 3S36H 1LK3H 3MACL 4HC1A 3OB8A 5DI8A 5KBNC 1XFPA 3AY4A 1W2KT 5D1XC 4PRDA 4MNGB 3A6OA 5KSUA 4CVZB 3BP5A 4HK0B 3JV0A 5MP6H 1VESA 1JK8A 3PXHA 5I1IL 4CVZA 4YHYC 2VLMD 2LQRA 3G9VA 2W60B 4GXUM 3NCCB 4JFFB 3MR9B 4J3UA 3ZLQC 5E2VH 3OAYK 5IEKB 1PG7L 3MR9A 2UVEA 3O3BB 2CJUL 4MDIB 4HC1L 3LEXA 5C09A 3OAUH 3RWDB 4AH2B 1MCIA 5TQ0L 5EOQL 5GRXG 4HXAL 1MCOL 1KCSL 4HKXA 3MXWL 4N0UA 1S7SB 5KSBF 1N0LA 4PLNC 4HWBA 4JZNA 3RZCD 3NCYP 3TFKD 1A7QH 3VXRE 4PGEA 3NZ8B 2DYPA 4I9WE 3VG9B 3SDCC 3RWJA 4X4YA 1J0IA 5A2KH 3B2VL 2Q7NA 3CVIH 4C4KT 1UZ8A 4OUUA 4WHYH 3TBSB 5MEND 2F15A 4ELMB 2HFEA 4PY8I 4ZODA 4LRNL 5SWQB 1FNSH 3TBSA 3V2AR 4PJ9A 2V2XA 1OGAE 4K94L 5FYLE 4XI5D 3NA9H 4XPAL 3WEXB 1HZHH 4LCYB 1X6NA 1VFAB 4F9LA 4TSAH 3LKQB 3SKNB 1FO0B 3PIQB 1VFAA 3TJEH 3QIBD 4B5EA 3GUTA 3ORJA 4HWBL 5HJ3B 3DX6A 2YN5A 2DQGH 3PIQA 1JN6B 1Q38A 1MLBB 1DFBL 1HEZB 1NGWA 1CFTA 1UA6L 4G6AD 1CTOA 5E2WH 2APWA 2X1QA 3QZWG 1JN6A 3QI9B 1SJEB 1KF9B 1HEZA 3TN0D 4RGND 4DFHA 3UTQB 9CGTA 3ZO0A 3HRZB 4Q9RH 2LTQB 4R96B 1MJ7H 2DDQH 3RIFF 2LVCA 5EWIH 2XNAB 1ONQB 3HRZA 1UB6B 4R96A 2D31A 2PW1A 5EB9A 4JY5L 3F8UB 2P7TA 3V7AG 1YNLL 2W9DH 1G9MC 4C56E 2CH8A 5ECJE 4QEGA 3I3BA 1NJ9A 3DV4B 5DLMH 4ZQKB 4NNXB 3KYKL 1WBYA 3N50A 5DJYB 4ZQKA 5I8EB 5EZIH 2G2RA 3HUJA 1KJ3H 5E6IB 5I8EA 2YS4A 3QXTA 5GZOD 1EBPA 4LSVH 4R4FL 3S35H 2D03H 3NABH 5I66A 1DN0B 3GMOB 3T0WA 1RZJH 2C4XA 3SGKC 1NGYB 2OYPA 2WWKT 5D7JB 1DN0A 2H32A 3RX8A 5E1AB 1HIML 4UTAL 1NGYA 5D7JA 1A7PH 5E1AA 1MCRA 1HXYB 3IU3A 4LKCB 2Y5TB 1NCAH 5C3TA 1ACZA 3IDYC 4ZAKB 5EZJB 1HXYA 1IEAB 4M6MH 3EHBD 1JZ4A 4ZS7L 2BC4B 3UTTB 4ZAKA 5CGYC 1IEAA 1A6VH 1S8DA 1U3HB 4QHLB 4JPIA 2ZOLA 3VG0H 3ARYA 4F57H 5B38B 5F6IC 3T0BA 4PIRF 1VEPA 4JAMB 3B3IB 5B38A 3RNQB 1MCLA 1RJCA 2K9UA 4U6TA 3VFTA 5FIEA 3GSWA 4JAMA 3B3IA 4G7VH 5CEZH 1BECA 4X0KB 4YFLF 5JO5A 5IM7A 4YHNB 3MOAH 3PL6C 4X0KA 4X9IA 4ONHB 2GEEA 3HMXH 3IFLH 4ONHA 35C8L 4CN6A 1H8OA 5D1XA 5HYFA 4X9BA 2ZG2A 5DRNA 2AXGB 5ESVB 3BFOA 3DX7B 3HNSL 3DHJA 2NW3B 4RAUA 2LU4A 1CFNB 2B2XH 1BGXL 1NFKA 1O7SA 1U93A 3LB6C 4YFDB 1EZVX 4U1SB 4NZRL 5A16A 1CFNA 1B0GA 4BQCA 2Q8AH 2FX8L 2F19H 1A1MA 5EORL 1M7IB 2WBKA 4PGJA 5C9JA 3MFFB 3U79A 2GSIB 3ESUF 15C8L 1HN1A 5FYJD 3T0ED 4MGXA 3RHWF 1NMCC 5T3XL 1S9VA 4LFHD 1I8LC 1OGTB 4YWGH 4PTTB 5ID0B 3U1SH 2VISB 1F00I 1Q9OA 2Z35B 5KS9A 2MFNA 1A6TB 1T3FB 5ID0A 4HCRA 2F53A 3CSPA 4IIQB 2VISA 2Z35A 3RKPA 3VXRB 2WBJC 3QNXA 3WO4C 1A6TA 3C5SB 1PLGH 4M62L 5FKAA 5TDOB 4LPXA 1J10A 1MSPA 2BVTA 4I0PC 3C5SA 1RQ5A 4NUJA 4ZUTB 3MLTA 3TM6A 3H6JA 1WBXA 4UTBH 4PJXE 4Y4HC 2V2TA 3SDCA 1CFSB 1D5XA 5EBMB 4RAVA 4OQ1A 2IALA 3S5LG 1OGAB 3HZVA 5GSVB 3MA7B 5EBMA 1EJ6A 3RGVC 3ES6A 3ZT6A 5GSVA 5HDQH 4LHJB 4YUEH 3LN5B 2JELH 5IBTL 4ETQB 3U82B 2OI9B 5EO1B 3QT2A 4HCRL 5JHLH 5HYSA 4L9LC 2DMKA 5E99L 1W8OA 4JKMA 5FB8B 4ONOA 1OOAA 4P2OD 4YHOL 3C5JB 4TYUA 3CK0H 2B0SL 4JM2D 1A6AB 4F7MB 3OKOA 3C5JA 4FTVD 2J5LB 2V2WB 3RWIB 3O3AA 4F7MA 1AQKL 1VGEH 2EE3A 2RCSL 4WI2A 5CWSB 1MQKL 3HFMH 3QIUD 4KK8C 3ILPA 4L4VD 3VGFA 4LLQB 5CWSA 4HFWB 5T1KA 2CK0H 4YHZL 4C56B 5HHNA 4XWOD 1EHXA 3MRKB 2Q86A 1ETZB 4W6YB 1A5FH 1T1ZB 4CADB 3P9MA 1CU4L 4GRWE 1ETZA 1X4XA 1DVFD 4M9OA 5IEHB 1H3WM 4NQVB 4YDJB 1F11A 3BAEH 1ZHNA 5IEHA 3ARUA 3ARDD 1KTRL 4YPGB 3L3GA 4UDTA 4FXKA 4P5KB 4Y1AE 4XXCC 4XHQA 5L2JB 1OAYL 1MRCH 3DRTB 3M17A 3L5IA 2I9TB 2ICEA 3V79C 3SGKA 3G5YB 3F6LA 1HINL 3IETB 5B3NA 1UM5L 1BBDL 5IROC 1CXKA 2I9TA 3L7FB 2B4CH 3FTGB 4UDUA 5ACLA 3IETA 5KOMC 1MF2L 1WITA 2YUVA 3OG6B 1P7KB 3VGEA 3P9LB 4E0RB 1URLA 3VGAC 1J11A 1MFCH 2C1PA 3D87B 4CL7A 2VERN 1P7KA 3PWNA 3JWNC 3V8OA 5DK2B 5IFAH 4U6XB 3NCBB 4OLWH 5J12C 5DZOA 1B4JH 1B6UA 5C08A 3STBA 2VXSH 4QRRE 5F7DA 5C0DB 5L88H 5TE4L 5E00B 4I0KA 4L3ED 5KN5B 2BFVH 1MY5A 1MCBA 4NZTH 5IGXH 2ADGB 3EYOB 2D7TL 2P47B 1DSFL 4U6VH 3ARTA 3N1GC 3WCYA 3QUMA 3G08B 1YA5A 3OTTA 4Y5YB 4C83B 3EYOA 3M1BB 5BO1L 2W0FA 4NQEE 4JG1H 5DC4B 3MRDB 1U8HB 3EKCA 4Y5YA 4C83A 3C6LD 1KJ2A 3S37H 3KGRA 3MRDA 3PL6A 8CGTA 1SEBB 4R8WH 4NQCE 1IGML 1MFNA 5EU4A 1FVDA 4E42A 3G6JA 1KT2A 1SEBA 4OCWL 4DOHE 4M61B 2DIJA 5DFVD 3D0LB 5HSFA 4DVBA 3UBXI 5EU6E 3FFDB 4M61A 3D0LA 5C92A 5EFIA 2YKLL 4GAGL 3HN3A 4NQXB 3F58H 2BY3A 2G5BB 4TULH 1U91A 2C3WA 4BZ2L 3TV3L 3QUML 4KPHH 1BX2B 2EH8H 4I3RH 3ZMRA 2G75B 2VLJD 3CVHB 4Z18A 1EA9C 1BX2A 4ZFOA 4JFED 2W38A 4R2GB 3QXAB 1KJ2L 2EIDA 3HG1A 3PV7A 4XMPL 3FN0L 4MMZC 1K4CB 5GGUB 2VITB 3ZL4L 2AI0H 2F8XC 1B4RA 2F5BH 4ISVA 2XV6B 4UUJB 2VITA 3OF6D 4HS8H 4OIIH 4UUJA 4LVEA 4H26A 2WBJA 2VXUH 4ORZC 1NANI 5KSAD 3N9GL 4PRPD 4I0PA 1CXHA 1UWXK 2NZ9C 5JQHC 1I3RB 4ZFOL 1I8MA 3L3JA 3EFDL 1D5ZA 3PWPD 3GI9H 3FT4B 2X4NA 3OJDA 5D5ME 1M7DA 3TT1L 2CIIA 3WD5L 4FFYL 4H1LB 4ELKA 3RGVA 4Y88A 2X5PA 2YEZA 5IHZB 3QG6B 2MJWA 4EIGB 4H1LA 2ADJA 1QFUL 1J12A 2CUMA 3QG6A 3QUKB 2NQCA 1T0NB 1FORH 4OCRL 4L9LA 3NCMA 4NC1C 4XP1H 2YWYA 5GRJH 3CPLB 1MEXL 5F1KC 5FUCE 1P7QA 4JJHA 4L1HA 2I5YH 1TDQA 3RPIB 4YBQD 3D9AH 2I24N 4LGSB 5ISZD 2FO4B 3RPIA 2DLHA 4KMLB 2AV7B 3WUWB 2HTKC 1BLNB 4J3TA 3EYVA 2BVPA 4E41A 4HJ0D 2AV7A 4GRWB 1BLNA 4OCLC 1K2DA 1Z5LA 4KRNA 4HIJA 3ZE2E 3NCJL 5JXEC 5I1EL 3VRIA 4OCXH 5JW4R 5F21B 32C2B 5IVXA 3WO3B 5DO2C 4NRXB 4XB8A 2WANA 1BD2A 1LO0H 4HUNB 1U8JA 1KBGH 1A1OB 3ARBD 2CPCA 4Y1AB 4PJFB 4V1DE 4M5ZL 1HKFA 3SDXA 3TJHD 3ARSA 4XRCB 4Y1AA 3TIDA 4PJFA 5EUKB 5FYKH 3T77B 2J2ZA 1TCRB 3PJSA 3TZVB 2XTJD 1KC5H 1EEYB 3UEZA 2GJ6E 2W0KA 1E4KC 5EUKA 3HAEH 5F1SA 4LF3A 3V52L 5KTEL 1R0AH 5JMOC 1MLCA 3T77A 3K8KA 3TZVA 1EEYA 2OZ4A 5JW5A 5D7SH 4C54A 5HVHC 1J0HA 1RFDL 4JVPA 1FV1A 3JWDH 5IROA 1NMAL 3MGOB 4MX7B 1CGVA 4QRRB 4MX7A 5A40E 1OWRM 4NHCH 3VW3L 1H3TA 2EYSA 5HGGS 4RIRA 3KPRD 4PGDB 2HMIC 3QXUA 4LEXL 1M05B 4NKOB 1H5BC 5BOZG 4XXDA 2OZ4L 3KXFD 3Q5OA 4KJWD 5I15L 3ULUD 2HN7A 3T04D 3GI8L 4NQCB 3O6LH 3OHXB 2DBJA 1D9KC 1PEWA 4K9EC 4WUUA 3WLWD 4ODBD 3GFUA 1TZIA 2A74A 5FO7B 4CW1A 5EU6B 3L3DB 3MLSH 2VE6A 4KQ4L 1T5XB 2V17L 5GISL 4AJ0A 4X7SL 3JBG7 3CMOL 3QWOA 2XXMB 2SEBB 4PYHA 1F8TL 3LZFL 4Z77B 3H3BC 1I7UA 4KUCD 1YEJL 4MQ7B 4Z77A 3P73B 2X4SB 4MQ7A 5F6HJ 4HIEB 1VFUA 2BVEA 2Q20A 2YD8A 2AJYH 4KKBC 5H35B 1FZMB 3RDTD 1VA9A 3FONA 2IGFH 5FCUL 2ID5A 1JHLH 2GSGA 2YBRB 3I50H 2AJSH 4AQOA 3GO1H 5EU3A 4MA3A 3F12A 3AREB 1EO8H 3CLFH 4N8VG 1G7HA 3JWOH 1ED3B 1NAKL 4WFHD 4YZFE 4FQXB 4N0YL 1C5DA 4CMMA 3TH3T 5JR1L 4K23L 1KIRB 3PGFL 4GLRH 4JRYE 4I13B 3UJIH 3RWEA 3VXME 1EEZB 3ILQD 1ACYL 4YHPA 4UOJA 5D5MB 1CD1B 5KSVB 2OL3H 3BPOC 1YEHL 5C0CA 5HYJE 2JJTA 5KSVA 4PV8B 4YQXH 4YXHL 2QL1A 2F54E 4N1HB 5I19L 4D3CH 4PV8A 2JTDA 1JPTL 4ZS6C 3U7YL 1AO7E 1TPXC 4L1DA 4Y4KD 1J1PL 5ENWA 2R9HD 2Y23A 3R8QA 1MRFL 3RIFK 1RK1A 5JOFA 2ENSA 3MNZA 1VHPA 1RAMA 4HFUH 1F6AB 5J11B 4RMVA 1AGCA 5CINH 1UXSA 4RWYL 2RQ8A 2GTZB 4Z6AT 3AAZA 1DANU 4LASH 5CILH 1JNNL 4YDLB 1QBBA 3BH8A 2VLME 2FYYA 3C2SA 4BSVA 3ZHLA 3U48A 2A77L 4R7DB 1A0QL 1ZANL 4UOW1 2ERJC 3JTSB 4NN7B 3V5DA 5JXEA 3S34H 1YNKH 2KH2B 3G6JF 1M7XA 4MAYC 3SY0B 4K2UH 3DRQB 4X9FA 4V1DB 1TJIL 4ZSOA 1MHCB 4I4WB 2QV2A 4G43A 3UTOA 3SY0A 4U1GC 4WEBL 1GYAA 5C86A 2GAZB 1KN2L 4I4WA 5CSGA 4G42B 5FUOL 3TNNB 1J86A 2GJ6B 3SCMC 4ENEC 1HYSD 2DICA 3EUUA 4IDJL 1SJHB 1JHKH 2GJ6A 4J7RA 3CFCL 3LD8C 3LPGA 2CLVA 2YSSB 3LKSB 1SJHA 1E4KA 2B8OT 5DEFA 3EDEA 3VI4E 5J0BA 2MKLC 4AEIH 2AEWA 1CICB 2XG4A 5DQDL 2ARJQ 4KVNL 4JQIH 5MENE 4DQOL 3OX8B 3O9WC 4LMQE 3TPUA 5CJQL 5D2NE 3OX8A 1G9NH 1R5WB 4PB0H 1G7QB 3VE0A 4NFBA 1NC4B 4KK5D 1FE8L 4IRSB 1BREA 3RVTD 1CL7I 2O5YH 4XNQA 2W1NA 12E8L 3O11B 2Y6SC 2UWEE 1FVCB 1H5BA 1FNGB 4LHUB 3BIKB 5I1HL 1Q0XH 4N0FA 4RGNE 3TBYB 1P4LB 3VA6A 5IMMB 1MUJA 3IDIB 1T7ZA 3BIKA 4GQPH 4CVXA 2FLBT 1D9KA 3L1OL 2FD6H 1MI5A 4OGYL 3L95B 4PJ8B 3D5OF 3TCXA 4PTUB 4JJ5B 3MRCB 3PWLB 3RHWK 1EXUA 3D25A 3VXUD 3MODL 1D7FA 3MRCA 3MV7D 1OSPH 1DBKL 3OAZK 5AG8A 3X3FL 1ZLUH 2XKNA 4P3DB 3WFHB 1A7OH 2CK2A 4ACPA 1MREH 1N26A 2RJMA 4JO3H 4XP4H 4CGTA 3WFHA 3I75A 5SX4I 3CDCA 5T5FL 5EIIA 2R15A 4KMTL 3MOQA 4DEPC 1RVFL 2F5AL 5F7LB 5EIVA 2HLAA 3B6SB 2WIIA 4QYOA 4AMKH 2NR6C 1KLUA 1HNGA 3HPLB 5IVXF 2GFBB 5IFHH 3TIEA 4JRYB 1JGDB 2GFBA 5JQ6L 3D39A 3STZA 3SDXF 4IJ3C 1NLDL 3CFIC 4PJFF 1LVEA 3ARRA 3BKYL 5I1JL 2P42B 5HYJB 4M8QB 3SEPA 1K8IB 1QHOA 5KVFH 1EERB 5GGRB 2ZPKL 3HS0B 1AIFB 3MC0A 1K8IA 1F02I 4KTEL 4FP8H 3WFBL 4NDMB 4YIQA 4G6JH 4TTDD 1AO7B 3MLYH 3C2AL 4M43L 3HS0A 2HFGH 4Y19B 4WI3A 1RZKL 5HHOD 2VL5A 4XGZA 4Y19A 5CKGA 3BZ4A 3ULVD 4PJHE 3MRMB 3VWKD 4QGTA 1P5UA 4IRJD 1LO3L 5A2LH 3OKYA 2XA8L 4ODUB 2ZCHH 3NGBB 5EOCH 4B53A 2D4DA 1KFAH 3RWFA 4GMSH 4NWTH 2E5EA 1AGBA 3TYGH 1I9EA 2EH7H 5FK9B 1REIA 3B5HA 3M8OH 1EFQA 1QYGH 3QG7L 3BOVA 5CHNB 2JJVA 1NFDE 2EDOA 4GQ9L 4PRNB 1NEZG 4OIAA 1VB9A 2Z92B 3RAJH 5CHNA 1S9YA 1U6AH 5KVMC 3KWWA 3ZTNL 2Z92A 2AK1H 5FYJE 3T0EE 3QFJD 1X5YA 4RWHA 4UV4L 1EJOH 2CGRL 5F96L 1I8IB 4MAYA 4RRPG 4OAWB 2P5EA 4YE4L 4JGJA 4P48A 2XZAL 1I8IA 4WEUD 3OKEA 3RZCB 1XR8B 3AVEA 4CVWA 5BS0D 4XBGB 3T3PE 4XBEL 1BFVH 4FQ1L 3SCMA 4XBGA 3BHBA 3C8DA 3INUH 4HD9A 5F7EL 1Q0YH 3GIZL 3REWA 3DMMC 2DLTA 1QRKA 3I02B 4XVSH 5MENB 4M7ZC 5F7KC 5HI4C 1WFTA 4MD0B 4OFYD 5D2NB 5IVZA 1XT5A 3NIFE 4QXUH 1JFQH 3V6OE 1YDPB 1I4FB 4P3CL 5DHXB 4L3AA 4L8DB 5DFWH 5F72S 2ZG3A 5AD0B 4G8EA 4L8DA 3VRJA 3QIBB 1FNHA 4Z7WE 5KJRH 3FO2A 4MHHI 4N8CH 1OP5H 1R3LB 4D9LL 1LE9B 3LIZH 4WW1B 5IFJA 1ZLSH 4RNRA 1R3LA 2UWEB 4JM2C 3TN0B 2YA2A 4RGNB 3T1WA 1XH3B 3G6DH 3MRLB 4PRID 2ZUUA 3TN0A 1XH3A 2AV1A 4FTVE 5D6DC 1LO2H 2MTPA 4NN6B 3VFPB 3X13B 2VXTL 5D5MF 2Y07L 3W81A 3F7YA 3GGWA 2DM2A 3IDXL 3X13A 3OJVC 1U8QA 4UI2A 4NNPH 5IMOB 5LKNA 3L5XL 3H2WA 4KDTC 4I18B 5E2TH 4PJCA 1UJ3C 5DJ2B 3CFKB 3UAJD 2VZUA 1G1YA 4IMLA 5CEZD 5TGBA 2BRRH 4N0CC 4H8WL 3QFDB 1IBGH 2EECA 4XVJL 5CP3A 4DGYH 5EZOH 5GZND 5DVLA 3QUYC 3IAPA 5HGHB 5GGTA 5EOTA 3VD9A 3WFZA 4KJQD 5KVGH 5HPOA 3GSOA 4I48A 4S2SB 4ODTL 3QWQB 5GGVY 5HGHA 2PF6A 2HH0L 2XA3A 3MBED 4W70A 4Z95H 5GS0H 2CXKA 4HBCL 3ZE2F 2HKHH 3K8LA 3OBAA 2QJDA 4UQ3B 5AWNL 3WIFA 5J57B 4JRXE 4UT7L 4UQ3A 1DQQA 4QTHA 5I8KL 2YD6A 3PF2A 4PJAE 2FEEL 4N8PA 1Z9SA 4DK6A 4YBLC 3ESVF 1IC7L 1JIBA 3CDGA 4CDHA 3CIQA 3DGCR 4QHKJ 2X4PB 1BMGA 5GGTL 2EC9T 4I5BB 1FYTD 4R4BA 4X7FC 4ZTPL 4LLWA 3W11D 4I5BA 3H42L 2I60H 2VLLB 4HJGB 3LAFA 4PJHB 3GKWL 4HJGA 4UQ2B 1EGJH 1JTTA 2O5XH 1L7TH 1FBIH 1QLRB 2E27H 4FQLL 2ZCKH 1KTLA 2FEDC 1IQWL 4GW5B 1YQ2A 1IQDA 1FYHB 1WZMA 4UB0L 1J5OH 2VTFA 4GW1B 3QJHB 3W0WA 3LSOB 3V7AE 2IBZX 4GXVL 3R1GH 4OJFL 4YO0A 1NFDB 5C8JA 4GG6E 4GW1A 5TDNB 3QJHA 5DGRA 2BOCA 5C0RH 1MWAH 1UCBL 1JRHL 2PYFB 4WDIB 4NKDA 1S7WB 5JUEL 4X6CE 3T0EB 1HOCB 5A2IH 3A6BH 5LGHL 5D70H 3O45A 3DGGA 5FV2A 1TJGH 5IB4A 3I2CH 3UDWC 3H9SE 3T2OA 4XBPB 2YPLD 3WHE1 2Y7QB 4OD3H 2BNRA 3GJFH 3MLVH 3MUJA 1J1OL 1JYNA 2Y7QA 2NY3C 2AJXH 3BD3A 1OD9A 3RX5A 1AQDB 1YYLH 2FX9L 4RFNC 3ZKSD 5CSZA 3X14B 4PRPE 2FX7L 3H3PL 2N7BA 4M93C 1NC2D 5C0AA 1AQDA 2FWOB 3WLBB 1GHFH 4YFEA 5FECB 2XIDA 5LCVH 3DMMA 5T5NG 4YX2L 2HTLC 1IKNC 5FECA 2BVQA 3PWPE 3EJYC 1RUPL 5IW1B 2AJZB 3OGCA 5MEOB 4Z7WB 1PQZB 3BPLC 5DF0A 3RUGA 1OAZL 2AJZA 4DGVH 1DBAH 3ARGC 5MEOA 1S5IL 5C0JB 5LWYH 2R0ZL 2OX5A 3NA4A 3GRWH 5DJZB 1JNLH 4P2OB 4YZFF 4PJGA 3VGBA 2A9NL 3V0VA 5DUML 3WIHL 4FTVB 3IVKB 5L8JB 1S3KH 4JM2A 2QQLL 4YBQC 4KGLA 4NQSA 3T2QA 4BA8A 3MMEB 3MYZA 3QIUB 4I1NB 4L4VB 3GSQB 4KZEL 4XAWL 5ISZE 3CJJA 4MNQA 5IW6A 3MMEA 1XF2A 3C08H 5D6DA 3QIUA 4L4VA 3GSQA 4NO3B 4N5UA 2FB4L 4JB9L 4XNXH 3SGEI 2R4RL 7FABL 2DMBA 3RWGA 1KLGB 1F97A 4HHAB 4NT6B 5K9QI 1DVFB 3IB4A 3K4ZA 3WHE0 3QUZD 2C3XA 1UJ3A 1CG9B 1SBBA 5FHAL 5TF1H 5HHPA 3ARDB 3GBNL 4JFOB 4QT5B 1R5IB 1CG9A 4X6FB 1J8HA 1ZOXA 4ZYKA 4R6UA 1F90H 4QT5A 1TENA 3LHPL 4UZGA 1CE6B 5I6XC 5GGSA 3LRGA 3PV6B 4LQFH 3VXNB 3QUYA 2NY5C 3O4OC 4JFXB 5JZ7C 2XTJE 5C0IB 3RVVC 3AROA 3EO0B 4JFXA 4WTZG 2BCKA 3ZDYE 4Y16D 2ICWA 4L9DA 3V4UL 4Z7NE 2QHRH 1QFWH 2ICCA 2DLIA 4Q97A 4CJ1A 5CBAA 5B3JE 3IU4H 2VZ3A 1RUAL 3G04A 1GSMA 4OZGA 5EU7C 1DUYA 2VJXA 4MA1C 4IOSD 4JO1H 1ADQH 1UXWB 3EJZC 4L3EB 3V5KA 3KPRE 1TITA 1AE6L 4L3EA 25C8L 1NAMB 2ATPB 5J6HB 3KJ6H 5C07A 5LAXB 2XTLA 2XY2A 2Z8RA 4KJWC 4TNVF 1NAMA 4YXLH 4N5ED 4OKVA 2IPTH 2VDOH 3ULUE 3KXFE 3C6LB 5LAXA 3SO3C 2GK0B 3GSUB 1JMZA 1GGBH 1NDMB 1L0YA 3FZUD 1MFEL 3C6LA 2LAGB 5I9QB 3GSUA 1H15B 4X5LA 1NDMA 1MCWM 3OAYH 1KCRL 2X1PA 3L9RB 4EN3D 5DRZA 2IH3A 1CE1H 1GGYA 2HJKB 1T4KA 3IJSA 4MJ6B 3L9RA 5GRZA 1TXKA 3RKDC 1X4ZA 4QHUA 3H9HB 3DX9B 3QCTL 2BJMH 4LVNB 4MS8D 4DN4H 2OR9H 4Q6IB 3BESR 3H9YA 3DX9A 4M1GH 1QP1A 5SWZA 2UWEF 1QBLH 4FFZL 1NAML 2VLJB 5I16A 2HLFD 4PV9A 2E6QA 2AEIT 4JFEB 3WNOA 2VABB 5LBSL 2DWEA 4UIKL 4F37F 1IEBA 4OB5L 1B2WL 2VLJA 3TNMB 4FQ2L 4JFEA 1F3JA 3B9KC 1CGTA 5BMFH 1T0MB 3CMGA 5E08H 3TNMA 4M03A 3HC3H 4DUWA 2VOTA 3I6KA 4AIOA 3BKCL 2YUZA 3MRQB 4ORGB 4N9GA 3WKML 3HZKA 5HD8C 3UDWA 3MRQA 2GY5A 2BY2A 2Q8BL 3QRGL 3SBWC 5TH2B 1J05B 1NGQL 4P5MA 5KSAB 2AABL 4CDGC 4PRPB 4WFHE 5TH2A 1BVZA 4D0DB 5KSAA 1KSRA 3V4VH 4R0LC 3PWPB 3RNKB 3MOBL 4TVPD 1Z6JT 1WEJH 2FJGB 3CDYA 3KHOA 5CAYB 5J4MA 3GDBA 1FFOB 4MWFB 1PYWA 3T4YB 5IV2B 1ZTXL 4F33B 2FH6A 5K9KA 2NY7H 2R2EB 3T4YA 5FYKD 3MCKB 2AXHA 1IFHH 3BIAX 1GRWA 3TBTA 1J1XL 1YEEL 3MCKA 3LQZA 2EIZA 2N7AA 1SEQH 3SQOL 1ZA6B 5IIEA 4J23A 1JGEB 4J8RA 3K1KC 1BQLL 4P2RD 2XQBL 3LQMA 3RTQC 5ISZB 1INEH 3DLQR 5BV7H 3QDJA 1L7IL 1XR9B 4BZ1H 5D71H 2NY1C 2VLKD 1RJLB 1XR9A 4LSUL 2X9WA 1RJLA 3JXAA 3K0WA 2NTFA 2EDFA 1AGDB 3BWAB 4ZPTA 1FAIL 2OM5A 3NIGE 4Z78A 1UB5B 4JFZL 4YPJA 2X4RA 1AGDA 4FMFA 3BWAA 4WHDA 4NJAH 2MCG1 3NTCL 1EEUA 3ARBB 2MCPL 1UB5A 3DIFB 3L5WB 5I18H 4XNYL 1UWEL 1CGSL 3U2SB 1Q8MA 4P4KB 4M6OL 3MLRL 1I1AC 5J06A 1TZHB 2DQHL 4XPFL 4JN2A 3MRHA 5EA0H 4FXLA 4G8GD 5D96B 2XTJB 2R29H 1KUMA 4ZFGL 5JXAL 2DJ4A 4GSDL 4H0HB 1YECL 1IGIL 3OG4B 2DTMH 4EQ3A 1NFDF 4JFDE 5TDPB 3QPQC 2CKNA 1RK0A 3O2DH 3FO1A 1QFWI 3G9AB 3QXDA 3S5LB 3HE6D 1LNUA 1JGVH 1R3KB 5DHYA 1R3KA 3VDCA 3NIDE 3KPRB 4G8FB 3UZVB 4NC2B 3T3PF 4MXVE 1S7QA 5A2FA 2DF3A 4G8FA 3MYJA 1G9EA 4K3DL 2P24A 3LMJL 1UEMA 3BE1H 3SE8L 1A47A 3KXFB 2X40A 2IMNA 4JPWL 2NY5L 4JM4L 4P9HC 1KXTB 1RPQA 1FLRL 2HVKA 4HIXL 2H26B 1AXTL 5F9OL 5AZ2L 3K2UL 3QO0B 3TLRA 2H26A 4OZHE 4I77L 3WMSA 5C6TH 4KHTL 1K85A 5FUZH 2K7QA 3QO0A 1KTKE 4PJ7E 1MCSA 3PWUB 4IS6B 3O6FD 4XP6H 4YLQT 5F70A 3RUGF 3ZDXF 4Z7WF 4IM8A 5HVGB 1I8KA 1FFNB 4HIHA 3Q6FB 2FBOJ 4PJGF 5C0BE 2VZ1A 3VXUE 1EAPB 1R3IH 3GM0A 2V5YA 2EZ0D 4HBQA 4JM2F 1IAKB 1YZZA 2P8PA 3RDTB 2ENYA 4XCFL 1QSFD 3KYAA 1R24B 5IQ9B 3BPCB 2D0FA 1WFNA 1A6WH 2P46B 3BUYA 3ZKXB 3CSYA 4WFFD 3BPCA 1GZQB 4BUGA 3BZFB 3SKUD 1MCKA 3P0YH 1CXEA 4OGAD 3QDHA 5DJXB 2H9GB 2IQ9H 1MRDL 4O51B 3MRGA 3UC0H 4LCUB 2H9GA 2A38A 3QPXH 4NGHH 5CMAA 4X6EA 4F7EA 3DSFL 4UINH 3SBWA 1FC1A 2MPAH 1ZGLB 5F97E 4RGMC 1IT9L 1WISA 5JLZA 1N4XH 1NSNL 4PB9H 1SY6H 1T83C 4LU5L 3NFPB 4R0LA 4LPUA 1PBYA 4M5YL 5DQ9A 3W2DL 6FABL 4XTRC 3OR6A 3RA7H 1UACH 3WL9B 3U4BL 2JB5L 4Y4KB 5F1IB 1I7ZA 4KROC 3WL9A 1ITCA 4BQ9A 1NLBL 3U4AA 3SOBL 2OTWB 3O3EA 5F1IA 1BFOB 4KI5D 3ULVE 4AEHL 3GM8A 4HWZA 5DMJB 4OZGF 3JV4B 2VKWA 4EUPG 1T2XA 3H3KA 2VDLH 3I3EA 3QO1B 1LILA 2WINB 2M1KA 1BVKA 5DA0B 2CXGA 3E1F1 3RTQA 3MO1B 4LSQH 1NCNA 3BMWA 4MJIA 2H8PA 1NCBL 4CKVX 1CFQB 1QLFA 1NBYB 1NBVH 5HGDA 1UYWH 3RIAF 4P23B 3WBDA 4HQQH 4JZOB 3FMGH 1NBYA 2NY4D 1EEQA 4YDVA 1QFHA 4HLJA 1ZLVK 3QFJE 5EBWB 5C0EB 4QRUA 3KJ4B 3RRQA 1AY1H 1OAQH 3VWJD 5EBWA 5C0EA 5I0ZA 1IL1A 3MXVL 1I1AA 1MJJB 1RULL 4G80B 4POUB 5E7BA 4XZUB 4B50A 4S1DC 4N9OB 4F2MA 5HI3C 2AEQH 4P59H 2VUOA 4LSPL 5TQ2H 5SV3A 3WJLC 3RVUC 4L3CB 5CUSL 1ZT7B 1I3GL 1RHHA 4XB7A 4NQDD 5F7HA 1W8NA 5KOVC 1HH9A 3MJ8A 4APQC 4L5FL 3QIWC 3FT3B 5KVDH 3U6RB 2PO6D 5DEGB 3L5JA 3FT3A 2BXZA 4QRPD 4H88H 4XPTL 1C08B 5CCKL 5E8OB 3GSVA 1F4YH 4JDTH 1RZJC 5F7WC 1MIEH 3QEHB 1C08A 5DZNA 4OFKA 5E8OA 3C6SB 4WVRA 2EDDA 3QEQD 1FNEB 3BP7B 2CR6A 2IANE 2P5WA 3MGAA 3SPVB 3EYQD 4OI7A 2LE9A 1RJYA 4XC3H 2ZUQB 4QCIB 3SPVA 4PJEE 4PRIE 5GHWL 4OZHB 5TFSL 1DQJA 4K7PX 4QCIA 3P77A 1QNZL 1A3RH 1DL7L 4OZHA 4ODWB 2CMRL 5DGQA 1CLYH 5HGAB 3V6ZB 4RAHA 4HF5H 2F58L 4ODWA 3MGTB 4TSCL 3VXUB 4ZNCD 2PTVA 3RVWD 2AJVL 3MV7B 3MGTA 4I2XE 5JW3H 2EDQA 4GRLD 2XICA 2NY0C 3MV7A 3X11A 1U8OB 4WNQB 1P53A 5FCSH 5F88A 1EV2E 3L3HB 4HKJB 5EO0A 1KEGH 5DD6B 4WNQA 4J6RL 4P9HL 4JZJB 5DD6A 1LD9B 3NH7L 3B2UD 1A9BB 3S4SA 3QUXD 1DBJL 2QR0A 4QRTA 4M6NL 5ESQB 2DL2A 1ZWIB 2IAMD 5IT2H 2PTTA 1FIGH 4L4JA 2FATH 2WLYA 1T1WB 4LLYA 5IMLB 4NRYB 2HG5A 3A6CL 4UAOB 1T1WA 5T33L 5IMLA 2A9ML 4NRYA 4OZIA 4F9PC 3ALXA 4OD1L 3S36L 2OBGA 4AIZA 1LK3L 2YD7A 2DKMA 1S7UA 4J4PD 5IB1B 1UGNA 1T83A 3EYFA 4XWGH 1FYTE 4PJIE 2ZJSH 5IB1A 5MP6L 5HHOB 5BW7A 2EDNA 5I17B 4Z7NF 2D0HA 2Q7YB 3VWKB 5HHOA 2P44B 5E8EA 3VH8B 1ITBB 4IRJB 5B3JF 5GS3A 2Q7YA 1G7MB 2XN9E 3VH8A 5E2VL 2B1HL 5B38G 3IFOA 1R3HA 4OF5A 4TNWF 1OL0A 5GSRB 3H7LA 4XCYB 4EVNB 4LIQH 3MUGA 3OAUL 4HS3A 4ZPVA 5EUOE 4Z7OE 1NBZB 2E7BA 4FXGB 4EVNA 2NXZD 4AM0A 1NBZA 4JKKA 3ULUF 5TJWK 1CZ8L 1N0XL 1IGTA 4KU1A 3MSPA 3QFJB 4ZOAA 1A7QL 1CXIA 2FJFA 2UYLA 5C0GB 3MJ6A 5IK3A 4OV5B 3DXAD 1DDHA 4HWUA 1JPGA 3GNMH 1FG2A 4Y5XC 1XGYH 1A7RH 5BS0B 5EBGA 2YPLE 3ABZA 1GJIA 3CVIL 3WDIA 1JYXA 2J1KA 5DMGD 2VXVH 3MROB 5BS0A 4N8VB 5HDBE 4XX1G 3J7HA 1WGOA 4WHTB 3U0PB 2QSCL 4KUCF 3UYPA 3MV8A 4JO2H 3WYRA 3NA9L 2EXYC 3OKNB 4WHTA 3U0PA 1QVOB 4TSAL 3RGHA 4MB3A 3LQAH 1KTDA 2X4OB 3TJEL 1JWUB 5DK0B 4JHWH 3THMH 4RISL 2FJHA 2DQGL 2X4OA 4OFYA 2VO5A 1JWUA 5E8NB 4TNVK 4APQA 4PJ5A 5D1ZD 3QIWA 5DD0H 5E2WL 4JFQA 5E8NA 1M6OB 4WI5A 5DJAB 2PR4H 1AKJD 4LKXB 1A9EA 1T2JA 4NRZB 2E3VA 1A14H 1MJ7L 2DDQL 3MLZH 2J3SA 1J8KA 5EWIL 4Z0XB 3EOBA 2B39A 4NRZA 5J1TC 2H1PH 3GBMH 4PJEB 2B4CC 1A1NB 4PRIB 4Z0XA 3PGCB 3SDDC 4J2XA 2W9DL 4PJEA 4QRSB 4A6YA 3PGCA 5K59E 5DLML 5IB5B 2V7HA 1QR1A 2BDNH 3UTSE 1NGXB 1FJ1B 4U1JB 5IMKA 5IB5A 2NY2C 5EZIL 1QLEL 2R1YB 2CLRA 3O81A 1KJ3L 1UG9A 3WFCL 3MA9L 1Y6KR 4LSVL 5AG9A 3DTXA 2AAVA 3S35L 4FQCH 2D03L 5HBBA 3LPWA 2AQ1A 1MCFA 3LV3A 1RZJL 4F7TA 2XZZA 4QXGH 2E7CA 2Q6WA 4RMTA 4PGCB 1U2CA 5I71C 1P5VA 3BDBA 1A7PL 1FC2D 3GB7B 1NCAL 3HMXA 2VZVA 4A6YL 3UBXB 1W72B 5ETUB 4M6ML 4QOKE 3GB7A 3MBEB 3MRNB 3OPZH 2AGJH 5ETUA 3KPQB 1A6VL 4LLMB 3MBEA 1LDPH 4F57L 1FL6B 4XH2B 5FF6A 3T4AB 3NFSH 3NIGF 4GO6B 5C09D 2IADB 2J7LA 1FL6A 3L6FB 4XH2A 3ARFC 5D1QD 1YNTA 4XHJC 1U8LB 2IADA 3VXPB 5HXMA 2NTSP 3U4EA 1AD0B 4G7VL 4KZDH 3OB0H 5CEZL 3F5WB 1U8LA 1DANT 2C26A 3C60D 5ALCH 5CBEB 3F5WA 2O61B 1WCQA 3VXOB 1KENH 3BSZH 4EOWH 1P6FA 3RY6C 3HMXL 3VXOA 3IFLL 4F9PA 1FYTB 1OF2B 4PJIB 2DQTH 2DYPD 3VFGH 1U3ZA 2C3VB 1UH3A 1OF2A 3KHQA 1JWMA 5FO8A 1HDMB 3FQXB 5ELIA 3SDAC 4ZUUA 2DQJH 1WWAX 3FZUC 3QEUB 4LLUB 3BKJH 3EIFA 5DQJB 4K7PH 3NZHH 2X4QB 3GSXB 5ITBH 1VPOL 4PJ9D 4XAKE 3UZEA 2ITCA 2Q8AL 2F19L 4GG8A 4LEOA 1GOGA 2IFFH 4R90H 2VSCA 1XIWC 1U95B 4M7LH 5FFLA 3BMVA 4MDJA 5EUOB 4MXVF 1XAUA 1U95A 4PY7A 3ROLB 4JY4B 5IHUL 2WUCH 5GJSL 4KXZH 3RY5A 2YR3A 1JNHB 5JHDD 4YWGL 3U1SL 2HLFC 4ODSL 3UCRA 4S1SH 5IB2A 1DUZA 5CKAA 5FOJA 3FOMB 1PLGL 2EEBA 4OZHF 4RGOH 1YJDL 3PWJB 4LLDA 4LSRH 1VSCA 3HI1B 1RUKH 2YPLB 2EKJA 5DDHA 4UTBL 2PN5A 1JGUH 2DI8A 4HUMB 3HI1A 1T21B 4BH7A 3TCLA 2H2SC 2BHYA 5I30L 5DC0A 1KEMH 2CQVA 4CAGA 5HDQL 1TCMA 4YUEL 1J0ZA 1NC2B 1PKQB 1ZHBB 2JELL 5F9WB 3HB3D 2LABA 4LDEB 4EI5C 1E4XI 1PKQA 5JHLL 3DETC 3ZT5A 1G7LA 4TVPE 2DQEH 3RL2B 3G5XA 3TA3C 3TPKA 1YMMA 4ZOEA 1DQDL 1JV5B 4Y5VB 2X70A 3RL2A 1N2RB 4EDXA 3CK0L 4GUPA 1S78D 3FCTB 1PJ9A 4FFVC 3V6OC 3C09B 1Q1JH 1GC1H 5CD5D 2FBJL 1A6UH 2QTEA 3VFUB 1YY9C 3VRLE 1UQSB 3HFML 4NCC2 4DN3L 4HG4J 4NYLB 1KNOA 2DLGA 1S9WA 2CK0L 4NWUH 4FZ8H 4NYLA 4EQ2A 4HS6A 4N1EA 3JWDC 3NAAH 4LDOB 1A5FL 4HG4K 1MQ8A 3SDDA 4DGIL 5HPMA 4OF0A 3OAZH 4H1LG 2VLKE 1WCBA 2BY0A 4MAUH 3QQ3A 4S1RH 2ATKA 1NEZB 3BPNB 3QUZB 5T3XD 2A6KB 4OCSH 1N5AA 3ULVF 5JIKA 1CF8H 5D1XD 1Y0LB 1G7JB 1MRCL 4PG2C 4OD2B 5KVEH 1Y0LA 3EO1B 1G7JA 1G6RH 3IYLW 5C2BH 3EO1A 2B4CL 4G8GE 2FNBA 1Y18A 1I9RH 3C87A 3OSKA 5CEXB 5GS1A 3B9EA 2I25N 3LH2H 3FO9B 4Y16B 4OLWL 5D7LA 4QNPF 5CEXA 3DO7B 4NJ9H 2VXSL 1BJMA 5L88L 3PQYE 2BFVL 4NZTL 5IGXL 1YN6B 5L2KA 1E28B 5ICXA 3ARFA 2DQUL 4GH7B 3LS4H 4JG1L 2HKFH 1SM3H 3PP3K 4HGWB 4NUGL 1JWSA 5K9OA 3BZEA 5ICZA 4Q58C 5DMYA 5SWSE 3BD4A 5SX5K 2QLVB 2FL5B 3RY6A 1INDH 5I1DA 1NCCH 3ISWA 3F7RA 3SDCD 1KIUA 3QNYA 3UPAA 1S7XA 3G5VB 4R97B 3JWOC 5TQ0H 2A73B 5EOQH 4L8CB 4HXAH 3F58L 3WSQH 2R23B 2BMKA 3DURA 4L8CA 3BP6B 1T5WA 4TULL 4EN3B 1TQBC 3T1FB 5DSCB 2R23A 3BP6A 4KPHL 2CLZB 2EH8L 4I3RL 2QSTA 4NOFA 1PX3A 3T1FA 2OK0H 3U36A 1F4WL 4HGKC 1XIWA 1NMBH 1QQDA 2CDGB 3B2VH 4KV5E 5BZDA 4LVHB 3WN5B 1FGNH 3IFNH 2AI0L 5MI0C 2Z0BA 4TVSa 3WN5A 4PJEF 1QBMH 2R0LL 2BZDA 3IDMB 4HS8L 1QSFE 1PD6A 1VGKB 4OIIL 5T1KD 1MCPH 2VXUL 3PDDA 3ROOB 4WFFE 1W0WA 2D0GA 4J12A 3CU1A 4K7FA 4JDZA 4U1LB 1H9VA 1HI6B 1DLFH 1V8HA 1V05A 4MNHB 3DX8A 5CZVH 2A2QT 4AT6B 4D9RE 1XGUB 3E6HB 1YUHA 4MNHA 3GI9L 3UPCA 1QZ1A 2NMSA 5ITFB 1F6FB 4KKLC 2X4TA 3AS0A 4MCZA 5ITFA 1XCQB 1KCKA 3S3PA 1RHFA 2W91A 2HT2C 3PE9A 2EIBA 4XNZB 1FORL 4U4BA 3F7PC 1BJ1H 4PYGA 4XP1L 4ZFZA 4JREB 3TA3A 5GRJL 3VFVA 5J13C 2VDNL 2C7UB 4UBDC 1JUFA 4QLRA 4V2CB 3SN6N 1N7MH 1FO0H 2I5YL 2QQKH 4FZEH 3DROA 4PJBB 1ZLWK 3DO3A 5CIPB 1U8KB 3HAEA 4PJBA 3EDDA 1PX4A 4OTXL 2A83B 1U8KA 2FHFA 4P2RB 5C08D 3DPBA 5CGYD 1ODAA 2A6IA 1J0KA 1YEDB 2A83A 3AS3A 4P2RA 5I74B 3CH1B 4OCXL 3QDMD 2VLKB 4HH9B 4OBSA 1E6JL 4WWKC 1G9NC 1UENA 1U3YA 1LO0L 4PJIF 4BH8B 1KBGL 2D7PA 4H5SB 1H3PH 2OTPA 1ZT4B 4BH8A 4LVOC 4AL8L 3PL6D 1J9CT 5LXGH 3DVIA 2R1WB 4NPYB 5FYKL 4C59B 5IKCB 1HILB 4AEEA 1F42A 1C16B 1GAFH 1KC5L 3CXDH 4Z7UB 3AM8C 1R0AL 1CR9H 5EC2A 4NPYA 5IKCA 1RZ8B 3SDYH 5ALBL 3FB6B 3P0GB 4Z7UA 5I75B 2G9HA 4ZD3H 3ZT7A 4HW6A 3TGXA 4G8GB 1HXMB 5TE7H 3ZHDA 4CN1A 4U1IA 5GJTH 1F4AA 1VFMA 4NO5A 1MCJA 4KK6C 3JWDL 3LB6D 4KGJA 7CGTA 5EU5B 4Y0GA 3LKNB 1NDGB 3KDMB 4X99A 3V0WH 5EU5A 3IS0X 5BQ7A 4IOIB 3BXNB 4FQHA 1J7VR 4NHCL 3EYUH 35C8H 3HG1D 3FOLB 2KQMA 1TVHA 3BXNA 4IOIA 5HYQA 1U58B 3JTTB 2DM4A 4NQDE 1CT8B 1QO3A 3HE6B 2QADC 3HNSH 1E4WH 1U58A 3JTTA 4OQTA 1MJUH 3T08A 1CT8A 1N59B 3VCLB 5EN2B 3OWEA 1X5XA 4NZUH 4QRPE 2FX8H 5SWSB 2OMNA 3O6LL 5J9PA 5FYKU 2WBJD 2OSLA 4OCYH 1H0DB 1P4IH 3RP1A 3NVQA 1UWGH 4BQ6A 1G7IB 4I0PD 4ZNEE 4TNWK 2ADIB 2EDYA 4Y4HD 3KYOB 2VDKH 3FHQA 3T0EA 1QFPA 4PRAB 3SKMB 3L3OB 1MCHA 3KPSE 4EDWL 1JPSH 1FG9C 1CGUA 5CEYB 3RGVD 3KLAB 3MNWB 5DJCB 3E6FB 4OQTL 3O6FB 43C9A 1RURH 3OXSB 1GGCH 1QFWM 3BD5A 5CEYA 3OXSA 1ZHLA 4DCQA 3TT3H 2F9BT 4U7MA 2OL3A 2LFGA 3QHTC 1JPFB 1C1EH 1U92B 2IGFL 3UTZA 4JR9H 1JHLL 1INQA 1P7QD 2DJUA 2Y36H 3I50L 4LHUG 2DQFA 5HI5C 3MLUL 4YHMH 3GO1L 3GMQA 2EYRB 1QSFB 1AP2B 1IC4H 3AXLA 1OCWH 1EO8L 4HPYH 4JGMA 3CLFL 4M1DH 5K9JH 5IBTH 1N64L 1AP2A 4KK8D 4E41D 3B2UC 2C5DC 1VFBB 5DS8B 1OP9A 1X5ZA 1AXIB 3I85A 4U05A 3OXRA 3OKDB 3UJIL 1VFBA 4GKNA 4D2NA 3R8BB 5D93B 1ZT1B 2P1YA 2OL3L 3C5ZC 1BD2D 1C5BH 1J87A 2B1AH 4Q0XH 4U2ZA 1FZKA 4X4MA 1NH6A 5A3IC 4YQXL 2XY1A 3ZZ1A 2RCSH 3RWCB 3AMLA 4D3CL 2WSKA 4P2QD 4Y8AA 4YHZH 5FYLH 4WV1C 2X2YA 1CU4H 4HUWA 4HFUL 4U6YA 4RMUA 1DEEB 1OY3B 5CINL 2VMFA 4LASL 4N68A 1DEEA 5CILL 3DUUB 1ZS8B 5JW4N 4PBXA 1DJSA 1P1ZA 1IGFL 1ZS8A 2P8MB 4JFHD 3GMNA 5I1LB 2VH5H 3VFMB 1HHJA 1GPOH 2P8MA 5I1LA 3VFMA 2EKSB 1UVQB 2Y25A 1B88A 2X89A 3T2NH 4PY8J 2EKSA 3S34L 1S7VB 1WBZB 1YNKL 3PXJA 4K2UL 1MF2H 4LP5A 2A1WH 4WWKA 2QEJA 3DYMA 1QRND 2NY4B 4S1QH 4WUUD 2XXCB 1U8IB 3N1PC 1RJZB 3ME0A 1BZ9B 5B39B 1U8IA 4LBEB 2IF7A 3VWJB 5B39A 1T1XA 3AM8A 1BFTA 2GT9B 3DXAE 3W9EB 3VWJA 1PY9A 1B0RB 2ICWI 3W9EA 3O4LE 1NQBA 1B0RA 4JQIL 3EZJB 5IP4A 1G9NL 1HSAA 2ZUWA 5DJ8A 4NQDB 4PB0L 5FA3A 3A67L 3MJ9H 4ZXBC 5IUSA 3BI9X 4HKBB 2XWJA 3R0MA 4PP2A 2PO6B 1KPVB 3N1MC 3BYTA 1LP9E 2VB5A 4CMHC 3GSNB 4QRPB 4QHKI 1P4BH 2PO6A 3MCLH 4BK5A 1QACA 1WAAA 2Z8VC 4X6DA 5F3BA 1MPAH 1F4HA 3T65B 4HWEH 1Q0XL 3QCUL 1BZQK 3TV3H 1Z3GH 2VIRB 5GS0C 1LEIA 1IARB 1XF3B 3QEQA 2EXWC 4NKIH 4XMPH 4ZNEA 2NZ9D 2E6PA 1KN4H 3MRIA 1J18A 3O2VH 4Y8DC 5C0CD 3ZL4H 3AUVA 5JORA 1FFPB 1FAKT 4J1UA 1XGQB 5DJ6B 4G7YL 4J3SA 1GGUA 1OSPL 1FFPA 4KTDL 1T22B 3BW9B 1XGQA 5DJ6A 5GIRB 2HFTA 3G6AA 4HKZA 4Q9BA 3BDYH 1SYSB 1YYMH 1RUQH 3N9GH 5GIRA 3N06B 1L0XA 3T0AA 5A1AA 5I1GH 3W39A 5L9DH 4PJBF 4GRLB 1AXSA 2X1XR 4LAQH 5LGJA 3EGSA 3OKKB 4GRLA 2X6MA 1DQMH 4RCAA 4R3SB 1KJVA 1I9JH 2E8YA 4AMKL 1X7QB 1TFHA 4FFYH 4M3JA 2AXFB 4R7NB 2HFFB 5IFHL 1X7QA 2HTKD 3TBVB 2AXFA 5IHLB 4R7NA 3QUXB 4UIMA 3O41A 4ZOBA 5B22A 5T3ZD 4OCRH 3TO2A 4QHNB 3MNVB 2BY1A 4GKOA 2ADFL 4B0MM 1DTUA 1P9MC 2IAMB 5JXED 1BPVA 5C09E 5C2UB 1QSZA 5KVFL 3REVA 3P4NB 4JFPB 5DO2D 4Q2ZB 4QF1B 3C5ZA 4Z7UF 4JFPA 4G6JL 4N0UE 4Q2ZA 3MLYL 4QF1A 2HT3D 3PWVA 3GMRB 1V7ML 2HFGL 2GCYA 2DRUA 3QEGL 3QNZA 3S96B 1NFIB 5J89A 1VACA 3GMRA 2M8XA 3IDJB 3S96A 1NFIA 3RI5F 5KANG 1AI1L 3NCJH 4HZAA 1MFDH 4D0BA 4H1LH 4J4PA 4RQQB 3IDJA 5CP7B 1WZ1H 4WV1A 4ONFH 3U46A 2ZCHL 4KQ3H 2OR7A 4YEFA 3MV9A 5CP7A 5EOCL 2CDEA 3OR7B 4G5ZH 1KFAL 4GMSL 4NWTL 3S98A 3TYGL 3E8UH 4M5ZH 2EH7L 1H8NA 2BHUA 4RMWA 3M8OL 3SE3C 3HLAB 4NHUA 3BN9C 4JFYB 3KPNB 1WC7A 1VENA 5FOBB 3WIIH 2G5RA 3RAJL 2JB6A 4JFYA 4U1HB 1L4IA 5FOBA 5D4QA 3IGAB 2AK1L 4MLIA 4M7KH 4U1HA 5FM5O 2HMID 1ZXQA 1PSKH 2NXZB 3IGAA 4GRWH 1EJOL 5JHDE 3LY6A 1A2YA 3DI2B 3VJ6A 4DAGL 3BIBX 3MRFA 4L8SC 5LVEA 1CLZH 4AEFA 4FFWC 3SKJH 2VQTA 1D9KD 3AB0C 2IH1B 4O2EA 1BM3H 3DBXB 3V6FB 4B7IA 1BFVL 4L29A 2OTUA 3DXAB 3INUL 3DBXA 3V6FA 4AYFA 1Q0YL 2NY6C 1DE4B 1FN4B 5MEPA 4NP4L 4TPRH 5GRWA 1AJ7H 2ZWLT 1N6VA 1EHNA 1WSST 5I15H 5JPNB 4KV5F 2VDMH 3LS5H 2JK5B 4PLJC 4QXUL 4DKDC 1XGTA 1JFQL 1HHGB 4PRHA 4FQQB 3HUJE 2JK5A 2VR9A 3FQWB 4LFHG 5KJRL 4EZMA 1CFBA 1FIEA 4N8CL 4M02A 1FPTH 1LP9B 3LIZL 4KQ4H 2BVOB 2V17H 3P4OB 3RFZC 4X7SH 3GJEA 1YEIH 4R26L 1KB5A 5D1ZB 1LEKA 1I1CA 4F3FB 3BDXA 4WO4C 4ZDHA 1AR1C 1S78C 3STLA 3LZFH 1U8MB 1VADA 1QEWB 3FQUA 1AKJB 3G6DL 5DMKB 2Z31C 5ERWA 3VMNA 2BERA 4JN1H 2I9LB 1K5NB 3SE9H 1LO2L 2EEAA 3N1QC 1UM4H 1FL5B 3D39D 1K5NA 1EX0A 1CD9B 4YGVA 3O8XC 3GMMB 4U7SA 4JVUA 4NNPL 4EUPB 5GGSY 1BZ7B 3GMMA 1T1YB 5E2TL 1MHHB 2XPGB 5B8CC 4BYHA 3W5NA 3QQ9C 3O0RH 2WM0A 2BRRL 1KB5L 1Q9KA 5I76A 3KS0J 1IBGL 2BOBB 1F2XK 1VDGA 3HNVL 2W0PA 4IMKC 4ZS6D 3D18A 4DGYL 5EZOL 2BOBA 5KSUB 5T3XE 3BP5B 3CFJA 4K23H 1IAIH 3FFCA 3PGFH 4IOFC 4OGZA 5KVGL 3FB7A 4HWNA 4KI5F 1JK8B 2DN7A 1JJUA 2DD8H 3IDNB 1FCCA 5CLTA 4U0RB 4Z95L 5GS0L 3IDNA 1FSKB 1EGJA 1MIMH 1JPTH 1CLCA 1ZA3A 2WP3T 3CXHJ 2W9EL 4XX1E 3RBSA 3LEXB 2IWGA 5C09B 5AAMA 5TPWL 2VN4A 4XP9H 5D1QB 5L7XL 2JLLA 4HKXB 3CXHK 4N0UB 5D1QA 4MAYD 2P5ED 5DA4A 2DAVA 5KS9E 2X42A 3U0TB 4NFDA 3C60B 1MWAA 4RMRA 4JZNB 2F53E 2I60L 3LVEA 4WFGD 2EDLA 1BBJA 3U0TA 4I0CC 4GRMA 3C60A 4PGEB 5IR1A 2A77H 3SCMD 2DYPB 1II4E 4ENED 3OJ2C 1EGJL 1OAUH 2O5XL 3RWJB 4X4YB 1L7TL 2KKQA 1MELA 3U9UA 2VDRH 2NZIA 4ZFFA 1UZ8B 1RIUL 2E27L 4OUUB 2OLDA 3VXSD 2ZCKL 5FA4A 2HFEB 4PJ9B 2V2XB 5E5UB 2ILLA 4PFEA 1KN2H 5L8LB 3O9WD 3BRGC 1BOGA 2N1KA 2YRZA 4ODXB 2AK4A 1WAAF 5F89A 3SE3A 4J3VA 3GUTB 4X6DF 1MWAL 5DRWA 5E2JA 3DX6B 2UZIL 4ODXA 5CLWA 3F6IA 3CC5A 1Z2KA 2Y06H 4GBXC 1NGWB 1CFTB 1ZLVH 4MQXC 3PGDB 5JHDB 2DBLL 3WNKA 1JYVA 1TJGL 3PGDA 5JHDA 4KVNH 3I2CL 2Y6SD 4DQOH 2AJ3A 2ZNWA 4OD3L 3S37X 4XNMA 4CVUA 3MLVL 3QDGA 2D31B 3GRWA 2PW1B 2P7TB 2IMMA 4WIQA 2AJXL 1YYLL 1MY7A 1GIGH 1CFVH 3S6CA 3O6KL 1NJ9B 2LVEA 5EBLA 5BV7C 4NO0A 1GHFL 4WI6A 3VDAA 1WBYB 2NXYC 2XOTA 4LGPB 2I26N 2G2RB 1X44A 1WIOA 1YEGL 3HUJB 3W9DA 4PBVC 1DZBA 1SVZA 3C8HA 2AEPH 2CRYA 4OZ4A 5I66B 4DGVL 4Z7QE 1DBAL 1BVLA 1MFAH 5LWYL 2H32B 3GRWL 1QSED 5IBUB 1JNLL 4PS4H 5JDSA 4NZDA 5BVJA 1OWWA 3GIVB 3IU3B 3MODH 4WO4A 4H20H 1S3KL 3GIVA 3JZ7A 2NR6D 3EDFA 1DBKH 4O00A 1S8DB 3D0VA 3C08L 4JPIB 2ZOLB 4PJDB 3SKOA 5IJVA 4UNVA 2NPLX 1OM3H 4X4XB 4XNXL 4PJDA 2EDHA 5C08E 5LG1A 5MHSD 4PGBA 3K80A 5I73B 1D6EA 4X4XA 4N90D 5AUMA 3VFTB 5I1KH 4YHIA 5J3HC 1FL3B 3GSWB 4H25A 5I1AA 5KG9B 2BVYA 3RQ3A 5E4EC 5JO5B 5IM7B 1FL3A 5E9DD 5B8CA 3I6LD 5KG9A 5TF1L 3JVGC 4KKNA 1JTOA 1XF4B 4W6WB 3CUPA 5F1NA 1C12B 5CFHA 3KYMA 1XF4A 4IMKA 1YY8A 5D1XB 1C12A 3MJGX 1HE7A 4LQFL 5DRNB 1XGRA 3G6JE 3BO8B 1NLDH 3WXVH 4U31A 4JQXC 4U6HA 3V7MA 4RAUB 3BO8A 1U93B 1OP3K 4RFEA 2Q76B 4YHYB 5A16B 1IGCH 1B0GB 3TO4C 1AFVH 3W0WD 2QHRL 1A1MB 1QFWL 4OI9A 3LDBC 2VXQH 2Q76A 5C9JB 1RZKH 3IU4L 5INDB 2VC2L 4BQBA 3HR5A 5E2UH 4K3EH 1CVSC 2EIEA 5INDA 2Z8WC 1FRGH 1S9VB 4JO1L 4QGYA 4JFFD 2XA8H 5TE6L 3HG1E 1KACB 1WFOA 1Q9OB 3IKKA 1ZVYA 5KS9B 3SGJC 1WTGT 3FQTA 2F53B 3KJ6L 4PRBA 4YXLL 3QNXB 4LCCC 3CFDA 1I3VA 2BNRD 5ADPL 2IPTL 2VDOL 5FKAB 3UX9B 1GGBL 1MNUL 4ALAH 1NKRA 2C9AA 4NUJB 4GQ9H 3MLTB 1LO4H 3MUY1 4QHMA 5D7IB 2BSSA 1WBXB 3EOYG 2V2TB 4K8RH 5D7IA 3SDCB 1DQLL 3ZTNH 1D5XB 5C0AD 4GKZA 1S7TB 2PCPA 4RAVB 2IALB 1ROWA 2DMCA 5LGKA 5E94A 3HZVB 2ITDA 3BKML 4UV4H 3DMMD 4JVWA 1S7TA 5E6ZA 3ES6B 5HI4D 1HQ4A 2BJML 4DN4L 3OGOE 2OR9L 3TVMC 5J1AB 1LP9F 5HYSB 4M1GL 5J1AA 1A6ZA 4DVRH 4FQ1H 4P46C 3ZYOA 4S0TD 5F7EH 1NCUA 1BOYA 2V6HA 4PG9B 4WTWA 4KMQA 5BMFL 3SJVA 2UVFA 5E08L 3OKOB 3Q5YA 4PG9A 3HE7C 3HC3L 1X6LA 1OLZA 3BGFC 1NPUA 4NC0B 2H3NA 1UC6A 3L3IA 3O3AB 1MCWW 3ILPB 5GGQH 5T1MA 1OT2A 2ESVD 4MNQD 5DFTA 5T1KB 2VSDA 2A6JA 5HHNB 5AYQA 2Q86B 3KLDA 3U7AA 3EO9H 4E41E 4HXBH 1I7TA 3P9MB 4YHKL 1H3UA 1FVEA 2ARWA 3CFBA 2EDEA 3V4VL 3HPJA 2IJ0C 3KR3H 3VFWA 2PW2A 1F11B 5IVXE 1ZHNB 1WEJL 1KPUB 4M00A 1BD2E 2BX5A 3HHRB 3L3GB 4N0CD 4FXKB 3MCG1 4UDTB 1KPUA 3NPZB 3U30C 1J8HD 3SDXE 2NY7L 4PJFE 2QSQA 3IDXH 3QUYD 1IFHL 3M17B 3RPKA 3H9ZA 3P30H 4YK4C 3LKPA 2ICEB 2QQQA 5CZXD 1SEQL 2YK1H 3HC0B 4UDUB 3CSBA 3HC4H 3IDUA 5GS2D 5D8JH 4NCC1 3HC0A 4OV6F 4XPBL 4H8WH 4Z76A 2C1PB 1INEL 1NKOA 3IDYB 2CRZA 3PWNB 1G9ML 5BV7L 1EVTC 5FKPA 1CDUA 4BZ1L 5D71L 5C08B 4S11A 3QULB 4XVUC 5F7DB 4JFHE 1YC8A 1LE5A 2YD4A 3D69A 3QULA 5F6IB 4ODTH 3GMLA 3O2DA 3QDMB 5DXWA 4I3GA 3E2HC 4MSWA 2HH0H 3QUMB 1V7NH 2NX5A 4HBCH 2X1OA 5C07D 3QDMA 4DZ8B 4NJAL 2W0FB 3D3VA 3D48R 4KDVA 5I18L 4LPTA 3P40A 4WU5B 4BFGA 1NCDH 4DZ8A 1KJ2B 1WWCA 2J8UA 3PL6B 3JVGA 4FG6C 4WU5A 2JCCB 1LMKA 5EU4B 1FVDB 4WUUE 4E42B 5EA0L 3G6JB 1KT2B 1F58H 2JCCA 5CJ8A 1N5YH 3RU8H 4DVBB 4X6BA 2BSRA 2CIKA 2DTML 1OT1A 3HI5H 4WW2C 5EFIB 3F7QA 4PP1C 2FEDD 4JQXA 5BVPH 3ARWA 3QSKB 4MVBC 3O2DL 3UZQA 1U91B 3E3QC 3TO4A 5SWZD 5CSBA 1U42A 4LNRA 4OLVH 4HIIA 4ZFOB 5M7QA 2GK2A 4F80A 4RRPA 3HG1B 2ZOKA 3I3DA 3CGTA 5JTWA 1NMCB 1GVIA 3MUHL 4OGXH 5FGCB 1IQWH 3RI5K 2ZKHL 1K8DA 1MH5A 3N1FC 4LCWA 3BE1L 1C5CH 4ISVB 1I8LA 1CQYA 3SGJA 4F8QA 1UKSA 4H26B 2WBJB 4LCCA 3DV6B 4HT1H 3WO4B 1YPZA 4JPVH 4WCYH 1TVDA 4DUVA 4CU7A 1OARH 2ORBH 1I9IH 3DV6A 2AS5M 2NY3D 4I0PB 1DEDA 5IG7A 1O5DT 5C6TL 3HUJF 5FUZL 2XZCH 2OP4L 4Y4HB 1I8MB 4YC2C 3L3JB 4UILL 4XP6L 1D5ZB 2X4NB 1KELH 3OJDB 4Y4HA 4I9WD 1TQCC 1M7DB 4YDIL 2CIIB 5C0CE 2HTLD 4ELKB 1A3QA 3RGVB 2YEZB 3EJYD 5HHQB 4LARH 1R3IL 3VXTB 2ADJB 1WWBX 4J3WA 5HHQA 4KH2A 2LU7A 4WI4A 3VXTA 4L9LB 1SY6A 3ARGD 1Y6NR 4P46A 2FX7H 1A6WL 4U3CA 1P7QB 3L7EA 4FQIH 4PJDF 4Z7VA 4NC1E 3S3SA 1CK0L 5FYJH 2X44D 5E95B 1BIHA 3QDJD 2IQ9L 3FL7A 4P49A 3EYVB 5ADOH 2BVPB 4E41B 3UC0L 4X7TB 3QPXL 4NGHL 1K2DB 1Z5LB 4KVCL 3ZTJG 4HIJB 4UINL 4X7TA 1JP5A 2MPAL 3VRIB 5L0QC 2R0ZH 3QQ4B 3OZ9H 4LOUC 4Y2DC 3ZYZA 3OL2A 5IVXB 1N4XL 4QTIL 4Y4FC 3QQ4A 4PB9L 1SY6L 1BD2B 2KPNA 5FAAA 1U8JB 3SGDH 4U0QB 4FQJL 4ZSOE 2QQLH 1SYVA 2R1XA 5DD1H 2BXYA 3SDXB 5FGBC 3HA0A 2C4FU 1F6LL 2HT3C 3RA7L 3TIDB 4EBQL 1UACL 5GPRA 5E5RB 4P2QB 4KRPC 3PJSB 3LKOA 5MEQA 1A6PA 4R4NC 2FB4H 2FSEB 4LF3B 3S4SG 1MLCB 5L6YH 2R4RH 4P2QA 4WENB 7FABH 1VEMA 4XXCA 1EBAA 5JW5B 4P5TC 2FSEA 5JZ7D 4NZJA 1RZGB 3RVVD 1EFXA 4OKDA 1V3JA 1CGWA 1FV1B 2IFGA 1RZGA 2VDLL 1HCVA 2XWTB 1HSBA 3O3DB 3B9DA 5C9KA 3NACH 5T1LA 3VGAB 2XWTA 4WJ5A 4LSQL 5DRXA 3O3DA 4OLXH 1NGPH 2F8VA 2Z93A 2R2BA 5KS9F 1MCDA 2YD1A 3ARVA 5J12B 2CUHA 2EYSB 1NBVL 4RIRB 1UYWL 2HRPH 4HQQL 3FMGL 3MRBA 4LPCA 3EJZD 4MMXC 4Q9CA 2NYYC 4LCIL 2YD3A 1K4DA 4F15C 3PABA 4XXDB 1FZJA 3P4MA 5EPMB 5EC1B 5D7IF 2HN7B 4NM8L 1DN2A 1ZVSB 5EPMA 1QRNB 1AY1L 5EC1A 4AG4H 1VKXA 2GKIA 4WUUB 1ZVSA 3NOIA 5DWUH 1QRNA 3VH8G 1TZIB 2A74B 4CW1B 3DJ9A 2VE6B 4TUOA 3QAZC 1MI5E 2AEQL 3QWOB 1IILE 4OLUH 4P59L 3H8NA 5TQ2L 1G84A 4WW2A 1I7UB 3FQNA 3HI6H 2AERT 2EO1A 3RKDD 4A2MA 3UYOD 3EDKA 4G6MH 4KKAC 5KVDL 2VQUA 3KNBA 3KLHC 1U0QA 1Q72H 1TVBB 1MFEH 3FONB 4L4TD 3PP3H 5DMIH 4H88L 4JO4H 1TVBA 5C6WH 1F4YL 1KCLA 3MLXH 4JDTL 5SX5H 2GSGB 1MIEL 3B9KD 5EO9A 5EU3B 4MA3B 3F12B 2B5IC 1X5LA 4XC3L 2LU3A 3X12B 1G7HB 1T04A 5HD8D 1Q94B 5ABDE 1C5DB 1KGCE 3X12A 4CMMB 4AZ8A 2L7UA 1NAMH 1Q94A 5LBSH 3RWEB 3D39E 1PGRB 3EDJA 3AC0A 2Z91A 4YHPB 5K33A 4HF5L 2PXYC 4U1KB 4RBPK 4GS7C 4Z7QF 4K71C 5C0CB 1CDGA 4U1KA 2YD2A 4M9PA 1T6WA 1NEUA 5JW3L 2YN3A 4QKXB 5ENWB 5DR5L 4XNUH 1GGTA 1CDIA 1F4XH 1RK1B 2IQAA 5JOFB 2AABH 5FM5M 3MNZB 4Y19E 5DUPH 1KIPA 3T8XA 3MZTA 1AGCB 5CJ5A 1UXSB 2BVUA 2OXHA 3AAZB 3VFOA 5SV4A 2UZXB 3VFNA 1SMAA 5D2LA 3BH8B 4O9HH 2FYYB 3RTQD 5KW9L 4ODVH 4BSVB 4KJYB 1MAMH 1T7WA 5IT2L 4MJID 1FIGL 4XMLH 2NY1D 4KJYA 2BP3A 4LAJH 2J8UF 3NFNA 2IG2H 3V5DB 5BZWA 2J6EH 2K7PA 2KZ1B 1NL0H<