4L4VE

Structure of human mait tcr in complex with human mr1-rl-6-me-7-oh
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
b'AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Recognition of vitamin B metabolites by mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 65
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vE02
4UUJA 5EBWA 4MNHB 2Q8AH 3GMPB 3OKLA 4ZFFB 1F90H 4GW1B 5EU3B 1RK0B 3T2NL 5EC1B 3LN9A 3VD4A 5JR1L 4IHOB 3PGDA 2E7MA 1G7MA 4Z0XA 5A1AA 1NAML 1R24B 4U7SA 5T5FH 1RIUL 4NO0B 4NO2A 3V7MA 4X5XA 3F12A 3SDYL 5IBTH 4MMXC 4PJDA 1N8ZA 1NGXA 1VADA 4Z7UF 1VENA 1Q1JH 4JPKL 3RZCB 1OLLA 1TPXC 3E6FB 4GS7C 4WY7L 5DJDB 1RZ7H 4TVPE 2D7TH 3LMJH 5ID0B 5GRYA 4JJHA 1AQDB 3ARBC 4U6XA 5BV7B 1K6QH 3HC0B 5DC0A 1JTPA 4O9HL 1IC7L 1BVLB 1QEWA 1DBBH 4Y5XC 3BO8B 5JDJA 1QQDA 1MWAL 1F13A 3MRMB 4L3CB 3QDGB 1T04A 4RA0C 3ROOB 4PJ9B 1YEDA 1NL0H 4I77L 1MJ8H 1BBDH 3RGVD 1JRHI 1T83C 4V2BA 2XWBB 2I9TB 1UFUA 2C3GA 2MQ0A 4G8IA 3FQRA 1IZJA 3VFGL 2J8UF 1CG9B 2DI7A 4LCYA 5C6TL 2V2TB 1JGEA 2F58H 2MKWA 2ORBL 3PIQB 5C07B 4NQXB 2WM0A 5DT1H 1RJLA 2UYLA 3ARYA 4HJGB 4LQ1A 4JN2B 1TVHA 4GG6A 5FYJD 4HWZB 1QYGH 2ZWLT 3PWVB 1T1YB 2ERJB 5DURD 4M6MH 4NO3B 2LQRA 1MCDA 1DUZB 2PW1A 4KV5F 4ZAKA 1QA9A 1JHTB 1D5XA 4O5LL 2I24N 3OKYA 4XPAH 3L5XH 1ZLUH 3QUZA 3MJ7A 1PKQB 4X98B 2XZCH 1FNGA 2ESVA 4Y1AA 4XBEL 1ETZB 3QJFA 4R96B 1FQ9C 4FQ1H 5BV7H 4LLYB 2QR0A 3UTSD 1DQDL 3DNKA 3WN5A 4YHKH 3SCMB 1JJUA 4TRPH 4PUBH 4XNZB 4EQ3A 5IHUL 1FNSL 4QHMB 4J8RA 3C60B 1KC5L 2ZNXA 2XKUA 1N5YH 1UXWA 4X99A 1UXSB 1NMBH 3BP7A 3VXMB 4QXTB 1Z5LA 5C0BB 3CUPA 4L4TE 5I73C 2MPAL 1MY7A 1RZKC 3RTQA 4U6YB 2AEQH 4KGLA 3DRQA 4TULH 5FUZH 3Q48A 2EYTB 1H0DB 5H2BA 5BS0D 2E3VA 3ARPA 1LK2A 1C12A 1NC2A 4I0PB 1F4WL 3DHMA 1CD8A 2VERN 3B3IB 4JN1H 4GQPH 1QSFB 4I18B 4LPVA 1T1ZB 1BQHB 3D3VA 4XX1G 5MI0C 4P5TC 1NSNL 1ED3A 5JLZB 4N0UB 4WW2B 1U8OA 5C0DA 4M43H 2OZ4A 3UZEA 3CDCA 3NCFB 2R1WB 4P59L 1M71A 4ZXBC 4PRDA 5JW4N 2O5YL 4FRWA 4YHNA 5IMMA 1WZ1L 2VMFA 4QRPD 2CR6A 4ELKA 3MRRB 2G2RA 3CFDB 35C8L 1BWWA 3BWAB 3IKKA 3ZKQD 2ADGA 1CL7I 5B22A 2B4CL 1NFIB 2DWEB 1L9NA 1PG7H 1TITA 3D3VD 3RDTA 3LKQB 4M1CC 2OXGA 5GJSH 1WC7A 2I07B 2JJWA 3PWJA 4JHZA 4CNIA 1WTGT 4NKOB 5I75C 4M5YH 2V5YA 1R3HB 3C6LA 2VKWA 1A7OH 1VGKB 4KQ4H 4KI1A 1V7NH 4KAQL 4XMPL 3ZTJH 2W9EL 3UJTL 3B83A 2XY1A 4MQXC 5AG9A 1QLFB 2DIAA 5D72L 1YMME 3SKNA 4KRPD 1GHFH 3STLA 3TFKD 1ULVA 1MVUB 1H5BA 5EO0B 7FABL 1BEYL 1FL5A 4JZOA 4JRXD 4P3WA 4ODVL 1AIFA 5DJAA 1IE5A 3BKML 4QTHA 5EZJA 5DEGA 3UBXG 5MENB 4JFDE 3GMLA 3RDTD 3QEHA 5KSUA 3SE8H 5I19H 1DANT 4RGNC 2P7TB 3CX5K 4DOHB 4KU1A 1MSPA 3EOTH 4ETQB 3VA6A 5HHMD 3MV8A 1ZA3B 3FTGA 4FQCL 1FN4A 1I7UB 1RIHL 1WITA 2EDQA 4K7PX 4N1EA 4U6TA 3SJVA 1ODAA 4NKIL 4Y16C 2Q76A 3LH2L 3CGTA 1HKLL 4NKMA 1U8MA 3BRDA 1J05A 2IPTH 2PYEA 3VFRB 3BQUD 1J11A 2VZOA 4X4ME 3TGXA 2AJZB 3RUGF 5HVFB 5JOFB 4D3CL 3QNYB 1BMGA 5IVZB 5GZND 4DEPC 1A6UL 5J8OA 4I2XA 1KCVL 2LVCA 3KYNA 1A02N 5GHWL 1SM3L 5CJXC 2ITDA 1MRCL 4XNQB 4OLYL 4DGYH 3MV8D 1KN2H 3HRZA 5HSFA 1T20A 3IFPA 3O3UN 3OXRA 1PZUB 1MCWM 3BGFC 4KK8C 4NM8L 5IBLD 1KJMB 2CK0L 4MVBC 1C08B 1J5OH 3N1GC 2VDOL 2NY7L 3QXAA 1NFDF 3VFUA 4K3GA 3G6JB 5ESAB 3ZKMC 3H2WA 1OSPH 1D5IH 1WZKA 2A9MH 3V52H 2N7AA 2PYED 1OAXH 3F5WB 3MO1A 4JR9L 4HIJB 1OM3L 4XT1C 2AW2A 3QO0B 5FYJE 1KIPB 1DLFH 5FECA 2Y7QA 4PRBA 5EUOA 4ZUSA 4UOW1 3HZYB 3O2DH 4LSVL 4XRCA 4OZHF 5EOCL 5GGSB 5I1LA 4FHBD 1MCOH 4TTDD 3WL9B 3DMMA 1F2XK 1XH3A 2FLBT 3RZCC 3NCMA 1NAKL 4KMTL 1PFCA 5IFHL 5J12B 5BV7C 3B9EA 1U93A 3UTSE 2XWJA 2FATH 3BEVB 5DXWA 4PGCA 1AGBA 4OGXH 5EA0L 2D7PA 1MFDL 5I18H 1RK1A 4EDXA 4K7PY 3OR6B 3D2UA 1P4IH 3BPCB 2VDRL 5I1GL 1AGFB 4IDJH 1Q9KA 4PJ9C 3VGEA 1UH4A 5DJ8A 5F9WC 3FN9A 1KJ2B 2IALA 2DKMA 1ACZA 1PX4A 1F8TL 4DKFL 1BLNA 5GGRY 3O11A 4A6YL 3IDUA 4P3DB 5F7YC 4XPHH 3U7WH 5BS0E 4AEEA 3QULA 2BVOA 1CLOH 1OPGL 4F7CB 1TJHH 3A67L 4JCMA 1KCLA 3VRLF 4X9HA 2FD6L 5KVGL 2JB5H 2CO6B 2H26A 4K8RC 1OP5H 3SDCD 2FGZA 2BMKA 5F96H 4NN6C 3RX5A 3BP6A 4LRIC 1RHFA 2ZG2A 2IMNA 1H8SA 4QRPE 5E9DB 4QTIL 2JCCA 3MLWH 3GSQA 1FL6B 2H2PC 4MJID 3IU3B 5IFJA 4ZFZB 3LEXB 5E94B 2BVYA 4HKXB 3DETC 3OAZH 4U1KB 3CSGA 4XNZC 3S34H 2OP4H 2BVEA 3GMQA 3D3VE 3C60C 5C9JA 3BUYB 2PF6A 4PJ7B 1SEQH 3STBA 1Z9LA 1S9KC 4BK4A 4HKBB 3C8HA 3GIVB 1KJ2H 3NACH 4NPYB 5DMIH 2DDQL 2KKQA 4NC2B 4LLWA 4Q0XL 1RUKH 2FSEA 1YPZA 4ESKA 4LHUB 4WJ5A 4HGMA 3V0WH 3UCRA 3KWWB 4OLXH 5I6XC 3S3SA 4I18C 3H9SD 5J06A 5KZCD 4PP1C 1KB9J 1FORL 4JRXE 4WW2C 3MGTB 5K9OB 4OD1L 1QFWH 1RZKL 5DF0A 3WEXA 4PJGB 4YDVA 4XXDA 5LCVH 2A77H 3SGEI 2EDYA 3HUJB 3EJYD 1TJGL 4BFIB 5CSBA 5HHME 4PB9H 4BZ1L 1IQWH 2OR7A 1A9EB 3JWDH 2NY2B 4JY4A 1H15A 5IEHA 5F1NB 5I1KH 2YKLH 1AGEB 3GJEB 2BSTB 5DK0A 1H3PL 4M1DL 3QUXD 4JKLA 4HQQL 2W60B 5F3BB 2QSCH 1IILE 1RI8A 4WU7A 4YHIB 4GAFB 3LPGA 3NZ8B 4GRMB 3B8SA 1NBYA 3MV9B 2L7JA 1X5KA 2J12B 3TT3H 1T03H 2XKSA 4PYHA 1YEFH 4F80A 5L2KA 1T1XB 1RZGB 2WBWB 2JJTA 4R8WH 4GLRH 5IESH 5FYLD 3I6KA 4HGWA 5EFIA 2V5RA 1JWSB 4N5ED 4PGDB 1JV5A 3X11B 1UYWL 15C8H 1MCKA 1RPQA 5ALCH 1DQQB 4AM0A 5BJTB 4CAGA 4MCZA 4S0SD 2VXVL 4ZTPH 4DQOL 2DQFA 4IMKA 4XWOD 3W9DB 3MUGA 3LIZL 1A21A 1DEEA 1GOHA 4BH8B 3AM8C 5I76B 1C5CH 4NC0B 1NC4B 2PYEE 3EYVA 4F9PC 3U6RB 3JV4B 3WSQH 1HXMB 3DYOA 1MQ8A 3ZLQC 2FDBP 3OKMA 3HKFA 3IJYA 4X6CA 5EU7E 5CZVH 3C2AL 5ICXA 1CT8A 1SYSB 5GSRB 1SBSL 4XPTL 3FN0L 3PP3K 3VXNA 3KYOA 4EUPB 2AERT 4RFNB 3OJMB 5HHNA 2FECL 5CKAA 4PJIF 2FL5A 5CP3H 1F90L 3GO1L 1YQ2A 4TUJA 4KTEL 4X8XA 1Y0LB 5F7NC 3P4OB 3VI3F 1P6AB 1CDYA 2A83B 2AXFB 3EGSA 3FKUS 1BGXH 3L6FB 1VCAA 5DSCA 5HDLA 5D1QB 4JREB 5T5FL 4NNXA 5IBTL 2ZOKB 1BD2A 2D2OA 3P77B 1Q1JL 4XP9L 4J23A 3AREA 3MRNB 1RZ7L 3B5HA 3LMJL 1CF8H 5SX5H 4C56B 2FEEI 4GAYB 5KSVA 1K6QL 2PTVA 2HN7B 2YUZA 4HD9A 4PJ5B 3SPVB 3S97C 1DQJB 1B4JH 1C7TA 1DL7L 3VXRA 3WIIH 1SJEB 5DO2C 1NL0L 1MJ8L 2X4SB 1ZAGA 1BBDL 2P5WD 2X40A 1VKXA 3V6ZA 4OCMC 4O2EA 2CDGA 3HUJF 4OUOA 2ZUTA 4YFEA 1ZT7A 3TA3C 5TE7H 4EUPH 4HSQA 1BD2D 3INUH 2HLFD 4Z0BL 1INQA 2LTQC 3AAZB 3OGCB 1A4KB 3LRSB 4MJIE 5DT1L 3DURA 3QXTA 3P73A 3RKDC 1LE9A 5TDPB 1QYGL 5HHOA 4Y5YA 1JF5A 1I9RL 3BIKA 2CGRL 1BECA 3IXAA 4M6ML 1QRNA 3PDDA 1S9WA 1WISA 1EAPA 2GT9A 5IB5B 2DLEA 1VSCA 4CMHC 4WTXA 2V2XA 3LKPB 4H5SB 4XPAL 3L5XL 3FHQA 3PQYD 5ADPH 5A16A 1FO0A 2XZCL 4HWBH 3HN3A 4RAUA 1P2CA 1IEBA 4M6NL 1JZ4A 3MLRH 5BV7L 4YHYC 3GJFH 4OCWL 4PJAA 4R4ND 2MTPA 4YHKL 4OZGE 3C9NB 1MCHA 4GKSB 4TRPL 4PUBL 4L8CA 2E27H 3R06B 4HCRA 3ZSTA 2X4NA 3EDFA 3CU7A 1YNKH 1HHKB 3DUUB 2OI9C 2QQNH 3RVWC 5IROA 5MEPB 3H9SE 1CU4H 4XCNA 5HHOD 4XNYH 1YQVH 2UWEF 2YA0A 4TULL 2XG4A 4IRJB 4OI8A 5AAMA 5FUZL 4WEMB 4KRMB 4WNQA 1S9XA 3BH9B 1XCQA 1BF2A 4TSBL 3UDWC 3MLUL 5C0EB 4JN1L 2W92A 1FYTB 5FV2A 1V7ML 3CZFB 4F9LC 4FA8A 3HZMB 2ENSA 1UB5B 4M43L 3G9AB 4K8RL 4U6HB 1ORQA 4HAFA 5DEFA 2EXYC 1AKJB 2A2QT 3HZVB 1RURL 3S9DB 3O9WD 4M48H 2NZ9C 3QNXA 3T0BA 5EIIB 4M61B 4OM1H 3B9KB 1OP9A 1CZ8L 3C5ZB 5F6HJ 2HT4C 2Z35B 5FGCB 4XZUB 4QRQA 3A6BL 2DM2A 3EYQD 5FYLE 1FNEA 4FXLA 1PG7L 5E2UH 5TQ0H 3VG9B 1FNLA 2AK4A 3KPSA 3P0YH 3LKSA 3FO9B 3AXLB 4RCAA 4NRXA 1P7QB 4JY6A 1BFTA 1YY9D 5E2VH 3SBWA 2DTSA 1A7OL 2VDMH 4KQ4L 3L3IB 4DGVH 3B43A 1V7NL 4PREA 1FE8L 1B0GB 5E8EA 3V6OC 4KKLC 1OTTD 1ZHNB 12E8H 4S1QL 1IQDB 1G7JA 2KPNA 2DQDH 3IDMA 3GB7B 3DVGB 3ZE2E 1OGTB 4DVBB 5F7UA 1GHFL 4F37K 5FOJA 4K7FB 3S8WA 5K9KA 2NY2C 2G5BA 4IS6B 2F5BH 4WWKA 4GAJH 3U1SH 3KPRA 4CADA 4OCLC 4Z5RB 1PLGL 1CLZH 5I74B 4YNYB 3GUTA 5DJCA 3SE8L 5AZ2H 2X7LB 1UENA 1CFQA 2NY3B 4QF1B 4Y4FD 1OT1A 4I4WB 3QUYB 1NGYB 1JPGB 2PKDA 4X6DA 3ZTJG 4CMMA 1WWAX 3MLYL 3NAAL 3MZTA 1I7RB 3MNZA 1OP3K 3VMPA 1EEUA 3V0VA 4KZEL 2CIIA 3C6SB 4B7LA 5C6WH 5GIRB 3BN3B 3IDNA 4C59B 3NCCB 5T3ZE 2A0LD 2F8XC 5L0QB 1A6TB 3RWDA 2HLAB 3IXTB 1BQHG 2PNDA 2DYPB 5ITBH 1S7WA 4BA8A 4MAYB 4OF7A 4DKDC 1AXIB 1BJMA 2IPTL 4JFZH 3TPUA 3K81A 2A38A 4N0YH 5A3ID 3ZKXB 5C2BH 4HF5H 1U58B 5DR5H 4HT1L 4O51B 5I71C 4PLOB 4W4NA 4DGYL 2YMXH 4DN3H 3QHZH 3PGCB 2P5WE 2VDNH 2XG5A 5CMAB 5C09B 1J5OL 1VFAA 4H88H 4Q6IA 1BFOA 1TIUA 2BC4A 2CRYA 2Z93B 3VXSB 4FXGB 1BD2E 5DJ6A 2WINA 4ODXA 3BX7C 4RFNC 5EBLA 1D5IL 4KY1H 2A9ML 3V52L 5GS1B 4ELMB 5FKAA 3VFSB 3S4SA 1OAXL 1JN6B 2NTSP 3WLWD 5I1IH 3BDXA 2WQ8A 3DWTA 1RHHB 4JM2A 4IJ3C 4MLIA 4MJ6A 5HGDA 2MWCA 2JJSA 4WEBH 1RU9L 3LPWA 5DJ2A 1K5NB 4JKWA 3O2DL 5D1QC 5CJOH 3TIEA 4S10A 3UYOD 1VPOH 5DJZA 1AHWA 4ONFH 2ZCKH 1RJCA 1MCOL 4GBXB 4PJHF 1NCDH 3QFDA 3PQYE 4OV6F 2PTTA 5T1LB 1DQTA 3D85B 4XHJD 1Q38A 1WCBA 3TBSA 5TF0A 1I1YA 1IM3B 3CZJA 3OB0H 3WKMH 4FQPA 3SE4C 4IMLA 5DRXA 1AP2B 1Z0NA 3QWOA 1NGZB 2FATL 4MX7A 4N9OB 4OGXL 4DUVA 5I18L 4P2OD 3FL7A 3OKDB 1P4IL 1ZWIA 3QQ3A 4MLSA 4IDJL 3IDJA 4JM2D 5HHOE 3JV0A 4LDLB 4PJCA 3SO3B 3WFHB 3ZE1E 4PJBB 4YDKL 1FZMA 1T22A 2GJZB 2GK0B 4OGAD 3ZE0F 3IRZA 5L7XH 4L8DB 1XGQA 1BVKB 1S8DA 4XPHL 3U7WL 3TLRA 1WSST 5ERWB 1YMHB 3V8OA 4QRRB 5KANI 1CLOL 3FQUA 5L8JB 2AAVA 1TJHL 5ELIA 3LEVH 3O8XD 4ODBD 4PJAE 1KYOJ 4HUUB 1NAMA 2R29H 5TE6H 5D6DA 4LLMB 5F96L 1CFSB 5EU4A 3KNBB 5J7CC 5BVJB 1CLYL 3HAEB 5H35B 4QCIB 5JPNA 3FN3A 5E8OB 3DUSA 3WO3B 5C0JB 3TCLB 2F53D 3PDGA 1CXLA 2YPKA 1A6VH 3IAGC 2OS7A 3FAWA 1SY6L 1LDSA 4JHAH 4U3HA 3GZKA 3B4NA 4LEXH 3ZTNH 4C4KT 3ARGB 3Q3GB 3OX8B 3S34L 1G7QB 2OP4L 3BH8B 4L8BB 1N2RA 3NPSB 2XNAA 3VI4E 3UJIH 1SEQL 1NCUA 1T2XA 3LVEA 2GIYA 2YPVH 3EOAA 1CGTA 5AZEH 4WI4A 4HFUH 3EOBB 5JXAH 1M7XA 3L5WB 5HXMA 1KJ2L 2EC8A 3NACL 4YPJA 1F00I 1NPUA 1XZ0B 4IRJC 4N0CC 1QNZH 3DX6B 1VERA 4AK1A 3FQXB 3BN9C 2P8PB 4MMZC 1RUKL 1TCMA 1EHLH 2NXZB 1GVIA 5FO9B 3TBTB 1YNLH 2BXYA 3V0WL 2FZ3B 4OLXL 1EA9C 2NXYD 4UU9A 2ZUXA 5I2IA 1A22B 2LE9A 4EIGB 4UDTB 3LB6D 4L5FH 1HQRB 4OZIE 4NQEE 3EFFB 5LCVL 5IT2H 1F2QA 3EYOB 1WFOA 5JW4Q 3KPOA 4V1DA 1DP0A 2C26A 3KS0H 3NZHH 3HAEH 5ILTH 3P9LA 4CRPA 4XBPB 2FO4A 1PW3A 5ICZA 3I6GA 5I1KL 3C5ZC 5KW9H 1QG3A 2UVFA 5KVDH 1BZ7B 3BP5B 4ZQKB 1EAJA 3IVKB 3OSKA 4OBRA 3LOWA 2QSCL 3FOMA 3R1GH 3QRFM 4P23C 3BE1H 4U1NB 5EG6C 1JK8A 1P7KB 2P49B 1NCCH 5K59E 3DX7B 5J13B 3DSFH 2HT3D 5IKCA 1I7ZB 4Y88A 3S37H 2VSDA 3QISA 3L3DA 1T03L 2ITCA 3MYJA 1YEFL 3RWHA 1UM4H 2HT2D 1I8MB 2WV3A 1ADQH 4OIAA 5IESL 3O6FA 4BSWA 4ZUTA 3OR7B 4D0BA 1U8HB 2DLFH 4LLQB 4HMEA 5EN2B 2YRLA 4LSPH 5ALCL 2VR5A 4OTXH 1SMOA 5B4MD 1TXKA 1RIVH 2DWDB 1UACH 1HSBB 1I1FA 1A0QH 2PR4H 4XMLL 4R90H 2CXGA 5LGHH 1T7VA 5I74C 1C5CL 5J3HD 2YRPA 3UTTA 5B38A 2GAZB 1HYSD 5INCB 2MHAA 3WSQL 4CVZA 3HPLA 3WXVL 2VLRB 3QUYC 3U9PH 3FO0H 5DDHB 2FO1A 4U1MA 5CZVL 3L3HA 2H32A 1FDLH 4Z78B 5ESQA 3TNMB 3PWUB 4BQ8A 1U36A 4R4BB 1HXYB 5L0QC 3VDBA 1NQBA 3UBXA 5DK2B 1VACA 2P1YA 2VLLB 3P9MB 2OSLB 1GZQA 4XXCA 1U8QB 4JKPH 2ARJB 3I3BA 4NQUA 1RSFA 3AY4C 1D5BA 2YPLE 4P0DA 3ARFD 1BGXL 2AJXH 4W68A 1MREH 3HE6B 5TFSH 4KJQD 4KDVA 3UTTD 3O3BB 2ED8A 3CH1B 1S5HA 3V7AE 1MH5B 4K07A 4D0DA 4PJXF 4XTRC 5L2JB 4G7YH 3DIFA 3H9HA 4R97B 3LKNB 3K2UL 1X4YA 3BAEL 4KUCF 4X7SH 2FBJL 5IF0A 4K9EC 3SOBH 3LDBB 4J1UA 3QZWG 1JRHH 1IL1B 3OKEA 3UXFA 3U30B 3KLHC 4X5WB 2A74A 2YRZA 4ZUUA 4JFEA 43C9B 4HK3N 1N64H 4MAUL 5IG7B 3WIIL 3MCKB 4Z7WB 1RD6A 5GS1C 4GW4A 1MELA 3S36H 2Y23A 1F4YH 1GIGH 2DIBA 1A8JH 4H0IA 4Y8AA 3BP4A 3L3JB 2BNQA 3MRFB 5EC2A 1JYWA 2EKSA 3V4PH 3MOBH 5DFVD 2VABB 3CFEB 4H25B 4X7FC 4Z7QF 3KPNB 2CJUH 5D2NA 5C0CD 4LP4A 4MXQC 3VFMA 2P24A 3HI5H 4W6XB 2X4OA 3INUL 2HTKD 1SYVB 3QFJB 1EFXB 2FH8A 2EEDA 4GBXC 2F53E 4ZS7H 2X10A 5HHVH 1N6VA 4JFFB 2VZTA 4F57H 2MOVA 5DWUH 1AO7B 3K2MC 3T1WA 1LEIB 4KJYA 1A7NH 4HPYH 3OB8A 1CICA 4KI5D 5D7IF 3PWPA 1XGTB 3L9RA 4MB4A 1KIRB 1LILA 4P46B 5HGHA 3V5HA 4QNPF 2OCFD 3RJDA 3PWNA 4GSDH 3T1FA 1V3KA 1ZLSH 4P57B 2RFXB 4V2CB 2BNQD 1OHQA 2V9QA 2UUDK 5ADPL 1OF2A 4HWBL 5L8LB 1Q9WB 2Z91B 2V9TA 3SO3C 4M7KH 4QY8A 1KENH 4NP4H 4G8EA 3MLRL 3HI6L 4FQ2H 3T2PA 2M26A 2VLME 3U82B 1AD0A 4Y4KB 4UBDC 3MROA 1UQSB 1T7ZA 5TGBA 1U2CA 1K8IB 1A5FH 2E27L 2VLKB 2V2WA 3FT3A 1YNKL 3MRIB 2QQNL 2ILLA 3VXOA 2C1PB 4U1LA 1CICD 1CU4L 1YY8B 3FQNB 4I3SH 5JXEA 1YQVL 4RWYH 1FV1A 4JGUA 1J87A 2W9DH 3O2WH 5IHZB 1F6AA 3DO3A 5KTEH 4UQ2A 1RULH 3RY6C 3EYUH 3FB5B 4PLJC 1WWWX 2OJEB 3EKCA 5KS9E 3JTSB 1BZ9A 2Q3AA 7CGTA 1NKRA 1EJ6A 2EZ0C 1G7LA 1Q9LA 2B7DT 3FT2A 3ARUA 5INDB 4FABH 4YO0A 1CDGA 5CSZA 3FT4B 5B39G 4ZO9A 3ARGC 3VGDA 4Z7VF 1KV3A 3NPSC 1CL7H 3W39A 3IDXH 4M48L 3MFGB 4XP5H 5J6GA 4KRNA 5JMRA 3WNMA 3ARBA 3CFBA 5CGTA 1BQLH 4OM1L 2OR9L 1YECH 1MHHA 4OKVB 4R2GB 3NN8B 1KBGH 5KN5A 4F2MA 3FMGH 5JO5A 3QDJA 3C87A 1KXTB 4RMQA 1IAIH 5E2UL 2VIRA 2ED9A 3PHSA 5TQ0L 2NXZC 1CD0A 1T83A 1S3KL 4GW5B 5T1KB 2XZQH 3MGOB 1E4XL 3C5SB 4LL9A 4IOSD 1XR8B 1NJ9B 2VDML 4LSTH 5SX4I 4NN7B 4OKDA 2Y5TB 1F11B 4GKNA 1RVFH 3ULUF 12E8L 4XNUH 3VD3A 4PGZA 3QI9A 2BVPA 2VTFA 1GSMA 1QFPA 4N8PA 3UO1H 2DQDL 2PYFA 2CK2A 3I75B 2HVKA 5JIKA 3QPQC 4JZNA 4HZLA 1JPFA 1FFQA 1KCSH 2F5BL 3QDJD 3U1SL 4U31A 1P4LA 2APVA 3NFPA 1ZS8A 5JDSB 4O2FA 1EEZB 1PQZA 5ESVA 2Y06L 5AZ2L 3T3PF 4A2MA 3QUKB 1UZ8A 4K2UH 4JJ5B 2GY5A 5J13C 1HHHB 2IFGA 5D1ZB 5EU6A 4X0KA 4TUKH 2AGJL 4LMQE 2H3NB 4AH2A 4XMKL 1YUHA 4RNRA 1HSAA 3VDCA 5HVGB 4CJ0A 3VRJA 3AMKA 5ITBL 4G43A 1IKNC 4R7DA 4JFZL 3V5DA 5T3XH 1QBLH 4ZSOB 3G5YA 1IKFH 4LBEA 1WBXA 5CUSH 3RVXC 4G8GB 3PV6B 5C2BL 3ZHDA 4HF5L 5DR5L 2WIIA 4P5MA 1CDIA 4M00A 2NY4B 1E4WH 2VQTA 3OJ2C 2B5IB 3NIFF 2YMXL 1UB6A 4DN3L 4P2RB 1U8JA 4M6OL 4Y2DB 5I17B 4JFOB 4G6JH 5T1MB 4PJDF 5IVXE 1DVFB 2VDNL 3ARRA 3BIAX 4LSDA 3IFNH 3ULVH 3AS3A 3RNQA 4XB7A 1CFNA 2MCPH 4HLJA 4H88L 1VEPA 5C0CE 2XXMB 1NBZA 2IADB 5FYKH 3B9VA 3GHEH 4YGVB 2D0GA 5DA4A 4U1IB 2Y6SD 1CK0H 4GRWB 1QLEH 5ID1B 3ILPA 4QHKJ 5I1IL 2ZP0T 1A4JB 5HYSA 3OQ3B 1ERNA 3UTQB 4LAQL 4OZ4A 2DI9A 5E8PA 3G6DH 3HE6C 4FQLH 5F9AC 1A1OB 4CVXB 3REWA 4CVUA 2Z4QA 4LIQH 4ONFL 1A7BA 1FJ1A 2ZCKL 4HUNB 4P5TD 3MX0A 3ARWA 4L29A 1NCDL 2BNQE 4QYOA 4WTZA 2V17L 2Z31A 2C4XA 4ZXBD 2X4TA 1KLFA 2DL9A 4MD0A 4NSKA 2X5PA 2IWGA 1F6FB 5E0QA 1HWHB 3VMOA 5CZXD 3U30C 3MFFB 4GG6F 4MD4B 3MOAH 3ECBA 3D39B 5TE4H 3Q2CA 4YBQC 3PL6C 2DTMH 1N6UA 3D48R 4YHOH 3TBVB 1LO3H 2E6PA 2CUMA 1TZIB 4G6FB 4WFHD 2I9LB 5E00A 3OBAA 1KTLA 3VXPA 4K9EL 1IEAA 1X5XA 2P8LB 5C0FA 1DE4B 4KGJA 5C9KA 3KPTA 4YJZL 4ZDHB 1LO2H 5L7XL 3ULVF 4M1CD 2X4RB 3GSNB 1OL0A 4XNMB 2W07A 2OQJA 3TO4B 1KJVA 1RZJH 3LEVL 2CLZA 4GRWH 3IDGB 3ES6B 2G75B 8FABA 1ZHLB 1IGYB 2P47B 5TE6L 4Z7NE 4MQXD 1YEIH 3MV7D 4POZC 4LSQH 4P46C 5JHDB 1KEGH 2CDEB 5AUMB 4OLEA 1V3JA 3VWJC 1J1XH 1G9NH 2ID5A 5E2WH 4JCLA 1J88A 2JK5A 3CSBA 5HVWA 2BOCA 3U2SA 4JHAL 4M8QB 1BPVA 3QA3B 4RGND 3CLFL 1OARH 3ZTNL 4Y4KC 1UWXH 5CJXA 1H3WM 4PJEB 2DQIH 4J3UA 1FFRA 4OJFH 3UJIL 4ZFOB 1KELH 3OMZA 3BGMA 2YPVL 4IIQB 5C71A 5AZEL 2EDEA 4HFUL 1O7SA 2AXHA 2CLRB 4NQDB 1ORSA 3UYPA 1MAKA 3LN5A 4J7RA 4RISH 1ZKAA 4Y16D 2CH8A 2NR6C 4MNHA 3CPLB 3GSNH 3GMPA 1EHLL 1QFHA 4ZFFA 4GW1A 4LNVA 5EU3A 4BM7A 1RK0A 3SGEH 3UPRB 3HS0B 1J12A 5EC1A 3NFSH 1V5JA 4IHOA 4L5FL 3QDJE 2J2ZA 2D7MA 1R24A 1ZANH 2BRRH 2WUBH 5IT2L 4DTGH 4NO0A 2YSSB 2ADFL 2BNRD 1MJUH 5K9QG 2G9HB 3NMEA 4E5XB 1J7VR 2H6PB 5ILTL 1U9KA 2E9JA 3RZCA 2MFNA 3DRTB 1EV2E 4JB9H 4KK8D 3SDAB 4F15B 3E6FA 5DJDA 3QSKB 5ID0A 1FC2D 5GRVL 4QT5B 5F6HI 1AQDA 4WI8A 4R2GC 4POUB 3HC0A 1TENA 5D2LE 5J6HB 3G5ZB 2NY1B 3ZKMD 5KVDL 1QBMH 1BVLA 3BO8A 3ARSA 3PDOB 2R0ZH 5ACZB 1NBVH 3MRMA 4L3CA 3QDGA 3ROOA 1Z3GH 4PJ9A 3QB7C 4Y4HB 3MRKB 4RGMB 3BE1L 4PGEB 2XWBA 4X80H 2I9TA 5I1HL 3K46A 3DSFL 3J7HA 1N3NB 3S37L 1RJZB 5F9JB 2EO1A 5HPOA 3HAEG 4NN7C 1CG9A 2GSGB 3FQWB 4EDWH 4ZAKC 4L4VB 4XP4H 4NGHH 1KB5B 5SWZB 3RZCD 2V2TA 3RL1A 3PIQA 4QGTA 1MCRA 5C07A 4NQXA 4Z7OE 1OT2A 5IB2B 1H8OA 2QQLH 4L3EB 2DLFL 4GRLB 5L8KB 1QSZA 3CIQA 4HJGA 4JN2A 3ULVC 4HWZA 4H0GA 4LSPL 3AS1A 3PWVA 3N0PB 3QXVA 4OTXL 1T1YA 4OV5B 2BY2A 3N50A 4NO3A 4LRIA 3WN5C 3SE3A 1RIVL 3WIFB 1UACL 4MA1C 1DUZA 3L7EB 2PR4L 1A0QL 3DVNB 2YK1H 4R90L 3QDGD 3RP1A 4PJ9D 3P11H 1JHTA 2ZUSA 2ZUQB 1PKQA 1HZHH 4X98A 4J3SA 2MJWA 3ME0A 1NGPH 3U9PL 1ETZA 1EGJL 3F62A 4R96A 5D1ZC 1FDLL 4LLYA 1CTOA 5C0ND 3SCMA 1G7IB 1W0WB 4QHMA 3C60A 3CSYB 5KSBB 1ND0B 1UXSA 4K8RD 1Q94B 2QHLA 3VXMA 5DVKA 4QXTA 5C0BA 4JKPL 2J88H 2AJVH 1GZPB 1NBQA 1X5IA 4U6YA 4XB8A 5C08D 4YBLC 4KJPC 2ICES 3I6LD 2AJXL 2EYTA 5EOCJ 1H0DA 1MREL 5TFSL 3DXAB 5EUOF 2ZCHH 3PF2A 3NA4A 1CE6B 4I0PA 4DN4H 1KB5H 4G7YL 2H2PD 3B3IA 5E6IB 4F3FB 2NY4C 4NZTH 2B5IC 1QSFA 4I18A 5I1DB 1T1ZA 1BQHA 4WFHE 4X7SL 1EO7A 3AFLA 3TYFB 4Y2DC 1MHCB 3IS0X 4Z7UE 3T0XA 3DETD 4N0UA 4WW2A 2JTDA 5JLZA 1KUMA 1DVFC 3SOBL 3TM6A 2R1WA 1KOAA 2MKLC 2OK0L 1UG9A 3QWRD 3FRPG 1LWRA 1M7DB 2VL5B 2ENYA 1IGMH 5C0BD 1RZJC 4PPTA 4L9LB 3SDDB 1KTRL 3MRRA 3S36L 1GIGL 3CFDA 4MXWL 3O3DB 5HYIA 4R9HA 5B8CB 1R5WB 2EYSB 4G8FB 3BWAA 3MV7E 5EULV 4PRAB 1QKZL 2YZ1A 2CJUL 4UZGA 1B6DA 1L7IH 1RZIB 1TZHB 1NFIA 3KR3H 2DWEA 3HI5L 5GGVH 3DX8B 2J8UE 2OX5A 1G9NC 3LKQA 4ZS7L 5IQ9B 2I07A 3U46B 4NKOA 5HHVL 2CLVB 1H5BC 5EBMB 5DWUL 1R3HA 1A7NL 1VGKA 5SWQB 5GRUH 4HPYL 3T0EB 4RGNE 2WP3O 1VDGA 4F7TB 2BJMH 2IF7A 3S35H 4HG4K 4RA3A 1P4BL 2EEAA 4GSDL 1QLFA 4KV5E 5HDQH 4I0KA 4PRIB 1MVUA 5EO0A 2JCCF 4M7KL 4PS4H 1KENL 4NP4L 4U4BA 4FQ2L 2GEEA 3AM8A 4FFVC 5MENA 4JZJB 4KMQA 4F9PA 4ODWB 1A5FL 2P7TA 2VLJD 2AXJA 4I48B 1UKQA 3BMWA 3TO4C 5D7LD 1HQ4B 4ETQA 2LU7A 3HI1B 1ZA3A 1I7UA 1OAQH 4I3SL 4RWYL 3O2DA 2W9DL 4ZPTB 4S1RL 4BQBA 2CKBB 5FF6B 3T8XB 2BNRE 5CKGA 3LS4H 1N0LA 2P4AB 4X7EC 1WT5C 3VRIB 3AGVA 2XYCA 1IZKA 3WIHH 1JF1B 1J0IA 3VFRA 1B88A 3P40A 4LCCB 2YWYA 1MVFA 1YPZF 1UT9A 2AJZA 5JOFA 3QNYA 5IVZA 5MEND 4YFLI 5JW4R 4QOKB 2W0PA 4HH9B 4HC1H 2GKIA 4LKCB 3UTPD 3E3QC 3DOSA 4XNQA 1OTSD 3EAKA 4NFBA 1CL7L 3WUWB 3TCXA 2M1KA 3IDXL 4XP5L 5D7SH 1FPTH 2ZCLH 1EHNA 1BQLL 1KJMA 1YECL 1C08A 4IIQC 4LDOB 5BVPH 1KBGL 2DQGL 4JFQB 2BSED 2X4QB 5F7MC 3FMGL 1K8DB 3GSXB 4KK6D 3G6JA 2BSRB 4HK0B 5ESAA 2DQEL 5F7EH 3RNKB 4LCWD 3DMMC 3F5WA 1CGWA 4B5EA 2IAMB 3T4AB 4HIJA 3QO0A 1EJOH 1KIPA 4LP5A 1WBYB 2ARWA 4X8JB 2APFA 4LSTL 3HZYA 4D9RD 5D1XB 3QDGE 1RVFL 5DTFB 5GGSA 4XNXH 2A1WH 4XNUL 1TETH 2JIXB 3LQAH 3WL9A 1XAUA 2UY7A 4Z95H 1KNOB 4G9FD 4F15C 2VRAA 2UUDH 4JFXB 4CN4A 3MQIA 5I1CH 4P2YA 3ETBF 4WENB 2J4WH 4PTUB 5KOVC 3BEVA 1I3UA 1KCSL 2HFGH 3MR9B 2Q86B 4MB5A 1AR1D 4NFCA 3OR6A 1R3IH 5DO2D 3BPCA 2YD8A 4WHDA 4OIBA 2R2EB 1AGFA 1JNNH 5B3NA 1AJ7H 2Z92B 4Y4HC 4HXAH 4RGMC 3O45B 3P30H 1NGWB 1XR9B 3MLZL 4BJLA 5DI8B 3S5LB 3KHQA 1KJ2A 5C08E 3TA3D 3T3ME 3I6LE 4TUKL 4X6CF 4P3DA 4LFHD 1D9KB 1ZGLB 4TSAH 4WO4B 2AK1H 2K1MA 4PJFB 1JHKH 1MHEB 1EBPA 1ZGLP 1PGRB 4F7CA 5KSAB 1XGRB 1EPFA 5J89A 4HS6B 5MERB 2DRUA 4WU5B 1AQKL 5IVOA 4GRLC 5T3XL 3RHWF 2X9YA 5CUSL 2DM3A 5CINH 3RUGE 3MRBB 3UDWA 5E9DA 2E7BA 5GXBB 3PWLB 1E4WL 1G0DA 1SJVA 1FL6A 1OTUC 4G6JL 1SVCP 3IU3A 3D25B 1FVCB 1A6WH 4ZFZA 3LEXA 5E94A 3U48A 3IFNL 3ULVL 1IAOB 2NYYC 4HKXA 2MCPL 4U1KA 4KK9C 2R0LH 3LQMA 2GJ6D 1NFDE 3GMNB 1HI6B 4XHQA 4F7PB 1PBYA 3BUYA 4XCEB 4PJ7A 2D03H 5CBAB 1QLEL 3FCTB 3HZKB 3CFKB 4HKBA 3GIVA 4NPYA 3LZFH 2C4FT 3OPZL 5CGYC 4JRYB 3G6DL 4FQLL 4NQCD 4ODSH 5HYJD 3O0RH 4LHUA 1ZK9A 4N5UA 4U2ZA 5FGRA 4K3EH 1I3RB 4OZHE 3KWWA 3HG1B 5CEXB 3P3YA 4PIRF 4NRZB 4BQ6A 5IQ7H 4JDZB 3G08B 3MGTA 3OG6B 5K9OA 4H26B 3E8UH 1BJ1J 3GMOB 1XCTB 4PJGA 3V6OA 1KJ3H 1A47A 4S2SB 4D2NA 2NX5E 3MOAL 2H9GB 3QEUB 4NC1E 5TE4L 2VLJE 4HPOH 2DTML 4YEEA 3DPBA 4YHOL 3HUJA 1CYGA 1LO3L 3X3FH 5D7LE 4BFIA 1A6AB 1M4KA 4L9LC 3SDDC 2HT4D 2B0SL 1A9EA 2X4PB 5F1NA 2Q8BH 1AGEA 3TVMB 2QJDA 4AEHL 3GJEA 4NCC2 2BSTA 5DLMH 5B8CC 5IBUB 2B8OT 2W60A 5F3BA 2ZJSH 4YHIA 5CP3A 1FIGH 1WEJH 2ZZUT 4GRMA 1S7RB 2Z8VC 3BRGC 1JCKA 1RZJL 1NLBH 3MV9A 1JZ7A 1MQKH 3VRLE 4KKLD 1FYHB 5MENE 1IVLA 1U41A 3T0EC 4OFPA 1T1XA 1RZGA 3O4OB 1YEIL 2UZXB 2YA2A 3GSVB 1SVZA 2B1HH 3KPLB 3UTPE 4LSQL 4JO3H 4ZNEA 1CFTB 5LQBH 3SDXB 4I9WD 2WW8A 5C3TA 4PV9B 1JWSA 1HNFA 3TO2B 1C7SA 3ZMRA 4PGDA 6FABH 1J1XL 1G9NL 5E2WL 1B9ZA 4KHTL 3X11A 1K3ZA 2P5EA 1DQQA 5DGQA 5BJTA 4X4XB 2XKNB 5FUCE 2W9LA 3HB3D 5F89B 1MCIA 2OTPA 3PXHA 4HH8A 1NMAH 2YC1B 3W9DA 1J8HE 1T4KB 4MYWB 4BH8A 4BKLB 1OARL 3FFCD 5I76A 1DQLH 4JZJC 4LCWE 1I7TB 4R0LB 1NC4A 3U6RA 3O81A 5ABDE 3JV4A 1HXMA 1DJSA 1KELL 3CK0H 3MACH 1SYSA 5GSRA 3IGAB 3MBXL 2WANA 4D9RE 4EUPA 1WAAA 4P9HH 1M7IB 2DF3A 4Z77B 4E41B 4RISL 3ZT6A 2XI9A 3I9GL 3LQAC 2R8SH 4CDHA 4LRNL 1KT2B 2BVTA 3IFLH 3GSNL 1G1CA 3DBXB 3AREC 4G9FE 1I4FB 1Y0LA 3P4OA 3VXTB 2A83A 1JYVA 1MI5D 2AXFA 4UAOB 3LKRB 4CBPA 4I3RH 3TN0B 2XQYK 3L6FA 2CR3A 3T4YB 4UMGA 1ZANL 2BRRL 5D1QA 1EO8H 1NC4D 2WUBL 4DTGL 4Y0GA 1J9CT 1MJUL 2HJLB 4F8TA 4OQTH 5FHAH 2ZOKA 3P77A 4ZMAT 1N0XH 3QEGH 2FJFB 4HWBA 1QFWI 1WIPA 4JB9L 3MRNA 3SE4A 4C56A 4GAYA 2HN7A 3QIBB 1Q9OB 4PJ5A 3SPVA 4EN3B 5C1MB 5IGXL 1F4XH 1DQJA 1UADC 2C9AA 3H3BC 5C0IB 3QIWB 4GO6B 5DMGC 3EYSL 4U6VL 2DMCA 1Z3GL 1SJEA 2X4SA 3V8CA 2IAMC 4ZFOL 2WBJB 5GS3A 1H9VA 1XFPA 1D6VH 4MNQE 5CAYB 5EO1B 4JHWH 2BX5A 4X6DF 4L4TB 3MYZA 1CD9B 3L5IA 5D1XC 3HMWH 4N8CH 1MPAL 1VA9A 4XP4L 4NGHL 4JPWH 5DVMA 3HR5B 2A6DB 1JHLH 1BBJB 1HKFA 1U42A 3AAZA 1A4KA 3OGCA 3LRSA 1S5IH 4C56D 2D7QA 3QO1B 1X5ZA 1YDPB 4OT1H 1XF5B 5TDPA 4UILH 3CFIC 4ODUB 1CGXA 2DJSA 4YXHH 4ALAH 3EO1B 4IOIB 4J3OC 4NUGH 5IB5A 5F97E 2KQMA 2BCKB 2XN9D 2DLTA 2GJ6E 2ICEB 2XXCB 3P11L 3LKPA 4AG4H 4H5SA 4APQB 2NTFB 1HZHL 1NGPL 2XRAH 3SDXF 4OGZA 4NFDA 1KXVC 1DN0B 5F6IC 1KYOK 3ALWA 1X5JA 3BKYH 1N4XH 2W0FB 4LVOB 3C9NA 1U3HB 3GK8L 4GKSA 4NQCE 1D9KC 2C1OB 4WO4C 2VC2H 3R06A 5HYJE 3WNNA 1F58H 3MNVB 1HHKA 3DUUA 2HRPH 4G6MH 3O6ML 5MEPA 3ESUF 2J88L 3DGGB 3ZHKA 4PJIE 4R3SB 1X3DA 4MZ3A 4KDTC 3VI3E 4IRJA 3B9AA 2MSPA 4JM2F 2FEEL 3BH9A 3SO5A 1PY9A 4HJ0D 2ZCHL 5IK3B 2R15A 4DN4L 5C0EA 1KB5L 1A3QA 1FYTA 4NZTL 3CZFA 4LGRB 3HZMA 3WO4B 1UB5A 1YMMB 4U6HA 5D9SB 3F7RA 5E2TH 2EIZB 5TH2B 1AKJA 2XTJD 5FXCH 4PFEA 3UPAA 3HZVA 4PLKC 3ZKND 3MBEB 4WFFD 3BI9X 4NZUH 2IBZX 4JFDB 5AD0B 2ZUVA 4QHKI 1E6JH 5EIIA 4M61A 3RHWK 3B9KA 3SBWC 5BOZG 3GMRB 3MUJA 3V6OE 4IRJD 2YOCA 1MCEA 3C5ZA 4N0CD 4PG9B 1R6VA 4LF3B 1HH9B 5ECJE 2Z35A 2NZIA 2YUVA 4XZUA 1UVQB 3BN9D 4PJCF 1PG7X 1URLA 2YBRB 3HUJE 5F1KC 3KR3L 5GGVL 3NCJH 4FQIH 3FO9A 3AXLA 4O02H 3PGFL 3V6FB 1P7QA 2FX9L 2BY1A 3WMSA 4AEIH 1LEKB 3L3IA 5GRUL 3Q0HA 4WWKC 4HGKC 2J8HA 1B0GA 2VH5H 4NJ9H 1ZHNA 3VXUD 3FFCE 2B39A 5CS7A 4XPFH 2PETA 2BJML 1IQDA 3WFZA 3C08H 3TJHD 3BKCH 4OM0H 3GB7A 3V4UH 1X6NA 3DVGA 1OGTA 4DVBA 1FIEA 3C5ZD 3V4VH 1FGVH 5HI3C 4K7FA 4FXKB 5C0AD 3RGVB 1WFNA 4IS6A 5F1SA 1TNMA 4PS4L 4P9HC 2WWMD 4Z5RA 1XF2B 1BF8A 4P23D 4YNYA 3K74B 3BSZH 1MCBA 5GS2H 2X7LA 4QF1A 4I4WA 1CWVA 3QUYA 1NGYA 1MI5E 1JPGA 3U36B 2WWKO 5FO7B 3WD5H 1BHGA 1I7RA 5DJYB 4X6EB 4DAGL 3LS5H 5HD8C 3EDJA 3C6SA 4M1GH 5GIRA 1UWEH 3O4LD 4Y19D 5DUMH 2F54D 2UWEE 4LSSH 3MLTB 5T33H 2BFVH 1A6TA 3D69B 1EXUA 3LS4L 2HLAA 3IXTA 3C09B 2R56L 2DYPA 3CFJB 4MAYA 4OI7A 4QRUB 4PD4K 3ZKSD 1ZVSB 2HFTA 2H45A 3AY4A 3BT2H 2AEPH 1MF2H 1P9MC 2ARJQ 4Q6IC 5DMKB 1U58A 4LMQI 4ONHB 1D3CA 1S7VB 3UTSB 4NJAH 4NYLA 5E08L 2XPGB 1YC7A 4O51A 5L9DH 3QUYD 5F7FA 2GHWB 4LU5H 3ARTA 3PGCA 5D7SL 4M9PA 4D0CB 5IMOB 5I8OH 5FB8B 1T2QH 1XGYH 5CMAA 5C09A 5BVPL 1EHXA 4RWHA 5E99H 2IPKB 3VGAB 2Z93A 3VXSA 4FXGA 3THMH 3U7YH 3ZSSA 2DYPD 5SX4H 2BY0A 1AHWC 5F7EL 4CUCA 4JVUA 4OF6A 3AUVA 5GS1A 4ELMA 5BS0B 2YXMA 3VFSA 4NHCH 1JN6A 4C56E 1JE6A 3SE9H 4HHAB 4YC2C 2I27N 5DFTA 3I02B 1RHHA 4UAOC 2WMPA 4XTRD 3JVGA 5J11C 1K5NA 5FYJH 2XN9E 1ONQB 2A1WL 4XNXL 4GBXA 1PEZA 3SQOL 5T1LA 3D85A 4LPUA 4XP1H 4Z95L 1MFEL 1X5HA 4QRPB 1KPRB 5C09D 1IM3A 3U7AA 3B2UC 5I1CL 1WJ3A 4XWGH 3KLHD 1AP2A 1G84A 2ED7A 1VFOA 2J4WL 3VXSD 3QIBC 3QP3A 1NGZA 3KXFD 1HIMH 4EN3C 3BZDA 2HFGL 3GBNH 3EO9H 1G9MH 3FONB 4WI3A 4FP8L 3OKDA 1R3IL 1RUPH 3QIWC 1HINH 2CRZA 4H1LB 2F9BT 3EZJB 5E5UB 1JNNL 3OF6D 1E6OL 1AJ7L 1CGYA 2NW3B 1HH6B 4HXAL 3P30L 1GGBH 4W70A 1R3LA 4J3VA 3WFHA 4PJBA 2WBJC 4MXQD 5D6DC 3RX7A 4NQVB 5DJ0B 2GJZA 1F6LL 2GK0A 3QG7H 4L8DA 1BVKA 2FLRT 4TSAL 2K7PA 5ERWA 2AK1L 1A2YB 1YMHA 5T1LD 2GI7A 4X7DC 1EFQA 2UVEA 4WCYH 2V5MA 4UTBH 1B3JA 2VO5A 1PKOA 4HUUA 2I60L 4LLMA 1T7WA 1CFSA 2XICA 2X89A 3KNBA 3I50H 4JRXB 3RBSA 5BVJA 2XTJE 1T89C 2BNUB 3HAEA 4BSJA 5H35A 4QCIA 4BK5A 1YEJH 4CGTA 3BKJH 5E8OA 3U0PB 2H2SC 5C0JA 4K3DH 3TCLA 1X4ZA 1TLKA 4APQC 1GJIA 2ADIB 1KSRA 5F7DB 3QJHB 4UBDD 1JGUH 1J86A 2DQCH 5KVFL 1WFUA 1QLRB 3ARGA 2R0LL 4QRRD 3Q3GA 1U3HC 3OX8A 1G7QA 2AV1B 3BH8A 4L8BA 4KI5F 2YUWA 4H1LH 3VXQB 4X9IA 5DVOA 3ULSB 2VSCA 3JTTB 5DRZB 4W6YB 4RSVA 3EOBA 3IT8D 3L5WA 3BQUB 1NUGA 2QSQA 4PLJD 1RFDH 1B0RB 1IGTB 1ADQA 1XZ0A 3VXUE 3DX6A 3BHBB 3DGCR 3EOYG 3BWUC 3FQXA 3ABZA 2P8PA 4ODSL 2EZ0D 3O0RL 1JP5A 5FO9A 3TBTA 1MEXH 1FFNB 4K3EL 5DHYB 4LOUC 2XY2A 2FZ3A 4DVRH 4PJHE 5C0AE 1YZZA 2BVQB 1I9IL 4IEFB 4PRPB 4MWFB 4UDTA 5IQ7L 3WO4C 4B7IA 3LCYA 4U05A 5D5MB 3ARGD 2A9NH 1HQRA 4TNWF 3EFFA 4YE4H 3EYOA 2HTLD 4NQSB 5F72S 5F7KC 1KLGB 4MA8H 4HPOL 3MBEC 4GAGH 4XBPA 3S5LG 3RIAK 3X3FL 2X2YA 1J8KA 1F3DJ 4HIIB 3QNZB 3TIDB 4KUCD 3O4LE 4Y19E 5DVLA 5E7BA 1BZ7A 3Q1SH 5SWSE 3BP5A 3GBMH 4ZQKA 2F54E 1N26A 3IVKA 3JWOH 3ZE0E 3S88H 5GGSY 1FIGL 3FRPA 4U1NA 1P7KA 1YYLH 2FIRT 3DX7A 1NLBL 1MQKL 5JZ7D 1UCBH 1I7ZA 4OCNC 3UZVB 4D8PB 4ZG1A 3B2VH 4EQ2A 1VFUA 1I8MA 4CDGC 4Q6YA 1MCSA 4PR5B 4GKZB 2B1HL 1L6XA 4JO3L 5KANG 1RUMH 5LQBL 3OR7A 1U8HA 4XAKD 5EZOH 1IKNA 2LFGA 5FKPB 4LLQA 3X3GL 5EN2A 4NOBA 3G5XB 4JQIH 1CFVH 1X44A 3RWGB 3DX9B 2DWDA 3BD4A 3S96B 1NMAL 1HSBA 1M6OB 1BIIB 5A43C 1NCTA 5BRZB 4U1HB 1DQLL 2GAZA 2WSKA 5INCA 1L4IA 3L95B 2VLRA 2FJGB 2KL6A 3CK0L 5DDHA 1OWWA 2O5ZH 4YLQT 3MACL 4G7VH 4Z78A 3QHFL 1PYWB 5EDXA 3TNMA 1PAMA 3PWUA 4W4OC 4YDIH 4HLZH 4P9HL 3SDCB 4R4BA 1HXYA 2EDRA 5ETUB 2R8SL 5DK2A 3I3DA 2B20A 5F7WC 4KZDH 2VLLA 3O3AB 3QQ9C 3C09C 3P9MA 3IFLL 2HKFH 3OJVC 2OSLA 2HFEB 1U8QA 4KTDH 3LQZB 1BQSA 4MNGB 5C09E 2ARJA 3RVXD 1NDGB 4NDMB 2VE6B 4I3RL 3VXSE 1RMFH 3KXFE 4MJIB 2X05A 5LAXB 1W0VB 3HE6A 1G9MC 1DN2A 3O3BA 1EO8L 3CH1A 1MH5A 5L2JA 3LKNA 2VLRD 2AXGB 1N0XL 4YPGB 3ESVF 3WDIA 3S7GA 1IL1A 5IBUG 1ZLVH 1MCFA 5D2NC 4X5WA 5FIEA 3VGAC 1F4XL 2EDJA 1NFKA 3E1F1 43C9A 4N1CA 5IG7A 3MCKA 4OZGB 4Z7WA 3W81A 4CL7A 3GM8A 1QHPA 2NCMA 1EUUA 1T1WB 3L3JA 4J6RH 3MRFA 4OAWB 2XTLA 3H9SB 1D6VL 5KZCB 2VABA 3CFEA 3KYMB 4H25A 3TBWB 3KPNA 2DBLH 3Q5OA 3HMWL 2DMKA 4N8CL 5I30H 4NHUB 2VDPL 4YQXL 4O2CB 1MCWW 4JPWL 1SYVA 1JHLL 1XIWB 3QFJA 1EFXA 5C86A 4JFFA 1AO7A 3CVIH 3VWKB 1LEIA 4OGYH 3H42H 4OT1L 4XI5D 4UILL 4NQTA 3WUZA 2FGWH 1U8IB 1XGTA 4YXHL 3PL6D 4ALAL 2DKUA 4QRRE 1KIRA 4P46A 4QRTB 2GTWB 3S4SG 2ICWJ 5IVNA 3QUXB 4LGPB 3ARXA 1JZ6A 4WDIB 4P57A 2RFXA 3MJ9A 3ULUD 5JA9A 1KACB 1Q9WA 2Z91A 1FG9C 4MHHI 2HP4A 4M93B 2Y1VA 3BKYL 1I8IB 1MUJB 4Y4KA 1UQSA 1MCJA 4LAJH 3U4EB 1K8IA 1DBJL 5F71A 1OVZA 2VLKA 1DQML 1F58L 1IM9D 1JWMB 3MRIA 2HRPL 4G6ML 2PXYD 2C1PA 5M95B 3Q6FB 4UB0L 1YY8A 3FQNA 5TDOB 4RIRB 1CN4A 1LO5B 4POZD 3TFKC 5JW5B 5IHZA 1H3UA 3FB5A 3VWJD 2OJEA 3F58H 1YA5A 3JTSA 1BFVH 1WTLA 2I5YH 5ACLA 3KLSA 4PJXE 1K85A 1QTYT 5KBNC 5INDA 3IKCB 4Y5VB 4L4JA 5E2TL 4GXVH 3FT4A 2W38A 4JANB 4KDWA 3JWOC 4XVTH 1ZGLM 4I5BB 4UDUB 4YR6B 1AE6H 4Q9QH 1C8PA 1E6JL 5KJRH 2WAHA 4OKVA 2PO6B 3NN8A 5FEBA 4UT9L 5IR1B 3OJDB 2NR6D 1JF6A 3MMEB 4MDJB 4NUJB 4S1DC 1KCUH 3RL1B 3FO2B 4CW1B 4FFYH 5DA0B 1W72B 2DD8H 3QI9C 4Z7QE 3STZB 4XAKE 1GGYA 4XP6H 4GW5A 5T1KA 4O02L 3MGOA 4WHCA 3C5SA 5E56A 3EFDL 1XR8A 1OAZH 4AEIL 1NJ9A 4PBWD 2N56A 3U0WL 4RFEB 2Y5TA 1F11A 3WFEL 2VH5L 3Q5YA 4NJ9L 2X42A 5D7IE 4XPFL 1CXFA 3C08L 2WP3T 3BKCL 2OJZH 4HS8H 3I75A 4R2GD 4YHZL 4QNPE 3V4VL 1FGVL 5JQ6H 2Y07H 2P5WB 3QDMB 5E95B 1FVEB 4O58L 3V5KB 4TPRH 5A2LH 4NWTH 4MJ2A 1EEZA 5JDSA 2XA8L 3J8F7 5T3XD 1M1SA 4UTAH 5A2FA 4JKMA 1JIBA 1VEOA 3QUKA 4JJ5A 4OLZH 1DSFL 1HHHA 3WD5L 5D1ZA 4XAWL 4TNWK 1NCBL 3LS5L 4ZAKD 4M1GL 5CEYB 2D31B 1UWEL 2H3NA 3MCG1 3ILQC 5DUML 3QUZD 2IGFH 1R0AH 4D9LH 3RWIB 2ESVD 1FAIH 4O00A 4Y1AD 5HJ3B 4JQXA 1W72H 2CUHA 1IGIH 3NPZB 3ULVD 1EEYB 1LVEA 5T3ZH 3S6CA 1FLRH 4ZSOA 3L5HA 3MUZ1 3PQYB 3BT2L 5E5RB 2AEPL 1MF2L 4G8GA 3PV6A 5JOPD 3KS0J 1NEZB 2RB8A 2ZG1A 4NJAL 1NCWH 1LD9B 4KXZI 2V6HA 1OQOA 5IW1B 3RTQD 2ZSWB 4LU5L 4P2RA 2R0KH 4Y2DA 5I17A 3U83A 4JFOA 4OD2B 4Z7VE 5D1ZD 5T1MA 3X12B 1DVFA 1XGYL 1HEZB 1UEMA 4J3WA 4PLNC 2XFXB 1C16B 1NC2D 4OSUL 4GG8B 2GUOB 2IADA 5E99L 2D7NA 3THML 3U7YL 4YGVA 2E7LC 1VHPA 1MFCL 1J0ZA 4U1IA 4ZD3H 3A0OA 4NHCL 5AWNH 1CTNA 2NNAB 3N06B 2Z31C 5ID1A 3SE9L 4KJPD 5CP7B 3FO1B 4G8GD 1A4JA 1MIMH 2KQNA 3SGKC 3UTQA 1IAII 1N6QH 5B38G 3N9GL 1DR9A 1EHAA 4LDEB 4UI2A 4FQHB 1A1OA 4CVXA 1BREA 4LCUB 1NCAH 5GRZA 4Y2DD 1A7PH 3ULUE 4N8VB 3LPFA 3KHOA 4XP1L 3O9WB 1J1OL 5EORL 1KEMH 3UTZB 2VISB 1A6ZB 1FNAA 1IFHH 4JE4B 3VFWB 3MFFA 4LASL 4IRSB 1HIML 4MD4A 1EK3A 3FB7B 4GMSL 3D39A 3EO9L 5GPRA 1G9ML 4YZFF 1HINL 3LRHA 3TBVA 4UIMB 4CJ1A 3T3MF 1TZGH 3C6LD 4WI9A 4LSRH 1TZIA 1R3KB 3MJGX 2I9LA 4Q58C 1GGBL 2AI0H 3T3PE 4MJ5B 1QP1A 2P8LA 4FZ8H 1DE4A 5FGSA 3P4MB 4ZDHA 3QG7L 1W8OA 4HMDA 1T21B 2X4RA 3GSNA 2Y5EA 1JZ2A 4XNMA 3U9UB 1LEGB 5ACMA 3KPPB 3TO4A 1XIWC 4WCYL 2E7CA 5ENWB 4P4RB 3IDGA 5DQJB 4NNPH 3ES6A 2X9WA 2G75A 3VWKC 3EJYC 2KH2B 1ZHLA 1IGYA 1VFBB 3BZFB 3UJJH 1E4JA 3I50L 1GRWA 1WT5A 5JHDA 5DUBB 4OZIB 2CDEA 4NQEB 1YEJL 5AUMA 2VQ1B 3QUXC 5AYUH 3NIDF 4K3DL 1BJ8A 2AV7B 4WTWA 4Y4FB 5DZNA 2EDWA 3NIFE 2OXHA 1FNFA 1JGUL 4M93C 2DQCL 4HDIB 4M8QA 4PJDE 3ZDZF 3SJVD 3VA2C 3QA3A 4WW2F 4NZDA 4XCFH 3GNMH 1MCLA 5BW7C 4PJEA 4Z8FH 3DECA 3M17B 5TF1H 1REIA 1V05A 3LD8B 4ZFOA 1CBVH 3JSSA 1J1PH 1ZT1B 4M7LH 4BUGA 3BIBX 4XPGH 2I25N 4PY8I 4IIQA 5D6CB 4N5EC 3ARQA 4X9BA 1S78C 2CLRA 2X1QA 4NQDA 1RFDL 4LNRB 5JHDD 5IM7B 3F8UB 5I1EH 4G6KH 4Z76B 4YIQB 1U0QA 4K23L 3CPLA 4OD3H 4XWOC 4HUVB 2R2CA 1MEXL 3FOLB 5GRXG 5ISZB 1A3RH 25C8H 3UPRA 1CIDA 3HS0A 4KQ3H 4DVRL 3MRQB 4OFIA 5FCUL 2AJYH 3BZ4B 3P4NB 2VNCA 3GGWB 2A9NL 1WK0A 2R39A 3AMLA 4Y5VC 4H1LG 2IJ0C 5LGJB 1IAMA 1IC5H 2P43B 2YSSA 4IM8A 1E27B 3O41B 1TTUA 2G9HA 4GG6E 5T3XE 4E5XA 2H6PA 2X9XA 2HVJB 1KPUB 4M5ZL 3WFDH 4MA8L 1F3JB 3DRTA 4B0MM 3LKOB 3SKMB 3SDAA 3DUHA 4GAGL 2EDDA 4QT5A 1XF3B 2PUQT 2PO6C 5J6HA 3G5ZA 4P99A 4FOMA 3Q1SL 3GBML 3DMMD 1JVKA 3PDOA 2ESVE 4Y1AE 3R0MA 4Y89A 1W8NA 5ACZA 2WUCH 3D18B 3JWOL 3S88L 2F8VA 4Y4HA 4XCYB 3MRKA 3ULVE 4PGEA 5A40E 1S9VB 3IETB 3ROLB 3S37X 3VFOB 3KPQB 1UCBL 1N3NA 1RJZA 2ERJC 5F9JA 3MNWB 3B2VL 3SE3C 3D2UD 5JOPE 2GSGA 3F7YB 3FQWA 2VZUA 4L4VA 4NT6B 1KB5A 3T2OA 2YPLB 5SWZA 1N7ML 4YH6A 3C8DA 3ZYJA 1SJHB 4P2OB 5IB2A 1MCNA 1JYXA 1JYNA 1L7TH 4L3EA 1DLHB 4MQ7B 5EZOL 4GRLA 1D6EB 4JO2H 3CX2A 1DUYB 2V9RA 5EU5B 1CFVL 2VXSH 4N9GB 4OV5A 1B0WA 1EZVY 3SCMC 3WIFA 3L7EA 4OB5H 3DVNA 3NCEB 5H8DA 1F02I 4Y4HD 1FL3B 4I8DA 1TJIH 5C8JB 2FX7H 4QHLB 4HAGA 1LMKA 2CXKA 5LG1A 5FA4B 4G8GE 4L1DA 3SKJH 2O5ZL 1BM3H 3O8XB 4WI6A 3DJ9A 4G7VL 1UCTA 5I8CB 1G7IA 4YDIL 1W0WA 4X6BB 3BDYH 5E70A 4J4PA 4I0PC 1D7FA 3MLVH 3CSYA 5KSBA 5IB1B 2OTWB 5T5NG 4KZDL 1ND0A 4GRLD 1Q94A 2HKFL 3G6JF 1XGUB 3UAJD 1KCKA 1NKOA 2JKXA 4KVCH 1BAFH 1GZPA 1N59B 2AABH 1BX2B 2F53B 1LO0L 3Q6GL 1IGCH 2LU3A 3P0GB 3DXAA 1U8LB 1DBKL 4HIXH 1OLZA 4PRHB 1CE6A 1YEEH 4GRWE 4ZUVB 4YWGH 3WXWH 5E6IA 1OTUD 4F3FA 3CLEH 5I1DA 3TYFA 2NYYD 1MHCA 4Z9KB 1Z0MA 4HLZG 3PHQB 2MMXA 4KK9D 5GISL 1U8PB 3RPIB 4HG4J 4HKJB 2OYPA 3WJJC 1M7DA 4WW1B 2CMRH 2VL5A 5JNYB 3S36X 4L9LA 3SDDA 1Y6MR 3P0VH 3HHRB 2DQUL 1Z2KA 3O3DA 4J6RL 5B8CA 1R5WA 2EYSA 4G8FA 4M62H 3ZYOA 4DK6A 1CDCA 4PRAA 1VESA 1S7SB 2DBLL 5FAAA 1RZIA 3K8LA 1TZHA 1MWAB 5I30L 4LLUB 3DX8A 3MV8E 3W0WB 3WIHA 4WUUB 3DV6B 1ZLWH 5IQ9A 1ZLUK 3U46A 3BRFA 3QCVH 2P5EB 3RL2B 2CLVA 5KS9B 5EBMA 3CVIL 2QQKH 3ORJA 3H42L 2C3HA 5SWQA 4GXUN 3T0EA 9CGTA 1M05B 3MGAA 2FGWL 3SJVE 5ADOH 4F7TA 4HC1A 4Q9BA 4IRSC 4KROB 1YJDH 3UYRL 1MJ7H 1MIEH 3G6AB 3E6HB 1U2HA 3N1MC 2IC2A 3EYQC 1CS6A 5HYSG 1QD0A 4PRIA 5L2KD 4MCYB 4ETYA 1ZEAL 4D9QD 4I2XE 5DS8B 5JHDE 1WWBX 5CEZD 1RUAL 5DC9B 4QHUB 4JZJA 4WTZG 4L8SB 3ISWA 2Q8AL 3KJ4B 3WKNA 4ODWA 3RZWA 1JTOA 4I48A 3MRGB 1A14H 1HQ4A 1U95B 1WIUA 4WY7H 3HI1A 1KGCD 4KPHH 2DQJH 3T0ED 1AXSB 2NY6D 4PJ7F 4U0QB 1U3JA 4YX2H 4QHNB 4ZFGH 1AGDB 2VAJA 4ZPTA 1YNTB 1IC7H 2CKBA 2FYYB 4OF0A 3T8XA 4YUEH 5FF6A 4M02A 3OAUH 2QBWA 1G7PB 4LLVB 3F58L 3VRIA 1BFVL 2I5YL 1JF1A 2Z8SA 3FQTB 4I77H 5EUOE 4KK5C 1K2DB 2D7TL 1WICA 2WZPD 4LCCA 4EXPX 5I8EB 4YAQB 4OF5A 4Y4FC 2PW2B 4GFTB 1YEHH 2DJUA 5I66B 2RJMA 1DBBL 4AENB 4GXVL 4QOKA 4HH9A 3T2QA 4LKCA 4XVTL 4PJGF 3BEWB 1LP9B 3WUWA 4EI5B 3DTXB 3LD8C 5EB9A 4ZO8A 4Q9QL 4K3HA 2VXTH 3KJ6H 4Y2OA 1MY5A 4TVSa 3DROB 4JFQA 2X4QA 1K8DA 2YEZB 3GSXA 4DKEH 2BSRA 4HK0A 3ARFB 3L7FB 2F58L 3OGOE 3RNKA 3ARED 4FFYL 1X9QA 4XPBH 5H37H 2IAMA 3T4AA 4XP6L 5BXFB 3SN6N 4WEUD 4ORGB 5J12C 1WBYA 2O61B 1OAZL 1RZFH 2YA1A 3MREB 4X8JA 4KTYA 1DQDH 1VB9A 5D1XA 3VXRD 5SV3A 1CGUA 5IHUH 4QRSB 5DTFA 2L7UA 2JIXA 4LPXA 2BDNH 2AEIT 3I3EA 1KNOA 4BSVB 4JFXA 3EDEA 3MV01 2MPAH 4FQ1L 1HE7A 5JW4M 4PTUA 2Y07L 1WBZB 5IVXB 3MR9A 3WHE0 2Q86A 3NTCH 2JCCE 3N1FC 1U8NB 2J8OA 2X1WL 4NWTL 2E5EA 2R2EA 1N5YL 5C0CB 1NMBL 2Z92A 2OTUB 2FNBA 4HUWB 4UTAL 3O45A 1NGWA 4RRPG 3ZYZA 1XR9A 5DI8A 3S5LA 1Y18B 1QRND 4OLZL 5A2KH 2AEQL 5DQ9B 2WWKT 1QO3B 1H3GA 1I9JH 1XGPB 1D9KA 2JIXD 1ZGLA 4AQOA 4WO4A 4ZUWB 4PJFA 2IGFL 4HX1B 1MHEA 1R0AL 1FAIL 1WAAF 1X5AA 5KSAA 1XGRA 1W72L 4HS6A 3VFPB 3JWDC 4P2OC 5MERA 4WU5A 5T3ZL 2R9HC 1ZMYA 5JA8B 1FLRL 4LARH 4QXWA 3RWCB 3ZDYE 1BIHA 4BFEA 4KDTA 3N1PC 1EH9A 1YPZE 4P9MH 3MRBA 1OAYH 1T3FB 1NCWL 4ENED 3PWLA 1EMTH 2DKSA 2R0KL 3BD3A 1I85C 3D25A 4LKXB 3PNWB 1FVCA 2ATPB 2AQ2A 3IYLW 1IAOA 1D9KD 4KAQH 2QTEA 4X5LA 4WO4D 2W91A 3TZVB 5F21B 3GRWH 1E4XI 3VGBA 3GMNA 1HI6A 4F7PA 4BFGA 4OLWH 4XCEA 1S7TB 5GJSL 1VEMA 3NCBB 2Y36H 3CH8A 1MJJB 5AWNL 5CBAA 3FCTA 4M5YL 7FABH 3HZKA 3CFKA 5D8JH 1N6QL 3BKMH 4JRYA 5BZDB 1YJDC 3BDBA 4EI6B 3M1BB 5DD5H 1DTUA 1NCAL 3QRGH 1I3RA 3HG1A 5CEXA 3KLAB 5L2KE 4DZ8B 3HTLX 4NRZA 4D9QE 3D0VB 1KEML 1CQYA 4HS3B 4I13B 3G08A 4JDZA 2BK8A 4RMTA 4H26A 1RIHH 3GMOA 1XCTA 3PJSB 4S2SA 5CEZE 2AK4D 3KPSD 4PLKD 2H9GA 3QEUA 5I19L 4RMSA 3TV3H 1ZHKB 1KTDB 1TZGL 1HKLH 3EOTL 4LSRL 1A6AA 1KGCE 3T0EE 2AI0L 1SJXA 2X4PA 1OP5K 3TVMA 4EBQH 2R23B 4NBZB 2R1YB 5JW3H 3O2VH 2BHYA 2HH0H 3GSUB 1EXUB 5ALBH 1KCVH 1SM3H 3MRDB 2HMID 2VYRE 4X6CE 1FH5H 3MLXH 4OLYH 3RWJB 1S7RA 2YD1A 3RU8H 1J0KA 4GS7B 3RY4A 3TNNB 2RAMA 4WWKD 3KPRD 3S3PA 4U1SB 1A7RH 1T0NB 5D7KD 4OI9A 3HR6A 4A6YB 1MNUH 1NEZG 3UJJL 3OAZK 3LN4B 2G5RA 3GSVA 4NYLB 4UNUA 4Y5XB 2ICWI 3KPLA 4KROC 4OQTA 5F8QC 1CFTA 1S7UB 4XVUC 3SDXA 1KN2L 4PV9A 5HI3D 3TO2A 4Y7MA 5AYUL 4JR9H 1S9YB 3BYYA 1T5XA 3DV4B 4X4XA 2EIDA 2XKNA 4JPVH 5F89A 1P9MA 3NABH 2EIEA 2YC1A 1T4KA 2AJUH 5D2LB 4BKLA 4XCFL 3GNML 5CGMA 1OSPL 1NLDH 2FJHB 1I7TA 1ROWA 4L8SC 4R0LA 3CNKA 2IPUG 2W65B 4Z8FL 2DLGA 4TTGA 5TF1L 2W59A 4U7KA 4N0FB 4BH7B 1CBVL 5BCAA 3SKOB 1J1PL 1K4DB 5HD8D 5ICYB 4M7LL 1DLFL 4XPGL 3IGAA 1A64A 4JO1H 3VXRE 4JREC 4BUHA 1M7IA 4Z77A 4E41A 2EDNA 5I1EL 3GSWB 3TT1H 2XQBH 1KT2A 4XBGB 4OD3L 3DBXA 3VGFA 1I4FA 1NANI 5J3HC 3VXTA 1A3RL 3M8OH 1G0YR 3QH3B 3PHOB 4KQ3L 1HYSC 3LKRA 3TN0A 1I1AB 2AJYL 3T4YA 4AEFA 1HHGB 2CIKB 4A6YH 3RJQB 1IC5L 3UX9B 2HJLA 4ERSH 5LXGH 3WFDL 2FJFA 4EI5C 1R3LB 1LK3H 5IHLB 1QRNE 2EDLA 5EO9B 5E1AB 3QIBA 5FK9B 1G6VK 1Q9OA 1UKTA 1P5UA 3QXWA 4E41D 4EN3A 3M45A 4K94H 2E7HA 2ZOLB 3HNVH 3EIFA 3QIWA 5C0IA 4FFWD 5DHVB 3ARFC 1ZA6B 2JB5L 5MI0B 4P5TB 2WBJA 4UNVA 3L3GB 4OUUB 4C4KO 1NGQH 5EO1A 2FIKB 4ZXBB 4ZYKB 3O6LH 4L4TA 1FLTX 2CDFB 3HR5A 2A6DA 2FHBA 1BBJA 3MLWL 3B2UD 1IRAY 1GOGA 1L7TL 5F93C 3VJ6B 3QO1A 3QIBD 1YDPA 4JO2L 1XF5A 2IBGA 4EN3D 2VUOA 4ODUA 5DUPH 3UPCA 2VXSL 3EO1A 4IOIA 4X6FB 4Z7UB 2DDQH 1AI1H 1FHGA 1T89A 2BCKA 4OB5L 4CU8A 1TFHA 2DLIA 2ICEA 5MEQB 5IEKB 1TJIL 2FX7L 4APQA 5M7QA 2NTFA 3HCVB 4MA3B 5FGBC 4MD5B 1FORH 4LLDB 3SKJL 2UZYB 3ZDXF 1DN0A 1BM3L 2YWZA 2APWA 5DMIL 5LGKA 4OD1H 2W0FA 4LPTA 4N68A 4DCQB 1U3HA 2QADB 2J6EH 1Y6NR 2C1OA 3BDYL 5F9OH 4KKCC 3MLVL 3MV7B 2YD7A 5DHVH 1FVDB 3MNVA 3D87B 4HIHB 1I3VA 2IMMA 5DD3H 5EWIH 2J8UB 4BZ1H 3DGGA 5DZOA 4E9LA 4ELMF 4KVCL 5SX5K 2D4FA 4R3SA 4BQCA 1QFWL 1AD9B 1HHJB 2A77L 2AK4E 3KPSE 4OQ1A 3VGGA 3CDYA 3HMXA 4HIXL 5HTSA 5IK3A 3WNOA 2AQ1A 1YEEL 4YWGL 4P49A 4RGNB 3HNTH 4APQD 3SGJC 1MCPH 3WCYA 3CLEL 3GI8H 4PB9L 1IQWL 3JWDL 3B9KC 5CIPB 2YKLL 1YMMA 5D9SA 1U3HD 3RVUC 2EIZA 1TQBB 5TH2A 3TZVC 4UINH 2D7OA 2J7LA 3VG9C 2CMRL 3MBEA 4DZBB 5GS0H 3JZ7A 3AVEA 4Y16B 4JFDA 4MS8C 5AD0A 2EDTA 3QG6B 1MCCA 4Q2ZB 1OD9A 5DGRA 3P0VL 3KPRE 3TT3L 1R5VB 3GMRA 3OKNB 2GTZB 4PG9A 2P8MB 4LF3A 5D7KE 1HH9A 5FCSH 3K1DA 4V1DD 3MRPB 4DQOH 1UVQA 4M7JH 1CVSC 1GGIH 2FBOJ 4M62L 3LIZH 4PJBF 4R8WL 4DEPB 2UZIH 2YBRA 4LOUD 4X6DE 2C3XA 1ZTXH 2BNRB 1NUFA 15C8L 3V6FA 3QCVL 2QEJA 3BGFB 2QQKL 1LEKA 4ZTPL 3RI5F 4NBXB 4X4MA 3GJFK 2EDBA 5ADOL 1YJDL 1MJ7L 1MIEL 4FQQB 4PD4J 2NY3C 1T0PB 2OL3B 3GO1H 4KTEH 3EUUA 2LAGB 4FXKA 3RGVA 2W1NA 5CIPH 2Z0BA 3PABB 3GKZA 4WRLA 3O6FD 1XF2A 4LHUG 3SDXE 1YN6B 3RY5A 4HW6A 5IW6B 2B1AH 4MAYC 1EBAA 1A14L 4XP9H 4CKVX 3U36A 5FO7A 1FNHA 3RVTD 4KPHL 2DQJL 1R3JB 1GAFH 5DJYA 4X6EA 4YX2L 1U92B 4HIEB 3ZKXC 1G7HB 4W4OA 4ZFGL 3K7UA 4OCRH 3T65B 1FFOB 3ZL4H 3FAXA 3JV6B 3MLTA 2LABA 4YUEL 3H6JA 3OAUL 3D69A 5MEOB 1DL7H 3CFJA 1PDKA 4QRUA 1HK6A 1UA6H 1HDMB 1CF8L 4KUZH 4WIQA 5F9WB 1ZVSA 2HKHH 2I26N 1I8LA 5IB4B 2F74B 5EOTB 4U7MA 1YEHL 4E41E 3NVQA 5DMKA 3QT2A 4K94C 5C0GB 4PJ8B 5E4EB 1BVZA 2NY0D 1B4JL 1CR9H 4ONHA 1S7VA 3UTSA 1U3YA 4JDTH 5GGVY 2XPGA 4Z0BH 2VAAB 3CDFA 1NMCB 2GY7B 2OL3H 4D0CA 5IMOA 2VXTL 3KJ6L 5FB8A 1QSVA 1F4AA 1I9RH 4NN6B 2CGRH 4R26H 5TE7L 3JVGC 2WNGA 2IPKA 1BJ1H 5C08B 2HJFB 3QQ9D 4C83B 4DKEL 3CAFA 3UP1A 1SHMA 3UMTA 4R7NB 4PJCE 5BS0A 4XPBL 1XF4B 4HHAA 3GDBA 3I02A 5F7HA 4EIZC 4M6NH 1FZOB 1T6WA 5DRNB 3X17A 1RZFL 3U4AA 2OBGA 4JFED 1I1AC 4OCWH 4NM4H 1SBBA 3NCYS 3W11D 1ONQA 4M4RA 2Q7NA 3RUGB 2BP3A 2BDNL 3CVHB 4QRPA 1KPRA 1P84K 4JAMB 2P45B 4EUPG 4F7MB 4LPCA 4H0HB 2Y6SC 3PP3H 1U91B 4HV8B 3NTCL 5J1AB 3FONA 5H37G 3CCHB 5I0ZA 4H1LA 1CDUA 4TSBH 4KKBD 3MLUH 3TH2T 2NW3A 4DKAA 5I6XB 1HH6A 4XNYL 1A1MB 3PWPD 1NFDB 1V7MH 2Z8WC 4ODTH 3BOVA 1JGLH 1TVBB 4K8RH 4NQVA 4ZPVB 3C8KB 1UEYA 5DJ0A 1UC6A 1I9JL 1FFPB 2VZ3A 5FDWB 1A2YA 5CZXC 1RURH 2OMBA 5GSVB 1RZ8B 1T5WB 5IJVB 4KXZH 1CXIA 4AYFA 4LARL 4OZHB 4JFPB 1CZ8H 2JELH 3K8MA 5CBEB 4GUPB 4NO5B 4R4FH 1WVZA 4NRYB 3A6BH 2GSIB 4JRXA 4P9ML 4F33B 4JVWA 2BNUA 2HAZA 1OAYL 2AS5M 4FQXB 5GS0C 2NX5B 2R2BB 4FNLH 3U0PA 4L1HA 5GGUB 3RWEB 5JXED 1EMTL 3MJ9H 4BYHA 2VLJB 2ADIA 1QPXA 3CVHH 4J3XA 5F7DA 1QFWM 1BQUA 3QJHA 5D7LB 3FFDB 3P2TA 4MXVF 4V1DE 3T77A 1QLRA 4WV1B 1FE8H 4BZYA 2O93L 2KDGA 3QUMB 2QADC 1I1CA 2AV1A 4S1QH 3GRWL 1IAKB 3P0YL 3KPMB 4OLWL 3VXQA 4XX1E 4NBYB 3ULSA 4U33A 2Y36L 2EXWC 1FZJB 4HWUA 3JTTA 5DRZA 3IFOB 5E2VL 3OB0K 4U49A 4Z7WF 4DGVL 2GK2A 1CXHA 5CHNB 3BQUA 2FWOB 1B0RA 3P4LA 3L3KB 1CE1H 1IGTA 5D8JL 2N4IA 1PLGH 3BHBA 1KPVB 3MA7B 4X7TB 3H3KA 5DD5L 3ARBD 2E6JA 3QRGL 1FFNA 5DHYA 1N5AB 5D93B 1F5WA 1KTKE 2V7HB 4LHQB 3WHXB 2NW2B 2DBJA 2JB6B 3MLYH 2BVQA 3VD5A 4PRPA 3NAAH 4KMLB 4MWFA 5AG8A 5D5MA 4KZEH 3OKOB 4GAJL 3VD9A 1CLZL 4NWUH 4NQSA 1MAMH 1TQBC 1S7QB 1KLGA 5GGTH 4E42B 2DQHH 1J8HB 3TV3L 1HILB 3GKWH 4LCWB 1VFMA 4J12A 4HIIA 3QNZA 4XGZB 3KAAA 5DMYA 2BERA 3TIDA 4U1GB 4EBQL 4S1DD 4X83A 1I1RA 3UTTE 3QHTC 5JW3L 3OHXB 3QI9D 3O2VL 4HUXB 2HH0L 1E4KC 2ZSVB 4B53A 2APTA 2QKIB 4FMKA 5ALBL 4HT1H 3QUMH 3F6LA 3D5OF 5F1IB 1FH5L 1QPPA 3MLXL 4U3CA 1IGJB 3RU8L 4PRPD 3I85A 3FRUB 2V7NB 4N0YL 4BFBD 1X6LA 1UM5H 3MUY1 1OGAB 4D8PA 4G9FB 5EZLB 1A7RL 5HGBB 1MNUL 5KG9B 3UC0H 4PR5A 4HBCH 4HJJH 4GKZA 4HBQA 5C7XH 3F7VB 4LPWA 3B9DA 1QR1B 1AXTH 1R5IB 3QHZL 2F5AH 5FKPA 5EU6D 2EE6A 1LGVA 3G5XA 3VH8B 4JPVL 3RWGA 3NABL 4NKQB 3DX9A 4U1JB 1T0MB 3H0TB 3S96A 1M6OA 3TA3B 1BIIA 2LU4A 1RU9H 1S7XB 4ZO6A 5BRZA 2VXUH 2AJUL 4U1HA 4YDJB 5AEAA 4C57C 1NLDL 4KY1L 4RMUA 2LTQB 4OZFB 3L95A 3D1MC 2FJGA 5B3JF 3OKKB 1MLBB 4KKAC 5AAWA 4KI5E 3RI5K 3ILQD 4JFEE 1PYWA 4WEBL 4OCXH 4JO1L 4ODHH 1A9BB 1BOGB 5CJOL 3SDCA 3L1OH 4CMHB 1VPOL 4MNQB 5ETUA 2E7LA 4R97C 3PXJA 3TT1L 2XQBL 3O3AA 1GCFA 2CSPA 2HFEA 5HHQB 5CFHA 2VJXA 3LQZA 4FTVB 4MNGA 5IUSA 1X4XA 5GRVK 3WKML 3LDBC 3M8OL 1NDGA 4NDMA 5D2NE 4JFYB 5IOPB 1TTFA 2VE6A 3SGKA 2C7UB 4YDKH 1OSZB 4MJIA 5BRZD 4YHYB 5LAXA 1W0VA 4PJ8C 5E4EC 1AGCB 3NA9H 2BOBB 3GEWB 4HFWB 5HBBA 5C0NC 4DFHA 4ERSL 2AXGA 5LXGL 1L0XA 2OI9B 2HJKB 5T1DH 3PWPE 2GJ6B 1LK3L 1NMCC 4JDVB 4YPGA 1OP3H 4YK4B 3S98A 1PY4A 1U6AH 5EIQA 2EICA 2ADJB 1IT9H 2V5TA 5F88B 5BZWB 3D9AH 4L9DA 4K94L 3QXUA 1CLYH 3HNVL 4XH2B 2Z31D 4OZGA 4NQCB 2Y4SA 4OZFH 1J0HA 5HYJB 1T1WA 2EH8H 2R29L 1DDHB 5E7FA 4OAWA 1G0XA 1SY6H 3H9SA 1NGQL 3KYMA 3TBWA 4PJIB 3O6LL 5IMKB 4NHUA 4TUOB 4O2CA 2LV4A 1WZMA 1XIWA 3PE9A 4JFHD 3FZUC 5HDBF 3MRJB 1A6VL 3ZO0A 3VWKA 5JPMB 3NFNB 4IBLT 4F37F 5DUPL 1U8IA 4LEXL 1FSKB 1ZHBB 5J1SC 1AI1L 2AQ3A 4QRTA 2GTWA 2EH7H 5ANMB 3QUXA 4WDIA 3QPXH 1JWUB 1SMAA 1JGDB 5FYKU 5TQ2H 1BOYA 2HRLA 3CC5B 3C5JB 5JXAL 1G1YA 3TYGH 1QNZL 1I8IA 1MUJA 5BW7A 3U4EA 2J6EL 5IIEB 1XIWD 4ZOAA 5F9OL 1YNLL 1JWMA 4ZS6C 3VWKD 4B41A 3L5JA 5DD3L 4U0RB 5EWIL 4DJMA 3Q6FA 4E0RB 5TDOA 1QRKA 4RRPA 2WLZA 3T0AA 4RIRA 1LO5A 32C2B 4GRWF 3K4DA 3RGHA 2FRGP 1INEH 3GFUA 3MJ8B 5JW5A 1BFSA 3WE6B 3QZWB 2SEBB 2IQ9H 5JIHA 3UEZA 3NZHL 1AY1H 4P2CG 3EYFB 1UJ3B 4FQXC 3HNTL 4MVBD 3FFCB 3X13B 1MCPL 2GCYB