4ODHH

Crystal structure of human fab cap256-vrc26.uca, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
245
structure length
222
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDLGESENGVVGAFDIWGQGTMVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.UCA light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 222
sequence length 245
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odhH01
2EE2A 2HT4D 3U30C 4LHUD 4YHPA 2FYYA 3QUKA 4X6BB 2HN7A 4WU5A 1P7KA 2Y7QA 5D7LD 4ZTOH 3SDDD 1G7QB 5A40E 1MCDA 3BZEA 3EYVA 4RNRB 3MRGA 1VFBB 4G8GE 1JF1B 5FIEA 4ODWA 4CL7A 2FL5A 2GJZB 3T0XA 4M7ZC 4N0UA 1ZOXA 3K4AA 4NQED 3ZDYE 2O5YL 5FM8A 1RK0B 2DMKA 2HFEA 4KZEL 3MX0A 3UAJC 1A4JA 2XA8L 2LTQC 3LHPH 1PKQB 3MXWH 3V79C 2P4AB 2A0LC 1CE6A 4K7PH 4POUB 3QO1B 1FE8H 1MLCA 4KKCC 1ETZA 4TSCL 3IFNH 1FLRH 5DC0A 3G04B 4N90E 1QFPA 1SBBA 3D25A 4P4KB 4Y4HC 3V4UH 2IAMC 1UB6B 1TJIL 3BOVA 3OX8B 1EUTA 3UROR 1M71B 1MREL 1IGML 2AABH 4HS6A 3P4MA 5AAWA 1VACB 4Y2DB 4AIZB 2R69L 3MV7D 3WO4C 4LSUL 4P57A 1PVHA 4OGAC 4LLDA 1RJYA 2ENYA 3WSQL 4HUVA 4D9RE 1ORQA 4GW4A 3H9HB 3MFFB 3VWJA 1KJ2A 3V6OE 4DQOL 3CDGB 1GYAA 3RDTB 1HINH 5L88L 3U6RA 5E2TH 5HD8C 2FGWL 2C3WA 2J8UE 3U2SA 2QQNH 3BUYB 3V5HB 3KJ6H 4OD1H 4OQTA 2NXZB 3T3PF 2BVOB 4NO5A 5CGYD 1CG9B 5D7IB 5KSUB 5HGDB 1RURH 1IEBB 3UZVB 4DTGL 5TFSL 1PZUB 4D0BA 3EJYC 5K59F 5IBLC 5DURD 2NCMA 1FG9C 1YEKL 1RVFH 1FCGA 3OJ2C 3D0VB 3GJFK 3WNPA 2HVJB 5DD0L 3QXVA 1SBSL 3EOAB 1OTSD 3UJTL 5JR1L 3D9AH 2ESVA 4PRAB 1CFSA 5CJQH 4KHXL 4L8DA 1NDGB 5ANMA 3D5OF 3GGWA 1QBLL 3SBWC 2N1KA 3G6JE 1DVFA 1OGTA 2GK0B 3QHZL 1NQBA 5DRWB 4YPGB 4NGHH 1L7IL 2ICEB 1WWWX 2JB6B 2B39A 4L3AA 1FQ9C 3ZO0A 1JBJA 4YUEH 4XCCL 3VRIB 4XBPB 4JO3H 3UPRB 2ZKHH 1DLHA 4Y4FD 4LKXA 2BOCA 5DSCA 1JK8A 3C5JB 5BVPH 4R4NC 2O61B 4QLRA 2VDPH 3IKCA 2EDOA 3K74B 3MRQB 5CEYB 3SKMA 4X5XA 4PJBE 3HNTH 4LBEA 2W65A 3FRPG 1ZHNB 3B4NA 3GHBH 4NO3B 5HYQB 2E9WA 5HGAB 5BW7A 4KKLC 2PW1A 2DQJL 3DVIA 3QQNA 2UYLA 2C7UB 2OXHA 2JK5A 3ARTA 5L9DL 4S0SD 1KT2B 1Q0YL 3O2DA 2FX9H 1RIHH 4QTIL 1ADQH 1YNKH 4I77L 4JCLA 2IH3B 2P8PB 4NFCA 3ZZ1A 1QSZA 5KZCD 1NCDH 4JRXA 4FFZL 5D1QD 1ZLSH 4OF5A 1WAAF 4KROD 4UDTB 2P5EE 3VH8B 3WXVL 1EXUB 3HE7D 5IHZA 2COQA 1NC4A 1RU9L 4KKNA 5FCUH 5GIRB 3ZTJH 4LAQH 5KSBF 1HHKB 5J12B 4L4VB 3B9DA 4YDVA 2BFVH 3GNMH 3CSPA 2DB8A 3W9DB 5IF0B 3VFPA 2I9LB 4OFKA 5F8RC 3QQ4A 35C8L 3UTPE 3RNQB 4LCCA 1ZVYA 4P9HL 4FABL 5C0DB 2VLMD 2FJFA 1QFHA 5EOCH 5E8PA 3AS0A 3TZVA 3RBSA 4XGZA 5IBTH 4Z76A 1IAMA 3MLVL 4MA1B 5DJ6A 2H26A 4R4BB 3L3OA 2JJTC 4K3GA 2WUCL 4B7IA 3BH8A 1OGAB 1W0WA 4Q9BA 3A6BL 5CGTA 3GI8H 3IDNA 4OUUA 1UZ8A 1KN2L 4BZ1L 3IJSB 3QI9A 2Q6WB 4D3CL 4JM2D 3L3DA 3QUMA 4JVPA 4LSRH 4RIRB 3DMMD 1KIRA 5BVJB 5DK0A 4Q2ZA 4JLRB 3QUZB 3WJLC 3Q48A 3QEQE 5DD1H 1DANT 3WIFA 2Z35B 2FIKA 1K5NB 4KK9C 1KYOJ 1MCRA 2A2QT 3ARBA 4DJMA 1VGKA 3MJ8A 3RVVC 3SJVA 1CFVL 2P8LA 4JO4L 1GXEA 1QLEL 4YWGL 2Q8BH 3IGAB 3IVKB 5ISZE 3ULVE 2VXVL 4NQCD 4PJHA 2F58L 2ZP0T 5FYJD 1LQSR 4PJFB 3N9GH 1BLNB 5TH2B 2WZPD 3A67H 1N7MH 4NSKA 3TH3T 2BY1A 5E9DA 5CMAB 3LKPA 1A47A 2XQBL 3LEYH 3QFJB 4X4XA 2C3GA 5ILTL 2VABB 5GGUA 4OFIA 3UTSB 2FJGB 4R2GB 3CLEH 2YPKB 3ZE2F 1KJ3H 1LHZA 3FOMA 1VDGA 4X6CE 5IVNA 4OV6F 2ICWI 4HWBL 3DURA 2EKSB 3QA3B 2D0HA 3S7GA 5BV7B 3HG1E 3ULUC 1PGRB 4OKDA 3HZVB 1X7QA 3MRPB 1P2CA 1D9KD 1FC2D 5DHYB 2R1WB 5GRXG 5EU6D 1H3VA 5DJDB 3F7VB 1Y0LB 3ARFD 2V7HA 2BOBB 3T2OA 1BP3B 3MRHA 1JWSA 1U3JA 1ZT1B 4PJIB 4XP4L 4M03A 2YKLH 3T0AA 5DXWA 5J3HC 4QRQA 5DD6B 3VXTB 3VI4F 4GRLD 3DXAD 4NIKB 4H1LH 4CDHA 4MDIA 4RAVB 3NGBC 3DYOA 2VDLL 4GAGH 1FL3B 2BC4B 4M3JA 3V8CA 4TUJA 3BEVA 1B4JL 2QQQA 1WWBX 1KN4H 1YDPA 4JY6B 5F9AC 5JMOC 3VFSB 2HVKB 5CEZL 2GJ6A 1NSNH 1F4AA 1TZGL 4PRIA 4CN1A 1HHGB 5E08L 2CQVA 1U2CA 3NCJL 3OPZH 2ADGA 1CL7L 2E6PA 1C5CL 3B6SB 1MCKA 2GK2A 4YE4L 3W0WA 1QBML 4PJ5D 3OKDA 1UYWL 4JFZH 4ENEC 4OCRH 2D7OA 4PUBH 1MCOH 4X98A 5FKPB 4H8WC 4L3CB 3E1F1 5JA8B 4X7EC 4X5LA 4QRSA 4HQQH 4JJHA 4YHIB 2ZCHL 2D7NA 1OP3H 3C60A 4AG4L 5I1EL 1QSED 3X3GL 1KTLB 4HC1L 1B0GB 2PYFB 1J0IA 5F6IC 5LGHL 1FYTE 1BZ7A 3ZDXF 3MNVB 4K94H 5IVXA 3B9KD 2VDRL 4Q58C 2X89A 4KC3B 4F7TB 1S7XB 4JFHE 1G9ML 4MS8C 4QT5B 1JWUA 4JM4L 2AW2A 4B5EA 1F13A 3D85B 3OAYH 4XP9H 3V6ZA 3U0TA 2LE9A 3DX9A 3DIFB 4LSQL 3QEUB 3O6FA 1FFOB 2C1PB 1I8MA 2ITCA 5T3XD 5H35B 5J56B 1IGCL 3E6HB 25C8H 2F19L 1AXTH 1LP9E 1AQKH 1OB1B 4NO0D 5EU4A 5EU5A 4MSWB 3D3VA 3S4SA 1W72H 5F7MC 3GBNH 1X5FA 3KPPB 4M6ML 2AVGA 5I15H 3IDMA 5C0ND 1BQUA 5DQJB 4Y88A 4YXLL 2GY5A 3RY4A 4XHJC 4TVSa 1ZMYA 4PY8I 4W81A 4X6BA 1ZLUH 3T0EB 2K3TA 1SYSB 1U8PB 1G7QA 5JHDE 4D9LH 4Z7VB 3VFGL 1OW0C 1VFBA 1JF1A 3NIFF 2PR4L 4PJHF 4PJEF 2GJZA 3VXSD 1YMME 2DAVA 1WWAX 1E4KC 2I24N 1RK0A 1U58A 4S1SL 4MAUH 5D71H 5IB2B 1PKQA 2B1AH 4ODUB 1BFOB 1U3HB 5SWSD 4KUCF 2O93L 3X11B 4QRRE 3GMPB 3NCFB 1MNUL 1WEJH 3QO1A 4AT6B 3WFBL 2OL3H 3HC3H 4S1RL 5FGCE 3G04A 3NACH 1BVLB 1Q9WB 2VLJE 5IBUB 2VZOA 3RIAK 2HLFC 4P4KA 1SJVA 3HFMH 1UEMA 1UB6A 2OM5A 2DQGH 4RGNC 4UB0L 1M71A 5IROC 1VACA 4Y2DA 1M1SA 4XCNB 4WFGD 4M7KL 4F7EB 2BNRB 2OP4H 2X41A 3H9HA 3MFFA 3SGKA 3CDGA 1G84A 4OZGF 2PO6B 4DGYH 4G7VH 3RY5A 3BUYA 3V5HA 4NWTL 2V2TB 3PP4L 2BVOA 1CG9A 5D7IA 5KSUA 1F11B 3QWQB 5HGDA 1XEDA 3PWLB 1IEBA 4IDLA 3ZKXC 3FQUB 1TETL 2WW8A 4N9OB 4OGYH 3FQNB 4GRMB 4PJAE 4JO1L 2NY6B 5HDBF 4NHUA 1XH3B 4I3SL 4KTDH 3D0VA 4GRWH 2J8HA 2HVJA 3EOAA 4ACPA 4PRAA 5HVGB 1FCCA 4Z9KB 1NDGA 3IT8D 3CK0H 5B3JF 4GKOA 4R97B 1EVTC 2B4CL 2GK0A 3MCG1 5AEAA 5I76B 5DRWA 1ZHKB 4YPGA 1GAFL 3HI1B 1JZ5A 3TJHD 1CR9H 1T2JA 2ICEA 2JB6A 3VFUB 4Q9QL 4U6YB 5DK2B 5I1HH 3MGOB 1JGUH 5LWYH 2FJHB 3VRIA 4XBPA 3UPRA 1EHXA 3KJ4C 3FN0H 2Z8RA 1MCJA 3FQRB 5D8JH 5CSZB 4D8PB 2FB4L 1NCCL 1QACA 2QHLA 3C5JA 2HT2D 4P2QE 2O61A 3ARGC 1CXKA 12E8H 2CXGA 1JI2A 4LRNL 4OF0A 1JHKH 2Q3AA 3UJIL 4G9FD 4CVWA 1CU4H 1QEWB 4CU7A 4AIOA 1RJZB 3MRQA 2KDGA 5CEYA 3SGJA 5KVFH 5EO1B 3D2UD 3OAZH 3UC0L 3ARUA 4EIGB 2HFFB 1ZHNA 3L3KB 3ESVF 2DJSA 5EDXA 1D6VL 4NO3A 5HYQA 3GBML 4MJ5A 4P2OB 5CZKA 2BZDA 5HGAA 2GUOB 5EZOH 3TCLB 5HHPB 3S98A 2C7UA 1M6OB 4Z7NF 5HHME 4EI5C 4J8RA 4HS8L 1ODAA 2OXGA 1KT2A 2X10A 1CI5A 4HUKB 1OSZB 1UXSA 2IH3A 1PSKL 5DMIH 3A6CH 3S5LG 4IRSD 4U0QB 3RTQD 5J12C 3V6OC 5D7LE 5E7BA 1YECH 1CVRA 4U6XB 4DFIA 2ZG2A 1KTDB 4UDTA 3VH8A 5LJYH 1MCFA 5GIRA 2DDQH 1NEZG 1JFQH 1IVLA 1F4XL 1PAMA 1F97A 1HHKA 4XC3L 1LO3H 5DFVC 4L4VA 4NQEE 1YEDB 3B83A 5AYUH 5FM5O 4LSSH 4KJWC 1MWAL 4V2BA 3W9DA 4ODVH 2X40A 1JNLL 5GSRB 2I9LA 5IF0A 3WKML 4GKZB 4TSBH 3RNQA 4P3CH 5CGMA 5JPNB 1DQLL 5C0DA 4OLYL 4LSTH 4NFBA 2VDKL 4JQVA 3WNLA 4HFWB 3SEPA 2APFA 5ESAB 1MFBH 1FGNH 4BFGA 3NPSC 3BRDA 4R4BA 3D39D 5F1IB 1A8JH 1Z5LB 3QIBB 1II4E 3I50L 4DW2H 4QYOB 4CGTA 1OGAA 3MV7E 1JYNA 5JW4M 1PEWA 5CZVL 4U2ZA 3KYNA 3NPZB 1VHPA 4X5WB 3P9WB 1CDYA 3U7YL 3QUZC 2Q6WA 5IWLC 1KC5H 1KCSH 4QRPB 4RIRA 5BCAA 3GSNB 5T3ZL 5BVJA 3FKUS 2VKXA 4JLRA 5KVGH 4YFEA 2J6EH 2Z35A 1K5NA 1TQBB 4KRPC 1J1OL 2C3VB 3BRGC 1NGPL 1WJ3A 4NYLA 3EIFA 4L1DA 3IAGC 5FO8B 4MB4A 4W6WB 4XPHL 5GGRY 5D7SH 1RZFH 5B39G 4PG9B 3IGAA 3IVKA 1RUMH 3P40A 1J18A 3T0VA 1YEIH 3REVB 3B9EA 3JWDL 2GITB 3I85A 4U7KA 4UTBH 1FDLH 5E6YA 3MUHL 4PJFA 4CBPA 4TTDC 1BLNA 5TH2A 1RI8A 5GGVH 3L5XH 5T3XH 1CDJA 4NQDD 2YD1A 1NBVH 5CMAA 4I8DA 4WGWB 4ZAKB 3DYMA 3RJDA 4KH2A 3QFJA 1UT9A 3BKYL 5DEZA 2FX7H 2VABA 4R7DA 4U4BA 3UTSA 2FJGA 2F54B 4ONGH 4GAYB 3WEXB 2XNAB 1MI5D 2YPKA 4G6KL 5BV7C 3C5ZB 5C0AD 1ZK9A 3IFPB 1CYGA 4AMKH 2EKSA 3QA3A 1RZ7H 1T3FB 3HZVA 3MRPA 4M4RA 3AB0C 5DHYA 2R1WA 1UEYA 3VE0B 4IRZH 5I75B 5DJDA 4W6XB 3WUWB 3F7VA 2RAMA 1Y0LA 2G2RB 2HFGL 2BOBA 5JW4N 4PD4K 4C4KO 2GFBB 4KY1H 1ZT1A 4PJIA 4WJ5B 1HN1A 4JQXA 1NANI 1BAFH 3LPFA 1NMCB 4PBWD 5DD6A 3VXTA 3TH2T 4RFOH 1NUGA 4JKWA 3RVTC 4RAVA 4KK5C 4PJDE 3OKMB 2BC4A 3KYMA 4MAYB 1I7RB 2R4RL 3MLUL 1R3LA 2LV4A 3PGDA 4E0RA 1B6UA 3RI5K 4UDUB 4JY6A 2E9BA 3VFSA 2HVKA 3VGBA 2ITDB 4X7SL 5TE7L 3KNBB 2BDNL 2OK0L 3BP7B 1GCFA 2IALB 1A14L 1HHGA 4AENB 4NZRL 2JIXB 8FABB 2V9RA 3UBXG 3CMGA 1NFDE 5I74C 3VD5A 3B6SA 4WDIB 2KZWA 1KXTB 4X83A 3QIUA 5B21A 2O5YH 4WFED 4KZEH 2X4OB 4KFZC 2XA8H 1MVFA 5FKPA 4OD2B 3FCTB 4KV5E 3LQZB 4HULB 2VLME 4YHIA 1JNJA 4TSCH 5FUCE 4NN5C 5HGGS 1UH2A 1T2QL 4B41A 1EGJL 4P49A 5H37G 1A2YA 1LDPL 5HI5D 4RRPG 1KTLA 5FGBA 5F6HI 3MQIA 1B0GA 1TJIH 2PYFA 5I9QB 2R2BA 3WDHA 4E41D 1MUJB 1MREH 1IGMH 3CXHK 3MNVA 1DE4B 3MRFB 3K8LA 2R69H 3ESUF 4F7TA 2BCKB 1S7XA 4LSUH 5GS0C 2ICWA 2J88L 4LLVB 5IB5B 4TN9A 5GZOC 2QADC 4JFEB 3WSQH 4QT5A 1UH3A 2RFXA 4JFYB 4KK8D 4GRWE 4P5TB 1EO5A 3D85A 3QIWB 4DQOH 5L88H 3F12B 3DIFA 2FGWH 3QEUA 5C09A 1FFOA 2OTWB 5JMRA 2C1PA 1DQJB 1T03L 5H35A 1QBBA 4TPRL 3OAUL 3E6HA 2NY0D 4EVNB 4I1NB 4D0CB 4K8RC 3EKCA 3KHQA 4G7YL 2VIRB 1G7LB 3O9WD 1HYSC 3JWNC 4N5UA 1OB1A 4DTGH 5TFSH 4MSWA 4IMKC 1I85C 3OGCB 4R0LB 3KPPA 3UDWC 4LCWD 1WBZB 1EIBA 3HUJE 5DQJA 1KLFA 1WFNA 1U42A 4NQCE 3F5WB 1YEKH 3ZT6A 4DCQB 1RHFA 3TVMB 4ODSL 3T0EA 1FAKT 2EXWC 1SYSA 5DD0H 5GS2D 1SBSH 5JR1H 4Z7VA 3UJTH 2Q8AL 3K0WA 4L9LB 4KHXH 4I9WD 3RY6C 1WIOA 3N1FC 1QBLH 2ZOKB 2W07A 1WZLA 3QHZH 2HMIC 1CXIA 5IB2A 4ODUA 1BFOA 1U3HA 3X11A 3AREB 3GMPA 4AT6A 1L7IH 4KUZL 3OJDB 5BRZB 1C5BL 1K4CB 4UV4L 1BVLA 1Q9WA 3JBG7 1TCRB 2ADFL 4K9EL 4OIIL 3LOWA 4TNWF 1LMKA 3FO2B 4FQQB 5EU7E 5EU6E 3P4LA 3IXAB 4XCNA 4F7EA 3AMLA 2DN7A 2VLRA 4L8CB 2QR0B 5JLZB 2BNRA 3EDEA 3MLTA 4ORZC 4OZIB 2YUXA 1MEXL 5A1AA 3DXAE 1Z2KA 2DQJH 3MODL 1JZ8A 2Z31D 1P9MC 1KF9B 3QO0B 4NWUL 2V2TA 3VW3L 5L9DH 2VXUL 1Q0YH 1F11A 4I5BB 4QTIH 4I77H 2NLJB 4N68A 2AEQL 3FQUA 3QAZB 3FQNA 4FFZH 1FPTL 4GRMA 3MC0A 4LDOB 2AJYL 4PJ9D 1QG3A 5LQBL 1P84K 2OR9L 3WXVH 1CGTA 3IU3B 1RU9H 1XH3A 3MUJA 4P46B 1DBJL 1FZKB 4NPYB 3FZUC 4ZG1A 3GIVB 4JY5L 3CIQA 3NMEA 1KV3A 3GSQB 3HC0B 2WBJD 4ZS6D 4BQBA 2A9NL 35C8H 3GJFB 1N5AB 4P9HH 2J4WL 4FABH 3LKOB 5I76A 4FMKA 1ZHKA 5JDSB 5KSVA 3HI1A 4AL8L 1U8NB 3VFUA 4MA7L 1QSEE 4OF3A 3VXMA 4RSVA 4U6YA 5DK2A 1A6AB 5FA4B 3MGOA 3ARWA 3MLVH 2FJHA 1X5KA 1S3KL 5F70A 1C7SA 4FHBD 5HYJB 2WUCH 3FQRA 1UWGL 5CSZA 4D8PA 4GG8B 3MBEC 1B4RA 5GRVL 3A6BH 3LS4L 1KN2H 4MD0B 1QEWA 4BZ1H 4D3CH 4OLUL 1RJZA 2D31B 2HTKC 5EO1A 5I8KL 3VFTB 1CGXA 3DPBA 2HFFA 3L3KA 3T3PE 4HUXA 5T3XE 5DLMH 2GUOA 2YUZA 3TCLA 2EE9A 5HHPA 1XIWD 4NBYB 2PYEB 1M6OA 4LPWA 5KSAD 3S35L 1HE7A 1JZ6A 4UAOB 3WFHB 5BXFB 4ZNCD 2I5YL 4MNGB 5A2KH 3UX9B 1CFVH 3E2HB 4ZO7A 4JO4H 1QLEH 3WHE0 4YWGH 1OSZA 2HH0L 4F3FB 2VXVH 2XTJE 4O2EB 4Z7UB 2F58H 1LD9A 1KTDA 1CQYA 3DV6B 5CILL 3EHBD 4GXUM 2X4RB 3TBSB 4FQIL 3VXSE 2CLVB 3OAYK 2H2SC 3K4DA 4Y8AA 1TZHB 1YEDA 1GL4B 1YJDC 4Z7VF 2XQBH 1UWXH 3V6FB 5IFAL 2C3XA 2CIIB 5ILTH 4TNVK 1T66D 1FVCB 1NAKL 2ARJQ 4GKZA 3WNKA 2ED9A 5GQBA 5JPNA 3QJFB 1MJUL 4G5ZL 2MKWA 3UZEA 3B5GA 4ZSOE 3O3AB 4HFWA 4HWBH 5CJOL 5ESAA 5LKNA 3OB8A 2AAVA 1J0JA 2EE6A 2ZG1A 4G8EB 5AZ2L 3MV11 4WI8A 3UXFA 5DMYA 5DC9B 4V1DB 1Z5LA 1G7IB 3DLQR 3QIBA 5F1IA 1ZLUK 2CJUL 4WFGE 5JXAL 4QYOA 1TVBA 5IJKA 4X5WA 4JRYD 4EIZC 1X5IA 4FS0A 1R3HB 1IARB 4P23C 4XHQA 4I18B 4XP4H 5D70L 5HI3C 2E7LA 1CGYA 1CF8L 2J5LC 3BJLA 4QRPA 3GSNA 5E1HB 4YXKL 3K8MA 2VDLH 1T1ZB 3ZYOA 4A6YL 1B4JH 2EH8L 1FBIL 2R1XB 1EO7A 1WAAE 1FFNB 5DQDL 1W0YT 4KVCL 3VFVB 5FO8A 4XVJL 4J4PA 5CEZH 3H3PL 4PG9A 5KSBE 1TZGH 3REVA 3RWIB 2GITA 3SDCC 5E08H 3NCJH 1CL7H 4N8VB 1C5CH 4GXUN 3O2WL 4I0PD 4YE4H 1QBMH 1VEOA 5JXEC 4LHUG 3SDXE 4M7JL 4MQ7B 3R1GL 2M2DA 2DI7A 5EZIL 3AM8A 1PX4A 1UJ3B 2IBBA 3MJ9A 1HDMB 2ZCHH 1ZT4B 2UVEA 1NJ9B 5JA9A 2F54A 4OFYD 4GAYA 2PETA 3WEXA 2XNAA 4AG4H 5DJ0B 1AH1A 5I1EH 3TWCL 3MRBA 3X3GH 2G60L 3IFPA 4HC1H 5ACMA 5LGHH 1F2QA 4GW1B 1WC7B 3BGAA 2VDRH 1DBML 2EDHA 2MQCA 3B9VA 3ME0A 3VE0A 4EUPH 1KB5L 1G9MH 4G9FE 3GI9L 3WUWA 3LB6D 2NZIA 2G2RA 1REIA 4HJJL 1QSFD 2GFBA 4JM4H 2ERJB 1BJ1H 4WJ5A 4LPVA 3THML 4M7LL 1NMAL 4LSQH 3CZFB 5JOPD 1YPZB 2NY7L 4C56B 1IGCH 1N3NB 2EDLA 4U1GC 2XICA 4ZXBB 2F19H 5ECJE 5BMFL 3SCMB 3OKMA 4MAYA 1I3UA 1I7RA 5BS0D 3FB7B 4WI2A 4HMDA 4M6MH 3V7AE 4O2CB 1YYML 4YBLB 4UDUA 4YXLH 3GSOB 4U1MB 3VXUD 4P2YA 2ITDA 4RX4D 4LRIA 3UTTB 3KNBA 2GHWB 3BP7A 3DVNA 2IALA 2ZUSA 3QHFL 3VMPA 2R15A 4LP5A 3KPLB 4AENA 2JIXA 3VFGH 2NY5C 8FABA 4CJ1A 1KACB 4P59L 2PR4H 3KPRD 3OAZK 1JL8A 4WDIA 1FSKC 2HKHL 4O58L 1BFVL 4S1SH 2X4OA 4YK4C 3ZE2E 4OD2A 1G0YR 3BPNC 3FCTA 3LQZA 3WFBH 3RWHB 1T20B 4S1RH 4XTRD 5DD3L 5JDJA 2MQ0A 1ZGLB 1CGVA 4IJ3C 1C16B 1CDCA 3MCLL 4HCRL 4UB0H 1MUJA 3OHXB 1DE4A 4ZMAT 3FHAA 5DMGD 1QR1B 4XAWL 5HXMA 5KAQG 4M7KH 5F7EL 2BCKA 4Y5XB 4KTEL 2NY3B 4LLVA 5IB5A 5D96C 3VI4E 2V5MA 2SEBA 4MA3B 3O4LB 4D0DB 2F53D 3QIWA 4F7PA 5EUOE 3TA3B 3F12A 3CNKA 2DLIA 2OTWA 1DQJA 1JGEB 4Y4FC 1T5XA 4N0RA 4NWTH 1SY6A 4LASH 3PP4H 3VWKD 4EVNA 2DLEA 3QPQD 2M1KA 4D0CA 4DVBB 4FTVD 1P4LB 2VIRA 5J13C 3LD8B 3IFOB 3P4OA 1JF6A 1TETH 3OGCA 4R0LA 4CAGA 2R0WL 3GJEB 3WIHL 1WBZA 3RL1B 4JG0L 4JO1H 3WHE1 2I9TB 1Q8MA 1SEQL 3F5WA 4WTZG 2UZYB 4DCQA 4I3SH 3TVMA 1J0KA 5EBMB 1SYVB 4HIJB 4CDGC 1CDBA 1BPVA 3W9EB 1ZEAL 4NQDE 4RDQG 4NZJA 1AKJB 2A83B 4BELD 2Q76B 2ZUTA 5ELIA 4CW1B 2B4CH 3ROOA 5JIIA 4M7LT 5D1QC 1MCWW 5H2BB 3AREA 1MI5E 1E4WL 3AS3A 3KLSA 4Q9QH 5C0AE 4DUWA 4KROC 5T1KD 3PQYD 2LABA 3HE7C 2OS7A 3OJDA 5BRZA 4JHZA 1Q1JL 3ZDXE 1K4CA 1F5WA 1QYGL 4ZFOL 4HK0B 3GMOA 3WIIL 1TCRA 1DANU 2FB4H 1NCCH 3HE6C 1F3DH 1DQML 4FFVD 3FO2A 3ORJA 4FQQA 2A74B 1U8IB 4LRNH 3F6LA 1Q9LB 1IZJA 5CKGA 3UJIH 3IXAA 3VD9A 1MFDL 4L8CA 1P69B 2QR0A 3MRJB 4HJ0D 5JLZA 1RV6X 4BFEA 5FUCC 3UC0H 4XXCC 4KQ4L 5L2JB 4OZIA 4KJYB 2ZNWA 1O0VA 1WICA 1D6VH 1CGSL 3GBMH 5KS9F 4PJBB 4QGYA 5D1XC 5HI4D 43CAB 1JRHI 3QO0A 2Q7YA 3UBXI 4L3EE 4HS8H 3F7YB 4DEPC 2YD8A 1I1AD 2D9CA 4I5BA 2NLJA 1OM3L 1PSKH 2R2HB 3SN6N 4JHBA 4JM2C 4UOW1 3DMMC 4N5ED 5DUML 2EC9T 3O8XD 4MXQD 3K80A 4PJEE 3IU3A 1UZ6F 3GSWB 4P46A 1FZKA 1F4XH 4FQXC 4NPYA 2P5EB 2GIYA 1QQDB 4XC3H 3GIVA 4H26B 2IJ0C 1JMZA 1LWRA 3GSQA 3HC0A 5T1DL 2IEPA 1MWAH 1PG7X 4P9ML 1JNLH 3WKMH 3BQUD 3GJFA 1N5AA 1DQLH 1OT1A 3LKOA 3ALPA 4OLYH 1L7TL 5JDSA 2VDKH 4M00A 1U8NA 4APQC 2VDOL 5FA4A 1A1NB 1A6AA 3TO4C 4U7SA 1ACZA 1KIUA 1TJHL 3BFOA 5ICYB 4NO2B 2BSSB 2VITB 3I50H 4GG8A 4G9DB 4ISVB 5CZVH 3NCCB 1NGYB 2XN9E 3U7YH 1VFUA 4MD0A 4X0KB 4EDWL 5I66B 5I1IL 2D31A 3LRGA 3ULUL 3EO0B 3VFTA 4HKBB 1QUNA 5DVMA 5T3ZH 4NQVB 1D9KC 2PYEA 1K3IA 3QULB 1J1OH 1CE1L 5D7KD 3WFHA 1NGPH 5BXFA 5HDBE 1NC2B 4MNGA 3ZDZE 1G6RB 2CMRL 4XPHH 1URLA 3QWOB 4U1LB 1EDQA 3EUUA 1YZZA 4F3FA 3JWDH 2YXFA 5D9SB 4O2EA 4GJTB 4XNZB 4XT1C 4GRLC 4Z7UA 1X5JA 1KULA 1VEPA 1DEDA 5ISZB 4FQCL 3DV6A 3QDMD 2ZOLB 2UV3A 2JCCB 5C3TA 3GDBA 4I9WE 2X4RA 3TBSA 1WTGT 2CLVA 2HRPL 5E4EB 2BY0A 2YPLD 3IDJB 3OKLB 4L4JA 1TZHA 3RIFK 3V6FA 2H9GB 4IIQB 3BP4B 3BKYH 2CIIA 2PXYD 1FVCA 4GMSL 5GPRA 1JGVL 2YA2A 3QJFA 1UADC 4G6KH 1BQSA 4OJFL 5D2NC 5IIEB 3O3AA 5I18L 2YC1A 2YA1A 4H8WL 5EWIL 4AEIL 2R39A 3DI3B 3OGOE 1NGXB 1INEL 1EFQA 4G8EA 4V1DA 1G7IA 4P0DA 4OGZA 3HG1B 2HFGH 1WK0A 5E1AB 3L95B 4LLUB 1F3JB 1EO8L 2CLZB 3VFRB 3TBTB 1R3HA 1JPGB 4I18A 4JFDE 4JREC 4GAJL 3W11D 1BFSA 1NL0L 5EA0L 3ALWA 4MD5B 4NKQB 3O3DB 2ATPB 3EO1B 2R4RH 1IGFL 4GG6E 3KG5A 3MLUH 4BQCA 4M9PA 2R1XA 4ZPTB 1Z0NA 1FFNA 4BZYA 3VFVA 3TYGL 4O00A 4X7SH 5TE7H 2BDNH 1AP2B 5GRZA 2OK0H 3AAZB 3WNNA 1A14H 3TFKD 1T83C 3HRZA 3FT4B 3QXWA 1HQRB 4NZRH 3RWIA 3DO7B 4A2MA 3IDGA 5KW9L 3SQBA 4N8VA 1GVIA 2XFXB 1MJ7L 1M7DB 3T0WA 1P5VA 3BZDA 4GS7B 3BPLC 4MQ7A 4GBXB 4C54A 3STLB 1IKNA 5C0NC 2AXFB 4MB5A 4FQ2L 2BHYA 1HDMA 3C8DA 1ZT4A 2BVTA 1T2QH 4F7MB 3ULUF 1EGJH 5DJ0A 4GQ9L 1LDPH 3WYRA 3X17A 2C1OB 2Y5EA 4YHKL 1BBDL 1F8TL 3WS6C 4QCIB 2EZ0D 4GW1A 4FFWC 4WFFE 4W4OC 1I9EA 4NQTA 1OTUD 1A1MB 2J88H 2DKMA 1D3CA 1MFNA 1SM3L 4LLWB 2IWGA 3F58L 1R5VB 1IC4L 3FO0L 5A16B 5F9DC 3MXVL 1U8HB 4S10A 3CZFA 2XWJB 2DL2A 2EDBA 5HHOD 4C56A 1RJLB 4TPRH 4TVPD 5TDNB 1T03H 1N3NA 3OAUH 4BK4A 4ZXBA 2AV1B 4HIEB 1AO7E 1MCQA 3H7BB 4ZOAA 3Q1SL 1RZJC 3AUVA 3SCMA 4G7YH 1ROWA 4W68A 3U0PB 3FB7A 3GMMB 3T0BA 4X99B 3CJJA 1LP9B 3SE8L 3C6LB 2PF6A 4H0GA 5I1KL 3GSOA 3ECBB 4U1MA 3LVEA 3UTTA 4Q6IC 4ZYKB 4U0RB 5EOTB 4WWKB 4ODSH 2MJWA 3L7EB 3LEVL 5D5MF 1WV7T 2Q8AH 3AVEA 1ZLVH 1TTUA 1M7XA 1ZA3B 1FH5L 4G8GA 5C6TL 4YHLL 1KPRB 4Y4HD 1I8LA 5INCB 3R8QA 5C0FB 1YMMB 1T7ZA 4KMTH 4HSQA 4U05A 2Y06L 1WITA 4KUZH 4XB8A 1T20A 1C5BH 3TIEB 4UV4H 3FN9A 4OCLC 2Q3ZA 1GZPB 5DJ8B 1A6VL 1DL7L 1ZGLA 5E95B 2ADFH 5FGCB 2BJML 4K9EH 1C16A 5D93B 3DOSA 2VLJB 2F74B 3OHXA 4PJXE 2XKSA 1AFVL 1QR1A 3VGAB 5K9OB 1V3JA 2UWEE 3LY6A 4MQTB 4JRYE 2OSLB 4Y5XA 1N0XL 4LGRB 4LQ1A 1EUUA 4IDJL 4MA3A 3O4LA 1MEXH 1UWXK 4D0DA 2AJXL 1QA9B 5C08D 3TA3A 3MODH 5J0BA 5IBLD 1JGEA 3V6OA 3ZLQC 1R5IB 2ZCLL 4NWUH 3VW3H 4POYA 2ESVD 2HT2C 2BK8A 2VXUH 2J8UA 4DVBA 1CTNA 2JLLA 5C0GB 1RMFL 4YC2C 4JB9L 3IFOA 4LVOC 2AEQH 5CINL 1FPTH 3GJEA 2AEPL 2AJYH 3RL1A 5LQBH 2I9TA 2DLGA 2OR9H 4PLNC 1T4KA 4PJAB 1DBJH 4Q0XL 1SYVA 5EBMA 4HXBH 4F9PA 4HIJA 1C1EL 5J4MA 3V7AG 4JY5H 3TNMB 3W9EA 3UYPA 1AKJA 2A83A 1VFOA 2Q76A 2NMSA 2E3VA 3BPOB 4PJGF 5I30L 3CFKA 3MLWL 2A9NH 4CW1A 2J4WH 4LKCB 4IRSC 4R4ND 3RTQC 5H2BA 3G6JA 4AL8H 3GHEL 1AHWB 4MA7H 1PFCA 1FYHB 2XACC 4XRCB 3QDJE 4HK0A 1S3KH 2APVA 3IYLW 1UWGH 2LU3A 3MYZA 4C83B 2A74A 1U8IA 1OAYL 4KKLD 1NCAL 1Q9LA 1SEBB 3LS4H 3G5XB 4QOKE 4BFIB 1QSFE 2F5BL 4P2QB 4OLUH 3MRJA 5I8KH 4XXDA 5IR1B 5L2JA 4K07A 4KJYA 5JOPE 3DX7B 2VC2L 4M93B 1T04B 2C4XA 1NC4D 4HS3B 3ZE0E 4PJBA 3SE4C 4ZQKB 1HIML 43CAA 3S35H 5BS0E 2P7TB 2I5YH 3F7YA 5HHMB 2E7BA 4OLVL 4RFEA 5J1AB 2CRZA 2MTPA 3FTGB 4O2FB 2R2HA 3VXUE 2HH0H 4M48L 4AEHL 3IAPA 4NKIL 4LHUB 3TZVD 5CILH 3GSWA 4JHAL 3SDDB 4FQIH 1XT5A 1YQ2A 2P5EA 1UJTA 1QQDA 3I75B 3JTTB 4H26A 3U9PL 5CJXA 3VA2C 5IFAH 1IRAY 3QCVL 1JF5A 3W82A 4MZ3A 2Y9RT 4JHWL 1NAKH 4NQEB 2DLFL 1TPXB 1EBPA 2DMCA 1NDMB 4Y16C 1MJUH 3QI9D 4G5ZH 4EN3C 5C2BL 4XAKD 3ZDYF 3EDKA 2QKIB 5CJOH 1A1NA 3DUSB 4H1LB 4C55A 5E5MB 4OUOA 4NO2A 4NC1E 2BSSA 3PHQB 5AZ2H 5LAXB 5IHUL 2VITA 4KGJA 4KJPC 2EYTB 4OLEA 2CJUH 3RU8L 5JXAH 2UUDH 4M02A 4G9DA 1NAML 7FABL 4ISVA 2FBJL 3SJVD 5D70H 1NGYA 4Y4KB 5GJTL 4X0KA 1AD9B 5AWNL 1NPUA 2OR7A 2F53E 5I66A 1CF8H 3RZCC 4OSUL 1DFBL 3EO0A 1KENL 4IS6B 4CNIB 3BKML 3WLWD 4WEBL 3BMVA 4YXKH 4NQVA 4L4TE 4FTVE 4A6YH 4PGJA 4JO2L 3QULA 5E9DD 2EH8H 2B7DT 4J2XA 1FBIH 5MEND 1NC2A 5DQDH 4KVCH 1G6RA 3DRQB 3MZTA 4XVJH 1S7RB 2J8UF 4R96B 4U1LA 3TP4A 3H3PH 4U6HB 5D9SA 2RBLA 1TTFA 3DUHA 1OD9A 1OHQA 1OWWA 3I6KB 5ISZA 1RZIB 2ZOLA 1A7QL 3O2WH 2JCCA 3VGEA 3I9GL 2BXZA 4GOSA 4M7JH 4OQ1A 1ED3B 3IDJA 1MAJA 3OKLA 3R1GH 1KCKA 1R6VA 2H9GA 3N0PB 5DJXB 3CSGA 2P46B 5EZIH 5HHXL 4IIQA 3BP4A 1O5DT 4QKXB 2VOTA 4NM8L 4RRPA 4Q9RL 4LDEB 2A6KB 3GMQB 4FNLL 3PQYE 2A6JB 3TWCH 1EVUA 5DYOB 2G60H 4HJGB 4ONHB 1JRHL 1A6UH 3G6JF 1QTYT 1BREA 4KGLA 4X6CA 1XR8B 1DBMH 1NGXA 1BOGB 4RWYL 5L0QC 3JV5A 2R29L 1KB5H 3GI9H 3HG1A 4QXTB 5E1AA 1LE9B 4HJJH 4LLUA 1F3JA 1D5IL 2CLZA 1KIPB 2NXYC 3TBTA 3VFRA 4CU6A 4WEMB 1JPGA 2GJ6D 4WW2C 3THMH 3NTCL 4UTAL 1NMAH 5HI5C 4PRID 4UOJA 4Z7QE 2NY7H 3PL6B 1KBGL 1WQVT 1K9TA 2FEEL 5BMFH 4MD5A 5FHAL 3KAAA 3W0WD 3HCVB 2YK1L 4Z7OE 3O3DA 2ATPA 3EO1A 4PJBF 1B0WA 1T21B 4MX7B 1G7MB 4PR5A 1YYMH 4ZPTA 5EN2B 5L8KB 1LO2L 5K33A 2XZZA 5HGHB 4ENED 1QD0A 2OL3B 1AP2A 3IJYB 3AAZA 3QHFH 4NQSA 3DO7A 1HQRA 3QNYB 2J3SA 2X1OA 4P59H 2DOCA 3U36B 2XFXA 1M7DA 2BY3A 3O4OC 5IV2B 2N56A 2OR8A 4WO4B 4CMHC 8CGTA 3O9WC 4WFHD 2HKHH 4O58H 2X89D 1BFVH 5F97E 3RWCB 2Q20A 3C09C 4GBXA 1SHMA 4KVNL 4NN7C 3Q2CA 3STLA 3VJ6B 5AG8A 3HPLB 4EUPG 2O5XL 2XWTB 2YWYA 5DA4A 1UH4A 1FZOB 1GPOL 4OI8A 2OBGA 5DD3H 4F7MA 4MS8D 2AQ2A 1ZANL 3O6FD 2C1OA 5EC1B 3RGVB 1I7UA 1OQOA 5D6CA 2VLKE 3MCLH 2EDYA 4HCRH 5FUZL 1Q9OA 3BT2L 4PB9L 1CVSC 4XAWH 3MLPA 1FYTA 5F7EH 4KTEH 3V2AR 2AEIT 1A1MA 1J1PL 5FYKU 3H6JA 4LLWA 2NY1C 1IC1A 1R5VA 5A16A 3QBTB 3TYFB 3EFDL 3NCEB 5IW1B 4GRWB 1CD9B 3CSYB 2PNDA 1RJLA 5TDNA 1GC1L 1T89A 2Z4QB 5ALCL 4XHJD 2AV1A 1NBQA 3PV6B 3HHRB 5D7KE 1PKOA 3M17B 3H7BA 1MFEL 5GS1B 3AY4C 3U0PA 2XZCL 3GMMA 4U0RC 4X99A 2R0WH 3WIHH 2VH5L 1LP9A 3C6LA 4JG0H 4X9HA 2RGSA 4X8JB 4YPJA 2B8OT 4KDWA 3GRWL 1RUKL 1SEQH 4JAMB 3K3QA 5BO1L 4F9LA 5EOTA 5ETUB 3HUJB 4WWKA 3L7EA 3QDME 4NQCB 2Z31C 3V7MA 3G9AB 4P4KD 2X4SB 3KHOA 1FFRA 1U2HA 3JUYA 1ZEAH 2X70B 2YPLE 1I3RB 3WN5C 1LNUB 1ZA3A 4LFHD 3FQXB 4E42B 1I3GL 2Y72A 4Y2DD 5D2LB 2HLFD 4Y5VC 1KPRA 5D7JC 3WFZA 5INCA 1NANH 5C0FA 1YMMA 1I1YA 1MHHB 4RGND 1E4WH 2E6JA 1KUMA 2ADIB 1PX3A 4PJ7B 4LLMB 1Q1JH 3TBYB 3TIEA 1QYGH 3RDTD 3WIIH 1GZPA 5DJ8A 1Y6MR 5FGSA 4DKDC 1IZKA 1BWWA 1NGZB 2ZUUA 1LK2B 3QFDB 1DQMH 2VLJA 2NXZD 2WBJC 5EIVA 2F74A 3KPOB 3P4NB 5K9OA 5IESL 4RGOL 1MIEL 3K7UA 4X6CF 1MFDH 1LK3L 1PJ9A 2IFFL 3ARFB 4LSDA 5ADOL 2XZQL 1AGDB 2IBGA 4KQ4H 2IC2A 4PY7B 1VADA 4YDKL 1CGSH 4LCUB 1QA9A 5KOMC 1N64L 2QSVA 2DKUA 3DVGB 5MEOA 5FM5M 4C57C 2DQDL 3DXAB 2IGFL 4OT1L 4L9DA 5C0GA 4CU8A 4NUJB 1OM3H 2APWA 3VFMB 2OZ4L 3MYJB 5IJVB 3M1BB 2P8MB 1XFPA 1MHEB 5DUMH 2RQ8A 2DQHL 4PJAA 1UFUA 3BPOC 4U49A 3X13B 5B8CB 1XIWC 3BXNB 4E9LA 3TNMA 5T1DH 4LL9A 5KVDL 1EV2E 1CICB 4P9MH 3DVFA 1DBBL 3WLBB 3K4ZA 4TNWK 1TVHB 4PYHA 1EH9A 1L7TH 3ARGD 2JF1A 4FP8L 1AHWA 4OZHE 2VDOH 1IGJB 3EHBC 1YJDL 1TJHH 3PV7A 5KJRL 1QSEB 1YC7A 3CZJA 4QGTA 2BNQE 4MB3A 1BQLL 2W60B 5KN5B 4C83A 4RGMC 3NFSL 3MRRB 4PTUB 4YHNB 3B9KB 4LIQL 1T66C 2CRMA 3CFJB 4QO1A 1HILB 1SEBA 3G5XA 3FO1B 5J9PB 4P2QA 4EDWH 5I1IH 4YXHL 4QHNB 4X9IA 1AGCB 3ULUH 5IR1A 4M1DL 1F2XK 3GJFH 3H9ZA 4RWHA 3DX7A 4Q6YA 5HHOE 1T04A 4HS3A 4JANB 1JWMB 5IQ9B 4CRPA 3P0GB 3CH1A 3SDCA 4ZQKA 1RFDL 3GFUA 1CE1H 2NTSP 3SE9L 4L4VD 2P7TA 5F3HB 5J1AA 1SMAA 2CMRH 1U6AL 4JKPL 3FTGA 1VFAB 4O2FA 1JI1A 1I8KB 3CD4A 3ARXA 4PGBB 4KJWD 3JZ7A 5SV3A 3WHXB 1LP9F 4LHUA 4FQCH 4I3RL 2EDDA 2XTJB 2LAAA 3MR9B 5I6XC 3SDDA 4YLQT 3C5SA 2HRPH 3I75A 1H9VA 3JTTA 1BECA 1A6WL 5M7QA 3VXSB 1S7VB 1R3JB 3ARRA 4MXWL 1S7UB 1GZQB 2DLHA 1IT9L 2VNCA 4GMSH 3KPNB 4NQEA 1JGVH 3PWUB 2CDEB 4FXKB 3HZMA 5LGKA 1NDMA 5FDWB 5FA3B 5JIHA 1UKSA 4OJFH 2YSSB 4QHMB 2EEAA 3T65B 2Y07L 3CLFL 2ZUWA 2QKIA 1QP1A 3DUSA 4H1LA 4H8WH 1PD6A 4I0PC 3QUZD 5E5MA 5EWIH 4AEIH 4HIXL 5DFWH 1INEH 1FC1A 3PHQA 5LAXA 5ACLA 3BPCB 4Y4KC 3P0YL 2EYTA 5DZNA 2XTLA 4Y5YB 4QHKJ 5ALBL 4EXKA 1RULL 1EO8H 1ZLVK 2ZSWB 1OP5H 4DOHE 2NW3B 4KRPD 3I84A 3BGFB 5SX4I 1EHLL 1XGRB 4GAJH 4K3HA 3G6DL 1OD7A 5C08E 4I2XB 5GRJL 3QHTC 4CN4A 4IS6A 4CNIA 1NL0H 2EE3A 5EA0H 2ESVE 1IGFH 3RAJL 4F7CB 3MMEB 3EGSB 3LB6C 2XA3A 4TTDD 1FNEB 2ILLA 3QXAB 4HEPG 3DRQA 1HNGA 3TYGH 1S7RA 1UZ6E 3UTSD 4LVHC 4R2GD 5CZXD 2CSPA 1NMBL 3N85L 1XCQB 2CO6B 3EDFA 5E8NB 4U6HA 4J3WA 5KW9H 2G75A 5KSBB 3I6KA 1MJ7H 1RZIA 1WZ1L 4WU5B 1P7KB 2ICWJ 2JE8A 3W2DL 2EO1A 4BK5A 1ED3A 1FP5A 4LSVL 1G1CA 3SE3A 5DJXA 3SDXB 5H94B 2VL4A 4FQ2H 1YEEL 2V5RA 2NY5L 2A6KA 2KUTA 3X14A 4GQ9H 3VGFA 5DYOA 4YHKH 1BBDH 1P1ZB 1F8TH 1ETZB 3LDBB 4HJGA 4ONHA 1Z3GL 1YNTB 1C8PA 1L0YA 4E5XB 3ZSSA 1XR8A 3EDDA 2KQMA 1BOGA 2ED7A 2Y25A 5ESVB 5FYKD 4QXTA 4KK5D 1SM3H 2YBRB 3F58H 4PRHE 4G9FB 1KIPA 1A6PA 1IC4H 3FO0H 3MXVH 4LLDB 2D2OA 3D2UB 4Q97A 3EO9L 3PL6A 1QFWI 1ZGLM 2ZG3A 2P47B 4DUXA 2VTFA 1BQHG 1H3TA 3Q1SH 5DMGC 3S9DB 1AXSB 4IRJC 5ENWB 1T21A 4MX7A 5DMJB 3MGAA 4GAFB 1G7MA 3SE8H 5EN2A 5I1KH 4O4YL 5HGHA 5DA0B 4JZJB 2HJKB 3HRPA 5GRVK 1QFOA 5E5RB 3T2PA 1F02I 4WO4C 4YJZL 5D1QA 3MA9L 3LEVH 3BIBX 3EOBB 3VWKC 3U36A 1MJJB 5IV2A 4UIKL 1FH5H 5C6TH 1NFDA 4YHLH 4KWUA 1BM3L 3TT3L 3ES6B 2H41A 3RWCA 5ANMB 4Y2OA 3GGWB 3HMXA 3HPLA 3MLZL 1LEGB 2XWTA 2Y06H 1DVFB 1FZOA 2YOCA 5FCSH 2ADJB 5GS0D 4XAKE 4HUUA 4X7DC 1A6VH 1DL7H 5EC1A 3RGVA 2EICA 1JYVA 2BJMH 1JCKA 3RWFA 4K3DL 1AFVH 2R4SL 2XY1A 4GLRI 3PP3H 4ESKA 4LKXB 5HVWA 1N0XH 4HK3N 4K8RD 4IDJH 1N26A 3PIQB 2ZUXA 2AJXH 4NQUA 1CD1B 3EFFB 4U3XA 3TYFA 2EC9U 3HMXL 3BIAX 5IW1A 1QRKA 3CC5B 3CSYA 2EIZB 2Z8VC 2ZCLH 5EUOB 5GSVB 2Z4QA 4FFVC 2DM4A 4MMZC 5E9DE 3PV6A 5E6IC 3QZWG 4JVUA 5GS1A 2EXWD 5MENE 4K7FB 4FZEL 5FOBB 1RMFH 4JB9H 4UMGA 5CINH 3LRHA 1AIFB 1AGEB 4KI5C 4HJ0C 3DBXB 2FSEB 2AEPH 3CAFA 4UU9B 1A64A 4XPAL 2UUDK 5IB1B 4JAMA 4U3HA 4LVNC 4Q0XH 3HUJA 1P6FA 5ETUA 4CJ0A 1C1EH 4R90L 4NQCA 1LEIB 5HI4C 1A02N 3ARDC 2X4SA 3JSSA 2X70A 5DO2D 5INDA 1I3RA 3H7LA 1TQCC 1WTLA 1LNUA 3OF6D 5I30H 1RJCA 1I1AC 3MLWH 4ETYA 3FQXA 4E42A 1EEQA 1H5BC 2G9HA 4NQDB 5D2LA 2OI9C 6CGTA 3FL7A 1G9EA 5AAMA 2CDGB 1MHHA 1U8LA 2ZUVA 4N5EC 3GHEH 3O8XC 2ADIA 1OY3B 5FXCH 4PJ7A 4LLMA 5L2KE 4G6AC 1DQTA 3TBYA 1MI5B 3LN4B 3MLYL 2PO6D 4HBQA 3CU1A 2HFTA 2VDML 4BZ2L 4RMUA 1NGZA 1OAQL 3QFDA 4Z76B 3B8YA 3HMWL 3VFWB 3JVGA 3KPOA 4YDLC 1OAYH 1NCAH 5KAQF 3BQUC 3P4NA 3FRUB 2CR3A 5FYJL 2F5BH 2BVYA 2BY2A 1CL7I 1MRDL 1L0QA 1EAPB 5T1LB 3CFIC 3ZYZA 3ARFA 1J8HD 2GJ6E 2NQCA 1AGDA 4X6DE 4PY7A 4EI6B 3FQWA 2VC2H 4IOSD 4LCUA 4NRXB 4LARH 4X4ZA 3TESA 2X7LA 4XWGL 1HIMH 4K71C 3DXAA 3PWPD 1H15B 3MREB 1NGWB 2RCSL 2OTPA 2AJVL 1Y6KR 4OLVH 2R9HD 4PBVC 2FLRT 4P3DB 3GM8A 4NUJA 3RVWD 4L3EB 1OAXL 3VFMA 4WHYH 3MYJA 5IJVA 4M48H 4AEHH 4OCWL 3BN9D 2P8MA 3MRMB 4PJDF 1MHEA 4NKIH 2VZ1A 4CVUA 3RJQB 4JHAH 4LEXL 2YRPA 3X13A 5B8CA 3OV6A 4PJEB 5IVXE 1GOHA 4Y7MA 3BXNA 4WFHE 1X44A 4RDQF 3U9PH 2FZ3B 2ZUQB 3QCVH 1CXLA 1BX2B 1KTRL 1CICA 3SGDH 1ZWIB 4JHWH 5JORA 3RX7A 2DLFH 4XVUD 3O3BB 3HZYB 2ED8A 5DHVB 2X1QA 4L8SC 4J3VA 1NFDF 4YBQD 4GW5B 5C2BH 1TVHA 4PJCE 4Y1AE 4MWFB 4TOYL 1IGJA 3CMOL 4HHAB 4P2OD 3ZL4L 3TH4T 2J6EA 4WRLA 4ZPVB 1QSEA 5T33L 2HTKD 4X6EB 3ARPA 5IHUH 7CGTA 2WIIB 4KV5F 1XF5A 3RU8H 5I17A 4ZTPL 2W60A 1NAMH 7FABH 3MRRA 4PTUA 5FB8B 4YHNA 1H3PL 2DIAA 2FBJH 3B9KA 3CFJA 2WM0A 1HILA 4HAGA 4HMEA 5GJTH 3FO1A 5J9PA 3DUUA 4U7MA 4WGVB 1XAUA 4LHQB 5AWNH 1EMTL 4OSUH 3OR6B 4QHNA 2XN9B 1Z9MA 1AGCA 1DFBH 2D4FA 4IM8A 4OZGB 5F1NB 1MF2L 1KENH 3T0DA 3BKMH 2NY2C 2BXYA 2CK2A 4WEBH 4JANA 1JWMA 4QRQB 5IQ9A 1PLGL 3SY0B 4YDJB 4AK1A 2CKBA 4JM2F 3L9RB 2NY0B 4MDIB 5I1DB 5EZJB 4O9HL 1FRGL 3AS2A 1HCFX 1PKQE 5F3HA 4ZFGL 3IRPX 4NO0A 3KYOA 1KOAA 1VFAA 3V9FA 1AI1L 1I8KA 3W11C 5HYSG 4PGBA 4J1UB 3WHXA 1XGUB 3MR9A 3I9GH 4YNYB 2OTUB 4EUPB 5A2JH 1XZ0B 3VXSA 1R3JA 5HHXH 4YZFE 1ORSB 1S7UA 3OR7B 1GZQA 2IMNA 4RGNE 4Y89A 3KPNA 2CKBL 4NM8H 3PWUA 4Q9RH 2CDEA 1N2RA 1LO0L 5FDWA 3TFKC 4MZ2A 3IETB 5DVKA 3MRCB 5FA3A 4QHMA 2YSSA 4FQ1L 1EPFA 1MJ8L 2IMMA 4QRPD 3T65A 4MXVE 1JRHH 4P23D 3T2NL 3FO9B 5HI3D 4KXZI 3N1QC 1VENA 3QDHA 5ITFB 1V5JA 4RWYH 1ZLWH 3BPCA 4XC1L 2R29H 2DMBA 4Y5YA 3U4AA 1MCPL 1UACL 1HCVA 2J7LA 1D5IH 3UCRA 2ZSWA 3CXDL 4J4PD 3LMJL 2NW3A 2MMXA 1H8OA 3NTCH 4IRZL 5AG9A 4UTAH 2X44D 2OJEB 1XGRA 3TN0B 3Q3GA 4I2XA 1KBGH 1NUDA 1QO3B 4JFDB 2VZ3A 5C07B 3DI2B 4MJ4A 4W70A 2EZ0C 1C7TA 5FHAH 3MNZB 4ZUWB 2YK1H 3BE1L 1VPOL 1V8HA 4WWID 2IF7A 4F7CA 2MCPL 3H2WA 3EGSA 4ZAKD 2EDFA 1LO2H 4GG6B 3QXAA 5EU4B 3WKNA 4RBPH 5D6DA 1WAAA 4FQPA 5E8NA 4PJ9B 2P42B 1RZJL 3C5ZD 5HDQL 1XR9A 1K2DA 5KSBA 4AY0A 1ZA6B 1NCUA 5EBLB 3SDAB 4NZUL 5GS3A 3UO1L 1HXYB 4KVNH 3SDXA 3KGRA 5H94A 4KAQL 4KK6C 2O5XH 1U92B 4N0CD 1GPOH 1D5BB 1T1YB 1U58B 1UKTA 4ZFZB 1ZANH 2IBZY 3QISA 1P1ZA 1FVDB 5L8LB 5FUZH 1YNTA 3BT2H 4POZD 3PXHA 4E5XA 4PB9H 3S3PA 4OLZL 2R56L 4MAYD 1PY9A 1Z9OA 5ESVA 1J1PH 2YBRA 4QXWA 2A77L 4G9FA 4WUUD 4YO0B 3VWJC 3EFDH 1UCBL 1HH6B 3D2UA 4EXPX 2A38A 1YUHB 3KS0H 2EO9A 2W91A 3DTXB 1GC1H 5ALCH 4LPTA 1EBAA 5DRZB 1CLOL 1MFEH 4KQ3H 1HHIB 1G7HB 1AXSA 5D1ZB 5ENWA 3QG7L 5KSAB 1AO7B 2XZCH 2VH5H 2V2XB 2ICES 3GRWH 1RUKH 3F6IA 2HJKA 4JZJA 1AR1C 5J7CC 5BO1H 5DJAB 5DGRA 3EOTL 4F15C 3EOBA 2DM3A 4NHUB 3C8HA 5F6HJ 1MJJA 2BRQA 2WK2A 5I1JL 3I2CL 2EDNA 3SQOL 1I3GH 2W0FB 4RQQB 1X4XA 2G5RA 3ES6A 2O5ZH 2LU4A 1KJVB 4JFED 1LEGA 1B0RB 1RPQA 3KR3L 4P5TD 2ADJA 3RVUD 4JN2B 2Z9TA 4X9BA 4OCYL 3UPAA 4ODTL 4WEUD 3HI5L 1JYXA 4MNQE 5IESH 4RGOH 1FIEA 1MIEH 4NN6B 1B90A 1LK3H 2IFFH 1NFIB 5EBGA 5ADOH 2XZQH 1I8IA 1XCTB 4JRYB 3ISWA 3PIQA 4YDKH 2CIKB 1CD1A 1N64H 3EFFA 3TVMD 5BW7C 1J11A 4XNQA 3CC5A 1A5FL 2EIZA 2DQDH 4JFFD 4PP1D 5GSVA 5EUOA 2IGFH 4HAFA 2VQUA 4OT1H 3HR6A 4MJ5B 3TV3L 3DRTB 3CVHL 1JPSL 3RVXD 1MWAB 4K7FA 5FOBA 2WSKA 2YZ8A 5E0QA 5KANI 1JTTA 1AIFA 1AGEA 2OZ4H 3DBXA 4J8RB 2OX5A 2FSEA 4J3UA 4UU9A 5FEBA 2AK4E 2MSPA 2DQHH 4GO6B 1UXSB 3D6GA 4M6AA 2IADB 2JELL 5IB1A 5BRZD 1NCNA 3L6FB 1OP5K 1GH7A 1LEIA 1S7TB 2NZ9D 2X6MA 4K3JL 4NDMB 5FFLA 3GMLB 5KVDH 1CS6A 2AJSL 3BGMB 4NQDA 1MVUB 4X4ME 4LCCC 1DBBH 2QHRL 1D7FA 4PJIE 3HE6D 2CDGA 1XF2B 4FP8H 1IE5A 1QFWL 4U3CA 3TZVC 3SDXF 1K85A 1YJDH 1MI5A 3LN4A 3U4EB 5KJRH 1FHGA 4YX2L 4H25B 4RA3A 2FO4B 1DP0A 5JW3L 1Q9KA 3QDJB 1BQLH 2JJVA 3RIFF 4RMTA 3NFSH 3VFWA 4U1SB 4LIQH 2DL9A 3V5DB 3E8UL 3FRUA 4TQEL 4U6TA 5D1XD 2QSCL 3QI9C 1EAPA 5T1LA 4MQSB 4Z0XA 4YXHH 4QOKB 1RUAL 3KYNB 4M1DH 4WIQA 3BDYL 1UG9A 3OXRB 4EI6A 4OZFH 5I71C 3D87B 4NRXA 4P46D 4GSDL 4PP2A 4XBGA 1RFDH 3VRLF 3ARBC 1H15A 3MREA 1NGWA 3SE9H 5DLML 3D18B 4ELMF 4P4RB 1X5YA 1TITA 2N4IA 2WWKT 4FQXD 4P3DA 1U6AH 3M07A 1J88A 1BHGA 4JKPH 2ARWA 4L3EA 5GJSL 2P43B 2YD9A 4NYLB 3MRMA 5J11B 2HYMA 3VXUB 3WLWC 4I3RH 5IHLB 2ZUQC 4URTB 1IBGL 4HWBA 1RIUL 3L3GB 3NCYS 5JNYB 4BH7B 4PJEA 3H9SB 5HYJD 3P0VH 4APQD 1A6WH 2FZ3A 3TO4D 1KGCE 2P44B 1BX2A 4MXWH 3LQAC 3QYCA 2X5PA 4R9HA 4DUVA 1IT9H 2GT9B 1ZWIA 1X5ZA 5CP3H 5DJYB 4M6NL 3O3BA 3HZYA 5DHVA 4GW5A 2VAJA 3L1OL 4R7DB 2Y07H 3CLFH 4MWFA 5I73B 3RL2A 4WW2A 4HHAA 4HIXH 1FFPB 1SVZA 4ZPVA 4AH2A 1NBZB 2PYED 1N6VA 4X6EA 3P0YH 2WIIA 4M5YL 3IDXL 5DWUL 2HKFL 2VR5A 2ZCKL 1A6ZB 4WNQB 5ALBH 5FB8A 5IW6A 1RULH 4GKSB 3F7QA 2CPCA 4HH8A 3U4BL 4ZOBA 2AERT 4WCYL 1TXKA 1EHLH 4WI5A 3G6DH 3OR6A 2XN9A 3MUY1 1BQHB 5GRJH 1ES0B 4OZGA 5F1NA 4DK6A 3GUTB 5J1SC 2CK0L 1DTUA 4Z95L 1SJHB 3MGTB 3SY0A 4YDJA 3RAJH 3LS5L 4XI5D 1M4KA 3VG9C 4RFNC 3L9RA 4L4TB 4KDTA 5I1DA 5EZJA 3HNVL 4FTVB 5EUOF 3UZQA 1X9QA 3KYMB 1R3LB 3PP3K 1NMBH 1X3DA 2AV7B 3N85H 3PGDB 4E0RB 1MCHA 5T5FL 2R0KL 4J1UA 5IB3B 1W8NA 1UQSB 2ZUYA 4X7TB 4HF5L 4HC1A 1XGUA 1WZ1H 3QEHB 3LRSB 3W2DH 4YNYA 2OTUA 1G9NC 2ZJSL 2B5IB 5F44A 2EEDA 4LSVH 4V1DD 4EUPA 4N9GB 1DUZB 5IMOB 1E27B 1XZ0A 4KKBD 3MRNB 1ORSA 3OR7A 1YEEH 2ICCA 3QIUB 4I48B 4JGJA 4ONFL 5JQHC 2NY5H 1UKQA 2JTDA 3C60C 3L3JB 1C08B 3IETA 3MRCA 1N4XL 4G3YL 1ND0B 1RD6A 3CCHB 5T1KB 2NY4B 3PQYB 3O41B 1F6AB 5EO9B 1Z3GH 3FO9A 2DM2A 4HDIB 3DO3A 1A2YB 5IM7A 3KLHC 4ZODA 3F65A 5MP6L 3TIDB 1J86A 3QPXL 5ITFA 1L6XA 2OYPA 2VXQL 2R2BB 2P5WE 2CKNA 4YIQB 4M5ZL 4U2YA 1J8HE 1KSRA 2ICWB 5HHNB 1CN4A 2DQFB 2J2ZA 2OJEA 3O6FC 3TN0A 1V3KA 1JVKA 1U95B 3EO9H 3SKUD 3S4SG 2RFXB 4XCYB 3QZWB 1QO3A 4JFDA 3PHSA 1CFQB 5TF1L 2L0DA 5C07A 3PWPE 5I8OL 1CT8A 3MNZA 4ZUWA 2WP3T 4HK3J 5C09B 3VD3A 4YHYC 1V7NL 4HIIB 3PHOB 3JTSB 5TE4L 1INDL 3WJJA 4O4YH 4GG6A 2FATL 1TENA 1JGDB 4OFDA 1HI6A 2CR6A 1NCTA 3MA9H 4KTYA 4HKJB 4PJ9A 1QBAA 2EECA 5HDOA 2QBWA 1JE6A 1ZA6A 1HQ4B 3KXFB 3R0NA 4UIKH 5EBLA 3SDAA 2C3HA 3BAEL 3PWNB 1BM3H 2QTEA 3TT3H 4HG4K 1P7HL 5BOPA 5TF0A 1HXYA 1YY9C 4X4YB 2X09A 3MLZH 4FFWD 3LSOB 5JOEA 5ADPL 5C86A 1U92A 1YY8B 1T1YA 1D5BA 2W0PA 4ZFZA 5B4MD 2NW2B 1J0ZA 4P4KC 4R4FL 2GY7B 4BSWB 2IANB 2VZTA 3LPWA 3N1GC 3QR2A 4P2RE 1FVDA 2IG2L 5DQ9B 3KPSE 3FQTB 4JDTL 4N0FB 4WTWA 4ZXBD 2FHBA 2ID5A 4BA8A 3UEZA 4K3DH 2R4SH 4Y2DC 5F7KC 3TF7C 2VLKB 4WW2F 2BNUB 1V7ML 3VXRE 3DECA 4LDLB 4B0MM 4UNTA 3KYKL 1JGLL 1CCZA 5MI0B 5SX5H 3T77B 1WFOA 4LOUC 5E2UL 2OJZL 3B3IB 3SGKC 4YO0A 2VLRB 4HH9B 3RDTC 4B53A 3HMXH 3BD4A 1HH6A 3MLTB 1YC8A 3B5TA 1YUHA 3DTXA 2NXZC 5DRZA 1HHIA 3QUYB 4QXUL 2B20A 5IK3B 4FZEH 1G7HA 2R0ZL 4NRYB 5D1ZA 2LAGB 3MJ6A 3WFDL 5KSAA 1AO7A 4LASL 4W6YB 5JO5B 2V2XA 4AQOA 1NCBL 2EDKA 4XPAH 5E8EB 1A21A 3PNWB 4DKFL 5DJAA 3CFBB 1DUYB 4R90H 5DJZB 1PG7W 4LIQE 3ZDZF 1U8OB 3QDMB 4L29B 5C70A 4ZD3L 1OLZA 1J05B 2W0FA 2YPLB 4RQQA 3RUGE 5IMMB 1A7NL 1FNHA 4N8PA 4UT6L 1S7SB 1KJVA 3HAEH 1T0PB 3V0WL 2PXYB 1B0RA 4EKXA 3O4LD 2X4TA 2B2XL 4WU7B 3BD5A 5FGRA 2DQUL 3MLYH 3QUXB 4D9RD 3L3IB 3QB7C 4WHTB 3TA3D 1GOFA 3WNOA 3SKOA 5KSVB 2E7HA 4JN2A 3V8OA 2VDMH 4JPIB 4BZ2H 1NKRA 3VXMB 1OAQH 1P53A 2EYRB 3HMWH 1YEJL 1Z9LA 5FYJH 2VJXA 1QVOB 1IM9D 1MRDH 1WBYB 3PGCA 2V5YA 3SGJC 1NFIA 4XH2B 1DDHB 3GKWL 1XCTA 2Y23A 1E0OB 4JRYA 2CIKA 3RNKB 5LG1A 4YEFA 4HMCA 5TQ2L 1DLFL 2WLYA 4XWGH 2XT1B 3S3SA 3DJ9A 4YDIL 2RCSH 4HUXB 2EIEA 2BVPB 5HYFA 1AKJD 3BISA 3DRTA 2AJVH 1MWAA 1TFHA 1RUPL 4LPYA 1BD2D 1OAXH 2MOVA 1Q72L 1ZLWK 4PJ8B 3HLAB 4OCWH 2L4OA 2BVQB 4GUPB 3NIDF 2IADA 4DGIL 1T0MB 3FB6B 4K3EL 5F9WB 1KTKE 4GG6F 3L6FA 4LEXH 1VESA 1LD9B 1S7TA 3WFEL 4HWEL 4JPVL 3VI3E 4NDMA 5KVEL 3GMLA 5F7FA 4ELKA 4U1IB 3FFCD 3BGMA 1MVUA 4ZFFB 1U3YA 1DQDL 4JQVC 3QH3B 3WO3B 1XF2A 5CIPA 4TOYH 3NH7L 4OFYA 1WWCA 3CMOH 4WTXA 4MA1C 5HVHB 3ZL4H 4XPBL 3U4EA 1N8ZB 3T4AB 4RBPK 5T33H 4H25A 2RJMA 2FO4A 4HWNA 4A6YB 1WGOA 3QDJA 5MERB 4ZTPH 2FO1A 4U1SA 1H3PH 5GRYA 3V5DA 4ERSL 2BNQB 4NNXB 4WUUE 1TVBB 2I07B 1EMTH 4QOKA 4WV1B 1MF2H 3OXRA 3QEGL 4Y19D 4WHYG 4YHOL 5KTEL 5GRWA 4JQIH 5C0BD 1PLGH 2P5ED 4S11A 3SO3B 5HHOB 1HSAA 3U30B 4PRDB 3D18A 4O9HH 4P4RA 1FRGH 4ZFGH 5DK3A 5C0CD 2P49B 4WY7L 3QT2A 4M7ZB 1AI1H 4MYWB 4YAQB 4K55A 1A9BB 3VXUA 5HVFB 2LTQB 4NCDA 3L3GA 4Y16D 4EN3D 5I0DA 5JNYA 4BH7A 3HNSL 5L7XL 3ZHDA 4PRBB 3H9SA 3LH2L 1KB5B 2R23B 2VQ1B 3N1MC 2GT9A 2A9ML 2CKBH 4JFEE 4K7PY 4Y4HB 5DJYA 1LO0H 2IAMB 4KJPD 3QXTA 4R2GC 5CZXC 3PF2A 3O11B 4FQ1H 4Q7DA 1MJ8H 3OMZA 2WMPA 2YMXL 3TC9A 2PTVA 3T2NH 3WO4B 3O6ML 1FFPA 3MRBB 3RZCD 1NBZA 4JKKA 4MGXA 4XC1H 3RRQA 1N6QL 4PGDB 2Q1EA 1A6ZA 1RZKC 4I3GA 4RMQA 2IPKB 4WNQA 1MCPH 1NC2D 1UACH 3VD4A 4GKSA 4JRWA 3CXDH 5C8JB 5EC2B 3LMJH 1VB9A 4UIMA 4JQXC 1IC7L 1YQVL 4DOHB 5KS9B 4PJXF 1BQHA 4RAHA 1ES0A 1ZXQA 2H32H 2F53A 3E6FA 5ISZD 4JFFE 3ULVD 3P77B 3GUTA 2UWEF 5C08B 1O7VA 3IS1X 5E94B 1RQ5A 3BE1H 1SJHA 1VPOH 4LSPL 3MGTA 3DHJA 2MCPH 2MFNA 4L4TA 4JY4A 5TE6L 4FTVA 2IH1B 5CD3B 1BIIB 3CSBA 3MV9D 4Z5RB 2AV7A 1XGPB 1EGJA 5HDQH 1RZJH 5IB3A 1UQSA 3H9YA 4X7TA 4M4PA 3QEHA 3DVNB 1VGEL 4NZUH 3LRSA 3QIUC 5IMLB 3OXSB 3U48A 3CX5K 1MCEA 3UO1H 4N9GA 1DUZA 5IMOA 1E27A 3MRNA 4GQPH 3VXOB 4KAQH 3MLXL 4I48A 4UV7L 2MWCA 4N1CA 3DWTA 5HHQB 4PD4J 3L3JA 1C08A 2GSGB 4FQJL 3WFCL 1ND0A 5FGBC 3CCHA 2X9YA 3KPQB 4UUJB 5IMKB 1I9JL 5T1KA 3PQYA 1F6AA 3O41A 2NXYD 5CCKL 5EO9A 2DTML 4HDIA 4GH7B 4YGVB 4OLZH 2R56H 3CX2A 3TIDA 3ZKQD 4EQ2A 2VKWA 4OM0L 1JHTA 3GEWB 4YIQA 1LO4L 1XGYL 1HZHL 2GTZA 2A77H 3Q6GL 5HHNA 4G6FB 2DQFA 2Z93B 2ZZUT 1UCBH 4PRHB 1U95A 2SEBB 4XCYA 3QZWA 3LQMA 3ZT5A 4F7PB 1CFQA 2R0LL 1A9EB 1CLOH 2DYPB 3IXTB 3ILQD 4JG1L 3T08A 3E3QC 3K46A 4HIIA 3QG7H 1CDGA 1T5XB 3PHOA 3HA0A 3JTSA 2FLBT 4GBXD 1QRNB 4JPKL 5A2FA 3ZE0F 4ZUSB 3S3JA 5GGTL 4H5SB 1GGUA 2H8PB 1JGDA 2X4NB 3JWOC 1I4FB 3P4OB 4JVWA 3FONB 3HPJB 3T0EC 4ZFOB 1FZMB 4HKJA 3EOTH 4JGMA 2AI0L 3O6LL 5HYJE 1I75A 5FYJE 1HQ4A 1EZVY 1HSBB 3KXFA 1PG7L 2YD6A 1KELL 1JUFB 4PLKC 5I1JH 3I2CH 3SQOH 3PWNA 5DVOA 3CXHJ 5SX4H 3AMKA 1QFWM 1U3HC 5IBUG 4X4YA 4M8QB 3IFLL 2VZUA 3LSOA 2RB8A 2APXA 3ROOB 4HEME 1YY8A 3KR3H 4KMTL 2NW2A 4OCYH 4PV9B 4BSWA 2IANA 2NY1D 4I4WA 5DO2C 5DQ9A 2PYEE 1SMOA 4ODTH 3HR5B 3FQTA 3O0RL 4N0FA 3HI5H 3GMOB 4XX1E 3VFNB 4Y0GA 2VLKA 2BNUA 5I1LB 1MCLA 5J8OA 4FQLL 5EOCJ 3T77A 3C6LD 2M8XA 1J87A 3B3IA 4Z77B 1OT2A 4HH9A 3TT1L 2PO6C 3EYUL 4WWKD 3R8BB 2ATKA 1A5FH 1TNNA 4OB5L 4LU5L 3TV3H 1HYRC 3CVHH 1JPSH 3QUYA 5IK3A 4NRYA 4KKAC 4OFVA 3T3MF 2Q7YB 5JO5A 3JV0A 1YMMD 5MENB 1Q38A 2NTFB 1CDIA 2NY6C 3BYTA 1WT5A 5E8EA 3PNWA 2H6PB 2JELH 3BVNB 3OQ3B 5IVOA 5K9QG 5D7JD 1L9MA 3QRGL 1YN6B 3CFBA 3T1FB 3RX5A 1DUYA 5DJZA 1HWGB 5D2NE 5EFIB 1U8OA 3QDMA 4K3JH 2FH6A 4L29A 2R9HC 4HXBL 4R97C 2AJSH 3ZKMC 1J05A 1F42A 2YPLA 4PJ5E 3RVWC 2QHRH 5IMMA 4H0IA 5BZDB 2HAZA 2AEWA 1S7SA 5BQ7B 3BN9C 4D2NA 3WD5L 2PXYA 3K2UL 3L5WB 1QFWH 4WU7A 4MQXC 3QUXA 1MQ8A 1CD8A 3L3IA 4YX2H 4WHTA 2QEJA 5LBSL 1F4YL 5IFJB 5L2KB 5J1TC 4JPIA 5JW3H 1GIGL 1ZSDB 1FNAA 4M43L 2EYRA 1HOCB 4G80B 1R3KB 4XP5L 3E8UH 4TQEH 1U8QB 4XVUC 1FNGB 1QVOA 2QSCH 5JZ7C 1WBYA 3U7WL 1WVZA 4YBQC 3NGBB 4KJQC 4XH2A 1DDHA 1RUAH 3S34L 1FL6B 3BDYH 3DX8B 4P2OC 3RNKA 1MAML 4X6DB 4NJAL 5HY9B 1G7JB 4GSDH 1P84J 4PG2A 2BVPA 3DSFL 1ZHBA 4J3TA 3NVQA 1J8KA 4Z7QF 2JJSA 2W9DL 1TDQA 4DVRL 3LKQB 5GJSH 5J6GB 3T8XB 4PJ8A 5F96L 3HLAA 1X5LA 1U91A 3NA4A 2BVQA 4GUPA 4MJID 5F71A 2DICA 4Z7OF 1FIGL 2Q87A 1T0MA 3AU1B 3FB6A 5D5MB 1IBGH 1RIUH 2K7QA 5E2WL 1T2XA 4LVEA 3CFDB 4GLRH 4QHLB 4WI9A 3TCXA 4LEOB 3GSUB 5FYLL 1Z0MA 2FCBA 4U1NB 1TNMA 2NX5D 4GFTB 1SJEA 2ENSA 4U1IA 5FUOL 4M6NH 5F6IB 3TO2B 4ZFFA 5SWSE 3L1OH 3QH3A 1A6TB 4JEGB 5SWQB 1YPZE 4YFLI 4ETQB 3ZT7A 4R26L 3BRFA 1N8ZA 1Y6NR 4PJCB 2APBA 3T4AA 4Y1AB 4OZHA 3MV01 4OZFG 3S6CA 4M5YH 3HZKB 3IDXH 5DWUH 4A6YA 2HKFH 2HTLD 3QIBC 2ZCKH 4XBEH 2YC1B 5MERA 5IJKC 2IPUG 2X9WA 3U4BH 2BNQA 4NNXA 3MUGB 2E7LC 3VGDA 4WCYH 1I1FB 3OB0H 2I07A 4ZOCA 1E6OL 4WV1A 3SO3C 5DHVH 4JZOB 3FHQA 2CK0H 4Z95H 3ETBF 3WDJA 1TQBC 1FO0L 4UINL 5FOJA 3H0TB 3LS5H 5HHOA 4FA8A 4PRDA 4NT6B 3HNVH 2FWOB 4J4PC 3V52L 1W8OA 4OD3L 5T5FH 2R0KH 4JCMA 3RKDC 4YAQA 1GSMA 1TVDA 4UOW0 4F8QA 3I6LD 5SX5K 1A9BA 4HF5H 4ZUUB 2AJUL 2K1MA 1L0XA 3BKCL 3RPIB 3VXPB 4M6OL 3HRZB 2ZJSH 4PRBA 3IDGB 3VMOA 4PJGB 1T1WB 4D9QD 1KB5A 2R23A 4ZAKC 1MHCA 2VQ1A 1QHOA 3AM8C 4AYFA 3MROB 4ONFH 4TVPL 3BESR 4Y4HA 2IAMA 4WI6A 4Y4KD 3O4LE 4OBRA 4RGNB 1N4XH 3C5ZC 3O11A 4G3YH 1CGUA 4BKLB 2CXKA 4HW6A 3WUWG 2DQCL 3D1MC 1S5IL 2V7NB 5MP6H 1JHLL 3QPXH 2H45A 4Q74A 2M26A 5FK9B 2FNBA 4PGDA 2VXQH 1A6UL 5I75C 1UCTA 4M5ZH 2GW5A 3U79A 2IPKA 5GS2H 1DBKL 4N0CC 5C8JA 5EC2A 1S78D 4LPUA 3WS3B 4PLJC 2Y1VA 1NMCC 3Q5OA 5E99L 4F37K 3VRLE 5KS9A 1F00I 3ZKXB 4ELME 5TF1H 4HXAL 3P77A 4POZC 5I8OH 5C08A 5E94A 3C8KB 3BO8B 4MAYC 1V7NH 4UILL 3SKJL 5E8OA 5TE4H 5HYIA 1KJ2L 1INDH 1KXQE 1BD2E 4RZCB 2IH1A 2FATH 2UY7A 5CD3A 2EKJA 4XNMB 1BIIA 4LRIC 5F72S 4Z5RA 3RWGB 4OQTL 3T4YB 3T04D 1XGPA 3SBWA 2H2PD 1FNFA 3PUCA 3AC0A 5C0RL 4H0HB 4HV8B 1FLTX 3B43A 4HCRA 3LKSB 3BAEH 5IMLA 3OXSA 4TRPL 43C9B 3FFCE 4UT9L 2HT3C 3VXOA 4G8GB 3KJ4B 3S97C 5FECB 3MV8D 1BFTA 5ADPH 3A6OA 1FVEB 4Z7WF 4NNYB 5HHQA 3RWJB 3OKEB 2GSGA 3ARGB 5E4IA 4R4FH 3KPQA 5IMKA 4UUJA 3PL6D 4I0CC 2IG2H 3C2SA 5I9QC 4JDTH 2LU7A 4LAJH 3ZHKA 4YGVA 2W92A 4JFOA 4G42B 3P9MB 1V7MH 3UPCA 3D39E 4QF1B 1J9CT 5I1GL 5IEKB 4OZHF 3KYKH 1JGLH 5ESQA 2DIJA 2DWEB 3WIHA 5E2UH 2OJZH 4TYUA 1P4IL 1S7QB 4IRJD 2XRAL 1XF4B 4P5TC 3QIWC 5ID0B 1AY1L 3FRPA 4EI5B 4Y19E 1WZKA 2Z93A 4PRHA 1L4IA 3RVUC 3SGDI 4BM7A 5CHNB 5C0BE 5K9JL 2HP4A 3FT3B 5GZND 4JJ5B 1A9EA 2A73B 4QXUH 4WO4D 5C7XL 2DYPA 2JB5L 3IXTA 3MUZ1 2PW2B 4XP6L 2R0ZH 3IRZA 2QLVB 3HC4L 2X2YA 5IW3A 3WFDH 5DHXB 1KYOK 4R0LC 1QRNA 2ZPKL 2J8UB 5C0CE 4ZUSA 1NCBH 4H5SA 2FDBP 3U46B 3S5LB 2H8PA 2WWMD 2X4NA 4DKFH 1I4FA 5DFTA 3FONA 3TVMC 4KXZH 5SWZD 3HPJA 3VDAA 4ZFOA 1FZMA 1H3XA 1NEZB 3MOBL 4F33B 3RGVD 3O2DL 4PP1C 2XZAL 1T4KB 4L9LC 4JKLA 1HSBA 4ZD3H 2DJUA 3RVXC 5FHBL 1JUFA 4OCXL 1A7NH 1MY5A 2CH8A 4UT6H 3AREC 3NPSB 4M8QA 3V0WH 5B3NA 3PG2A 1RZGA 3CFKB 3H3KA 4XNUL 2JJTA 2B2XH 3G5ZB 2A6IB 1A7PL 2DQUH 4NFDA 3G6JB 4PV9A 2NZ9C 1D5MB 1EEUA 2X4UB 3HR5A 3K8KA 1JIBA 1P6AB 1YEJH 2Z91B 4WI7A 3VFNA 4JFQB 1H8NA 4FZ8L 4NKDB 2DI9A 5I1LA 4QHKI 5GXBB 3WJLA 4MNQB 3GKWH 3G5YB 3ZE1E 5E6ID 2X4QB 1EFXB 1V3LA 4Z77A 4Z78B 4KRPB 2VWEC 4KI5D 5TQ2H 1IILE 1DLFH 2OCFD 4L5FL 3G6AA 4OFPA 1CK0L 4XXDB 3FT2B 3GK8L 4J6RL 2JCCE 4CKVX 1S9VA 3QXDB 1KFAL 4YDIH 1CXFA 5DF0A 3O2VL 1P7QD 2I60L 4PIRF 3QUML 5TPWL 1RUPH 1A3RL 1AC0A 2BHUA 3ARDD 5EORL 4PPTA 4NOFA 1Q72H 1X5AA 3QAZC 2VN7A 5MENA 3MV9E 5B39B 2EDJA 2NTFA 4RFEB 1WIPA 5ICZB 4DGIH 2H6PA 3BVNA 3RGHA 4K3EH 4P46C 3EZJB 5M94B 3HAEG 2AK4B 1YN6A 3T1FA 1X5HA 3LEXB 3FB5B 5GGVY 1DJSA 1D6EB 3N1PC 4ORGB 3MZGB 3WFEH 4HWEH 4JPVH 5EFIA 1T7XA 2PUQT 4G6AD 4LPCA 5KVEH 4XNXL 1NAMB 1CLZL 5FF6A 4O51B 5BZDA 4TTGA 1XGTB 2FEEI 3I3DA 1HXMB 4GT7A 4LMQE 4WFEE 5BQ7A 4BFBD 5GISL 3QDGD 1DQDH 3L5WA 3C9NB 4XWOD 2YR3A 3AB0B 3K1DA 3NH7H 3SKNA 2OQJB 4XPBH 4RA0C 3LQAL 1FL5B 2AK1L 5IFJA 1HKLL 5L2KA 3NZ8B 1ZSDA 1HOCA 4G80A 4E41E 4NBXB 1R3KA 4PV8B 4ERSH 1U8QA 1FNGA 4OV5B 1TJGL 1FL6A 3WNMA 4ODXB 3DX8A 3QEGH 4XX1G 2E9IA 4YHOH 1A7OL 2I27N 2AKRB 4FFYL 5KTEH 3VDBA 4X6DA 5HY9A 1G7JA 4LF3A 1MY7A 1NEUA 1EEZB 1GGIL 5C92A 1F6LL 3G9VA 5CIPH 2XIDA 5IP4A 4UAOC 1AD0B 4S1QL 3QNXB 4HLZG 1CICD 3E2HC 2CUIA 1Z9SA 3GB7B 3QEQB 4R7NB 1OCWL 5I74B 3M8OL 3LKQA 4WY7H 4RISL 5J6GA 3T8XA 5IFHL 1J10A 5E8DL 3RKPA 4LCWE 5E24E 5IQ7L 3AU1A 5D5MA 3I3BA 2R8SH 3UBXB 3HNSH 3CFDA 5L7XH 1UA6L 4QHLA 3OKYA 2E27L 3I02B 1WFTA 4XI5C 5F9OL 4LEOA 3GSUA 3LH2H 4NN5B 1AXIB 1LE5B 5IOPB 3EJZC 4U1NA 1A1OB 1YEFL 1ZKAA 2A9MH 3TO2A 1G9NL 2YMXH 1A6TA 4PLOB 5SWQA 3IF1B 4ETQA 1I9IL 1UM4L 3BSZL 3O6MH 5TGBB 4PJCA 2QADB 5EZLA 4Y1AA 4IHOB 1E6JL 1CFTB 1N6QH 3HZKA 1BF2A 4KKBC 2NY2D 1E4XI 4X6CB 1VA9A 4XPFL 4RAUB 4I18C 3MUGA 1UGNA 1I1FA 1IC7H 1YQVH 4HWZB 3MFGB 1FNSL 1QOKA 5ACZB 1VSCA 5DEGB 4JZOA 3IDYB 5FYLD 2XTJD 5K9QI 4XCFL 1KG0B 3PE9A 4LSPH 1GHFL 5ABDE 1BEYL 3H0TA 4PRNB 4RNRA 4NT6A 2VYRE 5TE6H 4N8VG 3NIDE 3LZFL 5A3ID 5KOVC 2FWOA 2QQKL 3JUZA 2EEBA 1OW0A 4NRZB 4PRPD 4PR5B 1KCVL 5E00B 4QNPF 1E4KA 4ZUUA 4EEEA 5T5NG 1OWRM 1F3RB 3OL2A 4P5KB 1VGEH 2P1YA 4NQSB 4O5LL 3RPIA 3VXPA 1ZS8B 4WI3A 3QWRD 1Z6JT 1T1WA 4PJGA 3OX8A 1N6UA 2DTSA 4Z6AT 4OM1L 2CRYA 1IKNC 5DEFB 3MLXH 2BSTB 4S0TD 1UJ3C 2NPLX 3MROA 4UV7H 1FZJB 1ZVSB 4AIZA 2XWBB 1LEKB 3JV6B 4OCMC 4M8VA 1IAII 4I0KA 4FQJH 4F2MB 3WFCH 2YD3A 5IROA 1JP5A 4BKLA 1I9JH 5CCKH 3PWJB 1T6WA 2HLAB 2DTMH 3WBDA 3RDTA 2CDFB 2V7NA 4FN0A 1OAUL 2HG5B 1I7UB 3SGEH 3INUL