4ODHH

Crystal structure of human fab cap256-vrc26.uca, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
245
structure length
222
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDLGESENGVVGAFDIWGQGTMVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.UCA light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 222
sequence length 245
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odhH01
1WSST 4XCFH 1Z5LB 2X4UB 4O02L 1KG0B 1NAMB 3P0GB 1HSAA 4U31A 3DI2B 1IFHL 2NYYC 2IFGA 1EJOH 3H9ZA 3L6FB 5TQ2L 5BZWB 5KVFH 4PJFE 4S1QH 3ZT5A 5HD8C 2WSKA 4E9LA 1R6VA 3U7WH 5D2LA 5EOTB 3W0WB 2AK4E 2WUCL 5DDHA 4O9HH 1U95B 5FK9B 5DHVA 5ELIA 1JFQH 2JB5L 4YXLL 1L7TL 5E24E 1A5FL 3E0GA 4X83A 4UU9A 2OP4L 1OCWL 4WW2C 4ALAH 4YZFF 5TQ0H 4JFFA 3VE0A 1Z0NA 3DTXB 4HPYL 4LSUH 1EXUA 4XZUB 4UT9H 3OZ9H 4PJ9C 3P0YH 5E6IC 3VD4A 4GAYA 5FHBH 5TFSH 2FIKB 2AQ3A 4CJ1A 4KJWD 3SDXE 4FHBD 4ZUSA 4JHBA 2H45A 3E8UH 5IBLD 1VESA 5F7UA 4U0RC 1SEQL 3LMJL 4N0UA 3QWRA 4TVPH 5J3HD 3UC0L 3ZKMD 1QR1A 1HCVA 4O58L 1D7FA 1KTLB 2NZ9D 3ARFA 3OAZK 5DHYB 5T3ZL 1S9VA 1HILB 2OJEA 4P2YA 5T3ZE 5TPWL 3KPTA 3WFHA 3PHOA 1K8IB 2NY7L 1QSFD 1JZ3A 1CE6B 1OAKH 2EDNA 3T3ME 2G5BB 2CPCA 2R4RH 4P9HL 3TJHD 4P3DB 2ZUUA 3UYPA 4QRPA 1S5HA 4P46A 4ODHL 5HHNB 1VB9A 2IPUG 4DVBA 4F9LA 2F53B 3A6OA 4NNPL 4XAKD 1JGEB 3GDBA 3QUYB 2AQ1A 3MOBL 4DUXA 2YD5A 4IOIB 5F8RC 3WDJA 2IWGA 5FA4B 4GG8A 4JQIL 4MQ7A 1JHTA 5FKAB 4YFLF 5BV7B 2J5LB 4HXAL 4UNVA 1BQHA 1DE4A 4AIZA 4QF1B 3LIZL 3HTLX 4Y4HA 3MJ6A 2WK2A 2OR9L 1T83A 4QWWC 4H8WC 3IFPA 4LVNB 1PBYA 1CLYH 3QXAB 3U9PH 1BPVA 3ARQA 4PJHA 4GW4A 3NA9L 2R29L 4KROD 3MLVL 1B4JH 3VWKD 4KZDH 3Q1SL 4FZ8H 4YHKL 4D0DB 3PDGA 3BMVA 5DA0B 5DDHB 2ATKA 1IT9L 4NP4L 4YHIB 3P4OA 4NM4H 1N4XL 4NKIL 4YBQD 5DK2B 5C0CB 1F11B 2ICWJ 5KSBA 5A43C 3R06B 3SBWC 5E4EC 1DR9A 3S37X 1HN1A 4JFFB 4ODWB 1MUJA 1U8QA 1EBPA 1GH7A 2X70B 4HWUA 2AXHA 2VKXA 3HI1A 3O6ML 3TO4B 3KPMB 5FM5O 4F57L 2DMBA 5IJKC 3L3KB 3VG0H 5CINL 4ZUSB 3UZVB 4C83A 4I77L 1ZLWH 3VGFA 5SX5H 4Y2DC 5ESQB 3Q1SH 1IGCL 2FECI 2NMSA 4XVUD 2NY4B 1UM4H 2CLVB 3UYRH 4L3ED 1KFAH 3ARFB 4P4RA 5EORL 2OJEB 3SKJH 4AENB 3X13B 1D5XA 4ERSL 1KTRL 2PYEA 3CGTA 2UYLB 3UTTA 5C0GA 2RR3A 4S0SD 3VXRD 3QG7H 2IEPA 4LARL 1TVHB 1WFOA 1DUYA 5EUKA 4PJBF 1CLOL 3VXSA 1FZOA 5MEQA 4CVZA 4LSSH 5DUPH 2ZG3A 5C9JA 3CFDB 4P46B 4F9PA 3V4PH 4BFGA 1FZJA 2BNQB 4HK0B 1FFNB 1S7QB 3R1GH 4DVBB 5D72H 1KCUH 3C6LA 4Y88A 4B5EA 4LCCA 3FHQA 4G42B 4GKZB 3UJIL 3MUZ1 1UQSA 4O2FB 3TYGH 5C0AE 4E41D 1N2RB 3QDJA 4FQJL 4GT7A 4NQEA 3TP4A 4CW1A 4MDJA 3RL1A 2CJUL 2DMKA 3BPLB 4GG8B 3QZWB 3VFOA 4MQSB 4UNTA 4HS3A 3B9KB 4Y5YB 4XP4L 1DE4B 4JO1L 4U1HB 4AIZB 3ULUH 3ARBD 3KJ4B 3MGAA 3N85H 5FXCH 4DQOL 4Y4HB 2Z92A 4PJEB 5EU6D 5JNYA 1CGWA 4JFHE 4QRRA 4WI2A 2X40A 2O93L 4XPFH 3WXVH 3BDYL 4LLQB 4HV8B 4P9HC 5I1GL 1SEBA 3JV5A 5DFVD 4XP5H 1B0GA 2QR0B 3TPUA 3FONB 1HKLH 4XP1L 4L5FL 1GGUA 2YBRA 4CGTA 4XNZB 4P4KA 3IDJB 1K4CA 2Q86A 2AABL 3MBXH 3TBTB 4L8SB 3EYUL 2EO1A 3SGJA 3UTZB 2DLGA 1WWCA 3OKLB 3UTOA 4K94L 4Q2ZA 1TJHL 2I5YH 3EYQD 4BSWB 3PWUA 4JRXA 3P11L 5SWSA 3VRIB 1OM3H 5CEZE 2ZWLT 4PRHB 1MHPH 5KSBB 3FMGH 4M7ZB 2P8MB 4PPTA 2BSRA 5BRZD 1QSVA 1C5CL 1DQLH 1VACA 3MUY1 1KJ3H 5K9JL 2FHBA 4H5SB 4FMFA 3S37H 4K2UL 3HI1B 4L9LB 2BX5A 3IDNA 4G3YL 5DJ2B 1OP3H 2R4SL 5I1AB 2J6EL 4XCYA 1I4FB 4KKAC 4M93C 5HHOA 3HRPA 4ZOAA 4OQ1A 2V2TA 2AABH 2ZCHH 4JVPA 3BHBA 1VGKB 3WIHA 4NPYA 4LCIL 3BDBA 5KVEL 5DK0A 1NMAL 5FUZH 5KVMC 4DKEH 4OUOA 1D5XB 3LV3B 2PYEB 1KJ2B 1TXKA 1I3UA 1MFDL 4WU7A 3TEUA 2BNRA 1LEKB 3B2UC 5EUKB 2UWEB 1FZOB 1PKQA 1QBBA 3IRZA 4K2UH 2WP3T 1LE5B 3PP3K 3UAJC 5CJQL 2FWOA 3DVIA 4QOKD 2DIBA 3UROR 3F7YB 4OZIB 2JCCF 4RZCA 5DR5L 3SJVA 4JM4L 3WNPA 2FH8A 3KR3L 4TVPD 4GSDH 2RCSL 3QDJB 4RSVA 5E8DL 2GJ6B 4UILL 1KPUA 5E99H 1IAII 3RL1B 4H1LB 1XGQA 1YEIH 4LCIH 5KVEH 1NMAH 5J4MA 1DQQA 5TDPB 3JBG7 1J18A 3HNTL 4FXKB 5DJYA 4PJXF 3WFEL 4UBDD 2Q3AA 5HVWA 1B4RA 1MSPA 1KIPB 4L8DB 4AEIH 1VEOA 4BZYA 4ZFGL 3FO2B 3MROA 5CGTA 2VL5A 4NNXB 1T4KB 4HF5H 1Y6MR 4DGYL 4RAUB 1K4CB 5C0DA 2Q86B 4HWEH 1I1FA 3EO0A 3GMPB 1CE1H 5GRUL 3DNKA 2X6MA 3C5ZD 5KANI 3EO9L 2Z31A 3LN5B 4YJZL 3OAUH 4JRXB 3HMXA 2GJZA 3SGEH 5EU4B 3DBXA 3DX9B 4KI5F 4KRNA 4F8TA 5DVNA 4AL8L 4Z7NE 4XBPA 3WD5H 2EDQA 3W5MA 1ULVA 2BSRB 2MKWA 1VACB 1MAJA 4K7PL 4ISVA 3INUH 2EYTA 3HNTH 3IDNB 1XCQA 4JFPB 3TBVA 2IC2A 5AWNH 4KMTL 1CD1B 1E0OB 5HPMB 5D1XC 4MJ2A 4ONGL 4XCYB 4H88H 5LBSH 4YEEA 1PEWA 5F6IB 1ZS8B 2OZ4A 4XTRD 2GSGA 1NBZB 3OR7A 4KVCH 4PJ5B 5C08B 3DIFB 3RRQA 5C0BA 2AXFB 2BVUA 1AQKL 5E4IA 4YDKL 1NAMH 2VZTA 5DK0B 4G7VL 4K94C 4JKKA 4YHMH 1E4WL 4K8RL 5F96L 2EEDA 1UWXH 4JPIA 1N59A 4P2OD 4WU7B 5DYOA 5E2UL 2AEPH 2M2DA 3DI3B 3ILQC 4PJGF 5FO7B 1NMBH 3T04D 3SDCA 4OZFA 1WQVT 5T1MA 1S9KC 5GSVA 1PKQB 5LXGL 4RGMC 4BUGA 5L9DH 5EZLB 3ZT6A 2VOTA 4J1UB 2DM4A 4GKSA 4U05A 1SJEB 3OKKB 3QUXA 3SJVB 5E95B 4HWZB 2EEAA 3L9RA 2CUIA 4E5XA 3ZE0E 5JDJA 5C09D 6FABL 1KPUB 1Q9OA 1GGCH 3IAQA 1FN4B 4KUZH 1I1CA 2IH3B 1EEQA 2J8OA 2IPTL 1YEGH 1A6AA 1T2XA 2Q8BH 5GRVK 2W07A 2ARJB 1P6AB 5KVGH 2DLEA 5D7JD 2YUXA 4Q74A 2PW2B 1CIUA 5F96H 4CMHB 1MQ8A 4U6XB 5ERWA 4HHAB 2W38A 1WICA 3O2DA 5JDSA 3DUSA 3NCCB 5HVHB 5ADOL 3QIBC 1ZGLA 4ODVH 2DJSA 2VIRB 5GS3A 5DTFA 5FF6B 2EC8A 3MROB 1GGBH 3Q5TA 4GRLA 2VDKL 5HHPB 4MS8C 4OGYH 5SX4I 1AFVL 2A83B 3GBNL 4FQIH 1T1ZB 4QRSB 1JGVH 1KTDB 1EHAA 3VXQB 2Z31B 1U58B 5MERA 1FFPA 1MQKL 1K6QH 3DBXB 3ME0A 3ULUD 3WFDL 3U7AA 4HMDA 3L3IB 5BMFL 3QQ4A 4JKPH 5EULV 3ES6A 2P48B 5F6HI 4WJ5A 3UEZA 4YHLL 1N8ZA 3GI9H 2AJYL 4K3JH 2EYTB 1N5YH 2VLKA 1GPOL 3TA3A 3L3JA 5I1JH 1RIUL 5ADOH 3CZFA 3C2AH 4LEXL 4M7KH 5TF0A 5BV7H 3BKML 1A6TB 3FFDA 3OR6B 1X5ZA 3RVUC 2E9BA 2JJUA 3SDYL 1AFVH 1OGAB 1AY1H 3VFNB 3GIZH 1QNZL 3MRBA 5I17B 4ZXBA 4IDJL 3FL7A 4KK5C 3UPRB 1R3HA 1A3LL 1MCKA 1RZ8A 1YPZB 2RIKA 4DN4H 4N8PA 4JPIB 4PJBA 3GHBH 4D9LL 1H8SA 5E5MB 4NZUH 5C0NC 5B38A 2J8UE 2XACC 4N0UE 5D7KD 2OQJA 5DQ9B 1CFTA 4M6OH 5LGKA 3SKOB 1HZHL 3SDDB 3RWDB 2V7NB 4NHUA 4JM2D 3IXAB 3U83A 1NCUA 1TQBC 3P40A 2ZKHL 5FYKH 1T03H 4GKSB 3SE3A 4LEXH 4PLOB 3BGFC 3QUXB 5IT2L 5GSRB 3L9RB 3NABH 5MI0B 2J2ZA 1DL7L 3NZHH 4HIJA 2R2HA 1YEKL 3HNSL 4I3RL 3RPIB 3DURA 1ZE3C 3LKPB 4MAYA 3TCXA 1FYTA 1IQWL 1A3LH 2AEIT 2F5AL 5ERWB 4D9LH 1SMOA 5IHZB 1J1XH 4K8RC 2B1AL 4NO0D 4YE4L 4B41A 4WCYL 5B4MD 2C1OA 4OIIH 1HZHH 3GM8A 1ZGLB 3PGFL 1CVRA 3D5OF 4PG2A 1PJ9A 3X14B 3CVHA 1E6OH 2BVYA 2CLZA 5JTWA 1Z3GH 1A6VH 3L5WA 5GS1C 3QPQC 4Z7VF 1J11A 3CFEB 5MENA 4PJHE 3RWFA 2EE9A 1FFPB 4KHXL 2X42A 1R5IA 3ZDXF 1MCPH 4P0DA 2WAHA 3QQ4B 3FT4A 2Y6SC 2CLRA 1Q0XH 1FFOB 2DQTL 3UJJH 1BBDH 1M71A 1NGXB 4XXDA 1ZK9A 4ODTH 4WJ5B 4CU7A 4MA8H 4CU6A 5LJYH 3QUYC 2VLKB 4JHAL 2CXKA 4XMPL 1D5ZA 1MJUH 1LO4L 5E8PA 1AGEB 5CEXA 1DBBH 5KTEH 1PKOA 2WBJA 4JPVL 4ZOBA 3NA4A 4BFIA 3BT2H 3LRGA 3I02A 4XNQB 4OCXL 2FJGB 2V5YA 4PLKC 4ZXBB 4NN5B 1JZ8A 1WCBA 1JTPA 3BJ91 2EDXA 1G7HA 2P8PA 3JSSA 2OQJB 4JFXB 5L2JA 2JCCA 3LKQA 4MXQC 5FOBB 1ERNA 5I0ZA 1CD8A 2DQIH 2FD6H 5C07A 1SY6H 4FTVE 4X7TA 5A2IH 1AI1L 4WW1B 3RKPA 3UTTE 5EOCH 4OLEA 2DI9A 3BW9A 3V4UL 4F33A 3VXSE 5A1AA 2R2HB 1P1ZA 3WFBL 1CGSH 3FT2A 2FH6A 3LKOB 5C0ND 1RHFA 1V7ML 1QFOA 3C5JA 4N9GA 3Q5YA 4NRZB 5T5FL 5DSCA 5C71A 1KPVA 1FYTB 5I15H 3DYOA 3FQTB 3FO0H 4PJXA 1CICA 3W0WD 2Y5TB 4YHZH 1CU4L 4NJAL 5T1LA 1IC5L 1H5BA 1YN6B 4L4JA 4NQEE 5C0EA 2CUHA 4OV5A 4Q97A 3VFWA 2C1OB 5B21A 12E8H 2XXCB 4OZ4A 2V17H 1FZKB 3ARFC 1P4IL 3GO1H 1KJ2H 5SWQA 2CLZB 1HOCA 2DWDA 1ADQA 1R5VB 2EZ0D 1X6NA 1NLBL 2Y72A 5FO9A 3IKCA 3V8CA 4MXWL 3UCRA 5MENB 4G6AC 4HMCA 1XGTA 3VGAC 4CRPA 4P46C 2VDNH 2GTWA 3FT4B 3U7YL 4KFZC 1Q38A 3GJFA 5C0JB 3OPZL 4K23H 4F9LC 1R0AH 1DCLA 4NJAH 1J1PL 1T1WB 2OSLA 3DSNA 4PRBA 1NGQH 5SWSE 4H1LH 3BPLC 1IC1A 2EIBA 4WDIB 5E8PB 1I8MA 5I1EL 2Q6WA 1S7XA 1G7JA 1HNGA 4WUUA 3S3SA 4ZUWB 4Y4HC 2F9BT 4BFIB 4F3FB 5IOPB 4ZNCD 1QHOA 5IQ7L 1T83C 3MRFB 4HIHA 4UINL 4FNLL 2VLME 3O41B 4PJGA 3QQNA 5KAQG 1HEZB 2F53D 3O3UN 2Q8AL 5HHOE 3OJ2C 2YPVL 4FP8H 1P7QA 2P8PB 3ZL4H 3AS0A 3ULVF 2X4NA 3WIHL 2JCCB 4R0LB 4I8DA 4ZS6D 1KB5A 1OAXH 4BH7A 4NN6C 4XVSL 3OV6A 5EPMA 1NCTA 1JF1A 1H3WM 3W2DL 4WHYH 5C07B 4NIKB 1I7ZA 4M7ZC 5DD0L 2CKBA 1T66D 2BNRE 3BW9B 2G60H 3REWB 3MMEB 1YYML 4DAGH 1P7KB 4Y8AA 2QQKH 2FX7L 2MQCA 3F58L 5F88B 1XIWA 3FB6B 2VQUA 1NPUA 5L8KB 1SVZA 5DZOA 4WHDA 5DSCB 4NWUH 4U6HB 1GIGH 4CN1A 4PJXB 4L29A 5EBLB 2ITDA 2FO4A 4WVRA 1N0XL 5BOZG 2FR4A 2PKDA 5L8JB 5FYKD 5C0CD 4NJ9H 3WUWB 4NBXB 4MMZC 1F8TL 3BIKB 3Q6GH 5D96C 4JFFD 5FO8B 5SWQB 3T65A 1YQVL 5FO9B 3IKCB 5CWSB 1LD9A 5I76B 4I48A 3TO4D 1BZ7A 1NFKA 1YYMH 1HHGA 4FFVD 4Z0BH 1HDMB 4F9PC 1NGYB 2GTWB 1BGXL 4DCQA 4RMWA 3MRIB 3OKMA 1FFQA 2NY4D 3C6LC 4LCCC 1WZ1L 3P30L 5HI5C 5EUOB 3HMXL 4FABL 3IJHA 3OJVC 4JQXC 1F8TH 1I8MB 1UFUA 4AT6B 4PV8B 2Q6WB 1RFDH 3QCUH 2DQGL 5IR1A 1MCRA 1JCKA 1MHEB 2GSIA 4QXUH 1NKRA 2BNQD 4HIHB 4IM8A 1MRFH 3MNWB 4OB5H 1RMFH 3CIQA 3RTQA 5IEKB 2D0GA 2NX5A 3VCLB 3G9VA 2EDTA 1PG7L 2OZ4L 3QJFB 2IAMA 1P7QB 5GZND 4DOHE 2EKSB 4P4KC 1U92B 4N0CC 2G75A 5C0BE 3SGJC 4AH2A 5DJ6A 4UUJB 5GRJH 3B9KD 3L3HB 4S2SA 2W91A 4XC3H 5IBUB 2XZAL 4LLDA 4LRNH 1JPFB 3KJ6L 4LLUB 1JF1B 3V5HB 1U6AH 3V6OA 2BSSA 4Y16A 4FQPA 4MCZB 4JO3L 1LE9B 3P9MA 4NFBA 3CAFA 2GJJA 4PS4L 2XFXA 5F7KC 2ZNXA 1JWSA 1AGCB 3K1KC 2ZSWA 1J05B 3DX6B 4ONOA 4L29B 5HHVH 3JV6B 5MEOA 1ZHKB 4M03A 1VA9A 1IBGL 2QADB 4NUJA 3RQ3A 1MCHA 5FDWB 2IQ9H 4PRHD 3ECBA 3GB7A 5FCUH 1UJ3A 1A7QL 1B2WH 4I9WD 1RUPL 4HAFA 3HNVL 2P47B 1WISA 4Z7VA 5J13C 4ZTOH 4NRYB 4GOSA 3FN0L 3DHMA 2FBOJ 3O2DL 4FOMA 3QO1A 2CRMA 5IWLA 1BZ7B 3R8BB 5DD5L 5D7IB 3JTTB 4M62L 1HHGB 1JUFA 5L0QB 2Y06L 5EC1A 4GQ9L 2E27H 3T4YA 2AS5M 1L6ZA 1BQHG 1X5GA 1EMTL 2OMBA 3MLZH 4XPBL 3HN3A 3CH1A 4PTUA 3ZO0A 1JHLH 1Z9OA 5DXWA 2KDGA 3H8NA 3C5SB 2BMKA 3IJHB 4B7IA 2PYED 4R8WH 1KEMH 3I75A 1K4DB 4G9FA 4PJDB 2DI8A 3VA6A 5JXAH 5IW1A 3GSWA 3CSGA 3BKJH 1K5NA 3FN0H 1LO2L 2GSIB 4XP9L 4GKOA 3MRRA 1YEFL 3BQUA 2XG4A 5HVHC 3UPAA 3I6GA 3QDJD 5DRWA 4PBXA 2IAMB 4OCRL 2GJ6D 1T04B 4Z78A 4HUXA 3VWJB 3HRZA 2HLAB 4AH2B 4S2SB 5D8JL 4LLDB 2Z31C 1JE6A 3FB7A 2HN7B 4X6BA 2BSSB 1MI5A 5HYQA 2OK0H 4PJBE 4ZQKB 1FCCA 1ND0B 4LCWA 3SE4A 1FPTH 5CSGA 1KN4H 4XB8A 5GGSB 4G6JH 1HHHA 1NKOA 2IADA 4JG0H 4Y19B 3V9FA 3WUZA 1RJYB 1V3KA 1B0RB 3G08B 1JWSB 1YNKL 4XP9H 5HVFB 3BEWB 1D3CA 5F7NC 4NDMB 4PRAB 3UX9B 3VXPA 4XWGH 4D3CH 3VXUE 4AEEA 1WEJL 4P23B 3G5YA 3ECBB 4NRXA 3GB7B 3M07A 4ORGA 4HUUA 5D8JH 3RAJH 1MCJA 1N6VA 3O9WA 1CGXA 1XAUA 3MRHB 4UI2A 4HKXA 4WFFD 1KCSH 1YEJL 4NHCH 5J9PA 2ADJA 1BJMA 3MGOA 5TE6L 1E4XL 3F7QA 4EI6B 4WIQA 3TV3H 4YGVA 35C8L 3MX0A 2R9HD 3SDCC 3M17B 1FNLA 4RGOH 2ZUXA 3WNOA 2DD8L 3PABA 3VA2C 3CVHL 5F72S 1FRGL 3I50H 2W0LA 2DQUH 3T4YB 4PB9L 3DOSA 4Z77A 3H7BB 4ZFFB 2HTLC 3O2WH 4JJ5A 3QUXC 4PJ5D 1BVLB 2NY1C 5C08D 3IU4L 3U0WH 1IEHA 1I1YA 2HAZA 1VFUA 1BD2B 4IJ3B 2APTA 4EKXA 4WI6A 1QBML 1OAYH 4R96B 4WEUD 4NC1E 1OF2B 5K9KA 1LO0L 2XA8L 3MGTA 1E27A 4DKDC 2P42B 2APFA 3HC4H 4OD1H 5I1IL 4XMKL 3BQUB 2F74B 3TLRA 5JLZA 1VADB 1KOAA 4WHYG 1L9MA 5JO5A 1L0YA 5ESVA 2ILLA 3IDYC 2W9EH 4OF0A 3DXAA 4GRLC 4GG6B 3IDGB 5C6TH 3EZJB 4DGVH 3SOBL 3Q3GB 3S9DB 5HYJA 3BVNB 2QHRL 1CXEA 5AAMA 1KGCD 3FB7B 1A7PL 3RZCA 5I30H 1FGNL 4TSCL 3GMLA 3CVIH 4XX1G 3GSQA 4QY8A 1CZ8L 1IGML 5CSZB 1HHHB 4L4VA 1SQ2N 8FABB 1AD9A 3Q2CA 4F58H 1LP9F 2GAZA 3TA3C 4OF6A 4GW1B 1HH9A 4GUPB 5I1LA 5DD6B 5AG9A 4HGKC 3O11A 4MZ2A 3L1OH 5B22A 3QXVA 3E6HA 1P84K 5I0DA 2FNBA 1G9EA 4ORGB 1FORL 4G8FA 1MF2L 1NCBL 4ZXBC 1FGNH 5IFAL 4TSCH 3TT3L 2ADJB 4N1CA 4XNXH 3U79A 1J0KA 1T1YB 4YGVB 1UCTA 3PV7A 1CDJA 3ESUF 2JIXB 3ETBF 4RDQF 4QHUA 3GSVB 3VRJB 4LCUA 2JJSA 4Z77B 1ADQL 3SE3C 1W2KT 1OGAD 4KI5E 2BOCA 2BERA 4FQCL 4I18A 5LAXA 5B39A 5IGXL 1JGUL 4ZUVA 5JQ6L 5DT1L 1W8NA 3K81A 2DBJA 1N0LA 4G5ZH 4PJIE 1H3VA 3CSYB 3VFSA 3PQYA 4MAYC 1A1MA 3LD8B 3LKRA 3A0OA 4ZOCA 2EC9U 3SDDD 5K9KB 3TH2T 4R7DA 4AG4L 1NANH 1W72B 1KBGL 3EHBD 3MR9B 3I6LD 4U0QB 5I9QC 4Z95L 2MJWA 4YAQA 2X4PA 4G8EB 2Y9RT 5JO5B 3V52H 2LU7A 4PG2C 2YZ1A 2CRYA 4UDTB 4WUUE 4JGMA 2WZPD 1FVEB 5J11B 2HTKC 1JYXA 5HHQA 3DRQA 1U93A 3C2SA 2J8UB 1XGYL 3WKMH 4PJGE 4ZNEA 2DB8A 2QQNL 3MLTA 2E7LA 2VRAA 5HI4C 3UXFA 1ZHBA 3PHSA 4Y4FB 2FCBA 4ONFH 4LMQE 3MLWH 1KB5L 3VRLF 4G7YL 5IB2B 1EEUA 2X7LA 4YLQT 4NC1C 2PYFA 2W9DL 4IOFD 1KIRB 1AD9B 1H3UA 3KHQA 1MFAL 2Z4QA 2RFXA 1YUHB 1Z9MA 5ILTL 5BVJA 1BVKA 2B8OT 5CS7A 1HH9B 1ACYH 3ZHDA 3QRFM 2CKBL 5LGHH 2R0LH 4POZD 2ESVB 2FB4L 2NR6C 1F4WL 2YPKB 3HUJF 3DPBA 5KVDL 2M1KA 1CK0H 2WBJC 4RFEB 2V9RA 5HJ3B 3MCKB 4QRUB 3QRGL 2H9GA 3O6LL 1I1RA 4PJAF 4YXKL 3RJDA 3GNML 5DGQA 2NW2A 4LDEB 2V2XA 1A0QL 4XNUH 5TJWK 5ID1A 1FQ9C 1HWHB 1U41A 4U6TA 4XBEL 1QLRA 3TBYA 1S8DA 1F4XH 4XVTL 4HK3J 4YHNB 2XN9E 2EDKA 1FE8L 2O61A 3NN8A 3DJ9A 1YY8B 1U8MA 3AAZA 5LQBH 2HJLA 5J06A 2IANE 2XOTA 4PD4K 3S34L 5JHDA 1P4LA 3DMMD 5JXEA 4G6FB 3S36X 3LKSB 2Z91B 4QHMA 1G84A 1A6ZA 4UQ2A 4I1NB 3ZYOA 2J3SA 3GUTA 2FB4H 3QQ9C 5LAXB 3DV4B 4ZUVB 3IVKA 1WFNA 4NFCA 2VE6A 1MREL 3WHE1 3TC9A 1RV6X 3NCMA 4K7FB 3GNMH 1CFSA 4JZNA 2OL3A 3PQYB 4X99B 1A1MB 3LKRB 1CXIA 5CZKA 2AJ3A 2IPUK 1EK3A 3S88L 1CICC 3ROOA 3GI8L 1H5BC 3ARGB 4Y5VB 1DFBH 5DEGB 2ZOKA 3QDGD 4BZ2H 4OKVA 4W81A 2CRZA 1WIPA 5K9OB 2NY2B 2I26N 3BDXA 2PCPA 4TSAH 1HSBA 1T3FB 4LF3A 1QUNA 4P2QB 1F13A 1TZGL 4KI5C 4PREB 1U93B 3KS0J 1R3KA 4K3DL 2AV7B 1NQBA 3EOAB 1FYTD 2LAGB 5IMKA 3UDWA 2NX5E 2CK0H 4ODBD 5GJSL 5I6XC 4I13B 1F00I 3GSRA 3RI5F 4YH6A 4F7MB 1KYOK 3Q6FB 5TDOB 1C5BL 3GI8H 3BXNA 4PP1D 3H0TA 4A6YB 5A2FA 2Z4QB 5BXFB 2RFXB 1C16B 3O3BB 1BVKB 3V6OE 4J6RL 3MRMA 3S36L 4P2RB 5F7EL 4LSRH 1QSEA 5F1KC 3D0VA 3O4LA 5B38G 2YSSA 3W11D 5MEND 1J1OH 4XCEA 5HHXL 3MOQA 1A6UH 2DKSA 3HZMA 2BZDA 1MHCA 1W0WA 2AK1L 1NCAH 2E7HA 4YDJB 2H9GB 3EOBB 2AK4D 4HIIB 3QAZB 2CGRL 5IKCB 4K3DH 2NW2B 1OTTD 3AVEA 5DJ0A 3DSFL 4M9PA 1J8HA 3VFGH 1MVUB 1BQLL 2FEDC 2A77L 1QLRB 5ICYA 5GJSH 3FRPG 3EOTL 4PJCB 5L7XL 3NN8B 3MV8B 2HFFB 3D3VB 1ZLUK 3BFOA 2RBLA 2MHAA 4JCMA 4BQBA 2Q7YA 1I8IA 4D0CA 5JHDB 5KW9L 3TIDA 4NQTA 4IMLB 1N6QL 2GITA 1L7IH 3KNBB 4Z7VE 4MQXC 2YMXH 1A6ZB 4HBCL 1ZT7A 1UB5A 4JY4B 3F6LA 1MAMH 3ZDXE 2A73A 4U33A 4XVJL 1J8KA 2AK1H 4OJFH 2F54B 1HHIB 4DKFL 5IFHH 1XIWC 1S7UA 1MIEH 3N1MC 2HH0L 4OTXL 5J6GA 1LQSR 3ROLB 5L2KE 4RNRB 4LU5H 3QNXA 1AKJA 5TDNA 2XTLA 1G6RB 5IM7A 3GMQA 2WLYA 5MEPA 1FL5A 4OZGB 5E1AA 1FC2D 1G9MH 3MXWH 4LGPB 3I2CH 1PZUB 3K0WA 4H20L 2B1HL 4WWKA 2BJMH 5DMKA 5BZDA 3TWCL 2R56H 4R90L 4N90D 5GGVL 3HFMH 1KXQE 4L8BA 4QHNA 5EOQH 3TN0A 1GSMA 4W68A 3Q48A 4LF3B 3H6JA 3VXMB 5DD3L 5ITBH 4GMSL 1JNHA 2A1WH 4BM7A 2EIZA 3FQRA 1LK2A 5C6PB 1HYSD 2XKNA 2ICWB 5DZLA 1FLRH 3SQOL 4D9QD 1YJDL 3V4VH 4RBPH 4U1SA 3BD5A 4PTTB 5KSAA 1A14H 2AV1B 2QQLH 4MA7L 3V7MA 3GSRB 5CFHA 4MCYB 4HKJA 1LP9A 1D6VL 2CD0A 3OKNA 4HWBH 4PRNA 2C26A 3WNMA 1E4JA 1SM3H 3BXNB 2L0DA 4HUVA 1QLFA 1NBVL 1UB6B 4Y4KA 4K3GA 1FV1A 1MI5E 3DECA 2B1HH 3N9GH 3BSZL 3MRMB 4JREB 4LCWE 1M6OB 3RDTB 3JV4B 3MPCA 4NZJA 1AP2A 4PGCA 1U8HA 3FFCA 1KPRA 5DD3H 5DUMH 2Y07H 4KQ4H 4QYOB 1ZLSH 3X3FL 1N26A 5JORB 2ZP0T 5GISL 2WINA 1J8HB 4UOW1 3RTQC 4LHUA 2VISA 4LNRA 4S1DD 4MA7H 2IAMC 3U2SB 4ELME 1RUAL 1T20A 3K4DA 3QEQA 1D6VH 3L3DA 2MHAB 2P5EA 3G6JE 4I0PB 5D7LA 1I8IB 2P5WB 4D0CB 3TIDB 2A6IA 4PRDA 3FCTB 3MODL 4M6ML 3RVVC 3HMWL 3U6RA 3V6OC 1ZT7B 4TQEH 1HXYA 3C87A 4LPTA 4Y16C 1LK3H 1PX3A 5KN5A 4V1DB 1OTUD 1A8JH 3IETA 4YR6B 1I9RL 1S9YB 2A73B 2P8LA 1U42A 1PYWA 4KK6D 4XXCA 3CDGB 5BCAA 1OAQL 2FEDD 1VEMA 4O5LL 3EDFA 1G7QA 1DLHB 5E08H 1IKFL 43C9A 5C0FB 2ZPKL 2VDML 4MJIA 5EA0L 5TDNB 2R2BA 4G6KH 5MEPB 2MSPA 4JFOB 5E1AB 5FGRA 5I8EA 1TZIB 2I07A 4IRJB 3S97C 1CQYA 4NO3A 2YUZA 2NW3A 1UJ3C 3MODH 3P73A 2OTWB 3TN0B 3EFDH 1F6AA 4JFZL 3WO3B 4PR5A 1W8OA 1R3IL 2X4SA 4QRQA 3OXSB 5A16A 3IJSA 2UV3A 2VDPH 5IWLC 2VQTA 3DYMA 5T3XL 2FYYB 3FQRB 3RFZC 2B2XL 1LK2B 2HWZH 3ULVL 2NY3B 5T3XE 1OAQH 2XKNB 1DBML 4MNQB 4WY7H 3ULVE 3CC5A 2DKUA 2HVJA 1JPGA 4MDIB 4U1SB 2VAAB 3MV9B 3HC0B 1U8LA 2QADD 2H2SD 1F2XK 2G9HA 3DXAE 4EUPB 2BNUA 2R1XA 3QWQB 3S4SB 3OKNB 3MV01 1KN2H 1RVFL 5C92A 32C2A 1NEZA 2HA1A 4HUVB 1QLFB 3HUJA 4Y4KB 5BS0A 3D9AL 3K2UL 1FV1B 3KPRA 4JRWA 2IMNA 5ENWB 2O5ZH 2FJHB 4X5WA 3MRJB 5D5MF 1AR1D 1KLFA 4I2XE 1EHLH 4L4VE 4PJAA 3QCTL 1NGWB 1OLLA 3BEVA 1QBLH 3X12B 1U8HB 3HE7C 1W72H 2GCYA 4OUUB 4DUVA 1RULH 3OJMB 3KPSA 2C5DC 3O8XA 3A6CH 1DBMH 4ODUB 4GH7B 4JANA 3EJYD 3D85B 1FNSL 5CEZD 2YD8A 2VISB 1WZLA 4WU5A 3CCHB 1YJDC 3QI9B 3T0XA 3WL9B 3EOYG 1T20B 5F3BB 1OAZL 1P84J 4RA0C 2H8PA 2J88H 4E42B 4LSPH 3IXTB 3RNQA 4HJJL 5DC9B 1NC2D 2YD9A 5DMJB 3PJSA 3ILPA 3BO8B 4EBQH 1B90A 3S96A 4HQQL 1ZA6A 2IFFH 5L88L 4MA1C 5F7LB 1G7QB 2PO6A 3OKOB 4BH8B 3F5WB 4PG9A 1HI6A 3IDMA 4UQ3B 3VWJD 3QCVL 1FSKC 1FNEB 5I8EB 4BSVA 2VSDA 5E2VH 4HK3N 3OAYH 4FMKA 4OV6F 1OAZH 2ZOLA 5CJOH 3SE9L 3T2NL 1CYGA 3DUUB 3O9WC 3K4AA 1F6AB 4Y19D 3PXHA 4WGVB 1IAIH 3D2UA 4QRQB 1RU9L 1D6EB 4RIRB 1ZT4B 4YQXH 2R0WL 3RGVA 1N3NA 2XWBB 3MXVL 2HVJB 4KU1A 3RWIA 4FXGA 4P23D 1U8LB 4FQQB 4GQPH 5FYKU 3JTSB 4TYUA 1N5AA 3BH8A 1V8HA 2OJZL 3FZUD 3WE6A 4MX7A 2XQYG 32C2B 3C9NB 4X8JA 1NEZB 4HEPG 5F89B 1M7XA 1F58H 4WHTA 3WIFB 4M3JA 1U3JA 7CGTA 2VC2H 4CNIA 1CFQB 5AEAA 4NQSA 4JN2B 4X5WB 5MP6L 4RFNB 4HMEA 3FT3B 2HFEB 3EYOB 1ZLWK 4ENEC 1RU9H 4HIEA 2DICA 4U3XA 3T2OA 3HCVA 4QRTB 1UWEL 4HUNB 1E4KA 4QTIH 3T0DA 1QPPA 1Y6KR 5T1KA 3VXUB 3WO4C 1DEEA 3ULVC 3D25B 4QNPE 4U49A 3TNNB 4YDLC 4Z8FH 3KLAA 5CLTA 1BD2D 3OKEA 2VZ1A 25C8H 1GGIL 1BX2B 1DQJB 4J3TA 3W82A 3SHSA 2D9CA 1MEXH 3RZCC 3V6FA 1OP5H 3FN9A 3PJSB 1ZKAA 1PEZA 5BVPL 5MP6H 4WUKL 2PTTA 3KAAA 3BQUD 5EWIH 2XI9A 3QFJA 4A6YH 3IF1B 2EDRA 5GGRA 4PD4J 1UWEH 2D0HA 1U8OA 4X4XA 2ORBL 2Y4SA 3OF6D 1IGFH 4U6YA 2R2EB 3ET9F 1OPGH 4I3SH 5I8CA 2DQCH 5TF1L 5F7WC 4D0BB 1A3QA 1RZKH 4RGNB 1ONQA 3BPCA 4JFQA 1AGDA 1R24A 2OL3L 1X5KA 1VHPA 3S5LA 3P9WB 4YEFA 3MRNB 3TZVA 4UTAH 3MRDA 1CDBA 1FGVL 3QFDA 4R26L 5F7DA 1XZ0A 4QHKI 1QRNB 4OD3L 3TIEB 2DL9A 4EI5A 3RGVB 2XTJE 1BLNA 1MH5A 1MRDL 4BFBD 3LPGA 4Q6IB 2MTPA 3MNZB 5MHSE 2JJSC 2ORBH 3B6SB 4X8XA 3BPOB 4TULH 1JF5A 1Y18B 3WE6B 4NQDA 4A2LA 4I18C 2DTML 3NACL 4HUKB 3G5XA 5AYUL 3BX7C 5SWZB 2FATL 5SX4H 1S7TB 1ZXQA 2O5XH 1NCWL 3STLB 2AJXL 4Y5XA 1G6RH 2GUOB 2X1WL 2MPAH 2PXYA 2JIXD 1G0YR 4P5TB 4QT5B 1KYOJ 3QUZB 4NUGH 4HH8A 5DMYA 5T5NF 3HCVB 4M9OA 1G7IA 1I3RB 1EGJH 1A1NB 5T1KB 5GRYA 1A7NL 4X4YB 4MJ6B 2BRQA 1QSEE 4FQ1H 4JPWL 3PWNA 1MRDH 1QVOB 2X4OA 3O4LE 5EC2A 1NGPL 2A0LD 2C3WA 2OR7A 2YRPA 3HG1E 3KPQA 1BFSA 4FRWA 5FYJH 1QFWH 4AZ8A 1ZOXA 3TCLA 4K07A 4X6FA 5FECB 2H32A 1IAIM 3NTCH 3DV6B 4NQCA 2E7LC 5HI3C 1LDPH 1NL0H 4EN3A 4OCWH 4RMSA 5TE7L 4U1IA 3LQMA 5IHUL 1WC7A 4JY5H 3FTGB 2N7BA 1CLZL 4R4NC 2WMPA 3GSNB 5DUBA 1C5DA 5CBEA 2VXVL 4WO4B 4Z9KB 4ZSOA 2B0SH 4RQQA 4ZPTA 2IQAB 2H1PL 2XWTA 5D1QB 4PJIB 1I75A 3CMOL 4J4PA 1ONQB 3BPCB 1FH5L 1S7SA 5EZJA 4Y4FD 4HXBH 3S5LB 3SDAD 2BSED 3T4AB 3TZVB 1U8IB 4XGZB 5JR1L 1IAMA 1KLGB 3QUMB 3K4ZA 4KPHL 4LLVA 2CDGA 2XPGA 3FJTA 3CUPB 2DWEA 5JXEC 1BLNB 2ESVD 1LVEA 1MH5B 1YQ2A 1G7MA 1O7VA 1UKSA 4JO4H 3TVMB 5CJ8A 5FHAL 4R2GC 1D5MA 2J4WH 4M1CC 4MAUL 4ZUUA 5JPNA 2ARWA 5D5MA 2N1KA 4NZRH 1DANU 1WF5A 2PF6A 1PQZB 3FOMA 3OXRA 4JHWL 4LSDA 5F3HB 4M1GH 5M7QA 3O81A 3QHFL 3TBSB 1CT8A 4Y5XB 5HDBF 1LP9E 2PXYB 3GK8L 5HHMB 4MA3A 4G6FD 3C60B 2AVGA 4KC3B 4Y0GA 4YBLB 5IB4B 4U1LA 3QSKB 4J3XA 5GGQH 5IHLB 5F9JA 4DTGL 3QIWB 4JZJA 4E0RA 2ZUSA 5F1SA 2XTJC 5EC2B 3HR5A 3G5ZB 3SY0A 3T09A 4P59L 3KPQB 4HG4K 4JFDE 2AW2A 3FFCE 4JO2H 3WXWH 2FGZA 4IHOB 4DW2H 4G8IB 1UVQA 5DJCA 1PD6A 2H32B 5CD3A 3WFZA 2DJUA 3SPVB 3UDWC 3KPLB 1QSFA 4I5BA 2JJVA 4U1JA 1U0QA 3S3PA 3ARGD 4EUPH 1M05B 4D8PA 2MWCA 4U1IB 3QEQE 1UXSA 1WC7B 2P5EE 3IFOA 5DJZB 4JDTL 1DDHA 1SYSA 1N64H 1F90H 4M6AA 4KDTA 2NY2D 5DUBB 4PJ7B 4NOFA 2BSTB 5DS8B 2VDLL 1T1XA 4I4WB 1RJLA 4P2QD 4LASL 3GMMA 2HJFB 3RP1A 2AJUH 1IC4H 1SBSH 5CP3H 5TGBA 2VZVA 2NXYC 3KLSA 2ITCA 3MSPA 5FEBA 3ZE2F 2Y36H 4NQVA 4UT7H 3I6KA 3JXAA 1Z9LA 3C6SA 4LEOA 4X9HA 4KTEL 3KYMB 4MJIE 1A4JA 1UCBL 4WV1A 2F19L 4FTVD 5A3IC 5B39G 2EDDA 3T0EB 5EO1B 5IJVA 4P2RD 2XPGB 2DWEB 1ZVSA 4XP6L 1BQSA 3FB5B 4Q9RH 1QFWM 1I9EA 1EA9C 1IGJA 4U1GB 5DQDH 3SEPA 3VWKA 4M5ZL 4POUB 1G7MB 1IJ9A 5KANG 1RJZB 3CK0H 1F3JA 3WMSA 4FFWD 1EUUA 4UIMA 3OXRB 1ZEAH 5I75C 5C8JB 3GGWA 1U8KA 4EDXB 3MV8D 3D3VD 1T5WA 3HPLB 3ULUF 1A1OA 4Q6YA 3EO1A 4M7LH 4J23A 4AMKL 1UH4A 1RZIB 3AGVA 4O51A 4GAGL 4U4BA 4X0KA 3HUJE 5BS0E 5E5UB 3KPRE 2HMIC 4E0RB 4WWKC 3F7RA 1FCGA 4KRPB 4PJAE 1J0HA 1AHWB 1C1EL 2F54D 2VUOA 2C3XA 4A2MA 2WQ8A 5I74C 3U4EB 3KPSE 3F7PC 4L3EA 1AGFB 3P77A 1MJ8L 2VLRB 1QO3A 2NY3C 1O7SA 4LPYA 5JZ7D 5FYLH 3MREA 5EBMA 3VFTA 4KV5F 3ZTNH 3FRUA 1MCOH 3MJ9A 4Y1AA 1MJJA 1UZ8A 5KSAC 4CVUA 3VXRA 1UXSB 5JOPE 3IFOB 5F1NB 2GK0A 3VH8B 1SYSB 2NY0B 1BEYL 4DKAA 4GAGH 3BE1H 5JIPA 2NY5L 2WQRA 1ITCA 1WFUA 3OL2A 3TJEL 2YKLL 1IM3A 2VLMD 4Y4KC 2I60L 2C4FU 4R97B 2QSQA 4IIQB 3VXMD 1X6LA 1CGUA 1JNLH 4K71B 4JM2F 1B6DA 3HZKB 3H3KA 5FYJD 3M8OL 4YXHH 4G80B 4E41A 4X5XA 1WWAX 1T21A 5B8CB 3DRTA 2YEZA 5H8DA 3U0PB 5T1DH 1S7VA 5C0IB 1BIHA 2CH8A 5DRXA 3I6KB 3L7EB 3ARBA 3FO9B 4WV1B 1TJIH 3X11A 1I9IH 5EU6A 2H26A 2MQ0A 1L0XA 2Z8SA 1WITA 3I85A 1XCTA 2VXQH 1GZPB 3L3GB 3RDTD 4GRMB 1INQB 5CIPH 5IB5A 5TE4H 4UB0L 4X7SL 2Z93B 2AGJH 2ERJC 5JA8B 3BAEH 1IGYA 3BGMB 2CK2A 3STZA 4OCYH 4XH2B 2ZCLL 3KYOA 1WTGT 1MLCA 4XXCC 4UIMB 5I1CH 3VXNB 2MCG1 3BZEA 3VXTA 3MRCA 4M48L 1BIIA 1KLUB 1GZQA 5JHLH 1S3KL 1T5WB 3LKNB 3LEVL 5BRZA 1JMXA 4I0PD 4LOUC 2ICCA 2P5WD 1HIMH 5A2LH 1EFQA 4KQ3L 5ALCH 4F7EA 5IVNA 1LMKA 4ZFZB 3MRGA 1T0NB 1BZ9A 5JW3L 3FAXA 3WFCH 4M5YL 4KZEL 5HGAB 4V1DD 5EZIL 3NH7H 2CIKA 4HIXH 3U30C 2D7MA 3OGCA 1AJ7L 3HC3L 3DUHA 3NIFE 1G9NH 3HI5H 4U3CA 4KHTH 5HYIA 1EDQA 4YHOL 2L7JA 4WI7A 3TESA 4YDVA 4GAJL 2YXFA 2X9YA 5DMIL 4ELMB 1CXLA 3WEXB 3FOLA 2EH8L 3RNKA 4ZS7H 2R1WA 5EBMB 3VFTB 2IMMA 1WBXB 4Y1AB 1UZ8B 2MMXA 2BVOA 4IRJD 3PP4H 4TUOB 3LEVH 4XAWL 4NGHL 3HPJB 1YY9D 4FZEL 5DK3A 4C55A 1IZJA 2D7OA 2O26U 5JOFA 1AE6H 4MNGA 1SJHB 3WS6A 1M7DB 3FO1A 4QOKA 1R3LA 3TN0D 3RUGF 2YK1L 4KZEH 3RVTC 1X5IA 1MFEH 3LEYL 3RVWD 3RKDC 3QXDA 2R23B 2NY3D 4WEMB 4MNQD 5JW4Q 3DRTB 3D39E 2EDHA 5GHWL 1NMCB 3NCFB 1S7VB 2R39A 5DRXB 4ZAKB 1W0VB 3H42L 3MV9D 5IB1B 3AS2A 3G6DL 5DF0A 3O8XC 5INDB 4N5ED 4YNYB 3DETC 4R4FH 1QA9A 3GSOB 1F6LL 2D7QA 2YC1B 3WHXA 4LKXA 1DANT 3E6FB 4O2CA 1CIDA 4Y4KD 2EDLA 2H26B 3NCYP 4M6NH 5LVEA 4RFOL 2FJFB 1S78C 4UAOC 4APQB 1T6VN 1PX4A 4U1KA 3VD7A 4QHLA 3PL6A 5C3LD 2NY5C 3ARPA 1DTUA 3B3IA 2HT2C 4Z76B 1RI8A 4ONHB 2LVEA 3TH4T 3GSUA 5AZEH 3C5ZA 4KXZI 2AKRA 1U8PB 5IK3B 2D9QB 5DJ8B 3MFFA 3D85D 5CP7B 2FEEI 1ROWA 3GSNH 4H26B 1MVFA 3BZEB 3VXTB 2PO6C 3QI9D 2WUBL 5C0RH 2FGWH 3MA7B 4IRZH 2YD2A 4OFPA 4NQDE 1IGTA 3RIAK 4FFZH 3VGGA 2HLFC 7FABH 1EHXA 4XCCL 4JG1L 1G0DA 2XKSA 4EQ2A 1IQDA 2D4DA 3CMGA 1U36A 4CVXB 4S0TD 5CZVH 4LVEA 2BK8A 3CXDH 3VFPA 4WNQA 2CMRL 1DN0A 1LO5A 3KYNA 3QG6A 1QR4A 1ZA3A 3ARRA 5J1AB 3QUMH 4YWGL 1A2YB 4XPAH 1NUGA 3JWOH 1MCLA 1D5IH 5GGUA 3RNKB 3RWJB 3G04A 4EOWL 2X4RA 4P2OA 5DJDB 2Q20A 4G6MH 3BPOC 2DLFL 2APVA 4BA8A 3MC0A 4EDWL 4YHPB 3BZ4B 4M43L 3FO1B 1NSNH 4QOKB 3VJ6A 3PGCA 1MIML 2EXWC 4NQCE 4LHUG 4YGAB 2EYRA 4ODXB 1YC7A 1WFTA 4PRPB 1UEMA 4RDQG 5JUEH 2CMRH 1JGLL 3A6BL 3LB6C 5C09A 4J3VA 5FGBA 5CBAA 4OLWL 3LSOA 4P48A 4B53A 4S1SL 1S9XB 5FYLD 3RX7A 2R0KH 4IRSB 1E4KC 4AEHH 5I1DB 2QSTA 5D7JA 2DQJL 2Y7QB 4ZSOE 4BJLA 4C56E 2NNAA 3V7AG 3G5VB 4LKXB 1BFOB 4P9ML 4OCMC 5ID0A 2D4FA 4DGIH 1TENA 3TPKA 3EDKA 4LSTH 2H32H 3BH9A 4YDIH 2WIIB 3B83A 3MOAL 4LBEA 2EXYD 4U1KB 3L95A 2VDOL 3RVXD 4QHLB 2BC4A 3PL6B 3OG6B 4XB7A 2DQDL 5JA9A 5HYSB 3MCLL 2JLLA 5T33H 3B3IB 1BJ1J 4JY6B 3WLBB 9CGTA 3VXUD 3GSUB 3NFSH 1RAMA 2HT4C 1KXVC 3JWDH 4QCIB 3TT1H 2R1YB 5DFWH 1JPTL 3B9AA 1ZTXH 3NPSB 1Y0LA 4Q9QH 3MV7B 1DSFL 2QSCH 3AUVA 5D5ME 5A40E 3M1BA 1IQDB 1Q72H 5ISZB 3P4NB 1F3DH 2GTZA 1JPSH 4MD4B 3TNMB 1TVBA 4F2MB 5HGHA 1DN0B 1LO5B 2DQDH 3KYNB 1EJ6A 4FA8A 3TZVC 3KPPA 4DEPC 5B3NA 5BQ7A 3V6BR 1OW0A 4X9FA 3RWHA 2CSPA 1NEZG 4MVBD 4NKOB 1PLGH 4OZHA 1RK1B 3PGDB 4NT6A 2A9NH 1VFBB 1KENL 3GFUA 1U3HA 5DEFA 5C3TA 4TSBH 4EI5C 3CLEL 5SV4A 5FUOL 1NFDB 4XHJD 3V5DB 1I3VA 5ANME 1JPTH 4CAGA 2YXMA 4RGND 2OMNA 4HG4J 3MYJA 2XXMB 2FBJL 3F65A 3NZ8A 1QFPA 4JM2A 1GGYA 3VJ6B 5HDQH 3GM0A 3MRKB 1FP5A 2Y1VA 4F7TB 1QSFE 2VQ1A 5I19L 3V79C 5GIRB 4OT1H 4TRPH 2Z35B 3O3EA 1JK8B 4KVNL 4Y5XC 1TIUA 2F58H 1PZ5A 1QRND 2PXYC 3MLSL 3ZMRA 4PJEF 5CBAB 3RGVD 1JF6A 4XNMA 2ZCKL 1OVZA 3V0VB 2HVKA 1V7NL 4GXVL 1ACZA 4ZD3L 1AR2A 2R69L 2XZQH 4MD0B 1AO7B 4NKMA 5D7JB 2NNAB 3DVGB 3S35X 3LRSB 4XAKE 1T0PB 3OKYA 5IV2B 3RWCA 2P7TB 2HFGH 4OD2A 4NO0A 4XI5C 1HINL 1JNNL 5SWZD 1G7LA 3BISA 3NAAH 3ZDYF 2J8HA 4X98A 4OF8A 4LBEB 3CLFL 3NFPB 3WBDA 4NFDA 4AM0A 2BC4B 4P5TD 1YMME 1WUNT 3QUZD 3DO7B 1GJIA 3QHZH 3LHPH 3GEWB 4EN3C 5T1KD 1OTSC 3OB0K 4Z7WB 3PP3H 4Y7MA 4PP2A 5D71L 1HHJA 4KJPC 2WWKO 1BFTA 2EECA 4LLMB 4ZPVA 5FV1L 5IBTH 1XF2B 3UO1L 1NAKL 5ALBL 1Q1JH 3NCBB 2AXJA 3WCYA 1MCQA 1IEAB 1JWMB 3OX8A 5DRNA 5L6YL 3X3GL 3QPXH 4HZLA 2E7MA 3MLXL 3MO1A 5E2TH 4J4PC 1IAOA 5D70H 3FQXB 1HQRB 2GTZB 3EYFA 3W39B 2YD4A 1FAIH 5CMAA 5E2WL 4MB4A 2XRAL 1U8JA 5BQ7B 3QQ3B 5DO2C 1UXWA 2ENSA 3HZYA 4OZHB 3L5XH 4CMMA 2UWEF 1NGZA 1P69B 4WO4D 3HG1B 1EEZB 1U3HB 3QJHA 5D71H 5DVKA 1GC1H 4R4BA 4XHQA 5D1QD 4OZIF 4LGSB 1ZANH 5I18H 4LHQB 2EIDA 3KDMA 5BOPA 3MYJB 15C8H 2KPNA 2X10A 4L3EE 4Z7UB 2R8SH 4XT1C 3ZKND 1QZ1A 2YPLB 3X3GH 5L8LB 4Q0XH 3TZVD 2ADFL 3IGAB 3MJ9L 5EN2B 3BP7B 1VGEL 3WIIL 3RWEB 2H3NA 3CFCL 5E56A 5AZ2L 3GZKA 2X4UA 3O4OB 3VXRE 4FQ2H 2V7HA 1NAMA 3LS4L 1IC7L 1EO8H 1J86A 3E2HB 3QEHB 1FDLL 5BZWA 3G6AA 3B2VH 3TVMD 2GEEA 4XRCB 3W9EB 5EOTA 4JZJC 4KJWC 3PWPA 3W0WA 3P3YA 2BVQB 4E41E 4LQFH 5IBLC 4OLUH 1U95A 4OD2B 5H94B 3S35H 2Q1EA 2X1OA 2UZIL 4LPVA 1Q9LB 1ZT1B 5J3HC 3ZKMC 2XNAB 5DMGD 1A47A 3SGKA 5LKNA 1RIHL 2NZ9C 4K9EH 1JIBA 4OM0L 1VFMA 3EYSL 5KOVC 3SKNA 4HDIA 2J12B 5HHMD 3DTXA 3MRLB 4XC1L 2NTSP 3C60D 5EU6E 4XZUA 5AUMA 1EBAA 4TOYH 2N4IA 3EYVB 3TJHC 4L1HA 4WFEE 3QIWD 5E9DB 1HHJB 2VLJB 4KDTC 1FDLH 3S5LG 2E6PA 1OB1B 5DD1L 2FIRT 3SE8H 4UV4L 3I9GH 4R97C 1S5IH 3NOIA 3IDXH 1BFVL 4QXWA 1KTLA 4XPHH 5DHYA 4XCNB 1HILA 2I25N 1IM9B 2UZIH 1K8IA 1IAOB 1EUTA 4LIQH 1CE6A 4OIBA 2OXGA 5CMAB 4D9RD 4POYA 2G5BA 1F45A 4XCFL 2COQA 5BRZE 3SN6N 1WZMA 1U8JB 4P3DA 1NUFA 3O6FB 4WV1C 3QA3B 4HKBA 3UTPD 3GRWH 1EJOL 3HZYB 3DROA 1NGZB 1I7UB 4OIAA 5KVFL 1FO0B 4S1QL 3U7WL 3L3OB 3VG9C 1A7OH 2F53A 2X09A 3LZFH 4KROC 1JRHH 3HLAA 4BFEA 2VSCA 3ARDB 4O9HL 1UGNA 4KK9D 4UV4H 3VWKC 1T7VA 1Q0YH 2DAVA 4IOIA 3KDMB 4Q58C 4OI9A 5FA4A 1NCCH 3PIQB 5FKAA 4ALAL 3LN4B 3H9SB 4QF1A 4QXGH 1KNOB 5TQ0L 1OSZB 4YBQC 3VFRB 4LSUL 5FAAA 3T0ED 4UT9L 3OZ9L 3P0YL 2V7HB 3QXAA 2XZCH 5FHBL 4GRWB 5TFSL 3E8UL 2EDYA 2W9LA 4X6EA 3G6AB 3ZSSA 1XR8B 3NFNB 1D9KD 4BQ8A 1I9JH 4D0DA 4TVPL 5D6CA 4TVPE 3PWPB 3ZHKA 5IB3B 4KJYA 4YHIA 3SCMB 1M4KA 4XVUC 3BIBX 5DK2A 5C0CA 1QFUH 1F11A 1UACH 3RU8L 3TBWA 2X1XR 4HKZB 4RISL 3R06A 1G7PB 4JKWA 4GMTH 1OAKL 2ZUVA 2KZWA 3QP3A 4HD9A 2R4RL 3SKNB 4HDIB 4ODWA 2JELL 2X70A 1M7IB 4HWNA 5AUMB 3TO4A 3KPMA 2D7TH 5K9QI 4EXPX 3WDHA 1IEBA 3QEGH 3L3KA 1U8NB 4P49A 2XKUA 4KRPD 5ESQA 1KACB 4FQHB 1EERB 1KCKA 2CLVA 3MCG1 2IBZX 1RIVH 4PGDB 4PGBB 1TETH 1CFNA 4OM1L 5IF0B 2VLRD 1YZZA 4PRIE 4PY7A 4AENA 3X13A 4BYHA 5HDBE 3ZTJH 3HE6B 3BZFB 3WJJC 3RU8H 1YECL 4RISH 2RQ8A 2UYLA 5KS9F 1YPZF 1TVHA 1I1AB 5CHNB 1CLYL 4X6DF 3U9PL 3ARBC 2NY0D 2JELH 4HKBB 1FL3B 2UVFA 2H41A 1FNGB 3CFDA 4UDUB 2XG5A 2BNQA 3DROB 4HK0A 1B4JL 1GHFH 1FFNA 4KZDL 1S7QA 4FZ8L 2FX8H 4G42A 4GKZA 5DFVC 2YRLA 3HLAB 4O2FA 1N2RA 1IL1B 2HMID 5L2KD 1UA6H 3SGDH 1T7XA 3GJFK 3BRGC 4NM4L 3ARUA 3MLRH 3QZWA 3GMNB 4OM1H 3B9KA 3QDMB 4Y5YA 3EYQC 3IRPX 4U1HA 1YECH 4PJEA 1UENA 4OI7A 4GS7C 4JPKH 1WTLA 2E9WA 2KL6A 1H3TA 4LLQA 4HV8A 2GQHA 3VG0L 5INCB 2AJSL 4U6VL 3UJTL 2P46B 2QR0A 3FONA 3PF2A 4UMGA 3VFMB 4F80A 4X6EB 5EDXA 1I8KB 4LKCB 3IDJA 2HG5B 5KSUB 3TBTA 4L8SA 3UTZA 1UM4L 5D6CB 3OKLA 3UYRL 4UT6H 3ZE2E 1KFAL 5C09E 3OMZA 4KJYB 4OGAD 4BSWA 1CDGA 3SKJL 3VRIA 3VH8G 2WWMD 4PRHA 4FQLH 3TBWB 2AP2A 2Z0BA 4X4ZA 4Z18A 1AIFB 2P8MA 1SY6A 3CFIC 4C4KO 3QG7L 3FB8A 2D2OA 5E2JA 1WBYB 1ED3B 2AEQH 4LSSL 4H5SA 5DUPL 5HGGS 4L9LA 3V4PL 3GBLA 2C1PB 4TTDD 3KXFB 1DBKL 1EO5A 5DJ2A 1IEBB 3R1GL 5I1AA 5D72L 1KCUL 2AJSH 4DN3H 4U6VH 1HWGB 2ZUYA 1I4FA 3UJTH 3TYGL 2BCKA 4P57A 1ITBB 1H3PH 1DQMH 4L4TE 1UYWH 1CBVH 4GJTB 2W60A 1VGKA 2XICA 5HGDB 1CFNB 4JDZB 3C8HA 4PBWD 3HHRB 4PY7B 1NUNB 3ULUL 3N85L 3ULUE 3LV3A 1KJ2A 5F9OH 3UTQA 4LAQH 4KK8D 4Y1AD 3CH8A 4OF3A 3HA0A 1HHKB 5I1KH 2KQMA 2OXHA 1LEKA 4HJ0D 4XPFL 3WXVL 2UWEA 4NWTH 1H3XA 1LE5A 1RZ7H 2QKIB 4XP5L 5LCVH 1HKLL 3F7YA 1DBKH 4OZIA 2OI9C 1LDSA 4UBDC 5FA3B 1TVDA 1FJ1A 3MBXL 2CO7B 5SV3A 1CQKA 2I5YL 4G8GB 4X4MA 2GJ6A 2EYSA 4ZAKD 4H1LA 1OM3L 1MHPL 1WCQA 2W0FB 3FMGL 1ZLVH 5ABDE 1NDMB 4KV5E 5D93C 1JN6B 3C5ZC 5TDPA 4MJ5B 3O3DB 2ADGB 1DQLL 1J0ZA 1KJ3L 1EVTC 2R2CA 5I71B 3S37L 3BP4B 1ZVYA 4YHYC 5D7KE 4FXKA 4MD5B 3SKMB 4APQD 3MBEA 1KIPA 4L8DA 3H3PL 2XQYK 3E3QC 4CBPA 3FO2A 2E7CA 5CKAA 4X6CE 3KVQA 1T4KA 4NNXA 2XA3A 4RAUA 3D39B 2DBLL 2ZCHL 3GMPA 5ICXA 3D18A 4LSVH 3LN5A 3P9LB 5FUZL 4XTRC 1GAFH 5EU4A 2EH7H 3DX9A 3LEXB 4LPUA 4DKEL 3EJZD 1EHNA 1S7RB 4D94A 4B7LA 1XGRA 3FB8B 1G6VK 2P4AB 2VDRH 3GBMH 2BDNH 4P3CH 3AC0A 4WTXA 3U82B 4YK4C 3WJLA 2ADIB 3NGBB 4P2OC 3CX5K 5CEYA 3WNLA 5TH2B 4JFPA 5IVXB 1CD1A 4LVHC 4ZFOB 5HPMA 4JN1H 3PDOB 2AEWA 4QXTB 3H3PH 3VI4F 4GSDL 4HPOH 4OCSH 1CD0A 2BCKB 4P57B 4RX4A 1HXMB 1ZS8A 3THML 2WW8A 1NBZA 2DBLH 5E99L 2NXZB 4PJ5A 1RUKL 1U2CA 3DIFA 5C08A 2W60B 3BN9D 2IH1B 2AXFA 2UVEA 1YEIL 1BOGB 3LDBC 4KRLB 2PETA 2VLLB 3BP6B 4N0YH 5FGBC 3B9VA 1AXTH 3UTQB 2PTUA 4Y89A 5FO7A 2B5IB 5D7JC 5EG6C 3UZEA 2E6JA 4QTHB 4AEIL 4YC2B 3QBTB 3O2VH 3NIDF 5EZLA 3KLHD 4Z6AT 4J1UA 2LTQB 4N8VB 4HC1A 1SJEA 3OKKA 4HF5L 3PWJB 4HWEL 4PRPD 4HWZA 1FJ1B 3T3MF 1CE1L 4RBPK 5T5NG 3THMH 3HI6H 1RZFH 3OAUL 4BQ9A 3LY6A 1RUKH 2EYSB 4OFYD 1FN4A 2IH3A 1GXEA 1CF8H 5GRZA 4IRSD 1MHHA 2ARJA 3WD5L 1OAUH 4GBXB 3T1FB 2PW2A 5GZOD 4U6XA 1H0DB 3ULUC 1BF2A 4HHAA 3INUL 2J7LA 4GXUN 5FGCB 1DQDH 1AGBB 1RZJH 4H25B 3RUGE 5AWNL 2G2RA 3MBEB 2VIRA 4K3EH 4UIKH 5FF6A 3PL6D 4H88L 5LBSL 3OBAA 4CVWA 4XMLH 4JLRB 5HHPA 1A7BA 3RA7H 2A83A 4KVCL 4O00A 1T1ZA 4QRSA 5ICXB 1KTDA 5C86A 1MNUH 3D18B 1NAML 3VXQA 5DWUH 4PIRF 5KJRH 1U58A 3PV6A 4YHML 3VW3H 4HSQA 1OW0C 3L3IA 4NM8H 5GS0H 1FO0H 1DLFH 2OM5A 2AEPL 1QRKA 3UBXI 1AXSB 1NMBL 1XGRB 1U3HC 1QKZH 3MV7D 1HH6A 2O5YH 1A3RH 5L9DL 5CEYB 3DX8B 1BAFH 4G43B 5ISZD 3V6ZB 2I9TB 4LL9A 5EUOF 5C70A 1JTOA 2VXUH 3ZTJG 5GS2H 1A6TA 4UV7H 3OR6A 4JM2C 3AB0C 1UWGH 4OQTH 4HGWB 1DBJH 1OGAA 3WKNA 1GGCL 1KCRH 4KUZL 3VFNA 1YEGL 4F37F 2Q8BL 5I17A 4GRWH 3O4OC 1MLBB 1TJGH 5KVGL 4R6UA 2QBWA 5KS9A 3UPRA 4ZDHB 3UTSA 3GHEH 1YPZA 3E2HC 1K2DA 4X6DA 5I8OL 3JWNC 2AI0H 5E5MA 5DQ9A 1LGVA 3SKOA 4KRMB 4RWYH 3SDDA 3RWDA 2V7NA 1YDPA 4ODVL 3IXAA 5ACMA 1R5WA 4PJ8B 3NCYS 5IFJB 2BRRH 2GHWB 4TPRH 1GGBL 3OTTA 5B4MC 1BMGA 5GSRA 4OGYL 3T0WA 1E6JH 4FQIL 4D2NA 1CG9A 4PB0H 5D2NB 5BJTA 1JGVL 3WNKA 3IJYB 5D9SA 1K6QL 4KAQH 2HT3D 4JKPL 1MHHB 1AO7D 3RPIA 5DVMA 5ANMB 3LKPA 4P5MB 1AC0A 2A9ML 4OCNC 2F53E 3PNWB 5I8OH 3CPLA 5IHZA 3GI9L 3JVGA 4K3JL 5E8OA 3ZZ1A 4LGRB 1N5YL 1TPXC 3QIUA 5I1JL 5D1ZB 3C2AL 4FG6D 4M7KL 2R0ZH 4M1DH 2G2RB 5BV7L 2BP3A 4C54A 3X14A 4WI3A 5CJXA 3MNVB 5J6HB 4TUKH 1JYWA 3UP1A 1V05A 1AY1L 5M94B 3GIZL 3CNKA 3CFEA 4UOJA 3DVNA 4O4YL 1V3LA 3PV6B 4EXKA 4FFYH 4DN4L 5D7IF 2F15A 3GHBL 4NZUL 1FFOA 5F7YC 1RK0B 1A6WH 5EU3B 2C7UB 4HS6A 4M6OL 1NGXA 1H8OA 2A9MH 4PLJD 5D2LE 3BKYL 1F4YH 1HH6B 3V0WH 1FYHB 4R3SB 4JRYB 3S7GA 5FYKL 1T03L 5FYKE 5C0CE 1QFWI 5E7FA 3LCYA 3DMMA 1AGEA 2ICWI 1UM6H 1CWVA 2KZ1B 1L0QA 3NABL 1DVFB 4ZO8A 3C8KA 4JFFE 1Y6NR 4HULB 3NZHL 4EJ1C 3CDCA 4PJDF 5H2BB 3OJDB 5AG8A 5F9WB 4YFDB 5JW5B 1RY7B 4XNQA 2FJGA 3OKDB 4EVNA 3HG1D 4O4YH 1U3HD 1Q94A 5IMLB 3SO3B 5KS9B 3UTSB 1K2DB 4X6DB 1J1XL 4LRIC 5F21B 5ACLA 4PUBH 3BKYH 4X5LA 4JFXA 3VXOB 1ZMYA 4OIIL 3MUJA 1GOGA 5FOBA 2YUWA 2YPLD 1YDPB 4UNUA 4YPGB 1R5WB 5GRWA 3ZSTA 1E6OL 3QDGA 1Z3GL 1KELH 1A6VL 3C8DA 4YBHA 1CG9B 4WW1A 4HCRH 5BJTB 3FRPA 3SGKC 4LLYA 1NFIB 5D9SB 3U4BH 4TVSa 4QRPE 1OARH 2VN7A 2EZ0C 3K8MA 3LKOA 1NLDH 1MCPL 2BNQE 2UUDK 3FQWB 1Q0XL 2L7UA 1T7WA 4NRZA 2I9LB 1BBDL 3UJJL 3B9DA 3KYAA 3TYFB 3FQTA 1RUMH 4ODTL 3ZHLA 2Y5TA 3K3QA 3CPLB 4MA8L 1YN6A 5E8OB 4WW2B 3QIUB 3RWGA 3F7VA 1MJUL 5HSFA 5F71A 2FZ3B 1FZKA 1A22B 1KCVH 5D4QA 5E6IB 2Q87A 1DBBL 4NQXA 5KTEL 1R5VA 1XF4B 4PJEE 5CCKL 2VAJA 4GKNB 4LFHD 3BT2L 4OLZH 4U0RB 3DVNB 2PW1B 5E9DD 1MY7A 3W9DB 5JW4N 3JUYA 2VLJD 3ARZA 3NVQA 4NCDA 2AK4A 4XWOD 4WEBH 3O6KH 3LQAH 4HS6B 4ZTPH 5C0JA 2RHEA 3EFFA 3ZDYE 3V8OA 1T1WA 3T2QA 1OP5K 1IM9D 4U2ZA 4F7PA 1GOFA 4JQVC 3N1GC 4PRHE 2DQIL 5KSBE 2FD6L 1SY6L 4ZS6C 3DMMB 4WDIA 4I9WE 5EOCL 5BV7C 2J5LC 3BYYA 2YRZA 3C8KB 3WSQH 1TTGA 3ZYIA 4ZUWA 3O6FD 4OAWB 4F7CB 1AH1A 5CCKH 4F3FA 5IOPA 2ED7A 1CGSL 3MRFA 4LVNC 1T66C 4EVNB 5GS0D 3O41A 1Q94B 4JFDD 1X4YA 2DQEH 5I15L 1HEZA 3IKKA 3FO0L 2CRIA 4YHZL 2DYPB 1TCRA 3ARDD 1ZSDB 1FAKT 2ED9A 5IVZB 4WGWB 4R0LA 5C1MB 12E8L 4LFHG 3VI3E 3HAEB 4GG6F 2V17L 5GS2D 3H9SD 4PLNC 1JHKH 3GO1L 1KJ2L 2KKQA 3QDGB 2PYEE 1MFBH 4JB9H 4Z7OF 2MKLC 2VL4A 4AK1A 1MWAB 2Y23A 4LLYB 1OGTB 3N0PB 3REWA 1QEWB 5ETUB 3MMEA 2UWEE 4KMQA 1P7KA 1OWWA 5F88A 1F4AA 3FB6A 2VDNL 3TO4C 4OZIE 1CDCA 2ED8A 4U6HA 1LILA 4FFVC 1EO7A 3PWPD 4K23L 1R0AL 4U2YA 3QDJE 1BECA 5EBLA 2VMFA 2ICEB 1FBIH 3SCMD 1NGQL 2GJ6E 3RWGB 5HYFA 3F7VB 5J56B 2NY4C 3CFBB 3IDUA 4JFEB 5EU7C 2CO6B 3WUWA 2WM0A 1KIUA 3BIKA 4M8QA 4MXVF 3BP5B 5FO8A 4NQXB 1U91B 3VU2A 3MUHL 5CWSA 5I76A 4QRRE 4X80L 3QH3A 2VYRE 5KG9B 4PJFB 1CFBA 1B88A 1KEGH 2P24B 1HDMA 1SJXA 1NGYA 2WANA 1F4HA 1QYGH 4LNVA 2AK4B 2X05A 3ZL4L 1YEEH 2VH5H 4FP8L 3MRIA 2XIDA 3EFFB 1B6UA 3MA9L 1OAXL 5EUOA 4NZTH 4KH2A 5GZNC 4F7PB 4JRXE 4RMRA 3HE6D 2VNCA 4HBQA 2XQBH 2QL1A 5C2BH 1F5WA 3B9KC 4AT6A 1KB9K 4PV8A 4Y5YC 4N8CH 2FL5B 1I1AD 2G60L 3KJ4C 3AU1B 4DAGL 2QQKL 2IBGA 1MHEA 3SDXB 5BW7A 4PV9B 2VWEE 4X80H 1JGDB 1X5XA 3MNWA 3CX5J 3D0LA 3V5KB 4NWUL 1GIGL 5IEKA 4PYGA 4XX1E 3VCLA 4N9OB 6CGTA 1TCRB 2EDBA 3QJFA 2EKSA 3V2AR 2QTEA 3AXLB 4PRIB 4WI5A 3EJJX 4XNZC 4ZMAT 4PJ5E 5F93C 1U92A 4NYLB 4L8SC 2C4XA 4NJ9L 2APXA 3MA9H 4UUJA 4U3HA 3L3HA 3U1SL 3QDMD 3Q6GL 5CZXD 4CN6A 1JPFA 2DMCA 4LLUA 3V5HA 4NQUA 5GGVY 5J89A 1YEHH 3QDAA 2J8UF 4MCZA 2D31B 1LE9A 2IGFH 1PKQE 4Z0BL 5AD0B 3O45A 1AGCA 4L9LC 5JMOC 3NGBC 4Q7DA 4OBRA 3SJVE 3T0BA 2B4CH 1J05A 1BP3B 1UEYA 4RMTA 3DX6A 3JV6A 3FQNB 1QOKA 1ZHKA 4M7JH 5EBWA 2Q7NA 5FDWA 1YNTB 2XZZA 4KTDH 2BFVH 5HTSA 5K93A 3U1SH 1WIUA 4J12A 1MPAH 2HRPH 1MFNA 4M8QB 1KGCE 1RFDL 4NRYA 3QCUL 5ICZB 3UPCA 4BQ6A 2IG2H 3O3AA 4YX2H 2CDEB 4QXUL 3NIGF 1CL7H 1BM3H 2DQHH 3KXFD 3QH3B 1MRFL 5D7IA 3JTTA 2YS4A 2YD6A 5GJTH 1DBAH 4LSQH 4OB5L 1RMFL 1VERA 1LWRA 2WP3O 4P5KA 4HC1H 4NBZB 3ALXA 1S7WB 2L4OA 1T2QL 5J12B 5E8NB 4NBYB 2MCPH 5GRJL 3KYKH 4XC3L 2VXSL 3A67H 3C5SA 4LRNL 4LCYB 1U6AL 4YZFE 3QNYB 1WWBX 4ZO7A 1K4DA 4PJDA 1IRAY 2H2PD 1SYVA 5CD5D 1OD7A 1D5BA 4KJQC 1IAKB 1UM5H 4Z0XB 3QUKB 2A6KA 1NC2A 1OOAA 4HH9B 1VKXB 4OI8A 3D0LB 4L4TB 4JCLA 1T0MA 5HHVL 3K80A 1FIGH 5J1TC 1T2QH 4G8GD 2AJZB 4JFYA 1OGAE 1T04A 2IQ9L 3VWJA 2HLAA 5EFIB 4DZBB 5FCUL 2VXSH 1B2WL 2HN7A 1L6XA 5E8EB 2GI7A 4ZTOL 1YPZE 1J5OL 5CKGA 4ZQKA 1ND0A 1KTKE 5BO1H 4QKXB 4KKLD 5GGSA 1PSKL 1OD9A 2P1YA 4Y19A 1OT1A 5CUSH 1RJYA 3O45B 1B0RA 3G08A 2EDOA 1H15A 2E27L 3BEWA 3WJLC 2VWEC 5C0AB 4CADB 4NDMA 3RBGA 2R9HC 4PRAA 3D39D 1XT5A 2GT9A 3MLZL 2NPLX 2X4TB 1AC6A 1QLEH 4AIOA 1JHLL 1YEDB 3GMRB 5EBWB 4P23A 5F6IC 1INDH 1AQDA 1ZHLB 4R8WL 2BHYA 1KEML 4MNHA 5JXAL 3MRHA 1NC4D 4OLYH 1J5OH 3BKJL 1WBZA 5D1XB 4O2EB 3O3AB 2Z9TA 4EI6A 2WLZA 1PSKH 4KXZH 3OHXB 3C09B 3M17A 3D87B 4DFHA 1X9QA 3WLWC 5HGBB 3HB3D 3QZWG 4PJCF 4P5KB 1N7ML 3H7BA 4ZFFA 4X9GA 2NXZD 1BVLA 4KKCD 2QV2A 4CN4A 2OR8A 3BMWA 4HWBA 5HYEA 4B0MM 3RL2B 1BD2A 2OK0L 4RGMB 2AJVH 1YNLL 4TNVK 4W6YB 1FPTL 4OGZA 1KN4L 1SYVB 4G6JL 1D5BB 4JG0L 4HFUH 4R96A 2A6KB 2VABA 3GKZA 1NC2B 1OF2A 4RA3A 4CMHC 1RZGB 1QSZA 2VLKE 1DUZB 2F74A 2K7PA 1VADA 1II4E 4OZGF 5ESAB 1T0MB 2YR3A 4XWGL 1A7RH 1X5AA 4LMQI 2RJMA 1N7MH 4L3AA 4D3CL 5JIIA 3RY6A 1ZVHA 4JFYB 4GG6A 3IDGA 4OLXH 3OF6A 4L1DA 3Q3GA 3DVFA 3BVNA 3TFKD 3QULB 3RAJL 4GBXD 1URLA 4KJQD 3TF7C 3IU3A 3QIBB 1EH9A 1KCSL 4ODSH 4NHCL 1YNLH 3B8YA 5CSZA 2X1QA 1ZV5A 3TV3L 2ZSVB 4RGOL 3MBED 5H35B 3VD3A 4LPWA 3L7FB 8FABA 4DVRH 1J88A 2FLBT 4URTB 1H15B 3I50L 2DQUL 4NKDA 4GW5B 1DJSA 4GW1A 3O2WL 4GUPA 2GT9B 3LH2H 5DD6A 3U0WL 5F9DC 4JDVA 3QYCA 5I2IA 4ORZC 4C56D 1CXHA 1AQDB 4XNYH 5F9WC 2F5BH 4MNHB 5HXMA 4OFIA 1J9CT 3HS0B 1FYTE 5CILH 5DFTA 2XY1A 3BKCL 1OAYL 1WBZB 4HX1A 1LO3H 2HKFH 3WYRA 4RMUA 1A9BB 1T1YA 3NCJH 2BHUA 2IBBA 3HC4L 4OD1L 3ARXA 2JIXA 4H8WH 4H1LG 4XBGB 3HAEH 4LLAA 3SDDC 4OGXH 3GSVA 3VRJA 1Q9WB 4NSKB 4RX4D 3EHBC 3MACH 2W9EL 4JAMA 5C6TL 1MWAH 3GJEA 3RI5K 4DGVL 2A6JB 4LAJH 2NY6D 5MI0C 5MENE 5ADPH 2UY6A 3UZQA 3IFNH 3DHJA 5I30L 5FKPA 2ZUWA 3CVIL 3CSYA 1TQBB 1GOHA 3VMOA 5GPRA 1JYNA 4ETQB 3BKCH 3BGFB 1XGUB 2YD1A 3C08H 3WLWD 2VABB 1P2CB 1NCDH 1W72A 2LE9A 3JVGC 4HFWB 4PJ8D 3VI4E 4F58L 3QT2A 3MR9A 3QIUC 5DQJB 1LNUA 4G8EA 3CSPA 4IMKA 4S1RH 1PY9A 4IOFC 4O02H 4UDTA 3L1OL 1J0YA 5CJXC 3P2TA 1FVEA 1IFHH 1C12A 4QGTA 2WIMA 4POZC 5TQ2H 2J8UA 5I16B 3IU3B 1J10A 2WUCH 4XNXL 4R7NA 4XPTL 4Y4FA 3NIDE 3SDAA 5D1ZD 2JB5H 2JCCE 5IB2A 4YXLH 1L7TH 4KY1L 1A5FH 5GS1B 1KIRA 1OCWH 2OP4H 3DX7B 3U0TA 1YUHA 3B43A 4NKDB 5C07E 3H9HB 5CGYD 4HPYH 2D7NA 2ESVA 3DMMC 4RCAA 5IMOB 2YPKA 1EEYB 1BWWA 4N90E 4JDVB 1P6FA 3LS5L 5I2IB 4RFEA 5HJ3A 3MCKA 4G5ZL 4QRUA 4N1EA 4HUWB 4AQ1B 1SEQH 3LMJH 1NBYB 1Z0MA 4KKBC 4ZUTA 4NN5C 4D9QE 4PJXE 1P53A 3UC0H 4HX1B 4O58H 1KXTB 4JRYD 2CIIB 3OGOE 4XPTH 5T3ZH 4YHNA 3MJ7B 4DZ8B 1YY8A 5TPWH 1YMMD 1H3GA 2NY7H 4KY1H 3LKSA 2A74B 3V52L 1DVFD 1X5YA 2Z91A 5DZNA 4P9HH 4JAMB 4BSJA 1HSAB 2GFBA 1I8LA 3GJEB 4ODHH 3DV4A 5F6HJ 3LS5H 4BZ1L 1QP1A 3UTSD 3WKML 3RX8A 1FG2A 5D2LB 5FKPB 4NNPH 3VGEA 1A64A 4K7FA 1TTFA 5I66A 2KH2B 3MOBH 1JPST 5DHVB 4X99A 4ONFL 3MLWL 4JQIH 2KBGA 5EUOE 4P99A 4UU9B 4HXAH 3ARGA 4Y5VA 5DEGA 4Q9BA 3LIZH 3VE0B 3T0AA 3D1MC 1LNUB 1ACYL 2NYYD 2OR9H 3ARVA 1EXUB 3UBXA 5LGHL 2R0LL 5K9OA 4PP1C 5HD8D 4GAYB 1KB9J 5EU5A 1CK0L 1A9EA 1T3FA 3NA9H 1PW3A 1C12B 2R29H 4P2QA 4PREA 3F6IA 3MLVH 4BZ1H 3W11C 2AV7A 3EOAA 4N0UB 5DI8A 4YHKH 2Z8VC 4XNUL 1QR1B 3M45A 1KF9B 5K33A 1F4XL 4R7NB 1IT9H 1S9VB 4NP4H 4NO5A 3QIUD 3RJQB 3SDAB 4NKIH 1N4XH 1OTTC 3WFHB 4F7MA 3PHOB 5LQBL 3Q6FA 5TDOA 4FTVA 1BBJA 3J7HA 4A6YA 4PJ9D 5E6ID 5BXFA 3U0TB 4OFDA 1C16A 3O3BA 3VGAB 4P2RA 4TNVF 4QRPB 1S5HB 3O6MH 1UH3A 3B8SA 3T08A 4F57H 4C59B 2LFGA 4YDJA 1UC6A 5CINH 3W5NA 1MOEA 3EOBA 3JV0A 4I77H 4HIIA 4JVWA 1N6UA 5IKCA 1IGCH 4JQXA 4ZUTB 2E9IA 1MVUA 4MQ7B 1JHTB 5EORH 4PJCA 1DFBL 2HFFA 1BQHB 3BD4A 1V3MA 2C9AA 3D3VA 3MV8A 4TN9A 5DURB 4ERSH 4BZ2L 4R0LC 4IMLA 5E5RB 3IFPB 3KNBA 4M00A 4LARH 3U9UA 4AJ0A 1HKFA 1CLOH 4PJHB 2UZYB 4WFED 4TSAL 4GW4B 2GFBB 4JY4A 1L9NA 2DTSA 4FQXA 1UH2A 5D7IE 3G9AB 4KKBD 2BOBA 1FG2B 5DC4B 2F54A 1HHIA 3UJIH 2CK0L 4NN6B 2DYPD 4FQJH 4I3GA 5I66B 2ATKB 3ROLA 3QB7C 4RNRA 5CEZL 3P4OB 1HYSC 1GCFA 1G6RA 2CJUH 1EFXD 4OZGA 1JRHI 4QWWD 1BVZA 4XP4H 4JO1H 5K59F 2QEJA 2QHLA 4DQOH 1EGJA 1MUJB 1U8QB 3PDDA 4LSRL 3UBXB 4PJDE 5H37H 2VXTL 1J1OL 3BDYH 5EU5B 1A9EB 1A6UL 2X89A 5I1GH 1NCAL 3VXMA 4ESKA 1SBBA 4C83B 4XP1H 4M61A 4L5FH 5DI8B 2ICWA 3R8QA 3F12A 3EYUH 3VFGL 4K94H 2ZJSL 2IF7A 4F15B 1TJHH 5D96B 4P4RB 4PTTA 2AV1A 2E8ZA 4NO5B 5J12C 3P11H 4MCYA 5CEZH 5DRZA 4JFED 4FTVB 3UTTB 1BBJB 1RHHA 4K7PX 4X9BA 1L7IL 5C0GB 4S1DC 2BY2A 1UB6A 2YMXL 1C5CH 5K9JH 1DUYB 3VXSB 5MEQB 4OLVL 4CVZB 5C9JB 4WTWA 2VXTH 4V2BA 1M6OA 1MAML 3RDTA 3JV4A 3VDBA 4Y2DD 1FZJB 4G3YH 4Y19E 2R4SH 1L4IA 2J6EH 4OJFL 3C6LB 4LCCB 4QYOA 5IFHL 1OTUC 5BW7C 1UQSB 3HAEG 1MIEL 3P0VL 5JORA 4NQEB 3S98A 1B0WA 4KK6C 4LU5L 4CW1B 4MDJB 1QG3A 4KWUA 2ZJSH 5FIEA 3VFOB 4HS3B 3U2SA 1G9ML 3MXWL 3I2CL 4I0PA 1QQDA 2P5WA 2Z92B 5JNYB 2BJML 1MFDH 1U2HA 3FCTA 2R56L 4QRRB 3U9UB 2YD3A 3HFML 5EOQL 4OLVH 1SEBB 4V1DA 1B0GB 1OLZA 1KCLA 5CJQH 4YR6A 4ETYA 5ITBL 4FQXB 1S9YA 3TPUB 1BJ1H 2A1WL 5DR5H 2YBRB 4JM4H 4P4KB 3CDGA 2BOBB 1FLRL 3V4VL 3KR3H 1DLHA 4HUMB 1XEDA 2RCSH 2UZXB 3P0VH 4Q2ZB 1P7HL 1GVIA 3ISWA 5T3ZD 1TNNA 1A14L 2QQLL 3QXWA 4PRID 5E8DH 3PWUB 4UILH 5SWSB 3IS1X 1TMCB 1OQXA 5C0FA 4HWBL 2EICA 4JFOA 1KT2A 1SM3L 1A21A 1TZIA 2QADC 1BD2E 2H2SC 4IRJA 1FVDA 3SGDI 3N9GL 4PJIF 4G9FE 2DN7A 5D6DA 3BPNB 2OTWA 3AROA 5DGRA 3WFEH 3S8WA 4J7RA 2EE6A 4DFIA 2HYMA 3OXSA 5DUML 2Y07L 4KQ4L 3UMTA 4ZFGH 1K8DA 1ZLSL 1CXKA 1AR1C 5HHOB 4M61B 2FYYA 3C09C 5F1IA 1CN4A 4MNQA 4DGYH 2V2TB 3F12B 1S9WA 5L0QC 5GRUH 3BHBB 4MDIA 2VAAA 4NPYB 3MV9A 2YA0A 3EO9H 3HC0A 3H3BC 5J13B 5J0BA 4GG6E 4EUPA 1UKQA 5DRZB 3S4SA 3EJYC 4KMLB 4AL8H 4Z7OE 3IFLL 1RHHB 2BNRB 1KJMA 2FECL 1FNAA 5ENWA 4K7PH 4TQEL 2FJHA 1LK3L 4KKAD 3MRJA 8CGTA 2FWOB 3PE9A 4N0RA 1NGWA 4RZCB 4KMTH 2B7DT 5CP3A 3X12A 2E3VA 4ONGH 3ABZA 4OUUA 2M26A 5E08L 1PAMA 2MFNA 3TGXA 4ODUA 3D85A 4H0IA 4IEFB 1XGQB 4G6KL 1CDUA 3CCHA 1AQKH 1ES0A 3QI9A