3NJKA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph5.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njkA00
2XX1A 1PNCA 2DYRB 1AZCA 3EH4B 3QJVB 1M57B 2VW7A 3PPSA 3UAEA 3BQVA 4WTQA 4KOBA 1CC3A 2XXFA 4HCGA 1ID2A 5ANHA 2P80A 1DZ0A 3QJTB 2XUWA 4DP6X 3CDZB 1KCWA 2B08A 3FS9A 3NJKA 1A4AA 1FWXA 3H4FA 1J9SA 1CUOA 1AACA 1M56B 5B1BB 2J55A 3ZDWA 4RH4A 1BQRA 4E9SA 3H56A 2R7EB 2PP8A 1VLXA 1HAUA 2WSDA 1KBWA 2YARA 1OCCB 2VM4A 2YAOA 3ASNB 2X87A 3HEIB 3HB3B 2ZOOA 2RACA 2UXGA 3ABMB 4UAHA 2IH9A 1W6LA 1JOIA 3OMAB 4DPBX 4A2FA 5D4IA 2HXAA 2Q5BA 3GDCA 5I6MA 2XLLA 3QPKA 2XV0A 2IDQA 4P5RA 1WS8A 3FU7B 2FNWA 5E9NA 2YAEA 1X9UA 1WA2X 2FT6A 3AW5A 5AZUA 4E9YA 1J5DA 1ASPA 4TXVB 4MFHA 1RZQA 3FSVA 3C75A 1ET7A 3WNJA 2LLNA 2GC4C 5B1JA 2BW4A 5B1AB 2IDTA 2PPDA 3H4HA 3S3BB 4JKNA 1IUZA 4KNUA 4A2DA 2AFNA 2YAHA 1PLAA 1RCYA 1WS7A 4KO6A 3T6VA 1OE2A 1SHXA 1KBVA 4E9XA 1RKRA 1KDIA 3AG1B 1J9QA 1F56A 1ETJA 4AKPA 9PCYA 1V10A 1BXAA 2H5UA 1SF3A 3AG4B 1IC0A 3PXLA 1PZAA 1AOZA 2X88A 4YSAA 1ET8A 2NRDA 2CUAA 3NJLA 2AZUA 3FYEB 1CURA 4DP4X 2XVBA 5I5MA 2AANA 2WO3B 4N8UA 1JZIA 3NYKA 5AFAA 1N70A 3EH5B 4A68A 1A4BA 1NINA 1NPJA 2VN3A 3X2QB 1ILUA 3QJRB 2JXMA 2P80D 1NIBA 1KGYE 2BP8A 4G7QB 5FC9A 4P5SA 5B1JC 2GSMB 1SDDA 3TA4D 2CJ3A 2XWZA 2IWEA 1SF5A 3S8GB 1J9TA 3FQYA 2XX0A 2FQGA 2AVFA 4YSUA 1NWOA 4YSPA 3CVBA 4HHWA 4WKXA 1ILSA 4AX3A 1BYOA 1J5CA 2FWLB 2FQFA 1QHQA 4AKOA 5LDUA 4W9ZA 3S8FB 1AG6A 2HLEB 4W1TA 1PCSA 3S3CB 1PLBA 4YSTA 1AG0A 1NICA 2IAAC 1KYAA 5IY5B 1PZCA 3NP3A 1JERA 3PCYA 1OCRB 3NSYA 2OV0A 1L9SA 3IBOA 1MZYA 1EHKB 4JHVA 1AQ8A 4N4YB 1AAJA 2QPEB 1J9RA 3MBWB 1FA4A 2WO2B 1E5YA 3PAUA 1A8ZA 1GS7A 3QJQB 1SFDA 1AANA 4EF3A 1PMYA 3FSAA 2OJ1A 2Q9OA 4G7SB 2UX7A 4BK5C 2FQDA 2IWKA 3WI9A 2PPEA 4HALA 4X4KA 2ZONA 3WKQA 4DP5X 4ENZA 3NJNA 3FQ1A 3IE9A 4F2FA 4HZ1A 5B7EA 4UANA 1E67A 1NZRA 5PAZA 4A2GA 3WIAA 4A2HA 1JXGA 3MX0B 2JFCA 1ZDQA 1M9WA 4HAKA 2I7SA 3AG3B 1R1CA 4G72B 4M4RB 1W6WA 1XMEB 4YSRA 3NSFA 2BW5A 3CVDA 3WNIA 2ZWNA 4DP9X 5PCYA 1MDAA 2N0MA 2VSKB 2BWIA 1HAWA 2DY2A 4GYBA 3X1BA 1PLCA 1AZNA 2VM3A 4PAZA 2XU9A 4DP0X 3ZIYA 3EHBB 1JZGA 2UXTA 4NAJA 5I26A 2BO0A 3CZUB 1MG2C 4YSDA 4F7KA 1PZBA 2A3TA 1SJMA 3GXUB 2PCYA 2JKWA 4G70B 2HZHA 1JVOA 2QDWA 5I6KA 1A65A 2DWTA 3FYIB 2GIMA 2YAMA 3AY2A 3ZX1A 3S3DB 3AZUA 1RZPA 1W8EA 1JZFA 4KNSA 5I5IA 3BVDB 1ADWA 2GBAA 2FTAA 4G7RB 4AI7A 4F2EA 3GYRA 2YAFA 5I5JA 2BZ7A 1V54B 4HIPA 2DYSB 3KW8A 4KO9A 3X1NA 5B7MA 5I6NA 4DP7X 1GY2A 3ERXA 3QQXA 2E86A 2HRGA 3SQRA 1GYCA 1B3IA 2UXFA 2GB2A 1E30A 3FQ2A 4KO7A 3TBBA 1GY1A 2FT8A 2XV3A 1GS8A 3NJIA 2QPDB 4GP5B 3NJFA 4CSZA 4E9WA 4GXFA 2VW4A 1AIZA 1KDJA 3CVCA 2IDFA 3V9CA 1JXFA 2GI0A 1A3ZA 2BP8B 1L9OA 4HHGA 1OF0A 1QLEB 3FSZA 3G5WA 2QDVA 1SDDB 1ZDSA 2PPFA 3JTBA 2FT7A 1TU2A 4YSCA 1PAZA 3EH3B 2J5WA 1JXDA 2H47C 1AZRA 1MZZA 1DYZA 1I53A 3AG2B 3V9EA 3IN0A 4BXSV 7PAZA 8PAZA 4BDVA 1BYPA 3FPXA 1FFTB 2Y69B 3NT0A 1L9PA 2CCWA 3ABLB 4M3HA 3L45A 4GY4A 1XB8A 2XYBA 2HX9A 2IDSA 3NSDA 1AS8A 1PY0A 1TEFA 4BWWA 3WKPA 2DWSA 4BWUA 3IEAA 4DP8X 3DIVA 2I85A 2PPCA 4Q89A 2YAQA 3NJJA 1NIAA 3DTUB 4FAAB 4A2EA 3ASOB 1ASQA 2BZCA 1BQ5A 1CYXA 4E9VA 2EINB 4GP8B 1ZIBA 1SHWA 1BXUA 1ASOA 2W8CA 1OV8A 5D4JA 3NJHA 2VMJA 3IN2A 4YVUA 1XB6A 4K9JA 2PP9A 2VSMB 1MG3C 1GSKA 2ZXWB 5B7FA 1IBZA 1L9QA 3ABGA 4ZK8A 1TKWA 1AZBA 4HCIA 2HX7A 3OD3A 4AZUA 5F7AA 2XXGA 3SBPA 4DP1X 5I6PA 1N68A 1OE1A 2UX6A 3FSWA 3ZBMA 4NERA 4DPAX 3CDZA 4PCYA 2IWFA 2CALA 1X9RA 3TU6A 3SBRA 4QLWA 2W88A 3X1GA 1OCZB 3QJUB 1NTDA 1IKOP 2R7EA 2VW6A 3FU9A 3DKHA 4L0PB 1AZUA 1CYWA 4Q8BA 3PAVA 4YVNA 5TK2A 5D4HA 2EILB 3N55A 1AS6A 1NDTA 2CBPA 4A66A 4BXVA 2TSAA 4DP2X 2BWDA 2J56A 4YSSA 1E5ZA 1V55B 3PAZA 1KV7A 4HCFA 1BQKA 1NIDA 1GW0A 3EF4A 1SFHA 3FU7A 3FT0A 3U25A 1JVLA 2DV6A 2QT6A 4GP4B 1IBYA 2I7OA 2BP0B 3UADA 4NB7A 2BP0A 1JZEA 3WG7B 1JZJA 1OE3A 4YSQA 4JHUA 2YQBA 3UACA 4E9RA 1OCOB 3TBCA 3TASA 1EZLA 2TSBA 3OMIB 1JZHA 3UGEA 2HRHA 3D12B 1TEGA 3NJMA 3QJSB 5EHFA 3UABA 4KO5A 5I6OA 1AR1B 5AKRA 4KOCA 1XB3A 1PNDA 4YL4A 2H3XC 3UAAA 2PPAA 4QKTA 3N2JA 4AKQA 3OM3B 5B1KA 3T6ZA 4FA7B 3T9WA 1KCBA 3T6WA 1L9RA 2OCCB 3X1EA 2Y1AA 2PLTA 1OOWA 1WA0X 3SBQA 4A67A 2GC7C 3RYMA 2PCFA 1NIFA 1YLBB 3X1FA 4BDVB 2AZAA 2YXVA 3T71A 7PCYA 1BAWA 1QNIA 1L9TA 4BWTA 3NP4A 2MTAA 2YAPA 4G71B 1HFUA 3NSCA 3JT2A 1NPNA 5I6LA 2J57A 5B3SB 2EIKB 4E9QA 1GR7A 1NWPA 1WA1X 2B3IA 2GHZA 4CSPA 1BXVA 2YXWA 1NIEA 1UATA 3OMNB 1ET5A 1URIA 1GS6X 5F7BA 4YSOA 3FPYA 1AS7A 1ZIAA 1ZV2A 1PF3A 2BHFA 5I28A 3CG8A 5TK4A 1A4CA 2PP7A 4E9TA 4YSEA 4KNTA 2MRYA 5A7EA 1SNRA 3ABKB 3OQRA 1E65A 1BEXA 4DPCX 6PCYA 2XV2A 2IDUA 6PAZA 3T6XA 2EIMB 2UXVA 1WAEA 3NJGA 2HX8A 1T5KA 2IH8A 2FJSA 2FQEA 3FU8A 1ZPUA 2CAKA 3KW7A 2EIJB 3PLYA 4UF7C
chains in the Genus database with same CATH superfamily
1IMHC 1DQQA 1G9HA 2I60H 3SPHA 3MACL 5I30H 2G2NA 4JDZA 4NN7B 4OW6A 1AO7B 5IZ7A 4NN5C 4WU7A 3VW3L 5AOKA 3FNKA 1H9DA 1DO6A 1WBZA 3OKDB 3DOSB 4GMTL 4KJYB 4OZHE 4ZW8A 5EFIA 4M1CD 1M56B 1I1AD 2B3RA 1J1OH 5J6SA 1J8HD 1OLLA 1MF2H 1QNZH 1F4XL 1JYXA 4QXWA 1H0DB 1X9LA 2DQCH 5IW1B 4X6EB 2E9WA 2WSDA 5GGRB 1QZ1A 2G3NA 4NO5A 4PJIE 1KEGH 1JWMA 1NPUA 2OW7A 2EJ1A 3T1FB 5C6PB 1BMGA 3DSFH 3F85A 3LZLA 5E6RB 4A04A 3QJOA 3RHWK 1MREH 3BVVA 4A2FA 3V2AR 3IU4L 4HUCA 3RVXC 4LSRH 3S4SA 5BS0B 3K6OA 3LSOA 3NPZB 3D18B 3HC4L 4OFDA 5FYKL 1J0YA 1WUNT 2OSLB 3AW5A 4E9YA 4HWZB 3GT6A 1YVLA 3FB6A 2GBUA 4NI6A 4GUPB 4ZXBB 1YMME 3C75A 1DSWA 1EEYA 1UB6B 2C3HA 3BZDA 5KVFE 5TJWK 2BY3A 3MV8D 4S1QL 2PYED 3CLWA 5D1QC 1RMFL 3I3BA 5DJXB 1JDAA 5IQNA 5FYLD 5E5UB 4P2OA 3A4AA 4TNWK 5ADPH 2TRYA 4PS4H 2OSXA 4KVNL 3FU5A 4PJDF 2D7MA 4HKZB 1DFXA 4AENB 2MPAL 3I50H 3IS0X 1TTBA 4HH9B 5DQDH 5EZJB 1RJYA 2A6JB 4I88A 2FHBA 4KDVA 4LEXH 3WUWB 1EAPA 1XF1A 3PL6B 5AYTA 1DJZA 2ZNXA 3HE7A 1LDSA 2X4UB 4JREB 4YSAA 3NEXA 5ADOL 3FYEB 1VEPA 4DP4X 2WO3B 2H0FA 3LZOA 1L5GB 3O6MH 1FG9C 5TD4A 4AYSA 1A4BA 1I85A 2Y07L 1OP4A 3VAEA 4YDVA 3OJMB 4N1CA 5IM7B 5B39A 3QJRB 2CK0L 2JXMA 3TO4C 1NIBA 4TLKA 3AT8A 5TPWL 2WZ0A 3KPRD 2YD7A 2QVMA 4FYRA 1USZA 4P5SA 2GSMB 5IMKB 3I3EA 2YPVL 2YPLE 4HHAA 3TT1H 4Y9FA 4KTEL 2VDPH 3CFIC 2K6ZA 2F9BT 4A6YA 5BRZA 3HI5H 3H6JA 4AZ8A 5D7IE 5D93C 5EORL 1NWOA 4UNVA 3VFMB 3IKKA 4ZX3A 5FO9B 1F58L 1AQKH 2JCCA 3ZT5A 1N6QL 1U8KA 5DRXA 3CK0H 5EU4A 3U7WH 5ICYB 2X38A 2WQXA 4RDQG 2IFGA 4APXB 1AG6A 2YD2A 1QASA 5FYLL 5EDSA 4ZG1A 5EEXA 5L2KE 2EIEA 3BVXA 4ZW6A 5LG6A 2HFFA 3ELQA 1WGOA 3ZGHA 1RY7B 4B96A 3CZFA 4JO1H 3U7YL 3BIKB 3BP7B 2NY0D 4PREB 1OB1A 4FQ1H 3MOQA 2BFVH 2R29A 1Z66A 2UZXA 3DXAB 4FD0A 4U3XA 3MBWA 4YHZL 3TP4A 3ATFA 3VXMA 3GBNL 1J12A 3QJQB 1XH3A 3SE4A 1AANA 2WTRB 1XH1A 3PQYA 3BUBA 3VSUA 4QXUL 4NPJA 4HFWB 4AG4H 2CRYA 4Q9BA 3OLDA 3WCYA 4BFGA 4ZW3A 2BRRH 5HGHB 4PJGE 1WITA 1GOGA 4H20L 4J4PD 1NMBH 5FKAA 4XPHL 1E67A 3HJEA 1KWGA 1CDHA 2VXSL 2IANB 1HKLL 1AYRA 4IOIA 4G8GE 3INUH 1LO4H 3IMSA 5KYWB 3IU3B 3RVVC 4K3EL 3X14B 3TNNB 2VLKD 2ODIA 4U6VL 2AJZB 1E5AA 3LEYL 3FQRA 1P9MA 2PWHA 5D2NA 4Z3IA 1CDJA 1K72A 4FKEA 2PN5A 4Z7UA 1N0LA 5HI4C 1XCTB 1GZQA 3MV9A 3PIQB 4KY1H 4K5LA 1B4TA 1JNHB 4YHLH 3IDMB 2XVKA 4MASA 2XU9A 1B6DA 1O7DE 4UM8B 2XIDA 2DEYX 4JFEA 3N85H 1JFQH 4KKBD 2MKLC 3HPJA 3O41A 3O6FC 4XN2A 1JRHI 3F8UB 3L2LA 3QULA 4IJ3B 3T5WA 2ZG2A 5SV4A 3D3VD 3HHSA 3GDBA 4JQIL 5DT1L 3VXRA 3WD5H 3CBJB 4I48A 2HZHA 2CBTA 4GRWH 3TV8A 3CZJA 4YIQB 4NN6B 1A0QL 2RGSA 3U30B 4JM4L 3D85A 2DLGA 5CLXA 1VERA 2PW1B 3BGMA 4H25B 2EKJA 4E42A 2NXZB 3US0A 3CFEB 3IDYC 1DBAH 2G60H 2FR4A 5AW3B 2J6EL 4HS8L 4V1DB 2XQYK 3BP4A 4LKCB 3KW8A 3N42B 1KENL 2WM0A 3MLUH 3ZMEA 4P46B 2KQMA 5GS1A 3QIWC 1QI4A 1YUHA 4KO7A 4KUCD 4PGDA 4QI3A 4UQCA 3W57A 3ZYJA 2VSDA 3U2SB 1VKXA 4JKKA 3SKMA 1DBBH 5DZAA 4LQFH 3ETTA 1NC2B 1S7XA 5KVGL 2NX5A 4TL4A 5JLZA 2FL5B 4HHGA 5ICXA 3BGAA 1LD9A 1TU2B 4U1SB 3ARBB 4HLZG 2FJHB 4WWKB 1RJLA 5D1XB 1B6UA 2HTLC 1PX4A 3FQXB 3P4NB 2BJML 4PP1C 4DH2A 4AT6B 2GJ6E 4MJIE 1E4WL 4PCTA 3QXDA 3EO0A 3W0WA 5CZXC 4JPIB 3SJVA 4ORGB 3PABB 4FG2A 5HI3C 1GGBL 4OLZL 5J6GB 1L9PA 5ID1A 3KLHC 1G9ML 3Q8FA 4IOFC 4PB0L 2EDNA 5JOPD 3ULAB 4Y4KB 4LCWD 4MCMA 3TBTB 4JDEA 2X89A 3O6KH 3Q6FA 4YBQD 1LP9E 4PGZA 1FNFA 2VIRB 1PKQA 3CFBA 1E2ZA 4ZDHA 2R1WA 3KYMB 4G11A 4JY5H 5MERB 3I2CH 3UYPB 3GHBL 5D72H 5CBAA 5KVDE 1TTUA 4IEFB 1XTMA 3DK2A 2KQNA 2PUQT 4MX7A 1VEMA 1DTUA 3VWJB 5DO2C 5LB1A 4N1EA 2FWOA 4LLWB 2FJFB 3U83A 5GGTH 3UYRH 1NDMA 1MHPL 4JRFA 4LSSL 4F7TB 3D25A 1XB6A 4JHZA 5CGTA 4WUKL 1FNGB 4M9OA 4MNQA 1EGJH 1C8PA 4HIEB 3L17A 2UUDK 4UIMB 4NCC2 4O02A 3LEXA 4RX4D 1KIUA 4TQPA 1CF8H 1CFSA 2P26A 1AQHA 1M1XB 3VFGL 1KJ2L 2DYPB 3BKCH 3FHEA 3LX9A 4PRAB 2UVEA 5LKNA 3EXJA 3VFNB 3U9UB 4F1SA 1SQ2N 4N0CC 4U1GB 3VXSB 4Z7NB 2R29H 1BEYL 2I5YL 2XBDA 5IB2B 4NERA 4QTHA 3QZMA 3GBEA 4ODUB 3U4EB 2H2PC 2Z8VC 4EI6B 4NWTH 4UDUB 2WAHA 2JKSA 1BQHA 2BOBB 5DD0H 2FB4H 2BXYA 3MRRB 2R7EA 1QR1A 1IGML 4AQ1A 2MSPA 5AOJA 2PCPB 3GLDA 1BHGA 2EIZB 4TRPH 5LO7A 3VTMA 4NPYA 1TZIA 4DP2X 1JV2A 5EO0A 1RUMH 2WLKA 2WKGA 4YSSA 4ONOA 2PTTA 3VFSB 4XBEL 2YS4A 1H3GA 4MQXC 2VMEA 4LVOC 4MD0A 1D9KA 3DETD 1X5FA 3S98A 4QHLA 1JYWA 3AAZB 3SQOH 1X5IA 1D2PA 1YNKH 4IRJC 1IBYA 1K2DB 1OARH 3UADA 2CO7B 2JJTA 3IS1X 1T0PB 1G9NL 2ENPA 4QF1A 5DC2A 5C0CB 4OKVB 2OZ4L 3GLEA 3EOTL 1U95B 2NZIA 3IMWA 2ENYA 4ODWB 1OSZB 1JNLL 3S2CA 3BESR 1IC4L 4FYQA 4P2AA 1F4HA 4X7SL 3VD3A 1IC7H 1SJHB 3CN4A 5C0FA 1FJ1A 4FXGC 3BH9A 5F0JB 1GPOH 3ARUA 5KOVC 3BQUD 3W2DL 3UAAA 2NY1B 2WWMC 2Z4QB 1KV3A 2AJUL 3MJ8B 5LAPA 1UD2A 4UINL 3C5JB 5DFAA 2B1HH 3WTUA 3MBED 4X7EC 2Q6WB 2OAAA 4F58L 3H42H 4HJGB 3CLEH 4P4KA 4N68A 3DJZA 4U3SA 3GJFA 1MAMH 5SX5K 4JPQA 2Q7YA 3QDGB 1JZ3A 4L3EB 4B9FA 1GMIA 1HHGA 3B9KC 4E41A 4L23A 3ZE1E 4NAQA 2AZAA 2YXVA 4X5XB 4XNZB 5F44A 4DCQB 1GJUA 1JPFB 3EJYC 5D71H 5J9PB 4PJ9C 5JIIA 3NZHH 2ADGB 3RHWF 2YMXH 2CRZA 3S2AA 4Z8FH 4PJHB 4Q0XH 1MRFL 4YGAB 5T1KA 5EH1A 5CD3A 1RURH 4JMXA 3QNZA 4OCXL 2IXQB 3IXTB 2LAGB 3CFDA 1DZBA 1TVBB 1ADQH 4L9LB 3ATAA 4XCEA 3DUHA 3DX2A 4M7ZC 1I1FB 2EH7H 1DEDA 2CDEA 3QWNA 5AAPA 4FZEL 4MS8D 4CL7A 1BG9A 1UD4A 4GSXA 2YK1H 5I28A 3TZVD 4X80L 3FUEA 4JJ5B 1ZV9A 4GW4B 1MFDL 4RISL 4ZS7H 4GT0A 4KMTH 1VFAB 2Y3NA 1LGVA 3HPLA 4JFVA 1UUNA 1D6VH 1MI5A 3GSNL 5AW7B 5GSRA 3V6OA 1CG9A 4YFDB 4FQXA 2IWGA 3KPMA 2P24A 5EZIL 1HCZA 3NJGA 4JPWL 5J6HA 5JTWA 3WS3A 3NIFE 2PKDA 1H19A 1TNMA 2WQSA 3U7AA 3NQKA 4PP2B 2WPGA 4R0LB 4YHKH 1DEEA 5FW6A 1JPGA 2H8PA 1NGPL 4MD5B 2VTFA 4CBPA 2DM3A 1QUNB 3PPSA 1KCRH 4M3JA 2C7UB 4JG5A 3TPUB 1T04A 3KPNA 3UJTL 3REVA 4F8TA 1JN6B 1IGTB 2GVYA 4N2AA 3QGVA 3QYMA 4S0TD 1CUOA 1OTTC 5BQ7B 2QGCA 2OL3A 1FL3B 4MAYB 1QEWB 1BQRA 3MRIB 3MGAA 2BSRA 2PP8A 5C2BL 3QZLA 1ZOXA 1GIGH 1X7SA 5E6IB 3KGRA 2X87A 4HAGA 15C8L 1EUUA 2W07B 3NGBB 4XMZA 3EYOA 3QJFA 4W9CC 3T6QC 2VWEC 1JNNL 1BLIA 4EZMA 1I31A 3L81A 4NSKB 2VDLB 1MCPL 1WT5A 3PY9A 4NUPA 1D5XA 5IMOA 2EVGA 3T4AC 4UNTA 3N1GC 3N43B 3D52A 3Q1EA 1HIML 5F3BB 4K73A 5CEYB 3GIVB 5CS7A 3BPLC 2HKFH 4ETYA 5CFAA 3P30L 3GZKA 1KG0A 4QRQB 2BOCA 3S8WA 2JLPA 4EQ3A 2QQLH 3KCWA 4G1EA 4ZFOL 1OWRM 3QIUA 3O9WB 4X42A 1PZSA 2DMKA 4YHOL 2X4OB 4YXLH 1U3HC 5H94A 1TQCB 1SHXA 1A14L 4PW3A 4JFDD 4ZUVB 3LN4B 1JDDA 3G6JB 1F56A 2FO4A 1ETJA 3ML8A 4Y16A 4XCCL 2HVJA 4EKJA 1GJIA 4NO3B 2WZAA 4U3CA 3VG0H 3QHTC 2WSKA 5ERWB 2AZUA 2HT3D 2ZSWB 3VWKD 3BXNA 3GFUA 3VXQA 4HWEH 5AD0A 1R4XA 1RQ5A 4ONHB 1VFBA 1ZS8B 1PFOA 4FF9A 4ZFZA 3X2QB 1ILUA 4G7VL 5F7FA 1YDPB 1NSNL 3ULUL 1ZRUA 1BREA 1P4LB 3RLSA 2H6PB 1BFSA 3SE3C 3X11A 1G4MA 1WYJA 3FQTA 4NKDA 3OF6D 2NY4B 5EBLB 2WLYA 2B15A 1TYJA 4OLUH 4OGAC 4OCNC 1LWJA 3SOBL 3VGBA 3ZTEA 1ZHBB 4WNQB 2NW3A 3CFCH 3EZJB 4P9MH 5HHOA 4BSWA 4C47A 5B38A 2FQFA 1RZGB 3IDJB 5I66B 3I84A 3PWUA 1IGYB 4QRSA 1CFVH 1OAUH 5IJDC 1H6FA 1UA6L 2R23B 2O6FA 4NDMB 4XZUA 3DMMA 4G8EA 1H3VA 4HKJB 3BN9C 2X1XR 3VQ1C 2E76C 2H32H 2KLTA 3S3CB 1HL9A 3ULSA 3HN3A 2VLJD 4P5KA 3JBG7 3NAAL 4P57B 1PZCA 3SKUD 3PCYA 1OT2A 3OAYH 2JV6A 4MJ5B 4GAJL 1MZYA 5IQ9B 4HOZA 1TTRA 4LASH 4XP6H 5DMIL 4LOUD 1QSEB 2FJUB 1BF2A 1CE1L 3C5ZB 3VGHA 5I0ZA 4UOW0 3HRZA 5D7KD 1JZ7A 4U1KB 1JK8B 4NKOB 4QXGH 4R3SA 3UTZA 4GRLC 3WMSA 2W0LA 3QUXD 2Q10A 1KBBA 3DHPA 1GKEA 1E8WA 3LVTA 2VXVL 4Q4IA 1S4IA 1DQJA 1FC2D 1HSBA 4FKKA 4IRZL 4LCCC 3QHZH 2WWNA 5LBSL 1AQDA 3L3HB 4FP8H 4G82A 4RMWA 3OLGA 4CMHC 4XNDA 4YWGH 2NXYC 2Z93A 3ZYOA 3C09B 1QD0A 4AVKA 1AD0A 2G3XA 4LLAA 4GQRA 1JMZA 2JFCA 1MIEL 4RAUA 4FQIL 5AW9B 1QQDB 4JPVH 1XMEB 5I1CL 3NSFA 3MA7A 4XOCA 1VACB 2QVIA 1LK2B 3FL7A 4Z3GA 4AUJA 1BD2E 1CFNA 1A7RH 3W82A 1C7SA 1TTAA 3BX7C 4OLVL 4BQCA 4Y5VC 4RRPM 1BVLB 4L4TD 5E9DA 3CQFA 2P5EA 1A7OH 4PJ8D 1FGVH 4BZ2H 4PLKD 2OL3H 5EEZA 2O6EA 4F9LC 3ECQA 3MLSH 2H2SC 1A3LL 1P0SE 3TVMA 4F2MB 2XG5B 5CBEA 4PBXA 3PG2A 4U1JB 2BNQA 3TN0C 4P07A 4H8WH 3FMGL 5KG9A 3NJXA 4WW2C 3OXSA 4KV5F 4XMKH 2BNUB 3APFA 3MJ9H 2ICEB 5AL0A 1M6UA 4FEIA 1JZFA 3FO2B 3ZXAC 4JO3L 4APQC 1IV8A 2OMTB 5GS0C 1TO5A 5D7JB 2YAFA 3MAWA 2XC8A 2DYSB 3JWNC 5AVQB 4NKIH 2WYIA 4F7CA 4HPHA 4WI7A 4J8RA 3MUY1 3FAWA 5KUMA 4IMKC 1HE7A 1UD3A 1OAQL 4NXKA 1MW1A 4EZLA 1I1AA 5CJOH 3RJDA 5GRVL 4N8VG 3SIKA 5K9JL 2X4TA 3MKKA 4I18C 2Q7AA 3APNA 4Q52A 4M1DH 4P0DA 5KUKA 4BD4A 4WV1A 1QLEB 3RG1C 3MRFB 1SDDB 2WIIA 2F8XC 1YZZA 3JV4A 1A64A 3M45A 2P3YA 3GXTA 4PY8I 4BHUA 2XIBA 1EDYA 1YPZE 2H47C 1YN7A 5IJBC 4H0LC 5HD8D 1WRFA 5SWSD 4K3JH 2AJVH 4HISA 5T1DL 4K71B 2CZNA 3K8KA 4QCIB 1A6WH 2CCWA 4QYAA 3UJJL 3TCLA 4RLDA 3LEVH 2BSSA 3AU1A 3HBQA 5DFVD 5HGDB 5I8KL 1EDQA 1NEPA 1P4UA 4MMZA 2K6WA 1EZVY 2VR6A 4IU2B 3UBXB 5I6XC 5HPMB 2D3LA 3BPOB 5F70A 2CHNA 1ZLUH 1U21A 4DP8X 4XP4L 4P23D 2QADB 4LEOA 5HHMB 3UBGA 2YD9A 3NSJA 3P9LB 5FGCE 3K6FA 2OFQA 2VUKA 3O0LA 5DRZB 2LU3A 1X5YA 2G75A 3ASOB 4YK4C 5EUOF 2DEWX 2BIOA 3K6SA 4Y1AA 1B9ZA 4MNGA 1UWEH 1ZIBA 3HNVH 3FBKA 3R19A 1BFTA 1H6EA 3RZCC 2DEXX 3EYFA 3GSOA 3VFOB 2RA1A 4YVUA 4YDLB 4JRXA 3GJEA 3RA7L 2XPYA 3NBNA 1Z5YD 3CVIH 3KLQA 2WUBL 2Z7ZA 3JV6A 1FO0A 4H1LA 3CU7A 2ZUVA 1ED3A 1HI6B 3LRMA 4HJIA 2FX8L 3BISA 3GSQA 2OLDA 3B4NA 2I69A 3OKKB 2IOMA 3MXVL 1Q9WB 3LQAH 2Y7SA 1P4IL 3MCG1 3WFCH 1UM6H 3ZMNA 1MW3A 4XCNA 3SBPA 4DP1X 1K8DA 5DJ8B 1YY9C 4GIPD 3KPRA 4L18A 5CCJA 1A5FL 1ECZA 3U0TB 5C0AB 4R4BB 4D8OA 3OAYK 1JGDA 2IV9A 4L0ZA 4FKHA 2IGFL 2WZ5A 3ISYA 4OZHF 2WXLA 5HHVL 2J12B 2RH0A 1INDL 2AXFA 3FU9A 5AVRB 1HH9B 2R59A 4KMLB 1UM4H 1IT9L 3BLKA 1J7VR 1U41A 4JAMB 2R69H 3DI3B 2LHAA 3S34L 1ORQB 5AQ0A 3QIBB 3NN8B 2MFNA 4L1LA 3FCGA 1F4AA 1XGYH 2AABH 5F7DA 3E3QC 5F6HI 4PVBA 1E5ZA 2JSFA 3FTGA 4K5MA 1A4KB 2M26A 3R0NA 3I6LD 2FUTA 3QUYC 4R96A 5I71B 1MCEA 2FZ3B 3C60B 1SY6A 2ILLA 3DUSA 4F3FA 5JXAL 5AALA 4EUPG 1WLHA 2X6BA 3G04B 4M93C 1NC4A 2BP0A 2OTUB 4PJBE 5AZEL 3RKDC 4XNYL 4HIXH 3LVEA 3OKEA 4JHAH 4B7IA 1P7KB 4JZOB 1S9VA 1T1ZA 4FNPA 3RURA 1FV1A 4N2OA 2OR9H 5DD5L 2BRQA 4J3OC 1AIFA 3QORB 5I6OA 1AR1B 4J4PA 4J3WA 2VDPB 5GPRA 1UWXK 1LYQA 4UM9B 4QKTA 4N2LA 2ARJQ 3TV3L 3WNMA 5D2LB 4X2UA 4MVBC 4WWNA 4U3HA 1OOWA 3HS0C 4MWFA 5DJDB 5GS2D 3BGFC 3SBQA 1P1ZA 3B6SA 2PCFB 4I7ZC 3P4LA 5CJBA 4KKPA 2ZCLH 1M05A 4G9DB 4XXCA 1ERNA 5KYUA 2VXUH 2YWZA 1OSPL 2MTAA 1YEFH 1FAIL 4XPBL 1D6EA 1TETL 4RESB 2R9HD 1WH0A 5JHLL 2J57A 4XNQB 1ECYA 3SHSA 3VGAB 2VDQL 4D9QD 5KSAA 4PSRA 2GHZA 4K3DH 1CXIA 1VIWA 3VMPA 2C1OB 4PV9A 1H3XA 3K71A 1FORL 3D4CA 3P0VL 2DKUA 1ZVSA 3DV4B 5E24E 3WBDA 5IBTH 4YEFA 2AK4A 3D3VA 4GW5A 2AJSL 2HTKC 2DMCA 3RTQD 3QUMH 4FFWD 2UY7A 2D9QB 5KANG 3U4KA 2X6AA 3LXBA 4RWYH 3C8HA 3GKWL 3HUJF 2YGPA 1BVKA 4FA8A 4KH9A 4NFBA 1JHKL 5D7IF 1IL1B 2ATKB 4WHDA 4OCWL 5DWUH 3K1KC 1FFOB 1KLUA 3GRWH 3KHQA 5SX4I 6PAZA 5F7UA 3QEQD 5G4NA 2E7MA 2VQ1A 4G5ZH 1MCCA 5GJSH 2EKSB 3GSXA 2R2EA 3VFVB 4ELMB 1II4E 2XWTA 2J5LB 3EO9H 2F54B 3L4XA 4WKZA 4BKSC 5DLMH 2P5WB 2FNBA 1QACA 3O2DA 1JL8A 2MH4A 2YD0A 3PLYA 2J8HA 1A7QH 5EPMA 1U3YA 4DK3A 4WTXA 2I07A 5I1JL 4JDZB 3K8MA 2MKWA 2LFEA 4ONGH 2XSKA 5MP6H 5F88B 5JORA 4WNSA 2P46B 4ABVA 4WU7B 3CZNA 4LRNH 3G5VB 1MWAH 5D1QA 1CR9H 4HJJL 4KGJA 1WBZB 2XUWA 3Q8AA 5DZNA 2I26N 4ZBJA 3CDZB 2VERN 2WXRA 3FS9A 3NJKA 4MCNA 4ENED 3AREB 2K0RA 3BHBA 2C9RA 4PRHA 4KPHL 4ZMOA 5E8PA 1WK0A 5FUZL 2EDOA 2NQCA 1ZLUK 1GMEA 5DK0A 5LAXB 4C56E 5ESVA 3AS1A 4NO5B 4DVRH 9CGTA 4GRWB 4NRZA 3H8NA 4PJGF 5JDSB 5AW1B 3WAJA 3N44F 1FO0H 3L7FA 5IOKA 2ZPKH 1VZHA 5D6CA 3ZO0A 1G7QB 2N3JA 2NY6D 3GK8H 5IG7B 1TZGL 4W9EC 4JRYD 1YY8B 3LSOB 3QNFA 4X7TB 3V7MA 1YEDA 3ECBA 4GXUM 4JO2H 4F8NA 2JQMA 1U8JA 1DDTA 5KS9A 1J5DA 4JFFD 1A7PH 1EEYB 3LKPA 4I85A 1RZQA 3LRSA 3OSKA 2AV1A 4XP5H 3ALPA 4LPVA 4R97C 2ED6A 3WLBA 5GRXG 5IV2A 1NFDF 4JO4L 3VD0A 3S3BB 3QCUL 4MJ4A 3S96A 2X53A 2GYSA 5CEXA 4R2GC 4OV5A 4GBXD 5CKAA 2HT4D 3LPWA 3LS4H 1GRWA 4HK0A 4JM0A 1OE2A 5FB8B 1KBVA 1SEQL 1XSJA 1RH8A 3QYCA 4ZOCA 2XZAL 5KANI 1RJYB 1RK1A 1HDMB 5FYJD 2BVPA 1EAPB 4DERA 4Q2ZB 1DCLA 4O58L 4ZFGH 1NFIA 1DFBH 3HE7B 5CJQH 2CE6A 1IO4C 4K2UL 3LRKA 5KVEL 2K8QA 2PXYC 1WG3A 3PP3H 1A2YA 5ALBH 5GZOD 4R90L 4KQ4L 4XNXH 2WCSA 3CVHH 3B9DA 2XKSA 3BMVA 2Z64C 3T3PE 4Z7WA 1SLWA 5ALCH 1OZUA 3F04A 2JXMB 4PMEA 4FI6A 5CGMA 3H3KA 1RZKH 5HHXH 3D05A 3JWDH 4MA1B 4HHAB 1SXNA 1U8NB 2XWZA 3HG1E 4Y19B 5DRWA 3S8GB 1U8IA 1F1GA 4A6YB 3QRFM 2LLLA 4AZ8B 4DK6A 1RK7A 4X6CA 1JPTH 1BCIA 5IMLB 1NKRA 4LFHD 5C97A 2RQEA 1NLDH 2JH2A 1U8KB 1SXBA 3FN0L 5EU4B 4AKOA 1KNOA 3DHJA 3HB3D 2FBJL 2GQHA 4XX1G 1EEZA 2HKHH 2QQNL 2ID5A 5JHDB 2VZTA 4N5UA 4NRYB 5L9DH 4Z5RA 2FX9H 1Q72L 4S1DD 5CEZE 4YSTA 3OKLA 1IM3D 1PTZA 2JTYA 2ESVA 5KN5B 1C12A 2HFFB 1A4JA 3EDDA 1IZKA 3O2WH 5IEKB 1PGRB 4RBPH 2AJYL 2DI7A 1FHNA 4GKNB 5F2FA 1LP9F 1OB1B 3B2VH 1AAJA 2UZXB 2N7BA 1GYUA 1DJIA 3MBWB 4X99A 1E5YA 3NVQA 2WGNB 3O6FA 1NCDH 3BQUA 3IDGB 3PQYB 5I1HH 1QBML 2G0KA 1CF1A 2WLJA 4WK2B 2ERJC 2DH2A 5IQ7L 1DQML 2UYLA 3QPQD 2NLJA 1FBIH 1P7BA 5EC2A 5FO8B 4FL4B 4X4KA 5EOCH 3SKJH 3TGXA 4Q9RH 1MJ7H 2ENQA 5FKAB 1AXTL 2IH1A 5BZDA 2DI9A 4FI7A 1EJOH 2ZCZA 3RWHA 2YD8A 2DQTH 2EEBA 3B83A 1WEJH 5J5EA 2NYZA 5EU7C 1EA9C 3IFLL 3B2PA 3LNEA 5IREA 4HAKA 2DS4A 3DSFL 5DS8B 1DSYA 3F7LA 5IMMB 2YEVB 3CVDA 3QR1A 2XTJB 1NA8A 1R5IB 3MV9B 3WNIA 3L9YA 1TTFA 4N0UA 3LNDA 2CJUL 5D7LD 3SCMD 2J8OA 4K3HA 2ISDA 4J23A 5HYJD 1VHPA 4XX1E 4X9GA 3DVGA 5C6WH 2IH3B 1UM5H 4PAZA 4WUUE 2ZCHL 4JFEB 4PWFA 4R7VA 1X3DA 4NAJA 1NAML 2JB6A 3HPJB 3O41B 3CN3A 4HMEA 3CZUB 2R4RH 4F7KA 3M07A 3Q06A 3HHSB 1S7UA 1J0KA 3EJTA 4UDTA 2J88H 3VXRB 2E0PA 3HFFA 4H88H 4I48B 4M7KH 3MUJA 1HL8A 4HJEA 1LTXA 5C09A 4BM7A 5DHYB 1BWWA 1MH5B 2G5UA 3WSQH 3H0TA 3D85B 4KKCD 2V17H 5F97E 3ZW3A 1HK6A 3QJHA 2ZQKA 4HZLA 1YEIH 4B6ZA 2AEOA 1C08A 2EDWA 4G6MH 5TQ2L 4E42B 1N67A 1YEJH 5DQDL 4X5WA 5FW7A 4O4YL 2GBAA 3TEZA 4IKIA 5IB5B 1RP8A 3SE9H 4YS4A 3TTSA 5EO9A 1PJ9A 4M3KB 3MV7A 4WHCA 3G6DL 4LPTA 3F62A 5LCVH 4EE2A 2GJPA 1GY2A 8FABA 2NZ9D 4DT2A 1LK3H 5GS1B 1DDHB 1ROWA 3Q9PA 1ORSA 4QHKJ 1YUHB 4JANA 2KPNA 4TUKH 1E30A 4LNVA 2K9FB 4W9LC 3S4SG 4AH2A 4Z3EA 4YO0A 2BP5M 4ZTOH 5GHWL 3G5ZA 1J8KA 1QPKA 3NJIA 5KAQG 5DVKA 3J07A 2WINB 4ZAKD 1CD0A 2WYZA 4GXFA 2NX5B 3V9CA 4MXQD 4L37B 2A77L 5ICXB 1X5LA 1MFUA 4PJAB 4UV4H 5KOMC 1BX2A 1LO3H 5IT2H 3UG5A 2APFA 2HCZX 1B2YA 3MN8A 3PHAA 2ED9A 5IB3A 1U93B 3BLBA 1PAZA 2I25N 3QO0A 2J44A 3OSVA 2VDOH 3EO0B 3HAEA 4KRPD 4RGOH 3W0WB 2HMID 5DEFA 3VGDA 1KCLA 4C4KO 1ITBB 2X70A 5CR1A 1INEH 1ZGLM 4YHYC 2BCKA 1Z5LA 2WLNA 2FX7L 3BUDA 4DGIL 3Q6FB 2B2XH 2WBXA 2YUXA 3L4YA 1TEFA 1JGVL 3MI6A 1PKQB 4BWUA 1WZLA 4ZDHB 3RDJA 4AM0B 2CQVA 5DF0A 1WTLA 1FL6A 1F90H 1WIPA 4FYSA 5LBVA 3IFNL 4A2EA 4YXKH 4MX7B 3D33A 3BW9A 4HXBH 3CSGA 1LEKB 1BQ5A 3STBA 1YRKA 4JFDA 2AF2A 4HJUA 5B39G 1BXUA 2HUHA 4PRPD 4E0RB 2DAVA 4P3CH 3VXUD 3KMDA 3TBSA 2YD5A 4OFQA 3B2DC 4KQ0A 5KWYC 4L48A 2G5RA 1MRCH 1SMOA 1T21A 1XR8A 3NCWA 3GQFA 3LXAA 4MNQB 3C2AH 5T1LD 3VG9B 2B39A 1MFAH 3I6KB 5FCSH 5E6UB 1GSKA 4ESKA 1RIVL 4OM1L 3LEXB 4OCSL 1G9MC 1CFSB 4NHUA 4M7JH 4G6FD 4IRJA 2V8LA 4CAGA 1OPGL 2HX7A 3C8DA 3LQZB 2CLZA 1R3KA 5KYXB 3RDTB 5F7AA 4LSVH 3GXIA 4BKLB 1R5VA 1ZSHA 5IFHL 1AZZC 5C6TH 4BZ1L 3BC9A 4QTHB 1QO3A 2OX5A 2VN4A 4IIQB 5GQBA 4AMKH 2EDLA 2NR6A 1JGUL 2WXOA 1T5XA 2YGOA 1O5DT 2OMBA 3V4VL 2VYRE 2OMXA 3FO9A 5EC1A 4UOJA 3KPSA 1VF5C 4BQ8A 4MQSB 4AQ1B 4M7LT 4JQXC 4L0PB 1CICC 1YCSA 2DQEH 3QP3A 5L0QC 4PJ5A 4X9IA 5TK2A 1PYWA 4FXKC 3RVTD 4HOWA 3ARRA 4HJ0C 2CBPA 4JFXA 2JIXD 4N0FB 3VA6A 2R0WL 4NPYB 1TZIB 4OI9A 3D06A 1A6PA 1L9NA 2TSAA 1JV2B 2OMZA 1MEXH 4G8IA 5EO0B 1DO5A 1E6JH 1JXJA 2PWEA 3N42F 1GZPA 2PTTB 3OTTA 2VLJA 1G84A 1OGPA 5DJZA 3D2UA 1AMXA 1DVSA 5LNEA 4IHOB 1H8SA 1D9KB 2X6MA 3HI1A 3EFDL 2VRQA 3OGOE 1G4RA 4HV8A 4MD0B 4PJ9A 4XN7A 4D0DA 1ZEAH 4A2LA 1WWBX 4LSPH 5DD6A 4LCIH 4TLSA 2IDCA 4ACPA 3EYQD 4QYOA 5JR1H 2EDJA 2JKXA 3RX7A 1CJYA 4AEIL 1J5IA 2Z8WC 3QI9D 5JXED 1A9VA 3DGDA 5BRZE 1EZLA 3FUMA 4NQDB 1IBBA 3S36L 4HT1L 2VXTH 5F9JB 1WWAX 1TNNA 2QMKA 1ZKAA 4JPKH 2F58H 3U79A 1BECA 2JCCE 2E27H 5T5FL 1DBBL 5HYSA 1H3PL 3CMOL 3PWVA 2P43B 3VMNA 4PJXA 1AGFA 1PZ5B 1JUFA 5IKCB 4RNRA 1NUFA 3OM3B 4XWGL 4M43L 2HH0L 5DTFA 3GS0A 1IAKA 3QUZC 4U3SB 1G6RL 5EZOH 5IVNA 3WIIL 4OJFL 5KSBB 3V0WL 1V3MA 1IFHL 3BZ4B 2DQJH 2YPLD 4A67A 1YQVL 4XN9A 2EH8L 2JI3A 4TKWA 1JCKA 1FCGA 1KTRL 1RZFH 1X4ZA 3AUWB 4MLSA 4MNHB 3ARFD 3O4OC 3T71A 1UA3A 1J8RA 4LU5L 2RCSH 3V5HA 3ULVE 2HJFA 1KCKA 3VXME 4BWTA 3QDMB 4JX0A 5KVFL 2V7NB 3IDNA 1G9NC 2JJSA 3JQOB 2P7TA 4FQLL 5T1KB 2WVUA 2AXJA 3T04D 1Q8MA 4ZTPL 5H35A 4L4TA 2J1ZA 3CFDB 4NO2A 4O2CB 3MU3A 4QHUA 3LIZL 3CJJA 3O6KL 4PJ8A 3LD8B 3ME0A 4XCEB 4Y2OA 1RP9A 4PY7B 3VJ6A 1NIEA 1WFJA 1L7IL 1ET5A 1URIA 1WZMA 1QBLH 4JN1L 4YC2B 4YSOA 4FFZA 4WI9A 4WI6A 4JFOB 1P6WA 4XCFH 4KVCH 4HS6B 3PJSB 3FO1B 3VXPA 3L6FB 4DGVH 2EO9A 1NBYB 3IFOA 1KB5A 4XPTH 3U0WH 4MCYA 4YR6B 1BW8A 4MZRA 3TIDB 5D2NE 3HZYA 2DJUA 3PHQB 4NQCD 3WL9A 1CG9B 5DMGC 3WNKA 4Z7UE 3SPCA 6PCYA 4DAGH 1GTFA 1FN4A 5SWQA 4IRSB 2VQTA 3EJZD 3X3FH 4FQQB 3UPRA 2ZYIA 1YJDH 2EAEA 5IVOA 4Z7NF 5KVMC 3OV6A 2FIRT 2MCPL 3T4AA 4AYFA 1XH2A 4MBRA 4QRRE 3P69A 2CHDA 5ICUA 4G1MA 4TPRL 1DEEB 2H9GB 4NP4H 1JPGB 2H8PB 1IRAY 2GAZA 4G8GD 3NCFB 2PO6D 3BQVA 4W4OA 1IE4A 1LLAA 3VXTB 2P28B 3WELA 4IBUA 2HLFC 3QCVL 1TQBB 2B08A 3M8OH 1IGIL 2Z3FA 1U3HA 4OT1H 2OL3B 4Y8AA 3EH2A 3RWJA 1YEHH 4U0QB 5F9DC 4EZKA 4UQDA 2BSRB 4ODSL 4E9SA 4EN2A 2FB4L 4MDJA 1EO5A 1NCUA 4OGXL 1KBWA 3OKMA 4XNUH 3UP6A 4PTUA 3PJLA 1PS3A 1OGAB 4FNRA 4WO4A 3QJFB 1DVYA 4PB9L 5EU5A 1GSMA 1WBXB 4DQOL 4HC1A 1M7UA 3SGJC 2Z35A 3MBEC 3C6LD 1D5XB 4S11A 3SDCC 3WE6B 5I8EA 4M6MH 2OMVA 3ILQC 1YMHA 1K4CA 4NXSA 4P5RA 4QY8A 1QWHA 3LDBB 2A83A 3RVWD 3V52H 1WBYA 2FT6A 5GIRA 1YYCA 1OARL 4FMVA 2W81C 5KSUB 1MVFA 3L95B 1CGTA 3TESA 3HC2A 3D39A 5E4EC 4ISVA 4OM0H 3FU3A 1IUZA 1JRHL 3W0WE 3SJVE 1H5BB 4O9HH 3DIDA 4WZ9A 1IC7L 4KK9D 2B5IC 2PWFA 4AIZA 4L05A 2X28A 3T8XA 2C7FA 3IRPX 1DN2A 1BQHG 3EFFA 1U8PA 1UFGA 5SV3A 3VD7A 3AG1B 3MREB 4MS8C 3PWPA 1PPIA 5K9OA 1UH4A 1FFNA 1HX0A 2HVJB 4KXAA 3AG4B 3BDYH 2ZYSA 4PIRF 1SJXA 3JWNG 2XA8H 3KYNA 3KE0A 4B95C 4HUUA 1OAXH 2W9EH 3BXNB 3VXQB 4ERSH 2Y7MA 5AVSB 3K3QA 5KBDA 3GNMH 1MQ8A 4MJID 1YUKB 1QFUL 3QEUB 1TZ8A 4OLXL 3PWLA 1XF4A 1HH6B 5CD5D 4WGVB 5ACZA 2BC4A 5C07B 3BSHA 5DZVA 3H55A 3BVWA 4G3YH 5AKSA 2WN3A 1IKFH 2Y5TA 5I73C 1HQRA 1AO7D 1DBJH 3LHPL 2Z0UA 4GRLA 3RZWA 4A7SA 3FQTB 5ITBL 4UQ3B 3WTSA 1GC1H 1DVTA 2CUIA 2GPZA 2IWEA 3FQNB 2AQ3A 2NY2B 4MMXB 1TQUA 2WO4A 4G6KL 3HR5A 2XWBB 5HYQA 5L4FA 2A6KB 2UV3A 3QUKA 4JLRB 3NPSC 5B38B 3MLXH 4HDIA 1EO8L 1J1XL 3KPPA 5I1KL 3W9DB 4PGJA 1I8KB 4Y2LA 5F9WC 4XZUB 4G8EB 4U1MB 4FNTA 3F3HA 4Q9QL 5AKVA 1PLGH 2GY7B 2HLEB 1HCYA 1R5WA 1N64H 1M53A 1KYAA 1GGIH 4WDIA 1SYVB 5F9AC 1TLKA 4S1SL 2IQ9H 3VVVA 2L7EA 1BZEA 1BZQK 3S7GA 1KXVC 3UZVB 1NCBH 5IB1B 2V2XA 3QQ4A 3ULUC 4GIOA 4ZSOA 3ZRSA 2WO2B 3HRZB 1CLOH 2DKSA 4UTBH 1BQSA 2FEEI 3IYLW 2VRKA 5TGBA 4WHYG 3UTZB 1KCVL 3EF7A 4K23H 4AUUA 1UWGH 3C87A 4K3GA 2WWKT 2FQDA 1KCSL 1DQJB 1ND0A 3THML 3S5ZA 1BVZA 3JYCA 2F2HA 2R4SL 4KTDH 1A25A 1XXDC 2M8XA 4N2KA 3O3EA 4HG4J 4OTXH 1G94A 1MCRA 2ATPB 2K8MA 3L3KA 5T3ZE 5H4ZA 2Z93B 5JQHC 4APQA 3EGDB 2WAQA 3D5OF 1I1CA 4LDOB 2DL9A 4IBYA 4M6OL 5E2WH 2Z8SA 3N43F 1EJ6A 1F4WH 1KJ3H 2ZX9A 4RAUB 4GG6A 3PL6D 1YECH 3MX0A 4JFWA 2ARJA 1XVSA 2WOYA 1F41A 3HE6C 4X4XB 5KVDL 5E1IA 2WLZA 3LN5A 1ITCA 1MDAA 5C08B 1GCYA 4MMYA 4UBDC 1ZAGA 2J2ZA 3KBEA 4POUB 2XBTA 1KLGB 1SM3H 5FGRA 2H6OA 1E4JA 1Z9PA 2CDGA 5DR5H 2P5EB 4HIHA 4PWJA 1ES0A 4R84A 2IEPA 1ZANH 3FO0H 4I0PB 1MIMH 5E70A 4YSDA 1FFQA 3G6JF 2VQ4A 4U7KA 1L6XA 1KYFA 2JKWA 4E41E 2DQ6A 1HNYA 1VCAA 3QNYB 4IIZA 2BNQB 2CXKA 5IHZB 5C9JA 5ITFA 2DWTA 4L4VB 5KG9B 4LLQB 1J5OL 2GIMA 4K0OA 2BIPA 4NENB 4F57L 1CI5A 2X4SB 4U0RC 1KXQA 3S3DB 3ESOA 2OP4H 2HG5A 3HG5A 4HC1H 3TNMA 5E8DH 2HFGL 3U1PA 4F2EA 2EEAA 5GISL 3SDDC 2C3WA 1IAOA 5EU3A 2WXHA 2O5ZH 3D0LA 4F7CB 1X5MA 4OUUB 2FATL 4J8RB 1JHTB 3SQRA 4PJBF 3OBAA 3K81A 1S8DA 1MFEH 3V5KA 3GXPA 4UQAA 2WCPA 1GY1A 5ELIA 2EVIA 1UFUA 2PW2A 4GJTB 2Y24A 2X4TB 1VSCA 5AAMC 1E43A 3KPOA 1IE5A 3DJRA 3OZ9L 1MI5E 4L8BB 1O5PA 5IK3B 2IDFA 4W9GC 3TA3A 3V6OE 4WV1B 4BFRA 3SDXA 3QUMB 2WIIB 4FYTA 4UT6A 3EJUA 3P2TA 3V4PL 1RSYA 5C0RL 5HDRA 2V2WB 1NBCA 1MJ8H 4GI8A 4X9FA 3BOVA 3B2XA 1AZRA 5D55A 3REWB 4HF5L 4LB8A 1KELL 2D2OA 3CFCL 4Y5XA 2IAND 3U9PL 4RMUA 3CXDL 3WO4B 3D9AH 1AI1H 1I3RA 3MLZH 3TCLB 5L4JA 4WSJA 5LGHL 4BRJA 3RNKA 2BSSB 3AU1B 3HMXH 3GXNA 4H26A 4PJ7B 3EJPA 4KKLD 3IFPB 4NNPH 4E68A 4TULL 3IMTA 3QWQB 4NIKB 3UJIH 3HZVB 1KF9B 2ZG1A 4ODTL 1GVIA 4LEOB 3FUDA 3OC5A 3SE8L 1NIAA 1NCCH 3IDXL 4AQAA 2CPUA 5F6IB 4AGNA 5I1LB 4YAQA 4D9LL 4GRMB 1TJHL 4Y1AB 4KZEH 3A6OA 3ABZA 2HSIA 4CN4A 5HYIA 2RMNA 1XSOA 1FYTA 2R51A 1Z1WA 3EYFB 3F7KA 3QG7L 4QXGL 3KPLA 3GSOB 4XMLL 3ET9F 3WN6A 2OMNA 4JRXB 3KJ6H 5BUPA 2AEPH 2H1LM 4I9XA 1MCWM 5CLZA 1GTNA 3UL4A 4UZGA 1KIRA 1ZVNA 2ADJB 3TJHC 1FO0B 3VQ2C 1ED3B 4L8SB 4B50A 3U6XS 3I85A 1T89C 1A9BA 4ABUA 2NXZD 1TKWA 1WWWX 2EC9T 1RZ7L 2KC0A 4V1DD 3UAFA 5I9QB 4AZUA 3A3YB 4GMSL 3W38A 3O8XB 2VE6A 1K8DB 3VCLA 1EX0A 4P46D 2CWRA 5CCKL 5L6YL 1GAFH 4I3SL 3ZSSA 4PCYA 4MB4A 5JW4M 1EK3A 1BJ1H 5GGVL 1KTJA 5SWZA 1K5WA 5EEWA 3LRLA 1MJUH 4CU8A 2AXFB 4FXTA 3HS9A 2ZXCA 4KX7A 3GPEA 1NC2D 1NLBL 1U3JA 1AZUA 3SYQA 1KACB 1KGJA 2OPCA 4KAQL 1RUAL 5I19H 3ARBD 2DMBA 1VADA 4WWKD 3HS0A 5CP3A 1W72H 2O6PA 2Y36H 1PG7L 1XIWB 3LQMA 4PS7A 1IGFL 1Z9NA 4XR8C 4YHIA 5DURB 1NMCB 5GS0H 2OI9C 3UBFA 3FTGB 3U1SH 3JWNH 1V55B 1NCTA 4XMKL 4OFIA 1R24B 3S3SA 4NM4H 2CKBA 3EOBA 2VDKH 3DUSB 1J1PH 5HD8C 3HZMA 3CPLA 4Y4KD 5DQJA 4NZUH 5A40E 4MGXA 1NC4B 2ADFL 2BP0B 2FD6H 3FN9A 1JAEA 3GHEH 4HD5A 1N5YH 3DO3A 1JZEA 1A7BA 1CVRA 1Q1JH 2WTPA 4YSQA 2YC1A 4PWIA 3BH8B 4NKIL 4YN3A 1S9VB 4PG2C 1T1ZB 4AMXA 5DFVC 1FV1B 3HCVA 3OC8A 1M2OA 2VJXA 5HHOE 3CWGA 3N06B 1IBGL 3NJVA 1PEZA 3ZE0B 1AIFB 3MLPA 3DECA 3F65A 4DETA 1FVEB 5I74C 3FTYA 1O6SA 1KJMA 2Q0ZX 5F1SA 3DNKA 1FE8L 4P23C 1CL7I 4JN2A 5C8JB 4UYQA 3FB7A 5E08L 1RUKH 3CUPB 3VDAA 4F9PA 4QHPA 3DRTA 5K93A 3B6SB 5HHQA 4MHHG 2LOEA 3S97C 4ETQA 1O6VA 1M05B 4P2RB 4QTIH 5EG6C 1J0JA 5I75B 3FB8A 1DJXA 4P04A 3SCMA 4OV6F 2YGQA 3QXTA 2DYPD 4LP5A 4W93A 4HVBA 4HCRL 4NN5B 2XN9B 5BZWA 3ZO9A 5CJXA 4PV9B 1BXVA 3CHOA 1CBVL 4XI5D 1ZVSB 4GW5B 3RY5A 3PE9A 1UATA 3OHMB 1WFOA 2VABA 3C12A 4GS7C 2UY7B 1AFVL 1PU0A 5AOMA 1T22A 5KZCB 1FZJB 1BVKB 2FVNA 3L7EB 4HK3J 3WFZA 2ZICA 3QDJA 3BFWA 4QHMB 2YRZA 1KFAL 1KLUB 4MB3A 1ID5I 4DTGH 2VQ1B 5LN8A 3GSXB 5B22A 5C0GA 3STZA 2IH8A 4LIQH 2X9XA 4WKZB 3MBXL 1QRNA 3MTXA 3FU8A 4IS6B 5E9DE 5EPMB 2P5EE 1LNUA 5C0EB 2I07B 4WRLA 3WY4A 4N26A 4NZRH 1FL5A 4IU3A 1MHHB 3GI8L 5ESAA 5EF2A 4XVJH 2JJUA 2ZCKL 3B1TA 5C0CD 1D7FA 2XXFA 4HPOL 1ID2A 3A21A 5D1QB 3H54A 1D5IL 5TF0A 3UTTB 2O5XH 3WFDL 4PW9A 2BNQE 4P5MA 1FGNL 1NAKH 3WTTA 1S9KC 2DQIH 3ZTNH 4JKLA 1K8IA 4PRHB 1CTOA 2HRLA 1IBDA 4B9CA 3NFPA 1UKSA 4N86A 1SXAA 1NJ9A 3FQUB 5E8PB 3MLWL 4JPSA 2WLLB 1BD2D 2AI0L 4P49A 2X7LA 3SYPA 5HP5A 2RJMA 2HFEA 2NY1D 2C3VA 1U8HA 3ILPA 1OCCB 1BZ7B 1M2VA 2ZXEB 4B7LA 3FFCA 1WD9A 2R69L 5D6CB 3U4BH 1TTCA 4L3ED 4I77L 5JQ6L 2YKKA 4KJPD 2YXMA 4WGKA 2XLLA 4WHTB 1MCFA 4RGNC 1YEDB 3ECBB 3M7OA 5E7FA 5LUMA 5FA4B 1S3KH 4F1ZA 3KZ8A 4CC1A 5KS9B 4H1LG 1KXTB 3TO4B 4F33B 4OD1L 3A0OA 1JZ2A 1L9MA 2XDHA 5EBMB 2XWXA 4J2XA 1WVZA 4W9IC 5C1MB 5FHAH 4R8WL 2DTML 3ARDC 1ET7A 5IV2B 5E6YA 4BA8A 3QRBA 4ZD3L 2AAAA 2R9HC 3S96B 3ROOB 3GMLA 3K1DA 4GNKB 4PRPA 5A43C 5CEXB 1R17A 3VXUA 3QQ9D 5D93B 4YX2H 2APXA 4ACTA 6CGTA 4JRLA 1XDTT 3V4UL 2H3NA 3Q3GA 5H4YA 1AXIB 3U36A 3BIAX 2O72A 4KITB 3RTQC 1WJ3A 2BVPB 3G9AB 2VDOB 1UD5A 3BSZH 2VC2H 1NFIB 1BJ8A 4M6NL 1FVCA 3VTAA 3KS0J 1F45A 1MCSA 2MHAA 5MENA 1QW9A 1AOZA 4UIKH 3CFMA 1B0RB 1EHLH 1NMAL 4KXZI 3C6EA 3IM1A 4PU2A 2ZCLL 3ARGC 4DVBA 1CIDA 1DJGA 4BHUI 3AXLA 5I6XB 4Z7WB 2DLFH 1T0MB 4M56A 4DGWC 4Y1AE 4MNGE 4LHUB 3KL5A 1TLMA 2YPVA 4U1HA 4PWEA 2ZSVA 2XZZA 2C3XA 1XL4A 1KGYE 1CL7H 3GIZL 2V2TB 5ENWA 3UTQA 5CSZA 4F8PA 2VISA 1CGXA 4JCLA 4NO0B 4P05A 4NUQA 4BE5A 2G9KA 2UWEB 4X6CB 3WFHA 5JPMC 1U92A 4YXHH 2QLYA 1MCIA 2VL5A 2EXYC 3IAPA 2CMRL 4ENEC 1YSOA 4RWYL 3FTVA 4ES9A 1KNOB 1DUZB 4QAMB 1X7TA 3HC3H 5F1IB 1T03L 3GTNA 4R4ND 4I2XA 1ZHLA 4JS7A 3MNZA 3KAAA 2ZYHA 3HHRB 3KPRE 3QC5X 3OKLB 1PLBA 4J39A 4ZZKA 4OD2B 3IJ7A 3DWTA 3VQLA 1XXFC 1A4JB 5JW5A 4NM8L 2PTVA 3QI9A 2HA1A 1EH9A 5CIPA 2C9XA 5AVYB 2FLRT 2JKNA 2H41A 4P5TA 5FUCC 3CH8A 4X99B 4LL4A 3GJFK 3H3PL 3O6FB 4JFTA 1MAKA 1INQB 1A8ZA 3WYRA 1RHHA 4JB9L 4GG8A 1E7VA 3KL0A 4Y2DC 1MWAL 3BP6A 2NLJB 3RB5A 5EC2B 4M61A 1BBDL 1Y7VA 3KM2A 3PWJA 3O9WD 4F20A 2H4EA 5IROA 3WKQA 1BF8A 1RI8A 3SYOA 1GYAA 3QCTH 4GINA 5B7EA 3CBKB 3KVPA 4JKPH 5CM1A 3LKNA 4GBXC 4DN4H 3IDYB 1PX3A 1K5NB 5KAQF 5IJKC 3WIAA 1FVDA 3WDJA 2J25A 3MACH 4XVSL 4Z78A 4OZFA 5IHUH 3E0GA 5D1ZA 4FMKA 2GY5A 3X12A 4JUSA 4M4RB 3AADB 3T0BA 4PSPA 4JZJA 3CX2A 3VW3H 3O4LB 1CBJA 3QIWB 2CRMA 3D1MC 3MRMA 4GMTH 4ZO9A 2AXWA 3SB3A 4ZYKA 3SGEI 2ZP9A 5C3IA 3FRUA 3W5MA 3AMKA 4U31A 1F4XH 2G3ZA 5E8EB 1N2RB 1R47A 2H3KA 3DUUA 4HIJB 1D5MA 3CXHJ 4U7MA 2VLKE 4UDTB 4IGBD 1ZLDA 2A3TA 5ETUA 3IJSA 2NY4D 4NP9A 1LM8V 1QSFA 2OJZL 2NDFA 3T09A 1FIGH 1THAA 1VDGA 4NGHL 5C09B 5GRJL 5DUJA 3BD4A 4XAWL 2VAAB 1P84J 3L16A 5MHSE 1XSKA 4GEIA 5J3HD 3HC4H 4MQTB 5FYKH 4X5WB 5FO7A 2VAJA 4A63A 3HKZA 2CRIA 1UXLA 1U33A 4L5FE 1D3CA 2K1MA 5EO9B 1WPCA 2FRGP 3MV7B 2BZ7A 5I0WA 5F7HA 1FC1A 1DFBL 2BMKA 3M1BB 4TYUA 1ZLWH 1G7LA 4LSDA 1N8ZB 2N1TE 2AK4E 3D3VE 3FUKA 3NCXA 4XBPB 5IBUG 3X1NA 4DP7X 3GUTB 1ORSB 1T3FB 2A1WL 4NFCA 4S1QH 3EGXB 4D8PA 4JANB 1RMFH 2P8PA 2GJJA 4G8FA 1U9KA 4BKTC 4YO0B 4Y9BA 3CVHL 3L54A 3OX8A 3G5ZB 5JPNC 4ODVL 5DC4B 4KVNH 2QPDB 2PR4L 5ACMA 1OK0A 2X1PA 2MPAH 1BPVA 3K5RA 2JCCF 2VJ8A 3FTSA 4EOWH 1IEBA 3EHBC 4X8JA 5IB3B 4K07A 2PPFA 3JTBA 2A7BA 2FIKA 3MSPA 1S7SA 5ADOH 1OSYA 5DEFB 2OXHA 3QPQC 3SDYL 4RFEA 3LB6D 4BXSV 1XL6A 4MA7L 5HXMA 1NLDL 4GW1A 3H9SA 1W8NA 3NT0A 2Y07H 1BAFH 2PYFA 2VKWA 5M7QA 1HNGA 1Z5LB 2BCKB 3ULVF 2ZZUT 2CK0H 1M71A 2X2HA 2BDNL 4KZ0A 5KSVA 5TPWH 4D9RE 5LWYL 4JY4B 4X4ME 3TLRA 1HESA 4BWWA 3MR9A 4ORZC 1OM3L 2YPVH 1ZGLP 1MVUA 2NSMA 1FL6B 2Z1KA 5MEOA 4KTEH 5F7KC 4AYID 2N59A 3LKRB 3IGKA 1SBBA 4TNFA 4Q89A 2AXGB 4YMPA 2YAQA 5EORH 4FAAB 2VXQL 5ESQB 4M48L 3LKOB 4P9HL 2WZPA 1F58H 3FBQA 3ZDZB 1CYXA 1N6QH 4JR9L 5I1HL 5KTEL 1T20A 2C1PA 4WJKB 4OGYL 1SHWA 3VO0A 3Q2CA 1COBA 5FYLH 1FBIL 2DQMA 3IN2A 1T21B 1KBPA 2H1XA 5ICZB 1WFTA 2VR7A 3MOAL 4Z7UF 4LP4A 1ZA6B 1I8LC 2ZWYA 3IBEA 3L4TA 3UZEC 2MNJB 3P9WB 3BT0A 2DW5A 3RE0A 3U7YH 4ICWA 2EDRA 2X4PA 4Q6YA 5B7FA 3ABGA 1S7VA 4IRJB 1A8JH 4XGZA 3OAUL 3WGUB 1O0VA 2YOAA 5B8CC 2A73B 3GM0A 4N5EC 4YHZH 3VI4A 1TQVA 3GBNH 3P0GB 4LPUA 2CIIA 3UOAB 2IAMC 1I9JL 4DN3L 4PBWD 2L7UA 3QXWA 4QXUH 5I6PA 1Z0MA 2I27N 2E8ZA 3FOMA 3OKDA 5E5RB 3DOSA 3TJPA 4FXGB 2OMXB 5EC1B 5A6IA 2WP3T 2WN2A 3V0GA 3U0PB 3DO4A 4XPHH 4PLJD 5F72S 3MRHB 3WUZA 5IW1A 1H0DA 2D2CC 2VXSH 1YEEH 1HKLH 2ZE0A 1L3NA 4X6EA 3NEEA 5K59E 4PJ5B 5GGRA 4YVNA 5HTSA 5FYKU 1FHGA 3V6ZA 4K3EH 4ZAKC 3BKJL 1EO7A 3T1FA 4U6VH 5IQMA 2K3HA 3B9KB 3LEYH 4MXQC 3TO2B 5J13C 1D7CA 5DJZB 4WI8A 3II3A 3D2UB 3L4UA 3ESUF 4HV8B 1PG7W 1Q94A 4PJ9B 1I3GL 3VXOB 2Y72A 5BS0A 1NIDA 5HDBE 3EF4A 1TJGL 3MV11 5A2LH 1C5DA 2C9SA 2OTWB 4KRPC 2YUZA 3WXVH 5JOEA 2HMIC 2OSLA 4EN3C 2Q8BH 3NIDE 4HWZA 2EECA 2L4OA 4NB7A 4GUPA 4ZO6A 1GH7A 5EZLA 3UO1L 1UQSA 3ZE2B 4ZXBA 4M7ZB 4PLOB 1HOCA 3ML9A 4WW1B 4JQIH 2E7HA 1KYUA 4X6CE 5DT1H 4HLEA 4YDIL 1OLZA 2QADD 5DJXA 4YNYB 3F84A 1A0QH 1QTSA 4JM4H 5HYSB 3PWVB 2AEWA 3M88A 1JUFB 5AKRA 4AENA 1CCZA 5CGBA 2E5EA 5EZJA 3WTVA 1LO3L 1IAKB 3SKNA 1CO1A 3UAJD 2J6EH 2ESVE 4HS8H 2KMWA 3WUWA 2W91A 3PL6A 4L1HA 4XCYB 4ZO7A 5BXFB 3T0AA 1KENH 1M3JA 3HG1D 4WQOA 4YDKL 3I9IA 2AHIA 3AWFA 5IFAL 1CK0L 3TH4T 2YSTA 1EMTL 2JQZA 2XBZA 3H7LA 3V5HB 2HJFB 3BUYA 2J8UB 1L5GA 4QRAA 1L9TA 3IDNB 3NP4A 5HI5D 2FO1A 1O9VA 1E8ZA 3QAZC 2KUTA 4NO2B 4POZD 5KVGH 3WIHL 1CTMA 3P9MA 5E5LA 1X4YA 2YQ2A 5CINL 5CEZD 3RB7A 2HAZA 3EXLA 1SOKA 3L3DA 1ZLWK 5E00B 5CWSA 1S9XA 1AQMA 1B9KA 5C0AD 1FCCA 3LAFA 3V79C 2BJMH 2BVYA 2ED8A 2XN2A 1E4WH 5ABZA 5F7BA 2FH8A 1P5VA 1F18A 1AKJB 4R9HA 1JTOA 3VFMA 5KYNA 1GGBH 3PFUA 4OLZH 2VH5L 2YWYA 5FO9A 5IWLC 1URZA 1SNRA 5FK9B 1HEZB 1G9MH 4PB0H 3WL9B 1NOFA 2ROXA 1FN4B 4N0UE 2D3NA 5E2TL 1WAEA 2VOTA 2HX8A 4BK4A 2DIBA 5D6DA 3T4AB 2F53B 4AYFB 1MFAL 3WY2A 3S5LG 3HAEG 3F05A 2EIJB 3GHBH 1BFOB 3BP7A 2D7TL 3C60D 3IF1A 4PR5A 2GAZB 1WIUA 4W6WB 3BPLB 4HKBA 1AZCA 4PREA 4J5VA 3DXAA 1V3JA 2VW7A 1QWNA 5C09E 5BRPA 2IALB 3PHSA 4P59L 2GCYB 1OAKL 4AMKL 4H8HA 1MHPH 4LSSH 3J2PA 4CILA 1U3HB 3P4MB 5GZND 1BGXL 2DBLL 5HGHA 3MROA 5JXEC 3QORD 1EEUA 1AR1D 4K7PX 5L88L 5TE6L 3OKMB 5CEZL 2A74C 4UM9D 5J56B 2IANA 1IJNA 1KJ2H 2X1WL 1YAIA 3AM8C 2B1AL 5BJTA 4Y7OC 3QH3B 3IU3A 4U4IA 1FIEA 3E8UL 5EU5B 4GUOA 3SPJA 3TNNA 1OW0C 2ZXDA 2BIQA 2AJZA 2NCEA 3NTCL 1RAMA 1BEYH 2I5YH 4HUWB 3SZ6A 5I8EB 2VDML 1NBQA 1QI5A 1WAPA 2OULB 3O6LL 3PIQA 4QY8B 4BQ9A 3B9EA 3QSKB 2A83B 5INCB 1D7DA 5E9NA 4LSPL 1X9UA 2BSTA 2L7QA 4G9FA 2WV3A 5AZUA 3WEOA 4B0MB 3S0PA 4DKTA 3C5XA 1IGMH 4UM8A 4Y9CA 5ABDE 4GQZA 1LO5B 4HU2A 3D39B 1MCJA 2HP4A 3MDJA 3RIFK 4KROC 3QZWB 2VXTL 1PLAA 4PJDE 3RUGB 3SO3C 3TIEB 4U2ZA 4CUCA 3RGHA 1RHFA 4XBEH 4YIQA 2Y6TE 1UHVA 1J18A 4LPCA 5T3XE 1LILA 3EFFB 1U8PB 1ZJBA 4RDBA 2Q8AL 2PW1A 4ZUWB 1CLYH 3PWPB 5K1NA 3D4GA 1FFNB 3UX9B 2VR3A 3U4AA 3CFEA 5JYLA 1KN4L 1V3LA 3TCXA 1OHQA 3FT1A 3KYNB 1SXZA 4MJ2A 2WYHA 1G9NH 4HUUB 1PZAA 2OZ4H 4N2MA 2BCMA 4LKCA 3TYFA 3EOTH 1ET8A 4O2FB 3IMVA 1JWUB 2Y2YA 3I02A 2P5WD 1IC4H 2YEQA 1XF4B 4X7SH 3EJZC 4WAFA 3U2SA 1F86A 4JFDE 3L3GB 5CSGA 4NQQA 4UT7L 2Y5TB 2W65A 3WAKA 3B37A 2O26U 2VERA 3R7QA 4GRLB 2AJUH 2SEBB 4HGWB 3CTTA 1EZVX 2V5YA 3VRJA 3CDGA 2FL5A 4F58H 1DQLL 2F5BH 2FJHA 4WWKA 4LCCB 5D1XA 4A7QA 5DLLA 4EDWL 3HR5B 3FQYA 4E5XB 4HUVA 5F9OL 5DD1L 4NOBA 4CMHB 5E94A 4GAGH 2NXYB 3AB0C 4FQPA 3STLA 5E4OA 3N50A 3T2OA 4CVXB 2JWYA 2FWLB 3NDYE 2B20A 4XHQA 3BPNC 4XPTL 1MRFH 4M7LL 4W9ZA 3R8BB 1VJSA 4QD2E 1QSZA 4OCXH 4Y4KA 3E8VA 3HE6A 4J7RA 3L1GA 4LO9A 4BQBA 4LNRB 4UOQA 4WDIB 4N1HB 2NNXA 5J11C 1KB3A 1YJDL 3K4DA 4XVUC 4ZOBA 4ZPVB 3KPSE 1P2CB 4Y5VB 3BYTA 4FZEH 5MERA 2NOYA 3UYPA 3R1GL 4EDXA 3C6LC 4PJ5E 2YKLL 4LBEA 1X5AA 3DC0A 4X80H 4YGVB 4PJCB 2JJWA 4RISH 4R26L 3WGVB 3QNXA 3QXUA 3VWJA 4ZMTA 4PI0A 4XVTL 3TF4A 4R5TA 3GSNH 4LLWA 3HNSH 2VLJE 2UX7A 4PUBL 2YLKA 5E8OA 2WK2A 1ND0B 5EZIH 2ARWA 4NKMB 4JPWH 4R7DB 4LOVA 5KJ4A 3T0XA 4QO1A 5DUPL 3FQ1A 3O3EB 2FE0A 2P48B 1W72B 2FEDD 4KHTL 4HIEA 4APQB 2GIYA 4UIMA 5D7KE 1M1XA 2YN5A 2O1AA 3CDYA 4GG6B 3MRNB 1NGPH 1E4HA 3MX0B 3SDDA 1UVQB 3HE7D 4AQOA 2ARJB 3BO8B 3U9UA 3UJTH 3NRFA 1E3ZA 2VDKB 4MXWL 3VXSA 3I9AA 1WUZA 3PXJA 5L4IA 2YA0A 3RVUC 3SBWC 1E27B 1T0NA 4HGKC 4MMYB 4OSUL 5PCYA 3U4EA 3N1FC 3R4RA 2GK0A 3KBPA 2VSKB 2BWIA 4EI6A 4PJXE 4KJQD 1HAWA 2E74C 4I18B 4UDUA 4EAEA 2CDGB 5H37A 3ZIYA 5C2BH 2EUWA 2FLMA 3MRRA 3S88L 4XMTA 1Q90A 5CD5C 4CC4C 5JMOC 15C8H 3CZSA 5T8IA 4OQTA 1QPPA 4HUXA 2PCPA 4ZMYA 2XG4B 2EIZA 1JNNH 1AR2A 3UFIA 5BRZD 5ITFB 1RFDL 4LSUH 1JV5A 3LY6A 1MCPH 3AS3A 3VFSA 2UY6B 1NUDA 1X5KA 2HG5B 4BINA 1HL4A 1UJTA 3TNMB 4L4TE 5FXCH 2Q2LA 5K69A 1HIMH 5I5IA 5JIQA 1FRGL 3F7RA 2FJGB 2QL1A 4BJLA 4AI7A 2XN0A 1K2DA 1NOLA 3RL1B 1OWWA 1HQ4A 3D0LB 3H53A 3PGDB 3P30H 1OAXL 2CCVA 5C0CA 3GO1L 4H40A 3A4FA 4HJSA 4K55A 5FM5O 4OCYL 1O9ZA 1S8DB 3V5KB 3QFJB 5LNGA 4YK4B 1CDGA 4X83A 4FFVD 2PW2B 4YHOH 5EWIL 4TSCL 3ULVD 4IYKA 3KPOB 1U0QA 1A14H 2G3MA 4F7MB 2XT1B 1DJHA 2E4TA 3S37X 3PQYD 3RZCB 4Z6AT 3SDXB 2F19L 1TZHA 1L9OA 2ORBL 1BYNA 4XC1L 4M00A 1GC1L 4XCCH 5I24A 5C3TA 2X41A 4L8DA 4CADB 2VCOA 1JWSA 3QDGA 4N2BA 4L3EA 4DZBB 1DYZA 1NCWH 4Y5XB 1T89A 4NIYE 4RA0C 4C4UA 1V27A 2NTFA 1FFTB 3BI9X 5L8KB 5IOPA 4H44C 1JPFA 1SBSL 5J9PA 4MA8L 5B3NA 5JW3L 3RNKB 4A6YL 2NNFA 4PJHA 3DJ9A 2ZUQC 1NSNH 1GZHC 4H26B 2WXQA 2ZT9C 3IXTA 4NRXA 3AQDA 3MV9D 4L9LA 3GLZA 4OUOA 2BXZA 2Y1ZA 4UAOC 4JREC 5JOFA 2LU5A 1HKFA 4AQAB 4YAQB 2MQ3A 4JFED 2XKNA 1CLOL 5DGRA 1GL4B 4PFEA 2ZX6A 1FYTB 4JJ5A 5J12C 4GW4A 1S7TA 4AV5A 3VMOA 3EOYG 3W9EB 4K7PL 2D3JA 2EUZA 4TVPE 1H3UA 1UWGL 1IBHA 3VXRD 2W0KA 1Z9OA 1UJ3C 3ULVL 3E6HB 1IC5L 3NAAH 1KIPA 3PDOA 3D85D 2VSMB 3ETSA 1ZXQA 4XBGA 2GIXA 5D8JL 3F58L 4Y1SA 4Z7IA 4GAJH 3QUYB 3D09A 4MRBA 1A9BB 1A1MB 2BS71 1LMIA 1JHLL 2BSCA 4M93B 4PP2A 5DMIH 5DJCB 5I16B 3RJOA 2ZOLB 1CE1H 4HCIA 3LRGA 3L9BA 1QA9B 3RPBA 1T4KA 4WJG3 3EIFA 3TPUA 1EAOA 2GI7A 1CGSL 3VE0A 1E2WA 3ARWA 1MSPA 3II2A 4JO8A 2UX6A 1OL0A 4PG2A 2YD4A 3ZKMD 4AJYV 1I1RA 4FDWA 4DPAX 3CH1A 1IGTA 2VXVH 1HHKB 1TJXA 4UT9A 3K2UH 4X9HA 5SWZB 3RRQA 2V3DA 4IRZH 5LGYA 3TU6A 5BQ7A 1C1EL 4P48A 4YLQT 1FL3A 4MAYA 1QEWA 3MRIA 3PWPE 5LBSH 3WNLA 3QRLA 2NX5D 4MA3B 5F7LB 4KKAD 3AGVA 1WFNA 2Y06L 2QR0B 5CU9A 5E6IA 1VADB 3MRBA 3N40F 3HS0B 4N85A 5C7XL 3BGFB 4M62L 1MIEH 4LLUA 2NNAB 1JMXA 1PEWA 4FQIH 4YHIB 3T77B 4BXVA 4D3CL 2XACC 4DIXA 5B4MC 3ESNA 1HEJC 4AM0Q 5I1CH 2A9MH 2F7QA 3W0WD 4JVWA 3SJVD 3BLPX 2VC2B 1IARB 1E90A 2CKBB 5FW8A 4XNBA 1SFHA 4FJYA 4LCUB 1TG8A 3HZMB 3CPLB 5IEHB 4OLVH 2LU7A 4RMQA 1UA7A 3GIVA 4JM2C 2X89D 3B3IB 3CFJA 3LV3B 2YC1B 1SYSB 1OE3A 4P2CG 1UCBL 4WNJA 5H37H 1EUTA 4TN9A 4QRQA 5KYYA 3QZPA 1A3LH 3TASA 3HCVB 4JFYA 3V4LA 3RIAF 3ZTJG 1RUQL 4N20A 1JZHA 3FMGH 4Z23A 4YUEL 1F6FB 1KJMB 2R1XA 1KY6A 4GLRI 4IDLA 4ZUVA 3LN4A 1T7ZA 3N41F 2E7CA 4D94A 1A7NL 4JO3H 4KI5F 3AACA 1RIUL 2A38A 2IJ0C 1YG9A 5HHQB 4NO3A 4A7UA 1UT2A 1WA0X 5D4QA 4MNQD 1OAYL 4OF6A 5ERWA 2ZSWA 3FB8B 5JHLA 4ZSOE 3ZJAA 4BDVB 4J3SA 1CTNA 2X2YA 1BAWA 1QNIA 1OAQH 1RU9L 4LOEA 3WV0A 1U30A 1ZS8A 1HFUA 3MLZL 4XT1C 1HXMB 1PZDA 5I17A 5K9JH 1FLTX 5I1IL 5BZWB 1YDPA 4BH7A 1UD6A 2NXZC 5HVGB 4BK5A 4ELKA 5T5NG 1AHWC 2H6PA 1NL0L 3U1QA 2J72A 1T6WA 4WWPA 2QQKL 3OMNB 1DANU 3GMQB 2I9LB 2OYKA 3E6FA 1T22B 3MLVL 5C0ND 4G5AA 1G43A 2Y4SA 1ZHBA 4WNQA 4CNIB 4GG6E 5A7EA 1RZGA 5E2VL 1M3IA 3IDJA 3T65A 5I66A 1IGYA 2N56A 2D4FA 4NJ9L 1HT6A 2R23A 2XV2A 4EKXA 4HKJA 5KBMA 4UTAL 5I8KH 1R3LB 2VSCA 5C0GB 4MS6A 4I9WE 3STZB 1QRNB 1S6NA 2FJSA 1D9KD 5I15L 3QEHB 2FLBT 4N3TA 4MJ5A 4QHNA 4XP4H 5F0LB 1LNUB 5L2JB 3CE1A 3FZUD 2JKIS 4UF7C 5IQ9A 1FL5B 5AUMA 2DQHL 4NLAA 3QJVB 1HZHL 4OJDH 1QSEA 3ARDA 4R97B 3C5ZA 4ATWA 1NDGA 4AJVA 1WCBA 1H3WM 4U1KA 4O02L 1JK8A 3P2BA 4NKOA 4R2GB 5ANHA 4RQQB 2XRAL 2P80A 4P5MB 5F93C 1DP0A 4DGYL 2B59B 5CHNA 4KUZL 4W4NA 2R0LL 3RA7H 5EEVA 3FAXA 2MCAA 1KXQE 1NJ9B 1A6VL 3HG3A 2X7LB 2WUBH 2C3VB 2X4RA 3MRPA 3L3HA 3FOLB 1Q9OB 1YAZA 1M2VB 2FX8H 4Q58C 3WLWD 2W0FA 4ALAL 5EOQL 2Y7NA 4P4KD 3ZHDA 3MXVH 4X6DB 3O11A 1P4IH 3ABMB 3DX7A 5E8NA 2Z6FA 3MFFB 3RWEA 4E41D 3ARGA 4JGNA 3QE5A 1VACA 1A5FH 3BJ91 3OHXC 2VR8A 3KXFA 2IGFH 4XTRD 5GRWA 5JYMA 5G55A 5T1KD 3ATDA 3ZE0F 3SDXE 2DWYA 5HHVH 5E51A 1INDH 2CM5A 4TXVB 2FD6L 1HTYA 1IT9H 3WOVA 2GC4C 3BZFB 4OFYA 5B1AB 1YA5A 3ECWA 6TAAA 3S34H 3S37L 2XY2A 4PWHA 5T3ZL 1F4YL 4HS3B 5JPMA 1E3XA 4F2MA 5AOZA 2H3NB 3EJCA 3Q3GB 1J8HB 4XP1H 3U36B 4PJEB 2BNUA 2W0PA 2ICEA 1MI5D 5JXAH 3ALWA 2YJQA 4LFHG 1FVCB 3QWOB 4AKPA 2ENSA 1SF3A 5D7JA 1BZ9A 2HG0A 2MHAB 4OU3A 1IC0A 1I8MB 4IRSD 3FFOA 4XNYH 3NJLA 4DO6A 5DD3L 2VMFA 3AXLB 2XWDA 3Q7JA 1CQYA 1WDAA 5DD5H 1N4XL 3TYGL 3QK0A 1XEUA 2XIIA 5FYJE 2WQVA 3KDPB 1T2XA 4Y2DA 4GLRH 3TV3H 4WFEE 1T66D 3UTQB 3MRFA 1SDDA 2VISB 5A16B 3WFHB 2HVKB 3IPEA 1U92B 1UXSB 2JF1A 2VL5B 4XO5A 3FQ4A 4HBQA 3JWOH 5DZ9A 5ABAA 1V3KA 2F74A 1OSPH 3ES6B 2EE2A 4KUCF 3TEWA 4I2XB 1FAIH 4XPBH 1TETH 5LDUA 2WQAA 2LABA 4AK1A 2XYCA 4QGTA 5JHLH 2NPLX 4BFOA 2VDQH 1TZAA 2XQBL 3KGTA 5HGDA 3RQ3A 4XXWA 5JW5B 3WFBL 3GINA 2B4CL 1FORH 2WXMA 2I24N 3P0VH 5SWZE 4BA0A 3RFZC 3UBXA 4LXFA 3RTLA 1NCOA 2AJSH 5C0BA 2HUEA 3C8KB 1WF5A 5T1MB 4N4YB 3P9LA 4NZRL 5DRZA 5AEAA 5K39A 3OJDA 1FA4A 3GKWH 2GEQA 5GRVK 1JHKH 2XWJB 4X8GA 3FFDB 4OCWH 5TH2A 1CQKA 3WU1A 1R3JA 4TNEA 2Q87A 1KPUA 3PXHA 3VFOA 1A6AB 4JE0A 5E4IA 4AE1A 3LH8A 1OQOA 3NJNA 4XHJC 2XQYA 1BFVH 2D31B 1EZSA 3LKNB 5ISZA 4QHKI 3OB8A 2EVJA 1BP3B 2WW8A 1HI6A 2C4FU 4Y16D 5I1JH 2A2QT 5GS2H 5KS9F 1CFQA 4OZFB 3GSWB 1URLA 1CE6B 1AHMA 1JTPA 4I0CC 2WP3O 3X12B 3SGKC 2Q3XA 4M4PA 2YBRB 4L3CA 4HJJH 3V6BR 5DJ8A 5FF6A 5A1AA 3L1FA 3MRM