3NJKA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph5.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
b'APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
molecule tags Hydrolase
source organism Shewanella oneidensis
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njkA00
3QJVB 3TBBA 1OF0A 2XLLA 3FU8A 1E5YA 2H47C 2J56A 3HEIB 3IEAA 2DWTA 3QPKA 2IWEA 2AVFA 3NJHA 1ET7A 1YLBB 4A66A 1DYZA 1JZHA 2Y1AA 1F56A 3WKQA 2H3XC 1J5CA 1OE3A 1PLCA 3FPXA 4DPBX 2WSDA 3U25A 5EHFA 4K9JA 1JZFA 6PAZA 2UXGA 2FQDA 5PAZA 1I53A 3FT0A 8PAZA 2VSMB 3X1BA 4CSPA 2YARA 3PLYA 1JOIA 1SFDA 3WI9A 3ASNB 1AZNA 1L9RA 2XWZA 2MRYA 3GXUB 1AS6A 4YSOA 2IDFA 3H4FA 1TEFA 1V55B 1J9QA 2EIJB 2VW7A 2YQBA 3TU6A 2MTAA 3EH3B 2IDQA 4NERA 3NJFA 2JFCA 3IE9A 5I6PA 1J9SA 2HX9A 4UAHA 1A8ZA 4X4KA 2VMJA 1BXVA 2VM4A 3N55A 1JZGA 1FWXA 4E9WA 3T71A 2PPEA 1WA2X 4P5RA 2DYRB 5I6KA 1KYAA 3GDCA 3CVBA 5I26A 2XV0A 4AI7A 2JKWA 3AG2B 3D12B 3S8FB 3NSDA 1BYPA 1A65A 2XXGA 3FYIB 4BWUA 4DP5X 1IC0A 1JVOA 1NZRA 4FA7B 4M4RB 1ID2A 2GIMA 3PAUA 3RYMA 1ZIBA 3AY2A 3DKHA 2XV2A 2PPAA 4G7SB 2R7EA 3IN2A 1W6WA 5TK4A 5I5JA 1KBVA 2JXMA 5B7MA 1KDJA 4A2FA 2GB2A 4CSZA 4DP2X 4QLWA 1W8EA 3PAZA 2HZHA 2XXFA 3QJRB 1JZJA 3FU7A 4GY4A 4YSTA 3SBPA 3ABLB 1CUOA 5B1KA 1W6LA 4A2EA 1CURA 1ETJA 2ZWNA 2Q9OA 2CJ3A 3N2JA 2HX7A 4HZ1A 3CDZA 4KOCA 2IAAC 1PAZA 1GR7A 4DP0X 1JXFA 1HFUA 1NTDA 4DP4X 2VN3A 2WO2B 2CAKA 3TBCA 1WS7A 4HCIA 1SFHA 2P80D 3FS9A 3DTUB 3EF4A 2BWIA 4FAAB 3IN0A 1L9SA 2BWDA 1MZZA 4JHVA 3FU7B 5B1AB 3JTBA 1AZUA 2YAHA 3CG8A 1QHQA 2CUAA 1XB6A 1OCRB 3MX0B 4AZUA 1PLBA 4A67A 2PCYA 3UGEA 1ZDSA 1OE1A 1TEGA 3AG4B 4L0PB 4ZK8A 5I5IA 3FSVA 1SHXA 2Q5BA 4AKQA 1FA4A 1J9RA 2FWLB 4DP7X 5I6MA 2BW4A 4A2DA 1NPNA 3CVDA 4PCYA 1JXGA 3QJTB 4P5SA 3WIAA 3ASOB 5I6NA 1JXDA 4YVUA 2DV6A 3WNJA 1CC3A 1GSKA 1N68A 4M3HA 4RH4A 1PZCA 1PMYA 1URIA 3TASA 4DP1X 4DP8X 2CALA 1B3IA 2XYBA 4E9VA 2IWKA 1SDDB 1AG6A 1ZDQA 1OCZB 1OE2A 1MDAA 2BW5A 1DZ0A 3SQRA 1L9TA 3NT0A 3FQ2A 3H4HA 3IBOA 4KO9A 1NIBA 1HAWA 1NIDA 1AZBA 4YSQA 1RZQA 3V9CA 3WG7B 4QKTA 1GS8A 2EIKB 3FYEB 1X9UA 2BP8A 2H5UA 1ET8A 1EHKB 4Q89A 1GYCA 1PNCA 1X9RA 2AZUA 2FT7A 3X1EA 2J57A 1GS6X 1L9PA 4GP5B 2N0MA 4BDVB 3OM3B 1ASPA 1GY2A 2I85A 3X1FA 5D4JA 2DYSB 2PP8A 2PLTA 3AW5A 4GXFA 2OJ1A 2BP8B 4G7RB 3FQYA 5D4HA 3EH4B 3T6VA 4JKNA 1RCYA 2GHZA 2YAFA 4TXVB 2DWSA 1WA0X 3NJKA 7PCYA 1AS8A 1CYXA 4N8UA 3AZUA 3QJQB 2UX6A 4A68A 1AACA 4KNUA 2GI0A 1TKWA 2GSMB 1BEXA 3ABMB 3NP3A 3FSWA 1IKOP 1ASQA 1M57B 3T6WA 3S3DB 2FQFA 3OQRA 2EINB 1PLAA 5B7EA 1AQ8A 1FFTB 1IBYA 4DPCX 5I6LA 4YSRA 2AFNA 1ILUA 2UXFA 1PZAA 3G5WA 2W8CA 1ET5A 1IBZA 4HHGA 1NWPA 4KOBA 5B1BB 1KBWA 2OCCB 4KNSA 3OMAB 1XMEB 3S3BB 3V9EA 2AZAA 3NJNA 2VSKB 4F7KA 4N4YB 4E9RA 1BXAA 3QJSB 3NSYA 3UABA 2X88A 1RKRA 4GYBA 3JT2A 1OCOB 1TU2A 4BXVA 1V10A 1JZIA 2IH8A 1NINA 2XX0A 2YAOA 4HCGA 2GC7C 3AG1B 1KCBA 2XV3A 2GC4C 5A7EA 2XUWA 5B1JA 4KO7A 4YSDA 3PCYA 3PAVA 1E67A 1N70A 3NJIA 2X87A 1VLXA 1IUZA 1WA1X 1A3ZA 1QLEB 3UAEA 1BXUA 1J9TA 1A4BA 1M56B 2BP0A 3T6ZA 2PPDA 4E9TA 1V54B 5F7AA 4AKOA 1NPJA 4MFHA 2YAQA 3NJMA 1ADWA 2QT6A 3FQ1A 4GP8B 3NSFA 2YAPA 3SBRA 3KW7A 1MZYA 3NYKA 2HXAA 1PY0A 2J5WA 2BZ7A 3T9WA 4AKPA 1KGYE 1R1CA 3X2QB 3MBWB 5B7FA 2LLNA 5ANHA 3CDZB 5TK2A 4E9QA 1MG2C 2R7EB 4HALA 3UAAA 4W1TA 1OOWA 1SJMA 1PCSA 2IDTA 1PF3A 4Q8BA 9PCYA 1NIFA 1ASOA 2QPEB 3ABGA 5I6OA 3H56A 2DY2A 3ZIYA 3ABKB 3CZUB 1RZPA 4BWWA 1ZPUA 2FT8A 5I5MA 3ERXA 1SNRA 1UATA 2HRGA 2TSAA 3NSCA 5F7BA 2RACA 2HRHA 3ZDWA 2BO0A 2OV0A 2NRDA 5PCYA 1EZLA 1E65A 4A2HA 2YAMA 2GBAA 3CVCA 1AOZA 1AANA 1ILSA 2YAEA 1KV7A 5E9NA 1GW0A 1PZBA 1XB8A 3PXLA 4UF7C 4YSPA 1AG0A 1SF3A 2HLEB 2I7SA 2PPCA 5AZUA 2XVBA 3NJLA 1KCWA 4F2FA 1HAUA 2W88A 5B1JC 1BYOA 2EILB 3BVDB 1NIEA 1OCCB 2VW4A 1KDIA 1A4CA 2QDVA 2IWFA 4HIPA 3BQVA 2QPDB 4WTQA 1E30A 7PAZA 2EIMB 4WKXA 4UANA 5IY5B 1BQ5A 2WO3B 3QQXA 3NJJA 1AZRA 4YSAA 2BHFA 3NP4A 1CYWA 2ZXWB 5I28A 4KNTA 4GP4B 4A2GA 2PP9A 3UACA 4DP9X 1AZCA 4NB7A 2FQEA 5D4IA 4DP6X 4HAKA 4KO6A 4EF3A 4E9XA 2PP7A 4G71B 3PPSA 3X1NA 4G70B 1T5KA 1NICA 3OD3A 2FQGA 2I7OA 4PAZA 1PNDA 1OV8A 3EHBB 2CCWA 1AR1B 4YL4A 2FTAA 3S8GB 2XU9A 4HCFA 3ZX1A 3NJGA 1SF5A 4YSSA 1WS8A 1JZEA 1L9OA 1ZV2A 3EH5B 2E86A 2HX8A 2IDUA 4HHWA 1QNIA 2UX7A 4ENZA 1XB3A 4AX3A 1NDTA 2PPFA 1J5DA 2TSBA 3GYRA 5LDUA 4KO5A 3DIVA 2BP0B 1MG3C 1M9WA 3S3CB 2IH9A 3TA4D 2B3IA 1BQRA 2B08A 4NAJA 2YXVA 6PCYA 1BQKA 1JVLA 1NIAA 3C75A 3WKPA 2CBPA 4BXSV 3QJUB 1ZIAA 2AANA 3KW8A 1AS7A 2IDSA 4YSCA 2YXWA 2Y69B 4YVNA 2UXVA 4DPAX 1SHWA 4BK5C 2XX1A 3FSAA 2UXTA 2FJSA 1A4AA 3X1GA 3HB3B 4JHUA 3WNIA 4E9SA 2FT6A 4YSEA 3FSZA 2BZCA 4BWTA 2ZOOA 1E5ZA 4G72B 2VM3A 4YSUA 3SBQA 4G7QB 5B3SB 1AAJA 2FNWA 1JERA 3UADA 3AG3B 1WAEA 3FPYA 3T6XA 2A3TA 4F2EA 5FC9A 3FU9A 2J55A 2QDWA 2PCFA 5AFAA 1GY1A 1L9QA 1SDDA 2ZONA 1GS7A 1AIZA 3ZBMA 4E9YA 1BAWA 2P80A 2VW6A 3OMNB 3OMIB 3L45A 4W9ZA 4BDVA 1NWOA 5AKRA
chains in the Genus database with same CATH superfamily
4HUCA 1C5BL 3TBBA 1G43A 3GJEA 5JO5A 3MBED 5DQJA 2VJ8A 1OLLA 4F24A 1JNJA 1V3JA 3E0GA 1CLOH 4IEFA 4KKPA 4GW4A 1D2PA 1JPEA 4YHLH 1NFIB 2YPVL 2OCJA 3A3YB 2AABL 1OE3A 1IL1B 2Z4QB 4FFVD 3FUKA 4QTFA 1JRHH 4CBZA 4BE6A 5LB1A 1VEPA 4ZTOL 4M5YH 1WBXB 2A4ZA 2VSMB 4NO3B 4AMKL 5E56A 1UASA 3W0WE 2WYTA 2Z0BA 1MJUH 3WI9A 4KXZI 4ZFOA 1G1YA 3GSQB 4YDZA 3D85B 2MPVA 3LS4H 4NKIH 1OK0A 3TO4D 5I17A 5HPOA 1TEYA 1MCRA 1NFDB 2OZ4L 1I7RA 2ZZUT 5IJKA 1ITBB 2X41A 5GGTA 1P7KA 5J6HA 1BXVA 1BG1A 1QATA 4PJXF 4H4NA 2IG2L 4UTBA 4OIAA 4GBXD 4L3ED 3H9SD 1CE1H 2QSCL 3GIZL 1KYAA 3NFSL 4HC1H 2UYLA 5FUZH 2QHLA 3FTGB 4AQOA 3TH4T 1KCRH 4LKCA 2XXGA 2A6JB 3F6IA 3WTWA 3MPCA 4I0PB 3NG5A 2OJEB 3DOIA 1KXQE 3FQ4A 3NZHH 4QMEA 4X42A 2YD4A 1U6AL 5AYUL 5KSBE 1S9YB 2WCPA 5EBMA 3RYMA 1NPUA 2HKAA 3GI8L 3KCPA 3DKHA 2GYSA 2XFXA 3AT0A 3B2VH 3MO1A 5ISZA 5FHAH 4K7PY 5B3JE 4PB0H 1A1MB 2YOCA 4ZUTA 2R51A 3QDJD 3HG1A 4AC4A 4BQ6A 3BT2H 4OKVB 3LH2L 3Q5OA 4WSJA 1C7SA 1YN7B 4IRJC 1JPTH 1QP1A 1IGCL 3MRHA 1USZA 2A2QT 4Q9RL 1P4BL 4LDEB 4YSTA 1MJJB 2ZSWB 3VWKB 1MHPL 2D7TH 2GJPA 3KWWA 1G9NC 1NGWB 3S36L 4G7VL 5EBLB 3FOMB 5I0DA 4IGBA 2TRYA 4G6FD 1NCCL 3DRTB 3VFVB 3MCG1 4UDUB 3LKPA 1CIDA 4FQQB 4I18A 4OZFG 1QA9A 2IWGA 5BV7L 1EEUA 2F9BT 4KROC 3T77B 3BFQG 2FWSA 2ERJC 5D5MB 2YSSB 4RRPG 1A6WH 1ES0B 2VITA 3PG2A 3U4KA 3IN0A 5C0BE 5HVFB 3A6BL 3FU7B 4IJ3B 5JYLA 5DZNA 1QHQA 4AVJA 3P9WB 2LVCA 1T22B 1RK0B 4M1CC 3P30L 5EZJB 1OGSA 2X6VA 2P8PA 5CAYB 3BKCL 1P6AB 5KYWA 4D3CH 3PXJA 5TFSH 5IR1A 4UT6H 3VRLE 3ASOB 4EBQH 2YUXA 4K94H 3KGTA 3DK0A 1AHWC 4M3HA 4EI5C 1KACB 2R0WH 3F12B 3MGTB 1KY6A 5ITFA 1DBJL 3CZFB 1CLYH 3WMQA 5INCA 3P3RA 4MD5A 4DZ8A 3LIZH 4X6CA 1XVSA 2FGWH 2IFFH 4XC3L 3P73A 2E46A 4PTUA 1R3LA 4PJ5D 1GYUA 4YHKL 3EAKA 4DP8X 3BX7C 2OSYA 3TFKD 3L1EA 1KIQB 4A37A 1T5XA 1SY6H 2IIJA 1JPST 2GTWA 4JPSA 3AS1A 3CLFL 3UTOA 5DMIH 2JB5L 2IQAB 5HHOA 43C9A 1LLAA 5JQHC 4QRRE 1HQRA 2EIZA 4K94C 2BFGA 1GC1L 2Q86B 2UY7A 3ATAA 4K8RC 2PWEA 1MVUB 5CN3A 3QP3A 2ADIA 1BEYL 4YWGL 1EMTL 1QTPA 3RAJL 2ZXGA 2EIKB 5EF0A 1W0VB 2NYYC 2Y1VA 4LSRH 1VZGA 2ZUYA 4LPYA 2X4OB 1FCGA 3ZDZE 3NCJH 1JZ2A 2FEDC 3EUDA 3PQYE 4FKHA 4OFVA 4C56D 3GMLA 4CUCA 2CLVB 4QUOA 3OAZK 2XG4B 1TQSA 4OV6F 1KXTA 5E8DL 3ZZ1A 5D4HA 5CJOL 2HJKB 2IANE 1RCYA 4GUPB 2X4QB 3KPSB 3ZO9A 3P3UA 1BLNB 3RWHA 3R8BB 1UD4A 1PU0A 2DICA 4UU9B 3VDCA 4FA6A 5ACMA 4XNBA 4M8QB 1G7QB 2P7TA 2FD6L 3V7AE 3LRMA 3QIUA 4KQ0A 1LL1A 4L5FE 3RWFB 4RZCA 5D7JC 1ZT7A 2NW3A 3H1ZA 1NM9A 2NNFA 4NLAA 4KZ0A 3QRLA 4MYWB 1XCXA 3FK3A 4EE2A 2UZYB 3CFBB 4APXA 4QR7A 4F7CB 5KJ7E 1LO5B 4MAUL 4YSRA 3C8KA 1XCWA 2EIEA 2HRPH 5E70A 5F9JA 5KSAA 3RRQA 4I1PA 2ZYIA 1H5BA 3CPLB 4AQ1B 1Y1UA 2BVPB 1X7SA 4ZOCA 1CE6B 1SVZA 2FECL 3RHWF 2MQ0A 1U33A 4JO1L 5KOMC 4F57L 3KBPA 2W60A 3IGLA 1CFSA 2CGRH 5FS5A 4ZJ9A 3NIFF 3X12B 4YAQB 5KAQF 3MNZA 3UABA 3EH1A 2X1PA 1QNZL 2EO9A 4OM1L 4LCWA 2WZAA 3EJTA 4ICXA 5EBLA 1NANH 1NINA 4E36A 2YAOA 2ITDA 3NMEA 4PWJA 3APMA 3QUZC 4NDMB 4NRXA 5IVZB 1DZBA 1DVTA 2HN7B 3GO1H 3KJ4B 1HXYA 3KH4A 1CDGA 4R97C 3TO2B 4G83A 4W6XB 5EC2B 4PRAA 1IUZA 4RSYA 3TZVC 1FNGB 2YRLA 3BEVB 1BXUA 5IMOA 1DVFB 3IDYB 3MO1B 2IXQB 1OAUL 3GK8H 5AG9A 2WLYA 1KBKA 4KMLB 4LSVL 1HXYB 4NWUH 1T22A 4NRZB 4H7VA 4D0CB 3JYCA 1I8LC 4JFYA 4HS6B 2CKBH 1AIFB 3CXHK 2ZOWA 4QOKB 5FYKD 5BQ7A 1YN7A 2CPCA 2B8OT 4GRWB 1F86A 4GG6F 4HIXH 4JPKH 4AY0A 4UTAH 2WXPA 3WIFB 3T9WA 2HT4C 3PWUA 1WT5C 1VESA 1R1CA 4RRPA 5EZIL 2Y24A 2ZUSA 3ZKNC 4JKKA 1ZLDA 3VRLF 3OGOE 2MHAB 4IGBB 3UO1L 2PWHA 2RBLA 4XH2A 5IFAH 5HDQL 4KY1H 5IT2H 4PJHA 4XVJH 2NX5E 4CNIA 3V4VH 4ELKA 1C08B 3MV9B 4MBRA 3WO4B 1MAMH 4OF0A 5SX4H 1SJXA 3U0TA 3TNMA 4G80A 2W59A 5KW9H 3MLYH 3FUNA 1SNRA 2F1BA 3NSCA 3LB6C 3ZDWA 1TETL 5J1SC 2Q7AA 3O6FA 1F1GA 4JDTH 1NLDH 3HE6C 2N01B 4PJ5A 1N4XH 3OWRA 5DC0A 5B22A 1XDTT 2QVMA 4PJEB 4MA1B 1GYAA 5IVNA 3A5VA 2AKRB 5I1CL 3IMRA 1R0AL 3MBXH 4BZYA 3T2OA 2Y36L 4WWKB 2FZ3B 3HS0B 2G60L 3QJHB 2VDOL 1V3MA 4GMTL 1SF3A 1OCWH 4IDJH 3W9EA 3UZEA 4U1MB 1RZKL 5GRJH 1EHLL 8CGTA 3LZQA 4FQCH 4KVNH 2WBXA 2X6MA 4X6DE 4XPTH 5E99L 3TBTB 1SYVA 4QPEA 4H5SB 1SXAA 3EW3B 1BZEA 4OB5H 2IAMA 4RETB 4ADJA 3B8YA 3D85D 1DBBL 1IAIH 5MP6L 2EDWA 4ZOEA 4JY6A 4M9PA 3BSZA 3SDXF 1T89C 2WJ5A 4BZ1A 5IUCA 1CICB 2D03L 2WIIB 4PJBA 2HKHL 3RZWA 2YEQA 3D0VA 1U8PB 2F5AH 3AREB 3LS4L 4NKIL 1UGNA 4WK2B 1IEAB 2FQEA 1B0RA 3HMXH 1MI5A 3CFUA 3BVWA 1R3JB 1NA8A 3SY6A 2E7HA 2AAVA 4PGCB 3F7VA 2BFVH 4G70B 3KYMA 4UI2A 4JNXA 4D7PA 1H3TA 4LGRB 1OQXA 1IL1A 4ILDA 1Q9LB 4P04A 4FABL 4XC1L 1CF8H 5DJAB 2FTAA 3OZ9L 2CBQA 4IBVA 2F68X 2LGNA 3QNZB 3IDUA 1WFOA 4N24A 4CVZB 3EH5B 2EDBA 1EDQA 4N8VG 1DQIA 3CJJA 1V5JA 1PD0A 2DQJH 2WVSA 1BVZA 2ZJSL 3UG4A 3F64A 2VLRD 3RKDC 4PRPD 5BXFB 4NNPL 2BOLA 1T1YA 4V1DA 1GOFA 3NIGB 2J88L 25C8L 3G5XB 3GI8H 3M7OA 1D5ZA 1X7TA 4QHNB 2VZUA 4G6FB 5T1KD 4AK1A 3DPBB 3HZYA 1VCAA 1HT6A 1DQLH 2MWCA 2AV1B 3PNWA 3VXPB 1B0GB 4X5LA 2JJTC 3EO0A 5EZLB 3ZRCC 3QXAB 4PJDA 4WSGA 4MB4A 1EGJA 2CBPA 4N6RB 1IGML 4XE0A 1RVFL 5DVNA 5E8OA 5ECJE 1JPTL 2NUTA 1CK0L 3W0WB 5F7HA 4U1NA 5EBWA 4L4TD 3O45A 4QIRA 4X5PA 1IGTB 2BCKB 1D5IL 2KC0A 1JZ3A 2EC8A 4NAMA 1RZJC 4GXUM 5D93C 4IBYA 5FHAL 5KZCD 4KZEH 2JKIS 3QHZL 5CZVH 4DKAA 1UXWB 3VFSA 4Z9KB 3BPNB 4LU5H 1G9EA 5ACZB 4TVSa 1Z0NA 5B3JF 3L8QA 1KTDA 5JQIB 2XTSA 3LZOA 5TGBB 3HAEA 4IS6A 1ZT4B 1KTLA 2VLRE 3BIKB 4DVRL 4HJSA 5AOIA 1R5IA 5I1EH 4NQVA 3GPSA 1VPOH 2EABA 4I87A 4IHOB 1YEIH 2A3TA 2WZ0A 1IGJB 4FQ1H 4NC1C 4PV9B 2VYRE 2W0PA 2JE8A 4L3EB 3ARUA 2AJ3A 4HVBA 3MRPA 1SXNA 2RALA 1J48A 1HXMB 3DRQA 2XLLA 4OGXH 1HDMB 2D73A 2MKWA 5DO8A 5FW6A 3TGXA 2W81C 3FO9A 4JY5H 5C0AB 1VFBA 1JZHA 2DIBA 3VI3B 3BGFB 4GBXA 3DJ9A 2B77A 3CVHA 4DPBX 2CUMA 4Y1AD 4KRPD 3C5SB 4K9JA 3T6QC 4IIZA 1KXQA 1SXSA 5ANMA 1WIUA 5IGXH 3JVGA 5T3ZL 2VSCA 2FEEL 2XWRA 4PBXA 3DJRA 4KROD 4Z7OB 3ASNB 2GBUA 1G9NL 4HS6A 4JRWA 5IEKA 4HJEA 1XH3A 4X5RA 4KNQA 1GGUA 1QLFA 1AKJD 3MJ8A 2IDFA 4L1TA 4NQEA 1U3NA 2DBLL 2K6WA 5DVPA 1HL4A 4GW5A 4JY4A 4HJJL 4LHUG 4YX2H 4KJPC 4AMXA 1FFPB 1OALA 4OCMC 2YWZA 2DWEB 3IE9A 2H0EA 5DLLA 2DYPB 2G2RA 4OY9A 1KSRA 2EADA 4IMKC 3BQUC 2APVA 1FJ1A 2G75B 3EJZC 2ADIB 2XV0A 2XTJC 5JO5B 4X7SH 1XGPB 4UNTA 3SHSA 4BWUA 4G11A 3KM1A 3TIEA 2FZ3A 3HS0A 3ZDYB 5GS1B 3GMRA 3TBVA 1Z2KA 2ZWLT 4TLSA 5DJ6B 1X7QB 2COVD 1CL7L 2VLLB 4TVPH 3VX1A 1I85A 5DUBB 1AXSA 3I3DA 4JFOA 3ROLA 2R7EA 3PHAA 1XGUA 5I5JA 2AEWA 4ENED 3DX9A 2X70B 1IEBA 5FLVA 2FGZA 1UZ6F 1WC7A 4Y16C 5FFGA 1ZPLA 1X5FA 2J5LB 3CFMA 2BNUB 3F7LA 4JRYD 3G3LA 4NJAH 1JNNL 3PABA 1U2HA 5DRWB 3REVB 2UZYA 2E9IA 3CFBA 4CJ0A 3U6RB 2QQLL 3FQRB 4ZPTB 3WXWL 1NDGB 3JWNE 2VISA 5IVXA 5B1KA 1W16A 2ZWNA 3IS1X 4OCXL 1PAZA 3I6GA 5HYJA 2BVPA 1S3KH 1KXVC 4MS8C 3KDMB 2QADC 4YXLH 5CZKA 1MFDL 4F8LA 4HCIA 5D72H 2XQBH 5GJSH 4HK0B 3RJOA 3TJEL 5EU5A 2IH3B 2YN5A 2KQNA 4NQCB 2F54B 3NN8B 4GT7A 3UYPA 4LK4A 4M7LL 3QEUB 1SUJA 4PW3A 5DYOA 1RZKC 4OLXL 2K4WA 1ZDSA 2V4LA 1WZ1L 1QA9B 1OP5K 5H4ZA 3HG1E 1IM9D 5E4EC 3FRPB 3LQMA 3V4UL 3QNXB 3WD5H 4N2HA 1TQCC 3T4AC 2IFGA 3CSFA 5I30L 1MHHB 3FFCD 5E7BA 1IBGL 4GW1B 1TCRB 3CQFA 5EC2A 2QELA 2VXVL 3H3KA 4OTXH 3GO1L 1J11A 2RB8A 3EJZD 4RH4A 5I1HH 5AB1A 3QORB 4ZOAA 4HG4J 5I82A 3T4YA 1TDQA 4LL9A 3S36X 1NBYB 5GS0D 2V0AA 3QI9A 2K6YA 2K6ZA 3U4EA 3LH8A 4U6TA 5D2LF 2EICA 3H9YA 3V6ZA 1AR1D 1VGKB 5I23A 5L8JB 1OP9A 1A02N 2BCKA 1QRNA 2VLMD 1C1EL 4XE5B 1IAIM 4FL4B 4TLKA 3MI6A 2VXUH 3K4AA 5A7BA 1MCWW 4NKDA 5GZND 5DHVB 4KO9A 5IJBC 3RVTC 1MELA 3FUIA 3D2UA 3HBQA 3C5ZB 4OLYL 3RVUD 4AQZA 1ZKAA 2Q76A 1T5WB 2W9EL 4QKTA 4AENA 2VRAA 5I1AA 4HUUB 5D7JB 4HIHA 5HGBB 5G2NA 3MXVL 1YECL 1YEWA 5DC2A 4ISVA 5KVFH 1IC4H 2COQA 2XWBA 1ZCRA 4X83A 4Q89A 5CLXA 1EFQA 4H88L 2AI0H 1CGTA 1NKOA 1N2RB 3QEHA 4P2RE 4YEFA 4IS6B 3D08A 3RDJA 4EIBA 1FZJA 3OM3B 1IIIA 1KIUB 3CSPA 4GRLB 2BSED 5F3HB 1NCGA 3G5ZB 1G9ML 1NLBL 3MGTA 2OMBA 5EIQA 1MWAA 2BP8B 1S46A 1ZWIB 3NABH 1G5AA 3DX0A 5DQ9A 2YAFA 1T03H 1WUZA 4FYQA 5GHWH 4GSDH 2OXHA 1JI2A 5EDSA 1LEIB 3S37L 4PY7A 2ZWKA 3BP7B 3QS2A 3L3OA 1T83C 1OSYA 3ALWA 1B9ZA 1IB5A 3N85L 1OAKL 3EDKA 2WMPB 2RA1A 3FT4A 4X98A 3S3DB 4DKFL 1E3ZA 5KYXA 4P5TA 2FYYA 1E2ZA 4QOKE 2CMRH 4GRWE 3D4ZA 4G8IB 3L16A 2ZAGA 2GJZA 2KT6A 3PWJB 5DMJB 4ZMLA 1MCNA 4KKBD 1JJUA 4HJ0D 4C58B 3UPCA 2HT2D 3ARDB 3CC1A 3GZPA 1MHCB 2A6IB 2BPBA 3H85A 5T33H 3D06A 1CFVL 2XZAH 5LGHH 1QACA 3FTXA 4BFKA 2VDKB 4N4YB 5E1AA 3FH8A 3QJSB 1EEYA 2AJZA 2GUYA 2EXSA 4AQ1A 1NEZA 4RQQA 3TN0D 1TTCA 1JZIA 2VXQL 4NCC1 2ZCHL 4JAMB 1CXKA 3WLBB 2VJ0A 1NGYB 1QR1B 2GC7C 3K46A 4JPQA 2PR9A 2XV3A 4NZUL 4L23A 4UIKL 3IGAB 1E3XA 4BA0A 3C6LD 4N25A 5AWNL 3NJIA 4OFKA 3VXOB 3QARA 1FF5A 3MOBH 3RI5K 4FTVA 1WA1X 3T2NH 4MXWH 2YA1A 1U3YA 3L13A 2ISDA 3V52H 1U58A 4UQ3B 4AQ8C 2LLGA 2CLRA 5FDWA 1GZPB 4E9TA 4TPRH 3TH3T 2UUDH 1EXGA 4TNWF 3OKDB 3HVNA 4W9DC 5A2JH 4YHZL 2NY0D 2ZF8A 4GUPA 2C3VA 1Q9KB 3HE6A 3ES6A 3NYKA 3DX1A 3G7TA 1PY0A 4M1CD 3D3VA 3JVFC 5ESQB 5DWUL 4RMSA 2ARWA 2AEPH 1Z3GL 5FO7A 1YPZE 1T04B 5GGRB 3LH9A 4NQEE 3L9EA 1VRSA 4G6AD 4FI7A 3MGAA 3DOHA 1DQLL 4DGVH 3LRSA 4X8JB 1FGVH 1NGXA 3SCMC 2NPLX 3O41A 4M1GL 1PCSA 3MRDA 9PCYA 1KPVB 4UM9B 4OZ4A 2X2UA 3UX9B 2V3FA 4FHKA 3DDGA 1ZHNB 5IB1B 1UXWA 3VFSB 3ERXA 1KG0B 4WW1B 3D69A 4POUB 4Z95L 2JSFA 3HBGA 5EBGA 3T0BA 4FD0A 5CZVL 3HOGA 5AVQB 5TGBA 5CBAB 3QXVA 5FGBA 4ZW5A 3HC2A 4Y2DB 1ECYA 4OBRA 4PRBB 1UM4L 4Y4HC 4UM9D 1IAKA 2OMWA 3UTZB 4TSCH 2W07A 2EEBA 5K9OA 1HOCB 1KV7A 1PZBA 3ARBC 1S7QA 4WHTA 1AG0A 3HZ3A 3VI4A 4HU8A 5I18H 4RMBA 1M05A 2XWEA 3LRHA 1VA9A 4NRYB 1A3RH 1KCWA 1U3ZA 3MV7B 5EORL 1MIEL 1WG3A 1UWXK 2X89A 5HPMA 4RA3A 2YGOA 3HZMA 5JLZB 3RNKA 3LN4B 1M7UA 1NOAA 2E6JA 1SJHB 3IDIB 5DFWH 1TITA 3P0VH 1UB5B 2BHFA 5I28A 3AWEA 1MFCL 5F9WC 3R7RA 1UWFA 2HH0H 5KS9E 1AE6L 1QUNA 1FZJB 1AZCA 4QRPA 1HHKB 3DURB 4DO4A 1GAFL 5HGDA 1YYCA 3RWJA 4NNXA 5CIPH 5AAMA 5JW3L 1I3UA 1OXYA 2PP7A 3NOIA 3FB6B 5HHVL 4L4TA 1ZLVK 1N3NA 4RBPH 3EHBB 3OQ3B 2CCWA 2WIIA 2ZX8A 5G5DA 2QZ5A 1NEUA 3DOSA 2H32B 3ZE0B 1KIUA 4TUKL 5JPMA 1MHCA 1IEAA 1P84K 4LGSB 1AQHA 2V5YA 3TFBA 4PJ8A 4E2OA 1NDTA 4KI5F 2OSWA 4LCCA 1ZHKA 5I76B 1GMIA 1W0VA 4QLRA 4WJ5A 4R6UA 4KO5A 1X9QA 3RE0A 4F15C 2R0KL 5JHDA 2BP0B 3K4DA 1MJUL 4J27A 1M9WA 3O4LA 2ADJB 2B3IA 2HWZH 1XF2B 3IDMB 3GMLB 4PY8J 5HSFA 1RMFH 4OBSA 1RURH 4Q9QH 5FYKU 1U8QB 5GRUL 4R83A 5JXED 3IJHB 2ED8A 1JNNH 3A47A 5LUMA 1X4YA 5ETUB 3IPBA 2FSEA 3LPGA 4DPAX 1E28B 3F62A 3LDBC 3NZUA 4P2QB 4OLWL 1P4UA 3IM1A 4NQUA 1KJ2B 2BHZA 2VDMH 3W56A 4B9GA 1LDPL 2FT6A 5F7DB 3BAJA 5EEYA 1IGYA 1CT8B 2Z92A 4J12A 3O0LA 1LWRA 5IVXF 1F3JA 2JCCA 3S6CA 4LCIH 1BLIA 1VGEH 3I84A 4JM4L 4MSWA 4PREA 2B1HL 3UAJA 2AITA 3Q13A 3HLKA 4P2QA 4OV5B 5AUMA 4CN1A 1QRNE 4PG9A 3QWOB 1BF5A 4RWYL 2A77H 2QKIC 2JK5A 2X4OA 3E3QC 5FFLA 3ILPB 1F42A 1HYRC 5CCJA 1MNUL 5C08B 4LHJB 5JDSA 1J88A 3ZDYE 1QO3A 1I7TA 3L45A 2A9DA 1AD9B 4H8PA 4D8PB 3U9UA 3DXAE 3FU8A 4Y19E 1DLFL 3GB7A 3QFJA 5CGMA 3OJDA 3ZKND 1NCBL 5ESVB 4HJIA 3F00A 3C5JA 5DLMH 1OP3K 2FEDD 3RP1A 3WIIL 3P54A 5FCUL 5BV7B 4GW1A 3JV4B 4CVUA 5EC1A 3SZ6A 2X2JA 3DGDA 5CFAA 2A9ML 2FAUA 1U95A 3V4UH 4KTDL 5DO2D 1XSKA 4X6CE 4TNVK 2C9RA 4GFXA 2P28B 3EHBC 4ONHA 3PGFH 4X4XB 5KG9B 4I5BA 3J27A 3V0WH 1MJJA 4U3CA 4TQHA 4N90E 4PRPA 2HRPL 3HN5A 4OW6A 4WEEA 1VACA 4NN7C 5CCKH 1F13A 5MEOA 1GIGH 1J1PH 4OKVA 1UB6A 4XCEA 4OF6A 1Q72L 1F4WL 4KI5D 3L3GB 5JR1H 2BSTB 2HCZX 3MNZB 2GY7B 1HH6A 5INCB 2PCPB 2F53D 4JCMA 2NUPB 4ETQB 2VMJA 2EDYA 2CGRL 5CR8A 5D2LE 3N55A 4PWHA 4KH9A 1YECH 4I8DA 1UWEL 1WA2X 2P49B 5I6KA 5K9JL 4KJYA 1UADC 3LKNA 2GEQA 3NK4A 3F85A 2CDGA 1TVHB 3AWFA 3V7AG 2EDEA 5GS0C 1H3UA 3EDJA 4HH9A 3C08L 4Q6YA 3IMBA 2A74B 4XNMB 7TAAA 3O9WB 3TO4A 4XN1A 4UT7H 2DI9A 2VDKH 3GXFA 4ANVA 1N6QL 4FGMA 4XXDA 3GC3A 2EYRA 4QTHA 1LO2L 4HWEH 1M05B 1KBBA 2NNAB 4PGEB 2UZPA 3UTSB 4R7DA 2EEFA 3A21A 2YD6A 3KWWB 3QDMB 1XQ4A 4Y1TA 1JYWA 4MMYB 4A2FA 3MRMA 5HPMB 4N6QA 3D25A 3ZTEA 3UC2A 2DQCL 3TO4B 1SEBB 1S7VA 3N85H 3UYRH 1M42A 3DO3A 3NEXA 4TRPL 1PL3A 4DEPC 5IESL 4PY8I 3T4AA 3SBPA 3UTTD 2XIIA 2JI2A 5I0XA 4JFOB 4GSDL 1CUOA 4A2EA 1A6UL 1XGUB 2VERA 1JGVL 3FO9B 1CDHA 4WEBH 2GK2A 1A9VA 3KPLB 2YJQA 4NPKA 2QMKA 3OAUL 3VH8B 1NTDA 3BDBA 2I5YH 1E5AA 3GT6A 3VFNA 1PZDA 3WUWA 4LSTH 3JT0A 1MRCL 5F0LB 1GXEA 5D9SA 5FO9A 2HTKC 2HFEA 4HXAH 4LP4A 4LXFA 5E9DA 2IOIA 3LQAH 5KYUB 2YQ3A 3VXQB 1U30A 4M6OL 2BWDA 1I9EA 4ZT1A 1MZZA 4XP6L 4DUWA 5B1AB 1VIWA 4ZFOB 5BVPH 4PS7A 3CG8A 2NDFA 3DGGB 1A6VH 1EEZB 1XB6A 1L7TH 4UOW0 4YXHH 4LEXL 1E5UI 1PLBA 1DBAH 2PYFA 3MRNA 4MTMA 1TEGA 3L17A 3F84A 5D9SB 1X5YA 3PPEA 2R2HB 1CFNB 3D3VE 3O6KL 2Q5BA 3IU4L 3NACH 1DJSA 4HJTA 4MCZB 4GW5B 1NPNA 5L2JB 1SDAB 1QEWA 5IHZA 3WNJA 5JW4Q 1MFNA 1GSKA 5A16B 3WNNA 3ZTNH 1QI4A 4IRJA 4ZW3A 1MQKL 1R3IL 1V3LA 4HHAB 2RJMA 1D6VL 4EMZA 3DMMB 3DJSA 5DHVH 4P9MH 5AB0A 4NC1E 1XGYH 2CBMA 2WLNA 5KSUA 4FQCL 5G4MA 3Q2VA 4WWOA 5SX5H 5IHLB 1OO2A 5E99H 3LD8C 1NCOA 4BA8A 1XF5B 1PJWA 2UV3A 3GLEA 2NXZC 4QHLA 4EI6B 4IIQC 2YD5A 3FOLB 1I8UA 5E8NA 1BBDL 4M7JL 2Y2YA 3MLRH 3MRRB 2OJZL 4H1LG 1G6RH 1HAWA 4BZ2H 3VU1A 2CIIB 4J6RH 1UFGA 4ZQKA 5DS1A 1MFUA 3AXHA 3FUDA 3L7EA 4GKLA 15C8L 4YQXH 2UVEA 2AGJH 1AD0A 1RZ7L 3HNSH 4IOFC 3ARDC 1SLWA 3ZKQD 5DD6B 2VUKA 4AYFB 5CEXA 4N2BA 1YQVL 3DV6B 4K15A 1BD2A 1IIKA 4FFVC 1YAIA 4R3SA 2IPTL 3WS6C 5IUSA 1A1OA 1CFBA 2WANA 1MI5D 4G6ML 3I3BA 3H55A 4LPVA 1FO0L 1UD5A 4LO9A 3M1CA 2DYSB 2WP3T 3U1SH 1TCMA 3SGEI 2RH0A 2RGSA 3I50H 2RTTA 5AW4B 5LLIC 2P42B 2VITB 4KAQL 1L9NA 4Q58C 4LCYA 3L3GA 4HC1A 4N2AA 5F93C 1DBKL 4U0QB 4NGHH 5DUPH 4KJWC 3T1FB 4NNPH 3SYAA 5EB9A 4L5FH 2AQPA 4HEMA 4DO5A 1CDCA 2ITEA 1A22B 5ILTH 3QXAA 2KLTA 3T6WA 4A1RA 1BQHA 4ESKA 1RL1A 2N7BA 5IQOA 2CRMA 1PLAA 3EO9L 1AQ8A 1K3ZA 4L2LA 4PJ9A 1I9JH 5E5MB 4KTEL 3HI5L 4QYAA 2L0DA 2ODHA 4OGZA 2EUVA 3ATBA 1CK0H 3B4NA 1AFVL 2JJTA 5JOFA 4BFFA 1JWMA 4QRRB 3B9VA 3RDTA 1FFNB 3GLAA 4NM4L 3HPJA 5LWYH 1YPZB 1BVLA 4H8HA 4KXZH 3BRFA 2V2XA 2QLVB 4IBZA 4YDMA 1UXLA 5FCSH 1WK0A 4YDLC 5I18L 4J3OD 4LAQL 2R4SH 4H20L 5ISZE 3HB3C 3GGWB 3RIAK 3VXSB 1TT6A 4BFIB 3MLZL 5KSVB 3LY6A 3I6LE 3W5NA 1M1XA 1BXAA 1J0KA 1XGRA 2IH1A 4JB9L 4V2BA 3KPPA 3RDTD 4LSQH 3PJSA 1AGEA 4PI2A 3VO0A 1MY7A 3IDGB 3CTTA 1QVOA 3MRKB 4Y5YB 2VDLB 3TBTA 2QHRL 2D7MA 3SDAA 1ZLUK 3UDWA 1KYOK 3AG1B 4FOMA 2B9AA 4KXBA 4FTDA 2IANB 3EGDB 2OMXA 4XBEH 1G7PA 1JPGB 4XB3A 2H1PL 4YHOL 1E67A 4O2EB 2ZXCA 3GWJA 4JY6B 3D25B 3F7RA 4P23C 4F5CE 5HP5A 5TH2B 4CGTA 3RHWK 5FV1L 5CZXC 1EO8L 2QMJA 1QFWH 1WZAA 2MNWA 2R23B 4TOYL 3V6OE 4X6EB 2QR0B 4PD4J 2WBJC 2P8LB 3U9PL 4ZUVA 3DHMA 2ZT9C 5AVXB 1CS6A 1QR4A 3W9EB 4U05A 2GSGB 3KVPA 5K39A 4C57C 1RZIA 4NQED 3MV7E 5C07A 1MZYA 2DJMA 4ODHH 4I0PC 3H8NA 5FO9B 4WW2F 2KPWA 3KXFA 4U1JA 4JPWH 2CK2A 4JFQB 1RFDH 1V7MH 1AMYA 3MLVL 3O6LH 4UOJA 4L3CB 4UT9A 4RSVA 1S9XB 5IG7A 3PV7A 4XAKE 2ZCKH 3GI9H 3LZLA 1CVRA 3MJ9H 1SJVA 3ZT5A 3K6OA 1I1RA 3BP5B 3K0YA 3UZVA 1ZTXL 3D34A 1QSZA 3I9GH 4XO3A 1HILB 3Q2LA 1DQDL 4OUOA 3D51A 3GBDA 4JM4H 3UAJD 3UJIL 3CSTA 5F21B 1FVDA 4GRWF 1PBYA 3TEYA 2DQDL 2XN2A 4LL4A 5JUEL 1MCEA 4XCCL 1X5JA 3P3TA 2CJSA 4EXPX 1A64A 2C9XA 3VTMA 1LE9B 3HLAA 4ALAC 1YUKB 3M1OA 1MNUH 5PCYA 1HILA 1CL7H 3EH2A 4N1HB 5E4OA 2CBTA 4OCWH 1D5MB 3X12A 4R90L 1WFJA 4X7TB 3C5JB 3LDBB 4LP8A 1E7VA 2K9FB 3BVTA 3X13A 2JJWA 1AY1L 5K1NA 2XXMB 3ARBA 1MH5B 3VFMA 3ZKXB 4KQ3H 2R27A 1NGQL 2XVBA 5BPPA 5LG6A 2NW2B 3G9AB 4XAKD 3B56A 4QRRD 1WT5A 4K0OA 1SN2A 1GGBL 3RB5A 3ZHDA 4HOWA 4N8VB 1D5MA 3L4UA 4KZCA 4J8RA 1TMQA 5IIEA 5E2WL 1KYDA 4JG5A 1C8QA 5AUMB 5EC1B 4HUXB 4OZHF 4Z7NF 3GSVB 5MEOB 3P4NB 3NJJA 5K59F 2NLJB 1ACCA 2IEPA 1A0QH 1NSNH 3ESNA 2MFNA 3NP4A 4IKJA 2ZXWB 3L3KB 2HG5A 4ANKA 4H8WC 3WUZA 1GTNA 5KG9A 1DTUA 4Q97A 1BECA 1RLWA 4FQ1L 1Q4NX 4Y1AB 4R0LC 5I1KL 1EJ6A 1MDTA 2ETWA 3W81A 1HH9A 1YEDA 1INQA 2I7OA 4MJHA 4ORGB 1QRNB 4OLXH 5BZDB 3BD3A 1XCTB 1ZS8B 2C9SA 4JFVA 4Y2DD 4DAGH 5DUML 2BMKA 2VZ1A 4JDVA 4KKNA 1JV2A 5DK2A 2FDBP 3RVWC 1C9SA 3FT3B 2F54D 1F1AA 1ZV2A 4NOFA 4FQIH 1NGXB 4KFZC 1UA6L 5D2NA 3AM8C 4LPCA 3U1PA 3HG1D 1RIUL 5D8JH 4RX4D 4NX0A 1IQWL 5FDYA 2VDKL 2HRLA 4JM2C 4MHHI 1KF9B 3SOBH 4UM8A 1G9NH 1CGVA 1TTRA 3DVGA 1AC0A 3ATDA 2GUOA 4NAJA 1YNLH 2NQ3A 3NIFE 3W57A 1ZLSL 1HHGB 2L04A 1FFNA 1EERB 4X5XB 4APQD 3CFJB 1C1EH 3HC0A 4ZUWB 3IWUA 2AANA 3UYRL 5DD3H 3KW8A 1HNGA 1FBIL 3VI3A 4N2DA 4HWZB 5IJDC 4NQVB 4C47A 5DD0L 1F3DH 2Y5QA 5EWIL 5F3FA 4F7MB 3QDGD 3DO4A 4BWTA 3RPIA 2ZOOA 4G72B 2CO6B 3UERA 4R26H 5ITFB 3D2UD 3L3JB 4JJ5A 5HI4D 2BNQD 2JKXA 1IARB 4BEIA 2VRKA 2OMZA 3IBEA 2DAVA 4M8RA 4W9GC 4TLTA 1J1OL 4RAVA 4L8BA 2FO4B 2ZPKL 2WQWA 1RULL 5DRWA 2HJLA 5F1SA 5AFAA 2Q8AH 4C59B 5JNYB 1NC2B 2NY1D 1T3FB 3OZKA 2ED9A 2OR7A 1A7BA 3P69A 1UZ8A 2OMNA 3OMNB 1TJHL 3ZZSA 4Y4KC 4PMFA 1ZT1B 3V4VB 4QRPB 4MD0B 3WGUB 5JW4M 5C0BB 3HE7A 1QLEL 4J4PD 2CM6A 2I32A 2QSVA 5CU9A 2NYKA 4Z7OF 2C8NA 4LLUB 4XP6H 3T0ED 3GBNL 5BVPL 2AJXL 3UTSE 4E9LA 3JQOB 3FT4B 1N3NB 1UEYA 2F7IA 4X98B 5CWSA 2XWTA 3RVWD 2JI1A 4U4BA 1T80A 3D87B 3TIEB 4PGJA 1A7QL 3N50A 3C8DA 4PJXA 2FQDA 1GA2A 3VI3F 1S3KL 2JXMB 1G7MA 3CZFA 4PLJC 3BRGC 2CKBB 4D9LL 5SX5K 1OF2A 4HP5A 3KBHE 4M1DL 1TQBC 1TO4A 3TJEH 1YN6A 3QEGL 4BFGA 2ZOTA 4HUNB 1K4DA 2K3TA 1SYSB 2Y5TB 3RL2A 3EH3B 4P9ML 2Y07L 4BHUI 2LTQC 1RPKA 2KZWA 3OX8B 4GUQA 2J1XA 3L1FA 3AS0A 4H25B 3KL5A 4XOCA 5DFAA 5F6IC 4MA7H 2EH7L 3U30B 4OLZH 3O81A 2NY6B 1HN1A 4JVUA 5AKSA 3AG2B 3N43F 3C60B 1T83A 3MLRL 1CDIA 3D3VB 3O3BB 4QRAA 5D6CB 1G6RL 1NFDA 4BZ2L 1IVTA 3CXFA 1IC0A 3DX7A 5F9OL 3ESOA 1BOYA 1U91B 1PD1A 1WC7B 4UIKH 3HIZA 4Y5XB 3D0VB 1T0OA 3O2DA 3S4SB 3CBRA 2J4WL 5FOBB 2VDNL 4RAUA 4ES9A 2VMDA 3FOMA 4KQ4H 4QXUL 1QPPA 4HF5L 3C5ZA 4J3TA 2X4SB 5F8RC 4OCYH 4FXGA 1ZEAH 2CLZA 5FV2A 3L54A 4IMLA 1LXMA 3BZFA 4N20A 3VXOA 3GHPA 3QCTL 1ZANL 3LPWA 4CSZA 5I6XB 2BXZA 5ESQA 1MW1A 4Z7OE 3A6CH 2XXFA 4HC1L 4F9LA 3SE8H 3KEDA 1REIA 2ZOUA 3MLWL 1BQSA 2IQ9L 4FXGB 1KCRL 4ZO6A 1U36A 1BFVH 5CGYD 2GG1A 2CJ3A 3KCPB 3ZDYF 4EI5A 5C71A 3NFNB 4HCRL 1P7KB 2AEPL 2IGLA 2IG2H 3RUGA 1JF1A 1JS4A 2EXWC 3UTTE 3F6JA 2ATPA 2F53E 4H2CA 4WV1C 2AI0L 4FQHA 5DQDH 2OTUA 3S96B 3S98A 1T4KA 4NQSA 1KCKA 4FAAB 3FTGA 4J6IA 3RURA 3WL9A 3L7FA 1Q9OA 4YJZL 1BMZA 1JV5B 2Z1PA 4P46C 5CSZA 1HL9A 3DO7B 2CG9X 2DD8L 3I85A 5CJ8A 5KBLA 3QB7C 4K8RL 5JMOC 4KJWD 3S37H 3FSVA 4BZ1L 2W1NA 2VR5A 2K3HA 3TBSA 4GKNA 32C2B 2D7TL 5CGBA 3SB3A 3LXAA 1CU4H 3MCYA 4XMKL 3VD3A 3WDIA 4J39A 4F8QA 4G6JL 4JRYB 4M6MH 4XCFH 3BDYL 4Z7VB 1B4LA 2DV6A 3WJMB 4CC4C 3EYSL 4R4BA 1CC3A 1BBJA 1Z5HA 3TWCL 3VDAA 1LEKB 1AGCB 1WIPA 4HKZB 1P9MA 4JJ5B 1UM4H 1WZKA 2I24N 2ORBL 3DMMD 1RP8A 2RQ8A 3JUZA 5KANG 3BUTA 3N40F 1HHHB 3LV3B 1P1VA 5C0EA 3F7YA 5GS2D 2BCMA 2WYHA 5F1NA 5E1AB 1A7OL 5GGVH 1AIFA 1EEYB 3HI1A 5LQBH 2IWKA 4AQEB 1TJGH 4POZD 2VLLA 3U4BH 3A67L 3KLAA 3INUL 1CD8A 4XP5H 3K2IA 1TOXA 2G9HB 4JFTA 3U7AA 1XT5A 3PGCA 2DH3A 3HE7B 1HJBC 1EIBA 4UT6L 5DRXB 2LV4A 4P5MA 5MERB 3EG9A 1I4FB 3O0RL 1M2VA 4ZW7A 4R4ND 3U7YL 3WG7B 3PWPE 1KGJA 1RFDL 4I13B 4E42B 1IRAY 5CD3B 3O6LL 1X9UA 2YS4A 4XB7A 3P4OA 3HFML 2Q87A 5HHME 4M48H 4YFEA 3QWRD 4MCZA 1G0XA 3X1EA 1V8HA 3AB0B 4LVEA 4PJFA 3SDAC 1IQDA 4QRPD 2X0VA 2VZVA 1ZTXH 4TTDC 3K71B 5EEXA 1L7IL 4L29A 2VR7A 5IB5B 5JPNB 2R56H 2G0KA 1DQDH 3UJIH 2NR6C 2V7NB 3QJFA 2YPVA 4TN9A 2ICWA 2HMIC 3UPRA 2P1YA 2PTVA 4Y5YC 2NX5B 4P46D 5E2UH 3M17A 4HS3B 4OJAA 2JKTM 1YEHH 2VE6A 2C7UA 2OS7A 4H26A 6FABL 1T2QH 3VXTB 3F01A 1QSED 4G7YH 1V7NH 2ZKHL 1IKOP 1FZMA 2EIDA 3DGCR 5L88H 4X5WB 4RFNC 4PRDA 4QXTB 3NIGF 3MKGA 1LO4H 1TQUA 4HIEB 3WEMA 1S9VB 1AMXA 2PXYA 4OV5A 4UZGA 2CO3A 4ACPA 4TSAL 1IC1A 2B1AH 4PJEE 4YZFF 1HZHH 5EUOF 1TENA 4BFOA 2Q10A 1H15B 4U1GC 4QEGA 3FH5A 5E6YA 1UT1A 5LBGA 1NCDL 1FCCA 3ZT7A 1XHHA 3PWVA 1I1AB 2A73A 1NWPA 5EF1A 3DI2B 4JM2F 4P4KD 3SGEH 5F1KC 2V2WB 5GS0H 2D4DA 4KNSA 4X6DB 1I3GL 1OW0A 4LE8A 5JOFB 3SPJA 2NT1A 5C70A 1HH9B 4IU3B 4DQOH 4S1SH 2XKSA 5H37A 3P2DA 4QRUB 3MV8A 4MWFA 2DQFB 1KB5H 2XX0A 3QXTA 4PJHE 2IJ0C 3N9GH 3JUYA 4JFYB 1JV2B 3O4OC 1AP2A 3VI4F 2VSDA 5F7FA 2XUWA 4IOSD 4Z78B 2DKUA 3MROA 4AYBA 1S7XB 3MCKA 4N2KA 5GGQH 1DJHA 2GTZB 4WI8A 2X4UB 4QKXB 5A3IC 4DVBB 5DJYA 1J0YA 4BSJA 1IAMA 1GKOA 4JFFE 3D7PA 2QADD 3MRCB 3P30H 5HYQA 5EOQL 3JTSA 4I3RH 1MWAH 2AQ2A 4ZFZA 3JV6B 2DJSA 2HN7A 3NJVA 4PLKC 5EUOA 3ZUNC 2FIKB 5IW1B 3BE1L 4U7KA 3QAQA 3VGDA 2RMNA 5J89A 1B88A 2HAZA 4FQIL 1UWXH 2FE0A 2R0WL 3QUML 3EBAA 5DDHB 1U8OA 2BK8A 1I3RA 1NMAH 3NIGE 1CFSB 2LLNA 4LLMB 4LLYA 3FTUA 5D1XC 1FFRA 2CE6A 2UY6A 1U3HC 1UENA 3AU0A 1VHPA 4FXLA 5D55A 5EUOE 4XNQA 3UTSA 3WY2A 5IZ7A 1YNLL 4TVPE 3T3MB 3N04A 1ACYH 1OLZA 3QYCA 1S5IH 1WUNT 3VE0B 3ECVA 1WP6A 2XN9D 4PJCB 1WBYB 4R26L 3ABKB 4G3YL 3HCVA 1ZPUA 5FM5M 2E7DA 3DO7A 2V17H 1C8PA 2C9AA 1T89A 2HTLC 1NGWA 3ETBF 5ICUA 2OMYA 3DSNA 1IBHA 2YJLA 1E6OH 1E4XH 1F8TH 1XR8A 4LSRL 4FQQA 4I18B 1E65A 2GAZA 2KZKA 3G9VA 4XO4A 3FQWB 4GNKB 5HJ3A 3MU3A 4GBXB 2P5WA 1VZHA 1YDPA 2ZP0T 1RURL 3ARRA 4K3EL 1RSFA 1J1OH 2YFOA 2ZUVA 2NDGA 1KT2B 3RZCD 1CF1A 2ZKXA 1DSYA 3CSYA 3MNDA 3BXNA 1SQMA 2RHEA 4PI0A 2DQCH 4GRLD 4F7TA 1JNLH 1ODUA 5JZ7C 1MUJA 4FADA 1OCCB 3ARFD 4RGNB 2C7FA 4ZXBB 3KGUA 1F1DA 2AKRA 2X1QA 4HIPA 4U6HB 3QCUH 3TTSA 4DTGH 3TVMC 1E30A 1JTOA 4C54A 3VXMD 1KT2A 2EIMB 1WSST 3P11L 4UANA 4NQEB 1TTFA 4Q6KA 1FH2A 2H26B 3UP6A 2UUDK 2AQRA 5KYUA 2OR9L 5HHNB 1QLRA 4Z3HA 2GPZA 4GP4B 3IFNL 4AYSA 4NO2A 2GY5A 1XH3B 5J4MA 1YC7A 3QZWA 5C97A 3RU8L 2X9ZA 5F89B 5JPMB 1EEQA 1SXZA 1QRKA 1RD6A 4WSKA 4DH2A 2ZXEB 3DYPA 4NHCL 5DZPA 1C12B 4EF3A 4F9LC 5IF0A 4Z76A 4P23A 1BQLL 2WN3A 3FCSA 1IE5A 1VKXB 1NC4B 1A6VL 1S7TA 1XXFC 4YXHL 2XPYA 5D5MF 1KLUB 1XGQB 1DBAL 1AR1B 4KK6C 4EO5A 1D5BA 2A1WH 2AV7A 4N9GB 3MQIA 2A73B 4G43B 4ANXA 4QWWD 5DLML 3UBXI 2Y07H 4B7IA 4P2CG 1JHKH 4HUKB 4AVKA 3CQPA 3D33A 3FQNA 1E0OB 1U3HB 5KAQG 1FN4B 1QZ1A 3RWGB 5ID1B 2JI3A 3HE6D 4MA3A 1JFQH 1E28A 4JDZA 2IH9A 4P3DB 5I1DA 2F5BH 2ZIDA 2PTTB 6PCYA 3D52A 2Y5EA 1ZK9A 4WO4C 5EU3A 2X44D 2F58H 2EO1A 2QTEA 3RDTC 5I8CB 2HKHH 1LK3H 2G5BB 5CCGE 3QCTH 1ESOA 4PJHF 3N0PB 2NZIA 4IEFB 4WI2A 1JVKA 3BVVA 2WXKA 5AVYB 3D05A 1OAZL 1ZEAL 3U0PA 3VWJA 1R3JA 1E4KC 3RVVC 4LIQL 5B3NA 1UCBH 3C6LC 4YSEA 3DUSA 4ZBJA 3U0WH 3VG9C 4PS4H 4XCEB 5C86A 2G5BA 2XPGB 3DJZA 1CF8L 1RI8A 1DBML 1B6UA 4MX7A 5E8OB 3SDCA 3TIDA 4ZO9A 4PJDB 1N7MH 3C08H 5E95B 3DSFH 4OI7A 2ICEB 2VXSH 3U0PB 2ZD0A 5E6ID 2I60L 4S1RH 3GTTA 2ZONA 1EXUB 1K4CB 4QRUA 4YUEL 5KVMC 2OL3A 4MX7B 4HK3J 1A2YA 3JV4A 1R3KB 5LJYH 1LO0H 3B7TA 2F0CA 4Y8DC 5MEQA 3S5LA 1E5YA 2J56A 5E00B 2AV1A 3PNWB 4U1HB 2E4TA 3IF1B 5FUOH 3SD5A 2XQYK 2JCCF 5KW9L 2P5EB 4MMXB 2J1WA 5TDNA 2JJSC 1FYTE 1CG9B 3FFCA 1Q9WA 3FO1A 3LPOA 4HUUA 2CXKA 5D7JA 1OGAD 3GQFA 4NQDE 4QYOA 4Y0GA 2F53A 4W9LC 5EHFA 5F1NB 3Q0HA 6PAZA 3NAAH 4FI6A 3QAZB 4HEPA 2CIKA 1KOAA 3HMXA 4QRSB 3I2CH 3O6FB 2VAAB 4Z3GA 3D9AH 3VSUA 5DD1L 3D4CA 3BEWA 4YE0A 3GXUB 1XMWA 1O6SB 4N5ED 2OL3L 4EUPH 1MWAB 4OJFH 1PYWA 1TEFA 1DDHB 3D2UB 5IHZB 3BWAA 4OGXL 4ALAH 3QC6X 32C2A 3QJHA 3W0WD 4TNEA 4M3KB 5ECGA 1FZKA 4JY5L 1ZV9A 4D94A 1WYJA 3LN5B 1UT9A 3K8LA 4MNQA 5T5NG 4X4KA 4BH8B 2BVQB 1OM9A 3MLZH 3ZRFC 2QVTA 5F9DC 4N87A 4JS7A 4Z8FL 4EI5D 2GBTA 3RVVD 1PAMA 2Q76B 5I1LA 3MUZ1 1OP5H 3S8FB 2VGLM 3I75A 2R2EA 3SSGA 4P8QA 4E41D 2F5AL 4HOZA 1MJ7H 5C0DB 1AQMA 2HT2C 5IM7B 3GLZA 3L5XH 3IMWA 4O02A 2CO6A 1UWGL 1L7IH 1XGTB 3MNMA 1IMHC 4Z7VE 1A6TB 1IT9L 4LRIC 1NAMB 3KS0J 1IX2A 2XV2A 3I9PA 3T8XA 4K3JL 2EUWA 1BFOB 1W6WA 4P06A 3SE4A 3PE9A 1T7YA 4YX2L 3R19A 5C0GA 4JL1A 5I9QC 1KTRL 4ZXBA 4M5TA 1U91A 5F9WB 4G80B 5IOKA 1DE4B 2OR8A 3PV6B 3QPXL 3CU7A 4GY4A 4NBZB 1FC1A 2MIZA 1FDLH 2OQJB 4NZRL 4JGNA 4WGVB 5E2UL 1L5GB 3MUJA 4OGYL 2PW1B 3HE7D 3BZEA 1J87A 4P23D 5C6TH 5DVKA 3MLVH 4WTZA 4NBYB 1KEMH 1EHAA 5MI0C 2ARJQ 2MPAL 4LPTA 4ZFQA 4CDGC 1IEBB 1RIVH 5C0CA 2QKSA 2Z31A 4FHJA 5DJDB 5JMRA 1M4KA 4DGIL 4L4VA 5JW5A 3JYBA 5J1AA 3BPLB 2C9QA 3JTBA 4GPVA 1NFDF 4FNQA 2YAHA 4AEHL 3GTNA 2CCLA 1EPFA 1BQHG 1VFAA 4X9IA 4GAJL 3V5KA 4TVPD 3VFTB 2OPCA 3KDMA 4HFUH 2V6HA 1A1NB 4XBPA 3SE9H 5DEGA 1DBKH 1JGLL 2VM9A 1CL7I 1J9RA 1K4DB 1XH1A 3ISWA 1UB6B 4N2FA 3NZHL 5BO1L 3FB7B 4B9FA 2EZ0D 3CVDA 1P2CB 3S4SG 1FAIH 2X28A 1UOLA 3MCKB 1WWBX 3GSNH 1JXDA 4HSQA 3GIZH 2GABA 4IBTA 2X0WA 4LBAA 3K81A 5AAMC 5LDSA 1BV8A 3BVNB 3FU6A 2DQ6A 3UJTH 5EULV 1E2VA 4ABWA 3K2UH 1LP9B 1PZCA 5AW7B 4DGUA 4XNYL 3QDME 5I8OL 2WC7A 3HI5H 4I3SL 3DRTA 1KGUA 5I75B 3N44B 3ZRSA 1KB5L 3DHPA 3ML8A 3W82A 1D7CA 4ZS6D 4DT2A 2DH2A 4YAQA 3WO3B 1P6WA 5GS1C 2GTZA 3U6XA 5DFVC 4GQRA 3SJVE 1XD0A 1TXKA 1JRHI 2P46B 1IKFH 5IB1A 2VL4A 2NZ9C 2BW5A 5JOPE 5GSVA 3T08A 4M62H 1VFUA 4CVXB 1CLZL 2DQFA 2WPGA 1ODAA 1HHHA 3LV3A 5C0EB 1NBQA 2AJUH 2VABB 4JCWA 1V27A 2F19H 3CPLA 5DCCA 4Q9RH 3IKKA 4GSXA 1Q9KA 4RMQA 3QISA 2D3JA 1YQ2A 5AVSB 3Q5YA 1ZJAA 3MACL 3MA7B 4HBCH 4TVUA 3VMOA 4M7ZC 2ATAA 1HQ4B 3HE7C 1IAOB 1WRFA 3EOBB 3QDJB 4NSKB 1PNCA 2FLMA 4QRFA 2HSIA 2XVLA 2I9TA 1JK9A 2FCBA 1YNTB 4N0RA 4L0ZA 3KPPB 2VOTA 1UVQB 2G4GA 2VR8A 3K6DA 4MKMA 5I1HL 3L4TA 2VDRH 5GISL 2I85A 1AO7B 4HJGA 3X1FA 5FPIA 4G3YH 4GXFA 1KELL 3ZY7A 2OJ1A 4N90D 5KUKA 4OI9A 3QRGH 5I1GH 4K94L 3JTTB 4UQDA 4MZ3A 3LN5A 4JFPA 1AACA 1CBVL 1CFQA 1TKWA 3FCGA 3GRGA 4DZ8B 2QQKH 3KLLA 4JR9H 4WKZB 1W8NA 3VVWA 2BY0A 2X89D 5D70H 5E6UB 4I1NB 5KWYC 3AUWB 3PDGA 2EINB 4FZ8L 2VN4A 3PS6A 3VWKC 5GPRA 5B8CA 4X8CA 2MOGA 1KYFA 4C83B 3MXVH 4ZAKA 1BWMA 3FU3A 5E4IA 4FFZH 4HPYH 4UINL 2GI7A 2CK0L 5GGTL 4JN2A 2CLVA 4ZS6C 3ULVF 4WO4A 2H2SC 3CD4A 2C4XA 1ZA6B 2O6CA 3CLFH 1PYWB 4I77H 1WZMA 3P9MA 4JG0H 1MN4A 2JB5H 1CQKA 3OMAB 4JFSA 1FAKT 3T3ME 3US0A 3UROR 2ZG2A 3GDBA 2HJFB 3QG6B 3QI9D 4N8PA 2V7HA 5K9OB 2D3VA 2ZICA 3PWJA 3IDNA 3ILQD 3I02B 1U9KA 3SKMB 5BMFH 3QCUL 4Y4FA 4R7VA 2Z31C 3W39A 2FRGP 2E47A 4KKLC 2DLHA 3HZKA 1S7SB 1QUNB 3G08A 1KCBA 3QUXD 5D72L 43CAB 5D1ZB 4JQXC 4DEPB 4LT7A 2IBZX 2X3CA 1FH5L 2OMVB 2FB4H 2WVVB 3FB6A 4XN9A 2O5YL 3FBKA 1J0HA 4HK0A 1HKFA 3PGDA 2KUTA 4MD4A 2WLLB 3OAWA 3QEQE 1D3CA 4HK3N 5BUGA 2YMXH 3SYOA 4GO8A 2IALB 5ID1A 2PPDA 4MQ7B 1F4YH 3MNVB 4AKOA 5CFHA 3E8VA 2P44B 4JDZB 2YPLA 4P3DA 3DX2A 1U8PA 3AREA 1LWHA 5KVDE 3CVHH 4JFZL 5GS3A 1JTPA 5HI3D 2Q6WA 1GZQB 5ICYA 3FQNB 4W70A 5FYLE 3UTQA 3F7VB 1RZJH 3Q06A 2HXAA 1MI5B 4LHUD 2A74C 2LQRA 1FHGA 2B4CC 3UP1A 5HDRA 3E1F1 1KGYE 3IJSA 2W94A 3KPOB 3VGEA 5KVEE 4C56A 3WFBH 3GMMA 4J4PC 4MMXC 3DLQR 1D5BB 4F20A 3BZEB 2AEQH 2WVTA 1TQWA 1O5PA 5CBAA 5FECA 2ADGA 5K9KA 2R7EB 3H0TA 3MOBL 5ISZB 1BYNA 3BFWA 2XICA 3T2NL 3BGMA 4AMKH 2VZOA 2R0ZH 1NOLA 4JZOB 1GPOL 4L8CB 2HVBA 5BVJB 2MJWA 3CC5A 4K3GA 4JFDA 4B5ZA 4L4JA 1UT2A 4WEUD 3J07A 3VFOB 4PV8B 5FWQA 4FKKA 1Q1JH 2YXMA 2HRHA 2YOAA 3GRBA 3DWTA 4LIQH 1WWCA 4PPTA 1UKTA 5JORA 1I3VA 3HW7A 4Y1AA 2X7LB 4OFIA 1QNZH 4YDKH 1JWUB 2QFPA 3CC5B 1NKRA 3WEAA 4CRPA 3GMPB 4AK2A 3P02A 3AFLA 4EDXB 2Q7YB 1ETA1 4NJ9L 4LIQE 4N3TA 5FUZL 3HE6B 4N0CC 3AAZB 2AXFA 3TT1L 3C6LB 5HD8D 4Y5VC 4HUXA 4M1GH 4MA1C 4WFGD 2W95A 2O5XL 4HISA 4H44C 2EYSA 2RAMA 1YC8A 3Q1EA 2ZXAA 4CADA 1MFBL 2W88A 4G42A 4B9PA 2VAAA 2NYZA 3F8UB 3L3HA 1SMOA 3BZFB 1A4CA 2Y23A 2QDVA 4X5XA 1CWVA 4Z95H 1I1YA 4KX9A 4Y19B 3KD4A 1J0IA 2XRAL 1LD9A 4UWQB 5JIIA 1PZUB 2JH2A 4QHNA 1OAKH 3U46A 5FYKH 4CADB 4PJBF 1IM3B 2BVOB 1AZRA 1UYWL 4GEIA 5CP7B 3TPUA 4BFNA 1HSBA 4ZI8A 1PG7W 1CN4A 2PP9A 2XZZA 3UACA 3ZKSD 2P4AB 1DVFA 2DQMA 3H6AA 3QK0A 4PJ6A 3V4VL 3SYQA 1BW8A 4V2CB 1MAML 3S36H 2APXA 4OZIB 3I2CL 5FW8A 4XP9H 5JOPD 1AOHA 4TNWK 1VADA 3VFGH 5DS8A 1T5KA 3RFRA 4J2XA 5KVDH 2O6FA 1WCQA 2BJML 4OJEH 4TMPA 3LQAC 4U3SA 5D1XA 3DC0A 1NCAH 1MCOH 2M2DA 3GINA 2D3LA 2MCMA 2A74A 4XNMA 4ALAL 3VQ2C 1DJGA 1L9OA 5F8QC 3ARDA 2VDQB 5CCHE 2GFBA 1YY8A 3Q9QA 4QGYA 4NBXB 1Z9MA 1UZ8B 4TULL 1F58L 4ENZA 4J3XA 3MODH 1FC2D 1UWGH 1V05A 2EEDA 2P5EE 4F33B 1J9CT 1PX4A 2I07B 2WXGA 2FSDA 3L95B 3DIVA 1KN2L 3NSJA 4L4VE 5ERWA 2MQGA 2NMSA 4O02B 4EQ2A 2EDOA 1QRND 4OAWB 1ZE3C 1FFPA 3RTQA 3NZ8B 3GJFA 4H5SA 3T0VA 3PXHA 3RPIB 3WHXB 1MFCH 4JX0A 4YHPA 5DURD 1MW2A 2FLBT 3C6SB 3IU3B 1OWRM 2V37A 5DJ0B 3ZE1F 5LXGH 2UXTA 3D6GA 3MMEB 3QZLA 2BS9A 1N10A 4PJ7B 4PJIF 1JZ7A 1AHWA 4JN2B 3Q6FA 4AT6B 3NBNA 3MOAL 1O7DC 1WE5A 4P99A 5ADOL 2FL5B 5CZXD 4HA1A 1WGVA 1W72H 3OKMA 5ESVA 3ZQWA 4RFOH 1J8HE 1R47A 4POZC 3FPYA 5T5FL 3OG4B 5E08H 3T8VA 1ZSDA 3BSHA 5FHBL 5DJAA 4GAGH 4Z0XA 2BP3A 5DVMA 1EO5A 2QDWA 4OSUH 1AGFB 2OKMA 2XOTA 3MBWA 1TJXA 3DTXB 5IJVB 2R56L 1F3JB 2JCCB 3SE9L 2DQJL 4IRJD 2XZQH 2F1AA 4QO1B 2ZJSH 5AKRA 5AW8B 4J2QA 2CGZA 4OLWH 4DGIH 5LBSH 3ZSTA 1H3WM 1MIML 5EOTB 2OW7A 3ETTA 4WU5A 4TUJA 6FABH 1UD3A 1KLUA 5B38G 1V7NL 2ZKHH 3Q1SL 3UJTL 2WXIA 4ABQA 4YIQA 3U25A 5E9DE 3NIFB 1A2YB 3V0IA 3WE1A 5C0FA 4NN6C 2DDQH 2VR4A 4PJAF 8PAZA 5L8KB 1H6EA 1PJ9A 2A77L 25C8H 4GAAA 3CFDA 1T1WA 2DQGL 4ODBD 1N59B 4G8GA 2VUOA 4LCIL 2Q2LA 5F7EL 4DKTA 3JVGC 4OI8A 3HHSA 3FT2A 1MHHA 3GSRB 3PHOB 1HIML 2VW7A 2EKSA 4KTGA 2WQVA 4PRAB 3EYFA 4K23H 3V8OA 4MJ6B 3FH7A 4JO3H 1MIEH 3L2LA 1PD6A 1J5OH 1A8ZA 3T4YB 4FXKB 3V10A 2NW2A 1U8HA 4EPSA 1XZ0B 2VM4A 3VD9A 1O6SA 1YEIL 4KK8C 4XCFL 2FR4B 4N6RA 5I26A 1CLZH 3TWCH 4M43H 1Y6NR 3KH3A 4FF9A 3QXUA 4YHNA 4WUKL 4XNZB 3ISYA 2OTWB 5KUMA 3WNPA 2J43A 4HUWB 4ZDHA 2G9HA 4M4RB 3TVMD 2VDRL 2H45A 4QYOB 1OT1A 3U4AA 2IGFL 4Y9BA 2Q8BL 4YFLI 3UYPB 4GS7B 4YGAB 5K59E 5IB4B 1A7OH 4XPHH 4OLVH 4OM1H 2NY7H 2LU4A 2CCVA 4XNQB 4UQ9A 5TK4A 4OZIA 2KHAA 1JYVA 1PG7X 1MXGA 3B7SA 2BNRD 1W80A 4OZFH 3T77A 2Z3FA 3CZGA 1WBZA 1R46A 3QIWD 4OIFA 1BM7A 3KPQA 3ATFA 2QQKL 2VUYA 4PGBB 3SO3C 4HH9B 4WI7A 1W8EA 4BK5A 3W38A 4TL5A 3SJVB 3L5JA 3CHPA 3FU7A 3NRPA 3QULB 4MRCA 1IM3A 1MCHA 2BVOA 5CP7A 4L3FA 4AQEA 1CURA 1XCQB 3N2JA 2E6QA 4QTHB 1MW0A 4FYSA 3GBML 2O93L 4U3HA 4XRCA 4ELMF 4LCWE 4Q0XL 4HAGA 3IMUA 1Z32X 1PTZA 2B0SH 4P5MB 2P80D 4MJIE 3ROOA 2L7EA 4FN0A 3IAPA 4LF3A 1MY5A 1S7QB 1G4MA 4JPKL 4WHTB 1L5GA 4UTAL 3VI4B 1L9SA 1SOQA 3C5ZC 2XZCL 2ZNXA 4Q52A 1OW0C 1OCRB 3NDYE 4AZUA 1L0XA 2AJVH 4A67A 3LXBA 4OFQA 3KE0A 3GXMA 3V0GA 2B59B 2JELL 2D2CC 1GTFA 1KNOB 1FA4A 3VFVA 4L0YA 3TOPA 1A6UH 1A14H 1HINL 1YPZF 2AMUA 2FX8L 2G0LA 1JXGA 1H0DA 4XTRC 3VXSE 4AVIA 4LKXB 1CGXA 5KBPA 4NHUB 3FKUS 1YDPB 2LE9A 4ZTPL 2OYKA 2B1HH 1S8DB 4M93C 4OF5A 2ENYA 1NCUA 4NKMB 4TRPH 4JG9A 1EDHA 2V2WA 5C9JA 4WRLA 1Y6KR 4X6EA 3WN6A 4Y4KB 4L37A 2ZUXA 4FFZA 3H3BC 2EIZB 3NCXA 4ABVA 4WHYH 2WXNA 1N4XL 2PWGA 3ZKMC 3LKSB 1QSFB 2NXYC 2WQ8A 2Y25A 2YD7A 4TVPL 1PX8A 4O2EA 3TASA 5I2IA 2DIAA 2XYBA 1YMMB 4YOKA 5ABZA 3J7HA 4LSTL 4Z7WB 3MLXH 2DI7A 2E9GA 2MCPH 4B7LA 3S4SA 4OZHA 1BZ7A 2EKJA 3MR9A 1A6ZA 1JNHA 3LPFA 4MNGB 2NY5H 3EGSA 4K2UL 7FABH 1D7DA 1PEWA 4P59L 1PEZA 1NC2D 1U8LA 2NY1B 3UBXB 3UTTB 5L0QC 4HHAA 2W0LA 4DF9A 3QZWB 3Q44A 3N41B 5LN8A 3H0TB 1NGPH 2PWFA 2XY1A 1DN0A 2QTVA 3RL1B 3WFBL 4X7EC 4KC3B 2J1YA 3QUXC 3VDBA 2XTJE 3BKYH 2H26A 1GZPA 1QSEA 4NZTL 1BLNA 4UAOB 3RWHB 3KWVA 4C56B 3HMWL 4WU7B 1C5CL 1KC5H 5L2JA 5FDWB 1F2XK 4PV8A 3WNLA 2VN6A 4CMMA 4EN2A 1ROCA 2BOCA 1U8QA 4H26B 4JHZA 1J1PL 2UWEA 4GKZA 5EO0A 3BPNC 3NH7L 1UC6A 2PP8A 3PIQA 4R4FH 1VAHA 4OKDA 2Q6WB 3WS3A 2WUBH 4OZIF 5C0IB 5TE4H 3V4PA 1SLXA 2B7DT 4P5KA 1GVIA 4WTWA 1SDYA 5DZVA 3I3EA 1WD9A 3OX8A 1WZ1H 4Q6IB 5F88A 2AJZB 4KDVA 4OVVA 1UWEH 3CZEA 4J3OF 3V0HA 5KS9F 1NEZB 1CGWA 4DVBA 3QWRA 1CMOA 3PF2A 2X0UA 3SDCB 4HD9A 3KPMA 4XZ4A 4Q2ZB 4R3SB 5EZPA 2R69A 4WAFA 3NIDF 2WWOA 5B1CA 4ZAKC 3QUMH 2JKJA 1QBAA 3MCLH 3RLSA 1FL6A 1THAA 5DMGC 1XSIA 1LO3L 4G6AC 5GGTH 4QHMB 1HYSD 1AXTH 4JANB 2X53A 3ZYOA 4UT9L 3RZCA 5I15L 4MDJB 4HWEL 2AFNA 5GGSB 5J06A 1MFBH 3SCMD 3HN3A 4WFGE 2AGJL 3L5WB 5A2FA 2GITA 1JDAA 5DJCA 1RZGA 2NCMA 4GUCA 3T65B 2WXQA 3VFWB 4CVZA 4Q4EA 4DCQB 4X4YA 3ARED 4MXQC 1I7ZB 4PP1D 4IKKA 1CFMA 3WHE0 3WKMH 3D48R 2YWYA 5HHMB 3GHEH 4EIZC 4PGBA 4F7KA 4B9CA 2A6DB 2EE0A 3KS0H 4P2QD 3UGUA 2ITCA 4P2AA 2EIBA 1MWOA 4HUWA 1OKEA 4ZDHB 5D1QE 3T65A 1E6OL 2NT0A 5DJXA 4UTAA 1JZ5A 3Q5TA 4PJ8D 5MEND 2IH8A 1GKEA 4HXBH 3B7YA 3MRBB 3CVIH 2LFGA 5HJDA 1IC4L 1U6AH 2F7RA 4NT6B 4EUPA 3EYOB 3HC0B 4WGWB 2BJMH 2EDHA 4AENB 3VQMA 4PIBA 3D1MC 3TN0A 3BLPX 5MEPA 2DWXA 1T4KB 3KHOA 4TM9A 4Y4FB 5EEWA 5DHYB 4C4BA 1ZHBB 2DOCA 1H3PL 2AK1L 3FJTA 2XWBB 1A4BA 3NABL 5DK2B 1H9VA 2VDPB 2I9LA 1EEZA 1X4XA 4XVSH 4DUVA 2PCXA 4IYKA 5EMYA 3US9A 5FGCB 2YAPA 4Y9CA 3P11H 5T1LA 1GYVA 2A38A 4RIRA 5F0PB 4ZYKA 2BS8A 4MKTA 4ELMB 2CNZA 2OMTB 2AHIA 4DW2H 1OIOA 1CXEA 5C3IA 3NIDE 3VNYA 1BA9A 1AGDA 3W11C 5BV7H 1Q0YL 4F92B 1B6DA 4ES8A 1BF8A 2ZSVB 1WHOA 3BXNB 3VD2A 4UMGA 1BQLH 4LMQE 3OMZA 1ICTA 2FUQA 5GJTL 3UAAA 2DTSA 4JQIA 4XBMA 4WI4A 4X5QA 1KWGA 1WDAA 1TNMA 4I9XA 2A0LD 2FT8A 2H1PH 1Q0XH 2GTWB 2FWOA 3ZL2A 1YYML 4DGWC 4YS4A 1FYTA 3FF8A 5DSCA 3D0AA 2EDDA 4YHLL 2ALAA 2H0PA 4HJJH 3ULUH 3LEYL 4S0TD 1DQJA 1DN2A 2B5IB 4PSRA 4YQXL 1EXHA 3BVUA 3S88L 2BO0A 1RZ7H 1PLGH 3APNA 3BGFC 3B2UC 1HHKA 1R3HB 1FO0A 1CZ8H 1UD6A 3I9AA 2APWA 1U58B 1HEHC 3D07A 1IGYB 1ZA3B 4R9HA 4RFOL 4E68A 3ARGC 5D7KE 4L4VB 1I1AD 3O2VH 3MMEA 4NKMA 5D7HA 5EO1A 5FYLD 2HLEB 4OZHB 2EXTA 5AZUA 1BZ9B 4DEWA 1CE1L 2QSCH 3V0EA 4ZMYA 1CTOA 1UUSA 3R4RA 1QHOA 4F2FA 2WXMA 3Q1SH 1QR1A 2ZAIA 2VW4A 1YVLA 4JHAH 4QRPE 1NBCA 5JUEH 3A4DA 5LGJA 4G8GD 5EO1B 2QL1A 5E6SB 1XD1A 4YHZH 5I0YA 3J8F7 1OTSC 5ILTL 5DJDA 2ED7A 5FB8B 3MRQA 4HUVA 4PRNB 1TZ8A 1IJNA 3JV6A 4W68A 3G5VB 1FFQA 3F58L 5EUOB 5F7EH 4B9JA 3ZL4L 2RIKA 4KK9D 4HKJB 2DF3A 4XVOA 5J6SA 3GMNB 3V0DA 1IFHH 4J8RB 4JGJA 2H32H 1J8HB 5AVRB 5GRVL 1KGCD 1P4IH 4AV5A 1PNDA 3MRQB 3VM5A 4GAJH 4HWBA 5J6GA 4HUVB 1V3KA 3CLEL 4W9IC 4PJEF 4YZFE 2KH2B 2Z8WC 4OF3A 2NY0B 3IGUA 1KGWA 4LOVA 2HX8A 3ZR5A 3F7KA 1FG9C 1A1NA 4I1RA 4XBPB 1LEGB 2PMZA 4H8UA 3MUGB 2HUHA 4AX3A 1GL4B 4N1EA 5EFIB 3II2A 4BSVA 3GYRA 4G7VH 4GLRI 4LPUA 2YUWA 4AH2B 3WTSA 1ITCA 1Z1WA 4LHUA 4U1KA 1WFTA 3ZMEA 2Z7ZA 2X2YA 2ZYHA 1M6UA 2R2BB 2DTMH 3IDGA 1IC5L 1GC1C 4I2XB 1RV6X 4LVNC 1OTUD 4XBEL 1XAKA 4JFXB 3MV8E 4WWPA 3IRCA 3W9DB 2GK0A 3B9KB 5ENWB 5L6YH 1IKFL 3M8OL 1G7PB 4BINA 3MLSL 1FVCB 4OLVL 2FR4A 2VERN 1SHWA 4Z7IA 3LS5L 1HI6B 2FJSA 4KMQA 3C6LA 3O3DB 4ONGL 3ZKXC 5HJBA 4JHUA 1OARL 1ORQB 2E7CA 3JTSB 4FMFA 1I9IL 2FGWL 2AJ3B 2IFFL 1LM8V 2XA3A 4WDIB 4OGAD 3VD7A 1DQML 3EO1B 1XTMA 3L4YA 5CSGA 2AVGA 4ADIA 3RTQC 2LVEA 5DFVD 2LU5A 1MJ7L 3K5RA 2HPOA 1TQBB 4PMEA 3TV8A 3RGVB 3SPVB 2K9UA 3CHOA 4F2EA 1A9BB 2NZ9D 4WJ5B 3GZKA 4OD3L 5DK0B 1FNSL 1AE6H 1WCBB 1KZYA 4XPGH 3WV0A 5BRZA 1S7UB 3S34L 2YFNA 5DJZA 2F53B 2P80A 2AJYH 2JELH 5C0DA 4URKA 4HLJA 1DR9A 2ZKMX 5HGAA 4NQDA 4J3OH 2O4EA 4Z3TA 3BP4A 1HQRB 1M2OA 3DIDA 2J1KA 4OZGA 2XZCH 4FFYL 1ZT4A 1E4JA 5ES4B 5FIEA 2ZG3A 4ANWA 4TUKH 2O5ZH 3FPXA 4Z7AA 2ZQKA 3AMKA 4JR9L 2O26U 3QFGA 1A7NL 1W8OA 1B2YA 5GHWL 1G6VK 2X10A 3RIFK 2YARA 1DEEB 1AKJA 3RY4A 1QBLL 4JG1H 2IAND 1XF4B 1DLHB 2XWZA 5T1LB 1MRDL 1KYOJ 5D2LA 4HX1A 1TG8A 4GXUN 2BWQA 4UTBH 4XMLL 3WNMA 4BM7A 5I19L 4RGNC 1TR7A 4CJ1A 2NY2D 4OQTA 4NZFA 1I4FA 1LDPH 1ED3A 3NA9H 5IMKB 5SWZB 4MB5A 1QLEH 5H2BB 5I1DB 2N7SA 2VKWA 4PY7B 5D7JD 5EZOH 3BZ5A 3OKEB 5T1MA 5IJVA 2OSLA 5JHAA 2XKUA 3F12A 4XTRD 5AW1B 3T0XA 2IGTA 1T0NB 3QQ9C 3OJMB 2HLAB 5HTSA 1BX2B 4FLQA 4RWYH 4XGZA 5GS2H 3GSNL 3IU3A 4P3WA 4ZD3L 5BXFA 4RBPK 2RCSL 5HHXH 1KB5B 1MREL 4BUQA 4YR6B 5INDA 5J9PA 3BKJH 1HE8A 1VGEL 1UQSB 4D9QD 3PABB 2WBWB 2ZWYA 1JVOA 1KLGB 4FULA 2PYEA 1PZ3A 2WCGA 2XPGA 2YPLD 3FRPG 4MBOA 1AR1C 1IQDB 3TV3L 2X38A 3APDA 4DQAA 4XOAA 1JPSL 1OGTB 4QGTA 2EDTA 2A6KB 1S9XA 5CJXC 2OQJA 5IG7B 4CMHB 2ESVA 1GMEA 4Z0BH 2C1PB 1B0RB 1VSCA 2NY1C 4W9EC 3O45B 3GXIA 5AAPA 5DUMH 4IDLA 2H8PB 4M1DH 3U36A 4FNSA 1LK2A 1O0VA 3QEGH 1ZS8A 5F88B 5EZLA 1U0QA 4L9LC 1BD2B 4U4IA 4YHMH 2AJUL 1JV5A 2GIYA 3AT8A 2MCG1 1I31A 3V0WL 4PSPA 4TTGA 3DV6A 3WFHA 3FTZA 1UZ6E 4WU7A 4GAFB 5SV3A 1K8IA 4RGOL 2H3KA 3DXAA 1J10A 2E59A 3RIFF 3S3JA 1EZVX 1U3HA 1FV1B 4KTDH 2VN3A 1F41A 1VFOA 2CAKA 2EH7H 2VH5L 3K6IA 2G3ZA 1RJLA 2AEQL 4G8EB 5DI8A 1U92A 1WZLA 1NFIA 2DLEA 5DZJA 4XP4L 1YNKL 3MCLL 1D6EB 5D7LB 4YXKH 5ICZA 1JAEA 1KCSH 4H8QA 5J56B 1TCRA 2XTJB 3CN3A 4HKZA 2D9CA 3VG9B 3F04A 2XFXB 3M1BA 5BS0D 5C7ZA 2HFGL 3S2AA 3B34A 3HS0C 1A4KA 5FW7A 2PCYA 3GHEL 1KCVL 2K7PA 2VDNH 1QABA 3AG4B 4U0RB 2QV4A 1F90L 3MRMB 4J23A 1HE7A 4I7ZC 1BHGA 2JTYA 3PRZA 2XBZA 1OAUH 8FABB 1SEQH 4HMDA 5SWSB 4KVCH 1P7BA 3BAKA 3WSQH 4P48A 1HSBB 1N68A