3NJKA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph5.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njkA00
1TU2A 1YLBB 2XLLA 3NSCA 3KW7A 2UXFA 5AFAA 1IKOP 2R7EA 2XV2A 2WSDA 1XB3A 5B1KA 1OCOB 3BQVA 3RYMA 2VM4A 4NB7A 4DP6X 1OCZB 3OD3A 4GP8B 4DP8X 4M3HA 1DZ0A 2AFNA 2BWDA 2VW7A 4A2FA 4DPCX 3WNIA 1PLBA 2UX7A 2GSMB 4HHGA 1ET8A 3GDCA 1GR7A 1ET5A 1W6WA 3SBQA 1SHXA 2QDWA 4HAKA 1DYZA 1RZQA 3T6XA 1CUOA 5I5MA 5B1BB 4DP4X 4A66A 5I6NA 4WKXA 3IE9A 3CVCA 1KBVA 5B1AB 1AZRA 5I5JA 1GY1A 1AG6A 2MRYA 2W88A 2YAFA 4UAHA 1KGYE 3T6WA 1NTDA 3QJQB 4HCIA 4GY4A 4BWWA 4G71B 1M57B 4G72B 5F7AA 2FT7A 1SJMA 4A2GA 2HX8A 4AKPA 1PZBA 1OCRB 1JZIA 3SBPA 2OV0A 2H5UA 1JZJA 1ZDQA 2OJ1A 4YSQA 4RH4A 1AZNA 1NIAA 2LLNA 2FNWA 3FYIB 3ZDWA 1JZGA 1J5CA 4YSTA 1L9SA 1ZIAA 4HZ1A 1JZFA 4PCYA 2HX7A 2W8CA 4YSPA 4HALA 5TK2A 2J55A 1AOZA 3NJIA 1JXDA 1PCSA 3CZUB 1KBWA 1URIA 3PXLA 4A67A 2VW4A 4F2EA 3WI9A 1BQ5A 2CJ3A 3NYKA 3AG4B 4DPBX 1NIFA 5F7BA 1L9TA 5A7EA 4E9QA 2GHZA 3ASNB 2XV3A 1CYWA 3IN0A 2FT6A 4N8UA 2IDUA 1PLCA 3CDZB 5PAZA 4BDVB 4DP2X 2XYBA 1AZCA 3QQXA 1WS7A 1KDIA 2QDVA 1IBYA 1IUZA 2FQEA 1RCYA 2BP8B 3MX0B 4KO6A 3V9EA 3U25A 1A4CA 4L0PB 1J9QA 4K9JA 3CVDA 1X9UA 3AY2A 2X87A 1RKRA 3OMAB 1JXFA 3L45A 2VW6A 1W6LA 2PP8A 3NT0A 4YVNA 4KO5A 2AVFA 2DV6A 2VSMB 3UAEA 1SHWA 3WNJA 2ZXWB 3FPXA 2UX6A 2XX0A 3WKPA 2BP8A 2R7EB 4DP9X 1KCWA 4F7KA 3IEAA 2I7SA 4GXFA 5D4HA 1BYOA 1SDDA 1GS7A 1R1CA 2HLEB 2YAPA 4BXSV 1L9QA 1M9WA 9PCYA 2DYSB 4HCGA 1WA2X 1AAJA 4DP7X 1AZUA 4M4RB 2YAQA 2BZ7A 1AACA 1OF0A 4TXVB 3FSWA 3PAZA 2FT8A 1BQRA 1E5ZA 1SF3A 1N68A 2E86A 3TBBA 2PPAA 3CG8A 3DIVA 3T9WA 4EF3A 2I85A 2BZCA 1QHQA 2GC4C 4A68A 1E67A 4AKOA 1L9RA 2GC7C 3IBOA 3QJVB 2WO3B 4KOCA 4DP5X 2EILB 3T71A 1MZYA 5I6MA 2XU9A 1AS8A 2XX1A 2AZUA 2IWEA 2PP7A 4PAZA 1MG2C 2EINB 1TEFA 1ETJA 2HRHA 2JKWA 2GI0A 1AS6A 2EIJB 5I6PA 5I26A 3NJGA 2YAHA 3FU7A 5IY5B 1SFHA 3FQ1A 1HFUA 1AG0A 4QKTA 2VN3A 3ABKB 1NIEA 3NP4A 3X1BA 4KNSA 1CYXA 1IC0A 4YVUA 2YXVA 4AI7A 1AS7A 3PCYA 5PCYA 6PAZA 2YAOA 3TA4D 3WIAA 1A4BA 3JTBA 4A2DA 3S3CB 1BXUA 2VM3A 2EIMB 2IDFA 2IDTA 2MTAA 2N0MA 5D4IA 2XVBA 3FYEB 1ID2A 3S3DB 1SF5A 1HAUA 2FQGA 1NINA 3X1EA 3EH5B 2YQBA 4YL4A 1AQ8A 1A65A 2IH9A 3QJSB 3AG2B 5I6KA 4A2EA 1WA1X 3S8FB 1CC3A 5B7EA 3NJHA 1NIBA 5AKRA 3CVBA 1J9RA 2BW5A 3NSDA 2OCCB 4BXVA 3PPSA 5I6LA 2YARA 3FSVA 3AW5A 3DTUB 2A3TA 1PNDA 5FC9A 1EZLA 2CUAA 1E65A 1TKWA 1CURA 3HEIB 3S8GB 3H56A 1MZZA 1NICA 1V10A 3N2JA 4UANA 1OE2A 1L9OA 2PCYA 5AZUA 4GP4B 3PAVA 1MDAA 2YXWA 1ZIBA 4AZUA 3TASA 2EIKB 3GYRA 3H4HA 2IDSA 4CSZA 2PPEA 1AZBA 1J9SA 1SDDB 2XWZA 2GB2A 4HHWA 3TBCA 1PZCA 3D12B 1EHKB 3OQRA 4YSAA 3FU9A 4YSCA 2FQFA 2PCFA 3ERXA 5I5IA 1NPNA 2XXGA 3PAUA 5D4JA 4BWUA 2J5WA 1BEXA 4G7QB 2FJSA 3FU8A 1SFDA 3X1FA 3ASOB 3UABA 1OE3A 1JXGA 1T5KA 1V55B 3OMIB 3PLYA 1BYPA 2HRGA 5I28A 2IH8A 2QPDB 2Y69B 2TSAA 2CBPA 2XV0A 2PPDA 3NSYA 5I6OA 2PLTA 1F56A 1WS8A 2P80D 1JVLA 2WO2B 3EH3B 3SBRA 1OOWA 4E9SA 4NAJA 1WAEA 1GSKA 4W9ZA 2QT6A 5B3SB 3NJLA 3N55A 1BXAA 2VSKB 1TEGA 2HXAA 1GW0A 3QPKA 3NJNA 1FA4A 1ZDSA 2FWLB 2YAMA 3FS9A 3FU7B 2B08A 3FQYA 1V54B 2XUWA 2FTAA 2Y1AA 2XXFA 4FA7B 4YSSA 3EF4A 4KNTA 1NWPA 4E9WA 3V9CA 2Q9OA 7PCYA 3T6ZA 2UXVA 1JZHA 3NJJA 1PMYA 2BP0A 3AG3B 1W8EA 1ASPA 1RZPA 5E9NA 3NJMA 1FWXA 2PPCA 4E9VA 5B1JA 1BQKA 1N70A 4YSDA 1HAWA 1IBZA 1QLEB 4MFHA 1ASQA 1L9PA 1JVOA 2PP9A 2CCWA 2H47C 3IN2A 4KO7A 1KYAA 2BWIA 4CSPA 3NP3A 4UF7C 1NZRA 4AX3A 2H3XC 3T6VA 2UXTA 1OE1A 3TU6A 2IAAC 4E9YA 4QLWA 2BHFA 3EH4B 3EHBB 2IWKA 4G70B 4DP1X 2HX9A 4X4KA 1AIZA 2J57A 2UXGA 2QPEB 5TK4A 1VLXA 4BK5C 2JXMA 2B3IA 3FPYA 2IDQA 4ENZA 1NWOA 4KO9A 2AANA 1J5DA 1KV7A 1E5YA 3FSZA 4E9XA 1PZAA 1JOIA 2YAEA 3BVDB 2HZHA 2JFCA 2IWFA 2BW4A 3ZIYA 1GS8A 3OMNB 2DWTA 2PPFA 4JHVA 5EHFA 3ZBMA 4YSUA 1PY0A 3S3BB 4E9RA 1XMEB 4KNUA 1NDTA 4HIPA 1ILUA 2FQDA 2DY2A 2GIMA 4G7RB 2CALA 1A3ZA 1BAWA 2I7OA 4AKQA 3ABLB 2DWSA 4Q8BA 1QNIA 1KCBA 1SNRA 4JHUA 2CAKA 4P5RA 5B7FA 2DYRB 1FFTB 2VMJA 4GP5B 4YSRA 1KDJA 4P5SA 4WTQA 3WG7B 3HB3B 1B3IA 3DKHA 3UACA 1ZV2A 7PAZA 1PAZA 3KW8A 4DPAX 3FT0A 3NJFA 4F2FA 1GY2A 4BWTA 3H4FA 2NRDA 1PF3A 3ZX1A 1ADWA 3GXUB 4NERA 5B7MA 4G7SB 4FAAB 3G5WA 3WKQA 2ZWNA 3ABGA 5B1JC 3UAAA 1BXVA 1GS6X 2X88A 4ZK8A 6PCYA 4YSEA 1M56B 3X1NA 2P80A 4HCFA 2TSBA 1X9RA 2ZOOA 4W1TA 3UADA 3NSFA 1A8ZA 1AANA 1NPJA 3UGEA 2ZONA 2J56A 3FSAA 1GYCA 1PNCA 2Q5BA 3SQRA 3AG1B 4YSOA 1AR1B 3QJUB 3AZUA 4A2HA 1OCCB 2RACA 1PLAA 3ABMB 3NJKA 3CDZA 3QJRB 4BDVA 3FQ2A 1UATA 3X2QB 4GYBA 1JERA 4Q89A 3X1GA 5LDUA 4JKNA 1ASOA 2BO0A 1XB6A 2BP0B 1MG3C 8PAZA 1A4AA 4E9TA 1J9TA 4N4YB 2AZAA 1ET7A 3C75A 1WA0X 2GBAA 3OM3B 3JT2A 1ILSA 1I53A 1OV8A 4DP0X 1XB8A 1NIDA 5ANHA 4KOBA 1E30A 3MBWB 1JZEA 3QJTB 1ZPUA
chains in the Genus database with same CATH superfamily
4KROC 2H9GA 5IHUH 1WAAA 3IPBA 3OLEA 5EU7E 3ARGB 2XLLA 3KW7A 1R3LB 3Q9QA 3T2QA 1D5IL 3CMOH 3OPZL 3KPNB 5B1KA 4AIZA 3WN5B 5HHPB 1HS6A 3FB8B 4LLYA 4DAGL 5DRZA 3UGUA 2AFNA 5DQDL 5I2IB 2YHGA 2BINA 4LSRL 1PDKA 4HU8A 1OARL 4B95C 5DRNB 5CIPA 4FRWA 4QAMB 5IOPB 2O30A 3NK4A 3IDXH 5IHUL 3I6GA 2AJVH 1HESA 1JN6B 2C3XA 32C2A 4Q9RH 2DBLH 2HFFA 3ECBB 2NY3B 3PWPD 1LQSR 4PY8J 1ZLVK 1B9KA 1S5HB 3P4MA 1LYQA 3QORD 3VDCA 2RGSA 1JSYA 1AIFA 2XQYG 4X8GA 2PETA 2H8PA 4N6QA 4OCYH 4RSVA 1UA6L 5E4OA 4K94C 1VFBA 4GRLC 2YA0A 3BKMH 3IDXL 4LCWD 3U2SA 3QHFL 4F2MA 1JFQL 2AJVL 4MJIB 3SY0A 2UY6B 2ZYRA 4PS7A 2CUHA 4LOUC 5CEZD 4Q9RL 4NNPH 4P4KB 3MROA 2EDQA 2DBLL 3CFUA 3DMMC 4YLCA 4PGEB 4C57C 3KH4A 3W11D 3EJPA 4PB9H 3FYIB 1AXSA 5CKAA 2VDKB 4OD1H 1WBXA 2ZUQB 3SKUD 4NX0A 3WTTA 1TEYA 3QFDA 5ENWB 3BKML 4F7CA 2HX7A 4YDLB 3F6LA 5AB1A 3TPUB 1OPGH 4N90D 5DLML 2ZOWA 4GO8A 4X9FA 4TTDD 1KBWA 1WTGT 3IJYA 5J1AB 3V7MA 5DJCB 4MJ5A 4PLKD 4QXTB 2WM0A 3PWNB 1G87A 3WKML 2X40A 3UYRL 3P11H 2CXKA 4PB9L 1CR9H 3NQKA 1FZOA 3KYOA 4DGYH 5I8CB 2ESVE 5E00B 5C8JA 1U4FA 4KUZL 2WN2A 5I1LB 2BMKB 4JFDB 4HKBA 3C12A 4J28A 1U8CA 1CXHA 2WYZA 2W5PA 4F37F 3QG6A 3IGUA 2XPGB 2UUDK 4NJAH 3RZCA 1EEZA 5CS7A 1NEUA 2FSDA 3QJHB 3V9EA 3P11L 3H55A 3Q3GA 3N42B 2YD0A 4OLXH 1FVCA 2WAQA 3CVHA 4NJ9H 1MOEA 3GI9H 2FJHA 1R5VB 2IOIA 1A1OA 3OGCB 4PVLA 3EZ8A 3OMAB 1JXFA 4MQTB 4L29A 4U1HA 4MB3A 2AVFA 2DMGA 3L4YA 4XAKD 2ZWZA 1WQVT 3G6JA 4LGSB 2YD5A 1SHWA 5C3LD 4U3SA 2VLKD 4BIKA 4AEFA 3O2WH 2ZXWB 3FPXA 2I9LA 4G43B 4NJAL 5EIQA 4DP9X 2FEDD 3ZYJA 3BVXA 1E9PA 2WIMA 5K9OA 1BYOA 1MCFA 4JRXE 1GJUA 3VSUA 1BZEA 2GUOB 3OWEA 4NJ9L 1TYRA 2ENYA 5LWYL 2FZ3A 3SGDI 2K45A 3ULUE 2V5YA 1OSZA 2DYSB 3MV9D 4KDTA 1W72A 4XO3A 1S8DA 1PYWB 3D3VB 1SY6A 5BS0A 5CWSA 2WGXA 1D6EB 1OF0A 4QRPB 5FYLL 3HNTL 3O2WL 4WEEA 5SX4H 5E2TL 5JIPA 1JGVH 4JRYD 1QFPA 4Y2DB 2CLRB 3P9WB 1L9RA 4MCZA 2VZSA 1OP3K 1R3JA 4OZ4A 4QRSB 2W60A 5MEPB 1QBLL 1IBGL 4JFED 4F3FA 2P44B 3GMRA 3GMPA 3O3DA 4XTRD 5E2WH 2GY7B 1V3JA 4NKDA 4F7MB 2K70A 1S9YA 5CLTA 1JCKA 1S7QB 1JGVL 2PYEB 2YGNA 3IS1X 3NJGA 3REVB 1PJWA 5D1QD 3GUTB 4WUUB 1DFXA 5DK0A 1DBAL 3DROA 4D8OA 2DQDH 1UQSA 4KY1H 4F5CA 1AC0A 5HY9A 4UMGA 1P1ZB 3BUBA 4LAQL 3OXSA 4FZ8L 3FB7B 1K2DB 3JZ7A 2EDWA 4C47A 3M7FB 3S35X 5LXGH 1NPUA 5CD5C 2YKLH 4LKCA 2Z0UA 2P5WE 3ZR5A 2DM7A 1BEYH 4OD2A 4WCYH 4XPTH 3ULUC 4HUUA 3D2TA 4E2OA 2D7PA 4LLQB 5DZAA 5BV7B 3P69A 2DQDL 3PFUA 2J3SA 3E2HC 2VR6A 4PRPE 3IJ9A 2LOEA 3VXUD 2AQNA 2BSTB 2B9BA 5KYUB 2EQDA 1X6LA 4LMQI 4LPWA 1DE4A 3X14A 2J71A 1ZHLA 4WWPA 4QHLA 1IGJA 3TT3H 5IB3A 2YKLL 3SCMA 3BT2H 3QG7H 3LJ3A 4E42A 2I5YL 3VI3A 3L1FA 3WIFA 4HKJB 3COOA 4BXVA 3PPSA 3F7RA 3ZE2B 2QQLL 4J8QA 3WTVA 1I8AA 2VUYA 1PKOA 1RUPH 3DI2B 2SEBB 2Y3AA 1FC1A 2UZYB 3LQAH 3VAEA 2EXTA 4NNXA 3DYMA 3P77B 3HCVA 5D7KE 2CUAA 4P5MA 1LK2B 3TFKD 3A4AA 2ZIDA 1U8MA 3LX9A 1VHPA 3TT3L 2AJZA 3FT9A 1MZZA 4LXFA 3TO2A 2GJ6D 2XNAB 3QE5A 4MD0A 3ZTJG 5F3FA 2ATKA 2WXOA 3H4HA 4CSZA 3VCLA 3ARDA 2IG2H 2YS4A 4LIQL 3VD7A 1EEUA 1W91A 2XDHA 1SOSA 4N2DA 5E8OA 1PZCA 4HQQH 1IFHH 4AENA 4I88A 3JWNH 3OAUH 2R2BA 4OZHF 3VD5A 3GF8A 4K71B 3QW9A 4AWJC 3I6LE 2XXGA 3T0EB 4L2LA 3VI4E 3P3UA 3U4KA 3QCVL 1T1XB 2F1EA 5GS0C 4Z78B 2E4FA 3F3HA 4KXDA 1V55B 2WINB 4UNVA 4L1LA 1JV2A 3V5DA 2IG2L 1PVHA 5B8CC 4MA8H 2WBJC 1UEMA 1G6RH 3BPOC 1S7XB 4K7PY 3WDHA 2R27A 4FXGA 1IFHL 1I1CA 2IJ0C 5ICZA 3REWB 2HKFL 4M8RA 5HYSB 5F96H 1WE5A 2BNRE 2NR6A 5I1JL 3SGJA 2O5XH 3D9AL 1TNNA 2GSGB 1N5AA 3HAEH 3GB7A 5DR5L 1IAMA 1VFAB 4J1UA 2ZUYA 2RHEA 3FU7B 3N9GH 4K5OA 5F1NA 2B08A 1KULA 4N2BA 3KHOA 5EUKA 4A2MA 1G6RL 3FO1B 3RL2A 3C5ZB 5IUCA 5E4EC 2XQBL 2IF7A 4OLVL 3F84A 4ABQA 2VSCA 5A2BA 3WYRA 3ZE2F 1G7LA 5IESH 1A1MA 2DEYX 3TA3C 4APQD 2EH8H 3NJJA 5KSUA 5KAQG 5H8DA 4HWEH 3UPRA 1S9VA 4N3UA 1MLCA 1PKQA 3D4ZA 4ELME 2ZCLH 1BQSA 4ZXBD 4Y9GA 3HHMA 5E9DB 2DEXX 3N9GL 3VXPA 2YOCA 4TQPA 3EOTL 4O2CB 3QIUA 4JB9H 5FXCH 3HG3A 2DD8H 1YHPA 3T08A 1RK7A 4UF7C 1KYDA 4P46D 2NXZB 3WS3A 1LTXA 1XR9A 4Y19D 1RZJH 3IMRA 3MRBA 2ZXAA 4HU2A 5IMMA 1SLXA 3MV7B 4GH7B 2EH8L 1KCKA 5C07E 4BQ8A 1J5HA 4I89A 3MI6A 1MHCA 2F1AA 3KPPB 2DQJL 2ZCLL 1MW2A 2D0HA 3ZDZB 4BSWA 1T2QH 4Q97A 2WLLB 1MN4A 4OCMC 3FPYA 4P2CG 4JB9L 5E7BA 2DD8L 2XPYA 1MFVA 1WC7B 3L7EB 1GZQB 4PI2A 4WNQA 3ARGD 1UD8A 4EI5A 4X4XB 4YHOL 4HCRL 4E0RB 1IQWH 2AS5M 4JFZH 2Y7SA 1RZJL 4XBEH 5IQ7H 4ERSL 1FQ9C 3PUCA 2YD6A 3WFDL 3BJLA 4XNQA 5TF1H 5E8PB 3D06A 3LPGA 5AW8B 1T2QL 2I24N 4EN3C 1ONQA 2FQDA 5E03A 1XSKA 5FECB 4P57A 4ONHB 2MFNA 3ABLB 3U82B 4YDNA 5DXWA 1M3JA 4Q8BA 1IQWL 1UM4H 4JFZL 3SE8H 4WRLA 3L4TA 5K59E 1IC4L 5C6WH 5IQ7L 1PG7L 2NY3D 4Z7UB 5ID0B 3J8F7 4YHZH 2N1KA 3QBTB 4KY2A 2YMXH 4WTZG 3HB3B 1B3IA 4LSPL 4XPGH 5TF1L 3HE6C 3ROOB 5FKAB 1VDGA 4YR6A 4WI4A 3FZUD 1ZV5A 2EJ1A 2RFXA 4DN3L 1AP2B 5EU6A 1NFIA 1NMAH 3AXLA 1XF1A 3B9DA 3MUY1 4LCUB 3MJ9H 3RLSA 4ZSOE 4RVBA 3KBPA 2X4QB 5C0AE 1JNNH 2VRQA 2K7QA 3WKQA 1IILE 2D8KA 1Q94A 2ZWNA 4JPSA 4MJID 3O4LE 4ANXA 4HOMA 3CLFH 3QB7C 4PGCA 3SE8L 1KPUB 3FTYA 4PJGF 3QZWB 4ODXB 5BOPA 2R51A 1MJ7H 4NPJA 2YMXL 2EICA 1ED3A 4XPGL 3BVWA 4NYLB 2XTLA 2HB0A 2D7NA 1IAKB 2EEFA 2DQFA 2V37A 3Q01A 4N0YL 5AUMA 5SWSE 1UWEH 3ECVA 4GRLA 3TN0B 1JNNL 2N7AA 1FNSH 1ICTA 4P59H 2X1OA 1RJCA 3ATEA 1U8OA 3QAQA 3T4AC 4NNYB 1OP5H 5GIRB 4H8PA 3O6KH 5ISZB 3VXRB 1MQKL 3CDZA 1A6TA 3EYFB 2ZX5A 3ZDXE 3GSQB 3DMMA 3QEQB 5JTWA 2ZCZA 3LEYL 4OBSA 2JWYA 5GHWH 2NXYC 3O11B 2W0PA 1R75A 3L4VA 3GZQA 1FUNA 3VRJA 5E23A 1JHLL 1BJMA 1UWEL 1E5AA 2C9PA 1ACZA 3O9WB 4K3DL 4K2UH 2DJ4A 1XB8A 3O6KL 5J3HC 3U7YH 1NAMB 1WIPA 2E8YA 2GI7A 4MB4A 3B7YA 1C7TA 4JKPH 2IBZY 1IIIA 2R7EA 4XCCL 1JV5A 3D0LA 2DYPB 4UAOC 2BCKB 3VFVB 2FLMA 1OCZB 5HHNB 2Y2WA 1U91B 4DP8X 1DZ0A 1KGCD 4LLAA 5C08E 2XA8H 4BZ1H 2C4FT 1P6AB 4K2UL 1YNTA 3T1FA 3UTZB 2KLRA 2Q7YA 2Y5TB 2FJGB 3U7YL 1ET8A 2CM5A 2WIIA 3K71B 1G9NL 2DMBA 2QDWA 12E8H 5KBPA 3EJZD 1JIBA 4DKDC 4DP4X 4A66A 5FYLD 1MWAA 3PGFH 1NFDB 2C1OA 3O45B 4JFPB 2K6ZA 1ZY9A 3SYCA 1NEZB 1YECH 2IQ9H 1TPXB 2EKJA 2PN5A 4QRPD 2AGJL 3ULVE 4JN1L 4EVNA 3U0PB 1E4XH 2EDTA 2W1NA 3N43F 5F7DA 4FABH 1Y0LB 1YAZA 2Z65C 5EZLA 4BFGA 4KKPA 12E8L 4Y2DD 1FZJB 1JZIA 3ZGIA 5A3IC 4YJZL 4RWHA 4YS4A 1DUYA 3MV8B 4WKZB 4C4KO 2ZXGA 3PGFL 2K4WA 1JRHI 1GPOH 2ROXA 5D7LB 3IRZA 2F9BT 4B7IA 2V2XA 2WWMC 3HA0A 3ZZSA 2O1AA 4ES8A 4B9JA 1VGKA 1QATA 1YECL 2Z9TA 4U2ZA 4H0IA 4PGBB 5HPMB 4FA8A 4Z7IA 1X5GA 3A4DA 1XCQB 3W56A 1Q9LB 5FM5M 1E4XL 3O3EB 2FWOA 3LHPL 6FABH 2PYED 4XO4A 2ZAIA 5D93B 2CU9A 2GYSA 5I71C 4LSDA 1AGDA 1G0DA 4WUUD 3PF2A 4MXWH 1J0HA 2CLZA 2ZKHL 5HHME 5KVEL 4NQCE 3K72A 3OKNA 3S96A 1GPOL 4NP4H 4F2EA 3WI9A 1R3KA 3KBEA 4UTAA 1L6ZA 1IGTA 3GTNA 4ALAL 4HWBH 3SSGA 4JUSA 5IQOA 2GJZB 4E9QA 1TR7A 2MKWA 3BUQA 3Q6FA 1WPCA 3F6JA 6FABL 3BGFB 5B39B 5DMGD 5MEQA 3SPJA 4QXUL 4AYFB 4EDWH 5C09B 4P2QB 1FO0B 5CBAA 3WMQA 5K9KB 2Y9RT 4X8JA 5ABAA 3ARQA 4IJ3B 3AWGA 2A4CA 4OZFG 1IUZA 1J9CT 4HD9A 4UM9B 4HX1B 2VLRE 1RCYA 1N26A 2BOCB 3N41F 4ODWB 5TJWK 4XP1H 1E9OB 1A4CA 1WITA 4ZMTA 2IAMB 1NFDF 1MFNA 4NZUL 4JRXA 2P5EA 4Y4HB 1YMME 2XN1A 4XP6L 5K1JA 1MCIA 2XXMB 4FMFA 1CB4A 4EDWL 3BRFA 3DO3A 3UAEA 5FDYA 2QEJA 2IANB 2W91A 3LZNA 5JYMA 4Z7NB 3WKPA 2BP8A 3JWDC 3WY3A 3UFIA 4YDVA 4F7PA 5BVPH 5MEOB 2IFFL 4ZX3A 3NIDF 1HYRC 5ESVB 9PCYA 1ECZA 3OAWA 1MJJA 4WW2A 1U8QB 3U6XS 1U8KA 4WHTB 4U1JA 2J8HA 1I7TB 2OYKA 1RXLA 4NO0B 3CU7A 4MHHG 4DOHB 1P7QA 3FC8A 2C3GA 2GJPA 3GRWA 5AVTB 4XN7A 5CP7A 1VJSA 5C0BE 2MEJB 4N2IA 1E2ZA 3ROLB 4W93A 5AAMA 3ME0B 2H1PH 1VGEH 4YH6A 2E7BA 2R1WB 2AZUA 2JJVA 5FGCE 4TUJA 1KEMH 2HRHA 3K6IA 3ZDYE 4NI6A 1FFOA 2CPUA 3B8YA 3APCA 5KOVC 3CSYB 1KGUA 4TQEL 5DRWA 2YPLB 3FQ1A 4QWWC 1MLBB 2AJUL 1S9WB 5EV7A 1NFKA 3K6SB 4ZS6D 1J1OH 1I7UA 3CZFB 4PY7B 3C09C 4JFFA 4H4NA 4AGMA 1YC7A 2EE6A 4MBRA 1GZPA 1CLZH 5EDSA 1OAYH 3SQOL 1NMBH 1KV3A 2V3DA 2XYCA 4W9GC 3SDXB 1ZS2A 3LKPB 3DRQA 1ZT7B 3RL1B 5KUKA 2VQ1A 1XF2A 2WBJA 1G7QB 3FULA 4YWGH 2WVVB 3KPRE 2BVOB 1HINH 3C5ZD 4I1RA 5I9QB 1E6JL 3VQLA 3S4SB 3QDJE 2YQ2A 4TNWK 1TTBA 4XNYH 3DA0A 3W9EB 4PRHA 3NIGB 2CUMA 4QRTB 4DUVA 2OL3A 4OZGE 4QOKD 4PCSA 1LMIA 5D72H 1OAYL 2EVGA 1NMBL 4OY9A 5DO2C 2I9TB 4RZKA 3RJDA 1KT2B 1A4KA 4HISA 5CHNA 3AG2B 3OSKA 4JPKH 4PV8B 4Y5YB 4A2EA 5B38B 4YWGL 4EUPA 2XSKA 1R9FA 1FP5A 3L5XL 1KCSL 3BAKA 5AVSB 4OCSL 3BPCA 5K9JH 1J9RA 2NXZD 1EQWA 3J07A 3PP4H 4WGVB 1NA8A 1CG9B 3TA3A 5JIMA 1DVTA 1CVSC 1J5IA 3ZPDA 3L3HA 3OZLA 2A38A 3MRMA 3UPCA 3S8GB 3SPGA 1EXUA 5I75B 3HBZA 4JPKL 4AL8C 3HI1A 3ISRA 1BDYA 3VXMB 4HXAH 4WJ5B 4UWQB 3L4CA 1N8ZA 2H32A 4PJXB 3D4YA 5ETUA 4ANWA 2R4SH 4N0CD 1HHIA 4KVCH 1UASA 1T0OA 2Z1PA 3C5SA 2BS71 2XACC 1NMCC 4H8WH 4OF8A 5F72S 1MRCL 5C2BL 4WWID 4P04A 3DVFA 2PWDA 4B53A 1G7PB 1F41A 3KLDA 3WJMA 4G7QB 2FJSA 5HHOE 2X1XR 3BESR 5FX3A 1LE9A 4W9EC 5AL0A 2BNRA 1L5GA 3DSFH 1SRDA 3BP7B 5I1KL 4ZFZB 2BIOA 5I17B 3ECUA 3G5ZA 2B5IB 4TL5A 5HVWA 5I6OA 2PLTA 4H8WL 4AVIA 2P80D 4PYGA 1ES0A 3O2VL 4MS8D 4PB0H 4EN3A 4J4PD 3CNKA 3NIGF 1KTRL 2LTQB 1IM9B 4N2FA 4F92B 2HXAA 3AVEA 1CXFA 1A6PA 5BZWA 3DSFL 2HVKA 1JHTA 4ELMA 4OD3H 1UG9A 2Q0ZX 3MA9H 3RKDD 3ZTNH 5B3JE 2P42B 2MPVA 3NZHL 5LCVA 5CKGA 1XTLA 4UQAA 1ACCA 3HE6A 3SE3A 2DIBA 3ETBF 3MRRB 3TBTA 3W81A 3MLPA 2YWYA 2V17H 2WWOA 3HIZA 4LARH 4M6NH 2B20A 4PB0L 3LKNA 5F9JB 7PCYA 1U92A 2P8LB 3TN0D 3P9LB 2DI9A 4H44C 2Z92B 3SEPA 3EJJX 3TF7C 3B3BA 3LVTA 4M8QB 5E9NA 2MOQA 3NJMA 1DEDA 3U0TA 4M7JH 4YDKH 4OZIB 3NCFB 1OO2A 2F5AH 5ISZD 3VXRD 1ASQA 4G6FD 2QSQA 3MA9L 3ILPB 3QNYA 3QEQD 4X7TB 2AXGB 1KNOB 3LOWA 2FAUA 5ACZA 1FBIH 2OMBA 3QUKB 2VT0A 2V17L 4Y2OA 4M6NL 4RAUB 4P2OB 2A83B 3TU6A 2DLGA 4Z5RB 1HHJB 2XWEA 3QUMA 2JKIS 4JMXA 3W0WE 5KG9B 2UXGA 3O9WD 2QPEB 3ULAB 3D8MA 1MCJA 3GRGA 3T4AA 1KCVL 1MI5B 5AZ2L 4UMSA 2PO6B 2HJKB 3WNLA 3LXCA 4KRMB 5DQJA 4PJ8B 5IHZA 4YEEA 3IJEA 2DYPD 3AM8C 3T4YA 3T0DA 1W80A 3LYRA 1T0NB 1YPZF 2HZHA 1OM3H 1ZGLM 2Y36H 3KLAB 4LBAA 1MCBA 3P2BA 3EOBA 2CIKB 3AS3A 4IS6A 4RESB 5JNYB 5LG6A 1XMWA 5C9KA 2E46A 5IQ9A 2I7OA 1A7QL 4PRIB 3U0WH 3NZ8A 1G9MH 1CICC 4LRIC 1T03H 1KCBA 1YEDB 2W92A 3A6CL 1BVKB 3QO1A 2ERJC 5F6IC 3HN5A 3L08A 4L5FH 1AR1C 4U1MA 3SDCB 3UZEC 5K9QI 4P5SA 5I8KL 1OM3L 2Y36L 3FRUA 7PAZA 1PAZA 4LLDB 1FFPA 2OZ4L 4R7XA 4F2FA 3O8XB 4Z7OF 2FB4L 5KYYA 1A14L 2BOBB 2JKLA 2W81C 2W0LA 3IDYC 4GNKB 4N0FB 3R4RA 3GGWA 5SWSA 1G9ML 3ABGA 4JM2C 4N5UA 3TWCL 4BH8A 3NFPA 1J8HD 4OZIF 1MCNA 1R0AH 4G3YL 1HKFA 4PJBA 4EZMA 2AJXH 5C70A 5D7LD 1Q8MA 3EDJA 4K7FB 3VRIB 3ZE0E 5DEZA 4GFXA 3LH9A 2WUBL 4LVOB 5J11C 1RUKL 2ZOOA 3L5HA 3E1ZA 1RUMH 3CZNA 2LHAA 1KB3A 5CUSH 4GOSA 3SPHA 2BVEA 3BVNA 3SOBL 3CFCH 2BFVL 3G08A 4BZ2L 1JWUB 2J56A 2OR8A 3PXHA 2ZG2A 1AGBB 3AG1B 4GUCA 3CIAA 4GRWE 2FATL 2Y7NA 3QH3B 2H3NB 2XN9A 4PJFA 1XF3B 3QYMA 5FM8A 1DLHA 3EOAA 5IFHL 2XJLA 2X41A 5I1DA 1MFDH 4YXKH 1PEWA 1XQ4A 3I2CL 1TZ8A 4M62L 5FUOH 2BLFA 3FUIA 3NDYE 3LPFA 1RUML 5CUSL 3INOA 2FBJH 5D6CA 2CLVA 3CFCL 1IGML 2QTVA 2AXFA 5BJTB 4N4YB 4K7PH 4LLMA 2EKSA 4PRBB 4P2QD 4J3SA 2WQ8A 5C09D 1FORL 3AJ7A 2YLKA 2QQNH 4KOBA 5TF0A 1J12A 1JZEA 3DO4A 2ZOTA 4UM9D 5CF3A 5IEHA 1ZHNB 3GLEA 3TIDB 1Q90A 4HPHA 4KJQD 3NSCA 4FJZA 5SV3A 5FUOL 3QHZL 3LPOA 1LO0H 4LLWA 1J0JA 4OIIH 4TNGA 1JF6A 1F6LL 4U6YA 2IAMD 2WBKA 3VD2A 2O93L 2YPVL 4Y4FB 4Y4HD 4M3HA 1BXXA 2BWDA 2BP3A 1LD9A 3FO2A 1FNEB 2AKRB 5CBEB 1UH3A 5J56B 4ICXA 4JZNA 2QQNL 4NZDA 5F7EL 4YPGB 5J13C 3ETBJ 3BD4A 4YBHA 1WHOA 1ET5A 2C1PA 1W6WA 2OMWA 1XH3A 3FO0L 2MTPA 2W9LA 2WJ5A 1RZQA 4HEPA 1UENA 4WFHD 4CU8A 2JKRM 1LO0L 1Y6MR 1YMHA 1UEYA 3LCYA 4CVZB 3PWPE 2ED9A 1HEZA 4DEPC 1OAKH 4OI8A 1HSAB 2M8XA 4FYTA 3LKRA 2OMTA 4LHJB 4AQEB 4UAHA 4RFNC 4NO0D 5GS1C 3DXAE 1UB5A 3U83A 2F08A 2A4ZA 4HCIA 3RDTB 4LCWE 3FDWA 3D5OF 4Z7WB 2VDMB 3D69B 3FBKA 4HJ0C 5D7SH 1EIBA 1SUHA 1ZTXE 2RALA 4JDZA 2NW3B 5IVZB 1FSKC 4L4TA 4YDJA 1KWKA 1DFBH 4IIQA 5E99L 2KZKA 5E5RB 4NQCA 3U7WH 1ZGLP 4YGVA 3H9HA 4MJHA 5FA4A 4QHMB 1LP9F 2X42A 2YO3A 2R69L 3SE6A 4GG6F 1HC1A 2YPLD 3OR6B 4N90E 3VGBA 5D7SL 1SLUA 2F7IA 5EORH 4TPRH 1KIQA 4KZDL 4OCNC 3IETA 1SXNA 1YEGH 2VW4A 2BSED 4IHOA 3BCDA 3Q2CA 1BQ5A 1BZDA 3A21A 4A63A 3WAJA 1Q9WB 3HRPA 2PR4H 3ZTJH 1LMKA 2QKIC 2VLRA 5KBMA 3F85A 1G1YA 3VGAC 3VW3H 3MRGA 2O6EA 4NLAA 1CL7H 5CGYD 1CYWA 4FFZA 1FZMA 5F1SA 3CSPA 1PZ2A 3VFWB 1PLGH 4MKMA 4NRYA 4R0LC 4JPWL 4DVBB 3QORC 4G6AD 1L9NA 1CTOA 3GJEB 5EORL 3ZK0A 1RIVH 1T1WA 1KIRA 1TQTA 1XO8A 3FFCA 4PJHE 4BHUI 3C6LA 5FCUH 3GUFA 3MRJA 2BIHA 3A22A 3WY2A 2DLHA 2QQQA 2WVUA 3DTDA 4IGBB 5DVOA 1WFTA 2NDFA 3CZGA 4XMPH 5FYJH 3VW3L 3CSBA 3ZR6A 1X5HA 5L7XH 5BVJB 1RD6A 1CL7L 4WWNA 4PWJA 4XNMB 2YSSB 3D18A 5DFTA 3NCYS 4MTMA 5CCGE 2VW6A 2Y6SD 4YVNA 1PLGL 1DVSA 1X4XA 1Y18B 5JYLA 1P53A 3NCCB 4XAKE 4IBUA 3TL5A 3EJSA 1TU2B 3DYOA 4M3KB 5DS8A 1E3FA 1OK0A 3W11C 3NVQA 5FCUL 2DJMA 1RP8A 3EFOA 1IEAA 4LKXA 3Q8EA 4PN6A 1IX2A 4MA1C 5FYJL 5EC1A 1E27B 4WU7A 5L7XL 2JJWA 2CGZA 1DVZA 3LQZB 3U6XA 4AUUA 1FI8C 3SKNA 4ZD3L 3VWKB 3NCWA 1DQLH 3KXFB 3MV9E 43C9A 1L0QA 4TTDC 1AAJA 2UVEA 3MRDA 3K1KC 4ZI8A 4D0BA 3EF7A 3ZT6A 5HHXH 3F64A 4JRYE 3DIFB 3MLTB 1OAQH 1HZHL 2XTJB 1A47A 4L9LC 5HVFB 2RQ8A 3K74B 2F53D 3KPOB 2XXCB 1DQLL 3F7QA 3T0VA 1RJYA 1F4HA 4ZFOB 3JUYA 1Z2KA 3OG4B 4JFEE 1EJOH 1MCDA 1QHPA 2WKOA 5DC2A 3FTVA 4BE5A 1INEH 1JDAA 1G0YR 2CO1A 2ENSA 2K9UA 3HG2A 3K46A 1UB6A 5D1QE 3LIZA 3VQ2C 4X80L 1BBDH 1LO4L 4LASL 1TQWA 1NLBH 1PX4A 2VDOB 5AVRB 4G7VH 3VACA 4E41B 3ZOAA 1NFAA 1WFIA 3QDJA 4R4BA 1IM9D 1I1FB 5DZLA 1SJHB 1VCBC 4FL4B 2VL5B 3VH8A 2YD9A 2WXFA 2DJSA 1EJOL 3QUYA 2FEDC 3O3BB 3QJZA 4H88H 3UTSE 1KELH 1MH5A 1PY4A 3C8KB 3O0RH 4R3SB 3BMVA 1QW9A 4EOWL 1BBDL 2XVBA 3FYEB 1NSNH 5GGSB 1JZ5A 1U30A 4FMKA 4B9FA 1R5IB 4G7VL 3S34H 4NQSB 4C8XA 3VXUE 5F6HJ 5I1GH 2BFGA 2FWUA 2LGNA 3VFGH 2XWBB 3POCA 4H88L 3GIVA 2E4TA 3LRSB 3HLKA 3FQNA 4WQOA 3IDMA 4YLQT 3QJSB 5GGVL 5BRZB 5IIEA 3CC5A 2G2PA 1WSST 2KYIA 4JFYA 2OP4L 4XBPB 4QRQA 3FQRA 1NSNL 1KBPA 3IXAA 4P2OD 1O6VA 2EABA 2WB7A 3S34L 4NT6A 5HDBB 3MRLB 4GAJH 1UXSA 3LV3B 3BC9A 2XVKA 1GGUA 4N26A 1CFBA 2X09A 3QPXH 3EO0B 5D1QC 1L3NA 2LR4A 1A9EA 3II1A 2GJ6E 4CGUB 5A2AA 5CGMA 1WFJA 4RQQA 3LY6A 4PJ8D 2VQTA 3T77B 3UBHA 4KVPA 4ZMQA 4OJFH 1BW8A 3RTLA 4ZT1A 1NJ9B 5HHOA 2V4LA 1GZHC 4LCCC 4G6KH 4GAJL 4O58H 4ZUUB 5D7IB 1N8OE 1OZTG 1SMAA 1K4DB 1XCTB 4LLUA 2ZWKA 1B0RB 3QIWA 4U1GB 1EHKB 3QXDB 3FU9A 1RJZA 2FQFA 3HI6H 3QPXL 2F8IA 4XMUA 4PREB 2AK4E 2AHIA 2PCPB 1VADB 5EZOH 3SDDB 3X1FA 4PRID 4XH2B 3UABA 3CX5J 5IFJA 2VE6A 5KS9B 1BD2B 2AEQH 1BLNB 5JHBA 4FOMA 3MJ6A 4ZX5A 3AM8A 3LNEA 1J87A 1A0QH 1J7VR 4AJ0A 2IH8A 3SDCD 4O58L 1HWWA 3AADB 3UTOA 4NUMA 3TLRA 5H4YA 3TYGH 2XZQH 3HS8A 2NQCA 2WXQA 1J10A 2DTML 4GKNB 3HUJE 4XRCA 5EZOL 1FL5A 1PX8A 3HR5A 4LSVH 1I8MA 1URZA 4AYEC 5ID1A 1R24B 2K7PA 2ILLA 1IVTA 4HF5H 1CICA 4FQQA 4LRIA 2C3VB 4AK1A 1QPXA 3FQYA 1V54B 3UZEA 3ILDA 4MZ2A 5KVFH 1DJXA 2P8PB 2ZKYA 3TYGL 1OF2B 3B9KB 2XPZA 4GQPH 5F3HA 4RAVB 3V9CA 5D4QA 4FXKC 5EU4A 3I02B 3U46B 3CQFA 5EOQH 2KQNA 3BEVA 3L4XA 1JMXA 3AG3B 3T3PE 4XPHL 4HF5L 4JM2A 2NY2B 4XVJH 2Q2LA 4MLIA 4B60A 3CDFA 4YSDA 5BW7C 2AV1A 2VSDA 4EIZC 2VKXA 1YN7B 3SD5A 1XZ0A 1DBMH 1DVFB 2C9QA 1J1XH 2NCEA 4HGMA 2NYZA 4PJEF 3VWJD 3GBLA 4OM0L 5J12C 4Y19E 2Z4TA 4E9YA 1X7QA 2KDYA 2X1QA 5D7IF 2DLFH 3UIZA 5ICYA 1TG8A 3RAJH 3VGEA 1U8PA 2PW1A 1ZWIB 2ISDA 5KSBB 2CKBB 5JXAH 1EZVX 3IFOB 4HKZA 4WW1A 9CGTA 4BK5C 2DKSA 3QQ4B 4TYUA 4J6IA 5FOBB 4XI5D 1ZD6A 4RX4D 4JZJC 3OB8A 1J1XL 2CKBL 3MU3A 3WUWB 1TVBA 4ZO6A 3I3BA 3IVKA 2NNXA 4L37B 4H0LC 3MODL 3CDGA 1YUKB 2HFEA 1ORQB 4PJ7B 5JHAA 4NWUH 3FCSA 3JV6A 2Q87A 1A5FL 4Y4FD 5D7EA 3RGHA 1E9QA 3RAJL 1DSYA 2R1YA 3KM2A 4X99A 2X4SA 5IW1A 1E5CA 5JXAL 5ESQA 1KB5H 3PDOB 1DANT 2OQJB 4OJEH 4R96B 2W07B 1QASA 3QWRD 2Z93B 5JPNC 3HZMA 4APQC 2NUPB 3NTCH 5GPRA 2IADA 3DVNA 3H53A 1WK0A 2BVQB 4H8QA 5F9WB 1P2CA 2J8UB 1U93A 2JB6A 3SHSA 2D9QB 2ODHA 4OZFH 2NRDA 1G7JA 1E0OB 2XG4B 4RRPM 1KJ2A 2LLLA 4NERA 4P46C 3Q0HA 2Z3FA 3H54A 4N2NA 4UZUA 2R2HB 3C6SA 3SDXE 1KXHA 1C08B 3D2UA 4ZG1A 1GS6X 1X9QA 5DJAA 3NTCL 5IHHA 4GRMA 3RNKB 5F3BA 3CFTA 4ELKA 4OQ1A 4XPFH 4YFLI 2VERN 1CK0L 4GQQA 2ZP0T 1UOLA 2H41A 5GS1A 2DIAA 2AITA 5HDQH 3ARGC 4KVNH 4DK5A 2DL9A 1N0LB 1JTOA 2VJ0A 4LEOB 5L4IA 1BFOA 3OJVC 1XBDA 2HRLA 3NESA 3WN5C 1QABA 5E0FA 1I1RA 5T1MA 3VDAA 1T21A 2ODIA 4FKHA 5FM4A 3P4OB 2X4UA 4OIAA 2JKXA 4BDVA 1UKSA 4LVEA 4XHJD 3ESNA 1TSRA 3SD2A 5SX5K 5I8OL 2DQMA 1BSIA 4KJWC 2MQ3A 1Q72H 4P2RA 5DJYB 2Z7YA 4POUB 2G3XA 3MX0A 5CIPH 3UYPB 1QYGH 5HDQL 3PFQA 4JY4B 2VNCA 2B59A 5C0DA 4LLYB 1JFHA 3OM3B 1PQZB 3MFFA 4M02A 1D5RA 1I9EA 3WOVA 2NY3C 3ZY7A 3MMEB 3LDBB 3N6YA 2WLNA 3UPAA 2YFOA 3WIHL 5IHBA 1DHKA 4F9PC 2V7HA 1XR8B 1P4BH 3FZUC 1XFPA 4NWTH 4JFVA 3WN6A 4CA4A 4YBLB 4IGBD 5JMRA 1Q72L 2OTUA 3EOYG 3WSQH 1VSCA 4FC3E 4HPOH 1OCOB 1MAMH 1QYGL 2F8VA 1QLRB 1UZ8A 2LFGA 2J8UF 2WLKA 4P4KC 4JHAL 1KGCE 4OU3A 1LGVA 4R0LA 1VAHA 4A2FA 1B3JA 2ICWB 3PWPA 2KZ1B 1KGWA 4HGWA 4JKKA 1TO4A 5FYJD 4EXPX 5E6SB 2J6WA 2H8PB 1HHHA 4JVUA 1VFBB 3SBQA 2YWZA 4JKMA 1DQIA 3ULSA 4YZFE 2ZUQC 2YEVB 1G5GA 4FE9A 4JE0A 2LQRA 1MAML 4PPTA 5HHVL 4JO4H 2D4FA 3VWKD 3KXFD 4PY8I 1AZRA 1IJ9A 4LPVA 4R7NB 4UDTA 3GSOB 1W16A 5A2CA 3QJQB 5TH2A 3D4GA 2GEQA 4G72B 4A2GA 3GKWH 1PZBA 2BPBA 2XTJD 4F7EB 1AKJD 2IGLA 4RDQF 1T3FB 4HC1A 3EYUH 2O5YH 5TFSH 4IKNA 3N04A 4JQXC 1CD1A 1GYVA 4AGLA 4DKEH 2LLNA 3VJ6B 4D0DA 2JMRA 2H2SD 3EH1A 5ILTH 3MV01 4WO0A 1TQBB 3C8HA 3MRIA 1GYWA 2RBLA 4HK3J 2ZP8A 3EFDH 1QNZH 3TYFB 3E8VA 2X2JA 3UTTB 4ZZFA 2PYEE 4HZ1A 2DM3A 1F4YH 3DBXB 5I0XA 3GKWL 3ZZQA 5AD0A 3PXJA 1BQHA 2RJMA 3RG1C 1KTLB 2BY1A 3CVHH 4X8CA 4L9LA 3GJFB 5HI5C 1OWRM 1KBKA 3IKCA 5DFAA 3V6FA 2LAGB 1WZMA 4ZMPA 3RZCB 4E41D 2CR6A 1E2WA 1Z0MA 4OFQA 4RZCB 5CJQL 2EYRB 3EHBD 4XMZA 5A7EA 4JY5H 5E6UB 1MXGA 5F9AC 5F7WC 2FJHB 1TFHA 2E47A 3EFFA 3EJZC 5B4MD 4U1HB 5BZZA 3ZTEA 1G9EA 3AMKA 3GIZL 2MCG1 3RWJA 3CVHL 2WCSA 2HH0L 3DDGA 1KDIA 1FAKT 2B0SH 3S48A 1NGZA 3I50L 4OCRL 1W72H 2QVTA 2VLKA 5GSRB 5E2JA 5LBVA 1SY6H 1PSKH 4N2KA 4XODA 1CFNA 4KFMA 5K9OB 4F8PA 4JLRA 4JY5L 1VCAA 3KYMA 5D71H 3OKEA 5BRQA 4Y2DC 3T2OA 1Y07A 2FZ3B 1ZAGA 2X87A 4NP9A 3RU8H 4X7FC 1W72B 5IB4A 2FL5B 4X4ZA 1NGWA 5BUPA 1DP0A 1ZVHA 4Q52A 3MV9A 3I6KA 1UA3A 4JO8A 4XCYA 1QI5A 2J21A 3LRLA 1M7DA 1I3VA 1W72L 1X5JA 1JI1A 2OMYA 4GXFA 5GRZA 5D8JH 4G9FE 1SDDA 1LK3H 1CFSA 4E9LA 5D71L 1R1CA 4JRYA 5K9QG 3RU8L 1M9WA 1SEBB 1ZA3A 4OZ4B 4LIQE 3LS5H 4FHBD 4CVUA 4KZEH 4TOYL 4ZTOH 4IKLA 2W0FA 1A7RH 1NCAL 3L6FA 4N87A 2XKNB 5ERWA 1AZUA 4KHTH 4U0RB 2YAQA 3P3TA 3P73B 2FT8A 3CCHB 1YG9A 3DOSB 5EEVA 1BZ8A 4HK0A 4JFEA 2ORBL 4NXSA 3KNBA 1C7SA 1OGAA 1JZ3A 1A9VA 1NBZB 3LSOA 3CD4A 1ZGLB 2UYLA 3PJNA 4HEPG 5D8JL 1GTFA 5HTSA 5JHDB 2VQ4A 3BDXA 1O7SA 5EUOB 4ZTPH 2KL6A 3AUVA 2RA1A 2CDGA 3SDDD 5HY9B 3HG1A 3LS5L 1AI1H 5BV7C 1A7RL 4KHTL 4HJEA 1BD2D 3ML8A 4MAYB 3AS0A 3BIKA 3JWNE 4O2EB 5INCA 1GZHA 5CR1A 4LCCA 2WTRA 4BKLB 1IBBA 5E70A 1E4WL 3KZ8A 1Z5LB 5HHQB 2GK0A 3VFOB 1R19A 5F7LB 4AH2B 1X5AA 3BGAA 3Q06A 5D7JA 3SGDH 2VR8A 4ZTPL 4TULL 4KNSA 5FAAA 1AI1L 4Z7VB 2ZX8A 1UCTA 1RERA 3PCYA 4XZ4A 4RDBA 5CJOL 3SKOA 2P5PA 3H7LA 5E6IA 1RZKC 3ARSA 1DE4B 1ZHLB 4KRPD 1IGJB 1YEJL 4Z3JA 4M6MH 3OXRB 2HAZA 2ZX6A 3SJVB 3B9KD 3SZKC 3ZHLA 3ARFB 3BO8A 4YLBA 3WIFB 4KK9D 2A9AA 2YEZA 4ODHH 1QEXA 5JOFA 4L3EA 4OGXH 1JYNA 2ZZUT 1OXYA 3DX7B 3ZE1B 5IMLA 3TCLA 3R19A 2NY2D 4QOKE 3ZRFC 4XWGH 3ECWA 3TBYB 4PHZA 4FFWD 1S7SA 4B9ZA 5A2JH 4M6ML 4ZW8A 4MNGB 4JZOB 3S97C 1RH8A 2MNUA 4K71C 1ACYH 3T0EC 5AKRA 2HJLA 3M6DA 1B2YA 3VFTA 1LEIB 4NM8L 4QYOB 4OF3A 4FXKA 3ARDB 2OMXB 1V7NH 4U31A 1Z5YD 3AW5A 5E8OB 4G7YH 1CLYL 2X44D 5FGRA 2BIMA 1YZZA 1X5MA 3R18A 3ZDZE 1CXEA 5FUCE 1BA9A 1AXTH 1DL7H 3QNXA 5EUOF 1CURA 1P4IL 1YVLA 2PCYA 3KD4A 4X4YB 5T5NF 1ACYL 3OX8A 1QI4A 4ZS6C 5E5UB 4XN1A 3DX8A 1EAOA 2IDSA 4IBZA 5DS1A 3CIQA 3U36A 2XWZA 4IKIA 3CSTA 4XN2A 4C4KT 4AQ1A 4M43L 3HLAA 4X5QA 2MKLC 3B7SA 4A6YA 3PG2A 4U6VH 1AXTL 4BK5A 2PCFA 3ERXA 2ICWJ 3PAUA 4HLJA 3C5ZC 3BKCL 4LFHD 4OVUA 4JZJA 1QLFA 2AQSA 4YFDB 3ARPA 4GAGH 4DQOH 3S3SA 2H3KA 4KK8D 1CBVH 4OSUL 4J1UB 2QSCL 1F1AA 3BIAX 4GLRI 4Z7UE 1BOGA 1IM3D 2TSAA 3X11A 4A7UA 1NGXA 3B3IA 3WMPA 2UWEE 5LGJB 4DGVH 2VITA 2BIPA 3VA2C 3WTXA 1NGYA 1TETL 5IK3B 3G5VB 4R7DA 5IB4B 3P40A 5B3SB 5E1AB 3ILQD 2NXZC 3OLIA 3MUJA 4XN9A 2WYIA 3ZE1F 3BGMB 5JPNA 1CXIA 4GAGL 2QHRH 4FTVA 4P49A 4WI0A 3W57A 4DQOL 2AJYH 3MLYH 5C0EA 3QQDA 4ZZKA 2ZTBA 3BWUC 3RA7H 1Y1UA 2EYTB 4FZEH 2OYLA 5FUCC 5GISH 4X6DF 1IC1A 1EDQA 5I1EH 5IEKB 3A6OA 5BZDB 4I8DA 1I8UA 4E9WA 4Y5VB 4YHPA 1T22B 3D25B 3MRBB 5DHVA 4EEEA 5IMMB 4JG0H 4PS4H 1Z5HA 4YNYB 4P46A 1PMYA 3UG5A 3G5YB 5LNEA 5I76B 1A21A 4XO8A 4Y19A 1W8EA 1RZPA 5AVUB 3VH8G 5ALCH 4F80A 3IGAA 3MLYL 3WNMA 1KLUB 3K91A 4HJGB 2R0WL 2IPTH 5ISZE 3VXRE 1Q9KB 4DN4L 3CXDH 2Z6FA 3FCTB 3UJJL 4U1KA 3QEQE 3W82A 2NNAA 4O00A 3D51A 4EI5B 2ARWA 1KG0A 4P05A 2IAAC 3TONA 3ARGA 2IWKA 5BO1H 1R3LA 3GS0A 4PS4L 1CD8A 1RFDH 5FK9B 2MCPL 3GHPA 3VD4A 1FAIH 3KPNA 3IFLH 4YL9A 3WN5A 5ALCL 2DI8A 5HHPA 4OCWL 1I8IB 3FB8A 4WI9A 3BHBB 2IPTL 3HB3C 1FYTB 4JDTL 1RI8A 3CXDL 5I2IA 4S1SL 4XVSH 1K3ZA 4MB1A 4MS8C 5IWLC 5DRNA 3BRDA 4D9LH 2J2ZB 3NGBB 1OT4A 4J4PC 4LOFA 2G9KA 4XMXA 1EO5A 3CC1A 5BO1L 1RFDL 3LKQA 4MA7H 4UOQA 4EQ2A 1J1PH 2AQQA 2BW4A 2RD0A 3VFRB 3ECBA 1UCBH 5JW4Q 1CMOA 3RKDC 1S5HA 2PKDA 4NO2A 4F9PA 2WVTA 1NFIB 1RL1A 1OOAA 3UBFA 4XVSL 1P84K 4A7TA 1UWXH 2P28B 2DWSA 2PUQT 4D9LL 1QNIA 4JE4B 5TQ0H 3TN0C 1MKFA 4PUBH 4EN2A 3DV6A 3LEVH 4K94H 4MJIA 3MDJA 4AJYV 2UY6A 1XD1A 5I74B 3ARBB 1J1PL 4P4KA 3FN0H 1UCBL 4OGAD 3BVUA 2HSIA 1EMTH 3CX5K 4PGEA 2DRUA 2DQFB 4K9EC 1L0PA 3OL2A 4J3OD 4FAAB 1JWMB 4ZW6A 2NYYD 5TQ0L 1J8HE 3SPVB 1JCVA 1MIEL 2X0WA 4PUBL 1J0YA 3TPUA 4UTBA 1KGJA 3LEVL 1UYWL 3O9WC 4K94L 5D7LE 4BFIB 2NY1B 4G8GB 4YBQD 2A6IB 5BQ7B 1NCDL 1A1NB 3FN0L 4J8RB 5J1AA 2BM3A 4XNXH 3EYVB 2H4EA 5DJCA 2VISB 1EMTL 3QISA 4QXTA 1NGPL 3HG5A 1B0GB 3K7UA 5IVXF 2Q6WB 3MBXL 1Z3RA 3MTXA 1F4WL 4O02A 2CA3A 2ZONA 3UTTD 3UXFA 5KVEE 4GBXB 1CTMA 3CQQA 2ZXCA 3FSAA 1T80A 2ZJSH 3LNHA 3SQRA 5IBUG 5JW4N 4HZLB 5EBWB 4RA3A 1IKFL 5E00A 1G9NC 2RACA 4PR5A 2WXNA 5I1LA 3RBSA 2BMKA 3HMXL 4JFDA 3RZCD 2BVTA 1SZNA 1U9KA 4QRUB 4U33A 2XPGA 5HDWA 1XB6A 3BD3A 4XVTL 2OK0H 1EA9C 1O9ZA 1GGCH 1N12A 4ZO9A 4TKWA 1MCQA 3QJHA 2OSWA 4Z95H 5DVNA 3KVPA 1R5VA 2Q3AA 3G6AB 4HS6A 3OGCA 1T20B 5C09E 3T2PA 4NPYB 3CHQA 1CN4A 1RLWA 1KYFA 1MWAH 4DIXA 3MBWB 4BRJA 3QJTB 1TPXC 2AAVA 4PBWD 1ZPUA 4J3UA 4R2GB 1YEIL 1F3RB 4W6YB 2DIJA 4L1HA 4G43A 1T83C 4ZNEA 1A9BB 2EDOA 4WNSA 1GGCL 3CN3A 4JN2B 4N1EA 1WISA 1L7TL 1ECYA 4ATTA 2E76C 3IWUA 5DEGB 2VXSH 3OJMB 2GUOA 4K5MA 2BCMA 3LZRA 5BS0D 4XPBH 3ZW3A 1QAWA 2LAAA 2X1WL 3D3VA 5F7YC 4Z7NE 3L7FA 3D07A 1D6EA 4QRPA 1HZKA 2QQKH 2OPCA 4WFHE 1CUOA 4NCC1 3KJ6H 5D93C 1AZZC 4K5LA 15C8H 1S6NA 4Y2DA 2CG9X 3CVCA 3CH1B 1SYVB 1U3NA 4ALAC 2CLRA 5EOTB 5C0JB 1M6OB 1VPOH 5I5JA 5F7HA 1AR2A 4WIQA 4QRSA 3LMJL 2N7BA 3IRCA 4G11A 4X0KB 2X5PA 3T6WA 4JG1H 5MEPA 3RQ3A 4TRPH 2B1HH 5FLUA 1N64H 4YHNA 2FT7A 4AKPA 4UTAH 3CSGA 1KC5H 3Q6GH 1AGDB 4OIBA 4F7MA 3KJ6L 3BGFC 4NENB 2PYEA 3REVA 4B5EA 3GUTA 1QW8A 4J3XA 3K72B 4WUUA 1AZNA 1HCFX 1G94A 2BHUA 4KKAD 4ZYKB 1I1YB 2IGTA 4OZHA 1DJZA 1VPOL 4IJ3C 4U1NA 1OTTD 3D87B 4J3VA 4MAYD 1QO3A 4KJQC 1P1ZA 5AYUH 1F3DJ 5HGAB 2VJXA 2HVBA 3FB7A 1ZLWK 3KR3H 1UXLA 1K2DA 5H37A 1N64L 3B2UD 2YPLE 2CO2A 3Q6GL 1J88A 1T1YB 2IAMC 4Y1AB 4GO9A 5TDPB 3V0DA 3DJSA 1E5BA 5HI3D 2J55A 4Y4HC 5TK2A 1KTCA 3IJ8A 4AXWB 3IMBA 1UZGA 2WLZA 2J8OA 4I85A 4LLQA 4P3WA 1PD6A 4TSCL 2YC1B 3AG4B 2VYRE 3FT4B 4M1CD 3ULUH 1L9TA 2WXGA 3CH8A 1ZS8B 4MJ6B 2PWHA 5AYUL 4X5WB 2BSTA 1E8WA 2GHZA 5KYUA 2XV3A 4ZMZA 5A6MA 1AGFB 4AYGA 4D9RD 1JNLH 4UQDA 2HA1A 2WMPB 1AO7B 1F00I 3RGVB 3Q2NA 5HYJB 3ARFD 5DVMA 1QKZH 1I9RH 1WCQA 1JRHH 6TAAA 1M1SA 2VXQA 4PJCB 2ARJB 2BP8B 4HKJA 1Q9OA 3U9WA 4W9HC 4ZMXA 5IBLC 1VEOA 1RZ7H 4N0UA 4NC2B 2SEBA 1H9VA 2UZYA 2OR9H 2JKJA 1GCYA 1L3WA 3GRWH 4XMTA 1JNLL 3KBFA 3P77A 3KEDA 4GW5B 1LK2A 3FRPG 2NSMA 3BE1H 4AEHL 1U8KB 3WHXA 1QKZL 3FUEA 1JRHL 4FNTA 5AALA 2XX0A 3ARDD 2XNAA 3WS6C 3EDEA 4L3CB 4Q58C 2HUEA 2VIRA 2GW5A 3G04B 4XGZB 5CP7B 5DUMH 3EGDB 4K4KA 1QPKA 1WEJH 5C0FB 3C2AL 1RZ7L 2FJUB 3J7HA 3MCLH 4P23B 2OR9L 3BSZA 1RZFL 1MREH 1EV2E 4N2LA 1XGTB 3BE1L 3PWUB 3Q7JA 3T0EA 2O5NA 4PJXE 4AOFA 4ZS7H 1T1XA 4XMKH 3U30B 3AACA 5F0JB 4ES9A 5GJTH 5FR3A 5GS0H 2WINA 2I85A 3VFMB 5B22A 4Y5XB 5CGYC 3U4EA 4MNHB 1WEJL 2GC4C 3DIDA 2I60L 1E67A 2XRAH 1S7XA 3MCLL 3W1ZA 2F53E 1FE8H 5I9QC 2NR6D 2EILB 1QLEH 2KPWA 3AQDA 1H6FA 5HYSA 1COBA 3FFOA 2ICES 4ZS7L 1A6WH 1CTNA 3SQBB 4J6RL 4DZBB 2GSGA 4AT6B 1EO8H 3FT3B 2VDNB 1VFAA 2VQ1B 2NZ9C 3ETTA 3FU7A 3K81A 1DQJB 2OL3H 5T1LB 4Y5YC 2XRAL 4FLQA 3FO1A 2Y6SC 5F71A 1GKOA 5HJGA 2VDNL 3C5ZA 1J0IA 4PJCF 3K0YA 4G5ZH 1SXCA 4EUPH 2YAOA 3EJRA 5T1DL 1A6WL 2X4NB 5C2UB 1EO8L 1BZ7B 1BXUA 5CHNB 2Z8SA 5E9DA 2OL3L 5DUBB 5CCKL 4UB0H 2IDFA 4O2CA 2MTAA 3V0FA 1INQB 5I75C 5TE7H 2N0KA 3KL5A 1CD0A 3S3DB 1DJYA 5E8EB 4G5ZL 5D5MB 4MZRA 3DX6B 3EH5B 4KI5D 2H32H 3MV7A 1I31A 1U4EA 1QHOA 4U1LB 3KPPA 3Q8CA 3FL7A 1JPGB 3NA4A 3U1QA 1WA1X 5E0QA 4HCRA 5B7EA 4UB0L 3V6OC 4WJKB 1A25A 5FFGA 4EBQH 3CVBA 4EI5D 4HUXB 2VDPB 5I0DA 1G7HB 1JPSL 2F7RA 1GZQA 3L7EA 3OKKB 4F58H 3QP3A 5IV2B 4HUVB 4PJIF 4UQEA 4X4XA 3L1EA 3E3QE 4Q0XL 4PH8A 2J4WL 2F74B 3SYOA 3M7OA 2VDPL 1HN1A 1LEGB 1E4HA 2B5IC 1F42A 1MXDA 1FYTD 3IMUA 1F0LA 4GP4B 1ZIBA 2ZXEB 4JQIA 3MVSA 3KGRA 2ADJB 4F58L 1F5WA 1FPTL 5FECA 2LTQC 4ONHA 4IBTA 4P9HL 1MRFH 4XMWA 3TJHD 3E0GA 4I18B 3PWJB 4YIQB 4DFHA 3OQRA 5ID0A 1SUJA 4HFWB 4Z7UA 4TL4A 1NKRA 3G6DL 5DMKA 3HKZA 3MOQA 3AAZB 3ROOA 5FKAA 3AWEA 1XXDC 3AXIA 5LCVH 3I9IA 5F88B 5IWLA 1AP2A 5FO7A 4LVNB 1KJ3H 1S5IH 1TJHH 4LCUA 4WEBL 1T4KB 1YYCA 1JDDA 2X4QA 5C7XH 4OLUH 2CBPA 4M03A 5E7FA 1NANI 3ARBD 4ZX4A 1KPUA 1A7PH 4JG5A 1YYLH 4AQAB 3QZWA 4F33B 5KYWA 4ODXA 4P5KB 3T0BA 4ZNCD 1TCMA 4YXLH 5D2NB 4NYLA 1XGRB 3L4ZA 3VYPA 1AMYA 3K6FA 1IAKA 4P2OC 1S4IA 1DN0B 1S5IL 1TJHL 4JM0A 3E3QC 3TN0A 2VLJB 1WVZA 2BVYA 4PCKA 4BFOA 5C7XL 1QP1A 4OLUL 3EUDA 4WU5B 3QUMH 3TH2T 3DMMD 3IJ7A 4NNYA 3RIAF 2D3NA 5GIRA 1YDPB 4CNIA 3VXRA 3VFPA 3GSQA 2M26A 2PO6C 1CU4H 3QEQA 4O51B 3B1TA 4YXLL 2JCCB 2W94A 3T8XB 2B1AH 4FLHA 4PJ8C 5EWIH 1O9WA 3O11A 3QUMB 4GBXD 3ZSSA 5DJZB 1Z9LA 1NOFA 2WQWA 3FUMA 4XX5A 4R97B 1VERA 2VO8A 2A6DB 3Q5OA 2CCVA 3GXIA 2F58H 3MRKB 3QUML 3O9WA 1G7MB 4GI8A 3UZVB 4WTWA 5E8NB 1WJ3A 1GGBH 1NAMA 3T6VA 3NG5A 2YJLA 3IJEB 1CU4L 5C0CB 4JJOA 4QXVA 3UJIH 3A5VA 2B1AL 5EWIL 1JPFB 5G4MA 3VXOB 3M1CA 4P3CH 2DYPA 4H13C 4ETQB 3I9AA 2BCKA 4GT0A 1WZLA 3SDCC 3VFVA 4ZUSB 5HHNA 5C6TH 3S36X 2F58L 2VDLB 2BVPB 1G9MC 4R2GD 3UTZA 5KW9H 2CCLA 4UOJA 3KPMB 1LILA 1GGBL 3K71A 3TEWA 1LLAA 3RFZB 4ISVA 4ZOAA 3GK8H 5FLVA 2VDLL 3TEUA 2NY7L 2ID5A 4U1MB 4I3RH 4XE5B 2JFCA 4N8VB 3DGGB 4P3CL 5FW8A 4AGQA 3HMWH 4RMTA 4PTUB 1NFDA 2R9HD 1KTKE 1TTGA 1Q0XH 1ZSDB 3FXIC 3O45A 1PY0A 4JFPA 5DD3H 4AYMC 5C6TL 3GM0A 4KNUA 1NEZA 4N5ED 4ZMAT 4LVOC 2EIDA 2CALA 3GTTA 4JVWA 3U0PA 1T83A 3T8MA 1DBJH 1AZVA 1Y0LA 3GK8L 2E6QA 3NK3A 1GGIH 1FZJA 4YSRA 2O4EA 4QEGA 3MV8A 3II2A 3QJFB 3DKHA 3AS2A 3HMWL 1ZV2A 4Y8AA 2ZXQA 3FT0A 1Q0XL 1Q0EA 5DD3L 4FLSA 3H4FA 1JWSA 1PF3A 2JCCF 5KJRL 5B7MA 4PGBA 5HPMA 2NUTB 1F13A 2FCBA 1XCQA 4Z7WE 2MNWA 1CLVA 3O3EA 1PIFA 1GYAA 1DBJL 1M7IB 3NRQA 3UP1A 4MS6A 3VSTA 1IAOB 5DDHB 5IKCA 2XWRA 4F1ZA 2G75B 4NKMB 2XVGA 4I48B 5CN2A 1KXTB 5HYFA 2XETA 4XI5C 5JW4R 2Y7LA 3SN6N 4H25B 1NUFA 1ZLVH 1P6FA 3VX1A 3K8KA 1FLTX 2ZUWA 3GPEA 2GJZA 3Q43A 2KT6A 5EEUA 1AE6L 4BELD 5B39A 3LRHA 4Y4FC 1OLZA 3OZ9L 4AYFA 1BOYA 4P2QA 1FO0A 5K9KA 1HI6B 1N59B 1ODAA 2VDRH 4Q89A 4OFKA 2V5SA 4Z0XB 5HD8D 4HX1A 5IHWA 4JBSA 4YDIH 8PAZA 4LLWB 5M7QA 1GOHA 2VZOA 2PWEA 1E9OA 2BY2A 3I84A 2P5ED 3MYJB 3CFMA 1DVXA 2V5TA 5ADPH 1UADC 3GJFK 3RGVD 2IAMA 5IFAH 1SN2A 5HYJD 3QYCA 1GYUA 3NCYP 4D0CB 1DQMH 4MASA 4Y4HA 4P07A 5CZXD 3ARXA 5G55A 5CZKA 1U8NB 3GINA 5DF0A 2VDRL 2IANA 5LUMA 4PQXA 1QRNB 2D2CC 2E6JA 1IKOP 3DECA 3RDTC 5CN1A 5GGQL 2H0JA 3OD3A 3LD8B 3HS9A 1DJSA 3TEYA 2RCSH 1BM7A 5IFAL 1WP6A 5ADPL 3MRHB 4CKVX 5MEOA 1A3LL 3EJUA 3NIFF 2IVFC 3GMOB 5ESVA 1DQML 5E4IA 5FYJE 3V4PB 1NCBL 1SLVA 3GDCA 1U8QA 4JR9H 2M83A 4LCVA 1UB5B 4WHTA 3L9RB 3V10A 1I7TA 4NO0A 5AAWC 2EVFA 3PHAA 3LRKA 3V4PL 4PP1D 4JDZB 4NZTH 2UUDH 2ZUXA 3RUGB 4P23D 2Y06H 2V8MA 4YDJB 1KBGH 3NUKA 3KXFE 3FTUA 2QSTA 4IIQB 5I8EB 3ROLA 4UT6A 1CFMA 1ZXQA 4DTGL 1RP9A 3ME0A 5IROD 2ITDB 4XHJC 1A3RL 1G5AA 2R1WA 4JR9L 1NTDA 4EXKA 1N19A 4I1NB 5LGHH 2FYYB 4PW9A 3WS6A 25C8H 1ZHBB 3TV3H 1SEQL 3VM5A 2QLVB 4D94A 3SBPA 1E7VA 2UY7B 2OX5B 2XTJE 1J11A 1OB1A 4NZTL 5LG1A 2YPLA 1ZDQA 3V95A 2LVEA 2Y06L 5IMKA 3ZMEA 1V3KA 4FFZH 1BQUA 1ZLEA 1TQCB 2FX7L 1KXVC 1MLBA 4W4OA 4JFFD 3DRTB 1S9WA 5AG9A 3K6SA 4YQXL 2CO4A 3CZFA 2B15A 4LOVA 4PY7A 1GRWA 3L95B 1USQA 3OJDB 4UQBA 4IGBC 2EAEA 2RMNA 1NC4B 3RWIB 1WZAA 5T33H 25C8L 4M9OA 4PCYA 2DLEA 3PDGA 3LKPA 2YD4A 4BJLA 1ZT7A 3JXAA 3RL1A 1G7QA 5KAQF 1PCSA 2WVVA 2BVOA 3BN9C 1JF5A 1U8LA 1ZEAL 3C6LB 4TVPL 4KXCA 1A2YB 4PRHD 3NYKA 4ZPVB 1N2RB 4JDVA 3S4SA 4KHXH 1FZKB 3W9EA 2GJRA 3CV5A 1OP3H 1JUFB 5HDLA 2EVIA 4X6CF 3WTUA 1XF4B 3KWXA 1KT2A 3VWKC 4PV8A 4Y5YA 5B38A 2BSSB 2CSPA 5DJDA 3RY6C 5IHLB 1MNNA 1GGTA 1AY1H 4KHXL 3KWVA 1ZE3C 4W9KC 3CSFA 1CG9A 1J9QA 2R2EB 3RUGF 5I0ZA 3RWFB 2V2TA 2AQ2A 2XTJC 3SKNB 3VFSA 3JV4B 1A6ZB 4JQVC 4X9IA 5EEXA 3PP3K 1HQ4A 2H6UA 1VZIA 2YGVA 3FN3A 4ZBJA 3KGTA 1KFAH 2H2SC 3VXMA 4YHYB 5CLWA 5FYKU 4WJ5A 5HDBE 4AL8H 1KCWA 4ABVA 1JGUH 2Y7OA 1F1DA 4Y16B 5C71A 1UWGH 4WEUD 1X5LA 2CWRA 1MCPH 5KSVB 5LVEA 5C3TA 1S7UB 1Z9SB 1OSEA 1WA2X 4WHYH 3LIZH 2V7NB 1G7PA 3V6OA 4FA6A 1MCSA 4RMSA 5I30L 3QULB 5EBGA 1LHZA 4KRLB 3LH2H 1ETZB 1KFAL 2R59A 4FL4C 4I0PB 1SLWA 2OMVB 3ZL4H 4V2BA 3U9UB 4AL8L 1JGUL 1XVSA 2E86A 2X9YA 3B5GA 3BP7A 5GRWA 3QFGA 1UB6B 3FMGL 4ZFZA 4OFYA 4PJDE 2YPKB 5I17A 4R4FH 5B4MC 1MCPL 1GW6A 1UJ3B 4ZPTB 4OF0A 3HJ0A 3RWDB 2ICEA 1WT5A 3V5KB 4ACTA 1ZLUH 1O0VA 3B8SA 4IMLB 5KS9E 1BD2E 1CDYA 1PIGA 2FBOJ 3GO1H 4KV5F 1IM9A 3LH2L 3SO3B 4ZW5A 3ZL4L 1IBDA 3EAKA 4QTIL 3WAKA 3BKYH 2G5RA 2J6EA 5D70L 1VRSA 3HZ3A 5AW7B 3WNPA 1FC2D 5ADOH 4HD5A 5IQNA 4P4RB 4DO5A 2FUTA 4HMDA 4UIKH 5J9PB 2NZ1A 3UJTH 3PJSB 4LZKA 2CD0A 3JYCA 3MRRA 5F9JA 1A6VH 5IB1B 1U2CA 2GHWB 4X8XA 2P8LA 4OFVA 3P9LA 2VLJD 2Z92A 3BZ5A 1FN4B 1QUPA 1ITCA 1DQDH 4M8QA 3RVVC 3W2DL 3W9DB 3EDKA 5H37G 3VXQB 4OZIA 4WDIB 4QHNA 2X9XA 1P4UA 2ZD0A 3GZPA 4MVBC 5ADOL 3THMH 4HJIA 3WO4B 2P52A 3ILPA 5DT1H 3T65B 3FQRB 1T5WB 4X7TA 3P4LA 1KNOA 4UIKL 2Y25A 5H94B 3WFEH 2RH0A 2VMDA 2R29L 4NT6B 3HBPA 4XP9L 3QUKA 4NUPA 1PZ3A 4RAUA 4V1DB 2A83A 4Z5RA 2J12B 1HHJA 5F6HI 3UC0H 1DSFH 4YL4A 4TSBL 3OKLB 4JY6B 1DQDL 5KG9A 4FNQA 4U1GC 3BFQG 4JO3L 4B96A 3S8FB 1CC3A 1A9EB 5KYXB 1MI5A 3GMQB 1F2XK 3HZKB 2CQVA 4FFTA 1OSPH 2PO6A 2HJKA 3BXNB 3SDDC 4FCAA 3S8WA 3KL0A 1JPST 4G1MB 1BG1A 4PJ8A 2R39A 3TO4B 1U8IB 3FSVA 4HUNB 4MXVE 5DJ0B 5KSBE 3QIWB 1DSFL 4OB5H 5TGBB 4ACPA 1IEBB 1T0NA 2V3FA 2MWCA 2VR5A 1JGIA 3CX2A 4I7ZC 1YEWA 4DERA 1NICA 3KLAA 2J1XA 1QSEA 4PJ9B 4N1HB 4QO1B 4C56B 1FNFA 5IFJB 1RSYA 3BAXA 4PS3A 5DQ9B 4LRNH 4NQUA 3GYRA 3T0AA 2PPEA 4PJ7E 4PRIA 4MBOA 4NQDB 1JNJA 4RNRB 1PZ5B 2PWGA 3TJPA 1YEDA 1UUNA 2OMUB 1LNUA 2XQ0A 4Y9BA 1BVKA 4FQIH 3TBCA 5F8QC 2OZ4A 4N22A 1CGUA 2P1YA 4OB5L 5EZIH 2E75C 4ZMNA 2CO7B 4Y4KB 3B9KC 4Y8DC 1F90H 4JVPA 5KZCB 5K5YA 3GSXA 4LLDA 1FL5B 1I8MB 4KK9C 3O8XA 5ID1B 1UZ6E 3BUPA 1JXGA 3V0WH 1T5KA 2BOBA 2BSRB 2CJUL 2MMXA 4N0FA 2X70B 2Y1VA 4L4VA 2GTWB 2DH2A 1SOXA 3UDWC 4EMZA 2NY2C 1QZNA 5AZEH 3TT1L 4FQIL 4FFWC 3BYTA 5LQBH 4HMEA 1H3GA 2C8NA 4PJAB 3SBRA 4BH7B 1IGIH 1DVFC 3PL6B 4QR7A 1GSKA 3VRIA 3P4NB 4LCIH 4BZ2A 3OZKA 1H19A 5CZVH 4OV6F 4U6XB 1GMEA 2YD1A 4UV7L 3T1WA 3V0WL 5HYSG 2AJSL 1M1XB 1JWUA 1OAZL 2X38A 2G5BB 2WPGA 1AGBA 4UINL 2R2CA 3QH3A 2WWMD 1XF3A 2CZNA 4HZAA 2ZOLB 5E1IA 2A77H 1FGVL 5C0ND 3RVUD 4LCIL 4KPHH 4ZDHB 3MREB 2EDNA 3MR9B 4UZGA 4R7VA 5ICYB 3DO7B 2IO5A 4FG6D 3R0MA 4I87A 3QDHA 1LP9A 5D2LB 2YN5A 5BJTA 1SM3H 3OKMB 2B7DT 3BRGC 1JK8B 3IN2A 4PEEA 1W0WB 2X10A 4PRBA 1LDPH 3MOAH 1WAAE 3OWRA 3C5JB 4N2EA 1ZHNA 2A77L 4RX4A 3M1OA 2J1ZA 3TIDA 4UDUB 4KPHL 2YPVA 3TH4T 2KI6A 3CDGB 4QTFA 4KK8C 4F8TA 3V8CA 1LL1A 1E9QB 3IDIB 1SM3L 1A4JA 3DX4A 3H1ZA 1PBYA 2CPCA 1EVTC 2AKRA 5CBEA 4RWYH 4AC4A 3MOAL 1NWOA 4ENZA 2CGRL 4YPGA 1J5DA 2WYTA 3HZMB 2Y1ZA 1B2WH 3T3MF 1JMZA 4OGYL 3EO9H 1BJ1H 4EAEA 1KN2L 1KJ2H 5DK3A 3VB8A 2VC2B 3E1F1 4JFXB 1IIKA 3OMNB 3PGCB 1YO4A 3VSVA 4HIQA 1ILUA 2X28A 2VC2L 4AQEA 5JA9A 1N4XL 4K3HA 1KJ2B 5CJXA 1F3JB 3EDDA 4CN1A 1AGCB 1BIIB 1RURH 3ARRA 3C6SB 4F2ME 2Q3XA 4KMTL 5E2VH 3RDTA 3KE0A 3S37H 4NQEB 2XY1A 5IB5B 3U1SL 3ZKXB 4L4TD 3BEWB 3PJLA 1KJ2L 4GRMB 4Z7WA 3D69A 3KH3A 5IVZA 4ELKB 1KWGA 2MCMA 2NW3A 4JPIA 1MIMH 4NQQA 2L7EA 1EZSA 3NJFA 2X3AA 4UOW0 4G82A 2R69A 1R33A 1SBSL 4JJ5B 1H8NA 3LZFH 4L9DA 4EI0A 5BOZG 4G7SB 5AAWA 4S11A 5T1JA 1E4JA 4QHMA 1F8TL 1RURL 3QO0B 5D2LF 2DQTH 2X88A 3NH7L 5E2VL 3SYPA 3WTSA 1PAMA 1DJIA 4Y7OC 4CGTA 3OR6A 3IFPB 2Q7NA 4JGMA 4OF7A 1D6VL 4WTXA 5DZ9A 2KLTA 2YMOA 1AYRA 3LDBC 4L3AA 5AKVA 1NCIA 1KN4H 3QZWG 2FJFB 1W0VA 3ALPA 3I9PA 1X9RA 3Q1SH 7CGTA 2X0UA 2AC0A 1RVFH 4KGJA 1JYXA 5K93A 4LDOB 4YBLC 4QXGH 1Q9WA 3UTTE 1QWHA 1HOCB 3W5NA 2D2OA 4HUMB 1KZYA 4TVPD 4ZOBA 4YSOA 4QKXB 2DQTL 3QUXB 4K55A 4QWWD 3VFWA 2J44A 3NJKA 5TDOA 1AGEB 3NFNB 3FFCD 4OJDH 1PFCA 1IC5L 4DVBA 3C6LD 1W8OA 4QHUB 3FCBA 3GJEA 1KN4L 4MMYA 1L0YA 3Q1SL 1ASOA 4Z6AT 1U21A 3QNZB 2XFXB 4QI3A 1WGVA 4QXGL 4EZJA 3MBEB 4HVBA 3IJHB 1O7DE 1WWCA 5BXFB 1M2OA 3IPEA 2MCAA 2OW7A 5BVJA 3FQTB 2HRPH 1ZV9A 1OV8A 2DICA 2R0KL 2YSSA 3G6JE 4XNMA 5GRYA 2HN7B 2Q8AH 1Y18A 5CEZH 1XF5B 2E27H 2TRHA 1ZTXH 2YZ1A 1TU2A 5EZPA 3DHJA 4YHIB 2R0LH 4HSAC 5DGRA 4UU9B 4J3OC 5DO2D 3BQVA 1D9KB 3BAYA 2NYYC 4M93B 3NACH 1E27A 2V8LA 2Y22A 1WIOA 3CHXA 3LQZA 3S5YA 1YN6B 4BFRA 1UT1A 5DZNA 4NS0A 4AY0A 5BS0E 3VWKA 1MJUH 4YBQC 4PRNB 3KXFA 5DU7A 4HC1H 2X7LA 2NX5B 2Q8AL 2AQPA 3RY6A 3UC2A 2WO4A 1CE1H 1TQBC 4CADB 5AB2A 3QARA 4Y16D 1HILA 5I5MA 1TXKA 1UT9A 1I9JH 5KBKA 3DIFA 4FFVD 3MLTA 5DWUH 4QUOA 3QUHA 4O2FB 5D1XB 2R83A 1XV8A 1ZANH 4JQVA 3KPOA 2W88A 1XH1A 2YAFA 3RZCC 4CN4A 4NO3B 4HC1L 4ZFOA 1NEZG 1EAPB 1MRDH 1CE1L 3QXVA 4XB8A 1U3ZA 4G71B 5ECJE 3WENA 2I26N 1P1VA 4WENB 4A55A 4CDHA 1BQHB 2LU7A 1O7DC 3LKOA 5E8DH 4X6FB 4F5CE 2ZXDA 1MELA 3BPNB 1AQHA 2X1PA 1T7WA 4XNUH 5DJXB 2WV3A 4E41A 1TUPA 3QUYD 4ZRGA 4FI6A 1CFQB 1JZGA 3IGFA 1I1FA 3ZN6A 1DVYA 1MRDL 2VL5A 4OFPA 5FHAH 3GLZA 3EFFB 4W6WB 3O3BA 3Q5YA 4YSPA 2VXVH 2GY5A 2EXYD 3BZDA 5E8DL 4AGPA 2YGOA 3S5LB 4BM7A 3PXLA 1OPOA 2YKKA 3C8KA 4R3SA 3VE0B 3M45A 1CFVH 4GW1B 4Z7VE 5GGSA 3HC3H 2E3VA 4XNUL 3NOIA 3S88L 3AT0A 4YHKL 4NQSA 2VOTA 4JLRB 1PEZA 1Z32X 1PTZA 2J7LA 2XWBA 2ADIB 4D9RE 1B88A 4TUOB 5DVLA 4OLZH 5BRZA 4LP8A 3PS6A 5B39G 4WUKH 2QDVA 1DBKH 2I69A 3L8QA 5I82A 4F9LA 2EH7H 2ZKMX 4U0RC 4XBPA 1M7DB 3QWQB 1KMGA 1CJYA 3HC3L 4V1DD 4LDEB 4FNLH 3SKMB 3MRLA 4BGLA 3PHOB 2X4RB 3LV3A 5FW7A 3X3GH 1RKRA 3B2VH 3OAZK 3VI3F 1FIGL 2CHXA 3EO0A 3BI9X 2DWDB 2DTSA 5ERWB 4TUKL 4WUKL 4KKAC 2GFBA 1DBKL 1DUZB 2F54A 2EH7L 1QFWI 3T77A 3MLWH 1ID5I 3TO4D 2QGCA 3NSXA 4I2XB 4PJEA 3ZKMD 4AMKH 4MAYC 4CBPA 2WZPD 3QZOA 3QIWD 3LSOB 4FNLL 5D96B 3JT0A 3D34A 4ZUUA 5D7IA 4F57L 1K4DA 1VF5C 1XCTA 3B2UC 3X3GL 1B0RA 5FGSA 1JZ8A 1NBVH 3QXDA 1FHNA 5DUPL 2WYHA 5HI3C 4PVBA 4RFOH 3HG1B 3KGUA 1HQRB 4C56D 1ADQA 2X2HA 4JL1A 4PREA 2PCPA 1VADA 4M7ZB 4AIOA 4PMEA 3SDDA 5FF6B 3UOAB 4M1CC 5H4ZA 2VZUA 3MLWL 1BD2A 1BLNA 2W65B 3WEAA 4KQ3L 2K8MA 3EBIA 3GM8A 2Q10A 1MHHA 4U05A 4AYSA 5D7JB 4Y4KD 4P2YA 4NUGL 5TPWH 1DLFH 1NBVL 3ARFC 3C6EA 3FH8A 4AW4A 4LCYB 4QT5B 2XU9A 3GTVA 4GKNA 4LMQE 4PAZA 4BK8A 1CICD 5E6IB 3DTXB 1ETJA 1T04B 2JKWA 1KENH 1R24A 4Q9BA 3AXHA 3STLB 1AR1D 2C3VA 4QPEA 4GG8B 1C9SA 1VKXA 4C83B 3QZPA 2FE0A 2KMWA 1MJ8H 1MCOL 1RUQH 2P8PA 4OI9A 5B3NA 2D03L 3F7PC 3L3DB 1OF2A 3B9KA 5BO0D 4MQXC 5TPWL 1DLFL 2EDEA 4YVUA 3P3SA 4GFTB 4RMVA 4UUJB 4LHUB 1PKQE 2FD6L 4MAUL 1G1KA 1IRAY 2CIIB 3ARDC 4JM2D 1FYHB 4XPAH 2F68X 3U46A 4DGIL 1KENL 2FH8A 3S3CB 4R8WL 3UDWA 4Z7QB 1XSJA 3KPQB 3NEEA 3MLXL 2E59A 2GAZB 4A7GF 2YGPA 1FRGH 4FYSA 4WSKA 4LNVA