4KUCF

Crystal structure of ricin-a chain in complex with the antibody 6c2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
QQPGSELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPGSGRTNYDEKFKNKATLTVDTSSSTVYIQVSSLTSEDAAVFYCVRWVYGNFDSALDYWGQGTSVTVSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ricin
publication title Structural insights into the neutralization mechanism of mAb 6C2 against ricin
rcsb
source organism Ricinus communis
total genus 18
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kucF00
2O5ZL 3EO1A 3T0EB 4KGJA 4PJ5A 1L7TL 4LLWB 3HFMH 5EG6C 1PX4A 2XN9D 3PXHA 2EXYD 4Y4KC 3VGAB 4NM4H 5T3XL 4X5WA 2NZ9C 4MGXA 4H8WH 4X5LA 5D6DC 3ZL4L 4I18B 4NJAH 5C3LD 1HSAB 1Y6KR 4UT9H 1Q1JH 3BH9B 5DURD 3G5YA 4PJFA 2AJ3A 3CFDB 4UIKL 3SKOB 1EFXB 1B6DA 4Y2DD 2V5SA 4F3FB 5E5UB 4N0YL 2OL3L 3QNXB 1IGIL 4UU9B 3EUUA 1RZ8B 4QRQB 5CWSB 3MRRB 2HA1A 1OP3H 3LRSA 3C8DA 3CFIC 2EDFA 3F7VB 4XXCA 1U36A 4WWKB 2VSCA 4RGNE 2YEZB 3B9AA 3AY4A 2OTUB 1QSEE 2V7HA 3RI5F 3X12B 5J8OA 5DMGD 4NQEA 1NBYB 4D0BA 3GFUA 1DQTA 1J5OH 3O6LL 1D5BA 4PGJA 5KAQG 2XZZA 2JCCA 1YQ2A 4M6OL 1BD2D 1AIFA 2HT3C 4GMTH 4D0CB 3RUGA 5I1DA 2C7UA 1B0RB 2J1KA 3QFDA 3HI5H 5KSAD 1QSEB 5FO9B 3N1FC 4JFFD 2NY2D 3TCLA 4TVPE 4GRWH 5I1CL 1MLCA 1QFUH 3SDAD 5C70A 5KSVA 4F8TA 1P6AB 2DJ4A 5IFAH 4U1SB 4E41D 4J3UA 5ETUB 5IESH 1G7LB 3O11A 5CMAA 3QG6A 3MOBH 4GAGL 4QRPA 2VQ1B 5HDOA 1J1PH 1FSKB 1ZHNB 4UTAH 1S7SB 4TTDD 2NLJA 4BZ2L 3BKMH 4LSVL 1FBIH 5TQ2L 2OI9B 1CDYA 2ICWI 2LU3A 3QUYD 1VPOL 3MCKB 4I77L 1A6ZA 4ISVB 3PHOB 1E4KC 4TUOB 4Y19E 3IETB 4BFIB 5CP7A 2WINA 1CFNB 2CLRB 3CMOH 5A16A 1DUYA 4M93C 1ZE3C 5GGVY 1UJ3A 5F7WC 1RUKH 2IQAB 3SGKA 1NEZG 4OI7A 2FBOJ 4GRLA 2WZPD 5J6HA 1AHWA 3D48R 3QSKB 1DCLA 5E6IA 2VXVL 4Y19B 2Z31D 3VH8G 5HYSG 5HDQL 3L95A 1TZGL 4RX4A 5H37H 4F7MB 5CIPH 3HUJE 3PABA 1EHLL 1N6UA 3GSNB 3HZVA 5FUZL 4LCUB 3DURA 4E5XB 3EOTH 3MRJB 1U95A 3ZE0F 3T0WA 1TETL 5FYKD 2H2PD 5FCUH 1DBJH 2UUDH 4FQIL 2BMKB 1U3HC 1YC7A 1GSMA 1FO0A 1BWWA 3FRPA 1MELA 2BY3A 3MGOB 5DFWH 2VKWA 5IF0B 2Z93B 1NDMA 1C5CH 2V2WB 1IKFH 4I2XE 4PYGA 1G6RL 1IAOB 1QTYT 3F7QA 4PRBA 3CSPA 3QDGE 5TF1H 3O8XB 3FOLA 2QHLA 4WI2A 3R1GL 2PKDA 2WLZA 1WAAA 4RQQB 1XGUA 5F1KC 4RMUA 3TZVA 4L4TD 4DWHA 4U1MB 3V6ZB 4PJ8A 2O5XH 5ID0B 5EIVA 2FECI 1HHKB 4GW5A 3QEUB 4A6YB 5HHMD 2VLRD 3GHEH 5DMKB 1FCCA 1WGOA 2ZSVB 4JHAL 3VGDA 3QDGB 3BRDA 3AB0C 3QPQC 3P73A 3THMH 3BWAA 3QIBB 5F89A 1VCAA 2VR5A 4PY7B 3JUZA 3MLZH 5KW9H 4BYHA 1DN2A 1MCRA 3GKWL 1OARL 2PO6B 2VITB 5E5RB 2WNGA 2HLFC 4MMZC 4HS3A 4JO4L 5DMIH 4PLNC 1UXWA 2R2HB 4MQ7A 2A6JB 4G6FD 1IM9B 3PNWA 2C3WA 1LD9A 2MQ3A 1PKQE 1JZ5A 2H32H 1T7YA 4MQXC 3VXUA 3HMWL 1KXVC 3PF2A 4HWUA 4XI5C 3C6LA 2VXUL 3U1SL 4XP4H 5DVLA 1K4CA 4R0LC 4XC1H 2F58L 3SE9L 1F6LL 5F7DB 1QO3B 1FH5L 3NCFB 3F5WA 4XPTL 2FX8L 3KJ4B 2N4IA 3DUUB 3G6AA 1HILA 2FGWL 4EKXA 5CHNA 3W5NA 1PKQB 2D31A 1BQHG 1NGQL 4RMTA 1Q9WB 4B0MM 4PJ5D 4ZUTB 1LP9B 2ICCA 5CJ8A 2UZIL 1UM5L 2P8MB 1CICC 4YEFA 4N0YH 1Z9MA 4LF3B 1CK0L 4X6CE 1IGIH 3MLYL 3RWGA 3KLHC 2B1AL 1NCUA 2XQYG 3ZKMC 3O6KL 3KWWA 1P7KA 2WW8A 1F8TH 5IMKA 3HRZB 4LPYA 3NTCL 1A1NA 2JJUA 3RRQA 4QXTA 4M7KL 1A3RH 2VZ3A 4K3EL 4KKLD 4EN3A 5E99L 5BZDB 2VIRA 1KJMB 1CTOA 4X4ZA 1I1AC 2GCYB 4MLSA 1BP3B 4X6CB 5BW7A 5IG7A 1DBML 1P4LA 4XZUA 2FJHB 5HHNB 1DQLL 2AEIT 5ERWB 3KYAA 3KPPB 4HKXB 4QTHA 4ZD3L 5LGHH 1FIEA 2XKUA 3BE1H 5H35A 4OSUH 2X4TB 4UINL 5I30L 3K8LA 4YWGL 1OGAE 3MOAL 4OQTL 4JRXA 1NSNL 4NN5C 5I1CH 4OCSL 1F42A 4KDTC 3OJMB 3WS3A 1MCKA 1HHJB 3G6JE 5GRUL 1KG0B 3RBGA 4AIXA 5C8JA 4YHKH 2Y07L 2XWTB 4U3XA 1NEZB 2YPLE 4P4KD 5BVJB 4QF1B 5KVMC 4HIEB 3Q6FA 1CFVL 4M1GL 5DS8A 3VH8B 1VFOA 5HYSB 5EOTB 3WXWL 4U05A 4LCCA 2NY3B 2FEEI 3DGGA 4P2OB 1MWAB 4LSVH 1KCKA 2ADIA 1BPVA 1JPFB 4YBLB 3IDYC 3F6LA 5IBLD 3G6JB 3MYJB 1MJ7H 5CILL 1CBVH 2ENYA 3WN5C 4N0UA 5HYJD 5TDOA 2ZPKL 2YPLB 5IP4A 1EERB 1JCKA 3WHXB 1S9VB 1T66D 4U6XA 5IEKB 2FO4A 3GBLA 5DWUL 2PW1B 1JRHL 4HUKB 4L4VE 4YHNA 5D1XB 3HE7A 3JXAA 5JHDD 3VWJB 5BS0D 4HKBB 1GHFH 4YPGB 3G08A 2LE9A 3MRIA 3OKEB 3QG7L 3EAKA 1E0OB 3DO7A 3B2VL 5BXFA 2CRZA 1I7RB 1Z6JT 4OZGE 3U0PB 1KIRA 4Q0XH 4X6DF 4P46C 1F11A 2Z92A 1TZGH 2QHRH 2DLTA 1KOAA 4MD4A 5FUZH 3X3FL 2PR4H 2VXSL 3MRQA 1UADC 2X9XA 1F4XH 4L4VB 1A6WL 1ZGLM 2EYRB 1I9IH 5DK2B 4OGXL 3SKJL 3OXSA 4HJJH 4WFFE 1T2XA 3ETBF 2XACC 4P2RB 1EJOH 2ICWB 3ZKXB 5I73C 4P23C 1FZOB 5IBUG 4JQIL 1CLYL 1QSFE 4CVXB 3B83A 2ADFH 2IPKA 3D1MC 4MQTB 3C8KB 3VXMA 2X4OA 1JBJA 3CCHA 3D2UD 3OBAA 3WIFA 4G9FA 1G6RH 5HHPB 1JHTA 3ZDYE 1N5AA 3B9KD 3WUWG 3CH8A 3IDMB 3NZHH 4XP6L 3IB4A 5I9QC 4X5XB 1NC4B 3LDBB 4I48B 3VFVB 4FQPA 4ZNCD 1O5DT 1IAKB 2RR3A 5IQ7H 4ZUUB 3KXFA 1QSFB 1S9XB 3GMPA 3LN4A 4LLVB 5JR1L 2NXZC 4M1CD 3E6FB 1MQKH 3PWNA 1B4RA 1CFQA 1P9MC 5CZKA 2GJ6E 4ALAL 3VD9A 3UYRH 3VE0B 1JPSL 2Q86B 2IWGA 1Q0YL 1WIOA 3V0VA 4WU5A 4GFTB 4RNRB 3H9YA 2LAAA 4U33A 1I3GL 2YMXL 2A74B 4QHMB 1MCIA 4K9EH 4PRAA 5CZXD 5MERA 1BQHB 1OD7A 1ZWIB 3VFRB 1MCQA 5J89A 2V9QA 2AEQH 1WV7T 1HINH 2GJ6B 4G8GA 4Y4KB 4K23H 2NNAA 4S1QL 3BN9D 3PJSB 3CH1A 5T33L 5D70H 1X7QA 3MMEA 4KK5D 1WBZA 4IBLT 2Q8BH 4W4OC 5IWLC 4NKDA 1PG7X 5CSGA 4N8CH 1MLBA 5KS9B 1R24B 3WDHA 1E6OL 3U1SH 1U8NB 1KN2L 4KHXH 4LLYB 3UTQB 1FH5H 3JWOL 3NN8A 1D5ZB 4YHMH 4QHUB 4M61A 5D1ZB 4FABL 1IL1B 4GRWE 4XPTH 4PD4J 3BQUB 3MR9A 4BH8A 3DTXA 5B3JF 3NBNA 3S96B 3UPCA 1BQLL 1MAML 5E9DA 5H94B 4YQXL 5I1HL 4UILH 3P4OB 3IFPA 2NPLX 3T3MF 2DKMA 4F2MB 1A4KA 2R15A 1UG9A 2GJZB 4Q9QH 1XGQA 1MPAH 3GMRA 3IVKA 3PQYA 4NKIL 3UJJH 4GRWB 4E0RA 5TE4H 3MLYH 2B1AH 1TVDA 3O6KH 4APQB 2GK0A 3FQXA 4NIKB 1KJ3H 1ZT4B 4XVUD 4X6EA 1NCAH 3NTCH 3K4ZA 4F8QA 4K3EH 5ALBL 4OLVL 1B2WL 4ZUSB 1CGXA 4G6KL 5T1DL 4P4RA 3BT2H 5IFHH 2DBLH 3B8YA 1U8LB 3U9UA 1DQLH 4ORZC 5DD3L 4P5KA 5C0EB 1OOAA 4X80L 4OM0H 3BKJH 1DN0B 5JNYA 3EJZC 2HJLA 1NGPH 3UPRB 3VXRD 4ZD3H 2CMRH 1T04A 2W0FA 3R8BB 2CKNA 4PRID 4DZ8B 4HEPG 4WGVB 4LEXL 4RZCB 5DK0A 3QNZB 1HQ4A 5FKPA 3TBSB 5E5MA 1FNSL 2N1KA 4ZODA 3WKML 5EU6B 1NSNH 5GGVL 2VJXA 5D5MA 3ZT6A 4MAYA 5IVZA 4RAVA 3WFDH 1ZGLA 2Y07H 1MJJA 2V2TA 1ETZB 1HKLL 4MJ6A 5CIPB 2CXGA 35C8H 4WUUD 1X4ZA 3F12B 1JWUA 2J6EA 4ZTPL 5KVGL 3WXWH 1UH2A 4JRXD 3RPIA 1OAQL 1UQSA 2EYSB 5E4EC 5E08L 2HH0H 4LRIC 2X1PA 2P5ED 4CN1A 1D9KB 1JWSB 1A0QL 3AGVA 3D0VB 4YE4H 4IDJL 1H9VA 2AGJH 1NBVL 1LO2L 3PDOA 5J3HC 2W91A 3RU8H 5IBUB 4ONFH 3PWPA 4Z0XB 2ZCHL 3G9VA 3CU7A 5FB8A 5D96C 4JVPA 4K7FB 3AU1B 2NZIA 5ACZB 4ACPA 3DECA 2WIIB 1A7BA 3RZCB 1JRHH 3HNVL 1N8ZA 4HZAA 4F57L 4P5TA 4XBEL 3F7YB 4EQ3A 2FX7L 2L7JA 4JDZA 4Y4HD 1IEBA 2VE6A 1R5IA 3WUWB 4MJIE 2AJYH 2FBJH 2F5AL 5IV2B 1TFHA 3QG7H 5EU3B 3A6CH 4KXZH 3B2VH 4DK6A 5I15L 5C0JB 3BMVA 4LARL 2NY1D 3VXNB 1CF8H 2VZTA 4ELMA 3TFKD 5KSUB 1ULVA 3BHBA 2PXYC 3OGCB 5EUOA 3X3FH 2VXSH 3QO1B 1EAPA 1BFTA 2ZUYA 3O4LD 1A6WH 3BYYA 1IGJB 3C5ZD 4OZHA 2ESVB 4LNRA 4PRDA 4CN6A 1ZA6B 3TPUB 4WFHE 1JWMA 4OGXH 3MRDB 3ULUE 1FGVH 4OZFG 1IGCL 3PV6B 3LPGA 1OAUL 5IQ9B 3ARGB 1T4KA 2XPGB 3DMMC 5CD5D 2ARWA 2MHAB 4JQIH 2QJDA 3BJLA 3GSQB 5F96L 4JZJC 4RDQF 4QRTB 2D4FA 1TDQA 1U93B 2V9TA 4IMKA 4Y5XB 5A2JH 1I7ZA 4XCYA 4XP6H 3P40A 5KTEL 2F53D 4UV4L 3BZFB 1N5YL 1HXYA 4NNXB 1KPVA 2EC8A 4O2CA 1WISA 4XT1C 4RAUA 2PUQT 1WZ1L 4NOBA 1KJVB 3CSYB 4CJ1A 1UZ6E 3ARSA 5DRXA 1FFQA 43C9B 25C8L 4PJAF 2X4UB 1JVKA 5JORA 1EUUA 1XIWA 1WEJH 3GSRB 2VDOH 2BERA 4ALAH 3H42H 3TJHC 3MYZA 2HFTA 5C08E 5I1EH 1YEDB 3V79C 3L7EB 2BHUA 4KZEL 4PJHE 4NZUH 3JWOC 1OCWH 3P30L 4TNVF 4I18A 1HSAA 1KELH 4GQPH 1NFDF 1NAKH 1AFVL 3ARWA 1A7RH 3C5JA 4LSQH 5I16A 3VGGA 2BFVL 1W8NA 5C08B 4QT5B 1DEDA 2VLKE 3P4MA 4PJXF 4LQ1A 1QBLH 4BK5A 5D1QA 2JB6A 1JZ4A 1WC7A 3DX9A 3QXAB 4NN7B 4XP9L 1JYVA 3OKMB 3CVHA 3QI9C 1ADQA 2L4OA 3ECBB 2DQIL 5T1KA 2PETA 3TN0A 3X14B 1CE6B 1MAMH 1U6AL 4FQ1L 3HCVA 1DL7L 2VLKB 1KCUL 2OTUA 4ODTL 4ZXBA 4MJ5B 4KQ3L 2CR6A 4QXGL 1EGJL 2XA8H 3WHE1 4DK3A 1JRHI 1B0GB 3DVNA 5EU7C 4BUGA 3H7BA 4JM2A 1T3FA 2NXYC 3NFNB 2I07B 4NFDA 4H0IA 4PBVC 2OQJB 2DQUH 1TQBB 5FYLD 1I85C 4RIRA 4NQVB 4FQLH 4LHUA 3CFJA 1SBSH 4YFLI 1ZVSB 3TWCH 2A77L 5FO9A 2WP3O 3OKKA 1RIUL 4I0PA 1DQML 1RPQA 2ZKHH 3FFDA 4EUPG 3PGDB 4FQCL 2X4QA 5ALBH 3VRLF 5IB1A 4BKLB 3OAUH 5CCKL 5FA4B 5IM7B 1Q0XH 3FT4A 4R97C 4DCQB 4U1SA 1S7QB 1G7LA 4NN5B 5TQ0L 3QDJA 2OCFD 4WHTB 5SV3A 4X80H 1XR8B 4HCRA 3DYPA 5GJTL 1FZKA 1T0NA 1JPTL 3WNKA 1BJ1J 2AJSH 1I8KB 1DJSA 5TDPA 4XPAL 1WTGT 3FO2A 4U6HB 4M4RA 4MQSB 3MCKA 5AUMA 3MBXL 3PHOA 3IGAB 2C4XA 2IPUG 5GGVH 4WY7H 2ZSWA 4BFIA 4DKFL 5KN5A 5HHOA 4EDXB 2JCCF 5L2JA 1JNNH 2H3NB 3MGTA 4DVBB 3I3EA 3MLXL 4HG4K 3WN5B 1NC2B 4ELKA 5GS0L 1RHHA 1HKLH 3RUGF 4NZDA 1MEXH 3LSOA 2ZUWA 1K3IA 4UT7H 4NZRH 4KJPC 4WJ5A 3BXNB 4KK8D 4BM7A 1CLZL 4OB5H 3SDCA 3EYVB 4Y19A 1HEZA 2EYTB 3DRQA 5F8RC 5C9KA 5JMRA 3RVXD 4F7MA 1OF2B 1A0QH 3AMLA 3BP7A 4OZFB 4IDJH 1NBVH 2WWMD 5GHWL 3MRJA 8FABB 5GRJH 1XCQB 2FH6A 3MV8E 2ZCHH 3MLSH 3QQ4B 2AQ3A 1UWGL 4IEFB 4XBEH 3MODL 3HB3C 2VDQL 3C6SB 3MGOA 3O3BB 1RJLB 3O9WD 4NO3B 4XCFL 3HUJA 4PG2C 2DTMH 2OS7A 5ITBH 4JFDD 5D9SA 1MCHA 5I76B 5DEGB 1EVUA 3QNYB 2GSGB 2C5DC 4YGVB 5I73B 1RZIB 1BGXL 5ACLA 1R0AL 1GGIL 2A6IA 1MSPA 3MV8B 3QQ3B 1INDH 1MHCA 1VACB 4IRJD 3IU4L 2VH5L 3IU3A 4RQQA 4D0DA 1KV3A 3ZE1E 3S37H 5GS2H 4DAGL 5FGCE 4U7MA 4WRLA 4TSBL 1IGCH 4OBSA 2FLRT 3U48A 1DVFC 4A6YA 3MRPA 4I2XA 4XCCL 5IHZB 1CL7L 5CBEB 3H3BC 4KV5F 5GGUB 1TVBB 5ID1B 5J57B 3NIGF 1NCWL 2BJML 5I8OH 1Y18B 3RVVD 3MZTA 5I1KH 5EZOL 1KGCD 4S1RH 4LU5L 5FGCB 4WHCA 5D72L 3W0WD 5IMOB 1N5YH 4EDWL 2DWDB 2YWYA 1MUJB 1KIQA 5LQBL 3FT2A 2Y06L 1E4WH 2VO5A 3SDDC 4PIRF 3CX5J 4R4FH 4GJTB 2OTWB 2GTWA 2Y25A 4N0FB 3S35L 5EIIA 1NCTA 3OG4B 1XGPB 2H26B 3BWUC 4JKPL 3KJ6H 5JW4M 2NY4D 1F3RB 4LIQH 3W82A 4URTB 5AWNL 1XGYL 1IJ9A 1P4BL 1I7UA 5BZWB 3FMGL 3BKYL 4PGDA 5HTSA 3MJ6A 3D85D 1K6QL 4ZOCA 1ZHLB 2EC9U 2Y7QB 1WAAF 5D7KE 4D9QD 5MP6L 1L6ZA 4P2YA 3T2NL 1MI5B 3QHFL 2ZZUT 1ES0B 5F7DA 1QO3A 2NW2B 4EI5D 3CU1A 5MEPB 4TNWK 3U82B 5DD1L 3C2AL 1N0LA 1F45A 4QHLB 5CJQH 4PY8J 2R29H 3SY0B 5HGBA 3UBXA 1SY6L 5HYQA 3IJSA 1INEL 1BVKA 3T0ED 1H3PH 2HKHL 2QQNL 4Q9RL 3BD5A 2BFVH 1P4IL 2F15A 2GFBB 3GIVB 1IAIM 1F2QA 2Z8WC 1XF1A 3OGOE 5F9WC 1ZOXA 1VGEL 2B8OT 3L3DB 3UTSE 5E2TH 2BNQD 2KZ1B 2ZJSL 4EUPB 1NEUA 3IDXH 1AGDB 3HMXL 2YRLA 1YJDH 5DJZA 3LKPB 2JK5B 1HYSC 4X6FA 1EFXD 2DQIH 2EDDA 3BIBX 4FQ1H 4OCWH 1JPGB 4JQVC 2ED9A 4TYUA 1U3JA 2WUCL 1RZJH 1T83C 3L5WB 3SDYL 3OKOB 1DBKL 1EGJH 4X6CA 3UTSB 2LQRA 4DKEL 4G3YL 4NCC2 2MFNA 1QFHA 3QQ9D 5HHNA 1A4JB 5ERWA 3VFPB 2R4RH 1MHHB 5KOMC 4DN4L 3CFKB 4WWKD 2DBJA 1AP2A 4LFHD 3SGDI 5JW3L 4Z7NF 4FQQA 2CH8A 2ERJC 3ZZ1A 3HAEG 4I4WB 2X4TA 2JJTC 2AERT 4JFQB 3LN5B 1RIUH 4R7NA 1UACL 4G5ZL 1JL8A 5EPMA 4X7TB 1T2JA 1IGTB 2UV3A 1T21B 5CCKH 5DDHB 4ETQA 2GJJA 3QO0B 3D18A 4O2EB 4PLOB 1TJGL 4KUZH 4U3CA 3FO1A 4O58L 3LPFA 1PGRB 1QSED 4GAFB 1ZA3A 1S7UA 4HXBH 5GGSY 5DJ8B 3GK8L 3LQAL 4LSUL 5GS0C 2CK0L 5IEHB 1JZ8A 1OGAA 3VG9B 1JPTH 1NLDH 1LEKA 5J56B 4JM4L 5IB5B 1MCBA 1KJ2H 3L1OL 1AXSB 1S7VA 3RDTB 4HDIA 4DKDC 3MBXH 2UWEA 3PWLA 4G6JH 1OAYL 4XP5L 3WNNA 4DKFH 3TV3L 2YKLL 1QFWL 4OIAA 3UAJD 1A1OA 1CG9B 4FP8H 4U2ZA 5EZIL 4XB8A 5DZOA 3VWJA 3P3YA 5EA0L 4K3GA 5DI8B 3ROLB 4HKBA 2FR4B 1NL0H 1JMXA 4GBXA 5D7SH 2HAZA 2WLYA 5I74B 4NQDE 4JAMB 5DRNB 2RB8A 4M62H 3ARTA 2GIYA 2VZVA 4ZDHB 3U4EB 4NQSA 3V4VH 2OM5A 1UWEL 3PL6B 4U7SA 4OZ4B 1BFVL 5A3IC 3O3EA 4FFVD 4YNYB 4L4VA 5FYKL 1FE8H 4ZAKB 4TNWF 4JPKL 5GHWH 1TVHA 5D6CB 3KPQB 2PXYB 3CVIH 3AMKA 3HC3L 1YNLH 4YDJA 3P77B 5CD3B 3FQTB 3W9EB 1UWGH 2XKNB 2XWBB 4OZGA 2BRQA 1P1ZB 1S7TA 1UC6A 5HHXL 4XCFH 1J0JA 4BQ8A 4P3WA 3HA0A 1M7XA 1FV1B 3BKCH 4HUWB 1Z9OA 3GHBL 1IEAA 5HHPA 4L8SC 1YEEH 3BMWA 4FQXA 1R0AH 1GGIH 3IDMA 3GRWA 2ICES 1WBXB 1FNFA 1MVUA 3BX7C 2O26U 3MV7A 2VH5H 5T3ZE 3V5HB 2UVEA 3FFCE 4WEMB 4CGTA 1CIDA 4YHYC 5CZVH 2R1WB 1RUPL 4JKLA 1X5ZA 3ULSA 4IHOA 3SO3B 4XCCH 1ZGLP 1IQWL 4Z77A 2QQKH 4F15B 5CJBA 3MLTB 1IC5L 3O8XD 5C2UB 2Z8SA 3FONB 5FYKU 5F7LB 5AZ2H 3UTOA 5CJ5A 3ZHDA 3EHBC 1EEYB 5K9KB 5D7JD 4IOFD 3FFCB 2XTLA 3EBAA 4NHUB 1H8OA 1DFBH 3WD5L 4EOWL 2EXYC 3PHSA 1MCOL 3REWB 4NN6B 2DI9A 3RY6A 4HIIA 3TA3B 4OD1L 3QDGD 3AVEA 1MFAL 3QIBD 4ONHB 2R8SH 3FO0H 2K1MA 1G7HA 1OHQA 3NCJL 4YHPA 1OW0A 2BXZA 1S7WB 1U8QA 3IJHA 5E95B 2C9AA 2XZQH 4LP5A 4Y2DC 3GSUA 3VA6A 2PO6D 4HGMA 4N90D 1KNOB 1Z3GL 1ZAGA 1FORH 1CS6A 3ULVE 4F7PA 3DVIA 1IQDB 2YUWA 4YAQA 1T2QH 3EGSB 4DN3L 1IM9D 4U3HA 1OAKH 1Y6MR 4V2BA 5DD1H 4ODSH 5I71B 4CW1B 2ZOKB 3U2SA 3S96A 2PTVA 1H0DA 1I75A 2BP3A 3EJJX 5ICXA 3EYOB 3QI9B 5DMGC 4F2MA 5IW6B 2QQNH 1IC1A 3QUMA 4Q9RH 3LKOB 3Q5YA 5IB2A 4KJYB 1WTLA 3HAEB 1AXIB 1N7MH 5HGHA 5IKCA 4XMPL 1BZ7B 1NGXB 4JFZL 4J3XA 3VWKB 3OHXB 2ZJSH 4NM8L 3CUPB 3WIHH 4APQA 5JTWA 4R3SA 3F58L 1RULL 4LHJB 4UOJA 1CQYA 2AK4A 4YBQD 3SDAC 1J1XH 2EDNA 1ZLWK 3HZKB 4Q7DA 4XPHL 3TBTB 2Q7YB 3CXDH 1U8OB 5ISZA 2CIIB 1VERA 1FZJB 1U8LA 4CBPA 1GH7A 3X3GH 5M95B 4HIJB 2QSCL 4DN4H 3MLRH 5J13C 4IIQC 4KVCL 4TTDC 1VFAA 4WW1B 5JW3H 3W2DL 5JDSA 3SE4C 2IANA 1GGBL 3ZE0E 4DZ8A 3V6OE 3LQAC 3MBEB 4G8FA 3E0GA 4U1KB 5GRZA 3TBVB 5HYIA 1NCBL 5L7XL 3TBSA 2UYLB 2VC2H 3TNNA 4JO1H 5FUCE 4BZ1L 3EDFA 4IRSA 1U8KB 5JMOC 4LSPL 4WHYG 4ORGA 5B8CA 4JG1H 3DX7B 1OB1A 4QWWD 1TJGH 4PJBE 2FJFB 2A83B 2LV4A 3F12A 1TPXC 4QHNA 2O5YL 4BH7B 2NR6D 3GK8H 1IC4L 3RL1A 2MQCA 4JM4H 4NZJA 3GMLA 1UZ8A 2OX5A 1RIHH 2Y36L 4RMQA 2Z31C 2EIEA 2R69L 5D8JL 2OK0L 1DLFL 4UAOB 3DSFH 4HK0B 4JN1L 1JWSA 4OIIL 2ARJB 3ARUA 3K8MA 1CXFA 4LCWE 4PJBB 4XPGH 2C4FT 4FG6D 4OLYL 3F6IA 3TV3H 2YKLH 4GXUM 1P7QD 4X7FC 1ZKAA 2H2PC 2NY3D 1WVZA 3FRUB 4A2LA 4P2OD 1MRDH 4OCRL 5EZIH 1JGDB 3F7YA 4L9LC 4YDLB 5EA0H 5DJXB 2Q8AL 2B5IC 2BY0A 5DJ2B 2K9UA 2W9DL 4JLRA 3UTPE 2YPLD 4LCWB 3CSBA 1A7NL 3KYOB 3NAAH 1GXEA 5KSUA 1KIPB 4U1JA 5D5MF 3P9MA 3OKLA 4OUUA 4GKZA 2DQTH 1QOKA 3BIKA 5D1XD 5FUOL 2GUOB 2OZ4H 3SO5A 1IGJA 4UB0L 4JPKH 2AKRB 4K3DH 1FYTB 1ZA6A 3TPUA 2XY1A 3MRDA 3LS5L 1A64A 3PV6A 2HVJA 4MJIA 2VDRH 5EOQH 4LIQE 5F70A 4MX7B 5DUML 5LWYH 3JWDL 5JXEA 3C60B 1ONQB 3IDJA 2EKSA 3Q1SL 1GZPB 3GSQA 4GKNB 3SBWC 4LLAA 4GRMB 1IVLA 1CFSB 3QDMB 1U93A 4JHWL 4FQJL 4LDEB 3UCRA 3KDMA 2WUBH 3S5LG 3V6FB 1R5WB 2YK1H 4HWBA 3ARDB 3WV0A 4P2RD 2KL6A 5C0BE 3O2DL 3BO8A 1Z2KA 1RY7B 4YXHH 3GB7B 1KJVA 3CSYA 3FN9A 1I1FB 2KKQA 43C9A 1IC7H 2X7LB 4Z78A 4O9HH 1NGZA 5ADPL 1IQWH 4HH9B 1CI5A 1NBZA 1NGWB 3WJLA 4ELMF 1FJ1B 4G8IB 1NC4D 3QYCA 5EUOF 3L3OA 1U8PA 3QUXA 1PDKA 5HJ3B 4NRZB 5C0BB 4OQ1A 5E94A 3JVGA 5DZNA 4OZHF 4HQQL 5BJTA 3C9NA 1QSFD 3BRFA 1YY8A 4PTTA 1FAIL 2ZUQB 5L0QB 1X6LA 5J11C 5B4MD 3CPLB 1K2DB 5C6TH 4HKZB 4WV1C 4JN2A 1YEIL 5E2VL 4MCZB 1UEMA 1KFAL 3B3IB 2PYFB 3FQWB 4PRHA 2DQDH 1IM3A 3NCJH 4OV5A 4HS8L 4KI1A 4ZSOB 5J06A 2R0KL 4QRRE 4QT5A 4MDIB 3RX7A 2VLME 3RWDA 1DDHA 3S9DB 1YPZA 3I6GA 3VJ6B 3EDDA 2PYEE 2QQLL 4N5ED 1W0WA 4PJHA 4QCIB 1FG2B 4LCIL 2YA2A 4UNTA 4XH2A 2VXTL 1WICA 2GJ6D 4MHHG 2IFGA 1ZANL 2YD4A 3FAWA 3KNBB 4X7DC 4Y4KD 4Y4FB 5F9WB 4OF0A 1DZBA 5JZ7D 4GOSA 4LSSH 3X14A 2EKJA 5I17B 1I9JH 3HC4H 4QRRB 5FM8A 5EO0B 1HE7A 2R2BB 3OTTA 4HIXL 5C09B 4UDTA 3DXAB 3LKQA 5C07E 2C1PA 2IGFL 1GRWA 4ZO8A 4ODBD 4NQCA 1BVZA 3D3VE 4OKDA 5D1ZD 3AS2A 3E8UH 2LU4A 4XMPH 4XXCC 2I07A 1DANU 3BQUD 3U4AA 1TENA 5F9AC 1J8KA 3QH3A 1I4FB 3AY4C 1NANH 1BIIA 4U1GC 1KF9B 4V2CB 3ROOA 4NM8H 4BSVB 2WBJA 1QR4A 5I66A 4AM0B 3IDUA 3BSZL 1EAJA 1RULH 4HMCA 5C0DB 4RISL 1EHAA 5C07B 5K9OB 4QRSB 1WT5C 3SGEH 3HR6A 4BFEA 4JRYE 3HZMB 5T5FL 3D3VB 1U8MB 4LL9A 2GSIA 1GC1H 1I3RA 5C9JA 1OTTD 3C08L 1KJ2B 4FFZL 5IFJB 4P4KC 3HR5B 1NJ9B 2Q6WB 5FA3A 1JF1A 3SEPA 5H8DA 1LO5B 4NRYB 2IQ9L 4X8XA 2NW3A 4YO0B 3T0VA 3D25B 2CDFB 4LMQE 3GM0A 1TNNA 2CUHA 1I8KA 3H9SD 3VGFA 3IFLH 4HZLA 5CEZH 1WIUA 5IBLC 1KLUB 1YMHB 5FO7A 4R7DA 1FL5B 1QLEH 3IGAA 5B38G 4UIMB 2AJZA 4LSPH 1FFPB 4ERSL 1T66C 4YGAB 5DA0B 2H3NA 4DVBA 1EIBA 5D2NE 1TITA 3WDIA 3QIUB 3G5XB 1I7TB 1IKNC 4S2SA 4RFNC 3QJFA 1HHHA 5EU6D 4LSDA 4MA7L 1V3LA 3EFFB 1FCGA 3ARQA 3DHJA 5D7LE 5C0GB 3VXSE 1RUML 3EYVA 2R69H 2EYTA 3VA2C 5C0FA 1DLFH 1S5IL 4PD4K 2QADC 1AD0B 3ZTNL 1TCMA 4OZFA 2XZAL 1R6VA 5AZEH 5F1SA 3K80A 3ZKQD 5F9DC 1MH5A 1U8HB 3S36H 5D2NB 2BNRE 1K4DB 3IT8D 3UTTB 1I8MA 1OWWA 3ZSTA 4PJ9B 1AHWC 3RWCB 5F3HB 2W60A 5E6IC 1HK6A 3KR3H 5D7LB 3HS0A 4C57C 3VXSB 1IBGH 1JGEA 2DYPA 1D9KD 3WFEH 4NO3A 4I5BB 3S5LB 2WIMA 2X44D 2YN5A 4FXKB 3JWDC 1AJ7L 3FQNB 2GSGA 1MJUH 2FZ3A 1RZIA 4HXAL 3B9KC 1R3JA 2CIKB 4AJ0A 1YNKH 4IS6B 2PCPA 1X5KA 3UDWA 3RZCD 3I84A 1J1OL 3RWHA 1QPXA 2D7QA 2R23A 2G5BA 3LS5H 4LGRB 3VFUB 2VTFA 4P3CH 4M1CC 3JSSA 5I1AA 3JWDH 4I9WE 5SX4H 3WFBL 3NPSB 3Q1SH 1QEWB 1GGCL 3TBWB 1BIHA 3MUHL 4PLJD 2WSKA 5GGUA 1ZEAL 2P7TB 2VSDA 4JB9H 4OAWB 4M6MH 2HJFB 4PV8A 4Y16B 4JHWH 2ESVD 4TUJB 5JQ6H 5SWQB 2BSRA 2ZNWA 3O81A 4PJ8C 1JNJA 3GNML 1FO0H 4AEEA 2E7LA 5CZXC 2EIZA 3T0XA 3TO4B 3EW3B 3ARGD 1BMGA 3U7WL 5HDBE 3CDCA 5EUKB 2CKBA 1NFIB 1J9CT 3VFGL 1EXUB 3HUJF 1PZ5A 3ZKND 3H9HB 2R1XB 5DJ6A 3BN9C 5JXAL 4BQCA 4KK5C 4WFHD 4EIZC 3VRIA 5BZWA 4M1DL 4XBGB 4L8CA 3SHSA 2OR8A 2Y7QA 4ZOBA 4KQ4L 5EU5B 5BVPL 4W6YB 5AAWA 1BOGA 1PAMA 1YEJL 2F8OA 2WK2A 4GQ9H 4J7RA 4OLXH 4BSWA 5E4IA 2D03H 4HBCL 4LVOB 3TH3T 4G9DB 1BF2A 4PGZA 3ZDXF 1RMFH 5E2VH 3TBYB 5JIPA 3MO1B 1QA9B 3C6LC 3CLEL 4HS8H 5DQJB 2R0KH 3MJ7A 2Z91A 4X7EC 2O61B 3T04D 4MQXD 4H26A 4G7VL 1H8SA 1Q9LA 1MF2L 1T0PB 3BDYH 5C6WH 5IGXL 1UWXK 3QAZB 1J8HB 4KI5F 3G9AB 2VXTH 2EICA 2VAJA 3S34L 5EBLB 1S8DB 1M6OB 3TIEA 5ESAA 1T5WA 1LHZA 3RWEB 1CD1B 4XVUC 3TGXA 3WL9A 3AC0A 3CIQA 5C08D 2YXFA 4NNPL 3SE8L 1JPGA 2AV1B 5SWZB 3QIWA 4HIXH 4OCYL 1HHGB 4MNHB 4RWHA 1N0XL 4X99B 4U0RC 3UTSA 2IGFH 5KVEL 3KPLA 4Z7UE 1CICD 4DJMA 3RAJL 5FO8A 5FYLL 1A4JA 4P5MA 4W70A 3QEQE 2FJGA 4HF5L 2ZUSA 9CGTA 5DHVH 4Y5VB 3BP4A 3SCMB 4ZOEA 3D69A 1Q9OB 3BPCB 2VLKD 4I4WA 3ZKMD 5B38B 2W0PA 4MXWL 5J13B 3S3SA 4NUGH 4J2XA 1DBBL 3FKUS 1YUHA 2NX5E 3V5KA 4GO6B 4Z7UB 2ZG3A 2AXJA 1T21A 4FQHB 3QEQB 5DDHA 3E3QE 1F2XK 1OQXA 4UT6H 2OSLA 2ATPA 3HG1E 2HTKC 1XGRB 5I1GH 2OJEB 1CU4H 4O4YH 3V4PH 2BVTA 2A0LD 2F19H 2KBGA 4C56A 4XMKL 1I9RL 2NX5B 4GKSA 5C0RL 1WK0A 3H3PL 3O6FA 1FGNL 2IADA 3O2VL 4I3RL 1IT9H 1OSPH 1KLFA 3F7RA 3ARBB 4X6CF 5J6GA 2E9BA 4WO4B 2VXQL 3HG1B 2HT4D 3ZHKA 5LKNA 3MV9E 4NBXB 3UC0L 3GMNA 5LCVH 2V17L 3EKCA 4LCCC 3LMJL 1XZ0A 5IW1A 1JMZA 1DSFL 3ROLA 4Y4HC 1G9ML 4LQFL 1FIGL 4AENB 4F9PA 3L3GA 3MRCB 1F6FB 4L8DB 4EI6B 2NY1C 1W72A 4JAMA 3JTSB 3TFKC 4DVRL 3U30C 4AZ8A 1U41A 4OFYD 5JO5A 4HAGA 2B5IB 3U4EA 4FQ2H 3FOMB 3PL6A 1OP3K 2HJKA 2XZAH 1NC2D 2YSSA 3WE6B 2XQYK 4NDMA 3HE7C 3C5ZC 1FFNB 5D6CA 5HYFA 2E7BA 3RX5A 1TTUA 5DRWB 2EH7L 4PBWD 2CLVA 2R4SH 1NBQA 2X1XR 3NABH 3QT2A 5ITFB 3WBDA 4LVNB 5CGTA 4P2QA 5CD5C 2I5YL 4NQDA 4M5YL 4AEHL 5I75C 4OD2A 1EUTA 5DD6A 2I9LA 2IBBA 1AGCB 3HE6A 4PJAB 1AGEA 1AJ7H 2EDWA 4ZS7L 3TO2B 5JPNB 4R2GB 1HN1A 1RVFL 3T1WA 3GI9L 3AAZB 5F6IC 4ZFZB 1NDGB 4PREB 4LSRH 1DQJB 2J3SA 3WUZA 1F58L 3G04A 1EX0A 2XG4A 3R4DA 4PGCA 1MAJA 5JOFB 2VN4A 3E2HB 3I6KB 5I8CB 5MENE 1AY1H 3KYNB 3KPSE 4RMSA 1P2CB 3VFNB 3MV8D 3FONA 1E28B 4MJ4A 3LKNA 5L8JB 2ADJA 3FB8B 3FRPG 1QYGH 3HNSH 4KMLB 3SDXE 5CJXA 4U31A 4NWUH 3QHZL 3RTQA 5EBMA 4NHUA 3GNMH 4HWZB 3WJJA 3ALWA 1JHLL 5DJ0A 5L2KE 1X9QA 4OLZL 3GGWA 2R0LL 4HS6A 5MENB 3KPSB 2VDNL 3U7WH 4OZGF 4ZFOB 2ZNXA 5IOPB 2IPTH 3VFGH 5T1LB 1ZLSH 4BFBD 1CVSC 3O45B 5J11B 4P9MH 3PP3K 1NMCC 3QXUA 1WFTA 5JXAH 1ZT1B 5C0AB 5FGBA 2C3HA 5KANI 3O41B 2J7LA 5L2KB 1TLKA 4PJFE 4WI9A 2BVOB 3EO1B 4OT1L 2FYYA 2HN7A 2JELL 3R0NA 5E8OA 2DQJL 5IJKC 1IFHL 4ODHL 3NH7L 3UX9B 4YDKH 2GY5A 1AR1C 4C55A 3CDFA 1KYOJ 1YEKH 4JY5L 5JIIA 5IMLB 5CKGA 2ZOKA 1TZHA 4XNQA 3CGTA 4X9FA 3ZDYF 3QUZA 5HVGB 3A6BL 4FXGA 3G5YB 4PJFB 4K94L 3WFCH 1MI5D 3LKOA 3I2CL 1YEGH 4KJYA 3HAEA 1VADA 1OD9A 1PX3A 5IK3A 1BZ7A 1NGXA 5BMFL 3LEYH 5C2BL 4WW2A 1F6AA 2D0GA 1A9BA 2IJ0C 5CEZE 2JCCE 3EZJB 5DJCB 3VCLA 3LRSB 3ARXA 1NLBL 3S35X 3RWFA 5ADOH 4WWID 3MACH 5D7KD 6CGTA 1U0QA 3SE8H 1CXKA 3UTZB 2V7HB 5EZJA 3RGVB 3TBTA 4NQEB 4R4NC 4D0BB 4R90L 2YHGA 5AEAA 5DO2C 1RU9L 4JANA 1NAMA 1D5BB 3MCG1 3RAJH 4OD3H 2JCCB 1WWWX 4HF5H 3VD4A 1AIFB 1A22B 3MSPA 4XTRD 3RUGB 1Q9KA 1TJHL 3QFDB 5ESQA 1QFOA 4P49A 4MXWH 1X4XA 3TCLB 2OP4L 2UYLA 4JFHE 1MLCB 3CX5K 2ZCLL 4F37K 5KSVB 5I2IA 1U8KA 2SEBA 3MJGX 1HI6B 4HK3J 3O11B 1BBJA 4P9HL 5CMAB 3QG6B 4QRPB 4XNZB 2R1YB 2LAGB 3RY5A 3V6OA 1LO0L 3AS1A 2NLJB 2H2SC 8CGTA 5F1NA 1G9MC 4JPVH 4MAYC 3MCLH 3RVXC 4OCMC 1INQB 4UMGA 4G43A 2ARJA 1FGNH 4G80A 3DUSA 4I3RH 1A6ZB 3D0LB 1W2KT 5GSVA 4JO2L 2Y4SA 3FB7B 4M48L 1JNHA 5CP7B 4QTIH 5T1MA 5A16B 2CDGA 4HPOL 1B4JH 5KOVC 3FRUA 4DW2L 1S3KH 4V1DE 1F4WL 4S1SH 1UJ3B 1DSFH 3O9WC 4F33A 3RDTD 4KRLB 3L3HB 3CZFA 4G6ML 3MNZB 1ZMYA 4GRLB 4LPVA 1IRAY 5J6HB 4LCWA 5JW4R 4K7PY 1U2HA 2XTJC 4DVRH 1KIPA 3C87A 1FRGH 4W6XB 1Z9SA 2J6EH 4IRJC 3T3PE 4P5TC 3RFZC 2P47B 4WI3A 5J3HD 1U95B 2IG2H 3EDEA 2VDPL 4FS0A 3WCYA 2P8LA 3OF6D 3B5HA 3HNTH 3GSNL 1QHOA 1XR9A 4TUKL 4MX7A 1FO0B 1NDMB 3PL6D 1H5BA 2W65B 1CFSA 4ZAKD 4Q6YA 4PRBB 3CX2A 1RVFH 1F90L 3U6RB 5IMMA 3TVMA 2PXYD 4LSTL 3FOLB 3T2QA 5GGRA 3X13A 1XGUB 5I1IH 3TZVB 5K9QG 3N1MC 1MREH 1QBBA 2NYYD 3BGAA 4PJ8B 2F5BH 2BSTA 4OIBA 1ZLWH 3GB7A 1CQKA 1I1FA 5F88B 4GW5B 6FABH 5D93B 1YN6A 2X7LA 1SVCP 3ELAT 3QQNA 3VD7A 2NY4C 1YYMH 3P73B 1FJ1A 5CUSH 5HGAA 3NA4A 5F89B 1MHPL 3T09A 4HUXA 5DLML 3QHZH 4AEIH 5KJRH 4A6YL 3QRGH 1EO8L 4EI5C 4YHOH 5IT2L 4O2FA 2D7NA 4QYOA 3CNKA 3U7YL 7FABH 3GI8H 3DI3B 3MA9L 4HS3B 4YXLL 4N9OB 2NY0B 3CFCL 2ZP0T 1UXWB 3SKNA 4MQ7B 2YUXA 1F02I 3BGMA 3PNWB 4MCZA 3LHPH 1XGTA 5DD0L 4F37F 1LGVA 3T0EC 2AJUL 4NOFA 4L3EA 3FFCD 3OB8A 3U9PH 4IMLA 5F72S 4HC1A 5CBAA 4NGHL 4K94C 3VD3A 3VXUB 1MNUH 4XNYH 3ULUF 1OTUD 3SOBL 3TJHD 4OT1H 3VGAC 1K4CB 4Z6AT 4WEBL 4ODHH 1FG2A 1R5VA 3IRZA 4I18C 4NC1C 3TA3D 3DVGA 1MCJA 1LDSA 5KVFL 3F5WB 4Y4FA 1UM4L 5SWSE 3LH2H 2XV6B 4Y5YA 4JO3L 3L3IA 2O93L 1HILB 1KB5A 5CHNB 5DRZB 1KEGL 5EO0A 2D31B 1GOHA 1E6JL 3DUHA 2PYEA 4K94H 3WSQL 1NQBA 2M2DA 1AE6H 1LO3L 4CMHB 3FQUA 3QQ9C 2IAMA 1UZ6F 4XMLL 4WWKC 5SWSB 5LAXB 4R4BA 5IROC 5BMFH 4FFYH 4HX1A 4U0RB 4QGYA 4FMKA 3PHQA 4Q2ZA 4JZOA 4OLWL 3STLB 4XVJH 3KAAA 4D9LL 2Z8VC 4WU7A 1YC8A 1CR9L 1P7KB 2VDKH 3S4SG 5IMKB 4R96B 4MSWA 1HH9A 3QI9D 1DP0A 1A1NB 3EOBA 1I3UA 4QXTB 3N85L 1W0YT 2R0ZL 3WEXA 4HPYL 4EN3B 3D3VA 1UA6L 1QBML 2VIRB 3MA7B 1YPZF 4F7TA 3NGBB 1ED3B 1UCBH 3ARVA 3QZWA 5IG7B 3CVHH 3VWKD 4PJHF 1P4LB 3SGJC 1RU9H 1ADQH 3P11L 4HWEL 3HR5A 3VG0L 4D2NA 5J12B 2NXYD 5D6DA 1LO5A 3MX0A 3LN9A 32C2A 4QTHB 4P9HC 4YO0A 5H35B 4BJLA 3L5IA 4M7LH 4YEEA 4JRYA 4U6YA 2W9EH 4QEGA 1KXTB 5CINL 4L3CB 3OX8A 4OJFL 3UJIL 1FSKC 1ND0B 1UH4A 3VI3F 4EQ2A 5C8JB 5IBTH 2BOCA 3GO1L 3I85A 5D71H 3NACL 1NCCL 1I8IA 3MV01 3MBED 3LKRA 1DBAL 2OI9C 2Y23A 4OGZA 4WUKL 4QHKJ 3ES6A 2YD9A 1V7NH 1LO0H 4LCCB 3DGGB 3LEVL 4RWYH 5E8DL 2M8XA 4RFOL 3UO1H 1BVLA 3T65A 4HCRH 2MCPL 4N0UB 5TDOB 1WFOA 4FFVC 5SX5K 4TVPH 4CUCA 1MWAL 5D2NA 5DC4B 3JBG7 1IAMA 2FO4B 2XQBL 5GS3A 2GW5A 4I8DA 1RQ5A 2F54E 3RWCA 1D3CA 3ZSSA 3O4OB 3S97C 5A2FA 1X5LA 4MDJA 3DO7B 3B4NA 2AXFA 4UUJA 5BXFB 3MZGB 1KIRB 1F11B 3QWRD 2Z92B 1CLOL 2J8OA 1I1YA 3L3KA 3VXOB 2BNRA 4MD4B 4LGSB 3AS3A 3MRQB 4XWOD 3VXME 5E03A 4OFDA 5ECJE 5E8EB 2IBGA 3OXRA 4Y1AE 4F58L 2EDQA 2PNDA 2ZUTA 1QKZH 3OXSB 3UEZA 4P2CG 3MREA 3GSNH 4OUOA 1TQCC 5GS2D 3QFJA 5FEBA 2Q3AA 4OF3A 2X89D 4LBEA 3VGHA 1E4KA 1UXSA 2CUIA 2Y5TA 5GGTA 1AO7E 2IPKB 3VXMB 3BZEA 5KZCB 1MFBL 2X4OB 3OJDA 3VMOA 1M4KA 3W9DA 5K9JL 4PV9A 3WIFB 1WWBX 4G9FB 4IOFC 1N5AB 1FYTD 2AJVH 1OLZA 4Y1AB 4DFIA 1C1EL 1KN4H 5HDLA 4ZTOH 3QCVH 4ETYA 3UTPD 1HNGA 1EZVY 3C60D 1NMBL 2BVEA 5EUKA 1NGYB 2NY6B 3KXFB 3GMPB 3LN4B 1AO7B 2WBKA 4Z7WA 2B2XL 1DVFD 2IPUK 2QV2A 2R1XA 3QDMD 3PWNB 1CFQB 3MJ9L 1A6VH 5DSCA 3MRLA 5I8KL 3MOQA 3ARDD 5HI4C 1FLRH 3V0VB 1MHPH 4WU5B 5HVHB 3S7GA 5EU5A 4A6YH 1SMOA 5FM5M 1U3HA 1EO8H 4PRAB 5MERB 2YD7A 1RJYA 2BVQA 4H8WL 4UT9L 1Q1JL 4RMRA 4NQUA 1A02N 4G8GB 5IVOA 2Z8RA 3BPOB 4JVUA 1SYSB 2NNAB 5C0BD 3CH1B 2HKFH 4K8RH 5E9DE 1X7QB 3MMEB 4LDOB 3DROB 3ZE1F 1WBZB 1K5NA 2EZ0D 4NGHH 4NKDB 3T77A 1MLBB 3KJ4C 2H1PH 4Z7QF 4RFEB 2E8ZA 5DHXB 4GH7B 2FH8A 2H9GA 5BQ7B 2V6HA 3NN8B 1EJ6A 1LMKA 5J4MA 2Z35B 1UM4H 5DUPL 1YEFH 3DTXB 2MSPA 2QSVA 15C8H 5E9DB 3FCTA 5IW3A 2ZCKL 2YBRA 1YA5A 4YFDB 3IFPB 2MQ0A 4KKBD 4S0TD 4X99A 3VDBA 1XGQB 1J5OL 1AGBA 5GPRA 3IVKB 4MS8D 2W0KA 1YMME 1F4AA 4W81A 4PJGE 4GMTL 4MNQE 4OLWH 5IHUL 1NFKA 4QRRD 2VLMD 4NYLA 3HI5L 3FQXB 1BM3H 5DQDH 5IB3A 5C09D 1MFDL 3DXAD 3RNQA 2AXGA 1HYSD 4ZMAT 4CL7A 4HPYH 4WTXA 4Z7UA 4R0LA 4H25A 5IFAL 4HV8A 1YMMB 3OB0K 4P4RB 5IIEA 2OL3A 3JWNC 3VW3H 3EOAA 5D5ME 3U9UB 4P5KB 1J1PL 3W39A 1AXTH 4UTAL 3BP5A 5JNYB 1CXEA 2NR6C 5C07D 1C5DA 1G1YA 5KVDL 2W0FB 3BKML 5EC2A 3CFEA 3D3VD 4HK3N 2D7PA 1FBIL 4B5EA 1CCZA 5DK0B 3RKDD 3TP4A 1HQ4B 5FKPB 3REVA 2X5PA 3MJ8A 5E5MB 4AG4H 1HHIA 4LHUG 2C26A 4PJEE 2A1WH 5D5MB 2G9HA 4U6VH 3UJIH 4MAYB 4FG6C 3VI4E 2Z4QA 5IVZB 3OAYK 4RAVB 1P7HL 3CMOL 4DKAA 1ZGLB 4L5FH 4K7PL 1MJJB 2NY3C 2A38A 5BRZA 4P2OC 3NACH 1NCCH 3L6FA 1RUKL 5CGYD 4DFHA 1LQSR 5JUEH 1UQSB 1KCVH 4DUWA 5GSRB 1I1AA 1P5UA 4PJEB 1SHMA 5F7NC 5EORL 1JIBA 1U91A 4XAKE 3MV9A 1N59A 4GW1A 2YOCA 3FOMA 4O5LL 3RI5K 4YR6B 5D1XC 3EOTL 4DZBA 4ELME 3VWJC 1WITA 1FFNA 3PWPB 1MWAH 3QIUD 5FB8B 5DRWA 2WQ8A 3PGCB 5FCUL 1N8ZB 3H3KA 5ITFA 4ZFFA 2VQTA 1FDLH 3M17A 4JDZB 2L0DA 3OR6A 1IEBB 1R5IB 2VE6B 4WFEE 3OZ9L 4KKCC 3WFHA 3O0RL 4KDTA 1T1ZA 1IKFL 3PWVA 3FTGB 1H15A 3DYOA 1JF6A 3HLAA 3INUL 4ELMB 4XVSH 5TF1L 1A2YA 3H0TA 5EWIH 1OT1A 3UTTD 4ZFZA 2HFEA 1EAPB 4PJ9D 4EBQL 1T5XB 4OZHB 3ZKXC 5D7LD 5ICZB 2AVGA 3VXSD 4PRDB 1PLGL 2O5XL 1JWMB 2OBGA 4W6WB 2GKIA 3VU2A 5JOFA 1T4KB 2QLVB 4R8WL 3THML 3LDBC 3WLWC 5KW9L 4YXKL 3TIDB 1OWRM 1C16B 1I7ZB 1XMWA 4KRNA 4XCYB 2MNUA 4HWZA 4UOW0 3BH8A 4ENED 5B4MC 1HXYB 1LILA 1KPVB 4O2CB 2FD6H 5MENA 1YEHH 5DMIL 1NMBH 3BP6A 2VNCA 3D39E 2VLJA 5T1LA 3RX8A 4P46A 3UJTL 3GRWH 4Z5RA 1B88A 4H8WC 5FECA 4YUEH 2W59A 3SDXA 3OG6B 3TEUA 2PTUA 4Y16D 3MXWH 1MCDA 2VZUA 1G6RA 1XIWB 2NQCA 1FFOA 4LCYA 5IJVA 1FVDA 5I8KH 2VZ1A 4LDLB 5L2KA 4IRZL 2BVOA 3TO4D 4N5EC 4XP4L 2X09A 4JZNA 4KPHH 2RGSA 4XC1L 3RY6C 4I9WD 3BEWA 1X44A 5EC1B 1ITCA 3VDCA 4P23A 3HN3A 1GAFH 5IMLA 1OW0C 5FM5O 5JZ7C 2N7AA 4LRNH 4NHCH 1IAIH 5C0CE 1IGFL 2FEDD 3KPTA 1BLNA 1X5XA 2QTEA 2WP3T 4J3TA 4CAGA 3C5JB 3BUYA 5I16B 1QVOA 3NCYS 1WCBA 3WO4B 2B20A 4QLRA 3P4MB 5D1ZC 1RUQH 3HPJA 5D1QB 2DM7A 2JB6B 2XN9E 3BQUC 1FYHB 3TYGH 4MB3A 1WC7B 4PJIE 3LEXA 4GSDL 3DX9B 4WNQA 5FFLA 5JDJA 2C3XA 3IKKA 4PYHA 1F8TL 5DJCA 3CVHB 5FM4A 3FAXA 1FPTH 5DUPH 2ITCA 1T1XA 4J4PD 3RVUD 1P9MA 2OMBA 5T1KB 5GRYA 3TN0B 1HH6A 1NUFA 1ZT7B 1L0QA 3HCVB 1OQOA 1A3RL 4PJDE 3C8HA 5IR1A 2ZCKH 4ZXBB 3UTZA 3RGVA 2P5WA 1OTTC 4ZUVA 3BIAX 4C59B 1J8HD 1F97A 4PJIB 4YJZL 3DVNB 1S9YA 2N7BA 3UBXG 3H7BB 4JM2B 2RIKA 4Y88A 1T3FB 4APQC 1X4YA 2GAZA 3M45A 1PJ9A 4XAWH 4ZFGH 5DEZA 2B7DT 4M7LT 5LGHL 4NWTH 3BE1L 2HLAA 4RGNB 3PG2A 4IJ3C 3GBMH 2B0SL 3QDJE 4OSUL 4RIRB 5IHUH 4LHUB 3CFJB 4JFEA 3QUMH 5SWZD 2X05A 2IFFH 1C12A 4M02A 2I60H 4YLQT 2R2EA 1MFDH 3OKKB 1O0VA 4I0PB 4W4OA 5IWLA 4K3HA 3FFDB 3ULVF 3MRGA 1GGTA 2X4QB 5IB1B 4HD9A 5KSBA 5ENWA 1HI6A 3FT4B 3DVFA 4YHKL 5F21B 3SCMD 3GMMA 2FWOB 1C8PA 5LBSH 4WW2F 3QDJB 1NMAL 2DDQH 1WWAX 2R1YA 5HHOE 2DLIA 5L8LB 1BJ1H 4Y0GA 4JFOA 4UTBH 1FZKB 1T0NB 1WJ3A 5HGDA 3BRGC 5KVDH 4TTGA 1R3KA 4JFFE 3SQOL 4QOKA 5TDPB 3QEQD 3FO2B 1INQA 5BO1H 1QUNA 2FHBA 1MJ7L 1CBVL 4G7YH 5AUMB 4LAQH 4CJ0A 3D0LA 2ZSWB 3FB7A 1RZFL 2J5LB 1N2RA 2HRPH 5KN5B 2FLBT 4YBHA 2GT9A 5C7XL 5HHOB 4UNUA 3PP3H 5L2JB 1K85A 3MGTB 4K7PH 4MWFA 2MPAL 2JIXD 5KSAB 4ELKB 3I75A 1RHHB 2NX5D 2R56H 3E1F1 1GHFL 3ILQD 3LSOB 1D9KC 2X4RA 4PTUA 4YHLH 3L3HA 3MNZA 4WJ5B 3ARBD 1WZLA 4OQTA 3SDCB 4Q0XL 1HEZB 4WO4D 3DRQB 3HG1D 4H1LG 2QHRL 5EORH 2J8UE 1S9KC 4WDIB 2PR4L 3BP7B 4HLZH 3NPZB 4O5LH 3RZCC 5ESVA 1F4XL 4GG8A 5L88H 4V1DA 1EEZA 1I9IL 4NSKA 1R3IH 3V6BR 4X8JA 1JHKL 4HJJL 2HWZH 5EB9A 4CADA 1EJOL 1N4XH 4Z7VE 3QUYB 4PB9H 1X5IA 4PJ7A 3HUJB 2ADFL 3OZ9H 2RHEA 4PLJC 5D9SB 3O0RH 1TZIA 5I19H 2W65A 3ZDXE 1TQCB 2FSEA 3INUH 4PJBF 1J11A 2A6IB 3NZHL 1JTPA 3U6RA 1MHCB 1PFCA 3IU3B 1A3LH 4EBQH 3ARGC 4D0DB 2HP4A 5FYKE 5IQ7L 1PLGH 5TE7H 1ZTXH 2FATL 1AQKH 1GCFA 4LRIA 4JJ5B 5F88A 3ZKNC 3MRPB 4I2XB 4TQEH 1MQKL 4KI5E 4ZUWA 1D5MA 4R2GD 3DV6A 4Y5XC 5DMJB 3ULUC 1L6XA 3EYFB 2P45B 4R8WH 3UYRL 4KJWD 3BVNA 5FXCH 5E70A 4YXKH 4WTWA 3K2UH 5C6PB 3LCYA 4K9EL 4L4TE 3EFDH 5F3BA 1MFCH 1DQQA 1KIQB 3FT2B 3IYLW 5TPWL 2AEQL 5JHLH 5GIRA 4HULB 4YPJA 1RJZA 2C3GA 1HINL 2VLRE 2GTWB 2WMPA 4MZ3A 4KVNL 3RL2B 5EIIB 3UJTH 4K23L 3ULUH 3QUXC 4YX2H 4HWBH 3BEVB 4ZPTB 5D70L 2X1WL 3K1DA 2Q8BL 1I7UB 3GBNH 1ZXQA 4N8CL 4L4TB 4PGDB 4IRZH 4CDGC 3MFFA 4KHXL 3KPSD 3WIIH 5FOJA 1EFQA 1MVFA 4YHML 5HD8C 3DMMA 3OKDA 4G6AD 1JUFA 1YZZA 1PZUB 1LK3L 1RK0A 4C83A 4AMKL 4JZJA 2B1HL 5C0AD 4PBXA 3ZYJA 2D7TH 1IGFH 5HGBB 4PRPA 4M5ZH 5DRZA 2HVKA 3WYRA 4UILL 2YN3A 3UBXB 5HYQB 1C08A 3IJSB 1BVKB 1MIMH 3QPXH 3ZTJH 1FL3A 3L5XH 2QSTA 1AD9B 4Q9QL 1MPAL 2BDNH 3VDAA 3WNOA 4NN7C 1UKQA 1CZ8H 4QRUA 3UJJL 2MMXA 4JHBA 1WZKA 5SWSA 1BFSA 5LAXA 3V0WH 4G6FB 3B2UD 4OF8A 1OSZA 5TE4L 3V7AG 3W81A 3STLA 4GSDH 1RZGB 3ZO0A 3WFZA 2YR3A 4QKXB 4G8EA 3DX8A 4RGOH 4R96A 1KJ3L 4ZNEA 5DJZB 1NCAL 1J87A 2AXHA 4X6FB 2DLGA 4MAUH 1ZHKA 5FHBH 3MA7A 4E42A 4H0HB 3RIFK 1ED3A 1QBAA 3EYUL 5C0IA 1TQBC 3BT2L 4NJ9L 1MFNA 4I1NB 5IFHL 2DBLL 1E27A 1BOYA 3O3AA 4I3SH 4OM0L 2WBJC 2EE3A 3BKJL 1KENH 3M8OH 1NGPL 1AP2B 2CMRL 4FQQB 3AXLA 2A0LC 2B0SH 3VFTA 4RBPH 1PYWA 2EXWD 4NQED 3MQIA 4L3CA 2DWEA 1OTSC 2V5YA 4R7NB 4UI2A 4BQ6A 5EPMB 4DGYL 1VEPA 5CEZD 2HT4C 1LDPH 4WI4A 1NCDL 2LABA 1ND0A 3WFDL 1I8LA 4ETQB 4NRXA 3D18B 4LASH 2H41A 4PGEA 2UWEE 3FO1B 1NMAH 35C8L 2VABA 1L9NA 4UZGA 2Y9RT 4MA8H 1ZA3B 1S7UB 1X6NA 3PWJB 1OGAB 3L9RA 4H20H 4OCXH 1LEKB 2BCKA 4O02L 2CRIA 2W1NA 2HH0L 3MUZ1 1KYOK 3SQOH 3FB5A 3IFNH 1DQDH 1S7VB 4HDIB 4YE4L 4XGZA 2AGJL 2DLEA 2UWEB 3PWLB 3QEGH 4QRPD 1RZFH 3RU8L 3ARFA 3IS0X 4ONFL 5C7XH 2EE6A 2X42A 1A1OB 4Z18A 2YXMA 1FNAA 1ZLVK 2MPAH 4JFHD 2YD1A 3RY4A 4NO5A 4GBXB 2AJYL 2FBJL 3T8XB 3A6CL 2APXA 2APBA 4F7CB 1X5FA 2XY2A 1CF8L 1JZ2A 4HLZG 4HFUL 2QADD 2CLZA 2DMKA 4XNUH 3VXOA 4WGWB 4NQSB 4PY8I 3O3EB 1E4XL 2F54A 1UM6H 5E8EA 3QWOA 1B90A 4JREB 1TVHB 1FGVL 1A6PA 4YDJB 1ACZA 1JHKH 4GRLD 5TE6L 3MV7E 4KU1A 4HW6A 5E6ID 5KANG 4OZGB 4OZFH 4L9DA 4PP2B 1S7TB 4RX4D 1JN6A 5A2LH 4MA3A 5D7IE 4Y8DC 4C4KO 4MA1C 3UDWC 4JPWH 2A73B 5E2UH 4JFYA 1IEAB 3MUJA 3TCXA 3U7AA 3N1QC 4FQXB 3NFPA 4Y1AA 1HCVA 1EHNA 3PWUA 3QXTA 3VD5A 1MVUB 1RURH 3MV7B 4GAJH 1BZQK 1D6EA 3IKCA 4ZO7A 4OZIE 4K9EC 1NGYA 4TSAH 2FATH 1AO7A 1NUNB 5D7IB 3SJVA 1PG7W 3ULSB 4IHOB 2E3VA 5HHQA 5FYJE 5INDA 3UYOD 1SJXA 1B0WA 4Z77B 1WEJL 1U8IA 3RIFF 4NO0A 1W0VA 2VDOL 3H42L 1CGUA 2NTSP 2CJUH 3TZVD 4OI9A 3WLBA 5E00A 5I1EL 3V7AE 4PJ8D 3KPRA 4FZEH 1P6FA 4XPFH 5E7BA 5F9JA 5JA9A 1BEYL 4MNGA 1MHEA 4Z7OF 4NZUL 4PG2A 3VGBA 4LKCA 1OCWL 5TPWH 4HIIB 5HY9A 1KELL 5DEFA 3HI6L 4AY0A 1NAKL 4KVNH 1G7HB 1A7RL 1SYSA 4LSQL 4MB4A 4YHPB 1U8QB 3IJHB 3PIQA 3DROA 1G7JA 2X10A 5EN2A 3GSUB 3LOWA 1QBLL 2CKBH 2F74A 3S4SA 4YHIA 2EDEA 3P0YH 4RFEA 4Q9BA 2XWJA 1RFDH 3H2WA 2NY0D 4F7PB 2QQQA 4KZDL 4YAQB 2CO7B 5BQ7A 5DT1L 4DTGH 5E6YA 3P9LB 5FDWA 2P1YA 2Z35A 2AV7A 3MUGA 4Z7WF 5F44A 3JTTA 1LK3H 3V8OA 5A2KH 1ROWA 4AMKH 3U2SB 5EDXA 5SX5H 1VFBA 1H0DB 2B1HH 3IFOA 3ZTJG 2VQUA 1YNTA 5ICXB 3VXUD 4YC2B 3NFSL 3C6LD 3RVWD 4YFEA 2XA8L 4BQBA 3QUMB 2AK4E 5IB2B 4GW4A 1SMAA 2XNAA 1NUDA 1QPPA 1RHFA 5FAAA 5HDBF 5GGQH 3F7PC 5HGHB 5IKCB 5J7CC 3T4YA 5ISZE 2DQUL 3MC0A 4FTVA 4XTRC 5FOBA 2W38A 3AROA 4FQLL 1SYVA 1SBSL 4EZMA 3TWCL 4R3SB 1QFPA 4CU6A 1KUMA 3Q0HA 5DGRA 4Q6IB 1WBYA 2IANE 4IJ3B 2ZKHL 4QXWA 2AK4B 2LTQB 1OM3H 2HFFA 3GMOA 3OAUL 3STZA 4NNYA 4FRWA 1Q0XL 1T20A 1YMMA 4JY4A 4OLUL 4EUPH 1G1CA 5ISZB 3EYUH 4M6NH 4PJGA 4MNQA 4NJ9H 5ALCH 1F4HA 1D5XA 5HI3D 2DJSA 1ZSDA 2YPVH 5AYQA 2HTLC 1VFAB 3ZYZA 3RA7H 5JDSB 2IANB 3R8QA 4EN3D 2AJSL 3O6MH 2DM4A 2VLLA 4G8FB 3K7UA 1HZHH 4TNVK 5CEXA 2GTZA 5EFIA 2ZOLA 3TC9A 3TNNB 3B6SA 4DGYH 3MNVB 1NUGA 5MHSE 1G7MA 4H0GA 4IRSB 4WY7L 3N50A 1JTOA 4BA8A 1G0DA 1NCDH 4ORGB 3T0DA 1RIVH 5TFSH 5B8CB 1JNNL 3HHRB 3MRMA 3VG9C 5J0BA 4EVNA 1OB1B 3GJFA 3WO3B 3U46A 4J12A 3S88H 1JGUH 2HTKD 3O6FC 1MEXL 4PRIE 4QHNB 2JE8A 4UT7L 4NZRL 3RDTC 3DIFA 3RL1B 4UV7H 4O02H 3GMLB 1UZ8B 4OB5L 2AQ1A 3G6DH 5GSRA 1AQDA 4PJEA 1N6VA 4Z7UF 5I1LB 1MCEA 1Y0LB 1T89C 4EXKA 1FL6B 4R6UA 4ODVH 2DJUA 1FNHA 1HWHB 1WF5A 4YR6A 3U0TB 3AM8C 2XT1B 2E9IA 5GRJL 2DQEH 4RAHA 3MLSL 5IVXE 3PGCA 2JJTA 1AKJA 3V5DA 12E8H 1OAZL 5I74C 5BOPA 1CGSH 2XOTA 1H3UA 4JRWA 4ZQKA 2DTML 5AYUL 5ITBL 5D2LE 1A6AA 2ATKB 3PL6C 4JLRB 4K2UH 3FTGA 3VXPA 4ZAKC 4HFUH 5DMYA 4U1JB 2EE2A 3P9MB 2X9YA 3OKLB 4OUUB 4GKZB 4GUPA 5IVXB 1INDL 4XVTH 3KLDA 3BIKB 1E4XH 3HE7D 1T5XA 5ICZA 1H3GA 2NYYC 1QR1A 3S37L 2EH8H 3CK0H 1W72H 4X6DA 1KXQE 2HVJB 4MJIB 3RJQB 1AH1A 5TE6H 1M1SA 4Q58C 4OF7A 1YYLL 4KROC 3UZQA 1VESA 3IDJB 2EKSB 2VWEE 2YC1B 3DV4B 3KYMA 1ACYH 4WI5A 5I8OL 3OJ2C 3TIDA 2QR0A 3KDMB 5F8QC 5I1KL 4S1RL 1C16A 4TULL 5B22A 4L1HA 4NQXA 2H45A 1GJIA 1Q94A 3SO3C 3BO8B 3VGEA 1GZQA 3IAQA 1E4WL 4F15C 1ZS8A 3N1GC 4XCEA 3OB0H 4R4FL 2C3VA 4L1DA 1KC5H 3RP1A 3VXMD 5KZCD 2VISA 5CJXC 4Z78B 4G9FD 5F1IB 1NGZB 3UXFA 3KJ6L 1NBZB 4LIQL 2DD8H 1NKRA 4PRHE 2CD0A 1OTUC 2YRZA 3L3OB 1U8PB 2EDKA 3QUXB 2G2RA 4NN6C 2F53E 4BZYA 5E94B 5L9DH 1QFWM 5BJTB 3RWIA 3C9NB 2NY6D 3KXFD 4M7JH 3TA3C 1YPZE 1YY8B 4PTTB 5EC1A 3D39A 1BEYH 5CJQL 1QG3A 4YHZL 2DIAA 2XZCL 2R29L 4JN2B 5FGBC 3OAYH 5T3ZH 1T03H 2HT2D 2ADGA 4AIZA 3HI6H 4L8SA 4PRHB 1H3PL 1UYWH 1IM3B 3U83A 1NKOA 1A8JH 2VERN 4OV5B 3EDJA 1GPOH 2AQ2A 3RWDB 1DDHB 3KG5A 2D9QB 2I9TB 1YPZB 2BOBA 3D6GA 3I6GB 4D8PA 2VL5A 2W0LA 4FNLH 1OPGH 1W8OA 5GS1B 1W0WB 4PJHB 3H6JA 5I71C 5E8PB 5E2TL 4NQCE 1AC6A 4KZDH 4XH2B 5TDNA 2FX9H 5C0CA 1AR1D 3BYTA 5DT1H 4G8GD 3IDXL 3VI3E 1MCWM 1YJDL 4PRNA 1PG7H 5E2WH 3SDXF 1ZT7A 4OCWL 1WWCA 3NFSH 1RZJL 4UDTB 3I02B 3LKQB 2C1PB 2XN9A 1P53A 3I6LE 4QNPE 5I0DA 4WW2C 3VWKC 3MRBA 1C5BH 4NQCB 4PJIA 5BOZG 2R4RL 3NVQA 5HPMA 3QH3B 1K3ZA 4KXZI 3CDGB 5E9DD 2RCSH 1U42A 2GITA 1BIIB 2YRPA 4DUVA 4PJDA 3ULVH 1CD8A 3ROOB 3VXTA 2WBJB 5I66B 3HAEH 4ODXB 1SY6A 4NO2A 4Y2DA 1DTUA 4PJFF 1RI8A 1E4XI 3D5OF 1PBYA 3PQYD 3IDGA 3V4UL 1A6TA 4CU8A 1RUAH 4DEPB 3BFOA 4JDTH 2GSIB 4R4ND 5FKAA 1I3RB 5C9JB 4OLUH 3BDBA 5DO2D 4KUZL 2DTSA 2FWOA 3TESA 1UVQA 4Y7MA 4F9LC 4X4YA 5FA3B 1JF1B 2PTTA 3MBEC 3KLSA 3BGFB 4HXBL 3HMXA 2NW3B 1EPFA 1NLDL 3HPLA 1KJ2L 1X5HA 2KDGA 1LEGB 4X6BA 1NAMH 4HZLB 5DJAA 5DGQA 1FNGB 3LV3A 1N6QH 4KWUA 4R7DB 5FO7B 2DQFA 3U79A 1RAMA 3BAEL 3VMNA 1RZKC 4G6JL 1LEIA 3NOIA 2AJZB 3FHAA 4OGYH 3V6OC 4ODWA 1ORSA 2Q76A 5FUCC 5KSAA 4FP8L 4DQOL 4JY6A 1A6UH 4JFFA 4UAOC 1NL0L 1FVCA 2NMSA 4S2SB 3SDAA 2H2SD 3QJFB 1HHHB 5D7SL 1KULA 1CN4A 4CVUA 5E8NA 5C0FB 4E41A 4MAYD 4M62L 3BUTA 2AEPL 5KSBF 2QSQA 1RZKH 3V4VL 4U1NA 4WDIA 4XWOC 3A6OA 3FT3B 3TJEL 4IIQA 1FE8L 5GISH 1MH5B 3MLVH 4X98A 4YDLC 4WIQA 3O3DA 4L8BA 3CVIL 1YNLL 1UJTA 2DQGH 3GSOA 4Q74A 1I8MB 4LGPB 1DEEA 2W60B 1OAZH 4LFHG 4P3DA 3HS0B 3QUYA 4N0CD 2OR9H 1OL0A 3WKNA 1T1WA 1JGEB 2DYPB 5AYUH 1U92A 2J8UA 5C1MB 3BKCL 3V0AC 1Z5LA 5I18L 1FVEA 2FZ3B 1YEEL 4CVWA 4X9IA 2XTJD 5L6YH 1R3JB 3PWPD 3DETD 3LRHA 1QNZL 4F80A 2PCPB 4MA1B 5BV7B 4K7PX 3GMQA 4P5TD 2MKWA 3RWHB 3HTLX 4Z7VA 2R23B 3C60C 1WFUA 5CZVL 2G5BB 4XAKD 3I3BA 4Z7QE 1FG9C 2Z31A 4MD0A 4JJ5A 1VDGA 2VDMH 5I1AB 2VZSA 1YYLH 2QQKL 3VFSA 5AZ2L 1LNUA 3EYFA 1CGTA 3ARDC 3DLQR 5AD0A 4PGBB 4B50A 4PV8B 4D3CL 2BSRB 3D9AH 4HT1H 3PXJA 4BELD 4TULH 1DFBL 2JJSA 2HFGL 2EEBA 2EIZB 5F97E 4LLDA 3HI1A 2CKBB 1KACB 4OTXH 2EDHA 1PZ5B 1XF5A 3RL2A 2R8SL 4WI7A 3FO0L 1EK3A 3CLFH 4PS4H 5DJ6B 1XF2A 5TGBA 1JK8A 4PPTA 3T3PF 3BEVA 4ZPTA 2XZQL 1VGKA 3MV11 2KZWA 3R06A 3VRIB 2E7CA 2EZ0C 3T08A 2ZUQC 3MLUH 5L0QC 4L8CB 3ILPA 4L4TA 4ZYKA 4EEEA 1H8NA 1FORL 2X4PB 3A67L 3OQ3B 3W0WE 3KHQA 3N06B 1BOGB 4LLQB 4GS7B 3MLPA 1T2QL 1GL4B 4HJGA 2ZUUA 2VLRA 1OAKL 5FHAH 4BSWB 1X5AA 4ODSL 2JB5H 4RA3A 4YHZH 1XIWD 2XZCH 3MXVH 1YJDC 4Y8AA 2A6DA 5DJDB 4GG6E 4HKJA 1A7OH 4KKBC 3T1FA 4LPWA 1AD9A 3MJ7B 3K0WA 2Z91B 3TT1H 1MRFL 1RZJC 1N7ML 4H26B 2V7NA 1MRCH 4Y4FC 1Q9LB 3OL2A 4MS8C 5GXBB 5DD5H 1SEQH 4Y5YC 2VN7A 2DKSA 1RZGA 1Q8MA 3WIHL 3TIEB 5I1JH 3GSWA 5ESAB 4AQOA 1T5WB 4HC1H 1QQDA 3LS4H 3WL9B 4U6TA 4NFBA 3HZYB 3T0EE 1J1XL 2KUTA 1QLFA 4K71B 3QIWB 4JEGB 5D1QD 3CXDL 3LIZL 3QA3A 3KPLB 4D9RE 4J6RL 3L5JA 5FO8B 3X3GL 1KB5H 2BNQE 4P5MB 2FJGB 1BQSA 3MLRL 4P57A 2BC4B 3FN0H 5CEYA 1NCNA 3K4AA 2X70A 3BP4B 5T1KD 3W11D 3TN0D 1HSBA 1R3LA 4X4XA 3RIAF 3D69B 4QGTA 1CLCA 4ZXBD 1QZ1A 1UKTA 3RKDC 3B5GA 1WUNT 3ABZA 4X4ME 1JZ6A 3QJHA 4JKWA 2VC2L 4JO1L 4C56E 1YUHB 3MRHA 3V5KB 1DUZA 2UZXB 4M8QA 3V4UH 4JM2D 4R26L 4MD5A 2BNQB 3S6CA 3BISA 3GSXA 2AW2A 3PGFH 3GUTB 1CYGA 1SM3H 4JG1L 4ONGL 1OGTA 4RGND 4LHUD 2OSLB 2ATPB 4WHYH 3OWEA 5CGYC 2EDTA 3QXDA 4H1LA 4I0PD 3PWJA 4C54A 5FV2A 4C56B 3F65A 1RIHL 4NFCA 4GKSB 2CGRH 2FIKA 3DSFL 3O6FB 2VRAA 1HYRC 4NZTH 1S7XA 4I13B 2E8YA 2IADB 5F7MC 1V3MA 5J6GB 4J3OC 3QDJD 3BAEH 1UB5B 4XPGL 1J7VR 3C5SA 3PP4L 1CD0A 1L7IL 1DLHA 1T7ZA 2AS5M 1IGMH 3GMNB 1JV5A 1KB9J 2G75B 1LO4L 3QIUC 3K74B 4PJCE 1CT8A 4TVPD 3AREB 5ACMA 4U1HA 1MRDL 4DQOH 3LKSB 1XZ0B 5LJYH 5IW1B 4J8RA 2JTDA 1WT5A 2VYRE 2X6MA 2D2OA 4TN9A 3T8XA 1MIEL 4KHTH 2DB8A 3L3GB 2VDLL 3FQRA 4F7CA 1EBAA 4P2QE 1W72B 3NAAL 1AR2A 1N3NA 5HHOD 5D2NC 2Y5EA 5JO5B 2AEPH 4HUVB 1JGLH 4P4KA 5DHYA 2DQTL 3QHTC 4PJCB 2HJKB 4PJ9C 2YSSB 4NDMB 3TJEH 2OZ4L 3J8F7 4K3DL 4CN4A 5KBNC 1GIGL 3IJYA 2CLVB 2ICEA 4GMSH 2VDRL 5EOQL 3SDCD 5CJOL 3FZUD 5LWYL 4Y19D 4KTEH 4P2QB 4NQDB 4PP2A 1OAXH 4OD2B 5HYJA 1HXMA 5DD6B 2I9LB 4N68A 1JYNA 3HE6B 1AGEB 2A73A 5I18H 5JPMA 5HHVH 5FK9A 4KROB 1A9EA 2WUBL 4CNIA 3Q48A 5F7KC 1Q72L 2YK1L 3U4BH 2RQ8A 4D94A 5JHDA 1QNZH 4ENEC 3V95A 5BS0A 1JFQH 3GIZL 5JA8B 2N56A 1IKNA 3G04B 4YXHL 3NPSC 4PGCB 4KY1H 1F3JA 5D7IA 4J23A 3L7FA 2DS4A 2JF1A 4M6AA 1IC7L 1U8JB 3BD3A 4O9HL 3RVTD 4Y16C 1YN7A 1DE4B 4XNMA 1X5GA 3LKNB 4J3WA 2J4WH 2XG5A 2ADJB 4LK4A 4L29A 4XB7A 3TO4C 5MI0B 1PEZA 4D3CH 3RTQB 1BWMA 2IALB 4OZIA 5EBMB 5JW4N 5JOPE 5EO9A 3SKUD 3NA9H 5DJ0B 2HFGH 3GGWB 5EU4A 4X7SH 5GGTH 4HS6B 4N8PA 5C6TL 3GSVA 1KT2A 4KRPC 3FN3A 2FEDC 1CGWA 1FNEB 3FL7A 3D2UA 3EJYC 3L3JA 2DQDL 3B9KA 1EZVX 3IDNA 1KTLA 3QISA 4MVBC 3WS6A 2R0WL 1EMTH 4ZFOL 5HI5C 4K8RD 5HI4D 4BUHA 2FYYB 2HN7B 5E8OB 3S8WA 3A67H 4LVOC 4KI5D 3ALXA 3O2DA 1CXHA 1F4YH 5LXGH 3ARRA 2E27H 3GJFK 3BJ91 1FN4A 3P9LA 1KPUA 1G9NC 1BAFH 3P0GB 4HIHA 4J4PC 3RVUC 1TZHB 4LSSL 3MRFA 4XNQB 1I9JL 3HC4L 3LVEA 4LKXA 5ABDE 3QUZB 5D7JB 2V2XB 4FXGB 1ZLVH 4WFGE 3QAZC 3TNMA 3IDIA 4N90E 4ZPVA 1MRFH 2DI7A 1QRNE 1VADB 3E8UL 1XF3B 5IK3B 4J1UA 4BSJA 3MGAA 3CSGA 3QWQB 4UDUA 1IGYA 4WW2B 1F6AB 1MCPL 3OSKA 1G9NH 1A9BB 2DLFH 5CLWA 3VCLB 4LMQI 5FF6A 4HUMB 2QEJA 3RWFB 3MRNA 4Q6IA 2G60H 4K3JH 5EOCH 1QRNB 5EZJB 1L0YA 4CRPA 1GC1L 4Y5VC 4NCDA 3SCMC 3LIZH 4JANB 1F3DJ 1NAMB 2WWKO 4J6RH 5I8EA 5JW5B 1UT9A 2ZUVA 4NT6B 4MCYA 5CS7A 2OJZH 3KLAB 1Q9KB 4OKVA 2O5ZH 1LP9E 2J2ZA 2HG5B 4GAYA 3IFLL 1K8IA 5ESQB 1L7TH 2P42B 5CEZL 2HRLA 4JQXC 1Y6NR 1EO7A 4RRPG 1QLEL 2EDXA 3MNVA 1G7PA 5I2IB 1RD6A 2SEBB 4R26H 5T3XH 1IZJA 5J1TC 3ZL4H 4ONGH 5DHVA 4M00A 1BBJB 5DTFB 4JFXA 4UIKH 5LGJA 3ILQC 3QZWG 5J9PA 3E3QC 2CR3A 3ARBC 5F1NB 3G5VA 4WO4C 2OL3H 3IXAA 2FHFA 5I1LA 5GGSA 5C86A 1Y0LA 1FL6A 1LWRA 4G43B 3DSNA 1M7IA 3QUKA 4G80B 3DUSB 2QKIA 5AZEL 5GSVB 7CGTA 2DQCL 4PJGF 3PP4H 1JNHB 3U0TA 3VXRA 1L7IH 3S36L 5T1MB 4PRIA 1LO4H 1EEQA 2CDGB 1R3HA 1OGAD 1UENA 5E7FA 3KR3L 4OFVA 3IXTA 1IBGL 3WFEL 5F6HJ 4F33B 3O6LH 1F5WA 1QLRB 1OVZA 3CZFB 1MIEH 1TCRA 2ATKA 4CU7A 2VDLH 2F9BT 1MJUL 4M6OH 1IARB 2H6PA 1YNKL 5IVXA 2UY6A 5JIKA 4KMTL 4WUUA 2X4NA 3UZVB 4LVNC 3VWJD 3BZDA 4FZ8L 4MHHI 3DHMA 3EO0A 4GBXD 1GIGH 1K9TA 2P8LB 5D2LA 4M7ZB 5IB4A 4P3CL 3RGHA 1BBDL 1XR9B 2P5EA 2OLDA 5CJOH 4R2GC 3S3PA 3SPVA 4QY8B 2DQHL 4PJEF 4Z76A 4KKCD 3VI4F 2YC1A 4GAGH 3DV4A 1H5BB 4JB9L 2CUMA 4KJWC 4L4VD 4M6ML 3MTRA 1P7QB 5EO1B 5JQ6L 1RK1A 2YPKB 4BZ2H 5IMMB 3J7HA 1FO0L 3TVMB 1Q72H 1CIUA 3DJ9A 2OXGA 3U36A 2MTPA 3E2HC 5GGRB 3X13B 5TQ2H 3GIZH 1EEUA 3O3UN 4HFWB 4Y4HA 1VPOH 4U1IA 4I77H 2BSTB 4QO1A 5GZNC 1IE5A 1A47A 1B6UA 1YN6B 1KPRA 5F1IA 3DBXA 3RNKA 1M71B 4FQXD 4OBRA 3O4LA 3C5ZA 5HGAB 4WFFD 3MV7D 3WLWD 3DWTA 4RA0C 4L3EE 4HUXB 4N8VA 4JDVA 2EE9A 4YK4B 5H37G 2ED7A 3BOVA 1VKXA 4P2RE 2P24A 4B7IA 2VXVH 4O2FB 4G6AC 4GQ9L 4QYOB 5HDQH 4OLXL 2EEDA 2D03L 1EHLH 3SKNB 1T0MA 4Q9CA 1KTKE 1RMFL 3MLWL 2Y72A 3BGMB 4YIQA 3T4AA 2I27N 1XGTB 4LLUB 2IH3A 1TETH 4L3EB 4IM8A 2F53A 4IMLB 2AJXL 4FQIH 3B43A 5CBAB 2R0WH 1G6VK 3ZYIA 2I9TA 4YZFE 3P4NA 3EYQC 3BDYL 2CPCA 5GS1A 2BVPB 4JHZA 5FYJD 5E8PA 3B2UC 4LHQB 1R5VB 1UH3A 2DIBA 3DVGB 1B9ZA 1ZLUK 2E6PA 2P8PB 4Y5YB 3L3IB 5TF0A 1KB5B 3R1GH 5LVEA 2K3TA 3NZ8A 5TH2A 4WI6A 4U1LA 2PYEB 3I02A 2JKXA 5JW4Q 4MXQD 4KKAD 1VEMA 4LVHB 3FQUB 1GC1C 2VAAA 3QR2A 2IAMB 2IH1B 4OGAC 4JHAH 4OFPA 4R4BB 4HX1B 3PHQB 4Q2ZB 1MCPH 3CDGA 4JZOB 1CE1L 4WU7B 3TYFA 4KK6D 3LQMA 1HH9B 2ITDA 3OKNB 4MSWB 2EXWC 4NUGL 3RGVC 4ODXA 3EOBB 3GKWH 2IEPA 3QEHA 3MRKA 1OARH 3C09B 4R9HA 3WEXB 1D6VL 5KS9E 3ARZA 2KQMA 5IJKA 1IILE 4JO4H 4PR5A 2BSSA 4F7TB 1SJHA 2X2YA 4CMMA 3QZWB 3QRFM 4GXVL 3OV6A 4UT6L 3LY6A 4APQD 3QB7C 5I1GL 32C2B 1CU4L 4O4YL 3V4PL 2A6KA 3BZ4A 2F19L 2AK4D 2J8HA 3HMWH