4KUCF

Crystal structure of ricin-a chain in complex with the antibody 6c2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
b'QQPGSELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPGSGRTNYDEKFKNKATLTVDTSSSTVYIQVSSLTSEDAAVFYCVRWVYGNFDSALDYWGQGTSVTVSSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Structural insights into the neutralization mechanism of mAb 6C2 against ricin
rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 18
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kucF00
5C0BD 4NM8H 2VDQL 2DAVA 3HUJA 4PB9L 4MWFA 1GZPA 3TT1H 4LFHG 5AWNH 3VWKD 4PBVC 2V2XA 1FFPA 2EXWC 5M94B 2HTLD 4PLKD 1TMCB 4YXLL 3BP5A 2FD6H 2HT2C 1Y0LA 2EC8A 4GMSH 3B3IB 4QYOB 3NIGE 3VI4F 5ADOH 3MRPA 2VRAA 4HMDA 1T0PB 2OR9L 2VLKE 4HIIB 3KLAA 2BZDA 4FQJH 4YFLI 4PTTB 4E41E 5KOVC 4FXKA 4I5BB 3NABH 1XGYH 4K71C 4GAGL 5JA9A 1RJYB 3GDBA 2DYPB 4X6BB 1NFDB 2R15A 1FNFA 1O0VA 4P2QE 2VQUA 2XNAA 3LN9A 5ANME 5EZJA 3GMRA 3JV5A 1S9WA 4AH2B 3QXDB 1MRCL 1CL7I 1FP5A 1UZ6E 1CF8L 2X7LB 1IAOA 5C3TA 4ODUB 3ZE2E 1N4XL 3KPPB 4N90E 2CKBA 5F6HI 2DQEL 3S96A 3PWPB 1ZA6A 1M7DB 3THMH 3ULVH 4HEPG 4LEOB 2IWGA 4DFHA 1DFBL 1HH6B 2C5DC 2YA2A 4HXAH 1JHKH 1HDMA 2WP3O 2ZCHL 3DMMA 3ZTJG 12E8H 1PEZA 1U0QA 4R4BA 2HFGL 1X5ZA 3LSOB 3TN0A 1D9KD 4ZO7A 1RD6A 3FQUA 1D5BA 4HT1L 1LE5B 4MVBD 4XC3H 1CXKA 4YXKL 4HULB 1PYWB 4L8SA 4S1SH 3WIFB 5HYFA 1JPTL 2VR5A 4Q9BA 4DK6A 3GRWH 4MAYD 3NACL 3CVHL 4NQED 2W0FB 1XGPB 5HVHB 4KPHL 4NC1C 1I1YB 4OCLC 1OW0C 2G9HB 4RX4A 1FH5H 3ARBB 1HINH 2WNGA 3R1GL 5IOPB 2ENYA 4YWGL 4U1SA 2W0LA 3X17A 3CFIC 5J1AA 4RFOH 1LEKB 4EUPH 5KSAD 4Z7UF 5HYJD 2B39A 3SKUD 5I1HH 5DEZA 2EKSA 4MJ2A 5E6ZA 3QISA 3PWPD 3ZMRA 4X6EB 2BNUA 1FL6B 1P7QD 3PQYB 1KEGL 2XWBB 1HHGA 1IM9A 3PWJB 3BIBX 3Q0HA 3HUJF 3U4EB 1CFNB 1UJTA 4X8XA 1G7QA 5F9DC 3X12A 4KKBC 5BZWB 1A0QL 2VO5A 4M3KB 4HK3J 1DLHB 5EA0L 3IJSA 3ORJA 1ROWA 3QH3B 4MZ2A 2H6PA 3OAZK 3IJHA 4MDJA 4XXCC 4P2QB 3OKDA 1WT5C 4TOYH 3EO0B 3KXFA 3QA3A 1A6AA 1KB5H 3SQOL 3IKCB 2IJ0C 3TIEB 4C55A 3ARBC 3EHBD 2ZP0T 3FQXB 1PX4A 2EYTA 5CCKL 1FNHA 5DTFA 1X7QA 1KEMH 1MHHB 2V7NA 3HLAA 3PXHA 5EOCH 2OZ4L 2GYSA 3O6FA 3MLWH 1OOAA 3KYNA 3NCCB 4OZFB 5I1KL 3C8HA 3AXLA 1MAKA 3SDAB 3ARBD 4E42B 2VH5L 5HHOD 2CD0A 3OKMB 1XCTB 5KSBB 4P3DA 2R4SL 2R2CA 2UUDK 3TYFA 4JM2A 1QSFE 4HX1A 3GK8L 5CINL 5I19H 2VLRB 3O6LH 2WWKO 4ZUUB 5TQ2H 4XMLL 1NGXB 3VJ6B 1CFTA 4GLRH 3SOBH 4E0RB 4NO0B 1ZLUH 2C1PB 4G3YH 1QNZL 3RVXC 3VFSB 1ZT7B 2O61A 3QUYA 3CUPA 4IHOB 3MBXH 3QZWG 4TVSa 4R96A 4GW4A 2VYRE 1WK0A 1VEOA 5FUOH 1BD2A 1X5HA 5DFWH 1U8PA 5GSVB 5A1AA 3B9DA 3T77A 1G1CA 5HDBF 3V4VH 2JELL 3MLYL 1MWAL 3WFZA 4M4PA 1HHKA 2NX5E 5HI5D 1KIRA 1V05A 3KPMA 5ITFA 2ZG3A 1D6EB 5IBUG 3SDAC 2PTTA 1N26A 4JY4A 5JOFB 1R3JB 5ABDE 1E6OH 1BP3B 3OAYK 1Q0YL 4B0MM 3WFBH 4BSVB 1YA5A 3IDJB 3HE7B 3SKJH 4XNYH 5H35A 1KTKE 1AHWA 3UTTA 2VLLB 4MB5A 2JIXA 2AXFB 2EH8H 1U8KB 3GI9H 1NBZA 3QP3A 4YHPB 2DRUA 4TUKL 5GS2H 1RJCA 1IAMA 1Z0NA 4UMGA 1Q0XL 3VFMA 4FQLH 4EOWL 2ICWB 4P9ML 3D39E 2HLFC 1DBJH 2NTSP 3ET9F 4CVXA 4S0SD 2GUOB 3CMOH 3EJYC 4JB9L 4S10A 3BP6B 4MS8C 3QXAA 5CSZB 3BHBA 4M43L 4CMMB 3WLWC 2O5ZL 4IDJL 4KRPB 4MHHG 4JPKL 3ZHLA 2VITA 4L8DA 5C0DB 3N85H 1CU4H 3WS3A 1G6RL 2BVOB 5INDB 2F54E 5JPMA 1CXHA 5FM4A 4MS8D 5IT2L 4NNYA 1MFEL 3HE7C 1J1XL 4PJAE 4HWUA 1UM5L 1ZHNB 3JWDL 5DEFB 1A1OA 4LLDA 1A7PH 3HR6A 3L9RB 5DYOA 5I76A 3ECBB 4PB0H 3S8WA 2KBGA 3S4SG 4U1KB 2AK4E 2BVEA 2ICES 1MLCB 1HIMH 1DUZA 1TLKA 3JV6A 2YKLH 4XVUD 4JHBA 5DS8A 3GO1H 3D2UD 5KOMC 1MHPH 4KK6D 5JHLH 5HSFA 5K33A 2QL1A 2CR6A 3F5WB 2VLMD 4KRPC 4JM2F 4PRIB 4XI5D 3RY5A 1AP2B 3FQWB 3MODH 4LKCA 4NUGL 5LBSL 4Z0XB 3IKKA 3EDJA 3DXAB 1NMCB 3TJHD 3MFGB 1VACA 3LMJL 3ZHDA 4NO2B 3A6BH 3LKSA 4KRLB 4H0GA 1AXIB 1N0XH 2IEPA 2XN9B 1E4KA 3ZDYF 5FKAA 5C07D 1OQOA 4KRPD 5C0IB 1UB5A 4ELMA 4OLXL 3ZT6A 5HDOA 4PJBE 1I9IL 4YO0A 1J86A 3G5YA 3SKNB 4MHHI 4NHUB 1UGNA 2DQHH 5GIRA 4KQ3H 5C8JA 4PLJC 4OCYL 2E7MA 5IB1A 2BY3A 4UI2A 4F9LA 1OB1B 3P4MA 4GBXA 3O3EA 4X6DA 3SE9H 2WWMD 2FSEA 3RJDA 1AXTH 5LXGL 3LCYA 4LCWD 4YFEA 4GG6E 2N1KA 5C09D 3TNMA 2CLVA 4I77H 1E27A 1NMCC 3Q6FA 3WN5A 2BC4A 1BZ7B 3TO2A 1TVBB 3L3OA 3MJ9H 3SDXF 4E5XB 1RZKC 5HDQL 5I1LA 1B0WA 1FZOB 4PRID 5EU4B 2YXFA 2X9XA 4ERSL 2XIDA 3DXAD 3QUKB 4O2CA 5CZXD 5DD6A 5J6GA 4PJAB 4Z18A 4DK3A 3HS0B 2BSRA 3FT2B 4ALAL 3WD5H 2XN9D 4RMWA 3OSKA 4KV5E 1EEYB 1KTLA 4I2XE 4GMTH 4JFFD 3MFFA 4JKWA 4ZPVB 3MGTB 4QY8A 1XIWA 1QQDB 1BVZA 4LVEA 4PRPD 4ZDHB 2FWOB 3OKNA 4MCYA 5KJRL 2YD8A 2V5TA 3MRNA 1F4WL 5KSVB 3REWB 4IMLB 2IF7A 1GPOH 3MRHA 4WIQA 4DGYH 4NFDA 4GW5A 1A9EB 3LIZH 4N9GA 5DMGD 4FQ2L 2X4SA 2W9LA 4AG4H 3H3PL 3GMQB 3ZYJA 1NC2D 3IDNA 3D85A 2WP3T 3T1WA 4KJQD 4F80A 4BA8A 3S34L 3ARTA 1YC7A 4JHWH 3V6ZA 1CT8B 2DQCL 2DM3A 2BNQD 3HG1E 1W0YT 1N7MH 5GXBB 3T08A 1UCTA 3J7HA 5D7JB 2FX7H 4J3UA 3K1KC 3CLEH 1S7SB 3UTSE 4Y5XA 4G6AD 4FQ1H 2DL9A 1FO0A 3SY0A 3RWJA 4Z7WA 5IJKC 1KG0A 4CW1A 3IXAB 3PHQA 3QR2A 4JFHD 4ORZC 1T5XA 2QBWA 5IFJB 4JLRB 5JDSA 5GS0L 1TZHA 1F4YH 4LOUC 3ULUD 4JG1L 4BJLA 4IEFB 3ILPB 4ONHB 4GG6B 3BW9B 1TVHA 3EYUH 2J4WH 3GSWB 3G9VA 3NN8B 2QADD 4R6UA 1W72A 3QO0A 2VIRA 4HFUH 4OF0A 4RGMB 5JW4Q 3OG4B 2XTJE 4FFYH 2OP4L 1C5DB 1Z9LA 5CP7A 2Q8AL 3G6AB 1T80A 1I9EA 2A9ML 2BSSB 1JFQL 2FO4B 5KW9H 4P46D 5EBMA 3ZKND 4X6DF 1IT9L 4WFEE 1VHPA 1A9BA 3FB6A 5D7JC 1MNUH 4X0KB 5DZNA 3QBTB 5INCB 4Z77B 1FCGA 5FO8B 4P2RE 2NW2A 2MNUA 5MP6H 2D9QB 1JNNH 2UY6A 4L3EB 3TFKC 1EHLL 2J6EH 4MXVF 2AXGB 3BDYH 3PL6A 2A6KB 5FM5O 3EOAA 4X9HA 2CUIA 5F96H 2IPKB 3MRFB 1N0LA 3U48A 4G5ZH 4O58L 1OAKH 1T04A 5JPNB 4QHMA 4L4TA 5B39A 4ZAKB 1NL0L 2VZVA 2HWZH 1XF5B 2QSVA 3G08A 1NCNA 5MEQA 3QIWC 2YK1H 3C8KA 4MQXC 5B38B 5IBTH 1N2RA 4U7KA 2VXSL 4RGMC 4JY6A 4YPJA 3MR9B 4Q9RH 2ARWA 2ESVD 2VL4A 2ZZUT 5D7IA 5IM7B 5GZNC 3I6KA 1CIDA 4P3WA 1VA9A 5K59E 3MO1A 3QIWD 3CVHB 5B3NA 4R8WH 5E6YA 3HG1B 4WUUB 4HXBL 4HJGA 1NCBL 3QWRA 4QRPA 2WWKT 2V2TB 5F88B 5GZND 1DL7H 5FDWB 5IKCA 1G6VK 2Q7YB 3FT4B 1NUFA 3NCYP 1DLFH 3LKOA 2HKFH 4X80H 2DLFH 1REIA 1YJDH 4U33A 4WUKL 4QKXB 1RV6X 3UTOA 3O3DA 4U1NB 3EGSA 1CFVL 3BMWA 1H3PH 2WW8A 2MMXA 2ZUWA 1A14L 5D5MF 5J9PA 3S9DB 5FAAA 4OLVL 2BNRD 3QXVA 3NFNB 3RY6A 3UROR 3ZE1F 3BWAA 1G1YA 1WGOA 3HC3L 2IH1A 1QSED 5D4QA 3MRIB 3O41B 4LLYA 4L8CA 4WFGD 5E99H 3UZEA 4Z7WF 4LLWA 5EO1A 4NKOB 2NY0D 1JF1A 3TIDB 4LF3B 2XZZA 5IW1A 2F5AL 4WHYH 3AS0A 5BMFH 1SJHA 2HKHH 1DBBH 5H94A 1ZLSL 4WHDA 4KAQL 5MENE 5ISZA 3DX9B 1VPOH 2JLLA 2LABA 3PDGA 3NIDF 3IXTA 4DTGH 4FFVC 4GKZB 5EZLB 5C08D 3ZZ1A 5GJSH 1JP5A 5LGJA 1RIUL 2HFEA 3GSRB 5EOQL 4IMKC 3ULVF 2P5WB 1MJUH 5DQDL 3ULUH 5DJ0A 1BWWA 3LQAL 1OP3K 4LGRB 1MI5A 3FQNA 1GGIL 1NGYA 3KYMA 4NQTA 4M6MH 1IKNC 4PGEB 5EZOH 4R4ND 2DM2A 3HZYB 4OGZA 4OD3H 4WW1A 1BBDL 1BEYL 2NTFA 1Q9KA 1N5YH 1HHHB 5D1XA 1AFVH 4OUOA 4JPWH 5T1LA 4ODVH 2BRRL 1T1XA 3B8SA 1I1AB 2XZCL 1XH3B 1BVKA 2WIMA 1W0WB 4W81A 4G8GE 4QXTA 1UA6H 4P4RB 1QFWH 4LNRA 4HWEH 3D3VA 3O4LE 4AYFA 2BK8A 3VXRA 4KFZC 5EU5B 2GFBB 3RU8H 1Q94A 1AI1H 1MWAB 2OJEB 4H26B 1FYHB 4D9QE 4FABL 3C9NA 5D7IF 1U8IB 4MMXC 1TJHH 4IBLT 3QIUB 1S9KC 2D0FA 4QF1B 3H8NA 2KL6A 4DJMA 3H9HB 4M7LH 1YQ2A 5E94B 1C5BH 3EYQD 3X3FH 4QGTA 2QQQA 3MRBA 3RGHA 1YYML 1EZVY 1OSPH 4XBGA 5I1CL 4K07A 1IGCL 2NR6D 1I1AC 1OGAA 2RCSL 5BJTB 3KPRE 2UY7A 3MLXL 5ICZA 4EI5D 4U0QB 3BQUC 2CIIA 1H15A 1RUPL 3T4AA 2KDGA 4PRHB 5DRWB 2BXYA 4G9FB 1HHJA 5MENB 3T3PE 1I1CA 1G9NH 5L2KA 3WKNA 5I18H 3A0OA 1S9VA 5E6ID 2UZXB 4XNUH 1KTDA 3BQUD 2DM4A 1DQMH 2ERJB 3QIUC 3RVWC 3CSBA 3HI6L 1XR9B 1R24B 2SEBA 4Y19E 4KI5C 4LLMB 3ARXA 1FYTD 5SWSB 3AS3A 3GJFB 4UU9B 2NXYB 4NQDE 1RK1B 1EHXA 5T3XL 3CC5A 4NNXB 4ENEC 2AJSL 2FLBT 5JUEH 4Y88A 3OJDB 4D94A 2H32H 2EE6A 1Z9SA 4LPYA 3S36L 1FGNL 4N0CC 4X4ZA 2FJFB 1UXSA 5IFHH 3C5SA 2YWYA 3WUWG 1H3VA 1F8TL 2CJUL 5FYJL 3O4LB 5J8OA 4JZOA 1YMME 3KYKL 2AEPH 1K5NB 5A2FA 1IGJB 1HWGB 4UDUA 3MV8B 3MRJB 2ERJC 4MA1B 3U1SH 2XQBH 2BMKB 5M95B 1SQ2N 3FOLA 4MA3A 1KPUB 4ZQKB 4L5FL 1TTFA 2V7HA 1IL1B 3JWDC 2E8ZA 2NXYC 3VXOB 1ED3B 1F4XL 1MSPA 3W9EB 1NFKA 1WBXA 4TYUA 1VFUA 1Q9LB 4XP1H 1JYNA 1OAYH 5KN5A 5HVGB 3W0WA 1KEGH 3FN3A 4YHIA 1QRKA 1NMBH 1UXWB 4PJIB 2BHZA 5EO0A 1OAXH 1JV5A 4QNPF 4OF6A 2ZCLL 3VXTB 2F19H 4NZDA 5HI4D 5I8OH 1BHGA 1NBVL 3QPQD 3QUXA 1ORQB 5GRVK 4BZ2L 5KSUB 4POYA 1WSST 1LK2B 1YN7B 2Z31B 5HGHB 5I1JH 1UZ8A 5JXEC 5DR5L 1OLZA 3MRQA 4P49A 1G9ML 4PUBL 1SM3L 1A6ZA 5JHDA 4KZEH 4OFYD 4MA1C 4EN3C 1T83A 5EN2B 4AENA 1F90L 1BQHB 5CCKH 1M71A 2FJHB 5DA4A 1RZFL 4DN4L 3QFDA 4XCCH 4OZHA 3RL2A 1HEZB 4XHJC 5K9OA 5CLWA 5CS7A 4QRQA 3SE4A 1HXYB 4R7NB 5HXMA 3NBNA 4Y19B 4NKDB 4EN3D 3MNVA 5KVDL 3TZVA 3KHOA 1I7ZA 5ERWA 1F3JB 4OD2A 4RWYH 4KK9D 4N0FA 4MX7A 2R1WB 1ZTXL 3BESR 4LIQL 5CINH 1CWVA 1JN6B 1HH9A 3W9DA 5C0RL 1OWWA 3UP1A 1PBYA 2Z31C 1NDMB 1BVLB 1S7RA 1FVCA 1IFHL 1YEJL 5LGHL 3B2VL 4JPVH 1J18A 3FFCD 4X4ME 3QUMH 2MJWA 3MLZL 4Z7NE 5IFAL 4HIJA 4I9WE 4FZ8H 3HUJE 4XBPA 2OX5A 4BFBD 4HHAB 1TFHA 2IG2L 3C09B 4BQ8A 3C2SA 3QDAA 5D71L 2ED9A 3FQTB 3C5ZB 4MJ6A 4RAVB 2JB5L 3DX6B 1S9YA 1CGYA 3Q1SH 1RMFL 1NJ9A 3K8KA 4RIRB 5DJZA 1I7TA 4HV8B 4R7DA 4JGUA 5SX5K 3UO1L 4P2OD 3L3JA 1EMTL 4RAHA 1KN2H 3A6CL 1T7VA 3ZYIA 5E00B 1J11A 4UTAL 2PCPB 3MRGB 4Q0XL 2B1HL 5BW7A 2DLHA 5ICXB 2AABL 5IB3A 3U9UB 5BS0A 3F7YB 3ARGB 3MLPA 4YHKL 1QFHA 3LY6A 1OGTA 2FHFA 4XWOC 1JZ3A 3WIIL 2D0HA 2AV1A 4NQCA 3KPQB 3GBML 1NC4B 5ILTH 2CLZB 2GT9B 3FB8B 3WNPA 3C09C 4PG2A 3KGRA 1G7IB 2D3VA 1G6RH 4WEBH 3TYGL 3C5ZC 1N6QL 1WICA 2IADA 1QSVA 2E7LC 3O2WL 1FDLH 4OZFG 5FECB 4JFDB 1Z3GH 4S1RL 3DRQB 1UM5H 5CP3H 2DWDB 4XZUB 4OB5L 3PGDB 1QO3A 4AEHH 1NLBL 3VXMA 3MA9L 1F6LL 2X1OA 3O3BB 5B3JF 4NCC1 5ESAB 5ID0B 3WS6C 5CIPA 4APQD 5D72L 2A9NL 3VXPA 5GS0C 4LRIC 5C86A 4BH8A 4DOHB 1BGXL 3FRUB 4OZHF 4YBLB 3S35H 2BJML 1ZLWK 3OKKB 5D7SL 1CQKA 2HJKB 4GRLA 3RWEB 3ARGC 5DVOA 3X3GL 3E8UL 5J56B 3PWLB 1A8JH 4MXQD 1KCRL 4KUCF 2RGSA 5EPMA 1YNLL 1AKJA 2AQ3A 4BYHA 1JNLH 5E4IA 1R5WB 3DX8A 5CGMA 3DUSA 1HCFX 4ONGH 3ARGD 3EOBA 3IFNL 4LPUA 4ZPTB 4YFLF 1U92B 5ENWB 3MRPB 1B4JL 4R97B 4OZ4B 3P0GB 2M26A 3CFDA 4CDHA 2VLJD 4ZD3L 2RAMA 5DD5H 1GRWA 3WL9B 1UKSA 4FP8H 2W91A 2R29H 5MHSD 1AQKH 1AD9A 2W60B 4X7TB 5T5FH 1ZE3C 5DF0A 5GGTA 3VFWB 4JFDD 4OCYH 3RL1A 4YBLC 1VADA 4M7ZC 5EFIB 4UIMB 2E7HA 1FFQA 3BISA 4YX2L 2VB5A 1H5BB 3BXNA 3QPXH 3KXFE 1EFXD 2EDTA 2OMBA 4FMKA 4BZ1H 1JGDA 1C16A 4JN2A 4LSPL 1XGQA 5E7BA 3BE1L 2I60H 3ALPA 3D0VA 3L5XL 4M5ZH 3DYMA 2HMIC 1INQB 3B9KA 1ZA6B 3D9AH 3BH9A 2Y36L 3EJJX 2W1NA 3IGAA 1FVEA 1VGKB 4HC1A 4R97C 5FM5M 1J88A 1AIFA 4IRJD 2DWEB 1QOKA 4I3RH 5JMOC 5HHNB 2HMID 5DK0B 3RTQB 5IB2B 2PF6A 1NAMH 4WRLA 3FQUB 4JFPB 3WFCL 1A47A 2HH0L 1EO5A 2ADFL 2DQFB 1UFUA 5IR1B 3GSUB 3OHXB 1H5BC 5E5MA 2QTEA 4ODTL 4HWBL 3I75B 3C60A 1U6AL 4YDJA 2UYLB 4YDLB 1ND0A 1EAPB 3L7EA 3GSQB 4JFQA 4JN1H 3E6FA 5DK2A 3MBED 2X4TB 5EBWA 3BRFA 3ISWA 4U6XA 1UEMA 2Z91B 2E6QA 5TDNB 4GAJL 4FQ2H 1BD2E 3LZFL 2OTUA 4NQXA 3MGOA 5EBGA 5J6HB 3QFJA 4LDLB 3U36B 2F53A 4X5XA 1CIUA 2EIBA 5AZ2H 1MCEA 5HHXH 4NJAH 4CU7A 5DDHB 3T2QA 2FX8H 5F1SA 3U46B 1MFBL 4P9HL 5HHME 3TPKA 1U41A 5MERB 3FO9A 3W39A 5E2WH 2ICWI 1YEIL 1N59B 2W65A 4G6FD 3VFGH 2VZSA 5GZOD 4K94L 3RTQC 5CZVL 1LP9B 3UTTE 1UYWL 3FTGB 3QT2A 4WEMB 1KV3A 5IB4A 3ARZA 4N8CL 4XP4L 4F8QA 1A22B 2PN5A 1HHGB 3QJHB 3IDIA 3JVGC 4DGIH 3VG9C 4TPRL 5T5NG 1VDGA 1YQVH 2X4OA 3QI9B 4HWNA 3WLBB 3GBLA 4I0CC 4YDLC 2W9EH 3CX2A 3V7AG 4F8TA 3U0TA 3HN3A 1QYGH 3NZHL 1MFDL 5CUSL 5B4MC 2ZPKH 2HJFA 5I17B 2CDEA 3QNZB 2W9DL 2R56L 3KPSB 1J8HE 3TLRA 2J7LA 1Z2KA 4NWUL 1BREA 3MCLL 4H1LH 4WW2F 1GOGA 1AXSB 4PJ9D 4KK8C 1V3MA 2OXHA 5C0CD 4YHML 1CK0L 3AREA 3FONA 1NUGA 4YLQT 5FCSH 1I8LC 4XP5H 3QI9C 1LE9A 3LB6C 1Q72H 3HRPA 4JRXD 3FO0L 4LSUL 4KK8D 3SDDA 1BJ8A 5IG7A 2X4NA 2YD6A 1ADQA 1M7IB 2EDFA 3WXWL 4C59B 5E8NB 5EUOA 4IOFD 1I9RH 1EVUA 5F9JA 2C3VA 1IAIH 1L9MA 4JKKA 2O61B 3WHXA 2W0KA 2FATL 4W70A 1KPVB 3LKNA 4NZUL 1D3CA 1SYVB 1S7UA 4GW4B 1RK0A 3ALWA 1FNGA 1OAUL 3WIHH 3HZVA 4Y16A 4DZ8B 4JKLA 4L3AA 3ALXA 2MHAB 2H3NB 5ESQA 3HRZA 3KPSD 4WO4D 1PSKL 1CFQA 4L1HA 2VWEC 35C8H 4ELME 5DWUL 1ZAGA 2PO6A 43C9A 2IMNA 4OSUH 3UTTB 6FABH 1IEAA 4LU5L 3S4SA 3X11A 2JIXB 5C70A 1TJGL 1B6UA 4N0YL 3L6FB 3EFDH 3RBSA 2Y5EA 1F6AA 5IROA 5JNYB 3LEVH 5DI8A 1SEBB 3PE9A 4NSKA 1T1YB 4OQTL 4RGOH 4Y2DA 5EOTB 4IRSB 1UH3A 1W0VB 1OTUD 2ZSVA 4X6DE 3DV6B 1CZ8H 3ARSA 4QT5A 2OK0H 3TBVA 1B0GA 2E9WA 3QUZD 3PDDA 4YEEA 1LD9B 2R0WL 5FHBH 2CIKA 4ZUTB 4Z8FL 4NZTL 1KENL 2VLKD 4QCIA 1KSRA 4S1QH 4S0TD 1J8HB 2VITB 3E1F1 5T3XD 3L5JA 3B6SB 4E41D 3RWHB 1P53A 1CGXA 1S8DA 2VUYA 1ZT1B 3RNQA 3UZVB 3TVMB 3MLTB 1YDPB 1GOFA 1ITCA 4EXKA 1A7RH 5ID1A 3HNSH 2H1PH 1QPXA 4J3VA 5EWIH 4KTDL 5EC2B 2A77L 5IVXB 2VISB 2CDGB 1JZ7A 1MCDA 3DBXB 4IRSC 3SDCB 5FYJD 3T2OA 5CAYB 3M1BA 4PG9B 1RIUH 3D69B 4ODHL 2IQ9H 3QHZL 2OL3A 4KVNL 1A6VL 2XWTA 3MUGA 3O4OB 5DQDH 1CLCA 3LQAH 2J3SA 4Y1AD 8FABA 1WZ1H 3GSNA 1JGVL 4DN3L 43CAA 3CFJA 1U3YA 1HSBA 25C8H 4K23H 5FGCB 1FG2A 1GC1H 1YY8A 4L4VA 3RZCA 3O81A 1BEYH 3BVNA 3F58H 4CJ0A 5JLZB 3RDTA 5B38G 4YDVB 5EU6B 4FZEH 4FQQA 5CEZL 3L3KA 5I9QB 4OZGB 1SJVA 3WFDH 1BM3L 1K9TA 3TVMC 5LWYL 3UBXB 3MJ7B 3KNBB 1G9MC 5EUOF 3IDUA 2VXTH 1Q9WA 4GG8A 1VFBA 3VXUD 3VMPA 1H3UA 4XVJL 2R0LH 1UB5B 4YGVB 4Y4HD 4HS6A 3MNWB 4GW1A 2GTZA 5E2VL 3VD5A 1G7PA 2AJ3B 4YK4B 3SDCC 2ORBH 2OTPA 3ZE0E 3TVMD 5GIRB 5C8JB 5D2LB 3L3GA 3HCVB 4FXGB 1F3RB 2XWJB 2P5EB 4EDXA 4PJHA 3WXVL 1MH5A 3NCJL 3TNNB 3WNOA 3SCMA 2A6IB 1X9QA 3UAJC 1J0JA 3SGKA 4HUVB 3JV0A 1A2YB 3NIDE 1JGEA 3O2VH 4F33B 3H9SA 1NCAL 3I02A 4JKMA 1GIGL 2ATPA 1LHZA 2V17H 5I9QC 4WDIA 2VR9A 1UM4L 5EU7C 3FMGH 5I1CH 3VGAC 4RBPK 2F9BT 1IC5L 3SPVA 5TE4H 4NN6B 1OY3B 1EO8H 3UAJD 2A1WL 5FHAH 2ENSA 2Q6WA 3WNNA 4WI4A 2XOTA 4HH9A 4V2CB 5EU6D 4LCUA 4NRZA 5JIIA 1D5ZB 4XVTH 3L7FB 4LSVL 1CDGA 5GPRA 3NFSH 1OPGH 1E4XH 4NRXB 3MRKB 3WJLC 4JZJA 1BQUA 1YZZA 4NOFA 4A2LA 2I9LB 5I8KL 3SJVA 4MA7L 3RVVC 3FN0H 2XPGA 4XPBL 1DVFB 3IT8D 1KIPA 4K3GA 2JJUA 1KFAL 4D0DA 4L4TE 4YDIL 4OZIA 1NLDL 2VDOH 3HFML 2WINB 4NDMB 1KELH 3AM8A 2GK0A 4M3JA 4ZFOL 5DJAA 5I1IH 3ZKMD 5L6YH 2H2SC 1SJEB 4MXWL 4XMPL 2WQRA 5T3XH 1QBBA 5I75B 3WKMH 2HFFA 5BVJB 1YC8A 4J4PD 2UZIL 1J8KA 4I0PD 4OGAD 5J0BA 1EEZA 3STLB 3FOMB 2P7TB 1MY7A 1F11B 1QSFD 4MD0B 3V6ZB 3GUTB 2DI7A 4R9HA 1QBML 5DLML 2XY1A 5DMIH 5FYJH 1U3ZA 4QRPE 1Q1JL 2AKRA 2I07B 2BSTB 3T0EC 1S5HA 4ZFFB 2PYED 3LRGA 4IOSD 2AV7A 4TSCL 5IMKB 2ZUUA 2X89D 2XKUA 4P59L 1DVFC 2X44D 3SY0B 2FB4L 4DKFH 1FZJA 5J12B 1X5GA 3X14A 5CGYD 4P4KA 4LARH 3T0ED 1F4XH 2NX5D 5L88H 3JUZA 5I75C 2D7PA 3FHAA 4WTZG 1J05B 4R2GD 1IGIH 3H3KA 5DJDA 4S11A 3QEUB 4M02A 1AGCB 1FL5A 1I75A 1JWMA 1KJMA 2YN3A 4G8IB 1P7KA 4G42A 1RUKL 2JKXA 4NOBA 4YJZL 2BY2A 4MQTB 4PFEA 2IGFL 3VI3F 1S7QA 5EBMB 4X6FB 4XWGH 5DR5H 3EYSL 2Y7QA 1BQLH 5F7DA 1KLGB 3VFTB 3B2UC 3QQ4B 3Q5YA 1U8NB 3D39D 3V4UL 1I7UB 1MIMH 3NMEA 2EDWA 4N5ED 3RPIA 5EUKA 1C8PA 4UB0H 3T2NH 1JHLH 2VDNH 3ZYOA 3AROA 1BX2B 4RMSA 3MV7B 3TBTB 5A16B 5KVFH 3L95B 5J12C 1MI5E 1XGRB 4HUWB 1BJ1J 2BOCB 3GMPB 2XG5A 3B2UD 3SGJC 2HJLA 4Q9QH 3V6OC 4OT1L 2DQGL 4ZODA 5GGQH 4EQ2A 2F54D 2YC1B 5KS9F 3PWUA 1WCQA 2P8LA 3EUUA 2EEAA 1A7OH 4X6CB 1F2QA 5T1KB 4WTWA 2D31B 2VZ3A 1J7VR 2Y06L 5AAMA 3MLRL 2F74B 3DARA 3O9WA 3EFFB 5GQBA 4JVPA 3TCLB 1J87A 3KLDA 5IIEB 4A6YA 4EJ1C 5C0RH 3U4AA 3I6KB 4RISH 1G0DA 1T2QL 2Q76B 3IAQA 5I71B 4JANA 2Z93A 2GKIA 4LHUB 1OSZB 2WUBL 4LLUB 3D3VE 2AK4D 1CDUA 3IRPX 4XPTH 1JL8A 2C7UB 3DLQR 3MLZH 4U6YA 2NZ9D 5IFAH 1NCDL 3VXRE 4QHUA 5C6WH 2JTDA 3S6CA 4PS4L 1ES0B 1H8NA 5HD8C 3HMXL 3GMMB 4PGDB 3RIFK 5T1MB 1CXEA 1BIIB 5DRXA 4HEME 3FZUC 2IG2H 3K81A 1CD1B 3D0LA 4R4FH 3N1FC 4DVRH 5EG6C 3D87B 1E4JA 3V5HA 5D7LE 1MFAL 1P9MA 2A2QT 3MRRB 1K2DB 2AW2A 4NWTH 3VA6A 4L4JA 4MNQA 4CADA 5CD5C 3EDEA 1EV2E 1KJ2L 3FZUD 1DN0B 2EYSA 4K9EL 4O51A 1T5WA 4PPTA 3ZDXE 5GGRY 4Q6IB 2DQJL 3TF7C 5FUCE 1O7SA 1OGAE 1VFMA 3FKUS 5I71C 3UPRB 4N9OB 1KBGL 5C9JA 4YH6A 4M8QA 4HFWA 1BZQK 3ZKSD 4UT7L 3KR3L 1LEGA 2XZQH 3NA9H 2FO1A 5I2IA 4YNYB 5FCUL 5L2KE 2Z8WC 1A1NA 3FAWA 4AK1A 2RJMA 3IXTB 3DTXB 4KZDL 5DHVA 2ZOKB 3HE6D 4P9HC 2E27H 4ZNEA 5TQ0H 4DAGL 5BV7B 4OF8A 5GGVY 4PJXB 1QRNA 1BQHG 4H25A 4K94C 5DJ0B 3PWVA 1CG9B 4HIHA 4PD4K 4X9IA 3RWCB 1MI5B 1NGYB 3KYMB 4GRMA 4KROB 5EC1B 1K8DA 2NW3B 1T7ZA 5I15H 1U8JA 3RUGA 5IUSA 3P73A 2NTFB 1K85A 1I85C 4Q6IC 1NLBH 3FO1A 1YY9C 3VWJA 1J10A 4Q2ZB 4XAKD 4WWKD 5A40E 1RZJH 3SE3C 2CMRH 3C6LD 4JO1H 2Y5TA 1T7WA 2HG5A 1ZA3A 4QHKI 1NGPL 4QXTB 2BVQB 1N6UA 4OUUB 2IAMA 5IHZA 2FBOJ 3SO3B 5SX4I 1BFOB 4TSBL 1CGVA 3GI8L 5C2BH 1N5AA 3PJSB 4NBXB 5LCVH 4HBCL 3A67H 1HILA 5BV7C 4PP1C 2PXYB 3C5JB 4Z7QF 4CNIB 2QSQA 3O8XD 3U6RA 1FE8L 4OV6F 4F7CB 1YUHA 4LSRL 5MEOB 1D6VL 4KROC 4DZBA 3PP4L 1HHIA 2H9GA 4PJGA 4IS6B 5D7LB 5IWLC 5JORB 2Y6SC 4B5EA 1YEEL 4JGMA 1B4JH 1DQLL 5AEAA 4ZO9A 5EIIA 2RFXA 1RULL 5E9DA 3OGOE 3AFLA 1K6QL 5C0AA 5E8PA 4KROD 4TQEL 1T2XA 2NY4D 4GUPB 1DBKH 3HHRB 1CGWA 4N0RA 3LS5H 5D8JL 1WLHA 2Y6SD 3WUWA 4BUGA 2FYYA 2ZWLT 2CIIB 3SO3C 3QCTH 2E5EA 2EIEA 3BO8B 5JHDE 3KLSA 1HHJB 1BJ1H 3N50A 2PXYC 5B3JE 1JGLH 5DMKB 3QRFM 3A6OA 4KJWC 2OTWB 3AY4C 3L5XH 3RGVD 5FK9B 3OTTA 1FCCA 3TT3H 5CJ8A 3SGEI 3W81A 4OZHE 2XQYG 3B3IA 4QYOA 2AEQL 2E6PA 4K3EL 3GKWH 1HXMB 4HIIA 2XTJD 4PTTA 2CXGA 4KJWD 3DUUB 3OQ3B 4J6RH 2A73B 4I5BA 1J0ZA 4XBEL 3WFCH 4ACPA 1RJYA 2ADFH 3K4ZA 4LVOB 2DYPA 4JAMB 4P2RD 4X6BA 2N7BA 3I2CH 5ADPL 3PV7A 3MACH 1MIEL 1LO2L 4HWBH 5F7FA 3C6SB 4AH2A 2C1OB 3QXDA 1YEKH 2X7LA 1I3VA 4P5TD 4Z7OE 4OCWH 5DUML 4ODUA 4Y2OA 3KPPA 3RUGF 3ARDD 4GSDH 1OW0A 1SYSB 3PWPA 4JHAH 1M7DA 4Y8AA 4AEIH 2HLAB 3F62A 4LEOA 3UJIH 3BEWB 3FOLB 4MA3B 1HH6A 4YAQB 2OI9B 4UT9H 2V7HB 1U8MB 1UJ3B 3LSOA 3CGTA 1D5IH 5JIHA 1OLLA 4BFEA 1C1EL 3ILQC 1FGVH 1AR1D 1LE5A 1PFCA 1L7IH 5KN5B 2YSSB 5EORL 4LVOC 2AJUH 2XTLA 1PYWA 4D9LH 2IMMA 3BN9D 4TPRH 3LEYH 2B1AL 3WIFA 5E08H 4JJ5A 1GGCH 3Q48A 2AQ2A 3ILQD 4XXCA 4PJGF 2W0FA 5BS0E 1XGPA 3QQ9D 3MCG1 5D1ZD 1I1YA 3QNXB 5AG9A 3DO7B 4AY0A 1HN1A 5JHDB 2G9HA 3B9EA 4NQCE 3ARBA 1R3IL 1KOAA 5D70L 5I1AB 2AI0L 5IOPA 2NY6B 4ZXBD 3TGXA 3QDMB 5C6PB 3TBYB 2Q8BH 4GRWF 1LEKA 2OI9C 4XPGL 1UJ3C 2GITB 2YUWA 4D9RE 4OCRL 4QRQB 2BFVH 2EDDA 5C0EB 1IC1A 4X6EA 3HC4L 1FL6A 3PQYA 4UT6H 2XWBA 4ZUWB 3PWJA 1I7ZB 3VXME 3U4EA 4J2XA 1CFNA 1EDQA 3UTQB 3OAZH 4MX7B 4ZOEA 3MSPA 1DLHA 3OAUL 5J11B 4DKEL 3ARFD 5GJTH 1YEGL 4ZTPH 4P2QA 1FVCB 5DRZB 3G5VB 3TESA 3EO0A 5FM8A 1JJUA 1HSAB 3IKCA 3TIEA 5CILL 4HIJB 4IRZH 2J1KA 5C7XH 2NY6C 4DQOL 3E2HB 2Y72A 4JO2L 2DQIH 4QHKJ 4XBPB 4P5KB 5F1IB 5T3ZL 1MHHA 2QSCH 3O6KH 4KKCD 2B0SL 1EUUA 1S7VA 1YECH 3EOTL 5IHBA 4OZFA 1NFDF 1CN4A 2UUDH 4POZD 3RX8A 3SDAA 5DMYA 2B4CL 4BFIB 5TDOB 3UC0H 4E42A 3TWCL 1NCWH 3OKMA 4F3FB 1JRHL 1XCTA 2EDBA 2VXUH 4BELD 5KSBA 4FN0A 4MJ6B 3HI5L 2JCCB 1UADC 3QG7L 2Q3AA 1EGJL 4PLNC 1XR8B 1KT2B 1I7TB 3CMGA 5J11C 2VLRA 4EEEA 4ETQB 5F1NB 4ZUUA 1HYSC 1M4KA 1NGXA 4JKPL 3VJ6A 3ROLB 1DSFL 4K3JH 1WAAF 4KJYB 3P11H 1Q38A 4NO0A 2C1PA 3V8CA 3QWOB 2DLEA 3VFSA 1ZT7A 1RZ8B 2VXQL 1INEL 3OZ9L 4V1DD 4IHOA 1QACA 1AGDB 2PTVA 5GRJL 1CDBA 4J3XA 3E2HC 1NCCH 3FN9A 2C3GA 4ZS7L 5SWZB 3GIZL 4FQCL 3U82B 2L7JA 2GY5A 5HHPB 4OLYL 5GSVA 4KTYA 4XC1L 3OAYH 1D6EA 5CEXB 3VDCA 1M6OB 1CLYL 2XKSA 3VGDA 1P4BH 4TN9A 2Q1EA 2O5YH 2LU7A 2X5PA 4J3TA 4BSVA 2FEDD 3IDJA 1OM3L 3CAFA 3HE7A 2KUTA 2VJXA 4BQ9A 1DQDL 1A6WL 3KPRD 1DBML 4HJ0C 4PR5B 2VLLA 2VDLL 2AXFA 1U8KA 1IGTB 3LKPB 2D7OA 1RZGB 3QQ3B 4LEXL 3VXMB 4YHPA 3BPLB 4W4OC 2DQUL 1NANH 3WJJC 5FOBB 1ONQB 4JY5L 1X44A 4N8PA 2ICWA 3VGHA 3QHZH 4HJ0D 1IVLA 1CLOL 4GAYB 2DQTL 5D1QD 1PKQB 3NIGF 3BP6A 3E6HB 4GKSA 2CSPA 2QQLH 5F3BB 4M9OA 2UWEA 5CSZA 4CMMA 1WWCA 4GKOA 5C0DA 1MVFA 1CE6B 3QFJE 2YA0A 2F53E 3GBNL 4C56D 2EZ0D 2DD8H 4NQDD 2BVOA 4HS8L 3DX8B 3B83A 5INDA 4PJ8B 2RIKA 2OJZH 3EO9H 1OAZL 3Q3GA 3O6MH 4MCZA 4O2FB 4PREB 4TRPH 3OF6A 1OQXA 3V52H 5B8CB 1ZHNA 5DGRA 5DEFA 4YDKL 3RWDB 3B9VA 2D0GA 1UZ6F 3L9RA 3BPLC 4QXWA 3WMSA 3ECBA 5DUPL 5GHWH 4LMQE 5ACLA 2W38A 5KG9B 1LNUB 1MLCA 3JBG7 1BAFH 4EKXA 1C5CH 1YMMD 2AEWA 5DRNA 1ZXQA 5FYLE 3RFZC 2B7DT 3P77B 5KSBF 3F5WA 5BOZG 1F02I 3NCMA 4NM8L 1VERA 2YPVH 1C16B 4PRIA 3FQWA 3TT1L 4Z0XA 2CUHA 5AWNL 3DXAA 4KVCH 1GIGH 1T3FB 4PJ8C 1WBZB 5DURD 4Z7UB 4QRTB 1E6JH 4NO2A 1IZJA 2FD6L 1OF2B 4RA0C 3PGCB 2XN9A 5E0QA 4JQIH 3DGGA 1IC5H 1YEFH 4GMSL 4RQQB 1X4ZA 1KPRA 5ADOL 5B8CC 5E8OB 3QDGB 1TENA 1T7YA 5C0IA 3IGAB 4HKXB 2C3WA 4FA8A 4YBHA 4CL7A 2LVCA 3BJLA 1AGEB 3LQZB 5I1GH 3SKNA 2YD3A 3NABL 3PHOA 4NHUA 1LVEA 1XGYL 2UZYB 5KAQG 2APTA 1FNEB 4W6WB 1ERNA 1N3NB 1JPSH 1OB1A 3HZKB 4AQ1B 1WTLA 2FH8A 5CMAB 2XA8L 3L7EB 4K9EC 3FJTA 4X9FA 4OF5A 4GS7B 3S35X 2IBGA 4XCEB 1FAIH 3DVGB 1TTUA 3HNVH 3G5XB 4WGVB 4K3DH 1N6VA 1BZ7A 1TVBA 3THML 4NGHL 3ULVL 2OTUB 1GSMA 4E5XA 1MELA 5F71A 1FZOA 1JHKL 1NGZA 1KJ3H 2DN7A 12E8L 3QUKA 4UDTA 3UBXG 4OAWA 3HS0A 2R0KL 3FT2A 3H9YA 1CICD 5TF0A 3VH8B 4Y4KB 1EPFA 3OG6B 3HNTH 5DFTA 1EEYA 4XC3L 2Y9RT 3KLHC 3NH7H 1ZVHA 4KHTH 2EDLA 4JCMA 5DMJB 5IGXH 2CK0H 2J8OA 1LO0H 2WBJB 4FFWD 2DB8A 3MGTA 3R0MA 4XCYB 4S1SL 3B9AA 4ZDHA 2FWOA 2BVYA 5IJKA 3GRWL 3OBAA 5KSVA 4HCRH 5EH1A 4JO3H 4OD1H 5DQJB 3REWA 4GS7C 3K0WA 4IMLA 5FYKU 5E7FA 4I1NB 1A9EA 4JEGB 2HJFB 2CDEB 1FH5L 2XFXB 1JF6A 3B5GA 5D6DC 3GMQA 3T0BA 2OMNA 4RFOL 4HLZG 2GHWB 2YOCA 4YGAB 3UYPA 3RVTD 1E4WH 2L7UA 5L7XH 5I1HL 1CT8A 2WBWB 4WI2A 3AS2A 4Y4KC 4WV1B 5D7JA 1S7SA 5EULV 1IC7H 1WVZA 2WBJC 3WEXB 3VG0H 3IETA 3MRLB 4JZNB 3JWOH 5BXFB 3OWEA 3IXAA 5IJVB 2AJYH 3GSOA 4WNQB 5IFJA 4Y8DC 4JLRA 4Y4KD 4TOYL 3TPUB 3AS1A 4WJ5A 3UBXI 1KB5L 4IOIB 3O3AB 2PR4H 3ILPA 1LDSA 4ONHA 4AQOA 2WBJD 3AU1B 4OT1H 3BW9A 3GMLA 4L4VE 3CZFB 3KVQA 5E2TH 3QIWA 4Y4FB 1DUYA 4G8EB 3DMMD 5T5NF 4K2UH 2ARJB 1KEML 5EOCL 3IB4A 3HPJA 4M1GH 1C5DA 3MLWL 3MLRH 3TN0D 1T4KB 4Y16B 3G6AA 4I18B 2V2WA 5CJBA 1GAFL 5F70A 5FO9B 4UQ2B 4WV1C 2DIJA 2VZTA 1CFQB 1EAJA 4X0KA 2EDHA 5INCA 4Z77A 5FO8A 3WUZA 3GZKA 4HIXH 2EIDA 1JTTA 1CDCA 5I19L 1RURH 3O6LL 1T66D 1TNMA 4L3EA 4K8RD 1MF2H 5TQ2L 4QXGH 5E1AA 3EJZC 1GGYA 2BNRA 3SOBL 4G3YL 4PJHE 4RX4D 3MRFA 4H20H 1S5IH 5JPNA 1XF5A 1MY5A 3MBXL 4Y4FC 3CDCA 4PJAF 5B38A 3H9SE 4UILH 3MR9A 4PJCB 2YD5A 3EJZD 5FUOL 4ZYKB 2AVGA 3O0RH 3V4VL 4PJ5D 4QRUA 4Y16C 5IM7A 2EXYC 4I18C 5ITBH 1AE6H 1IM9D 3KPOA 3LOWA 4Y4FD 1DN2A 1E6OL 2R23B 3CVHA 4UQ3B 2ATKB 3WFBL 3HG1A 4WUUA 2YPLB 3SKJL 4XNYL 4OCMC 4Z7VA 1TNNA 4LPTA 2A38A 2V2TA 2EH8L 5F88A 2EXYD 4JDTH 4JRYE 3GI9L 4AIZB 3AAZB 5FDWA 3FT4A 2DJUA 1U3HB 4G8FB 4HF5H 1FV1A 3V7MA 3W5MA 4FQLL 2VQTA 3SJVE 4IMKA 1WWWX 5GRUH 4NZRL 1DBJL 3GB7B 2XWTB 4M4RA 4U1NA 3CMOL 4OZIE 3QEQB 4XT1C 1NAKH 3OB0K 3O6FD 1IKNA 3DV4B 2ADJB 1HSBB 3NFNA 2BHYA 2K1MA 2LQRA 2YN5A 1FFNB 3IDMB 1I9JH 1T20A 3SDXB 3N85L 1XGUB 1CU4L 3MRIA 3O41A 4ZSOB 1UG9A 1RPQA 4I3SH 4JM2D 1H3WM 3H0TB 3UZQA 4NKOA 2BY1A 3TIDA 4LF3A 2H8PB 4LVNB 4WCYL 2G75B 2Z9TA 4ODWB 4HGMA 1PEWA 1VFBB 4JFXB 3DX9A 4LHUG 1A7PL 4GG6F 1GHFH 2VDKH 4GKZA 1U3HC 1TETH 5EZLA 5IMOB 1OP3H 3GI8H 2VQ1A 3QUYD 2OZ4A 4PB0L 2CKBH 3GSRA 1FQ9C 2P5WA 3CH8A 2UVFA 1HIML 3T0WA 4UOW0 2YKLL 4Z76B 5HI3D 3GO1L 4PJHB 1MHPL 2FBJH 4FS0A 5JHLL 4PGEA 3HZYA 4NKQB 2VKXA 3TO4B 1HHHA 3QHFH 5HHMD 1T1ZB 3MODL 3PWNB 5DJ6B 2V9TA 1SY6A 2HYMA 3I6GB 2GJZB 3A6BL 3I50H 3PHSA 4LVNC 1I1AA 2CRIA 1WZKA 4FQXC 1W0WA 4AM0B 1RUAH 2QSTA 4P4RA 4NKIL 1LO5B 3BQUA 5JR1H 4H88L 4GXUN 2HT4C 1WCBB 4K8RH 4LCYB 4N1HB 5EU5A 2GFBA 4HAFA 2PTUA 4FTVE 1FYTA 4KQ3L 1MWAA 2OJEA 4H26A 4JRYB 2IH3A 4JZJB 4FQXD 2B4CC 3T8XB 1U8IA 2CQVA 1SBSH 3WNLA 2MQ0A 3SE9L 3QIUA 3MOBH 3K1DA 1G7HA 1AXTL 4QF1A 5AUMB 4WTZA 5T3ZD 1KIPB 3H9HA 3TO4C 3WFEH 4OZIB 2VL5B 1MFCH 2CGRH 2GJ6E 5E94A 4I77L 4ESKA 5I8EB 1WIPA 2GTWB 4RMVA 1T6VN 4PJDB 4PJFE 2DQDH 3ZDZE 4X7DC 5BJTA 2X1PA 3GSVA 4UTBL 4P5MA 5IBLC 5GRXG 1A3QA 4PRHA 3DHJA 5DRWA 1A6PA 5D2NB 4G9FA 1MCWW 3WD5L 2NY2D 1T03H 2FL5A 2BP3A 1MJ7H 1CE1H 5CZKA 4GMTL 4RFEB 2NXZB 1DCLA 4LCIH 2AV7B 5IBLD 3IVKB 4NT6B 5DVMA 1XR9A 1R24A 3BKMH 5I16B 3EO1B 1N8ZB 5SWSA 1QG3A 2IC2A 3GJFA 4OKVB 1BECA 1GPOL 4DGYL 2H2PC 1CYGA 3KHQA 4MNQE 5GGSB 3LIZL 3FQRB 4NNXA 1OARH 4R0LB 5IHLB 4AG4L 1JPFB 5DJDB 4XH2A 4JFOB 2NY5H 3OJDA 4BKLB 1IQWH 1P7KB 1UVQB 4OFYA 4OLWH 2GK2A 2B1AH 3W11C 1QSZA 4JHWL 1CI5A 3CIQA 5LJYH 2FJFA 5D2NC 4MLIA 1GXEA 1WBYA 2PW1B 4F15B 5JXEA 1A3LH 1EBAA 2FX7L 5F7DB 3CLEL 4WWID 4GBXD 5GGRB 5C71A 1FNLA 1FSKB 3M17B 1K5NA 1IGJA 1W8OA 2D7TH 2NXZC 3MV8A 4FQ1L 1LDPH 4FTVB 5LAXB 3RPIB 4EN3A 5KVGH 2BMKA 1AO7D 1KPUA 1QRNE 1DP0A 2IANB 1IL1A 1G7JB 4H5SB 4XPGH 4QOKB 1FZKB 3VXOA 1ED3A 1F4YL 5D5MB 3MJ6A 3W9EA 2HJLB 1BZ9A 1Q9LA 1TCMA 4R0LC 1NGQH 3RUGE 5FV2A 2GJ6B 2J4WL 3VXSB 1UXWA 4PJIA 4HFUL 3ZL4H 4L29B 3D18B 3VXTA 1Q9OB 1X5IA 4FFYL 4PJ7A 2WUCH 4PJFB 3E3QC 3IDXH 1ORQA 3E0GA 4A6YB 5KW9L 5KSUA 1LK2A 4F15C 1YN7A 2Z31A 5HGHA 4D0BB 1ZMYA 5HYSB 1LWRA 4D3CH 1HNGA 4OFIA 4CBPA 2VZ1A 4S2SB 1RJZB 2DLIA 5GS3A 1XIWD 4KI5F 1FSKC 5I6XB 4RRPG 4MJIB 5MP6L 2NY3D 3VXQB 2W0PA 1RU9H 4AL8H 2DKUA 5EN2A 1BQHA 5JO5B 3BDYL 2FJHA 3O11B 2HTKC 1I3RB 2B0SH 4QGYA 4X7SL 4RMRA 5F8QC 5F96L 1HEZA 5FOJA 3EOTH 3UPCA 4G5ZL 1HXYA 4R7NA 2HWZL 4Y19A 1OTSC 1MUJB 3D85D 1A7BA 4NKDA 5BRZB 5HYQA 5HYEA 3OR7A 5IBTL 3VD4A 1ZT4B 1F3JA 3MUY1 3HC0A 1ETZB 5E9DE 3BOVA 1PD6A 5FGSA 4Q9RL 2R1WA 3PP3K 4QOKD 5IVZB 5IP4A 5CJQH 1JN6A 3P4OB 1NDMA 1BVLA 5JXAH 3VXSD 5GSRB 1D5XB 3R8QA 3EOYG 2YA1A 4BK4A 1PG7H 4R8WL 1UH4A 3UXFA 5I6XC 4M8QB 1INEH 1IGFH 1MREL 2IBZX 4W6XB 5A3IC 3ULVC 1DL7L 4OFKA 3U0WH 5ACZB 4HHAA 3MUHL 3W2DH 2AQ1A 1DLFL 4EUPB 4IDLA 2DLFL 3ARUA 4M61B 1YJDL 4XC1H 4J1UB 2NY1C 3C5ZA 1H3PL 5SX5H 3ULVD 1QLFB 4RAVA 3U83A 3DX6A 2E7LA 4F7EB 1NCUA 1A3RH 4RIRA 4HV8A 3N1GC 5TGBA 4Z78A 4NQEE 2NY1D 4KTEH 5E99L 4TNVF 3WS6A 5BRZD 5C0BB 2PCPA 3MRGA 1I8KB 4LRIA 2WMPA 3BZFB 4F37F 3VWKB 1KB5B 4S1DC 1I4FB 5BMFL 2HKHL 1SMAA 1DBBL 4XNQB 4XCFH 1L6XA 3U9UA 3PL6D 1ZA3B 3F7YA 3ARGA 1VPOL 5FYKE 3STBA 1LO3H 4NUJA 3KPQA 4NC1E 1LMKA 3T65B 1EHAA 1UCBH 3K3QA 1NC4A 4HD9A 4OGXH 1N5AB 5D7KD 4L4TD 2CLZA 2GT9A 3FB8A 3DX7B 3PWPE 4HLZH 3ESUF 1G7IA 3DETC 4ODBD 5E5UB 5F9OH 3U7WH 1MJUL 3ULUL 4CJ1A 1MVUB 2OS7A 1T89A 1Z9MA 4FFZH 3CXDH 5IV2B 4WFHE 15C8L 4M6ML 3EAKA 5EZOL 5FECA 4JFDA 1AC6A 3VE0B 4OD3L 3DRQA 4LLQB 3HMWH 2DWDA 2QJDA 4XZUA 1N5YL 3PGDA 5HGAA 4KXZH 1AFVL 1P6AB 3O3BA 5ESAA 4Z6AT 5ID0A 4ODVL 1ZLWH 3AGVA 4J3SA 5HHVH 2X70B 3P9MB 4ZOAA 1DANU 3QWRD 4QRPD 1IILE 3VWKC 3FRUA 5M7QA 1QHPA 2HTLC 4U7SA 5MI0B 2HJKA 1UA6L 3Q5TA 1QFWL 4R90H 4HWEL 3PWLA 1H0DB 2ZUYA 5ESVB 1IEBB 4XRCB 3RU8L 4MA8H 1AI1L 1EJOH 2YZ1A 3K8LA 4I4WB 5DJ8B 4HS3B 5FIEA 1R5WA 1FFOB 2QR0B 4J8RB 1D9KB 1TJHL 3QNYA 3ULSB 3ARWA 2D7NA 1P1ZB 4O02H 4ZPTA 4ZTOL 2FLRT 3GMOB 4M7LL 1U92A 1AD0B 5ENWA 5CGTA 1TJIH 4OZ4A 1C5BL 3X3FL 1NEZB 3PQYE 3VFRB 4GQ9H 1MCKA 4HGKC 3CXHK 3WL9A 1OSPL 2W60A 4MAYB 4OGYH 1F00I 4X7TA 4XNZB 3RAJH 2XXCB 3VFWA 3K46A 5ISZD 4NQEB 5HDLA 3MREB 5EFIA 4UIMA 3S7GA 1FO0H 4JPIB 4NHCH 5MI0C 4KKAD 1JZ6A 1H5BA 4N8VA 5IVOA 2XA8H 1RAMA 1EFQA 1G9NL 5KSAB 1JIBA 5I18L 4JE4B 1X5KA 5HYJB 3BP4B 4M7KH 4XNUL 1JYXA 1RI8A 3NPSB 1INQA 5FUZL 1D9KC 2DM7A 1W72H 3INUH 1XEDA 1DQML 4NGHH 5IB5B 5L9DH 2HAZA 1IE5A 1P7QB 5D1XD 4MVBC 5T1LD 1A6TB 5ECJE 1VGKA 4LQFH 5J1TC 2VC2H 5KSBE 3ARVA 3RNKA 2DWEA 2X4RB 5HHNA 5DK0A 3RTQA 5IB2A 2DDQH 2R0KH 4MAYC 4JFPA 4XNZC 2E7CA 2VLRE 5JUEL 2DMBA 2DQFA 3O45B 3JVGA 3C87A 3MCKB 5IR1A 3GSUA 3OHXA 5T33L 1HI6B 4LAQH 4PRNB 3TA3C 3QXTA 4LCCC 1FNSH 1ZKAA 2YUZA 3I75A 4HQQH 2UYLA 5GGUB 5IHUH 2CRMA 3QO1B 5GS2D 5IFHL 1EAPA 3GSQA 4JJ5B 5F21B 5KSAC 2X4TA 1PQZB 5JA8B 2ZNWA 2Z91A 5TDNA 3NPSC 2AEPL 4KJPD 3HKFA 2JE8A 4A2MA 3TA3D 5J6HA 5HHOB 3U1SL 2XQBL 3U36A 4DW2H 2C3HA 1KNOB 2HVKB 2QV2A 1A1MB 1ODAA 2I5YH 3L3HB 5DDHA 2A83B 3U46A 2R0ZH 2YPKA 1X4XA 1T22A 5MERA 2DKSA 1SBBA 4TVPE 1N59A 4NM4H 3ARRA 2VNCA 1OGAD 4XP1L 1LP9A 1OAYL 4NJ9H 5C0JB 2V5YA 4LP5A 3FTGA 2X10A 4Z7NF 3U4BH 1NMBL 3QJHA 4OCXH 1OAXL 5TH2B 5H37H 2F19L 1I8LA 5I8OL 3EHBC 3QI9A 3WLBA 3K8MA 1OHQA 2R9HC 4MNGA 3SGDH 1GZQB 4MMZC 4Y5YC 5I1JL 5A2IH 3U9PL 1PZUB 1DDHB 1ZEAL 1WFOA 4WENB 4ZO8A 5I17A 2P24B 3QNZA 3UTPE 2UWEE 4KZEL 4JFZH 5JW4R 3KPSA 5IK3B 1MCNA 2VDRH 2R9HD 3SKMA 1I1FB 3WO4B 1KACB 1S7VB 4XCCL 1WQVT 4YC2B 4FMFA 1AXSA 1KYOK 1GAFH 1CXIA 5DD0H 4JGJA 1G9EA 4RWYL 1KCLA 1F4HA 3H7BB 2BERA 3VH8G 2B20A 1NFIB 1G0YR 3LH2H 3BSZH 4OI7A 1M7IA 3TEUA 1A7NL 3CDYA 5E8NA 4PY7A 4JPVL 5F1OB 5DC9B 3FB5B 3UJTH 5IF0A 3QUML 5HI5C 4BSWB 1LQSR 3QDJB 4PYHA 1RZIA 4FZ8L 1J0YA 5F7EH 1KPVA 4PRIE 3LEXB 3NZ8B 4NQUA 1SYVA 1O7VA 3FT3B 3WO4C 3DXAE 4M5YL 4YC2C 4DZ8A 4IJ3B 4QRRB 1EERB 2MHAA 2XN9E 2H3NA 3W0WD 4XPFH 1IAKB 1A4JB 2XACC 2OSLB 3C08L 1NUDA 1P4LB 4FQHB 2IFFH 3GHBH 4DCQB 3Q1SL 3QUXD 4KK5C 3P0YL 5IQ7H 4X5WB 3L6FA 3D2UB 3QG6B 5JNYA 1KN2L 1SEBA 3EYVB 1T1YA 3V7AE 5EOTA 4IRSA 3LRHA 1W0VA 1M7XA 4WI9A 5J1SC 3DV6A 3CCHB 5CJXC 2WLZA 2FZ3B 4NZRH 4KK5D 1O5DT 4C54A 2Z8VC 3ZSSA 1LD9A 1LP9F 4GKSB 3MRMB 4ODSH 4ZUTA 3UTZB 2MOVA 2UWEB 5C07B 5ILTL 4IJ3C 1J8HA 2IPUK 3KWWB 3MV9B 3TZVD 3B6SA 3QDJD 1D7FA 3CFEB 4KUCD 4WEBL 5AZEH 3RWHA 5FB8B 1ZT1A 5F6HJ 4LMQI 4ZUSB 4JG0H 3TVMA 4MCZB 1FDLL 3MLTA 3Q3GB 1YDPA 1WJ3A 3CX5K 4WCYH 4YHLH 1Z3GL 1NQBA 3PABA 4FG6D 1KLFA 3MV11 4JFHE 4QRRD 4XVUC 4HIEB 4AEHL 5EC2A 4KK6C 5IVXA 2VISA 2CDGA 3NAAH 4YXHL 2ADIB 3DBXA 4LCWB 3SDCA 4PG9A 5HY9B 4ONFH 3HB3C 3D69A 4XI5C 5C09B 1PLGH 5K93A 3S35L 3BPCB 3TJHC 2VSDA 5DRNB 3CJJA 5E8DH 3ZT7A 1EXUB 1EUTA 1FORH 3WE6B 3HB3D 1ULVA 5JLZA 1UB6B 4YDVA 2OCFD 5EU6A 1JNLL 3GJFK 3VDAA 4OZGA 3BKYH 4ONGL 4PV9B 5L8KB 3UBXA 3DJ9A 1I7RB 3KNBA 3MJ7A 3UPAA 3DGGB 3MMEB 5F97E 2EIZB 1KPRB 5GS1B 4JFFB 4YGVA 3GMNB 4NKIH 4H88H 3MV9D 3MNWA 4WHCA 5DD5L 3V6FB 4PRPB 4KDTC 2WWMC 5BOPA 2AJ3A 4FP8L 2R29L 3IU3B 1AQKL 2VUOA 3VMNA 1GH7A 3PHOB 3WBDA 5T5FL 3S98A 2XRAH 5D2LA 5BS0D 2DBJA 3FRPA 3HCVA 4LFHD 4FXGA 3WJLA 4DGVH 1ZSDA 2XWJA 4Y7MA 3DSNA 2P5EA 5EIQA 3LKRB 4EQ3A 4NQCD 2IBZY 3KPLB 3LV3B 3NA4A 2HA1A 2ESVE 1MCQA 4LP4A 3QPXL 5E4EC 1A6UH 4X8JB 3TNNA 2FGZA 4TNVK 2A6IA 4BZ1L 4HUVA 1NC2B 2NYYD 1A2YA 4NIKB 4F33A 2IQAB 2I60L 3AMKA 4RBPH 4F37K 2YXMA 4KI1A 2ICEB 2ZKHH 4M5ZL 5CZXC 2EH7H 2BNQB 2YEZB 4UUJB 1HWHB 1CXLA 3MYJB 3KS0J 1BLNB 3VD9A 4OBRA 3D9AL 5GS1C 2PYEA 3DWTA 3PG2A 5L8JB 4QHLB 5HJ3B 1NGZB 4UTBH 4CVWA 3MGAA 2X89A 5EBLB 1D5ZA 1QHOA 4UDTB 3L7FA 4I3RL 2R39A 4OAWB 1NAML 4KHXH 5CD3A 4HKBB 1YJDC 4NRXA 3MRKA 4M93B 4GRLD 4XX1G 3IAPA 4L3EE 3T0EA 2YBRB 2CXKA 2I9LA 3RI5F 3RIAK 5HGBB 5DMGC 4FQPA 4KUZH 2BNRE 3LS4H 2D2OA 1DVFA 3KYOB 1P5VA 2QADB 1QSEE 2HT3D 3KYAA 4WFGE 4JN1L 1NH6A 4M48H 1J0IA 2WINA 4NDMA 4KJQC 1GGBH 1TZGH 4PD4J 4PGBA 1SJEA 3QCUH 4P46B 1BFSA 2P49B 4D8PB 5IVXF 1PVHA 5BVJA 5KAQF 2A74B 3BP7B 2DTMH 4WW2C 1B3JA 3OR6B 5AZ2L 5HHXL 2XT1B 4NJAL 3AUVA 2FX8L 4G6AC 1U58B 5DHYB 3STLA 3FOMA 2P7TA 4JM4L 1F11A 4ODXB 5E2WL 1MQKH 4RZCB 4MD0A 4U4BA 3GUTA 3VFGL 4WUUE 4W4NA 1AH1A 3OPZH 1XCQB 3FO2B 5DK3A 3MPCA 4Z7VE 1TXKA 4M93C 2I07A 2X40A 2BSTA 4ZMAT 4F9PC 4ZFFA 4RA3A 3ULUC 1OTTD 3GHEH 4DGIL 5C1MB 1YQVL 5IMKA 4OZGF 3IETB 1WIOA 2QADC 1H8SA 2W9EL 4NO5B 1HCVA 1I3UA 2YZ8A 3GSOB 5F1KC 2KQNA 4WHTB 2ESVB 4L3CB 1CL7H 1QYGL 3B9KD 4WI5A 3SGJA 4WJ5B 1X5LA 2ZPKL 3V6OA 4ELMF 1OP5K 3TC9A 1KC5H 1J05A 4P46C 3ZKNC 8CGTA 3VD7A 3GMLB 3QEUA 4NN5B 1AGCA 3QIWB 3WHE0 1DUYB 1GGTA 1CDIA 4G8IA 2YMXH 3FFDB 5CKAA 4WY7H 3S88H 3HPJB 5JW5B 2FECI 4YHZH 1ZHKB 4O5LH 2V2WB 2FEEL 2XY2A 4AEFA 1X6LA 4X6FA 1JRHI 1KLGA 3VFTA 4HWZB 3QQ4A 1U8NA 4RAUB 1I7UA 1MJ8H 2K3TA 1G7LA 1DBAH 4XP5L 1UACH 5TDPB 32C2A 4U1IB 1Q72L 3CSYB 1GOHA 1YN6A 4X99B 3QEHB 1BX2A 2P5WE 2FDBP 3MV7A 4KKLD 3VFVB 3TBTA 5A16A 3L95A 3LN5B 5E1AB 1XGRA 3BIKB 2BNRB 4X7SH 2AP2A 4HUWA 2BOCA 2MCPH 3GMPA 5E95B 1I9RL 4C57C 1HK6A 5FEBA 1R3HB 1KIQA 1IAIL 3QFJD 4UZGA 1QSEB 2F53D 2XQYK 3MLVH 3T09A 3RA7L 4NN5C 2YC1A 2NY0B 1KN4H 5L8LB 4X6CA 5T1KA 1QLRB 2D31A 4ZFZB 3TH2T 2H32B 1NGWB 2F74A 3WIHL 3QDHA 3EFFA 3TCLA 5CIPH 5IIEA 2QHRH 5F7LB 4QRUB 3DVNA 2I26N 2Q76A 3SN6N 2P8MB 3KPOB 3I6LD 4LHUA 5C08B 1OSZA 2AJXH 1G9NC 35C8L 4LLUA 4Q58C 3EDDA 1QA9B 1J12A 1XZ0B 2LAAA 2C7UA 4OSUL 6FABL 3MA7B 1MREH 4U05A 4Z7VB 2P44B 1ES0A 5CWSB 1FYTE 4H8WH 3EFDL 3GMMA 4PGDA 5T1MA 3LEVL 1BIIA 2YRPA 4RGOL 2DICA 1RUQH 3FL7A 4RFNB 1CD1A 1AJ7H 2R2BB 4TSAH 1FV1B 4NP4H 2EICA 4FXLA 3ZTJH 1FVDB 4OLZH 1CZ8L 5BQ7B 2OK0L 3VFUA 1FBIH 3MRRA 1K2DA 4KI5E 1JWUB 2NY0C 4OLEA 2XI9A 3JSSA 4LSQH 1C08B 5FHBL 3UYRH 4TTDD 4WI6A 1DN0A 4WU7A 4HZAA 2KH2B 2OR8A 2VMFA 1I85A 4S1QL 5DC0A 4Q6IA 1T20B 4G7YH 2Y1VA 2ITCA 3PIQB 4G9DB 3ARED 3ZE0F 5GGTH 3UPRA 1IGMH 2Z0BA 3BZ4B 1QZ1A 4XCNB 3SE3A 1ZVSB 3IJYB 5FDYA 4PRHE 1A7RL 5HYSG 3SDDD 4G9FE 3GGWB 3HNSL 2H1PL 2EO1A 4YNYA 1KXTB 5EWIL 5DO2D 4NO3B 3V0VB 4R4NC 4LHQB 3DTXA 4MD5B 4RFNC 1MEXH 2ZOKA 4QWWD 1CXFA 2VQ1B 1QBAA 1HQ4B 4FQIH 5DJCB 4HK3N 5E56A 2IQ9L 4PJXA 2Q86B 1CG9A 2Z35B 3RWCA 1WZ1L 1ORSB 3X13B 15C8H 5SWSE 5EC1A 1FIEA 2NW3A 4HC1H 4M6NH 4MAUL 25C8L 4K23L 5IWLA 1GC1L 3F58L 1NBYB 4EI5B 5LKNA 3BN3B 1VFAA 4FZEL 4HUXB 5ACMA 4L9LB 2PO6D 4OIIH 3WFDL 4Q2ZA 2AJVH 2GEEA 4U6TA 1X5YA 1IMHC 4B53A 3QUMB 2QKIB 4OTXH 2DIBA 2OLDA 2VXTL 5E6IB 1RJLA 4HPOH 1U8QA 2BVQA 2R0LL 4OUUA 2DS4A 3BQUB 3MX0A 2ZCKH 1BFOA 3PJSA 5F9AC 2BDNH 2ORBL 3MV8E 2LVEA 2PXYA 3C5JA 1FYTB 1X6NA 3EYQC 4CNIA 1IM3B 5J3HD 2IH3B 3U0PB 1X5FA 3AY4A 4F7CA 5MEOA 4EUPG 3DO3A 2I25N 4MZ3A 4LBEB 2NR6C 1KJVB 1G7HB 2YD4A 4IS6A 5D7LA 4ZTOH 5JORA 2Q87A 4Q6YA 4TNWK 3O2VL 1WEJL 4EI5C 2R4RH 1YEHH 1F3DJ 3RZWA 3BKCH 2V17L 4PJIE 4L9LC 2X6MA 4OQTA 2NNAA 3FMGL 2LFGA 4PJ7E 3LVEA 4GUPA 1INDH 5ALCL 4MDIB 2WV3A 3IDGB 5TE4L 1EO8L 1R5IB 4QTIH 5FHAL 3GSVB 5E6IC 3P4NB 1WWAX 4JFED 4P5MB 1UQSB 5FYLH 4YE4H 3JV4A 4XVTL 4HDIB 2EDYA 1OD9A 3BO8A 4LK4A 4Z5RB 3NFSL 1OPGL 1HKFA 1E4XL 3VGBA 3QRGL 5DMKA 3RHWK 3TBWB 2E8YA 1WIUA 2FL5B 2OTWA 1VKXB 2NY7H 5FK9A 4X4YA 3G6JB 3IDYB 1G6RB 3LN4B 5FUZH 3RZCD 3F7VB 3UDWA 3FN0L 3QIBB 4LL9A 1HYRC 3RDTD 1RHHB 1HXMA 3MLSH 2VDOL 1KELL 3QSKB 5I1IL 2CPCA 1PY9A 5L6YL 3DUUA 2A73A 4LDOB 3WKML 1HOCB 3EYOB 4C58B 4XNXH 1V3KA 4O2EB 3MROB 2C4FT 5C0FA 4N0UB 4XH2B 4PJEB 1U8OB 4JAMA 1VCAA 4PJXF 5CBAB 4X9BA 5T33H 1NCTA 1ADQH 2I9TB 3C6SA 2X1XR 2C1OA 4RRPA 3RP1A 1WBYB 3UJJH 5DMIL 5DD3L 4JDVB 2J8UE 3GSXB 2XZAH 3BRDA 1IKFH 5TFSH 4KMTH 3IDYC 1SYSA 4JQVC 3SCMD 1AQDB 2HLAA 1QTYT 4JVUA 3QIBC 2BCKB 4EN3B 4B41A 4XXDB 2AK1H 3H9SD 1DEEB 1MLBB 3BEWA 2D4FA 4YAQA 5FV1L 2ED7A 5DEGB 5FGBC 4DKFL 4RMUA 4JCLA 1U8MA 5HI4C 1UJ3A 4LARL 5L88L 3QPQC 1S7WB 1BZ9B 1MOEA 1IGIL 1NSNH 1J5OH 3QIBD 3L1OH 2X4QB 2YSSA 1NEZG 3FFCB 5H8DA 1V7MH 1U8LB 1BBJB 2AERT 4PJ7B 3N1QC 3VW3L 1EA9C 5C6TH 5F7MC 5D9SB 4UOJA 4XWGL 3T3ME 3N9GH 5F8RC 1BQLL 4XPHL 1XMWA 3U9PH 4ZOCA 2LAGB 3QNXA 1ZEAH 3DO7A 1MIML 1MCRA 1V3LA 5I1AA 4UB0L 1JF5A 3T2NL 1JHLL 2VDNL 3QDMA 3TBYA 3MOAL 4PBXA 4KK9C 3CLFL 3ZDXF 5KVFL 3CPLA 2V5SA 2NQCA 4ORGB 2GITA 4P2OB 1F58L 4KWUA 1H8OA 1JYVA 3RI5K 4JFDE 4Q9QL 5C0EA 5GGQL 5JZ7D 4B7LA 1NAMB 5HYQB 4ZUWA 3IAGC 3OR7B 1EEQA 1A7OL 3HC0B 1K4CB 5C0GA 3UTQA 3MUZ1 4JHZA 2NLJB 3BI9X 4DOHE 4RISL 4LAJH 3DURB 3BMVA 2FX9L 3D25B 2OL3H 2ARJQ 3RWGB 1A7NH 3B8YA 3DOSA 5DRZA 3G5VA 4F7PB 1HSAA 1N64H 2G2RB 4RWHA 3GSNH 4XPTL 1S78D 3BKJH 4CN1A 2J8UB 2FRGP 2NMSA 4HG4K 1Q8MA 1UWGH 5JW4M 4P5KA 4P4KD 5F1IA 3CFBB 1RIVH 1JWSB 2PKDA 1ZHLA 4LVHB 4M5YH 5I1DB 4R4FL 3TJEH 1F3DH 4P2OC 4OI9A 1HE7A 4DVRL 3WNMA 3ARYA 4BFIA 5TDOA 4U1HB 4F3FA 3C08H 1FN4B 4APQB 3OJMB 3BZDA 4P23C 3DVIA 4NWTL 2JCCA 2FCBA 5IESH 5TF1H 1U9KA 1XR8A 1KT2A 2WK2A 3P0YH 5TGBB 5FF6B 4ETQA 5F1NA 4Z78B 3CZJA 2F5BL 3MZGB 4W4OA 3ROLA 3WJJA 3ESVF 4KJYA 4P23D 3MC0A 3QWOA 1RZ8A 1F5WA 4C56A 4YBQD 1AGDA 1RVFH 2XZQL 3NA9L 5I66B 3IFLH 2A0LD 5SWZA 1BOGB 5HHPA 2WANA 4NUJB 1SVZA 4LVHC 1KUMA 2E27L 5TQ0L 4H1LB 4Q7DA 5CEXA 1V7NH 4UINL 1NMAH 3IF1A 1KCUH 2VLJB 3LRSB 1M6OA 4JDZA 4APQC 3F12A 3OJ2C 4U6HB 3O9WD 5I15L 2R2HB 2WBKA 2ZOLB 4PR5A 5GRWA 5HGAB 1IGTA 3LKPA 1RZGA 3QQ3A 2DMCA 4K7PH 1JGUH 4MXQC 4Q9CA 1AR2A 1EFXB 2X9WA 3P2TA 3SE8L 3VRIA 4YXHH 5FOBA 1ONQA 1MHEB 4X5LA 1RZJL 2CMRL 4JO1L 2Y07L 4I3GA 3O3UN 4J7RA 2WZPD 4M7ZB 5CSBA 4GAYA 1PKQA 3CK0H 1MHCB 3RRQA 3F6IA 3E6HA 1YYLL 5F3BA 4LRNH 4MQ7B 4X9GA 3TV3H 5C2BL 1T6WA 5LCVL 1J1PH 5AYUH 1PG7X 2VABB 3A67L 1CE6A 7CGTA 4IRJB 2CO6B 4MNQD 3KPNB 4PJ8A 3BPOC 1T89C 4O2FA 4PREA 3QNYB 4G7VH 5B8CA 1LP9E 2MTPA 3RWDA 3DVFA 4Z7OF 3HMXA 3H9ZA 3H6JA 3RKPA 3T0VA 3UCRA 1GL4B 3EBAA 1FIGH 1WFUA 4P99A 5KG9A 1LNUA 2Z4QB 1DBKL 3MBEB 3K2UH 3CSPA 1ZHBA 3LS5L 4MNGE 1A21A 4RGNC 3V79C 1HKLH 4EI6B 3QCTL 4WU5B 1XFPA 3P77A 4N8VB 2GSIB 5AD0B 1KJ2A 4YZFE 2GCYB 1QRND 2JCCF 3PUCA 4RSVA 3KPSE 1JGLL 5TPWH 4IRJC 1T3FA 4G6FB 1WBZA 4EIGB 2HVJB 3RY4A 4Z7UA 3ZKXB 4QRTA 3TT3L 3H3BC 4RGND 1OF2A 3PGCA 3HPLB 2EDKA 4RQQA 2OM5A 1MPAH 3GJEB 4OIBA 5E8OA 2QQKH 3GKWL 3QDGA 2EKJA 4L8BB 1PDKA 3VWJD 2FIKB 4HKXA 5JOEA 4MJ4A 3PXJA 2VWEE 3S3PA 4U0RB 4Z0BH 3RNKB 3KJ6H 4J6RL 4C4KO 1HZHH 3SO5A 1ZGLP 1AGEA 3LQZA 2MFNA 1TCRB 5IQ9B 3MBEC 2PETA 1U93B 2IAMD 1FNEA 3WDJA 1N3NA 3WYRA 2F15A 3HZKA 3I2CL 3VG9B 2DBLL 3MACL 5CMAA 1G7MB 3L3IB 3OL2A 4TUJB 3BT2H 1J0KA 5T3XE 1YEKL 1R5VA 2EXWD 4OCWL 4RNRA 5ALBL 4XCEA 3BD5A 2HT2D 4GSDL 3DVGA 4PJ9B 5GZOC 3G5XA 4XB7A 3ZKXC 5J89A 5GGVH 4JHAL 4AEIL 1P2CB 4I13B 1JZ4A 5C0CB 5D6DA 3UJIL 5E9DD 4UT9L 4A6YH 2YPKB 3O2DA 1T22B 4JM4H 4AEEA 5FYJE 4U0RC 1FNAA 5C0AD 3G5ZB 2F58H 1D5IL 4F7TB 5IW6B 3RIFF 4JRXB 4Z95H 3S3SA 1FGVL 3VH8A 4Y4KA 4Y1AE 1CBVH 1L7IL 1QKZH 2AJUL 2BSED 4JO4H 1QFUH 1BF8A 3LQAC 4D9LL 5DJYB 2WBJA 3LEYL 4XCYA 1DQJB 2Y4SA 2ZJSH 4NKMA 5E08L 3TH3T 4MNGB 1GGCL 1GC1C 1R0AH 1S7TB 5DQJA 1YPZB 4XMKH 3VXNB 2N56A 3LPGA 4PJ9C 4WTXA 1KCVH 2XFXA 4OCNC 3BDBA 3SDYH 5EU3B 4WO4B 3VXUE 3HI1B 2R8SH 2RB8A 2Q8BL 3SKMB 5DSCA 4W6YB 4I48B 2FNBA 4QXUL 5AYQA 5K9QG 1F6FB 1MJJB 3MOQA 1OAQH 4WHYG 2BFVL 4NN7B 2DYPD 4WV1A 4UT6L 2IPTH 1MCSA 1CGTA 3MRDB 4IOFC 1OT2A 5IVXE 3PGFH 4HGWB 4P0DA 2ADGB 3WEXA 3QUZB 3Q6GH 3MRLA 5DHVH 4JZNA 3HAEA 5FYKD 1Y6NR 5GJTL 5BXFA 1GCFA 5IJVA 3EDKA 4ZTPL 2CLRB 4WNQA 5DHXB 4G6KH 1VSCA 1L4IA 4PJ5A 4PY7B 3TPUA 2VLKB 1MCOH 4IOIA 5IF0B 3O3AA 3AU1A 5FGCE 1OWRM 1L7TH 3CZFA 4IRZL 1RZIB 4E41B 5C7XL 4WO4C 3RA7H 4Y4FA 4WFHD 4G8EA 4LIQE 2DQIL 4EDWH 4WI3A 5EU6E 2ARJA 2QSCL 3O6KL 4YHOH 1QD0A 4OZGE 1T4KA 4BSJA 1YECL 5EU7E 3ZYZA 4I18A 4BK5A 4OV5B 5HVHC 5ANMB 5FO9A 5K9KB 4AMKH 1JUFB 3UC0L 2E9IA 1NCWL 3BYTA 4NN7C 4UQ2A 5I8CB 3DRTB 2VXUL 1E0OB 1PZ5B 2EE2A 4KKBD 4YHNB 1OTUC 4H0HB 1MCPH 4PBWD 4DVBB 2N4IA 1Y6MR 1CR9H 3QUZC 4Y1AB 3Q2CA 4GQPH 3V4PH 1H3XA 2AGJL 3WSQH 4P57B 5ICYB 2YUXA 3MXVH 5D2LE 4KY1H 2P5EE 1D5MB 2C4FU 4K3JL 3P11L 3RQ3A 4PGCB 5K9QI 1QBLL 5CEYB 3UX9B 3ZHKA 5EO9B 1NCCL 3G9AB 4U1JB 5DGQA 1JK8B 5EDXA 1T2JA 4PJCA 1SY6L 4ZYKA 2J88H 4U1GB 3VXUB 3OKLB 2X4UB 4YIQB 2MPAH 3PQYD 4Y4HB 2BXZA 4Q97A 4GRWH 5FO7B 4B50A 1P4BL 1JI2A 4F2MB 2PYEE 2O5YL 2D03H 2R23A 4UQ3A 2ATKA 4U1MB 1A5FH 3ME0A 2YPLA 3PABB 4K3HA 4YHYB 4WFFE 2YD9A 1FC1A 2QLVB 4O4YH 1QR1B 2ILLA 4P2QD 1QPPA 4AIZA 3AAZA 4PV8B 1W8NA 1QVOB 3T0EE 3RVXD 1U3HA 4G8FA 4LLVB 1XF3B 4UV4H 1P5UA 2YD2A 1EZVX 3WFHB 3OB0H 2AJZB 2HN7B 2XYCA 3GB7A 5DQ9B 4N90D 1MRDL 3QEQA 2ICCA 3DV4A 1QFWI 2QQLL 3VA2C 2ADJA 4MAUH 1CVRA 4U1GC 3SDAD 1XF2B 3EYFB 4CRPA 5IEHB 1CDHA 1FFNA 2EO9A 3IDMA 3SDXA 1XGUA 4Y4HC 4ZSOA 4D2NA 2Z92B 5GISH 2DD8L 2VDPH 3H0TA 3R0NA 2OJZL 3EO9L 2H8PA 3OX8B 1K3ZA 3O6ML 5JW3H 4TRPL 2G75A 4ODWA 1QEWB 2VLRD 3VGAB 3V52L 1V8HA 2X09A 4YHYC 4FQXA 4JFXA 3L5HA 5T1DH 4LASL 9CGTA 2HRPH 3N06B 5CJ5A 4NO0D 1JNJA 5FYKH 4LHJB 5IMOA 2ICWJ 2HLFD 3KDMB 5DD1H 5GHWL 2DJSA 3EJYD 4HKZB 3VCLB 4M7JH 4PIRF 3S37H 1BAFL 1WZMA 1C5CL 4OF7A 1ZSDB 4Z76A 5C9KA 4JREB 4Y5VB 3FCTB 3WLWD 5TE6H 5K9JH 4EXPX 1MAMH 2FGWL 3BGMB 4JFYB 1T7XA 3TO4A 1EGJA 3V6OE 2YPVL 4I0PB 1I3GH 1OVZA 1T1ZA 1WEJH 3PWNA 4CN6A 5DC4B 5DJ6A 2LE9A 1QSFB 1QUNA 3I6GA 4KVCL 3CFCH 4TVPD 2WQ8A 1OD7A 3G6DH 2VDMH 4YUEL 3HE7D 3BUYB 1E6JL 4GXVH 2GJZA 5HGDB 3EIFA 3KJ4B 4JQIL 1X4YA 1YEFL 5ALCH 2J2ZA 1ZWIB 3LHPL 4X7EC 4AM0A 4LDEB 2PYEB 1LO5A 1LEIB 3ARPA 4QLRA 4N5UA 1WCBA 4LCYA 3T0XA 5I1GL 4PJCF 3JZ7A 3H42H 4JRYA 5CD3B 2LTQB 3QRGH 5KBNC 3ZKMC 1VB9A 3VD3A 3H2WA 3T0EB 2NX5B 3T8XA 3MV7E 4F58L 3QCVH 1CGUA 1JPSL 3UTPD 4JREC 5BVPH 4Y5VC 5HPMB 4R2GB 1ZLVK 1CFSB 4G6JL 5AUMA 2GAZB 5H2BB 4ISVB 4J4PC 1C12B 4I0PC 3MXWL 2VL5A 4OGAC 4F57H 4GFTB 5I30H 4DFIA 4NPYB 5I8EA 1ZGLB 2GTWA 1FAIL 4PGBB 4U3HA 4OCSL 2AAVA 4RMTA 4X6CE 3HNVL 3OF6D 1BPVA 4K3DL 4PJDA 3KJ4C 4LSSH 3D39B 4XP9H 3EKCA 1IEHA 1KJ3L 5JDJA 4C4KT 1IBGH 1AO7A 5D2NA 4PLJD 2EDQA 4MSWB 5DD3H 2LTQC 3REVB 2VR4A 3PDOB 5CGYC 3HNTL 3SBWC 1UWXK 3IU4H 4XAWH 2XG4A 2FJGB 3V8OA 3NH7L 4RFEA 4KHTL 1T1WB 5IGXL 2CK0L 4G6MH 1LO0L 4GAFB 4C83B 4R2GC 4OJFL 4TTGA 3IVKA 4NT6A 2F54B 4HKJA 4KC3B 1FZMB 2W07A 3R4DA 4OZFH 1J9CT 5I16A 1IGYB 1FJ1B 3B5TA 3EO1A 1N8ZA 1EBPA 4HCRL 4JO3L 4OD1L 4OKVA 1NUNB 2KQMA 2WIIB 4XAKE 2ZSWB 5GGSA 4XPAL 4NQSA 3FQRA 4HZLB 4J3OC 4R0LA 2IPUG 1JPFA 1RZJC 4JFOA 4BKLA 2IALB 1WC7A 2AK4B 1DE4B 3PV6A 1E4WL 1UVQA 4N5EC 5L7XL 3BGFB 1XF4B 1U3JA 2YR3A 1JTOA 3VW3H 4HBQA 4PJHF 3FB7B 4QTHB 4J3WA 2PW1A 5FKPB 4PRAB 3EZJB 3QEGH 4XPHH 5GGRA 1QLEH 3M17A 3BGAA 2X05A 1IC7L 3EDFA 1G7LB 5J7CC 1MCFA 2G60H 3G04B 4FTVA 5LAXA 32C2B 3VG0L 3AC0A 4U3CA 3JWOL 1YN6B 4PJXE 3MOAH 1Z5LB 2AJYL 2IANA 3CLFH 3I9GH 5E1HB 1G7JA 2R2EB 4H5SA 4QOKA 1FZKA 3RWFB 5D5MA 1F58H 3MRCB 3RBGA 2APWA 1KIQB 2PR4L 4TVPH