4KUCF

Crystal structure of ricin-a chain in complex with the antibody 6c2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
QQPGSELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPGSGRTNYDEKFKNKATLTVDTSSSTVYIQVSSLTSEDAAVFYCVRWVYGNFDSALDYWGQGTSVTVSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Structural insights into the neutralization mechanism of mAb 6C2 against ricin
rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 18
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kucF00
2HJFA 3ARFB 1S7VB 1MCPL 4YIQA 5JUEH 3VGFA 5EB9A 2R29L 2NY0B 3WV0A 1LK3H 2DQUL 4I18B 3ZYJA 3HMXL 1ZVYA 3X3GL 2XNAB 5EDXA 5HHOB 1DQDL 3SJVE 3V6ZB 1QLEH 2IEPA 5CS7A 4KDWA 5C0CB 1DANT 5CD5C 4KC3B 3OAYK 2HT2D 3JWDL 3FT3B 1U9KA 2AEQH 2I07A 4LRIA 4JDVA 2A74B 4PRPB 4OV5A 4LCIL 4RNRA 3V0VB 3DPBA 5E1AB 3FFCA 4S10A 1YNTA 15C8H 1T89C 3GKWH 1T1YB 1PBYA 1P84K 1YEKL 3VD3A 4ERSH 1KNOB 4O02L 2WBJC 3BUTA 4QTHA 2O93L 3TWCL 3EDFA 1EH9A 1MCLA 3LEXB 5BS0E 4K07A 2IBZX 4P2OD 4NJAH 4W6YB 3T8XA 4YAQA 3Q5OA 1IGFL 2YHGA 3I3DA 2VYRE 1D5XB 2MJWA 2MNUA 4ZPTB 4KHTL 4JRXB 3PGFL 1Q9WA 4M3JA 2C4FT 2YXFA 2VDNH 3VFOB 4C56A 2VITB 1I8KB 1E0OB 1T7WA 4YZFF 2IFGA 2QLVB 3OKLA 4JZJA 3RX8A 2CKBB 2G5RA 3IGAA 5D2NA 4B7LA 5T33H 1IBGL 1MCEA 3IDUA 4XMLL 4L29A 1A47A 2IAMC 3R1GH 5D1XA 4EI5C 5TQ2L 2V9QA 4FABL 1ZANH 2WQRA 1RZKH 4NQCB 3HAEG 4PJIF 2VH5H 3BT2L 5C0GA 1AGFB 5BZDA 2X9WA 1RJLB 2VDOL 1A4JA 3BKCL 4ODVH 4KFZC 4CVXA 2FGZA 3HI1B 1MHCB 3P4LA 3EYFB 4MQXD 5FHAH 4L4JA 1VADA 4EIZC 5F7EL 1EIBA 2QKIB 2VL5A 1I1FB 5C0BB 4H1LB 4TUJA 1CFTB 2PCPB 5J8OA 4JFPA 2E7HA 2X2YA 3UPCA 5C0NC 5E8OB 1JCKA 1RUPL 4D94A 3BDXA 2X9YA 3W9DA 4OZFH 3AS2A 1I1RA 1S9VB 4KK8D 2ZSVA 4F33A 3NZHH 4LKXA 2HTKC 2Z9TA 2MKLC 3L3IA 2K1MA 1K9TA 2HVKB 2A6IB 1A7QL 4K7PY 3QHZL 1T6VN 4BH7A 4MA7H 4WI3A 2HLFC 3EYOA 3M45A 1K5NA 1F42A 5DMKA 4ZMAT 4EN3C 4H8WL 3QDMD 2G5BB 2VLRD 2YMXH 4TOYH 3T77B 4JFXB 1UCTA 1XCQB 1PY9A 2JB5H 3TO4A 1D5BB 1NAMA 3V5DA 2P8PA 3DI2B 5EBMB 4K3GA 4LSTL 2RFXA 1K8DB 1D9KC 1CQYA 1J8HA 4PJFB 3CCHB 1S9YB 1UKSA 2VDLL 3CLEL 4LBEA 3FOMB 1TQBB 5F9DC 3W0WA 1IFHL 5FDWA 1EFXB 1KJMA 4DGVH 3G5VA 2VUOA 3D1MC 5ADPH 3KLHC 4ZSOE 4DGYH 2BHYA 4MX7B 3WL9B 1SVCP 1P4BH 1Y0LA 3D2UB 5T3XE 5C0JB 1IGJB 2CRZA 1AXTL 3K4ZA 3VGHA 1J1XL 4PRPE 4WDIA 4QKXB 1YPZF 1NCWL 5FF6B 2XN9E 4RZCB 3T2QA 4F7CA 3MRNA 3FRPG 4QRUB 2IWGA 1NCCH 1BAFL 1AC6A 2PXYB 5I1KH 4Z0XA 2E9JA 1FBIL 4HKZA 4XVSH 2W92A 3MNWA 5IW1B 4CW1A 4M7KL 5DHVB 2HLAB 4GOSA 1FVDA 5DMYA 3O2WL 1T20B 4N0UB 3VWKB 3Q0HA 2D31A 1R24A 2ZUWA 3T1WA 2W0FA 3CMGA 6FABH 3GSXB 4G8IB 4M6NH 3MMEB 3TBTB 1VGEL 4LDEB 5CEYA 1KSRA 4AEIH 1FVCB 3U0WH 1OGAA 2VXSL 4MD0A 5C6PB 5GGSY 4RWYH 4HBQA 3IDNB 3QCVH 2P8MA 3QDGA 2ZUXA 3RWFA 4M61A 4ELKB 1DBMH 1IC5H 1X7QB 4P5TB 4GW1B 3O3AA 5FUOL 4YBQD 3V4PL 2LVEA 1KXTB 3FAXA 1MWAA 3H7BB 4GFTB 1FE8L 3RGHA 1XCTA 3GJFA 5JNYB 1UXSA 1IC4L 3DGCR 4NQCE 4YEEA 3C5ZC 2AEWA 4NN6B 4EQ3A 5C3TA 4NRZA 1TTUA 2NY1B 2X09A 4J3WA 3BKMH 5TFSH 5J57B 1K2DA 4OGAC 1UB6B 4XCYB 2JB6B 1AGDA 2X4RB 1NDMB 3JV5A 4ORGB 5H2BA 1KJ2B 1RI8A 4HFUH 5BMFL 4K3HA 5IB3A 4L3CA 1H3UA 4GBXC 2LTQB 3MBXL 3AXLA 2C7UB 3IDGA 4ONFH 3SDCB 3ZT5A 1XGYL 3S3SA 2APBA 3QEHA 1YQ2A 1I7UB 2WP3O 4PJGB 1IEBB 5C0BE 1KTLB 5SWQA 5T3XH 1AFVH 2VISB 2P24B 1RZKC 4YJZL 4PRHB 3HZYB 2XKNA 4OF6A 2F8OA 2WM0A 4RFNC 2JK5A 5I0DA 2AEPL 4LLDB 2D7TH 4NQSB 2FRGP 4P4RA 5IG7B 4NKIH 1UCBH 1P84J 2GK0A 5DT1L 5HI5C 3ARPA 2EECA 4I1NB 1OSZB 4C4KO 1W0VB 3VDCA 3JTSB 1MHEA 3T3ME 3X3FH 3BEWA 5BVPL 3CFEA 2KDGA 3QNXB 4QXGL 1GOFA 1L0QA 1T5WA 4PJ8C 3NFNB 3QO1B 1WV7T 1AIFA 2IBBA 2D9CA 4RBPH 2DM7A 4XRCB 1KTKE 4PRBB 3A67L 4N5ED 1BZQK 3ARGB 5EC1A 2QADB 4HC1H 4DGIH 1V7MH 4JCLA 2EDLA 5EG6C 3O2DA 5E8PA 3TV3H 5DRWA 3NPSB 4MS8C 4PJFE 4XNQB 2ARWA 3I9GL 2IH1A 4ONGL 3ZE1F 5DJCA 5EBWB 1XT5A 1AGCA 1XGQB 9CGTA 4HZLA 1I85C 4YDJB 4AENA 3AREA 2CIIA 4OD1H 4NM8H 2HN7A 2VN4A 3U2SA 4GAJL 4N0YH 3X12B 4FXLA 3NIDE 5DFVC 5CILL 5HGAB 2ZKHL 3HB3D 4Y5XC 5IEHB 1URLA 1A7RL 4FQLL 3SY0A 1HKLL 3DBXB 3P77A 3U48A 1KCUL 4X98B 5FAAA 4WU5A 4O00A 2BC4B 5DEFA 3RWCA 3I75A 5L2JA 1SYVB 4JGJA 1HH9B 2KQNA 3RVWC 5I1AA 2UZIL 4S2SA 2A0LC 2YSSA 3G6AB 2E7BA 4YGAB 3TVMB 1HI6B 3BWAB 5CKGA 3U1SL 4OZGA 5D6CB 3N1GC 1NAKH 1RHHB 5J1AB 2CGRL 3MLWH 5E5MA 5JIHA 4NQVA 3RL2B 3DXAD 4W70A 3CZFA 4Z7WF 4MXQC 1F3JB 4N0UE 4PJXE 2B0SL 3WIFA 5F70A 1UH2A 3GB7B 1CT8A 3QXAB 3QXWA 1CYGA 3O4LD 4N0FA 5SWSB 4QRSA 1ZWIA 3ULVL 2DQIL 2J88H 1JRHI 1IGCH 5E8DL 2D4DA 1MUJA 4XP4L 2EO9A 2YRPA 3GM8A 4M6MH 2V2XB 4ZFOA 3GDBA 2DB8A 1Z9MA 4KY1H 5DZOA 3C8HA 1U8LA 3VE0A 1I9JL 4CDHA 4G43A 1BIIA 4HIIB 3TN0D 2V2TB 4QEGA 5JIIA 5DK3A 3UTPD 3R4DA 4GMSL 3MRJB 3NA4A 1MCWW 3V9FA 2BOCA 2YPKA 4M1CD 1EBAA 2NTSP 1SEQH 3HFMH 5DUPH 1ZVSA 1IT9L 3V4VL 4XP9L 5C0IA 3FT4A 1NKOA 1AP2A 4Y5VA 1BBJA 4L8CB 1IEAA 1LDPH 1GGTA 1ADQL 4NDMB 1AQDB 5KVEL 2D03L 2J2ZA 3B5GA 1ED3B 1QLFA 1F02I 1WWWX 4D0BB 2B5IC 3EZ8A 3NCMA 4NZDA 5A40E 4J3TA 4Z95L 5MENA 1B2WH 1T1ZA 2FLBT 4LQFL 4PIRF 2DIBA 1TZIB 4FZ8H 1V3KA 4QRPD 5J11C 3W5MA 1Q9KA 4X6DF 2R4SH 3AMKA 3F5WA 2IBZY 5HHVH 3B5HA 4JRYD 1RUKL 2ED9A 3IDYB 5GZND 4YC2B 4FQCH 1RIHH 3WNPA 1H8SA 5D71H 4JM2D 4YGVA 4F7TA 3N50A 1PYWB 3PHQB 1R3HA 1LVEA 4R4BB 3RPIA 5DQ9A 2GAZB 4D9LL 3QRGH 5DK0A 2R9HC 1HZHH 3U7WH 2ITDB 3PWPE 3DETC 5FA4A 1AI1H 3SE8H 1H3VA 4U1KA 3QSKB 3TT1L 4XNYL 1OLZA 3MRKA 3HG1B 3TH4T 1P6AB 2MCPL 5JA8B 3RA7L 4LLQA 1UH3A 3QEQB 3VRLF 5D7KE 1E6OL 1YEDA 2DBJA 3FB8B 5AUMA 1U3ZA 1UWGH 2VQ1A 3HPJB 4PJIA 2BSRB 5C1MB 2AV1B 5E8NA 3BHBB 5DQDL 3VGEA 3MA7A 1JRHL 1RURL 3M17B 3O6KL 4M4PA 5AWNL 2VZTA 5ICXA 4XNZB 1N5AA 1QP1A 1PKOA 2ATKB 5C9JB 4P2QB 1J0KA 5GS0L 1X4YA 2AK4B 3VG9B 5TE4H 5IB1A 3OAUL 4G8GD 3VXUA 2PYEE 2FYYB 5IVXB 2FEDC 4YHMH 1J0HA 3SKMA 1PQZA 3ZDZF 3PGDA 3DV6B 5DJ0B 1FVEB 1JF1A 1QSFD 4V1DA 2VXQH 3EO1A 1IQDA 1S9WB 1YN7A 2YPLB 3VD4A 4G8EA 1RZFH 5C07A 4RAUA 3SBWC 5D1ZD 4KAQL 4NQEA 3HMXH 2PYFA 1NL0L 3HC3L 4XMKH 4U2YA 4I0CC 5I16B 2BSSA 5JXAL 1L0XA 3W2DH 5SWSE 4EUPH 4IRSB 1HWGB 3L7FA 5C0AB 1EO5A 4N0CC 1IGYA 3TBYA 5E9DB 5I6XB 4JFEA 2R4RH 1N6VA 2DD8L 5J4MA 2FHFA 5E00A 4IS6A 2ICWI 1G0XA 1VCAA 3JWDH 1J86A 5TJWK 5K33A 1I7ZA 3UJJL 1QPXA 4KI5D 4LCIH 3WDJA 1BQHB 5I8KL 4MNHB 4URTB 3RP1A 3D85A 3QNZA 1WZLA 2XWBA 3U9PL 1TZHA 3ZHLA 1YEKH 1BQSA 3MRHA 1P4LB 4KPHL 4O02H 5J12B 5DDHA 2BERA 1M7XA 3ARDB 5HYJD 3W82A 4GG8B 4OQ1A 1U8PA 1CE6B 2YC1A 4M7LT 1MJ8L 1T0MA 2VSDA 3CFKA 5EU6A 2CRYA 4GXVL 4N5UA 4PBVC 4YDVB 4AZ8A 1HEZB 3PQYD 4MZ2A 4JY4B 5GGVL 1LEKA 5IMKB 1MHPL 3F6IA 1YPZA 1P2CB 4HUWB 2F54A 4H5SB 3GJFK 5GGSA 3S97C 2D0FA 4LSPL 2ZUQC 4PY7B 2JJWA 4PJ9B 1Y18A 3O9WB 1HCFX 3QHFL 5L88L 4L3ED 5TDNB 5C7XH 1CLYL 2H2PC 5C86A 3I6GA 1XGRA 1A1MB 5GRVK 1WAAE 4G6AD 3BD5A 2B39A 1RJZA 3KG5A 3BT2H 5F9JA 2NXYD 1CN4A 5ESVA 5JQ6H 1I1CA 2VXUH 5L7XL 4MAYA 1IL1A 4M4RA 1U8IA 4Z7QE 4Y4HD 5CD3B 3CU1A 3SKOA 2XIDA 5HYQB 4FXGB 1KLUB 5F7EH 2P5WB 3WO4B 4ZPVB 3NACL 2AK1H 2X1OA 2EDXA 1BFVL 2FH8A 1RUPH 2QR0B 3KPLB 2BHUA 1TVBB 3BQUD 4NZTL 1WT5C 4NKOB 2BCKB 4XBGA 2OR9L 5DGQA 3ARWA 4O51A 2BVQA 1AR1C 2FBJL 2DKUA 4HUMB 5E1HB 4Y1AA 1CXKA 5E2UH 1RVFL 2P5EB 4DKDC 4GRWH 4P2QE 1J18A 1RK0B 2QQQA 1QFOA 3C6SB 2AK4E 2XA8H 5H8DA 43C9A 4JFDB 4H8WH 3C5SA 4KK6D 4BSVA 1UKQA 4GAYB 3PHOA 4HQQL 5CCKH 1KB5B 3FB7B 2FLRT 4NO0D 2CDGB 4H0IA 3KJ6H 3OB0H 4NN5C 1MQKL 1AKJB 4LSTH 4PP2B 2YPLE 1MOEA 3MCKB 3GSWB 2BY1A 3MV9A 4UDUB 4KMTH 2VZ3A 4WFED 4G9DB 4PPTA 1IFHH 4GXUN 1ZHBA 4YE4H 5ILTL 3RWHB 5E9DE 2H1PL 1U3HD 1WBYB 4WI7A 3O2VH 4N8VA 3OJMB 4OIBA 3VFMA 4XHQA 1AO7A 4QLRA 1BQHG 4MA1C 4PRAA 1WISA 4AEEA 1J1XH 1FH5H 3N06B 3LRHA 5CJ8A 3L6FA 1JL8A 2IQAB 2YD1A 3JV6A 2DWEA 2X4NB 3S36X 3RKDC 5F71A 4F8QA 1G7HB 3ZDXE 4KV5F 1FBIH 4JFYA 1NDGB 1SVZA 4M7KH 2ZUTA 4F8TA 3AUVA 3RNKA 3FO2B 5IHLB 3O2WH 2CSPA 1U36A 3AS3A 3QWRA 3O3BB 3SDAB 5DD6A 4LGRB 3JWDC 4TTDC 3EW3B 4O2FB 4KKBC 4WV1B 1CD9B 4X4ME 3VU2A 4GAGL 4LLAA 4RX4A 3QIWC 3RWDB 4WY7L 7FABL 5I1CL 1T3FB 3VWJC 1UZ8A 4YHZL 3UO1H 4RGMB 3RWGA 1QHPA 2R15A 3L5IA 3ESUF 5J9PB 3VFUB 4C57C 4FQJH 3SGDI 3TIEB 3DMMB 5FUOH 3V4PH 2F5AH 2YS4A 3HC4L 3IXAA 5HGDA 1CICC 3BP7A 1AD9A 5AD0A 1XFPA 4Z7WA 1LNUB 1SJHA 1F6LL 1Q0YH 2FL5B 2DL9A 1H15B 1LE9B 5IMLB 1N64L 3I6LD 1CFSB 3WNKA 3CVHH 1JF5A 4F7EA 5DJDA 2ESVB 3MBXH 4W68A 5EH1A 4IRJC 3LKSA 2BJML 3SCMD 4XTRC 3W39B 3ZTNL 1HXYB 5I1JL 5KJRH 1BWMA 4OZHF 3TBSA 2VR4A 2P5WE 4HS3A 3H9SA 3H0TB 3GBML 3PP3K 5JOPD 1FNGA 4OF8A 2JJSA 3HMWL 4KVNL 2X6MA 3MRCA 5MHSE 2I26N 2AEPH 2YA0A 4HWNA 1C7TA 3ULVE 2EH8L 3MLXL 5DYOB 5T1DL 3RWJA 1EEZB 1G7IA 5KW9H 3B9KA 3QFJB 4K55A 4M02A 4OAWA 5D1QD 2WNGA 2P5EE 4V2BA 3WEXA 5B4MD 5BVPH 4QXGH 2PTVA 2YWZA 4JFDE 4WWKA 4NZJA 4R0LA 4W4NA 1VGKA 4ZNEE 2YRLA 3A67H 1IAOA 5IROC 5HGBA 5F3HB 3G9VA 2X1XR 2O5YL 1FGVH 4F9LC 5A16B 4MJ4A 1L7IL 3EHBD 4Z6AT 3PV7A 5KSBF 3BIBX 5ENWB 1U2HA 3WS6A 4MJ6A 3ULUF 4X6DA 3GSQA 3D39E 1AHWA 1RUAH 2X05A 4GW5B 4NC1C 1FC2D 3HZMB 2F58H 4KU1A 3NA9H 4GAJH 4H8WC 1EGJL 1WZMA 2J8UF 4GKSB 2M26A 4Q58C 1IKFL 5DJZB 2ZKHH 4I8DA 3TZVA 3OJDA 4NP4L 3QYCA 4FQLH 3PP3H 5DJXB 1OB1B 3LQZB 1HKLH 1U8HA 3GMMA 3QUYC 3SEPA 4NKDA 4KJYB 3MRBA 3MV7E 3WSQH 1JI1A 2DYPB 2OM5A 2GIYA 5B38A 1YUHA 4Y89A 1FFNB 1VHPA 4U1SA 4FOMA 3BGFC 2UZIH 4IM8A 4KROD 1MJ7L 4UV7L 2Q8AH 3TBVA 5TDPA 3U4EA 2B1HH 1LP9F 1IM9B 4X9IA 1LEGA 1X5AA 5D6DA 5ALBH 1EERB 1G7LA 3VJ6B 4HAGA 2F53B 4RAVA 5ANME 2NY4D 5C6WH 4Y16A 1NH6A 3DHJA 1U6AL 3HUJB 5JOEA 4G6KL 1JGEB 5ETUB 4YO0B 1R5IB 3ULVH 4XVJL 2X4QA 3HS0A 1PW3A 2D7QA 4XP4H 3D3VB 2NYYD 3DO3A 1NC2A 3UJIL 4YHNB 4WO4A 4YFLF 5GRZA 1ZGLB 3G6JE 4P46B 5T1KD 1FV1A 3ESVF 1R3IL 5E99L 4P9HL 4Z8FL 2BXYA 3RWIB 4E0RA 3MLTA 4U1JA 4AH2A 3QI9A 3JSSA 4PTTA 4BQCA 5KZCB 5DMGC 4Z9KB 2P42B 4GMSH 4BH8B 4QHNB 4KQ3L 5D7LA 5KS9B 1PKQA 5JLZB 1A7NL 1P1ZA 3KXFD 3TYGH 5J6GB 2EDOA 1MH5B 1IT9H 1MCCA 4U3XA 3V4VH 4XP9H 5KAQF 3RVUC 1NGPL 3QUXC 3OBAA 1ADQH 2R69L 4MSWA 5KVEH 1N59A 3UTSA 3PV6B 3S4SA 4U6XA 2HJLB 3STZB 1HSAA 1OP5K 1F90H 3ORJA 3O0RL 4L4TB 4MQSB 4NNYB 4Z95H 5IBLC 2B2XH 4XAWH 4LQFH 1KPVA 5GSRA 1WBXB 3LD8B 3L5JA 4MLIA 3OF6D 2BVOA 4LEXL 3V6BR 1FG2B 3VFPB 4BFIA 3DRQA 1P9MC 1EHLL 1D5MB 3MV8B 2X10A 1WCQA 3QFJE 4PS4L 2P44B 3G08B 3MBEB 4RGNB 4MQ7A 3QG6A 1RUKH 3BIKB 3CFJB 3PL6B 3O3EA 2GSGA 3HE7C 2N1KA 3VRJA 4PRIA 4WUUD 2VSCA 2FSEB 5IOPA 4ODXB 2APVA 3RWEB 1X9QA 4I0PC 4F58H 3OKMB 4AK1A 5FHBH 1U91A 1TQCB 3TT1H 2Z31C 3O6FA 3BXNB 1F45A 1UJTA 4RDQG 5JXEC 3OTTA 4LSQL 2MCPH 1I4FA 2QL1A 3B83A 4LDLB 4U6YA 2PTTB 3SE4C 1E4KC 3FOLB 4P5MA 3ILPA 1E6OH 2AKRA 4NQDD 4O2CA 1A7OL 5CWSB 5J12C 5ACZA 2UYLB 1A7PL 3C8DA 4K23L 1H3WM 2EYTB 3GMLA 1I3UA 4LNRA 4XXCC 1ZHNB 1CDJA 1ERNA 3PWUB 2EKSB 2H3NB 3NFPB 4CVZB 3L3GA 1TNMA 5DQDH 5HD8C 2DTML 1JRHH 1FO0A 1RURH 1JPSL 3UTTE 2IG2H 5AWNH 1JWSB 2X89A 1BVLA 5GS0H 4YWGH 1QYGL 2QV2A 2LU7A 3NVQA 3OAUH 1IJ9A 3FFDB 3LCYA 4PJDB 4PJ9C 2FR4A 3O9WC 1A21A 3HRZB 3A6BL 2MQ3A 2XWTA 4MNQD 5IHBA 3RVVC 1R5VA 3RGVB 2EYSA 3GSRA 1C1EH 1MSPA 4KAQH 2F53E 1NL0H 3HC3H 2UZXB 4YHIB 2NTFB 3STLA 2IMMA 3HUJE 3BVNA 1LEIA 1ZOXA 3U6RB 2GSIB 4PV8A 1F11B 3QZWA 3D3VE 2DD8H 1FFRA 4H25B 4HKJA 1EZVX 3KHOA 2ZOLA 5CJXA 1BZ7A 3KYNA 4NO5B 4WW1B 3OB8A 3M1BA 3I6KA 1R3LA 3UEZA 2G2RB 4Q0XL 2WK2A 4X83A 5IUSA 4OF3A 2W60B 4X6CF 3D48R 5KVGL 5KS9E 5EU3B 4KPHH 5CGMA 5C09A 3L3DA 3ULVC 1A9EA 3H3BC 3VGBA 1PZ5A 4TTGA 1I9IL 4JFHE 2W65A 2K3TA 4CGTA 4UAOC 1I3GL 1X4XA 1S7TA 1PSKL 4XMPH 1MJ8H 3O3DA 4YK4B 3RTQA 1T4KA 5E24E 3VXMA 1MHPH 4RMSA 4FQHA 2DQTH 3T4YB 2P49B 2XTJB 5FYLL 5AYUH 4Y8AA 2FIKA 2ZUYA 3GSNH 4LSPH 5HDLA 3ROOB 3QFDA 5I1HH 3L1OL 4Y2OA 2VLRA 3QHFH 4EEEA 2IALA 2VC2H 1DUZB 1I1AD 3QRFM 1JYWA 1C5BL 2IAND 1BEYL 3MV8E 3P73A 4YDKL 4CADB 3BH8B 4PREB 2AS5M 5HHMD 1SYSA 3DNKA 4NHCL 2VQTA 3QUZD 5GGQL 1MI5E 1YNLH 1G7MB 1KIUA 4LARL 2VO5A 4HKXA 3LKRB 4C83B 3LB6C 2AEIT 1ES0A 1NBZA 1P5UA 3K0WA 4UTBL 5ACMA 3SDDB 1QTYT 2NCMA 3PGCA 1NAML 4G8FA 4I9WE 3G04A 4OV6F 5GISL 3FQUB 1RV6X 4JLRA 5JZ7D 4O4YL 5E2WL 4M48H 2XTLA 3NACH 1BFVH 1MRDL 3VCLB 4KQ4L 1JGDA 4JZNB 2DIAA 4ODUA 1OHQA 3KPRA 4HF5H 4NZTH 1T2XA 5FO7A 1T2JA 3IFNL 3V0AC 2OR9H 2GTWA 2VXVL 3X17A 2XI9A 3MXVH 3LZFH 3LN5B 5E2TL 1J05A 3LN4A 1SBSH 4TVSa 4QRTB 5CP7A 1JGUH 3KYKL 4FQXD 3QCUL 5HVHC 2EE2A 3LEVL 3C8KB 2VABB 1RUML 4OKVB 3MJ7A 4D9QE 3WFEL 1HHGA 1XIWB 3MLRH 4HQQH 5HY9B 4OZHA 4J8RA 1U8MB 1BECA 4ZODA 3LPWA 3VXRE 3MNZA 3U7YL 4M8QA 1KIRB 1KN4L 3QUMA 1F58H 4HXAH 2JF1A 4LVOC 5D2LE 5SX4I 5C08D 2P47B 1R0AL 1FAIH 4YXKL 3TJEL 5GS0C 2H1PH 4TRPL 4L9LB 4J2XA 4AEHL 5CD5D 4MAYC 3EJZC 3T0ED 4OCSL 1I7TA 1JTTA 3HNVL 1NCAL 1JHLH 2B4CH 2YA2A 2FO4B 4JDZB 4NCC2 4XZUB 1UXWB 3TA3B 1P7KB 2J6EL 1J1OL 3K8MA 3U36A 4OIIH 1MWAL 2X41A 3LRSA 2Z4QA 3WMSA 3IFPA 4OLZL 4OFYD 2Q76A 4WEBH 2BNQA 5KSBA 1MY7A 4OLXL 4B41A 4LLWA 5ICYA 3RDTC 2OL3L 4TVPH 2EE6A 3BYTA 2J8UA 1KJVA 3MZGB 3PE9A 1CXIA 3MRGB 4GAGH 1BJ1J 2HJFB 1XMWA 5MI0B 4WY7H 7FABH 5I1CH 5EA0L 3UYPA 4YHZH 3ECBA 3G5YA 2BVTA 4PG2A 3T0BA 2X7LB 1CXHA 1FCGA 4OCNC 1JNJA 4G9FA 5E7FA 2ZJSH 3L95A 4DFHA 4EI5D 2F74A 1ZHKA 2I07B 4XAKD 1NGYB 4GQ9L 4ZD3L 4JDVB 1FYTD 4OV5B 4RNRB 4GW4A 2DQFA 3FFCB 1YNTB 2Y07L 1EJOL 4HUUB 4HGMA 2R23A 3N85H 5FUCE 1IAIL 5IBTL 3SDYL 4O2EA 1WWCA 1I8IA 4LPTA 3ZTNH 5I1JH 3P4OA 3EFFA 4QTHB 5FYJD 2AQ3A 4JFZL 5E8EA 2R8SL 1S3KL 3GBMH 2BK8A 3GIZL 2GJ6D 5EBLA 2WLYA 4X9HA 3O8XC 3T8XB 4YAQB 1T66D 5GS1C 4X8JA 5CBEA 3HNTL 4Y5YA 2D2OA 3MLXH 2B1AH 1DL7L 2R2EA 4G3YH 5T1DH 1DP0A 2YKLL 4ODSL 4HFWA 1Q9WB 4G6ML 5FCSH 4C56B 1PVHA 3DXAA 3H9HA 5F7DA 3OKLB 4JZJB 3BZ4A 5D2NB 3WXVH 3T0AA 3UP1A 4HCRA 4M7ZC 1JV5A 2QSVA 4L29B 5IBUB 3O4LA 2JCCE 5D1XB 1ZKAA 4ODBD 3B2UD 3FT2B 5C0GB 3MRLA 4XH2A 5BZDB 4XPBH 4M1GL 4JDTL 1L7IH 4ONHA 1E27A 1Y6MR 1A4JB 3E3QE 5DC9B 4CVXB 5BV7L 2XA3A 4P4KB 3TN0A 4MD4A 1VSCA 2FGWL 2HRPH 2XXMB 4PR5A 1VADB 4G7YH 2VL5B 4TUJB 2ED7A 4JFPB 5TF1L 4NP4H 3ES6B 3KS0H 4BZ1H 4QXTA 5AG8A 2AERT 3W9DB 5GIRA 3F7PC 2ZSVB 2QQKL 3SGDH 5F6HI 5SWZA 1LHZA 4OFIA 5CSBA 5KSAC 2XWJA 1KIQA 1JMZA 3N0PB 1MJ7H 5M7QA 4UV7H 5F1NA 4BH7B 3EYOB 5HYIA 1K5NB 2HFGL 5DMKB 4HH8A 1MRFL 3FQNA 3BP4B 1AXIB 4NNXA 2BVEA 4K3JH 4NO3A 3VFVA 4L8DA 2AJXH 1D7FA 4MLSA 2Y6SD 3TO4B 2B4CC 4XVJH 1HHHA 1BWWA 1NAMB 3P9LA 3QIBA 2P8PB 1GGBL 5DD0L 2RFXB 1J8HB 5LWYL 5I1EL 4X9GA 1J8KA 1HHJB 4WHYG 4JFFD 4LBEB 4WWKC 3GHEH 5FDWB 2NY2D 3W0WB 1R3IH 1T7VA 1WZKA 4P9HH 3DX9A 1KJMB 4W6XB 4JR9H 4E41B 3G5VB 4JHZA 4LVHC 2QHLA 5LBSL 5HHQA 5IFHH 5JHDD 4E5XA 5EORL 2HT4D 1TMCB 3ARRA 3QDME 4DEPC 4KQ3H 1XH3A 1A7NH 3QQ9C 1KN2L 3GK8L 4KWUA 4WDIB 1A22B 4XB8A 2NZ9C 3MRNB 1N8ZA 1EZVY 5GJSL 5E4EC 4OZIF 4Z0XB 1F97A 4HKZB 2DQEL 3OX8A 3MNWB 4CW1B 3TZVC 5I74C 4X6BA 3NABH 3V2AR 1FVDB 4OGXL 3O0RH 5C70A 1ZLVK 2D31B 1R24B 2FJHA 3U9UA 2VDQH 2QSCL 4M03A 2W0FB 1JWMA 3KAAA 4X6CA 5CEYB 1SJVA 3BWUC 1OGAB 3MV11 4MD0B 3QR2A 4JPIA 4C56E 2P8MB 4K7PL 3QDGB 3RZCB 4CU8A 3SJVD 5FOBA 3AY4C 4Y4KD 3GKZA 4M61B 1RIVL 4Y16C 2V7NA 5D2NE 5IBUG 5INDA 3O3AB 1IQWL 1MWAB 2X1PA 4OM1L 1XCTB 3GJFB 3WFCL 1CL7H 1T04A 1UXSB 4AM0A 1U3JA 5I1GH 2CJUH 1CGWA 3D18A 5BW7C 4WO4C 4NRZB 2YD7A 2V17H 3QO0B 4LSQH 2OP4L 1K2DB 2XPGA 3FRUA 1K4CA 4YHOL 2CLRA 3C6LC 5H2BB 4Z7OE 2WWMC 2DQJL 5IJKA 4GSDL 1A7OH 1KLFA 4PJAF 5IB3B 4LQ1A 4L3CB 5E03A 1A7PH 1OSPH 5FV1L 1NCDL 3AXLB 3IDGB 4DTGL 3QEHB 4HUNB 1UWEH 2CXGA 3T3PE 4ZOBA 2R56H 2GQHA 3KJ4B 4PJCB 5SWQB 5EU5A 1JPSH 1UVQA 3WJJC 5F89A 5FYLE 4CMHB 4Y4FD 3TO2A 1QR1B 2XKNB 5DFVD 2H45A 2RBLA 2Z92A 4LEOA 2CR6A 4M93C 4O58L 1A6PA 2JK5B 1ZLVH 1QYGH 1IGIL 2HH0L 4LCWA 4JJ5A 4LSSL 4YLQT 5FO9A 5EO0A 4P4RB 3U46A 2GUOB 4Y2DD 2GK0B 3PWLA 3MJ8A 4U1LA 4GRLB 2NY6B 3A6BH 5D8JL 1WK0A 1MHEB 2A0LD 4OF5A 3BEWB 1HQ4A 3CFEB 3KS0J 4QCIA 1NGXB 5IHZA 3KYAA 5EO1B 4XBEL 5CGYC 4FG6C 5EC1B 3CGTA 1CLOL 4M5YL 5GGRB 4OCWL 3DUUA 1C5CL 5DRWB 2AJZB 2E8YA 2IH1B 5I1DA 5FUCC 5DJCB 3MGOA 1AGCB 4LCYA 2AV7B 1WFNA 5IB4B 4HZLB 4E41E 3TPUA 2WANA 3AREB 1QQDA 4TSBL 2YD9A 3MRPA 1K85A 1C16A 2CIIB 3CSYA 2HN7B 1Z5LA 4IJ3B 3U2SB 2NW3B 1BFSA 4Q0XH 2CUMA 1E6JL 2HT2C 2IADA 4JHWL 2OZ4A 4APQD 1A14L 3SY0B 4U1MA 1I9IH 5K9QI 3P77B 3RVXD 2R1XA 1QBAA 3VFRA 5M94B 4WU5B 1OAZL 4WI2A 4JG0L 3RWCB 3I75B 5L2JB 1PSKH 3KPNB 1JPGA 3KPSB 3GEWB 3QUMH 4YEFA 5GGTH 1QBML 2YPVL 4S2SB 2YSSB 1OGTA 5DSCA 4P9HC 4OZGB 4UZGA 4XPGH 1GIGH 1XIWC 5E5MB 3CZFB 3MUZ1 4U0RC 3ULSA 5FYLH 3WIFB 3KPMA 4P2OC 2PO6A 4W4OC 4KJQD 5BV7B 1YYML 2DQGH 4D3CL 3L1OH 3CH1B 1FLTX 1ORQA 3ARFD 4QRSB 1A4KA 1ZWIB 1BM3L 3C9NA 4JO3L 1OGAE 2NY0D 3E3QC 1MUJB 3Q2CA 4K3DL 1KPRB 4ZFOB 3RIFF 2ITCA 1MAMH 2FX9L 2X44D 4ORZC 5DI8A 5FKPA 4KRLB 4POUB 2VR9A 3MXWL 4ZUVA 2A83A 4KRNA 3WJLA 5GGQH 4OCYL 4YX2L 1U8LB 3OXRA 2HKHH 4LARH 3VE0B 1T1WA 4PG9A 1F4AA 5MERB 4EOWH 5C0CD 4G43B 1HILA 1BIIB 1OL0A 1NMBL 2MFNA 5C0EA 4YFDB 5D7JC 1DVFA 4UTBH 5INCA 5B8CB 3TA3C 2BOCB 4YDLC 3LKOA 5CJXC 5GISH 4FXKA 4DAGL 4PRPD 5HGGS 5E2WH 1QFPA 4L8BA 4KQ4H 1DLFH 3KYOA 3D9AL 1YEEL 4Z7VF 4Y5VB 1BBJB 4FRWA 5EZJA 1IEAB 5D7SH 4YQXL 3BPCA 1RK1A 3GRWL 4MQXC 1K6QH 4MNGA 1OD7A 3P4MB 1QLFB 4PJCE 5E2TH 1BBDL 3U0PA 4OJFL 5CJOL 3QCUH 5MENB 1T1ZB 2ICEB 4HJJH 1K8IA 3MCG1 3LEVH 4U3CA 2AJYH 4RISH 4KK8C 3V5HA 1G6RH 2MCG1 4ZAKA 3VXNA 4JRXD 1YQVH 3F5WB 4ZYKB 5MP6L 5D7IA 2XY2A 3MLUL 4XP1L 3VGAC 1Z9SA 4PGBA 3U7YH 3UTOA 1KN4H 5GRJL 4YGVB 1R3HB 2HVJA 5E70A 2F5BL 1R6VA 3KDMA 5D5ME 3LDBB 5DK0B 1FDLL 4NQCD 2EDJA 5FA4B 3MROA 2O5XL 4U1KB 4Y88A 5L6YH 1NEZA 1Q1JL 3TJEH 4TRPH 4DN3H 3DROA 4UOW1 4ISVA 3MRKB 1JHKL 3QQ4A 4AEHH 4LLQB 1T6WA 5JPNB 1YEHH 1GGCL 3LEYL 1YEDB 1CXLA 3BAEL 1NCAH 3HNVH 5AUMB 5FECA 5JW4N 1KENH 2W9EH 2VQ1B 2J6EH 1HINH 4PLJD 1IAKA 4PJIB 1J1OH 2CLVA 5J89A 5E8NB 5C0BD 3V0WH 4PBWD 3MA7B 2H9GB 5AYQA 5ICXB 1TFHA 1N5AB 1BZ9A 5F3BA 4CJ0A 5KSUA 2OL3H 2ZOKA 5IB1B 4R6UA 2Q8BL 4K7FA 3NIGF 3VXUB 4U7SA 4LP4A 2DWDB 1J12A 2H2SD 3KPSE 1GVIA 3BISA 3SKMB 1PQZB 4XBPB 3PGDB 4NQUA 1JF1B 1VFAA 4OZGE 4V1DB 3ZSTA 1UEMA 3EO1B 1YN7B 1VPOH 4YXLL 4G8EB 5C07B 4OQTL 3OKDB 4RAUB 4EVNA 3SGJA 4NQEB 4I48A 2BSSB 3RVTD 1JNHA 2X1QA 5GZOD 1C12A 4YH6A 4KRPB 2EDDA 1MY5A 1TJIH 1BD2A 3L7FB 1H0DB 1UWXH 4ELMF 4JFEB 3OJ2C 1S9XA 5E00B 4IS6B 4A6YA 2H2PD 3QJHB 1INEH 1OAKL 4P59H 1I7ZB 1J0YA 3MLSH 4KZDL 2NPLX 1EFXD 4HIHB 2G9HA 4WU7A 4JY5L 4YBQC 3D85B 2Y07H 1CWVA 4M6AA 3R8QA 1EJOH 3QNZB 4K2UL 2XWBB 3TH3T 3D2UD 3MRHB 5FGSA 4XI5D 2A1WL 1HWHB 5DDHB 3T0WA 1CGSL 3RL1A 3SE9L 3GSOA 4XWOD 1MCNA 4JFZH 1S3KH 4MA8L 4R4FL 3GIZH 4L5FH 1DCLA 4NO2A 1U8PB 2BHZA 2YC1B 4R96A 2PXYD 2OJEA 1T0MB 3HPLB 4NNPH 4C58B 4FMKA 1QSEA 1YZZA 3CFKB 3HNTH 4WI9A 5EU6B 1U92B 1JFQH 5SX4H 1HYSD 1DL7H 2QTEA 4PJHF 1LEKB 1MFBL 2YKLH 2M2DA 1YPZB 5IHUH 4WW2C 3VWKD 2F54B 2A9NL 1VFUA 1YDPB 5GGSB 5MENE 3S5LA 4QTIL 3DRTA 1OQXA 2COQA 2AQ1A 4JKWA 4ODTL 3V5KA 3VGGA 4OZIA 3F12A 5IB2A 5ITBH 1OD9A 3TNNB 1GSMA 3I6GB 1XGRB 1PG7W 1G7QA 4RFOL 1RJZB 5MEQB 4JKMA 5F9JB 4QRRA 5ESVB 1UQSB 1FN4A 4NZRL 3K7UA 2CRIA 3OKYA 4M1GH 4JDTH 4P5TD 2MKWA 3PQYE 5T1KA 5CIPA 2IFFL 3AM8C 5BV7H 5DK2B 4N5EC 3SKOB 5I9QC 1JK8A 5HSFA 2FGWH 2NY1D 3NIFE 1DEEA 4K8RL 4DW2H 3KXFA 4KRMB 4HX1A 35C8L 4PJEF 2CH8A 5CJ5A 3GSUA 5KOVC 3NCCB 3D69A 3SDCD 4PJIE 1P7QA 4XBGB 2LE9A 1GZPA 2QQKH 5F7YC 4LCUA 1HE7A 1XGPA 3FL7A 4S0SD 2CK0L 1TNNA 5I0ZA 4O51B 2BVQB 4J4PC 2GK2A 3RKDD 1FNAA 1X5IA 3W9EA 3GO1L 2ORBL 3TH2T 3HB3C 4Y1AB 4LK4A 3T1FB 4PRHD 1OM3L 1WIUA 4PJAA 1ONQB 4KUCF 5HBBA 4PB9H 1HNFA 43C9B 2ADIA 3GMOA 3P11L 3C5SB 4BSVB 1EXUA 3PHOB 3RZCC 3HE6A 1KCSL 5AZ2L 3NZ8B 5F1IA 3L7EB 1B4RA 2MWCA 1XEDA 3BEVA 5DD0H 1ZK9A 4S1SH 4KGJA 1CZ8L 2E8ZA 2XQYK 5I75B 4OD2B 1IC7L 2BNRB 2P8LA 3TCXA 3MV9B 4LSDA 5BXFA 3K2UL 2HTLC 4WUUA 1FNLA 3VWJD 1U0QA 2QADD 4JCMA 4ZS6D 4IRZH 5F96L 1NCUA 4QOKA 2W9DL 1LO3L 5CGTA 3FMGL 1JNLH 3VFMB 4HWBH 3UMTA 3VFWA 2EDFA 1AO7B 5D7KD 1YY8A 4I4WB 1BMGA 1NANI 4PRAB 1A8JH 1J11A 3L6FB 1I75A 1AD0B 1TJGL 3JV6B 2Y5EA 2ZP0T 3TN0C 3X13A 1RULH 1FIEA 1NUFA 3JWNC 4HK3N 5GJSH 4M43L 4YBHA 2JIXA 3SO5A 5DJ2B 3DARA 1N3NA 2W91A 4JFYB 3DX8A 2MHAB 1MCBA 2Z35B 1UB5A 3RNKB 4NOBA 5K9JL 5DD6B 2PYED 2QSCH 4FQQB 1ODAA 3B9VA 4LDOB 3TVMD 3SDXB 4AIXA 4OM0H 1Q0XL 1DJSA 2A77L 4UIKH 1YPZE 1A6WL 1BIHA 2VUYA 3IFLL 5DC4B 2VLJE 1ACYL 4X4XA 4JM4H 3RWGB 4JZOA 5SWSD 2Y72A 3OKNB 1IQWH 2Q3AA 1HYRC 3IXAB 5HGDB 5I18L 3WFCH 3BP7B 1AD9B 1NJ9B 3ARYA 5F9WB 4DFIA 4Z7WB 5AD0B 1SJHB 2OCFD 1RU9L 1U8OB 5GZNC 1I7RB 2EIDA 3BPNB 4JM2C 5EZOL 4IDJL 4BFBD 3G9AB 1YEGL 4DZ8A 2DQJH 3KWWB 4MB3A 4F7EB 4YR6A 1CGTA 2BOBA 1NCDH 3LKSB 3MLZL 4P23A 1RHFA 4DTGH 2W38A 3CFDA 4WTWA 4JVWA 3IU3A 4HS3B 5I30L 3H9SB 2ILLA 2FZ3A 5MEOA 4DWHA 4UUJA 1CLCA 4KUZL 5C2UB 4G6FB 5EO9B 4O58H 3V8OA 3MRCB 1IGIH 5CSZA 2P45B 4LSSH 4KVCH 3I6LE 4AEFA 5BV7C 2YD4A 3RWJB 5DHXB 1G7IB 4HUXB 2QQLL 3B9KB 4HGKC 1S7XA 4Y1AE 3RNQA 4Z7VA 4OAWB 5D8JH 1ACZA 4B5EA 1QFWI 5IF0B 1CDUA 1CDGA 3LKNB 4RQQA 3UBXI 4JQIL 4LVNC 4J12A 4R0LB 1VGKB 2C3XA 2V5MA 1IAOB 5HGBB 1K4DA 2D4FA 1OQOA 4NBXB 5F7UA 4M5YH 2OQJA 3K4AA 4OCWH 5D4QA 1C5CH 5ACLA 1O0VA 2EE3A 5BQ7A 3QUZA 1F6AA 5D1ZC 5DJ6A 3IKCA 2BNRE 2CDEA 2ZWLT 4MJ6B 3GSQB 5E6IA 2WV3A 1PX3A 4TSBH 1GHFH 1LO5A 1A5FL 3EYUL 4LPWA 4EXKA 3HG1D 3GNMH 4XPFL 1E6JH 5KSVA 3QEQD 4U6HA 5DMGD 3OJDB 1VERA 4LMQI 3BDBA 43CAA 4KTEL 2AJUL 4EI6A 4KI5C 2H6PB 2E9WA 4JQVA 4ZXBA 1U8HB 3CK0H 3WNNA 1ZT7A 4NKDB 2VN7A 2X40A 3MRBB 5EUOF 1OAZH 2H26A 5B38B 1YUHB 4R7DA 4U1SB 1QBMH 4X4YA 1G9ML 3ZE1E 1HNGA 4HDIA 4MA3A 3TBVB 3GUTA 5TDPB 3QUXD 3U4EB 4P2QD 1CG9A 4FQ2H 2AK4D 2VDKL 4FQXA 5K9QG 5EC2A 2VR5A 1G7LB 2B8OT 2DQDL 4RAVB 1WWBX 3CDGA 1YYMH 3L5XH 4D3CH 1E4XL 2CLZA 4LLMB 4ZQKA 3BRGC 3SDXE 1F4YL 3B2VL 5H94A 2UZYB 2X4QB 3HS0B 4JO3H 1KTDA 3EYVA 1IE5A 1ZT4A 1H3XA 2YPLD 4K3DH 2DKSA 5CZKA 2DM3A 1NC2B 4PLOB 2NXZB 4PFEA 4ZTPH 3THML 4XCCL 4OCYH 4YX2H 3CJJA 4IRSD 5C0AD 5DHYA 3MLTB 4U1JB 4AH2B 4GO6B 5E9DD 5C08A 3QI9B 4PTTB 3O4OB 1CGYA 4HD9A 4S1QL 5D7LB 4Z7WE 1PKQB 2NXYC 3LKPA 4I77L 5ALCL 1MAJA 1P1ZB 4DAGH 3EYSL 2O26U 4KDVA 1FGNL 1QFWL 3D9AH 5M95B 5FGBC 4Y4HC 3JV4B 2YWYA 4YQXH 1LK2A 3X14A 5EUKA 2E27L 4MSWB 1N59B 1YMMA 3UTSB 2DDQL 3S4SB 4U6XB 1HSAB 4OFYA 1KBGL 4GG6E 3UC0L 5IW6B 2OXHA 3ISWA 4OJFH 5CJOH 1N0LA 1WZ1L 2WBJA 1OAXH 1QBBA 1KPUA 1VDGA 3BQUC 1KPVB 5GSRB 3OR7A 3K74B 2XFXB 3BOVA 2BVOB 4BFIB 3DRQB 3MA9H 5MP6H 3MLUH 2RHEA 4WFHE 5DJAA 1U8KA 1XF4A 3SHSA 4PJ9D 3ULUL 3OGCB 3O9WD 2GSGB 3DGGA 4R2GB 1ZLUK 3RVVD 3VRJB 4HEPG 4PRIB 2F5BH 3CH8A 4ETQA 1NMCC 2I60H 4N1HB 2BMKA 4PJHA 1J7VR 3AGVA 5E2VH 5DMIH 4OCRL 1Q1JH 1U91B 1VFBA 4FFZL 2UWEF 3O6FB 4RGOL 2IAMA 3BGAA 4EI5A 1JHKH 1S78D 4I2XA 4U6YB 3X11B 4I3RH 2CO6B 3BO8A 3MPCA 1FYTA 1GGCH 4P5MB 3ZKNC 2AKRB 1HKFA 4J3SA 4O2CB 5HJ3A 4R90L 3GMLB 4LNRB 4B7IA 2BSTA 4B50A 1U3HC 3LSOA 2DJUA 2HFEA 4R8WL 4U33A 3L3GB 2P5WD 4KHXL 5FDYA 4HXBL 3U30B 4YPGA 3INUL 1PEWA 2GJZA 4NRYA 4PJBE 1S9KC 3MNVA 3Q5YA 3FCTA 2AJSH 2GJ6A 5MHSD 1BVLB 5I8OL 1DBAL 5DVOA 5B38G 4HUVA 4RCAA 3CMOL 2Q8BH 2XKSA 2Q86B 4NQDE 2FR4B 1FSKB 2P5ED 1UM5L 2XWTB 1DQJA 5A2LH 4PJEA 1R5VB 2NY3B 5ESAB 1KCVH 4YXLH 2D0GA 3GSRB 4OQTH 2GY7B 4JFDD 5HPMB 4G80A 1YC7A 3QDHA 4CKVX 5TE6H 1DBKL 3STLB 3EFDL 3H42L 1LEIB 1CS6A 3MGTA 4EN3A 1QA9A 3IRZA 1AKJD 4NBYB 5ABDE 3ILQD 3QZWB 1JGVL 1XR9A 4HKJB 5EU7C 2ZOLB 2OTWB 1BZ7B 3TJHD 1QRNB 3KYNB 1WSST 3ZE0E 1OAKH 5IP4A 4KZDH 1D9KA 3F65A 2R1WA 3ZDZE 4JY5H 1G84A 4HCRL 3S34H 3I6KB 1R3LB 4K2UH 5F7FA 3RUGF 4PBXA 3LB6D 1K3IA 2A1WH 5JQHC 5C09B 3L3DB 1CGSH 3SE9H 2WBKA 1A9EB 5F1KC 1GPOL 3F7QA 4MA8H 4R4FH 1FL6A 2W65B 5I66A 1LO2L 3BN9D 2VZOA 3QDAA 1S7TB 4LHUA 2NMSA 3GSVB 3O3DB 3SCMC 3RTQB 3HC0A 3VXMB 1MFBH 1X6NA 3IDMA 4QF1A 1MRCH 4FQHB 4Q6IB 2DN7A 2MPAH 2R0KL 2VLKA 3MOQA 1ZEAL 5CHNA 3SDAD 3LS4L 3WIHL 1IGML 1CLZH 2EH7L 3N1PC 2VLRB 3QEGL 2IALB 1IILE 4HLZG 1DLHB 4GLRH 5E4IA 3DI3B 4NWTL 3P73B 5EFIA 4O9HL 3NCJH 1MCDA 3MC0A 1IRAY 2L7UA 1SYSB 4OF0A 5D1QC 1UM4L 3NIDF 3RIFK 3DX7A 4NZRH 5B4MC 5IR1B 3ARBC 4S1DD 4JFFA 5K9KA 3OQ3B 3DMMD 1WFUA 2IFFH 1QACA 4KDTC 4P3WA 4HKXB 1S8DA 3WE6B 4P48A 1NBZB 3QXTA 1FNEA 2IPTL 4DKAA 4N9GA 1II4E 3PGCB 3BSZL 4G8FB 3G04B 5JA9A 4JLRB 3MRFB 3N9GL 2IANE 3EHBC 5EOTA 3C5ZA 5K9OA 35C8H 1JGDB 1CVSC 2ERJC 1U3YA 4PJXF 1CE1L 3KPRB 5HHME 3QXDA 3C2AL 1VEMA 3B4NA 3VXPA 3Q6GL 2G75A 3RPKA 2CK0H 3PJSA 3U0TA 4UT6L 3OZ9L 4FQIL 4GBXA 1IM3A 1J05B 3LN4B 2AXGA 2ORBH 1A2YB 4DKFL 1OM3H 5C9KA 3T2NL 4MDJA 1B90A 1T1XA 3EIFA 3MJ7B 1HHGB 3QB7C 4BM7A 4K71B 4OZHB 2YZ8A 4J8RB 4BQ6A 5AZ2H 2KH2B 3QFJD 1H5BC 1FYHB 3MNZB 4M8QB 5C0DA 4LSRH 3UYOD 1CZ8H 4OD3L 2V9TA 3S36L 1UYWL 1AC0A 3DV4A 1S5IH 1D6EA 1ITBB 4Z0BH 1MFNA 3WN5B 5GHWL 1ZTXL 3EDJA 2X9XA 3QZWG 1T83C 4NHUA 4PJ7F 2NYYC 4JREB 2F9BT 2W9DH 1LO3H 1NC4B 3FMGH 5FYKU 5MEPA 1QRNE 2APTA 5EULV 4OZFA 4RMTA 5AZEL 1EMTL 2ICES 3MRDB 3OXSA 1NBQA 3MYJA 2EDEA 3BPLB 3JTTA 2AI0L 5DJ8B 1TJGH 2NR6D 1T7ZA 3U36B 1F3DH 3Q6FA 4ZO8A 3BN3B 3LRSB 4M43H 2NX5B 3AC0A 5TQ0L 1I85A 3IFPB 1XF3B 2Z8SA 3ARZA 2Q76B 5C09E 3KPQA 1JWUA 2R2HB 4GS7C 1A6UL 2BNQB 5KSBB 5BS0A 1H3GA 3ZHDA 5ICYB 2DYPD 1TENA 4M62L 3CUPA 4Y5XA 5L8KB 3BZEB 5ID1A 3QIUB 4IOFD 2J8UB 1KJVB 2H41A 3OR6A 4HK0A 1AY1H 2YXMA 3GI8L 1AGBA 5KVFL 3OG6B 4NKMA 4XPAL 3VXME 1Q0XH 2A77H 1KELH 2AP2A 2F53D 2L4OA 3EO0A 3IFLH 4L8SC 2DBLL 4NPYB 4NQXA 1ACYH 5EUOA 2AGJL 3ECBB 4KK5D 3ROLA 4UV4H 4MJ5A 1JYNA 4OFKA 4AY0A 4TQEL 2I9LA 4KV5E 3KHQA 3CSPA 1KFAH 1LP9B 4G9FB 2Q20A 5EZLA 3D3VD 4LP5A 3L95B 5I18H 3WUWA 3BZFA 3QULA 5KTEL 5I15H 4Z7UE 1ZHKB 1RU9H 3S88L 4P46D 4KTYA 4EQ2A 5EZOH 4GW4B 3L3HA 1W8OA 4OGYL 5KZCD 2XZQL 4YBLC 3WHXA 3SPVA 1R3JA 2R23B 2DLEA 4ZOEA 4O2EB 4WFGE 1KEML 1MVFA 2BDNL 1I8IB 4MDIA 3F7YA 3P4OB 3EFFB 1FNSL 5D93C 4NN7B 1YEFL 4CN4A 5E8EB 5I30H 4YXHL 5HHXH 4JFHD 1UACL 3MOAH 4PJ5A 5EBLB 3O6LH 4HV8A 3RFZC 4MHHI 3KPRE 2R0WL 1I8LC 2FEEI 4MAUL 3BMWA 4X8JB 5CBEB 4UB0L 3V7AG 4Y5YB 4PB0L 5KANG 1FHGA 2X4TA 5KVDL 5HDOA 2VDML 3WFBL 2QQLH 4L4TD 1B0WA 4JPKL 2H8PA 3DXAB 3H9HB 5F7DB 3UDWA 3BZ4B 4JQIH 5CAYB 1NANH 1YC8A 2M1KA 3SKNA 4X5WA 1JV5B 3MV8D 4LLUA 2HRLA 3OV6A 4NFCA 4RGND 2N7BA 3H3PH 1MIML 3P40A 5GJTL 4R7NA 3PL6D 3MRLB 4XH2B 3F7VA 3C60C 3O45B 1W72H 4ONHB 4GRWF 1E27B 5B39G 3BPOB 3VXSE 2A6JB 1FZJA 4LSVH 4KKNA 2R2CA 4ZSOA 2OI9B 4MD4B 1GCFA 4ZO6A 3KPOA 1F4XL 4POZC 4I9WD 5IESL 4Q2ZA 3ZYZA 4PRPA 4KTEH 4N8PA 1MFAL 2AJUH 5C2BH 2XN9A 4I13B 5LGHL 2EKJA 4QXTB 1DQMH 25C8L 1GC1L 2UWEA 3FRPA 4HKBB 1J9CT 5SWZB 2NX5E 2XWJB 1KIQB 1W8NA 1G9MH 5T3ZD 1MNUL 5JOFB 1MELA 1TLKA 1I9RL 1R5WA 4FP8L 3ULUE 2VDKH 5K93A 4LMQE 1OVZA 4NNXB 4NO3B 3VFVB 3MTRA 4RAHA 4L8DB 4HC1A 4Z7QF 5H35B 3FQRA 1MFCH 4J1UA 3F8UB 1Z9LA 3UXFA 3B2VH 3QIBB 4NT6A 3RGVD 5B21A 1I8KA 3DSFL 4XP5L 3MZTA 1HIMH 1FL3B 3GMRB 3THMH 4CU6A 4PGEA 4XCCH 4NSKA 3VG0L 1J10A 3KVQA 4WHTA 2ZCLL 1I1AC 3SBWA 4HJGA 5FYJH 4XWGH 5HHQB 4XPTL 3CLFH 4XGZA 5EWIL 4E5XB 4WJ5A 2FEEL 1LP9E 3MRQA 4PV9A 1RUQL 1DTUA 2R2BA 3ZT7A 1CQKA 4DOHE 3QUZC 5ALCH 1P5VA 4LCCB 1A3RL 4XNXL 4DVBA 1FGNH 3LAFA 1MHCA 3A6CH 1N8ZB 2ARJB 4Q9QL 2X4OB 5C0BA 2E27H 5IGXL 2DLFL 3OX8B 2DDQH 5IWLC 3RY4A 5JZ7C 4L9DA 4X6BB 3WKNA 3UC0H 1OAQL 4NWUL 4JQVC 2DTSA 1WZ1H 3U9UB 4E42A 3RUGA 1JWMB 3A6OA 5E08L 4X6CB 1KCRH 2Y06L 3NN8A 4LRNL 4LKCB 2EDNA 3UX9B 2XTJD 5J13C 2XACC 1OARH 3L3JB 4FQXC 4P9ML 5JORB 5FOBB 4MQTB 2VLLB 3QG7L 1KC5L 3CXDH 2V7NB 4JFXA 5INDB 3EJYD 3NPZB 2P1YA 1T7XA 2CQVA 1YY9D 4Z7NF 1T04B 4OCRH 3ZDXF 4FFZH 1S9YA 3D18B 3O6ML 1D5ZA 5DO2D 3GI9H 1QRKA 3SKUD 2YBRB 3FOMA 4PGCA 2YN5A 2XPGB 3FRUB 1K4CB 2CLRB 2H32B 1LD9A 1KT2A 3FB5A 3QAZB 4HIEA 3SDDD 5IB5A 4R90H 3WL9A 1NCBL 3C09B 4UDTA 2KZ1B 4JG1L 2KKQA 5JIPA 2Y7QA 4R8WH 1JN6A 2EDKA 4KHXH 4WHDA 2CK2A 4HXBH 2G60H 1I1YB 3INUH 1ULVA 1UJ3C 5EU5B 3T0EC 4A6YL 1UVQB 2VIRA 1MFEL 5BO1L 1M05A 3TO2B 1OF2A 4MXVE 5I8OH 5I76A 1MCWM 2ZCKH 4LCWB 4JJ5B 3CMOH 2PXYA 1BX2B 5L0QB 2ZPKL 2YUVA 3D0VA 5DD5H 5F7HA 5FO9B 5EO0B 3NGBC 5F6IC 3Q48A 3SO3B 3V8CA 3PWLB 3W5NA 3NH7L 5DHVA 1WT5A 3MJ8B 3NMEA 2BRQA 3CDFA 3GJEB 4PJXA 1HQ4B 1UC6A 2BFVL 2WWKT 5DRNA 5LQBH 5DA4A 2K7PA 1MFDL 1XIWD 3GSXA 1U93A 1FLRH 2C3GA 4JVPA 1UM6H 5DZNA 3EFDH 2XYCA 2V5TA 4WUKH 3PHSA 2BY0A 3IDNA 1BLNA 3CVIH 4U1GC 3VFGL 5I1DB 4JO2L 4D0DA 3L3OA 4GW1A 1CFVL 1G9MC 5FO8A 5CMAA 3TPUB 1QQDB 3ZO0A 1UKTA 3BJLA 4IIQB 3MRPB 4WFFE 1C16B 4Y19B 3CSYB 1Z5LB 3ULVF 3PG2A 5DRXA 3DJ9A 5D7JD 3WO3B 2IADB 1EK3A 4GKNA 4XCYA 1CGVA 3TA3D 4ORGA 3VMOA 1GPOH 4ACPA 2EICA 3VFRB 1N0XH 1NFDE 5C0RL 3IJHA 4HWEL 4PJ7A 4R97B 1JPGB 4QHKI 3BZDA 3RHWF 1IEBA 1OGTB 5DSCB 1KTLA 3O11A 4P99A 3HMXA 2VISA 1PGRB 3HZYA 2W0KA 4N9OB 2R0KH 3ULSB 4ZFFA 3WD5L 1CGXA 3KPMB 4EUPA 2PO6B 2FX8L 1I3VA 3ABZA 3WIHH 1T66C 4MB5A 2EH7H 4XCNA 4X6CE 4FN0A 1A4KB 4NZUL 2APFA 4MGXA 4JEGB 3C9NB 1W0VA 4RMVA 2XQBL 4O9HH 2ITCB 5HDBF 5FKPB 5DI8B 4Q9RL 3QJFA 1UM4H 3B9DA 1J5OL 3NFNA 3ARTA 3QIWA 1EO8L 1T1WB 4PG9B 4PRBA 3PWPA 3P9MA 3VWJA 2HG5A 4JHAH 5C0EB 1SY6L 2C3VA 1DVFB 2IPTH 2K7QA 4HGWB 2RAMA 3B2UC 3BSZH 3LKOB 2FD6L 4PYGA 4YHYC 1XZ0A 1BQUA 1CICA 4P3DA 1NQBA 3FFCD 4L8BB 4YDJA 3KYOB 4XC3L 1RZGA 1CE1H 2D7PA 5FM5M 1CDHA 3C2AH 5HHOE 1JUFB 3BPCB 1RK1B 3IFOA 5IVZA 5FEBA 4JKKA 3X12A 4OBSA 4PY8I 4MNGB 5HGAA 5C0CE 4UT6H 3OZ9H 5IEHA 4FFYH 4FQIH 4R4NC 5GS3A 2DQCH 4IRJA 3U0PB 1ZT1A 3BP5A 1K8IB 4KI1A 1BVZA 4NM4L 3HAEH 3G6JF 2HAZA 1SYVA 4LCWE 2PYEA 1HH9A 3MLYL 3SN6N 2ZUUA 3V5HB 3E2HB 1CFQA 1J87A 3NAAL 3G6AA 4ZAKB 5C6TH 1DFBH 2XRAL 3VXNB 1TJHH 2DQHL 1X5KA 5J56B 1OAYL 1RHHA 4C56D 3RL2A 1IVLA 4PGBB 1F3JA 1MIEL 5DD1H 4NOFA 4JPVL 5DR5H 3QXAA 4OD3H 3S36H 1UYWH 2JLLA 5A2IH 2HVJB 3WLWD 2YUZA 1EAPB 3DVFA 3KDMB 4UMGA 3T08A 5D1XD 4YHPA 1MPAH 4D9RE 3KPPB 2Y6SC 3LS5H 1ZTXH 3CPLA 3MROB 1NEZB 1D6VL 3AB0B 4XP6H 3DROB 3C87A 2A6DB 4PYHA 3QQ4B 5IROA 4HS8L 4IHOA 4F80A 5AG9A 1V05A 4JRXE 3QDJA 4P4KD 4F9LA 5AZEH 3JWOH 2NY2C 4D8PA 5FECB 2V2TA 4UTAH 4LPVA 4RBPK 1X5FA 4Y19E 1X44A 1VEPA 2HT4C 1WGOA 4L4VB 5TQ0H 3S9DB 4TULH 1AE6H 5FYLD 2J5LB 1A6UH 5C92A 1JPFA 1BZ9B 5F3BB 4M1DL 2RCSL 4L8CA 5KSUB 1WEJL 2ZOKB 2H32H 5L8JB 4M62H 1J88A 4K7FB 4ZUTA 3QUYA 1KYOK 1ED3A 3EO9L 3GI8H 4F3FA 2VZSA 2DLHA 4XPAH 1XGUB 1EPFA 1B9ZA 3IB4A 4Y8DC 4H1LG 4KXZI 4OCXH 4EVNB 4WI8A 4I48B 2DBLH 1S7QA 3E8UL 1TZIA 1LO0H 3C5JA 3VD7A 5FM8A 4QT5A 1C12B 1CXEA 3TO4D 4TQEH 4KJPD 1BD2B 4B53A 3RJDA 3EOTL 4BUHA 1UA6L 3RRQA 5IT2L 1S9XB 1MLBA 4A6YB 5EOQH 2XOTA 1QKZH 3JUYA 2XZAH 4J6RL 3S88H 3W0WD 3CDYA 4X5LA 4Y4KC 4R4BA 3NFSH 4I3GA 4E41D 4F7MB 4WU7B 2XZQH 4LF3A 1LO4H 1ZLSH 4LFHG 2Q6WA 3JVGC 1TITA 3WS3B 2YD8A 1KEMH 2BDNH 5CZVH 5DVNA 1TDQA 1X5HA 1FNSH 3RL1B 3GSOB 4OLYH 3EYQD 2ENYA 1YEFH 1UACH 3FB8A 3KYMA 4NO2B 1X5JA 3ZKXC 2FB4L 4R96B 2ZG1A 4JB9L 2OJEB 5ISZB 1KLGA 1QSEB 4UB0H 3HUJF 4F37F 1IGTA 2Z8VC 3PDGA 2CKBH 3DTXA 4WCYH 5KVDH 2VDMH 5CZXD 3QUXA 3WFBH 4M5ZL 4JPKH 4QXUL 4Y4FC 2ADFL 2CO7B 3S5LB 4J4PD 4MHHG 3DRTB 2ZCHL 3UCRA 4OZIB 3V5KB 3ZE2F 5IB2B 1OGAD 4P2RA 4Y2DC 1W0WA 3VI4E 1S9WA 2YPLA 2NQCA 3RZCD 3QDGD 2Y5TA 1MIMH 4QRRB 5KS9F 3JXAA 1P9MA 1FN4B 1JE6A 1TPXC 4W81A 4FFWD 2WSKA 1A1NA 3CVHA 5I16A 3BD4A 5T1KB 4U1IA 5CIPB 4H1LH 2VDPL 4X99A 1NEZG 1X5ZA 2J8OA 5E9DA 1JK8B 2CMRL 4LCCC 5IJVB 1WC7A 3HE7A 2HTLD 4BZ2L 1Q72H 1DEEB 4I0PA 2MQCA 4HX1B 4FTVA 4DVRL 2Z31A 1MFAH 1DUYA 3QUKA 5F9OL 5JXEA 5I73B 1SJXA 1DSFL 1F2QA 3D69B 1EHXA 2FO1A 1ETZB 3R0NA 25C8H 3SE4A 1P7QB 1DEDA 1GC1H 4OB5L 1E4KA 1GZPB 1P4LA 3W11D 4L4VE 5IVOA 4LCUB 1XGPB 1QPPA 2PKDA 1QUNA 4XVTL 2V5SA 3W9EB 4KKCC 4APQC 1MNUH 1FPTL 1YEJL 1KB5L 4XXCA 5FYKD 1I9RH 3SE3C 3I50L 4FP8H 4FZEL 3RVXC 2ADIB 1U41A 3ZKMD 1A7BA 4ZS7L 3HE6B 3B3IA 3TIDA 3HZVB 4U0QB 3JWOC 5IMKA 4GRLD 5F1IB 2NY6D 3O3UN 4X7CC 3ZL4L 3BEVB 1AJ7H 3L5WB 1T7YA 3DSFH 2C3WA 5SV4A 4FQ1L 4PJGE 5DFWH 3UDWC 5CBAA 4PJ9A 2P8LB 3ZDYE 3O9WA 4KJQC 3P0VL 5TDNA 1S7RB 2Y36L 1CU4L 1AQKH 2ZCLH 3ARFC 4PRHE 1BD2E 3F58L 5DF0A 5EWIH 1B6UA 1BQLH 2NY0C 2DMCA 5JW4M 5HI4D 1RUQH 4I18C 1CBVH 4QOKB 4H0HB 3I3BA 3VFWB 4AL8H 1YY8B 3G5ZA 4KKLD 4XNXH 5DHVH 5FA3B 4Q9QH 1GXEA 3ZZ1A 5I17A 4FXGA 4MCZB 2JIXB 1NGQL 3STBA 5IGXH 4XXDA 2P5WA 1N3NB 4BJLA 4ZPVA 3DOSA 1LE5A 1BPVA 4HS6A 3SO3C 3TBWA 1EEUA 1T22A 4HMDA 1TVBA 3QPXL 5GQBA 1MCKA 3VRIB 2A9ML 4ZFGL 3KPSD 5E56A 5ISZE 2PTUA 4NGHH 1QSEE 1OPGL 5D2LF 5TDOB 5I71B 5EOCH 2M8XA 2Y06H 3BYYA 3UYRL 5D72H 1QO3A 4K3EL 5H37G 3HCVB 3T09A 3S5LG 4U6VL 4LSUL 2I9TA 2JJTC 5BOZG 2Z8WC 4JZOB 4UT7L 2YEZA 4TUKL 3QG7H 5F88B 4ZNEA 4OZIE 4OKDA 2Z93A 4I3SL 4ALAL 1T2QL 2OR7A 3EGSA 5F1SA 1S7WA 2CDGA 1NUNB 3TPKA 1KYOJ 4R26L 4TUOA 1KJ2H 3VDAA 1MEXH 4PP2A 1A3QA 2C1PA 3MCKA 2KL6A 4QRRE 3V6FA 2CDFA 1MCPH 5HI3D 2R29H 4CN1A 3MGAA 3KLDA 2DQUH 3D39A 4DZ8B 5JHLL 3RWHA 4MXWL 1ADQA 4P5KA 5GGUB 3X3GH 5E6YA 5CUSL 1DQDH 5IK3A 4P23B 1ORSA 2XY1A 2YR3A 3CFDB 2EEBA 3IU3B 4ZFZB 1A6AA 1QVOB 2FZ3B 1MFEH 4UUJB 5DVLA 2J4WL 3MV7A 2X4NA 3VFNA 4PLJC 4ETYA 1EEQA 5CSZB 2VJXA 2EXWD 5HHNA 4AG4L 4U3HA 3NH7H 1R3KB 2XG4A 1S7XB 4Z7VB 2HA1A 5MEND 3DVIA 4IBLT 5ANMA 1DN0B 2BFVH 4RQQB 3TWCH 4WV1A 3U7AA 4PRDA 4U6TA 2H2SC 3HN3A 1K4DB 1CXFA 1N2RA 4C59B 1NBVL 2OQJB 2ZNWA 1GC1C 5BQ7B 1IGFH 1F6AB 5DJ6B 3G6JA 3IKCB 4JO2H 3VFUA 5DMJB 5FUZL 4KHTH 2CDEB 5IMMA 3PGFH 3RVTC 1CFVH 3TIEA 5GZOC 5ICZA 5E6IB 1LO5B 4GUPA 4LLYB 2AEQL 1IBGH 3R06A 5T1LA 4QOKE 4XMLH 1F4WL 3OKKA 5KSVB 5TQ2H 4KMLB 4U6HB 4FABH 3OB0K 2UY6A 43CAB 1TQBC 1MLCA 1CFSA 2DF3A 4EI6B 4ZXBB 1ZT7B 3GKWL 4OUUA 4PLKD 5C0RH 2H26B 4X7DC 3FZUD 2VDOH 3BKCH 4R7DB 1HXYA 4KMQA 2JCCF 4X4YB 4XI5C 4HDIB 2QSQA 3MQIA 4MA3B 3H0TA 5FGCB 5HVGB 3GUTB 4XWOC 1Q94A 1CG9B 4NJAL 5EC2B 3HG1E 1GOHA 3WD5H 3VXUD 3CDGB 1QFHA 2PXYC 3QEQE 2CLZB 4ZQKB 5DUML 2HT3D 3ZSSA 3GM0A 4V1DD 3RDTA 5H94B 1HYSC 5BZWA 1KTDB 3EYVB 1ZA6B 3QFJA 1ZT4B 2VDNL 5C07D 2CR3A 3VWKC 2JJUA 1A7QH 2EIZA 3QHZH 1N7ML 2OTUA 2ED8A 1JYVA 4K9EL 5DHYB 2UUDH 4P0DA 1ZANL 5EOCJ 4JFED 1SY6H 1YN6A 2W0PA 1SQ2N 3MR9A 1U8JA 5IVXE 3JBG7 4EDXA 3DUHA 4P5TC 4U1NB 4WRLA 2WINB 3D85D 4JY6B 3MREA 3IXTA 4ELMB 4GW5A 4QY8B 2VDLH 3CLEH 4X0KB 3ZKND 4I0KA 1LK2B 3X14B 5EUKB 4NN6C 2IQ9L 3IVKA 2NY1C 1YMMB 5DJZA 3RIAF 3UTTA 4HSQA 5C0AE 2MMXA 2EC9T 3LQZA 3S37L 3GSNA 4BELD 5L2KA 2WBJB 4P57A 1JTPA 1KPUB 2LTQC 3NZHL 3SDCC 1FFNA 1AXTH 1A3LL 3OR7B 1F3RB 3O8XA 1NCWH 1O7VA 1FFPA 2XRAH 2O5ZL 2DQHH 1A6TA 4PGJA 5GS1A 4MA7L 1BAFH 2VLJD 4Z7VE 5DJAB 5B3JE 1U8KB 2X4SB 1XF4B 4JPVH 5C0FA 4YNYB 3IJYB 3VXTA 3HUJA 1KUMA 1N5YL 2JB5L 3QPQD 4ETQB 4Z5RA 4PJHB 2BMKB 1MCFA 5T1MB 4GKOA 1FORL 3QT2A 1E28B 5DTFA 3D3VA 1D6VH 4M9OA 4PTUA 1VFBB 2E7LC 4YHNA 2IAMB 1OAUL 1VGEH 1M71A 4HS8H 1WBZA 1BOGA 2VXSH 3BO8B 4MJIB 4DGVL 4M3KB 3ARGC 5FGRA 5T3ZL 2QADC 4ZS6C 1X5XA 4JGMA 3HZKB 1CD1A 4BH8A 2BSTB 4QHNA 2ZZUT 4PD4K 3LSOB 5KS9A 3NPSC 2HFEB 4YPGB 1FE8H 2GJZB 4ZUWA 2ICWA 4NRYB 1MH5A 3IAPA 1IC4H 3MNVB 2Q3ZA 2X4PA 3FCTB 4M1DH 2RCSH 1VEOA 4N90E 1NCCL 1WEJH 3TESA 2CIKB 2FWOB 1I3RA 1QOKA 1MCHA 1KACB 5BMFH 2SEBA 4Y1AD 3EO9H 1LDSA 1OTUD 3SGKC 1DQQA 1DQJB 4PJEB 1RZ7L 1XGYH 5KSAA 2R1YA 1HHKA 3H9ZA 5J3HD 1GZQA 6FABL 4WEUD 4M6NL 4LVEA 4WNQA 4AEIL 3TVMC 1QLRA 3QQNA 4EN3B 1M7IA 1QA9B 3EOTH 3MJ6A 1MI5A 1XR9B 4GKZA 4HJ0D 5DT1H 2BNRD 3T3PF 1DBML 3MV9D 1IC5L 4U7MA 4R9HA 3OHXA 1LMKA 1D9KB 2OK0L 2R1WB 4KK9D 5IM7B 1CTOA 5LGKA 4ENEC 3ARBD 3VI3E 1HSBA 1AO7D 8FABA 5DVMA 2IPKA 3K80A 1FL6B 5I1IL 2UYLA 5I66B 1EJ6A 1WVZA 4OFPA 4UNTA 3I9GH 3V6OE 4ELME 4LU5L 4JB9H 4HBCL 4ONGH 4LHUB 4QHMA 3PWUA 3PNWA 3NFPA 3FO1A 4WW2F 1QSZA 1BJ8A 3HC0B 5DRZA 3RHWK 1JPST 3IDMB 4NJ9L 4QF1B 5AEAA 3C08L 3QP3A 4M5ZH 1GRWA 2VLKB 3QWRD 5CHNB 3QH3A 3WIIL 5CILH 5FK9A 4CU7A 2ZCHH 3FFDA 1A7RH 4KJWC 2AXHA 3GFUA 1KCUH 4EZMA 3VXRA 5EFIB 1YNKL 3X3FL 5LVEA 3RGVA 2V2WA 1V5JA 3WHE0 5KN5A 1MCIA 3U1SH 5J6HA 1JVKA 2NTFA 5K9KB 5D2LA 5D9SA 2CGRH 2Y25A 1X5LA 4PJHE 4JN2A 3LN9A 4HC1L 1V7ML 2AW2A 4DGIL 2DLIA 3AY4A 2B0SH 4HK3J 1FNEB 2CMRH 1F11A 3TV3L 1TZGL 5I8EA 4N9GB 5DC0A 4Q9CA 3IDYC 4B0MM 3K1DA 4YC2C 4BZ2H 1EA9C 4JGUA 3VFSA 3SKJL 2DQIH 1PDKA 3VA2C 5E8DH 4MJIE 5EOTB 1N6QL 3C5ZB 4DVRH 1B4JL 1NKRA 5BW7A 4KXZH 5F9OH 5TH2A 3QXDB 4OCMC 4OD1L 1DSFH 4N0YL 3MUJA 1DE4A 5GRXG 3VXPB 1I9JH 3C6LA 1N26A 2G75B 2W60A 4XVUC 4CN6A 2FHBA 3J7HA 3H9SD 3U0TB 3KNBA 4EBQL 4GBXB 3OPZL 3MJ9L 1IM3B 2AXGB 1FPTH 5GSVB 1KB5H 3LPGA 3I50H 4MDJB 3F7RA 4FZEH 2PETA 1Q38A 5GPRA 5L9DL 1T1XB 3WJJA 4JAMB 1KIPB 4ZS7H 4PLNC 3MJGX 3K46A 4RFNB 3FAWA 3B9KD 5FB8A 4WFHD 2LABA 2VQUA 4OF7A 4XNZC 2ESVE 3ZL4H 2DI8A 3HR5B 4PJEE 2OXGA 2VE6A 5C0DB 2A73A 2D03H 1EFQA 3VG9C 5LAXA 4FQ1H 3LV3A 3ROOA 1J0ZA 1DUZA 3P0VH 4ZUUB 4HWZA 1D6EB 1HCVA 3BJ91 3PABB 1IGCL 1QG3A 4PJ8B 1Q9LA 1MREL 4TNVF 3CAFA 5EIIB 1G7MA 5MEPB 3GMNA 4PJCF 4OZFB 1OLLA 5E5RB 3OXSB 2PUQT 3MYJB 4IRSC 3LKRA 3JTTB 3ARXA 1J1PL 3V95A 5I6XC 1U58B 3Q6FB 1QFUL 4GMTL 1NGQH 3P4NA 2W07A 3TC9A 1SEQL 4D9LH 4BA8A 1ZS8A 1X5YA 5DUPL 2GW5A 3KPQB 1JWUB 3LIZL 3DVGB 4J3XA 3FTGA 5BS0B 4XNYH 2BZDA 4AT6B 2E9IA 1JZ6A 3QPXH 4LHUG 4K94L 3CUPB 3RA7H 4Y5XB 5TGBA 1GL4B 4KKAC 5ID1B 5D5MF 3OR6B 4HK0B 4PD4J 1JF6A 1AGBB 3ARDC 3NBNA 4QRTA 1ZV5A 4QWWD 4K3EH 1RJYA 1U95B 1B2WL 2VTFA 1PG7L 4U6VH 4LSUH 4MCYA 3EO0B 1MQ8A 4NQXB 5EUOB 3C8KA 1FP5A 3GGWB 1G7PA 2VABA 3SGEI 3Q3GA 4MJ5B 4TUKH 4UT7H 1L0YA 3O6KH 1XIWA 2JCCA 4I3SH 5HY9A 4ALAH 1PY4A 1T2QH 4JQXC 1L7TL 4P2OA 4W4OA 1KTRL 4OIAA 4K8RD 4R26H 1NC2D 3MODL 2NXZD 3WUWB 4JM2F 3BZFB 3QULB 1T21A 4FQCL 2WWKO 2AABL 2PW2A 1QZ1A 2K9UA 4WWID 1F2XK 2QEJA 3QRGL 1HZHL 3U7WL 3L3HB 3ALPA 3QI9D 4I5BB 4OCLC 3C60D 3B43A 3BW9A 3PWJA 3SE8L 3SPVB 2ZG2A 2I5YL 5CUSH 3WFHA 2EIBA 4MDIB 3FKUS 5JXAH 2VRAA 3F7YB 4QNPF 3DX6A 5EIVA 3N1QC 4POYA 1S78C 4POZD 5D7JA 3TA3A 1FG9C 4UQ2A 4PJ5B 4H26A 1UXWA 1T0NA 2J4WH 1B0RA 2LAGB 3WDHA 1K3ZA 3O41B 1ZAGA 3UJJH 2YZ1A 3UTSD 2X4TB 3ZHKA 5I8KH 3WO4C 4F37K 4RRPG 3EOAB 4X5XB 3UPAA 3U9PH 2H8PB 4AMKL 3OMZA 2WIIA 5BJTA 5TE4L 3TNMA 2B5IB 5CP3H 3UTZA 5JIKA 2BXZA 4YHML 4X5WB 1AH1A 5HGHA 4LLUB 1UZ6E 2VXQL 1NBVH 1RSFA 5J11B 1RZFL 32C2A 2AVGA 4R7NB 4MMZC 3T0VA 4GXVH 3F7VB 4XMKL 4HHAA 2DOCA 2Q87A 3FHAA 4R2GD 5GGVH 4PRID 2X7LA 5FUZH 2ATPA 3W2DL 1BF2A 4L4TE 1FZJB 1Z2KA 4ZSOB 3CD4A 5IQ7L 2R4RL 3KPOB 3RAJL 3QDMA 3O6FD 4Q2ZB 2VKWA 5L88H 4ZO7A 3ILQC 1H3TA 4KI5F 1HOCB 1ZGLM 3V6OC 1TIUA 4BKLA 1F4WH 4OZFG 1NGYA 1CLYH 4TN9A 3TJHC 5DQJA 4RGNE 2XN9B 1NLDL 4HUUA 5L7XH 3VH8A 4LAQL 2UWEB 1S7SA 3GMPA 5J1SC 2VB5A 5LGJA 5K59E 2XG5A 1NFIA 3BH9A 2X89D 1R5WB 5JW5A 1NLBL 1H8NA 1P7HL 5IEKA 1Z3GL 3NCYS 1V7NL 3BN9C 1ND0A 3VXQA 1QD0A 3FQRB 4NBZB 5DUMH 4J1UB 1ROWA 4GAFB 5BRZB 1CF8L 3DURA 1KG0B 5JO5A 2B7DT 4NT6B 2NY3D 1F5WA 2JELL 3NIFF 3FB6A 5EUOE 3SDAC 3CFBA 1NGWA 4PGEB 2FBJH 4NSKB 4WV1C 5C7XL 1N7MH 5T3ZE 2XKUA 1RVFH 4WHTB 3P30L 4HJGB 4K9EH 1FFOA 4XGZB 5FKAB 4WJ5B 3WUWG 3MRQB 4PV9B 3FT2A 3LOWA 3OAYH 4JHBA 1IAII 2Q7YA 4OSUL 5HYEA 1TCMA 2R2BB 2R0LL 5JQ6L 2VXUL 5HTSA 1QRND 7CGTA 4RGMC 4PJDE 3D6GA 4CUCA 4S1DC 1MQKH 4P4KA 3DMMC 3MFFA 4DVBB 4TSCL 1PZUB 1KJ3L 5ADOL 3MOBL 5GGTA 4M6OL 5IMOA 3CSBA 3FONA 3UZEA 3QEUA 3AAZA 3TT3L 2IQ9H 5C09D 2VXTL 5ILTH 4J23A 2AK1L 3ES6A 2HFFA 4OT1L 4MMXC 3S37H 4PJ5E 5DS8A 3DLQR 4E42B 3DIFA 3RUGB 3DVNB 3RTQD 1A3LH 5GRUL 3RY6C 4X7SL 3VXMD 3NN8B 2O5ZH 2OJZL 5E2UL 3BDYL 2ZG3A 1MCRA 2XA8L 3BP4A 4NUJA 4DQOL 1ZHLB 4WW2A 5CEXA 2I24N 5CCKL 1N5YH 2MQ0A 1FORH 5DUBB 3KJ6L 5GRVL 2ZUQB 1VKXA 5IQ9A 1EO7A 2NZIA 4CRPA 1D5ZB 4HMEA 1HHJA 1OAUH 4YIQB 3BRDA 4KMTL 4PGCB 3P2TA 3T2OA 4E41A 2YRZA 4YE4L 1LD9B 1KT2B 4Y7MA 1JHTA 2XTJE 3FB5B 4HIEB 1FL5A 5T3ZH 2YD3A 5IB5B 3WNOA 4WFGD 5FYKL 3O2VL 4UDTB 3AM8A 2O61A 2WMPA 4V2CB 3NOIA 2Y7QB 1JN6B 5E7BA 3HC4H 1FH5L 2VIRB 3PP4L 1M05B 3KPRD 1OF2B 5EZIL 1G6RA 3ZLQC 3MRIA 5I76B 2P48B 2NR6C 1N64H 2UWEE 3D0VB 3R0MA 4UIMA 5BOPA 3OKOA 2DIJA 2GCYA 4CMMA 3IDXL 1RZ7H 1P69B 2BJMH 4PJXB 2LAAA 5DRNB 3O2DL 5T5NG 4J4PA 1RAMA 5D7IF 3JV0A 1U93B 3SQOL 2LV4A 4IOFC 4QHLA 1CFNA 5BRZE 3HMWH 4HT1L 4KVNH 1BLNB 2GI7A 3D25A 1W0YT 1CK0L 1VENA 4KTDL 3RZCA 2EH8H 3UO1L 4JFQA 3PWVA 2BVPA 5LXGL 4F57L 4GQPH 4D0DB 2FNBA 4FQJL 4KK5C 3L3OB 3VXSD 2J6EA 4NN5B 2GY5A 5DWUL 1G7JA 2F5AL 2OK0H 5FO8B 5CMAB 4EJ1C 2OTPA 3EBAA 1YJDL 3IGAB 4GRMA 3IDJA 1NC4D 1Q0YL 5DRXB 1WWAX 3ALXA 3QO0A 4NUGL 4GKNB 4P46C 4N68A 2OL3A 4UQ3A 2O5YH 3CVHL 3E6FA 2HJKA 5I1IH 4YDIL 4Q97A 3IU4L 2ICWJ 2BP3A 1FFQA 5F9AC 3IJHB 3IJSA 4HBCH 2NX5D 4LU5H 4MA1B 4PJ7B 4XHJD 5KJRL 5ESQA 4PJCA 2BNQD 4K9EC 3O11B 1L6XA 3ULUD 4NJ9H 4ZDHA 1QR1A 3C08H 4WI6A 1EGJH 4W6WB 4ZFFB 2BRRL 4ZFOL 4DK6A 4EUPB 3WIIH 1IKFH 3QIUD 4R4ND 4XB7A 3UZVB 1RZIA 3RUGE 1WIOA 4XCNB 1H3PL 2GUOA 3SOBL 1CDCA 5KW9L 3DO7A 4GRLA 4JE4B 4S0TD 4F33B 1YNKH 4LKXB 3QJFB 3L3IB 1NGXA 3QIWB 5EO1A 3LD8C 5D5MA 2VKXA 2DJ4A 3PWPB 3P9MB 2JKXA 3VWJB 3BX7C 2HG5B 4PRNA 4G9FD 4MWFA 2HP4A 1WFOA 4D2NA 2C3VB 5GGRA 1FGVL 5EPMA 2F8VA 3MBEC 1TZGH 4RGNC 4QRPA 1U6AH 2UY7A 4WGWB 1NGZA 2AJZA 4G6KH 3PL6C 1XZ0B 3SKJH 1CICB 4P3DB 3V5DB 4JJHA 1ZVHA 1DN2A 2AV7A 5IB4A 4JRYA 1HXMA 4ZUSA 1N6QH 1B4JH 1XF5A 4MD5A 3UJIH 1RUAL 1RZGB 3U4BL 2F58L 1FZMA 4PGDA 3NA9L 4JM2A 3IFOB 2NW3A 5IVZB 1TQCC 2BNUA 5E99H 3UPRA 4Z8FH 3SDXF 1FNFA 4EBQH 4G7VL 3OPZH 3RIAK 3MJ9H 4IRJB 1Y0LB 1ZT1B 3BP5B 1KCKA 1E4JA 3WSQL 5L9DH 1VESA 3EJJX 2PYEB 3KPNA 3KPSA 1CFQB 4P2YA 1Z6JT 2Q8AL 3FFCE 2B1HL 2DM2A 3FN3A 2VOTA 4F7CB 5ALBL 1NGPH 2PF6A 1Z0MA 1JNNL 2KBGA 3DHMA 4OBRA 2R69H 4Y0GA 3CH1A 4YHPB 1MCQA 3HRPA 3QXUA 3S35L 3CPLB 1PAMA 1KPRA 2EC8A 1MREH 4G8GA 3RGVC 3UAJD 2XV6B 4LEXH 2GYSA 1EHLH 3AMLA 4IHOB 4GG6F 1QSFA 2J7LA 3QDJB 2Y1VA 5MERA 4D8PB 4PS4H 2I27N 5D1ZA 3RWFB 1J1PH 5B8CA 1VA9A 1U8QA 2F15A