The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Ultrahigh resolution studies of amicyanin
rcsb |
| source organism |
Paracoccus denitrificans
|
| molecule tags |
Electron transport
|
| molecule keywords |
Amicyanin
|
| total genus |
29
|
| structure length |
105
|
| sequence length |
105
|
| ec nomenclature | |
| pdb deposition date | 2007-02-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00127 | Copper-bind | Copper binding proteins, plastocyanin/azurin family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Cupredoxins - blue copper proteins |
