2OV0A

Structure of the blue copper protein amicyanin to 0.75 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Ultrahigh resolution studies of amicyanin
rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ov0A00
2YXVA 4A66A 1BYPA 8PAZA 3H4FA 3QJUB 1AS6A 4G7QB 2FT7A 4DP2X 3AW5A 1AZBA 1RZQA 4E9VA 1ZDQA 3FQ2A 4G7SB 4HALA 3OMIB 3U25A 1PLCA 2GC4C 3NJFA 5D4JA 4M4RB 1WA0X 1IKOP 3EH5B 3TBCA 5LDUA 3X2QB 4BK5C 1JZHA 1M9WA 1AANA 1BXVA 2JKWA 1KGYE 3FSAA 2DY2A 4HCFA 3IN2A 3CVCA 5B1AB 2R7EA 4AZUA 3NSFA 2RACA 1GW0A 1JZJA 3FU7A 1BXAA 5AKRA 4GY4A 5TK4A 3X1BA 4F2FA 1J9TA 2FT6A 2IDTA 3ABGA 3FYIB 2VSKB 1V55B 3NJIA 1J5CA 1MZZA 1KDJA 3FSWA 5I5IA 2UXVA 2BO0A 3NT0A 5I5JA 2ZWNA 3NJMA 2VMJA 4JHVA 2AZUA 2XVBA 2XXFA 4E9YA 1L9OA 3FSZA 2CUAA 1V10A 3UABA 1AS7A 3NJNA 1W6LA 1PY0A 3WKQA 4JKNA 1J9RA 1SF3A 2HX7A 2FT8A 2PPFA 1AACA 2XUWA 3AG4B 2IWEA 2MRYA 2UXGA 4YSUA 3T6XA 1ILUA 2QDVA 4M3HA 3PAUA 5I6LA 3X1NA 4DP0X 2YAEA 1XB8A 1KBWA 1BAWA 4BDVB 1I53A 2PCYA 3ZX1A 4N8UA 2CAKA 1KBVA 4YSDA 1EHKB 5E9NA 3KW8A 4DPBX 4AKOA 3BQVA 2EINB 1OCRB 1F56A 4AX3A 2XV2A 2IDUA 2BP0B 2B08A 1CYXA 4DP4X 2FQDA 3S3DB 4FA7B 3NJJA 2GC7C 3FQYA 5AZUA 1W6WA 3V9CA 3QJVB 3L45A 3WIAA 4BDVA 1URIA 3WI9A 1SDDB 5B7FA 4GP8B 1FA4A 4BWTA 3FQ1A 1PNDA 1ZV2A 3OM3B 2IDQA 3CZUB 4HHGA 4ZK8A 3WNJA 2AZAA 4YSCA 2BW4A 1FFTB 4KO5A 1KCBA 2XV0A 2OJ1A 2B3IA 2BP0A 2H47C 3TBBA 3ASNB 1JVOA 2HRHA 1PZBA 1SF5A 4HZ1A 1L9TA 1JZGA 3QQXA 2Y1AA 3C75A 3KW7A 1OOWA 1AIZA 2NRDA 1AZNA 2XX1A 4RH4A 2VW6A 2HZHA 2OV0A 3NP3A 4ENZA 1AZRA 2H3XC 3OQRA 1GR7A 1CC3A 3NP4A 2UXTA 2TSAA 3PAVA 1NIFA 1QLEB 1NIDA 3T6ZA 1QNIA 3HB3B 1AS8A 5F7AA 2VW4A 3ZBMA 4W9ZA 2GHZA 1RZPA 3H4HA 1KCWA 2PLTA 3GXUB 4UF7C 2E86A 5I5MA 1AZCA 3PCYA 4HCGA 7PCYA 4A67A 3NSYA 2UX7A 1JXDA 2IWKA 2XX0A 3AG2B 4HCIA 5EHFA 4L0PB 1QHQA 3NJKA 4YVUA 1OV8A 1A65A 2BWDA 2ZOOA 2HLEB 4YSOA 4QLWA 2HX8A 1JOIA 2XWZA 4AKQA 3S8GB 2PPEA 2I7SA 2J56A 2AFNA 3SBRA 1SFHA 3JT2A 1E5YA 3X1FA 3D12B 5PAZA 1MG3C 3UAAA 3UADA 4NB7A 4YSPA 1JXGA 2IDSA 2JFCA 4A2EA 2LLNA 2XXGA 3ERXA 3IBOA 3TA4D 1WA1X 1ZDSA 5I6PA 5F7BA 3N55A 3NSDA 4EF3A 4YSEA 3NYKA 1HAUA 4GP4B 2GBAA 1ET5A 2UX6A 3FT0A 3PPSA 1AR1B 3EH3B 2DYSB 1J9SA 1L9PA 2YAMA 3EH4B 3WNIA 3SQRA 2YQBA 4BWWA 1NIBA 2BZCA 1IC0A 3FPXA 5D4IA 2P80D 5B1JC 1IBYA 2CJ3A 1M56B 3ABKB 2H5UA 5I28A 1WS7A 4MFHA 2IH8A 5TK2A 1JZEA 2VSMB 3DKHA 1OCOB 3UGEA 4BXSV 4KNSA 3EF4A 4A2GA 1NIAA 2PPAA 1NINA 1WA2X 3T6WA 1XB3A 1BYOA 1JZFA 1GSKA 3ZIYA 3H56A 2W88A 4CSZA 2Q5BA 4A2DA 3NJGA 4K9JA 6PAZA 1OE1A 4KNTA 2VW7A 1E30A 2YAOA 2AANA 2IAAC 4PAZA 1BXUA 1JERA 1NWPA 4DP6X 4DP5X 2X88A 5ANHA 4KOCA 1AOZA 2BZ7A 4DP9X 4DPAX 2DWSA 3ZDWA 4N4YB 9PCYA 4A68A 2DV6A 2XLLA 1XB6A 1NTDA 2FJSA 1AG6A 2BWIA 2IWFA 1N70A 3FYEB 2QT6A 5I6KA 3SBQA 4DP7X 4FAAB 6PCYA 4HIPA 1OE2A 1GY2A 1ADWA 1PLBA 1PZCA 3GYRA 1JZIA 4A2HA 3CDZB 4AI7A 3ABLB 1ZIAA 2AVFA 2PPCA 3DIVA 1CYWA 2J5WA 1SDDA 1XMEB 1GS6X 3OD3A 5B1KA 1WS8A 2IDFA 1OCCB 2BP8B 2J55A 1NZRA 3IEAA 3QJRB 1SHXA 1AQ8A 3NJHA 2HRGA 4KO7A 1A4BA 5I6OA 4HHWA 2OCCB 1BQRA 1A4AA 1ILSA 1MDAA 1ET7A 4KO9A 4QKTA 1M57B 2PP8A 1PZAA 3TU6A 1CURA 2FWLB 5IY5B 5FC9A 2I85A 4AKPA 2CCWA 1KYAA 3QJTB 2YAFA 2YAPA 3CDZA 3CVDA 1J9QA 4DPCX 4KO6A 4YVNA 1A3ZA 3X1EA 4NAJA 3MBWB 5I6MA 1KDIA 3AY2A 1R1CA 2BP8A 2XU9A 2CBPA 2PPDA 2WO3B 3X1GA 3CVBA 4WTQA 3DTUB 3PLYA 2EIJB 2TSBA 4G70B 1JVLA 3S3BB 5B7EA 4E9RA 2YAQA 3OMNB 1MG2C 1SHWA 2JXMA 2UXFA 3WG7B 2I7OA 4F2EA 1NIEA 1FWXA 1W8EA 3OMAB 4YL4A 3RYMA 1B3IA 3PAZA 1ETJA 4GYBA 1T5KA 1NPNA 1PLAA 1ZPUA 1X9RA 1GS7A 2BW5A 2Q9OA 1TEFA 1NWOA 1X9UA 2XV3A 1YLBB 1EZLA 4YSSA 4UAHA 1BQKA 4A2FA 4DP8X 2PCFA 1A4CA 1L9SA 2QPDB 3G5WA 5B7MA 1PF3A 2DYRB 1RCYA 4E9QA 1ASQA 2VM3A 2PP7A 4WKXA 5AFAA 3IE9A 1IBZA 3JTBA 2BHFA 5D4HA 1ET8A 3S3CB 4G71B 1OF0A 2YARA 2QPEB 1AAJA 1SFDA 3EHBB 1ASPA 1OE3A 4E9SA 4BWUA 5B1BB 3NJLA 1L9RA 1BEXA 3QJSB 2ZXWB 4DP1X 2FQFA 1NPJA 2YAHA 4P5RA 2HX9A 4Q8BA 3QJQB 3SBPA 2EIKB 1DZ0A 5I6NA 1CUOA 5PCYA 1DYZA 3FPYA 2GIMA 2GB2A 3T9WA 4PCYA 3TASA 2VM4A 5I26A 4E9TA 1MZYA 3T6VA 3AG1B 1ID2A 3HEIB 1SNRA 1NDTA 4G7RB 3FSVA 4KNUA 4BXVA 3UACA 2W8CA 7PAZA 3ASOB 2A3TA 2YXWA 3IN0A 2WSDA 4X4KA 3BVDB 2EIMB 2DWTA 1GS8A 1PNCA 1AZUA 2GI0A 4KOBA 3CG8A 1PMYA 4E9WA 1OCZB 4YSAA 1E67A 4W1TA 2FNWA 3ABMB 3AG3B 4YSRA 3V9EA 3GDCA 1JXFA 1ASOA 2GSMB 1BQ5A 2FTAA 4CSPA 1VLXA 1HAWA 2VN3A 1GY1A 1V54B 4Q89A 2FQGA 3PXLA 4YSQA 3S8FB 1WAEA 2HXAA 4G72B 4GXFA 2PP9A 2N0MA 2EILB 4P5SA 2MTAA 1A8ZA 1TEGA 4NERA 1RKRA 3AZUA 1KV7A 1E65A 1AG0A 1GYCA 3UAEA 5A7EA 1ZIBA 1N68A 4JHUA 3QPKA 4TXVB 4UANA 1PCSA 4HAKA 2P80A 2XYBA 5B1JA 1NICA 1TU2A 4E9XA 2X87A 1IUZA 1L9QA 1TKWA 2IH9A 3WKPA 4YSTA 2WO2B 3T71A 3N2JA 2CALA 2R7EB 1E5ZA 2QDWA 3MX0B 1PAZA 1UATA 2Y69B 3FU7B 3FU9A 5B3SB 1HFUA 2FQEA 3FS9A 4F7KA 4GP5B 1J5DA 1SJMA 2J57A 3NSCA 3FU8A 2ZONA
chains in the Genus database with same CATH superfamily
1BYNA 3RWFB 8PAZA 1UWEL 3BRDA 2X4TA 2FT7A 3PWPB 2QPUA 1Z6JT 4LZKA 3C6SB 5AW8B 1LP9A 2K9FB 5J13C 5JW4Q 2K8QA 1BFOB 1E6OH 3ECQA 5SX4I 3QIUA 4EIZC 1S78C 1WA0X 3EOBB 3SGKC 3QUML 1QSFB 3UYPB 4MNQD 5LDUA 1KEGL 4LIQL 1YEHH 3E80A 3TL5A 3GKZA 5HDRA 5DUPL 1IAMA 3WFBH 2R7EA 4MAUL 4ZOEA 2FLBT 3FU0A 4D7BA 2ITFA 3FU7A 4ATWA 4WI6A 4X4ME 4Q2ZA 4AM0B 1IGML 1F13A 3WDIA 5FS5A 4O2FB 2V2TB 2FATL 1T1ZB 3HC4L 1MCCA 4PTTB 3ESPA 5DUMH 2VO8A 3BPOB 2BO0A 3NT0A 4NO0B 4ILDA 2BNQD 4HWBH 5DQDL 3FHAA 2PTTA 2VLJA 1U42A 5BZWB 1B4LA 1BECA 3WTXA 3TNMB 1GVIA 1OTTD 4MA7L 4HBCH 2BY0A 2CUAA 2A73B 4DGWC 4UM9A 2Z9TA 5D2LF 4NM8L 3V8CA 1YDPA 3QIBD 4G6JL 1Y18B 4MDIB 4JN2A 2HX7A 4GT0A 4IBYA 2DM2A 3NZHH 4MJHA 1FL3A 4LKXA 1I8UA 2K6YA 1Q9LA 3PS6A 5LB1A 3KLKA 5F7DA 4ZXBC 1NAMB 5I8CA 5IGXH 5D7IA 2DMCA 1CDIA 2QKIA 4MTMA 3FQXB 1G9MC 2ZP8A 4P5KB 5HGAB 1VACB 5EU4A 3L3GA 5F96H 2BSTB 2EDTA 1SBSL 3QZWA 3M1OA 1YG9A 1FAIH 1E9OA 3LZFL 3DNKA 4S1DD 2CBTA 1UENA 3ZX1A 5LNDA 2NQ3A 3WTTA 4UINH 2FIRT 4X5RA 1P84K 5CR1A 3KW8A 4Y5VA 2CJSA 2D3NA 2M26A 3HMWL 2V7NB 4QOKB 4WWKB 5C1MB 4I1RA 1QPXA 2Q8AL 1F56A 2YPVH 2IOIA 2BNRE 3STZB 4KUZH 1ZXKA 3WXWL 4AYID 3C6EA 3DX4A 1DVFD 1KJVA 3HHSA 3MRPB 4DCQA 5DLML 5KSAC 4O5LH 3BDYH 5EEZA 3GSOA 5GRWA 3NJJA 2GC7C 5EBGA 1L0QA 5IOKA 4K2UL 5DHDA 2WXQA 3MI6A 5JIQA 1WC7A 3BZFA 3O4LE 2UYLA 1URIA 1ZVYA 5DZVA 4AIZB 2VXTL 4BFIB 4NZRH 4AC4A 4KFZC 1HXYA 4KXZI 2GJ6D 2IDQA 4CW1B 2EH7H 1X5GA 2M1KA 5FHAL 3MACL 1HXKA 3L13A 4QRSA 5IMLB 5DRNB 3TVMB 4KO5A 1WDAA 1W80A 1OKEA 4HIHA 4M4PA 5ERWA 3H54A 4F2ME 2XHNA 1S2EA 1LO3H 1SOKA 1CFMA 2DQHL 3F5WB 4D8PA 1I8IB 3D7PA 3UTSA 3ARDD 5DRWB 2NNFA 4MASA 3TA3C 4AYGA 3FO2B 1CGTA 4AGMA 1FVDA 2WQ8A 2MQ0A 1EXGA 3CDGB 2ZXAA 2KKQA 3ML9A 1NSNL 3S7GA 2VR4A 3GMOB 5A16A 3HNVL 3T2PA 4PRNA 2BY2A 4PJGB 1CDYA 2APXA 1IGCL 1U95B 3IWUA 2IAMA 4JY6B 1KN2L 1TJHL 4FQXC 3PYCA 2ZF9A 1G7IA 2FH6A 2GAZA 4Y1AA 4F1ZA 4AQAB 4TYUA 4BFBD 1TCMA 4OFVA 1Q90A 4FYSA 5DQJB 3SJVA 3F04A 3VG9C 1P1ZA 4DKFL 1DJZA 4EI0A 1CIDA 1MAMH 3KPRB 4X5XA 4XZUA 2HLAA 5SWZE 4R26L 3CWGA 4KWUA 4RSVA 2CPCA 3K4AA 3SE8L 3UZVA 3NSYA 4U1NA 5D1QD 3IPEA 3PPEA 3CDCA 2H0JA 4JX0A 3LZLA 1UGKA 1PZ5B 1EEUA 4TNVK 2Q76A 4W9LC 4DGVL 3NOIA 4RMVA 1G7QB 5KAQF 3INUH 3RJDA 3QUYB 5GRVK 5MI0B 1YECH 3QJFB 2J8UF 1JF1B 4CADA 4K23H 1D5MA 2HLEB 3NGBC 3V6FA 2FLMA 5JQ6L 5CUSL 4MMZA 3S8GB 2C9XA 1P1VA 2R0WH 3H3PH 3LB6C 4EVNA 3CX2A 3JT2A 5D7JB 4Q6IA 3ZYZA 3CH1B 3IGUA 4PJEB 2EDJA 5HJ3B 1BF2A 3UYRH 1TITA 3IFLH 2OL3H 4X4YB 5T3XL 1FPTH 4BINA 4HLZH 4NNPH 1JI1A 1K5NB 1MCSA 3MRLB 3VFMA 3T0AA 4RVBA 1A14L 3WN5A 1EH9A 1D5IH 2E5EA 4R8WL 1XCWA 4LNRB 1IGTA 1KGWA 4WI0A 1BFVL 5F7BA 1AXTL 4FX5A 4PJXA 4PMEA 4QXTB 4ANVA 3QIWA 2L7EA 1NUFA 5T5NF 3F7VB 3RLSA 1ORSB 1RP9A 5T3ZL 3L1OL 4NSKA 3PPSA 3EH3B 3G08A 1FUNA 5T5FH 5KJRH 1CDCA 3HUJE 4HEMA 2DKUA 1CDJA 1L9PA 1MHEA 1S7UA 2EDDA 3P3TA 4PGZA 3NCJL 5DTFB 5I16B 3DXAD 4HW6A 4HEPA 4WW1A 2EYRB 3F7PC 5EOQH 1OO2A 3OAUL 4A6YA 1QA9B 3N43B 3RWJB 3ABKB 2VLRA 4FEMA 3QW9A 2QR0B 5DC0A 1SLUA 4QHLB 3BN3B 3MV8B 4Z77B 1AFVH 5JOEA 4JNXA 1UM6H 3QI9D 4GI6A 1OD7A 3O3AB 4JKKA 4WW2F 1WA2X 5LGJB 2MCPL 3BPNB 1XGQA 1AHWC 5HYFA 3CXDL 4KZCA 1OW0A 3VW3L 3QO0A 2PXYB 3VX1A 5JUEH 4HUKB 1XGPA 2VIRA 5D7LD 1FYTB 2GJJA 3K2MC 1Q72L 3CLWA 3C5ZC 4MJID 3BP7A 1MWAB 1ZVSA 4G8AC 2Y5TB 4M29A 4Q74A 2WINB 12E8H 2OMVA 3RWIA 1JPTH 4PRAA 4TV3A 4JO2L 1W15A 1ETZB 2NX5B 4UQCA 4Y2OA 4B9CA 3G6AB 3L3OA 3R7QA 3V4VB 1CF8L 2NNCA 3SDXB 2Y7QB 4ORGA 4G7YH 5D2LE 3VXQB 1RUQH 1DFBL 2Y7SA 3DVNB 3FKUS 3HTLX 4PB9H 4X6EA 2IMNA 2CO7B 5C3TA 5GS2D 4I4WA 1E4XI 3ABZA 3HAEH 4FXGC 2FSEA 1YEIH 3HG4A 2D7NA 1WBYB 1DUZA 3IDMA 2MHAB 4CRPA 1N70A 1S8DB 4POZC 4EQ3A 3FF7A 2F53E 3IDXL 4H8WL 4NUJB 5BRZE 3CVHH 2DJSA 2XBZA 5MEQA 4HXBH 1ES0B 3CZKA 3J8F7 4RBPH 3OXSA 1J7VR 2VDOL 1IT9L 4HWEH 2R8SH 1XZ0A 2FWSA 2UWEB 3QUXB 4L8BB 2IPUK 1XR8B 2FHFA 4MD0B 3KLLA 5E1IA 1BJ1J 1J86A 3VCLA 3GINA 4P2AA 1UKQA 25C8H 3O11B 3JTTB 1OT4A 2CDGB 1U8LB 1XL6A 5CLWA 4Y4KB 4U0QB 3SDCB 4RFNC 3TX4A 4QRAA 4BIKA 1MVUB 4R96B 2IQ9H 2WKOA 4X4XB 4YLBA 2BVPB 4DO6A 2FL5A 3FAXA 2BP5M 4NQXB 4F7MA 1XGTB 2XZCH 3OZ9H 4KDVA 1AO7A 3VFPB 1E8YA 1P9MA 1YC8A 2PO6B 5DD0L 3VWJB 2Y36H 2CHWA 4WSKA 5F1SA 4JO8A 3RKDD 5HYSA 2C4XA 2XTJB 1ZAGA 3OBAA 3VXSE 1A6WL 1DVQA 4IU3B 4P2CG 4PRPB 2ICCA 5KZCB 3WUWB 4X7SH 3W11C 4C59B 5ENWB 4E9RA 4UIMB 3C2SA 2DM4A 4Z7AA 5EC2B 2P8MA 2WXFA 4P46C 2P3YA 3KHOA 5J57B 2FBJH 4IKIA 1HXMA 3U9WA 2VABB 1OLLA 3QNZB 3QUZD 4G6FB 3APFA 3LIZH 3OL2A 3CX5K 4HMEA 1JI2A 3C5SB 2NXYC 1X9UA 2KZWA 3KWWA 6CGTA 1EAPA 4DERA 2BIPA 2OBGA 5BOJA 2ZD0A 3X12B 1U93B 1SQMA 3IXAA 4UAHA 2C3XA 1B2YA 4ZPVA 3CPUA 1OAKL 3FTUA 4Z78B 1E7VA 1MPAL 1RCYA 3QK0A 4OCNC 3FT4A 3S3PA 4IRJB 2X4SB 3QXTA 4GAAA 1ZTMA 1KTDA 4M62L 1A4KB 1SYVA 3ZKNC 1E6JH 3U4EB 4EAEA 5GGQH 5E00A 3MRDB 2DDQL 3VXRE 4LOEA 4CA4A 3Q2LA 4F7CA 1HINL 3BEVA 2IFFL 4C47A 2QPFA 2J8UE 5CN2A 1BD2B 5FWRA 3RWEB 3F8UB 4XN4A 2IANB 2A83A 2ITEA 4Z3JA 2J8HA 5GZNC 1RSYA 1M05B 3SYOA 3QRFM 3C9NA 3ZUNC 2WGXA 2YBRA 1LEIA 4CMHC 4JANA 3FH8A 4QUOA 2A6IB 5DVOA 2ORBL 2EVJA 3OKLB 2BNRD 4BZ2H 3G7TA 2CCLA 4PV9B 3P4MA 3WTSA 4YDVA 2B4CC 2A74C 1X5AA 5FYKU 2BVUA 2WQAA 4TVPE 4RX4D 2EXYD 4PSRA 5C3LD 1MLBA 4UUJA 1CICC 1H5BA 1JZ2A 2ZX7A 1N5AB 1EDHA 4EIUA 2Y25A 2LHAA 3O4LD 5EBMB 5C0EB 2W80C 1L0YA 1AZUA 1X5IA 2Y6SD 1I1AD 3CZNA 1IEBB 4I85A 3GS0A 3K8MA 4LLMB 3DRTB 3VD4A 1DBAH 2DTML 3IETA 1RSFA 2VDLH 3V9EA 4JDZB 1NMBL 3QRGL 3BAJA 4YZWA 1A9BB 1A8JH 2J25A 4Y5XA 1WLHA 1KB5A 2CIKA 1VZHA 1V54B 2RH0A 1LO5B 3IGAB 3LH2H 5JXEC 3M1BA 4YAQB 3ZW3A 2R1YA 5F3BA 4NQEA 4AGOA 2JI1A 4YK4C 5C2BL 3KGUA 4MCZA 5IHZA 3WDJA 2W38A 3GXNA 3SO3B 4K5NA 1QRKA 3ZZSA 4V1DA 1R3IH 2QPSA 5HHVH 5J5EA 1G5GA 5BV7H 3CFEB 3AT9A 3NTCL 2BSDA 4FKKA 1KT2B 1FE8H 2P80A 1KXVA 4M5YL 1GZHA 2Z31D 4UT7H 1IUZA 1OQXA 2E7CA 1MCOH 1P2CB 4Q56A 2G3ZA 5IBLC 3WBDA 4YBHA 2AXGB 1VZGA 1N6QL 4ABQA 2FLRT 1M6OA 4KK5C 4Y88A 1DVZA 4U3HA 4Y2DB 3T71A 5I9QC 1KXTB 1TYJA 5SWZD 2Y69B 4H0LC 4QHUB 6FABH 3DSNA 4AIEA 4ZD3H 4FQHB 4YFDB 4WEBH 4ZFZA 4KTGA 1SJMA 1E4KA 4P9MH 3SYPA 4MMYA 4XVSH 5KSBF 3H4FA 1AS6A 3FL7A 1LE9A 4MB3A 3ARGD 3MLVH 2Y7NA 3DK2A 3WE6A 3T3MF 43CAA 1YSOA 2H32H 1TJIL 3LN4B 1O7SA 3STBA 4QRQA 1AANA 1YMMA 1ADQL 3GHPA 4OAWB 3BUDA 3FSAA 4LQFL 4ZDHB 1FG9C 4JG0L 4YDJA 4I13B 2FJHA 4CBPA 4XC3L 3QDMB 4HWZA 4WI8A 5CIPH 3ZKMC 1NCOA 1CF1A 3EJZD 4OQ1A 3CC1A 3VG0H 1IAIH 3QYNA 1J9TA 3R4DA 4WWKC 3DX8A 2FT6A 1HH9A 5IOPA 2A9DA 4F58L 4HUXA 4LPUA 2MTPA 5HI5D 7FABH 2DN7A 4KHXH 4ODWB 1M9SA 1YYCA 4LAQH 5FLVA 1ACCA 2AQRA 2EICA 3VM7A 4K15A 3R06A 4J8QA 3B7UX 1BOGA 2VLLB 2XY2A 3EO9L 4KZ0A 5H37H 4GUOA 3QEQE 2XJLA 5HGDB 4HBQA 2JTDA 4AZ8A 4Y4FA 4M00A 3S5LA 1T0PB 3FCTB 1KMGA 3HZYB 2X70A 4MNHB 2OXHA 3KBHE 3QUMB 2YC1B 3DSFH 2DS4A 4PFEA 1BX2A 5JW4N 2X41A 1QWHA 1AACA 1HHHA 5LGKA 4XX5A 5JW4M 3A67L 4Y19B 1M53A 4PLNC 5IVNA 5EIVA 1UYWH 1K2DB 5JNYA 4P9HL 4HCRL 5ACMA 3MO1A 4XMXA 5CEZL 4XO3A 3QYMA 4PQXA 3W2DL 4C4KT 3DETD 2QV4A 1J05A 5I73B 2NY4B 1RHHA 1PFCA 1L7IH 2L7UA 2EIEA 2O26U 5E9NA 1BAFL 4IKNA 3VYPA 2QHRH 4I9XA 1PQZB 2G60H 4ZO7A 4L8DB 3TNNB 3EO0A 2EVIA 1PZDA 1HX0A 1Q9OA 2VLKD 3G04B 4NLHA 1ZRUA 2LFGA 4OCXH 3QDAA 2QTVA 1A0QH 3BGMB 1E6OL 2ZYHA 3CU7A 2P42B 2GSIB 4GINA 4MDJA 4AWJC 2ZG1A 3Q6FB 1OAJA 3EYOA 1ORQA 3K80A 4QHMB 3V5HB 2V5YA 3AUWB 3ELAT 2ZG2A 3X13B 5C0ND 4EZMA 4GUQA 1KXHA 4OD1H 3TC9A 1JGVH 3DO7B 4BWTA 3WTUA 2A38A 2O5XH 4P2QE 2DLIA 2G75A 2DYPB 5BRZD 1WHOA 4LRNL 3V52H 2VISB 3TO2B 5KYYB 4WWNA 1ULVA 3D34A 5DEFA 4J28A 3DYMA 4OUOA 4U4BA 5DD5H 4L5FE 1FVCA 2XWJB 3D18A 3RIKA 3BX7C 4BELD 5FYLL 2HAZA 2OZ4H 3AQYA 1CLVA 4RGNB 4WV1A 5AAMA 3TCLB 3Q1SH 4TPRH 3C6LC 3ARED 4XAWL 3GHEH 2NXZC 1EFXB 5DMGD 5AOLA 3VMNA 3QDGA 3ARSA 3B2PA 2AJVH 3KLAB 5G5DB 3IJYA 3WAKA 5IKCB 1Z5HA 2DI9A 4P2RA 4X80H 1CLYH 1TTAA 1HDMA 2B77A 2X0UA 3A22A 2BSEA 3IKKA 4POYA 4FOMA 1FAIL 5KVGH 4GXVL 5F72S 5EPMB 4P07A 4RMUA 1IEAB 1BVZA 4FXKA 1AZCA 2MQCA 4XMZA 4DJMA 4URKA 3AWFA 4QIRA 4B5ZA 3QQ4B 2CG9X 4WEUD 1IJ9A 3VXSD 1OPGH 2O6FA 1A21A 2WN3A 2YPVL 3QZPA 4L4TA 5DVPA 3E8VA 3QNFA 3ZQ9A 4NYLB 4M6OL 2BOCA 1TQCB 3U30C 4O5LL 3OHXC 4YSOA 2HX8A 4C57C 3TWCH 3X3GH 5I1CH 1SM3H 3HC0A 5DVNA 1BQLH 1N6VA 4RAUA 4APQB 3D12B 2Y5QA 5PAZA 3C08H 5ISZE 3UADA 5G55A 3S8WA 1JXGA 3O6FC 4NZRL 3P4OA 4HIEA 3UBXI 1WAAA 2C1PB 2HB0A 4ZSOA 3QG7H 1UT2A 4Y5YB 4BCZA 2EH7L 2JIXD 5KSVB 3EBIA 2BINA 3HNTL 4JFPA 5I6PA 1A1OB 2H7WA 3HI1A 3BH9A 3H9HA 3HIZA 3N55A 4FZ8H 1D9KB 1OZUA 1HCZA 2AXHA 3ARBA 4FULA 5GS2H 1GOHA 2BSCA 4M1CC 3DWTA 3M7FB 1H3PL 4F8NA 4DNLA 4FEIA 2BVYA 4HQQH 1DANT 2X7LB 2HT4C 1G0DA 3Q9QA 5ACZB 2ZXBA 1J9SA 5KSBE 4I87A 3VXRD 4JFDB 1IBBA 3MOBL 4UYPA 1LMKA 3DIFA 5D4IA 5DEGB 5KYWB 4LMQE 2CJ3A 3T3ME 1EDQA 1R34A 3BVNB 1M56B 3GSXA 3UTTB 2X4RA 2HVBA 5FXCH 4FJZA 4X50A 4HKJA 4MA8H 3MOAL 4GW1B 1AKJA 3T8VA 3EF4A 3GMRA 2Z8WC 4H1LB 4MS8C 5CJBA 2VCOA 1BF8A 1GGBH 2BFGA 5F1IB 2Q8BH 4RCAA 5D1XC 1TPXB 3NPSB 4A2DA 1F3JA 4K9JA 4TVPD 4HGMA 2W60A 4KNTA 1E30A 1ZS2A 1HHKB 1M6UA 4KY2A 2VAAA 2WLYA 3SGKA 4JJ5B 2AV7B 4K23L 2NR6D 2YSSA 4M5SA 3WY3A 4EOWH 4BV1A 4R5TA 2CE6A 3OGOE 3D4GA 1QLEL 2AP2A 3CZJA 3H3PL 3HCVA 3U0TB 5L6YH 3BQUA 4TM9A 2GJPA 1PDKB 2Z91A 5EDSA 4Y8DC 3IFLL 2OL3L 1JBJA 2DBLH 5I5RA 3OF6A 3H42H 3VWJC 2BWIA 3NDYE 4PCSA 1D5IL 4ZW3A 2IGFH 4MCNA 1U0QA 5C0AE 3HR5B 4H26B 2GK2A 4RAVB 2PETA 3HBZA 4N2KA 1KELH 2P28B 1RPKA 2V17H 4FFYH 4KTEL 2YD7A 5GS1C 1RERA 2WZ6A 5T5FL 5KJRL 1HILA 4OVUA 3FN3A 3CDYA 3BSZA 3WFEH 1AP2B 2ZCKH 4BZ1A 4PD4J 4ZXBA 1D7CA 2B16A 2WNXA 4PJ8D 3WAJA 5E6IB 5K1NA 1WEJL 3WFCH 4JRYB 1RURH 2NY5C 3P9MA 5I6OA 4A04A 1QUNB 8FABB 2DWEA 5EOQL 4GO9A 2J5LC 4XB3A 2CZNA 1HIML 4KDWA 2JXMB 3UBXB 4PY8I 1R3KB 4OB5H 1NC2D 4XB7A 1AFVL 3VE0A 3ES6B 4BCXA 4KK6C 5IB3A 4PREA 1UM6L 3L5HA 1R6VA 3ET9F 4HVBA 2E74C 4B9FA 4YVNA 3RP1A 1CTNA 3TBTA 3JYCA 4LF3A 3AS1A 2J6EH 4G1MA 5JUEL 5FA4A 2QZ5A 1C08B 3LSOB 4Z3EA 3WOVA 4I2XB 5KSAA 2IJ0C 1WTGT 32C2A 1UB5A 12E8L 3GEFA 3ULUH 4ICWA 2B14A 3JSSA 5IFAL 15C8H 1UKTA 4G9DB 1JWSB 1XF3B 4G7YL 3UG4A 1PIFA 3ZL1A 1IM3D 4MQTB 4N2EA 2ARJB 5D6DC 2J12B 1ZPUA 4OV5A 1ZV5A 1GS7A 2J3SA 1E2VA 1NCGA 1NEZB 1NGXA 1THCA 1JJUA 1CFSB 4XNXL 5AD0B 1KLGB 2OJEB 4BJLA 3P4LA 4Z7QB 2FZ3B 3QEQD 4GQRA 4AMXA 1JTOA 3CVHL 2PCFA 1XIWB 4PJAA 1QLFB 2EZ0D 3RWHB 4HXBL 3TA3A 2FR4B 2YGPA 4WF7A 5I1LB 3ZTNH 2BSSB 3D85A 5EF3A 1U8MB 1KV3A 2WXJA 3OAZK 5IHUH 3X11B 1WIOA 4HWEL 1IKFH 3S3CB 3IDYC 1ZE3H 1OF0A 5ID1B 2UZYB 1S9WA 1XD1A 3U48A 3ESMA 3OPUA 3O4OC 4FQXA 5HDQL 2NT0A 3Q01A 4OZHF 3FCGA 3NJLA 3WXVH 3AAZA 3NSJA 1JGEA 4AEFA 1T7VA 4KRPB 4U1SB 2PN5A 5CCHE 5JOPE 3GQFA 3AS2A 4JO1H 5DS8A 5FYJU 3P0VL 3R4RA 4L4VE 2EIKB 2WZPD 4TVSa 1VADA 2OCFD 5GHWL 3F7QA 5I0WA 1H19A 4YS4A 2PABA 2GB2A 4MD4A 5A2CA 1WZ1H 2VZ1A 3DV4B 3OZ9L 4PJ5E 1NKOA 3CZGA 4LEXH 5GS0H 4HJJH 43C9A 4GG6B 2ZP9A 2DLFH 2X9XA 5FM5O 3B9VA 3UTPE 4HDIB 1TNNA 4JZNB 1BVOA 2YMXH 2SEBA 4IRZH 4YR6B 2NY2D 1T6BX 4WO4C 4X7SL 3HPLB 3RPKA 3H7LA 3O9WC 4Q9CA 1ZS8A 1C1EH 2G3XA 2A3TA 2VDMH 3HE7C 3AT8A 3D0AA 5GRJH 1UVQB 5ANMB 3IKCA 4JFFB 2AQTA 4HLZG 1UCTA 1PNCA 3IK2A 4XP9L 1DBBH 2ADGA 3ARXA 3J2PA 4OU3A 4XBMA 1EERB 2FBJL 4JM2D 1YAIA 1LNUB 2X89D 1SHSA 4IEFA 4P2QD 3EADA 3LIZL 3LRGA 4R0LB 5DJ8A 1AYOA 5F6HJ 4V11A 2KZ1B 2H3NA 1ZLUK 3MRMA 1OSYA 1TKWB 1UGNA 3JWNE 4PY7A 1ZGLP 3PXLA 4LEOA 1T3FB 1FNHA 1VFUA 4LSPH 5K93A 1XTLA 3QQ9D 2NW3A 1JNJA 2VL4A 4N85A 2OTWA 2NZIA 2JK5B 4GXFA 2BHUA 2W07A 5EZLA 5AW5B 1A8ZA 4LLWB 2FEEL 3II2A 1MIMH 1KV7A 2AEOA 3TJEH 1K72A 4YO0B 2Y07H 4HJIA 4DQOH 1E6JL 1C9SA 4RZCA 2HVKA 1IARB 5BPPA 3LIUA 4BH8A 1CPUA 4QRRA 1S7RB 3BKJH 2F19H 2UY6B 4HCRA 3I6GB 3GF8A 5F0PB 5JTWA 3SGEH 3GPEA 1DQDH 2CBQA 1ED3B 1U8PB 2VR8A 2G9HB 3CFUA 3SQBA 5TDNA 3ZTEA 3UEZA 3WMQA 1AHWA 3KD4A 4GP5B 4IBQA 1GZPB 2X4OA 4P05A 4GBXC 1TTRA 2FJGA 4WK4B 1PW3A 4BZ2L 2FDBP 3IVKA 2E59A 3C5ZA 3N44B 5CO1A 3RWDA 3CFDA 5SX5K 1AGEA 3BD5A 4YDIL 4U1MA 3QH3A 4HJGB 3KPTA 4Q52A 5IP4A 1GW6A 1TSHA 2DQEH 2N01B 2NY4C 2XFXA 5ISZD 2YLKA 3MNMA 3PFQA 1E5UI 5EN3A 2XQ0A 3GSWA 1JZJA 5FPIA 3DARA 4OJEH 4BGLA 3O41B 2VDLL 4FXGA 3PUCA 4Z76A 4X5PA 4NRZA 3LVTA 2F18A 2C9AA 2OLDA 4GRLD 4N9GB 5TE6L 1JD7A 1V3LA 5FKPA 3LH2L 4B27A 4Z8FL 5B8CC 1RUPH 4FG0A 1Z5LB 3KYOA 4LCUA 2G2RA 2ZCLH 4OQTL 1MVFA 3FU6A 1UXWA 4HETA 1BVNT 4F9LC 1T2QH 3HRPA 3D5OF 2GK0A 3TJHD 1J9RA 2AKRA 1N8OE 2FT8A 3LVEA 4AY0A 1FFOA 4IU2A 1OGAB 5KYNA 1KUMA 2UUDK 5I1HH 1FE8L 1TVHB 3T6XA 4LCVA 3GTNA 1J88A 1VGKB 3RZCB 2O5YL 5FUOH 2PR9A 3U79A 5I74C 1YNTF 3KH4A 4MYWB 2FYYA 1DCLA 1HESA 1W0VA 2PCYA 4KTYA 3VTMA 3H9ZA 4ZS6D 1ZT7A 2QVFB 3DBXA 4HUNB 4XOBA 3C8DA 4PS3A 4EDWH 1UUNA 3OKKA 4K7PY 5SWSB 2EEAA 2OTUB 2YRBA 4KTDH 1FC2D 1I7TA 3LRMA 4N5ED 4P2OC 5BZDB 4OI8A 3BQVA 2F8VA 2IH1A 4Z7UB 1XF2B 1J1XH 2JB6B 3GXTA 5HXMA 2C1OB 2ZNWA 2HUEA 3PNWB 4DT2A 2X6MA 4U33A 2MCAA 3TLRA 4JE0A 4PHXA 3UAJC 4P46A 4AV0A 1FJ1B 1S7XA 2YRLA 4TSAL 1FF5A 4M5ZH 5HI3D 4LFHG 1O0VA 5AENA 4QTHA 3GMLB 3VG0L 1IAIL 4AVHA 3ZDYF 3KEHA 1KG0B 5I30L 1GYAA 5EOTB 7FABL 1K6QH 3A6BL 1PNDA 2X1WL 3BAWA 3JT0A 4KHXL 5C0AD 1DN2A 3B3IB 3VFNA 2P8LA 3S37X 2XNAB 4OZHE 4PJDA 1RJYB 1FO0H 2W0FA 4DKDC 5IFHL 1GGCH 2JH2A 5L7XH 2KQNA 5C0CE 4QYOB 1MJUH 3G5YB 5D9SA 2FX9H 5CGTA 4XMKL 4D7PA 2R29A 3BJLA 3MLXH 3OJDB 2P46B 4KQ0A 3BO8A 5ECGA 5GSRB 4P5TC 2ATPA 3GHBH 4AQOA 1JS4A 4OY9A 1J8HE 2GUYA 1PKQB 1AGFB 3L4UA 3T77A 3GBMH 4Q9QL 5J12C 3UC0H 2ETWA 1UYWL 1FSKC 5IVXF 3V6BR 3ZKXB 3LNIA 4FLHA 1IM9A 1FDLH 1CFBA 5GZNA 3EZ8A 4J5VA 4JKWA 4G9FA 1TTUA 3EZJB 1CLOH 1GYVA 2IXQA 1YY9D 3RB5A 5BVJB 1WAPA 1L3NA 3MFGB 1I3GH 4LLQA 2G60L 1TO5A 3AG2B 1CVSC 1DE4A 2A74A 1T1WA 5F7LB 1A0QL 1QHQA 5J89A 3MPCA 2DBJA 3VM5A 4UOZA 4FQJH 4G6KH 5FGRA 1CICA 2R9HC 3RVWD 4B9JA 5KSUB 4AEEA 2H1XA 1LJMA 3AS3A 3B43A 2H26A 2AFNA 5IBUB 5I19H 3G5VB 4E41B 4KJWC 1TJMA 2G30A 2L4OA 2X1OA 3N1MC 2PTVA 1NDGB 5CJXC 3FFCA 4L3AA 4OZFH 2EDHA 1P6WA 1CLZH 4HIJB 3I9IA 4UM8B 1QBLH 1URZA 5AYUH 4PN6A 3TH3T 5FK9B 4FJYA 2ENSA 3MBXL 2E7DA 5JXEA 4MBOA 3ZMEA 1ZDSA 4UILH 1OQOA 3RHWF 4D0DB 3WNLA 1VIWA 4OCLC 4NCDA 5JMRA 3D4CA 3L3JA 3ATAA 3DUUB 1CR9H 5F9WB 2LW3A 2O6CA 2J8OA 3REVB 3DYOA 3BAEH 4L4JA 2OZ4L 2PYEB 3DHJA 3FUKA 2YAMA 1CT8A 5TF1H 3KJ6H 4DO4A 5D2NE 1AE6H 2YQBA 1AZZC 1BSIA 3EIFA 2Z1PA 5B1JC 3DX9A 2B7DT 5JOPD 4X80L 5JPNC 4L4VD 3V5KB 2BPBA 1PG7W 3KPPB 2NCMA 2L7JA 1MNUH 3AB0B 3UIYA 4PJ5D 5L88L 2PPAA 3EJPA 4X9HA 2XWBA 3P0YL 4RLDA 4BEIA 3CAFA 3E1ZA 2HJLA 3D0LB 4HF5H 3UTPD 3DVFA 3VJ6B 3P3UA 2KDGA 4Z23A 1F45A 5E1HB 1OPGL 1N10A 3IPFA 2NCEA 2BVOA 1RZGB 1SMOA 5EN2B 4P5MB 5F7MC 3QGVA 1D5XA 5HHNA 1TIUA 1OP3K 1Q1JL 4UOJA 4NQCE 2FEJA 2X88A 5ANHA 3TWCL 3X3GL 3VXOB 3TV8A 4BUQA 1BQLL 4J8RB 2P52A 2WB1A 5IWLC 4C55A 3GJFA 1T80A 5DDHA 3IMWA 4OF8A 5DU7A 4QHNB 5EO1B 4WWKA 1A25A 5JO5B 4F9LA 5H37G 3STZA 2NZ9D 1LWJA 5DJCA 3QG7L 4PMFA 2AS5M 2HLFD 3FYEB 2JI3A 1KYUA 3V0IA 1Z9OA 2CLZA 1GY2A 4FZ8L 5F1NA 4YL9A 5EO9A 2VLME 3HJ0A 4CVZB 5CHNB 1DQKA 4NZ8A 3ULVF 1LK2A 1QMUA 2FO8A 3HG0A 3UTQB 3ZU8A 1XMEB 1M4KA 5HDBF 1UWGL 5T33L 3L17A 5AW0B 3BJ91 1P69B 1FNFA 3MBEC 1A66A 1B0IA 3ZHLA 4HHWA 1A4AA 4AOFA 4FRWA 1G4RA 1IO4C 1BMGA 2QGCA 4JHZA 2OL3B 3T4YA 1QFUH 1GL4B 1X5MA 1WWWX 1MCLA 5J6HA 3F5WA 2WP3O 1SVCP 3GMQB 3LKSB 3N1PC 4HH9B 2Q2LA 1XH3A 3EYFA 3CDZA 4FYRA 4MAYD 3AU1A 3GLZA 5A43C 1GGBL 1E28B 1OSZB 2I24N 4HK3N 4UV7H 3QWRA 3ZDYE 5IB2A 3ZZLA 4U1IB 4LCIH 3CGTA 1DQJA 3GGWA 3BWZA 3SDDC 4P3CL 4XP1H 1G7LA 4AXWA 2ID5A 1T2JA 2R4RH 4S1RH 3LKQA 3W9EA 3WUZA 2F9BT 4S10A 4ZTPH 1JVLA 1E4WH 3IJEB 4ALAC 2AMUA 5FEBA 2V5SA 4JDVA 5L6YL 4MD5A 4P23B 3KPNB 2UXFA 1DQTA 1XR9B 3F7YA 2JJTC 4M6AA 5C07B 3G6JB 3W1ZA 3LJ3A 5KS9A 5HJDA 2C7FA 3GK8H 2ATKB 3L95A 4GLRH 2AK4A 4EUPA 2DBLL 3H42L 1XZWA 3IU3B 1BVKB 3SE4A 4ABWA 1N5YH 1EAQA 4GKNA 1G7QA 1O75A 4IHBA 3VXUA 4ZMWA 3WU1A 2A4ZA 3CUPB 1JF1A 2IGFL 2CK0H 1MVYA 5IVXE 2WJ7A 1NC4A 4F5CE 3KJ4C 3EFFB 4FFYL 1FI8C 2B5IB 2QPDB 2YD9A 2VXQL 5A2BA 2HG0A 1RU9L 1R17A 3E1F1 2FEEI 1XT5A 2WWMD 3S2AA 2DH3A 3OB8A 1V7NL 1F4HA 3HMXH 3C6LA 2E6PA 5D4HA 2XVKA 1KJMB 2PCPA 2VC2L 3KDMA 1BVLB 4G71B 2Q86B 1LO2L 1U3NA 1Z9NA 3E3QC 4ETQA 3QDHA 3LV3B 4JZOA 5F6IB 2Q7AA 3UPCA 4KRMB 3EH1A 1HYSD 4JO3L 3HAEB 5E9DE 4XNYL 1MH5B 4WHYG 4U0RC 2KPNA 5LGYA 3VNYA 3FB7A 3QJQB 3R0MA 1YEJL 4U3SA 4YBQD 5FYKL 1R5IB 2WBJD 3QNYB 3N41B 1FBIH 2YFNA 3CVHB 3DX6B 1TCRB 1JFHA 2J6EL 2VZTA 4PCKA 1HNYA 4GRMA 1BIHA 4F24A 2EDXA 1YEKH 5C8JB 5KWYC 1G7JB 1TQTA 2YGQA 3B1UA 3A23A 3WLWD 2RCSH 3OHXA 4ABVA 4RA0C 1KJ3H 1LM8V 3ZKSD 3LRLA 1BVNP 3ULUL 5B4MD 3MRHA 2YA0A 4M7KH 4XVTL 3U1SH 5BO0D 5F3FA 1N2RB 4K71B 4LU5H 4WNJA 4X0KB 4U7SA 4IS6A 1NGPL 3O6FA 5DLLA 4X9GA 1ID5I 1ZANH 3GDCA 3D2UA 1JXFA 3VRJB 1MRDH 4I5BB 2Z92A 5I8KL 4YGVA 3QORD 5C0CD 2GFBB 3KVQA 2P5EA 4W6XB 4DESA 4R4NC 2AEIT 1YJDC 3PGFH 4OQTA 4J6RH 3D39A 1J5OH 3NACH 1JTTA 2QADD 4J3OD 3PGDB 4ZRGA 4JRWA 1NQBA 2LLGA 1TEGA 2C3HA 5H4YA 4G59C 3N43F 1AY1H 1GYCA 3LKOA 2DQTH 3BDXA 2NMSA 4P57B 2DQDH 1J8HD 1JL8A 4UMSA 3B9KB 3WCYA 1PCSA 4PVLA 3F12A 4QHPA 1QKZH 4A37A 1MLCA 3OMZA 1WZMA 1Z9SB 4O51B 1DBKH 4FHBD 4A7TA 1Y0LA 3B2MA 1K4CB 3WXVL 2CR0A 2DI8A 4K7PX 1ES0A 2FSDA 4X6BA 3MUGB 3LEXA 3SDAB 1X5XA 1Z1WA 3FS9A 2DLTA 1WZ1L 5D1XA 2JJVA 3CN2A 4LEXL 1B4TA 3QXDB 4GKOA 5GS0L 5GRVL 3GTVA 1H3WM 1AR1D 2D7TH 1OM3H 3B2XA 4HS3B 4NHCL 1LVEA 3VFRB 4AUJA 3RWGB 2EDEA 3D05A 3RVUD 2GC4C 3RZCC 3VFVA 1C1EL 3Q9PA 3BRFA 3ULVE 3VGAC 2CRZA 1DBBL 1SVBA 4YLCA 2W59A 4AZUA 3TFBA 4XCNB 4LHUD 1IAII 4GY4A 5TK4A 3HN3A 3TURA 3VWJA 2BIOA 1RUKH 4FCAA 4R7LA 5F3HA 5B39A 1BZOA 2OMZB 3BVTA 3SZKC 5ES4B 1QFPA 1MWOA 1J5CA 4G43A 2BY1A 3S35X 3BPCA 4ADJA 5TE7L 2F54E 8CGTA 5A6IA 3RTQB 4LLVA 2UWEF 2ZWNA 1U8CA 1A6TB 4JQIA 4QOKE 4H40A 1YNLL 3T1FA 1MY7A 4N20A 5GS1A 4HG4J 4Z0XA 3NIFB 3D69B 1MUJB 5FUZH 3VU2A 4FABL 5C0FA 1J12A 3MRJB 3PG2A 4DQOL 5FOBB 2Y07L 1DEEA 1KIQB 1TTGA 1CXIA 3WGUB 4W9EC 4NRXB 1X5YA 2ARWA 2MRYA 3CSFA 3DURB 3L9EA 3LDBC 3Q2WA 4BM7A 3F6IA 1WT5C 2V2XA 3BKJL 1AQDB 2F19L 3QNXB 2VDLB 4XPGH 2VMCA 4YFEA 1FNGB 3NN8A 1V7MH 4UU9A 5HJGA 3PL6C 4JY4A 1JZ7A 4KK9C 3IFPA 3TYFB 3WEAA 4PRHA 3WHE1 4BDVB 2N3JA 5ESVB 3SO5A 3V6ZB 3PU7A 1H3VA 3SZ6A 4HOXA 1A4KA 2H6PB 3E6FA 4NN6B 3VI4B 2OA9A 2E6QA 3ISRA 4FNTA 1QI5A 2ADJB 4KKAD 4NQCD 2FE0A 2AGJL 3O2DL 2ZPKH 5IFJB 1U8JB 3BKMH 5L8JB 4MCYA 4FC3E 4TKWA 3FJTA 4FQCH 3EGDA 4MZ3A 4NWTL 1IX2A 2DQEL 4RRPM 4Q4IA 1RPUA 5A2FA 2X9ZA 3ZUCA 5DJ2A 5D6DA 1IC5L 4KJYA 5TE4H 1T66D 2AQQA 4N24A 4OZ4B 5EMYA 3VAEA 2K9UA 4NXKA 1YAZA 1ZV2A 4H44C 2B20A 3BISA 3RGVC 3KPRE 4OLXH 4L3CA 4U6XB 4FLQA 3S97C 1RUPL 2VLJE 3OXRB 5BQ7B 5L2KA 2XACC 3EGSA 4EDXA 5GGSB 3EDFA 1QQDB 2X6CA 2ZCLL 3OAZH 1YEDA 2Q3ZA 1JVOA 3LPWA 4TUKH 1T2QL 2CM5A 3ECUA 4ZFGH 3IFOA 3MRCA 4LSRL 2J1WA 2H32B 3ARFD 3TH4T 3VXMA 4TF4A 2CO6B 4PRIB 1S7VA 2E4FA 2WIIA 4DQAA 4FHJA 5DHYB 2B9AA 2W81C 3MRKA 1G5AA 4JFTA 3Q5TA 3FH7A 5I8OL 4K9EC 5CIPB 4AVIA 1FIGH 3R18A 2GBUA 4Q14A 3A4AA 1KGJA 4PJEE 5CJOH 5IQNA 1F18A 1A3LH 1A6UH 1VSCA 1AS8A 4XNQA 5ADPL 1F8TH 2D0HA 2VW4A 5IEKB 3L4TA 4Q6KA 3TBVA 3KCPA 4MNGB 4W9ZA 1CBVH 1BMWA 3P54A 1HI6B 3BMVA 5CD5C 3FQUA 4M7ZB 3RUGA 1A6ZB 4EDWL 5CFAA 7PCYA 2F1EA 3TBWA 3F65A 1INEH 1EJFA 1ZA6A 2XN9A 3ZHFA 2DL2A 3EYVB 3A0OA 4IMLA 1DFXA 1M3JA 4PJCB 1J1XL 2NW2A 4N2MA 1KTLA 4WO4A 2WMPA 3O9WA 5LXGH 2BWDA 3N9GH 4DK5A 3BE1L 2JI2A 3HE7A 2N7SA 4JL1A 2O6PA 2WKOF 3LN5A 3WLBA 4UT9H 2CDFB 1A6AA 5LAXB 4GKSB 4M5ZL 3ARDB 3FN0H 3QHFL 4JFXA 1ZLUH 2WTPA 4NQSA 2WLZA 4KVCL 3PABA 4TQEH 5IW3A 4EI5B 4KZDL 4WU7A 1BREA 1YEGH 4JHWH 1BPLB 3MV8E 4N2IA 4A2EA 3SY0B 3C09B 4BFNA 1U92A 1FLRH 3DLQR 2GJZB 4J12A 1FO0L 4PB0H 1S9YA 4NO3B 2NY3D 2JCCB 1E9PA 1QHOA 5F7WC 1FYTE 3ZQWA 1NFKA 1PBYA 1YA5A 4HXAH 3TN0C 5E8PA 3MLXL 3DPBB 4NQTA 3IF1A 5T1MA 3FT9A 4FFVC 3HHRB 2J1XA 3CXHJ 3L5WB 4MXVF 3SB3A 4ZUSB 3T8MA 4Q7DA 4JDTH 4TTDD 3ZT6A 5E9DD 1CG9A 2F8IA 1T22A 1CFNB 3FB5A 4XH2B 1KY6A 1FDLL 4Y1AE 3CCHA 4L37B 4QYAA 2B1AH 1UD2A 3OKNB 4MJ5A 3KWVA 3TP4A 3U7AA 2NY1B 1CE1H 3HZYA 3UFIA 4JR9L 4YHNA 2YC1A 4GBXA 4G1EA 3CFKB 4I8DA 2V5RA 1L6XA 5C09A 3VXTB 1W0WB 3K72A 1I3GL 4I0PD 4AUUA 5SX5H 3BAYA 4H0GA 1IGFH 3S36X 3NJGA 4N2FA 2YAOA 4W6WB 1HH6B 1M7IB 1SYSA 4XBGA 1AIFA 4PAZA 2WVUA 1XCQB 4G6KL 2UWEE 4F57H 2P5WA 5ALCH 3HZVB 4AW7A 2E75C 1DANU 1E9QB 1J1OL 4QF1B 2FIKA 2YS4A 4ELMB 3HE6C 4HX1B 1A7OL 3MODH 3BI9X 1NGQH 4QJ3B 3FOMB 1XB6A 1Z9PA 2HT2C 1NTDA 3FTGA 3KPSA 4LNVA 1XCTA 4YHPA 4ZODA 3EBGA 3TF7C 4KRLB 1KF9B 4ACPA 1QBLL 3AT0A 3DXAB 5AYUL 1UOKA 4WTXA 3S37H 5FKAA 2QT6A 3IMBA 3EYSH 2P24A 1MQKH 4DP7X 2R4SH 1G4MA 1X7TA 4UILL 1D2OA 4X98B 4YHIA 2VJ0A 5B8CA 2XJKA 2YEZB 5EZOH 3GSUA 5ELIA 1I3VA 2VXQA 4K7FB 3KWTA 1ZK9A 2QBWA 2R2EB 1KN4H 1SRDA 2XTJE 4YC2C 1HN1A 1CR9L 2XA8H 3L6FA 4JQXC 1K4DA 1JG9A 2D7MA 4HEME 5F9JB 4Z7WB 4OZIB 1J5HA 3EFDL 1CL7H 2KZBA 1I1FA 5TF1L 3D9AH 5D7LB 4ZW7A 4O9HL 2JKTM 5I76B 2OCCB 2G4GA 1NL0L 4QKTA 5JIPA 2JB5H 4N0UA 4OZGB 2DWXA 5D72L 5C0BB 3CK0H 3NCXA 1ZSHA 3RAJH 1Z0NA 5I75B 2VUYA 4PRBB 1HHJB 1ZEAH 4DZBA 4NO0D 2GSGA 1FZJA 4Z95L 2Q10A 5CM1A 3B34A 4AIXA 4E9LA 4P2OA 2Q7YB 4HF5L 2CNZA 2EKJA 1EAOA 4P4KC 2I9LB 2HT3D 1X7QA 1EO5A 1BXXA 2WLLA 3GBNH 2ZSWB 2EIJB 4FNUA 3QAZC 1V3JA 2YAQA 3UAJA 3ULVD 4ZFFA 4IKLA 4UTAH 3MRNB 4M93B 1EEYB 4I48A 3OMAB 3FZUD 4LPTA 1NFDB 2WZ0A 4RMWA 4F7PB 4YHMH 3PWNB 1NPNA 4AQEA 2IANE 3V4PA 5AAWA 3CFNA 1ZGLM 2C26A 2R2HA 3HW7A 2FJFA 2AJYL 2F54D 3MBWA 4NO5B 3AXIA 2EEFA 1ZSDB 2RJMA 4P49A 4NZUH 5L0QC 2DQJH 2L04A 3D6GA 1WZAA 4DZ8B 4QOKD 3SIKA 1UHVA 4LCWB 1CD0A 3FNKA 1A9EA 4XO9A 3ZGIA 3ZL4H 2PW1A 4Z7VA 1KJ2A 4JRXA 4ISVB 4TRPL 4X6DB 3ROOA 4NQDA 4OGAC 4P5TA 4RFEA 3NH7H 4R97B 1RPQA 5B3JF 4KHTL 3V0DA 4LPYA 5FYJL 3DOHA 5INDB 1UURA 1KIRB 1S9KC 3HRZC 3CLFL 4EZJA 2X2UA 5KVEL 1CTOA 4R4BA 2GY7B 2D31B 5CJQH 5JDSA 3OAWA 3GRWA 3WS3A 4HHAA 3OZLA 5FO7B 4K07A 1CUOA 1P84J 3BZ4B 3BAKA 4RDQF 1UJ3C 4UV7L 1AO7E 5CZXD 2NNRA 4LKCA 2CCVA 2J88L 4LCIL 1MZYA 4CMMA 5L2JB 5HHQA 1ID2A 3G3LA 4M7JH 5GGRB 5IEHA 2JNZA 3ENEA 4BCYA 2QHLA 4ZTPL 5IMOB 4BXVA 1K3IA 2ITCA 1KLFA 5FM8A 4B7IA 4BD4A 5T5NG 2NLJB 1AJ7H 1TNMA 2LU5A 2HJKA 2BK8A 2DMBA 5IMKB 3ZLQC 5CJXA 3IMVA 1JNNL 4OV6F 3MYJB 5CFHA 1E67A 1V3MA 4MXVE 3ROLB 1OAXL 3GM8A 2P5PA 1YEFH 3BD3A 3KPRD 1F3DJ 3WV0A 2WBKA 2VN3A 1KPVA 2VLJD 2R23B 1OHZA 1QPPA 2CA4A 2F58L 3ATEA 5DJ6B 3WS3B 5DD3L 4X6FB 2EC8A 4UM9D 3UJJH 3FXIC 5FCUL 1KPRA 1JSYA 4ZMNA 3QUYD 4K8RC 3ZDZB 3QR2A 2OZNA 4CVXB 1OZTG 4H88H 4KITB 4LL1A 1E50A 1E65A 1UADC 3HMXL 1NGYB 4KJPC 4Z18A 5I0YA 1HSBB 2E56A 4TXVB 4M7LT 5D7JD 3BDBA 5FIEA 2NPLX 5J8OA 4GW5B 4K9EL 5L4IA 4M6NH 5B1JA 2QSCH 1J18A 2ILLA 3VWKB 5JPNA 1L9QA 3SGEI 5D71H 5EEYA 1HL8A 3KLHC 4K3DH 4N9OB 1BJ8A 1X7SA 4NIKB 4X5WA 4CGTA 2HH0H 3PDOB 3LEYH 2YBGA 5B3SB 4FE9A 1FBIL 1FCCA 1QSEB 4NFDA 4RISL 2ED7A 4PPTA 3NA9L 4AG4H 1ZMYA 2AEQL 1YEKL 4I3SH 1RZJC 3O2DA 1AMYA 2RCSL 3LS4L 5DEZA 1KJ3L 3UPRA 4YIQB 3NJFA 1MHCA 1FIEA 2CPUA 2HFFB 2B39A 3LQAH 1NCAL 3R8BB 1MFBH 2BY3A 2JKWA 1ROCA 2VZOA 3DJTA 2AXWA 4Y19E 3U1SL 5IWLA 1OY3B 1XTMA 4NKDB 2O61B 3NSFA 4P3DB 3U0PA 2CKNA 4Y2NA 3MV8D 1R47A 1YMHB 3NK3A 3QWOB 2WLKA 4F7TB 2HMID 4XNMA 1CFTA 1TVBA 1ZANL 5CGYD 4W68A 5EC1A 1HE8A 1A2YA 1JZ6A 3HFFA 3NJIA 4G83A 1MZZA 1DUYB 5I5IA 3VQ2C 5D8JH 5BV7C 1D5ZA 2CHNA 2PXYD 3SGDH 3QFDA 4WZ9A 5I5JA 3NJMA 1FYTD 1GGUA 1I7RA 4WGVB 5EU3B 3WY1A 3PGFL 1UH4A 4J6RL 2IO5A 4JPSA 3NACL 5A1AA 1OTTC 3ETSA 1FAKT 5DUBA 5SWZB 5E8DH 3NJNA 2F5BH 1UZ8B 3QIBC 1MCDA 4GH7B 5E2WL 4JKNA 1N4XL 2P26A 2VDMB 3MBEA 5FUCE 2DQDL 1WAAF 2VTFA 4FGMA 2IAMD 1F90H 3QJOA 4FA6A 4YNYA 1QKZL 4D8OA 2YD2A 4WJKB 4Y7MA 1S46A 4Y1AD 5GSVA 2GITA 1RP8A 4M3HA 3O6LH 4G6MH 4UBDD 2BCMA 3LXAA 4QTIH 1RVFH 1CMOA 3CMOL 1TETH 5CWSB 2D7QA 4S1DC 2PWDA 2DJUA 1I8AA 4FTVA 1EEQA 3QC5X 1AGDA 1R33A 4K5OA 1KCUH 4KX8A 2YN3A 3L5XL 1MXGA 1QFOA 3SDDA 1TJGL 1A1MB 1OM3L 3ZRSA 1F41A 3W39A 5JQHC 5EZJA 5HVFB 3L3KA 1DVFC 2VITA 3QUXD 4XVOA 5EU6B 5MP6L 2A9MH 3FTSA 4WHDA 2BHZA 1GGTA 5DRXA 2AQPA 3CFQA 4RGNE 2VDRH 5CSBA 3HB3D 4FG4A 1FZKB 2FQDA 4ZO9A 4HK0A 1PLGH 5I6XC 3TYGH 1PD1A 2JJTA 2MH4A 4Y4KD 3V9CA 2CGZA 5BRQA 3DV4A 3SDCD 4CC4A 1H15A 2ENYA 2H2SD 3L45A 4DKEH 3LN9A 1RUKL 3G5XB 3F62A 5EEVA 3PIQA 1T0NB 2EXSA 5T1KB 3M88A 1WBZB 3MLRL 2BW4A 2PO6D 3KGSA 3VSUA 1ZT1A 1RK0A 5ANMA 2XTJD 1I3UA 1MCHA 4GO6B 2B3IA 4LCCA 2DAVA 3HS9A 3MCLH 3RA7H 4HS6A 1UB6A 1WBXB 3KPQB 3KYKH 4JZJA 4RQQA 5CLYA 4AGPA 5GGUB 4XI5D 1AIZA 5FUZL 3TFKD 1AZNA 1WFNA 3ESNA 4UQDA 1GC1H 3O3EA 2FH8A 1CLCA 5BQDA 3C09C 2VDQH 3RWCB 1DDHB 4X6CF 3NP4A 4JQVA 2PWFA 3PAVA 5KBDA 4UTBH 1NMCC 1WVZA 2VQ4A 4UQIM 4XPGL 5TQ0L 3OGCA 1D2PA 1KCRH 2JK5A 3MMEB 5D2LB 5KYUA 1QEXA 2XPZA 2NUTA 4X99B 1T4KA 2PLTA 5LQBH 4UF7C 3COOA 3BUYB 1NGWB 4LLYA 1ICTA 4R2GB 1V8HA 2V9TA 3O3BA 2ZKHH 5D1QC 1DO5A 5IR1B 1U2YA 2R0KL 4IRJD 4NPYA 3ATBA 2F53B 5KN5A 1X5KA 3POCA 4LDEB 1T7XA 2ZPKL 1A65A 3BKML 5D93B 2ADFH 3KM1A 1A6VH 2VXUL 5TPWL 4FQCL 4XNUH 1YN6B 4JFDE 2J56A 2EYTB 1JPST 2ZXQA 2QVMA 4U1KB 5C0DA 2IAND 2NYZA 2OSYA 2WYIA 3REWB 3MZTA 3UTTE 5TE4L 5T3XE 2EVGA 4JREC 3CHQA 1KCSL 4EO5A 4FZEH 3I9AA 4M1GH 4XCCL 3AREB 1IE5A 4UDUA 1NBYA 3ERXA 3BC9A 1G6RH 1NJ9A 4IIQC 1HQ4A 4Y4HA 4OI9A 3GMNA 4MX7B 4U6HB 3SKNB 4YSEA 4AT6B 2H2PD 4GP4B 1RHFA 1OP9A 5LGHL 4ZFGL 3TPUB 5T1DH 2C7UB 4OKDA 5JPMB 1FL6A 1OWRM 1IC4H 3U7YL 1BLNA 3ZVVA 1S7QA 2MWCA 1VKXA 3BVXA 4LL9A 4EJ1C 2UZXA 4WDIB 3V10A 2O4EA 4XN8A 1N59A 3FUMA 3KYNB 1FIGL 3T0EB 2BZCA 1TMQA 3QDGE 3JZ7A 5CJOL 4MS6A 1A3LL 3KYMB 1F8TL 1KB9K 4GAGH 4LLUB 4PJAF 4PCTA 4Z0BL 2VSMB 3N44F 3QI9C 3UGEA 1AO7D 4BXSV 1INQA 1MCJA 1FO0B 1NIAA 4OFIA 4UQ2B 1PIGA 3RPIB 4J1UB 4YQXL 3MV01 1EQWA 1R3JA 1IQWL 3MLZH 1INEL 3QEHA 3ZIYA 3NVQA 5BOZG 1JZ5A 2P48B 1U8QB 3VH8G 2ZOKB 1CDBA 1P5UB 1QVOB 2P43B 4LLDA 4CNIA 2JIXB 2R1XB 3NFPB 5DHVH 3DX7A 5TDPA 2E7BA 4ZFOL 4PWIA 2OMTB 3FUHA 3QUGA 1QRNB 4OTXH 2VWEC 2N1TE 4DP9X 4JRYE 3O6ML 1TOXA 4BA0A 1R46A 4NN5C 1TQUA 2XG5B 3FN0L 3OR6A 1RIUH 2G0KA 3FT2B 3MGTA 3QDJA 4ZUVA 1P53A 4Y2DD 5HGBA 5EV7A 1WAAE 3RL1A 5JXAL 1WISA 2Z7ZA 4ODXB 1FLRL 4NO2A 4DK6A 1LEGB 4G8EA 3ARYA 1OAYH 4PB0L 5E8NB 4NUMA 1PLBA 1M2VB 3UZQA 1FJ1A 2LR4A 1JHTA 1ZIAA 2AVFA 5FB8B 3RI5F 4HXAL 4I2XE 1XXFC 4P4RB 3H9SB 4M56A 3UC2A 1GS6X 4XP6L 1C5DB 1OGTA 2D7PA 3PWVA 2F7RA 4QRTB 3OLDA 2FWOA 4LBEB 5K39A 5FF6A 1G7MB 2LTQC 2J7LA 2ZWSA 4S0TD 4NGHL 1WT5A 4RZKA 4WRLA 2GTZA 5I8EB 1ILSA 2WXPA 5CSZB 5DZLA 1WHPA 1ONQA 4E68A 2DIEA 3DROA 4OM0H 4N2DA 2X3CA 1MN4A 4HFUL 3PL6A 4OZFB 3PP4L 2X38A 1D6EB 3TU6A 1MNNA 4MXWH 1TQBB 2ED8A 3MJ9L 2TRHA 1U33A 3QJTB 1U3HC 3SSGA 1U2HA 4ZFQA 3D2TA 4R97C 4D94A 3OKYA 3AY2A 4WNQB 4BE6A 3RKDC 2H1LM 4GSRA 3Q8CA 4GMSL 1RZJL 4GNKB 1J1PL 4A7UA 5AVSB 1A7RL 1XGYH 3PGCA 4TLSA 1DDTA 4Y19D 3N0PB 5EFIB 3N3EA 1BIIB 1MF2L 4R7VA 1SHWA 5K59F 5JHLL 2ALWA 4ANXA 3O8XB 2BNUB 3MODL 4GLRI 4LPVA 2K8MA 7TAAA 3JTSB 1Q94A 4LBAA 4J4PD 3QUZC 4PJ8B 1WRFA 2Q9OA 1S9VA 1RZKH 3RGVA 3KPLB 1RH8A 4N28A 1KCKA 2W9DL 3NCFB 4X6CE 1ZTXH 5GJSH 3S37L 3QCTH 5IB1A 3DUHA 1MQKL 1Q8MA 1DJYA 2R4SL 1DLFH 3TV3L 1EZLA 2DMHA 4AITA 5HYJA 1GJWA 2BRQA 4KH2A 1R24A 2FBOJ 3EGXB 5EZOL 4A2FA 1NC2B 4GG6E 3N1GC 1EZUA 2AQ3A 3CZFA 2K78A 5DMIL 3QG6A 1G7HB 2X0VA 4KROB 1P5VB 4R90L 3L9RA 1ASQA 5H35A 4WKXA 4JRFA 1CL7L 3PHAA 1BEYL 3W5MA 1RUAH 3D9AL 4JFFE 4LPXA 1ZA3B 1I7UA 2BP3A 1JK8A 1ZLEA 2OMYB 1GXEA 1T1XA 1T6VN 2JB5L 5EIIB 1WFUA 4IHOA 2DZEA 4FMVA 5KG9B 2FQFA 1KNOA 1SXAA 5BW7C 2DLEA 2DYPD 3P4NB 4FYTA 3SBPA 4EKJA 4ZYKB 4FQQB 3EOTL 4HGWB 5GGTA 2BHYA 2AQSA 4PJ9B 4U1GC 3VFGL 2W0PA 3MCYA 2V9RA 1BG1A 1KBKA 1LDSA 3L7EB 3T6VA 1GPOH 2PWGA 3QE5A 4YE4H 3AM8C 2ZUQC 3GIZL 1AD9A 4RGND 4XN5A 3MLYH 1N0LA 4AVJA 1DQMH 3MREA 4BQ9A 2OXGB 3PHSA 3D8MA 2Y6TE 4G7RB 2XWTB 2CK2A 4PW3A 4E0RA 1EFXD 3VX0A 1AXSA 2VDKH 3NZ8B 3UMNA 2Y6SC 1I1AC 4O2CB 2VGLM 4W6YB 4WUKL 1ZLSH 1HCFX 1VESA 3U6XA 5IB5B 4NKMA 4YHML 4W1TA 4NNYB 5HPMA 3L16A 4YSRA 1TU2B 5AL8A 3EDEA 1ASOA 3WKYA 3O2VH 1FG2B 4FI6A 5JLZB 3LKNB 1CFQB 4BFRA 1H0DB 3JWNG 2V8MA 4NZUL 2DQJL 4Q89A 2OMBA 1S9XA 5J1AA 3VVWA 5DJZA 1W72A 5KOMC 5ICZB 2HUHA 4F15B 3QEUA 1ZE3C 5AVTB 4NENB 3GSQB 2C3VA 4M8RA 4PJAE 3UAFA 1UZ6F 1WAEA 3TN0A 1RIHH 1QR1A 4XMWA 2WXLA 3VDBA 3DPDA 5AOMA 1DQVA 2ZUSA 1EHNA 1Q38A 3HG3A 4G7VH 5ITFA 3NH7L 4HWUA 1R5VA 1YUKB 5A7EA 4MJ6B 4QRPA 2J72A 2ZUYA 1MXDA 4APQD 4B96A 3GI8L 3K1DA 2Z31C 4JFEA 5HHPB 3MNWB 1F02I 4KXCA 2X87A 3B5TA 2Y06H 3N1FC 3WKPA 1RZ8A 4JVUA 4LPCA 4Z7OB 4N3TA 3UTQA 4NC1C 2FQEA 5AUMB 4PJFA 1D9KD 1UOVA 2K45A 1EWHA 2EIZA 3MA9L 3WEXB 5JR1H 1A7BA 3CBJB 4HP5A 3TEYA 3MYZA 3UDWC 2OSLB 2QSVA 3RY5A 3DTDA 2WVVA 3ARQA 1FORL 1U8IA 2W92A 3FQWB 3FT3B 5F8RC 5AEAA 2EDOA 3ARGC 3SE9H 2YD1A 1E3ZA 2L3BA 2E6JA 5CP3A 4JFDD 4K5LA 2ZP0T 5LO7A 5IM7B 1MJJB 1C5CH 2V2WB 3DGCR 3OV6A 3OTTA 3VDAA 1AJ7L 4O2EA 4NOBA 5T3XD 3HE6A 2XFGB 4NN7B 3UTTD 3CN0A 4MQ7B 2RACA 2OX5B 1QBAA 1LEKA 4ZJ9A 3FYIB 5HI5C 1YEFL 4B5EA 1P4IL 3MUZ1 2H9GB 4KKBD 3FTZA 3B5HA 2OYPA 1PGRB 1IAKA 2UXVA 3BIKB 4ZBJA 1YPZA 4HAFA 3RI5K 1LE5A 4L3EA 5DK2A 1MCEA 5SWSE 2B1OA 4TUOA 3UJJL 1Z3GL 1T6WA 3IDIB 4DGYH 4Z7UE 2X4QB 4HUMB 4JQXA 5JORA 2D03H 3SPVA 1JZ3A 4E42A 1QASA 2C9SA 1F1AA 3DI2B 1KACB 4GI9A 1JIBA 1H3TA 1SUJA 2WCGA 4R84A 1SXZA 3QDGD 3QRBA 1MCNA 2GPZA 4M6NL 4HKZA 4QRRE 3MA7A 2QSCL 4NBYB 1BJ1H 5CEZE 2BSED 5I6LA 5KYXB 1JV5A 2A6JB 3UYOD 3X1NA 4K3DL 4AW4A 2C9VA 2AXFA 1NBQA 1XSJA 3DETC 2HH0L 3I02B 3L7FA 4R7DA 4KQ4H 5K59E 3AITA 4N22A 2IVFC 1XX9C 3FQ4A 5EDXA 4A6YH 2CAKA 1KBVA 4HK3J 3WELA 1OD9A 2A9CA 3S2CA 4R4FH 5TDOA 2OW6A 4M48H 4NKOA 4P4KA 3WIHA 4AG4L 4AKOA 5FFLA 1OCRB 5E2VH 4D9LH 5CMAB 2GTWB 3DECA 2GYSA 1MEXH 3FRUA 4J3UA 4FFZL 3MHZA 1NDMB 5AL0A 2BOBA 4JRYD 3TEXA 4DEPC 1PYWA 4MB4A 1MFBL 1F4YL 2MPVA 1KIPA 1F3RB 1PKQE 2RB8A 1I3RA 4XCEA 2FX8H 5FV1L 3SD5A 3T8XB 4UAOB 3V0AC 5KSBB 3NSXA 3VQMA 4DVBA 4C54A 5B7FA 4GP8B 5C0NC 3TZVB 1U8NA 5I1EH 2XETA 3HG5A 3I2CH 3OC8A 5EO0A 4M8QB 2VZ3A 2WLIB 2WSKA 5JZ7D 4OSUH 3NDZE 4FXLA 4U6YA 3DUSB 2JCWA 1L6ZA 4PJ7B 2AERT 2H45A 3CLEH 4YPJA 1RL1A 3PWJA 1MCFA 2XV0A 3BP5A 4GQQA 2J43A 5IV2B 1SJEA 5MENB 2F5BL 4ZOBA 3K6OA 5FYLE 2ZOLA 3VA6A 2NRDA 2ESVB 3MQIA 3D33A 4JFOB 2ZNXA 1RZIB 3VH8B 3TIDB 1OP5K 4LEBA 3AREC 1I75A 2OV0A 4Q0XH 1F90L 3OQRA 2H3XC 4QCIB 3NABL 3HRZA 4E41E 5DMGC 3ZE1F 2UXTA 4NT6A 3N41F 3S4SA 3EF7A 2APFA 4NQUA 4X7TA 2EXWD 2Y3AA 4XPHL 3T2NL 3ULSA 3U4BH 1FGVH 2JTYA 1CYGA 1TETL 5DMKB 4J7RA 5JW5B 1UJ3A 5C0JB 3WTWA 4PWKA 1OOAA 5C08B 3PCYA 1XIWD 1KCUL 1H8SA 5F97E 5GGVY 4UV4H 5J06A 2X4PB 3BWSA 4JFZH 3JWOH 5T1LA 3M45A 1QX1A 1IKNC 1JWMB 1T04A 2WXRA 3IPBA 1MJ8H 2ZOOA 2VDRL 1KWGA 2B59A 2PYEE 1E27A 2I27N 3EYUH 3T65A 1BZ7B 4N8VG 3B9DA 3BQUD 1J9CT 2QEJA 1GSMA 1PLGL 1UZ6E 3TYGL 4PBXA 3OF6D 4OIIL 2QGEA 5ETUB 2Y24A 4KRPD 5F9OL 3HG2A 2YUWA 4PTUA 4LHUG 4AE0A 1DBJL 2DTSA 4A2MA 4G8GB 1P5UC 3C2AH 3JV6A 4Z3GA 4GAYA 3M6DA 4K3JL 1Q9KA 3GD1C 3TBYB 1MIEH 3I9GH 4IW4C 1GMIA 2WWOA 1MW3A 4O02L 4ODHH 5EUKA 3ZSTA 5IG7B 5IQ7L 4JAMA 1YNKH 3KYKL 3IJHA 4L29B 4I9WE 4KAQL 1KLUB 1UG9A 4PV8A 4QY8A 4AMWA 4LP4A 5KS9F 3JBG7 5IK3B 4A7SA 1KYFA 1JDDA 4XR8C 3MRQA 1VEPA 4JFFD 1GC1L 2R1WB 5FWQA 3MRFB 3E6HB 3KMDA 1ND0B 3MV7A 2BS9A 2VDQL 4MA3B 3VFWB 3UTZB 1I4FA 5HGGS 5IHLB 2QV2A 2AJUL 4K7PL 4JCMA 4NFBA 2ZICA 2F5AH 2QQQA 2H5UA 3W37A 1KCRL 2F08A 2Z3FA 3MJ9A 4MFHA 1GKEA 4I18C 4EN3D 5BVPL 3GC3A 4XMVA 3T3PF 3GSVB 1XB3A 3MJ8A 3TPKA 1U6AL 3VFTB 2O6EA 2ZX5A 2GIXA 3SCMB 3P69A 3ZT5A 4Y7OC 3LPGA 1OE1A 1U8KA 3HZMA 2V37A 2VL5B 3E2HB 4RRPA 4YDZA 3MN8A 1JERA 2A4CA 2NR6C 2ADFL 1TTFA 4MNQA 4DP6X 3KLQA 4QRUA 4XNUL 1AD0B 2RFXB 1KY7A 1TQBC 4QO1B 4F3FB 4FA8A 1PL3A 2CWRA 5E9AA 1JF5A 2HFGH 3MCKA 5JHLA 4ETYA 2DQIL 4K3HA 3BGFB 2CHZA 3TWYA 3PY9A 1KEGH 1HEHC 4LSTH 2XPGA 3FFCE 4LIQH 1GTNA 4FZEL 4D9QE 4JPQA 3S35L 3SKMA 4MAUH 1BWMA 1ZHNA 3QJHA 2FCBA 3NIFF 2BNQA 5FAAA 4IOIA 3HC4H 1TQWA 4GSUA 1FV1B 4WW2C 3PREA 2HA1A 3QIBA 1QLRB 3QQ3A 4PJ5B 5T1DL 1FVEA 4GG8B 3I50H 4ZFOB 4A1RA 4I89A 2QZQA 3MUJA 3GO1H 1ZHKB 2B15A 4U1LB 1CL7I 4MA7H 2D73A 3IEAA 1T20A 2X4UA 1ZHBB 2CLVB 2E9WA 1FZOB 3MJGX 4G6JH 4KO7A 4OLVH 5C07E 4TL4A 2AJSL 1E2ZA 3ILDA 1FL5A 4CN4A 1SOXA 3AFLA 3VI4F 5I2IA 2MMXA 1PZAA 3AXLA 1CURA 3TIEB 5F70A 4DSYA 1HTYA 2KT6A 2XRAH 3KZ8A 3CVDA 2GT9A 1SBSH 2OI9C 1YYLH 2XIBA 1ZK5A 3ILPA 4R3SB 3L3DB 2FB4H 3GSRB 1C5BL 3LZFH 2K4AA 4W4OC 1F11A 1FP5A 1QUPA 2WOYA 1DVFA 5JA8B 3WFZA 2CIIA 2HJFB 5D5MA 2WO3B 1G7PB 5CP7B 2A6DB 4KDTC 3HZKB 3D25B 3S3JA 4Y9FA 5KBLA 1INDH 4MNGA 3WXWH 1JHLH 4BA8A 4NQVB 2KLTA 4LE8A 5DLMH 4FQLL 3MR9B 1CXHA 3N50A 2F7IA 1Z9LA 1A6ZA 1ECYA 1RIUL 3DJSA 1AGBB 2ZOTA 4HLJA 4N1HB 1EHAA 4FDWA 4K2UH 2GJ6A 2R2CA 5F2FA 1BZQK 5BXFA 1SJHB 5SWSD 1QEWA 2CGRH 5DMJB 3B2UD 4ELDA 3P73A 3HJEA 2IPTL 2WLMA 3GJFK 3VGHA 3K1KC 2EZ0C 4DWHA 5FHAH 3B4NA 4H5SA 4OF6A 4AYFB 3NCCB 5I15H 2DQFB 2DQHH 1ACYL 4FG2A 4ODUA 4QRRD 3KPMB 3ECVA 3NCWA 1EAJA 5CEZD 4U3CA 4XWOD 5CF3A 2AF2A 4OM0L 1NSNH 4LVNB 5B1BB 1T5WB 1CE6B 2BWQA 4MXWL 1IGCH 4X7EC 2VQUA 2YAHA 3U1PA 1IBGH 4L8SC 1P7QB 1KN2H 4Y2LA 3BZDA 1NBZA 4DGIL 4JFSA 1OHQA 3IMTA 5BS0B 4OGQC 4R5VA 2VMDA 2VM4A 4OCSH 5D1QA 3MRGA 4DKFH 3IRZA 5ESAA 1Q4NX 4JPIB 3B5GA 2BVTA 2NY2C 1WICA 3J7HA 4ZUTB 4DGVH 1E5CA 3RTLA 2F74B 2P1YA 5DI8B 1IZJA 1S5HB 4HUUB 1GS8A 2DWTA 2GI0A 2EH8L 4L9LB 1FNEB 2EDKA 3DVGA 5DK0A 3A4DA 1F00I 1W0WA 4JM2C 1HSAA 5CUSH 1GGIL 3OKEB 5KJ4A 4ES8A 4DH2A 2LU7A 4CJ0A 2JCCF 2FHBA 4OLWL 1A1NB 2ICEA 3TCTA 4DPBX 5I1AB 4BGDA 1RZKL 4N5UA 5SWQA 1ZTXL 2EYSB 4FL4C 5DJXB 4IIQA 4BH7A 5I66A 1L5GA 1DLFL 5T3XH 1YY8B 3PJSA 3MFFB 4CSTA 2APWA 2D7OA 3TO4B 3S8FB 1O9WA 2AITA 4UNTA 3EOAB 5FYLD 3ZSSA 3WJMA 4H1LH 5CN1A 1YEWA 1BFVH 2V33A 1HE7A 2VN5A 4OLUL 3T3PE 1AXTH 4R6UA 4RAHA 2DQMA 3FFDA 4R7NA 4GS7B 4D9RE 4K5MA 1WGVA 1ZIBA 5T3ZH 4E41D 1BGXL 1HZHL 2H0EA 3QPKA 4K55A 2EC9T 3VI3B 4TLTA 2W91A 3T4AC 1BQSA 2XYBA 5JHDB 4PV1C 2P7TB 4HJ1A 5DD6A 3QS2A 5EWIH 3NCJH 4FLOA 2APVA 4UT6L 1MCKA 6TAAA 4RESB 1K8DA 3QI9A 4GUPA 1DQQB 2HG5A 3MX0B 2RAMA 1IIKA 3NJVA 2C34A 1UM5H 2X09A 1EGJL 5E23A 5IMMB 2EDNA 4XVUD 4U05A 3RDTC 2WD0A 3GM0A 3Q05A 5DZOA 5E0FA 5C86A 3S36L 2YR3A 4HAGA 4NLAA 4ANKA 3GTTA 4MJIA 1ANUA 1GPOL 4OZHB 3SDYH 1QW9A 3CXDH 3MLYL 3NIFE 1B6UA 1DQML 2PYED 4FFZA 4GIOA 4K4KA 3VW3H 4HKXA 3OKOA 3LH9A 2H0FA 1KIUB 2UY7B 1AH1A 2WLHA 2IBBA 4ZW6A 3GFUA 4BK5C 1XGRA 2QADB 1JCKA 2WTOA 1IFRA 2DY2A 1NCDH 3BN9C 3W0WB 5DYOB 1ZGLA 1XEUA 2OQJB 1ZLSL 3RUGF 4NEHB 1R5WA 3O2WL 4KI1A 3VFUA 4B9PA 4R7XA 3O2VL 2VSKB 1V55B 4QPEA 3W9DB 1UXLA 5C9JB 3ESUF 4GRLC 4M61A 2A0LC 4OJAA 1BOYA 5C6WH 1HOCB 1M3IA 3SGDI 5I1JL 3TF4A 3FU5A 2P5EE 4LVHB 1QOKA 2PF6A 1S7WB 1E43A 4WWID 3VI4E 1JHKL 4I9WD 1QI4A 3L54A 3O45A 1BV8A 1RJLB 3UOAB 1RIHL 3ZKND 3IDXH 4H8WH 1NLDH 4WGWB 4PJBA 4UAOC 4OZGF 4RIRB 3QXUA 4W9JC 3VFSB 2QVKA 4JFYB 2NNAB 3FONA 2QVTA 1PZUB 3RQ3A 3IAPA 1HHIA 2VDOH 1IM9D 1IT9H 5E2TL 4N8VB 3RFZC 4HWNA 2YXFA 5D70H 1ODUA 1AQMA 1S7SA 2O5NA 2QMKA 5DEJA 1SN2A 3UEQA 1NOFA 4IDJL 1U3HA 2Y9RT 1VDGA 1HNFA 4ZS6C 5IREA 5D1XE 5JQIB 5FO2A 5JR1L 4HUWB 1WCQA 1G0XA 3EFOB 4N5EC 4ZQKB 5E56A 4TVPL 4OF7A 3LZPA 3PE9A 4ZAKB 4ZO8A 4TQHA 2KS0A 4WJ5B 2MPAH 2XI9A 2KI6A 2BP0B 4PLJC 1I9JL 4PRIE 5DD0H 5DFTA 1JK9B 3FFOA 4XXDA 1A6WH 3FQYA 3ORJA 5HI3C 4X4MA 1NBVL 3FRPB 4EE2A 3FFCD 2DJMA 4L1SA 3BP4A 1N9PA 1XF5A 4JGUA 5FGCB 4D9QD 1HKLH 3QUZA 5D2NB 5E6SB 2X3BA 4N0FA 4QXVA 1IBHA 2E27H 3FQ1A 4BK4A 3D52A 3OM3B 4S2SB 4X6DF 4TUJA 5DHEA 4ZMVA 1NM4A 5E6UB 1AVAA 3P77B 5KBMA 5IB4A 3CFJA 3QXAB 3LD8B 4OUUB 4O02A 3WY4A 1J8KA 3BT0A 3JWDC 4UZSA 5J6GA 4OFKA 1KBBA 1AGCA 5MERA 4ONHA 2X6AA 3PDGA 5B1CA 1JZGA 1T0MB 2EDMA 2D03L 2XIDA 3C75A 2L7QA 4ELKA 3PWLB 5AKTA 4P23D 1YN7B 4C56B 3HG1A 3HS8A 5C07D 1PS3A 2YMOA 2AQ2A 2XKNA 3FO1A 1I1YB 1WGOA 2OR8A 4M62H 5C7ZA 4I1NB 2W65A 1WK0A 2HVJB 2JKLA 3BSZH 4BZ1H 4L2LA 2Q87A 3AVEA 1WWAX 3L2LA 5BW7A 1G9MH 4PYHA 2YGOA 3BWAA 1YY9C 2VUKA 3DHPA 1I7ZB 2YEQA 5DZ9A 2BNRA 4H0HB 3GBEA 4R4FL 2JCCE 4A67A 4H8UA 2LVEA 1YQ2A 3AM8A 4D9LL 1FZMB 1LD9A 1LMIA 3WL9A 4RX4A 1JNHB 2ORBH 1MEXL 4PGDB 2ICWI 1JAEA 1E8XA 3RB7A 1XXDC 1YNTB 3CBRA 2WANA 3RVWC 4XGZB 2XYCA 1WE5A 1JOIA 4QWWD 3O4LA 5ICXB 1I1AA 3EO1B 3N5AA 3BVVA 3EKCA 5DJYA 2P45B 5DQ9B 1WFMA 3V0WL 1J0KA 3MRIA 4YSPA 3AC0A 1WCBA 1OB1B