2OV0A

Structure of the blue copper protein amicyanin to 0.75 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh resolution studies of amicyanin
rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ov0A00
5B7FA 2CBPA 2JKWA 2BZCA 1JZIA 6PAZA 5PAZA 4KO5A 1L9SA 1OV8A 1PF3A 2YXVA 1PCSA 3NJNA 3DTUB 1WA0X 2FQEA 3NSCA 2Q9OA 1JZHA 2GSMB 1J9SA 4KOBA 1CC3A 2P80D 1ASOA 5I28A 2QPDB 1WAEA 1BQKA 1L9OA 1WA1X 3CG8A 3QJUB 1V55B 4BDVA 1OCCB 1XB6A 5EHFA 2TSBA 1IBYA 1OOWA 1A4BA 1WS7A 5E9NA 4HZ1A 2P80A 1PLAA 4E9YA 1R1CA 3TBCA 2VSMB 2IAAC 3UAAA 1AS6A 2CALA 4KNSA 1GYCA 5LDUA 4A2HA 1A65A 1NDTA 2H5UA 1PZCA 2H3XC 3AG3B 2OV0A 1SFDA 1OE3A 1JZGA 5B1KA 2CAKA 1BQRA 2I7SA 3ZDWA 2TSAA 2IH9A 2BW5A 2GC4C 6PCYA 5B1AB 2GI0A 4FA7B 2FJSA 2IDTA 3SBPA 3UAEA 5B1JC 2QT6A 2YAHA 1TKWA 2VW6A 2DY2A 3FYEB 1GS7A 2VM3A 2JFCA 1IUZA 3TBBA 3N2JA 2PCFA 4PCYA 2EIJB 1NICA 2HXAA 3NSDA 4YSOA 3JT2A 3FSVA 4MFHA 4YSAA 4YSRA 1NIAA 1CYXA 4YSEA 5I5IA 4BXSV 1DYZA 3ZIYA 1SDDB 3QQXA 3X1FA 4AKPA 4GY4A 4RH4A 4DP9X 2EILB 2I7OA 3NP4A 2EINB 3ABLB 4CSPA 1AZNA 3CVCA 2BW4A 3X1EA 3UADA 1PZBA 5I6KA 3NSFA 1RZPA 2XXFA 2HX9A 1ET8A 1JXFA 1QHQA 3T71A 2YAMA 3EHBB 1M57B 2X88A 2NRDA 4N8UA 4A2EA 2ZWNA 4HCIA 3RYMA 4G72B 1E5ZA 4K9JA 4NB7A 5IY5B 1NWOA 5I6NA 2UXFA 5B1JA 1RZQA 2XLLA 1JZJA 4A2FA 5FC9A 4KO9A 4YSPA 2BP0B 4E9TA 3V9EA 2XXGA 2VSKB 1AS7A 3H4HA 1E30A 1CYWA 3DIVA 4E9VA 2EIMB 4GYBA 4KOCA 1MZYA 4W1TA 1IC0A 2UXTA 5I6OA 3FQ2A 2XV3A 3FSAA 3TASA 2DWSA 4N4YB 2IWEA 4A68A 1MZZA 3EH3B 2W88A 3QJVB 3CVBA 2UXVA 1KBWA 3FQYA 2PCYA 1JOIA 2AFNA 1ZIBA 4HCFA 1GSKA 2PP8A 2X87A 2WO2B 3MBWB 3NJJA 4G70B 4JKNA 1BEXA 5I26A 1JZFA 1EHKB 2GB2A 1ASQA 3ABGA 3WNIA 1GS6X 1AR1B 1IKOP 2UX6A 2VW7A 1TEGA 3PXLA 4E9RA 5ANHA 5PCYA 3IN2A 5D4HA 3NSYA 1SNRA 1QLEB 2FT7A 1ET5A 1XB8A 3TA4D 3FPXA 3FU7B 1NIBA 1NIEA 4KNTA 2J56A 3WIAA 4E9SA 3T6WA 1L9TA 2YAEA 2DV6A 1BYPA 2UXGA 1ADWA 3U25A 4YSCA 4NERA 1JERA 1AIZA 3ZX1A 3CVDA 3NT0A 3TU6A 5AZUA 4GP8B 1AQ8A 3CDZB 2FTAA 3IBOA 3X1NA 4BWWA 5TK2A 3FSZA 2AANA 3EH4B 2MRYA 3IN0A 4PAZA 2Q5BA 4F2FA 2HRGA 3ASOB 1WA2X 1OCZB 4YVNA 4HHGA 2PPEA 3UACA 3ABKB 3S3DB 1AG0A 2VMJA 1FA4A 3CDZA 1YLBB 2GIMA 2FQFA 1J5CA 2PPAA 2IWFA 2UX7A 4UF7C 3H4FA 2Y69B 4E9WA 2PPDA 2YAQA 5B3SB 4EF3A 1ET7A 1PLCA 2QPEB 2XV0A 3S3CB 2BZ7A 3KW8A 5I5MA 3OM3B 2VM4A 3SQRA 1JVOA 2H47C 3OMNB 4BWUA 4DP4X 4BWTA 3QJSB 1AANA 2AZAA 3FU7A 4WTQA 2HLEB 1I53A 2XX0A 4ZK8A 3AZUA 2PPCA 1MG2C 1MG3C 3KW7A 1A4AA 5F7BA 2IDSA 3NJIA 4UAHA 1NIDA 2ZOOA 2GC7C 3QJQB 4P5SA 1PNCA 1URIA 1RKRA 2GHZA 3BQVA 2J57A 5A7EA 3GDCA 4UANA 4GP5B 1OCRB 3GXUB 4AZUA 1RCYA 3OD3A 2YAPA 3ASNB 1AS8A 2PPFA 1BAWA 1ILSA 1SJMA 2XU9A 3UGEA 9PCYA 3T6VA 3WG7B 2VN3A 1NIFA 1OE2A 1E5YA 3JTBA 1XB3A 4M4RB 2AVFA 4AI7A 4JHVA 2MTAA 1W8EA 4DPAX 3DKHA 3EH5B 3NJFA 2R7EA 1KDIA 4W9ZA 3NJLA 3PLYA 1SFHA 2HZHA 4F7KA 3QPKA 5AKRA 4G7RB 2XUWA 3ERXA 1TU2A 1PAZA 3AG1B 4YVUA 2FNWA 3T6XA 3BVDB 4G7QB 8PAZA 4JHUA 1B3IA 3PCYA 1GW0A 4KO6A 4CSZA 1BXUA 3IEAA 2GBAA 3WKPA 4HHWA 1ETJA 1CUOA 1J9RA 2I85A 1X9RA 2WSDA 1KGYE 4AX3A 1ZV2A 1J9TA 5AFAA 3S8GB 2FWLB 5B7MA 2XV2A 5I5JA 3N55A 1F56A 2VW4A 2IDFA 3QJTB 4G7SB 4YSTA 4Q8BA 2N0MA 1AOZA 2OJ1A 1L9PA 4BK5C 1SF5A 1GY1A 1NPNA 1NPJA 1PLBA 1WS8A 5I6LA 1OE1A 3PPSA 4FAAB 3C75A 1ZDSA 4YSDA 4F2EA 2BP8A 3NP3A 3NYKA 2B08A 3NJGA 3OMAB 3D12B 3EF4A 3HEIB 4WKXA 2AZUA 1ASPA 1E65A 4DPCX 4YSQA 2IDUA 7PAZA 2PP7A 2IDQA 2YAFA 2Y1AA 2XYBA 2BWDA 1N68A 3GYRA 2CUAA 2DYSB 2A3TA 1M56B 3FS9A 4HCGA 4QKTA 2XX1A 2ZXWB 3HB3B 7PCYA 2BWIA 5D4IA 1KCWA 3G5WA 4KO7A 3QJRB 2XVBA 2BO0A 3FU9A 4A2GA 1HAWA 4DPBX 4G71B 1GR7A 2YXWA 2FT8A 1IBZA 3H56A 1A3ZA 3NJKA 3V9CA 3PAVA 1V10A 2FQGA 2W8CA 3FSWA 3T6ZA 4AKQA 3FQ1A 1AACA 2FQDA 2WO3B 4M3HA 2BP0A 3OMIB 1GY2A 1A8ZA 4DP0X 1JVLA 3AY2A 4E9XA 4AKOA 4A66A 1A4CA 2OCCB 1L9RA 3ABMB 1GS8A 3S8FB 1MDAA 2HX7A 1DZ0A 4BDVB 4KNUA 2CJ3A 1NINA 4DP5X 1SHXA 3IE9A 2IWKA 5B7EA 2HX8A 4A67A 1J5DA 1JZEA 3WNJA 3FYIB 4DP8X 3NJHA 2J5WA 4DP1X 2JXMA 2YAOA 1FFTB 4A2DA 1NZRA 1OCOB 4YSSA 4TXVB 1J9QA 1VLXA 3MX0B 1ZPUA 3X1BA 2HRHA 2IH8A 3FT0A 1V54B 1KBVA 2QDWA 1PNDA 3FPYA 4HALA 2RACA 2BP8B 2PLTA 2FT6A 2ZONA 1SDDA 1ZIAA 2EIKB 3UABA 3OQRA 1TEFA 5B1BB 3L45A 4YSUA 1JXDA 1M9WA 1KYAA 5I6MA 1AZUA 1AZRA 1PMYA 4YL4A 1EZLA 2BHFA 3X1GA 3FU8A 2LLNA 2QDVA 1ILUA 1FWXA 5D4JA 5F7AA 1ID2A 4L0PB 4E9QA 3SBQA 4GXFA 1NWPA 4NAJA 1BXVA 1N70A 2E86A 1OF0A 4HIPA 1HFUA 3NJMA 1KDJA 2CCWA 1UATA 3T9WA 4QLWA 1HAUA 1AG6A 1PY0A 1SHWA 1QNIA 1W6LA 2B3IA 2J55A 1ZDQA 2R7EB 1CURA 1JXGA 1E67A 1T5KA 4GP4B 4DP2X 3S3BB 2DWTA 3AG2B 4BXVA 3PAUA 1PZAA 4Q89A 1KCBA 1BXAA 2YARA 1AZCA 3SBRA 3AG4B 1NTDA 3WI9A 3ZBMA 1SF3A 1W6WA 4ENZA 1KV7A 1AZBA 3PAZA 4HAKA 1AAJA 1L9QA 1XMEB 3X2QB 2PP9A 2YQBA 4X4KA 5TK4A 3WKQA 4DP6X 1X9UA 3AW5A 3CZUB 4P5RA 5I6PA 4DP7X 2DYRB 2XWZA 1BQ5A 1BYOA
chains in the Genus database with same CATH superfamily
1MCHA 1LXMA 2QQQA 4UM8B 5CN1A 1NH6A 4NRZA 4ZXBD 2BZCA 1YSOA 1Z9LA 2A7BA 5DC0A 2N7AA 3US0A 3ZL4L 5F96H 1M05B 1JN6B 3NJNA 2XN9D 3KAAA 1ZGLP 8CGTA 4EKXA 4JLRB 4RISH 5C08E 1YY9D 3UGXA 3QXVA 2P80D 3WLWC 4HISA 3POCA 3GT6A 4I48A 4PJBE 1YQVL 1G1YA 1XZ0B 3L3JB 3WY3A 2DQUL 3QWRD 3V4UH 1HCZA 4LSTH 2QLVB 4MMZC 5D4QA 5I1AA 4JL2A 4U1NB 1EUTA 2ZUQB 3HNTL 1AHWB 4XNYH 3LH2H 3ZZQA 5JLZB 1X6NA 2D0GA 1XB6A 2ADFH 4LCCA 4AEEA 5E9DA 1SBBA 4LNRA 1QQDB 3QJFA 4L4VE 1OT2A 5FA4B 1P7QA 3LN4B 5JMRA 4LO9A 3ZKQD 1RK1A 1GYCA 3LZOA 1KXVC 3PGDB 5DQJA 3VXUB 3TYFB 1ND0A 3K91A 1TNMA 1BFSA 3HC2A 1IZKA 1UGKA 2OV0A 4H88L 5K1JA 1E6OL 1UWXK 5F1KC 3CHOA 5D96C 5B39A 3D25A 3Q5YA 3D34A 1LEGA 4B7IA 3CFDA 4F5CE 4GUQA 2FJSA 1X7TA 1JZ8A 3ECBA 5I0XA 4WUKL 4QF1A 1SN2A 1QWNA 1FZKA 3Q01A 3HS9A 2GAZB 2WNWA 2EIJB 4AQEB 1NICA 1Q9LA 3SQOH 2R1WB 4JJ5A 4N0FB 5F2FA 3CXFA 1QRND 3SCMD 2RFXB 2AC0A 3N85H 1XEUA 5IHWA 1QHOA 4HJJH 1AD0B 1KIRA 3NIDE 3QH3A 5DT1H 4XP4H 1QFOA 3MRJB 5JHAA 4KDTC 4BSVB 1IKFL 1WFUA 3DSNB 2CNYA 4AEIL 3C8KB 3IWVA 5DZVA 4QTIL 4OGQC 5D7JC 4JG9A 5DGRA 3ETTA 2GPZA 4F7MA 3I74A 1EJ6A 1OF2A 3EZJB 3UROR 1T03L 2ZG2A 4YDIH 4HKBB 2J4WH 5LG1A 1HH6A 3UBGA 1U8HA 1IIIA 4Z7WF 4PJEB 1JGUL 3X3FL 1F2QA 3ASWA 4AH2B 4UILH 1O7DC 1TZHA 3V55A 1J1PL 4X6DE 2WB1A 3ARPA 2H1LM 4L4TE 1IAOA 3P73B 1G1OA 5IMOB 3RWEA 4NZ8A 2APSA 4BQBA 1T21B 2A77L 3FTXA 3KPNA 1N2RA 3NJVA 1VGKB 3CHQA 4XVSH 1NKOA 2MQCA 3HMXH 4Z76A 2QFPA 1MCDA 1IKNC 2HKHH 1KT2B 3FUMA 2RQ8A 5AG8A 1JZ4A 4Z7UB 2ZCLH 5CEZD 4E2OA 2X10A 1BW8A 4YIQA 5ETUA 3CVBA 3B2UC 4NFBA 4W4OA 2R4SL 4WUUA 1UD5A 4NZFA 2VDKB 3DI2B 1LWJA 2P5WA 3UTPE 2P49B 3I3DA 1E5CA 1GH7A 1IFRA 1KCSH 3MRNA 3NCEB 3QHFH 1OGTB 4PB9L 3EBGA 3GUTA 4LPCA 3MLUL 1QLEB 5EUOA 1XIWC 3WN5A 5JZ7D 4OTXH 3W81A 2DYPB 2HFTA 4F15C 3BZEA 2HJKB 4POUB 5FUCE 2CPCA 1NCBH 5HI4D 2OAAA 1E4JA 2WPGA 4HXAL 4B27A 2E74C 2UXGA 5HYQA 2X4PB 4MAYA 1CD9B 1G9HA 1ZOXA 4IU3B 5FO7A 3ZTDC 1T1XA 4POZC 4IIQB 4UDUA 4YLBA 1HHIA 5CU9A 1SEQH 3VFWA 4K7FA 3IJHB 2FTAA 1NBCA 3RKDC 3TEZA 2KPWA 3VGAB 1U3JA 4BGDA 5DUML 3BHBB 5E8DH 4MMXA 1PDKA 4Y1AB 3KMDA 3P11H 4GSDL 3TFKD 2VDNB 1BM7A 2NY2D 3CBKB 4K5OA 5GGTA 5FFLA 2PPEA 5KBDA 4ZO9A 4OY9A 1XGRB 1XHHA 1ZEAH 3EJTA 3OKOB 3IJHA 4FULA 2MOQA 4X4YB 3CIAA 3EYVB 4OFYD 1E2ZA 1RVFH 3BC9A 1TU2B 5E1AA 3BAIA 2JJTC 4QTFA 2N59A 2X4PA 3VVWA 3FOLA 5TE4H 1Q0XH 5I19H 2ROXA 3U9PH 4DW2L 1T3FB 3UP1A 1FCGA 2Z91A 1U8IA 4AE1A 5BJTA 4BWUA 5FYJE 2WUCH 1KTRL 1IBGH 3VXRD 1E4XI 4JFYA 2ETWA 5T33H 4JFDA 3IJSB 4BZ1L 2OMYA 2WWKO 4K23L 3WN5B 5ANMA 1A4AA 5AZ2H 3HUJE 4PGCA 3RY6C 5C1MB 5K9KA 2YA1A 1TF4A 5EU7C 3U7AA 3WEXA 2ZOOA 3IS0X 3F7VA 4KKCD 5BZWB 1XSIA 3M7FB 3U6RA 2DLFL 4G11A 2P5WB 4BQCA 2YRLA 4ALAH 2XBZA 3FQTB 1QX1A 3MOBH 4QHUB 4KKAD 3E38A 3OMZA 3Q0HA 5GHWH 4PY7A 3SO3B 1GYVA 3MRQB 1P4LA 3VXSB 1FH5L 4M7LH 2R9HC 1YYML 3OG6B 3RNKA 1XB3A 3LPFA 3ZYZA 5LLIC 2JJVA 3EBAA 1KB5L 3GGWA 4MAYD 4DQAA 1WT5A 4ELKA 3H7BA 3WLWD 3HR5A 4OLZL 1TJMA 1JPGB 1TEYA 2EVFA 2ERJC 4ZUVA 1KWGA 1QFWH 1D5MA 3GXTA 3AG1B 4JO3H 3CSYB 3IJ7A 3Q6FA 5F7WC 4J3WA 4GEJA 4L8CA 5AOIA 2A4EA 1CTOA 3UOAB 3TWCH 1E5UI 2QGBA 2VN7A 2C34A 1J8RA 1OF2B 2I9LA 3QIWB 4ADJA 2ZCKL 3DOSB 3CLFL 2HJFB 4GKZB 2HKAA 5FYLL 4RMRA 1C8PA 2ZCLL 3DX8A 1JUFB 5EC1B 3WTVA 4NP4L 5FUOH 1NMAH 1VESA 1D5XA 2E6JA 3H3KA 4PGBA 2BP8A 1H5BA 2ZAIA 3K74B 4D9QE 3OMAB 2D7TH 4Y19E 1OPOA 2EE2A 3D9AH 4JZOA 4PW9A 2GAZA 2DQTL 1I8AA 4Y8DC 4DEWA 4H8QA 3SD2A 2YPLE 3GYRA 4MAUL 1DO6A 3BUYB 4ONHA 3V4PH 4WV1A 5EH1A 1S8DA 3GBNH 3KPTA 3FUHA 4ZO7A 5IROA 5I6XC 2P3YA 4UYQA 2GJPA 2R29H 15C8H 3ECWA 1G1CA 3P4MA 3GSXB 2E6QA 4TSCL 1NUDA 2O5XL 4BKTC 4BUQA 4DIXA 4GSQA 1J1OH 4OFKA 2ZP8A 2WGNB 1KFAL 4AVJA 1AKJA 2XA3A 3LQAC 4WDIA 3T8VA 1YZZA 3ZKMD 3BWAA 2PCXA 1A9VA 3VXQB 4NHUA 4OCMC 4LLDA 1NGPH 1I7UA 3SDCB 2B77A 3FC8A 1MI5E 1BV8A 4Y5VC 3QJFB 1G7LB 5D7KD 1MCOH 1DCLA 3N1FC 1XGYH 5AD0A 1GC1C 4PRAB 2P24A 4PG9A 2G3XA 4JFQB 4NKMA 4PRBA 2VXVH 1H5BC 4RFEB 1N8ZA 4IMLA 2YQGA 1VKXA 4OD1H 5ICUA 2JCWA 4WI9A 1M6OA 3QZBA 2VDLB 2B7DT 3MPCA 3UTTE 3VDBA 5I17B 1LDPH 3UBXB 4Q6KA 1AQMA 1FCCA 2R39A 2H32B 2JXMA 4MMYA 4DCQB 2AQNA 4JLRA 1J9QA 3LNEA 4ONFL 4WHCA 4NP9A 3HVNA 2O26U 3TEUA 4MA1B 2QSCL 4X6FB 3TX4A 3X13B 4IIZA 5E6ID 5C0GA 1FNGB 3JBG7 1MW1A 1T1ZA 5J12C 5T3XH 3MRLA 3QZWA 5JPNA 1FZMB 3L5WB 4NRZB 4Q6IB 4ISVA 1XVSA 4XMPH 1FZJB 2VR5A 1A25A 3KPSA 3PPEA 1ROWA 5LCVA 4JG5A 2WWNA 3FQUB 2ARJQ 1SY6L 1XGTB 2ZG3A 4BFFA 3RP1A 3JWOL 4NQEA 3B2XA 5D7SL 3LNFA 1MFBL 3UBXG 2RHEA 4HXBL 4AOFA 4JPKH 2F53D 3ATFA 4IRZH 5D70L 4APQC 2B5IC 3OKKB 3LEYL 3MCLH 4M8UA 4PW3A 3GJFH 1SBSH 5D1XD 5T5NF 4HJ1A 3FT4B 1HE8A 5FLUA 2NZ9D 1EFQA 5FGRA 2AABL 2NX5E 1FYHB 3VI4F 1PY0A 1W6LA 3ZUNC 2J55A 1A02N 3D0VB 5IQ7H 2Y5TB 1WUZA 5E99L 4BE6A 2WSKA 3OC8A 3T3PB 1RAMA 3KYNA 3IVKA 3I75B 5CJQH 2DAVA 2XJKA 4HF5L 4LMQE 4Q89A 2KL6A 4ERSL 2XWCA 3KGTA 4WTZG 1AGBA 1S7RA 4M5ZH 4XNQA 5HHOB 4IKIA 5C6TH 1SF3A 5T1LA 1ZMYA 2X38A 1KV7A 3VGEA 5DMGD 1DBML 5FA3A 1BLIA 4Y2OA 4Y8AA 3BWUC 4J3SA 3RJOA 1FUNA 1FO0A 4H25A 1MXGA 1RHHA 3QC5X 2Y7MA 3KCWA 3WKQA 1U93A 2WXFA 3MBEA 3MLUH 4JVUA 1MI5D 4P9MH 2OSXA 3BEVB 1H6FA 2BOBB 3DXAE 4JG0L 5B7FA 1RPUA 2BIMA 2JKWA 4KTEH 1DBKH 1JZIA 1XCWA 2F5AL 2I9TB 4ORGA 1CE6B 3O4LE 4PLNC 5I1HL 4AYSA 4JPIA 2DKSA 3INUH 3P0YL 4ZFFA 3EJSA 3INOA 4HIEB 2J5LB 3LJ3A 4HCRL 5C0ND 4NC1C 1TXKA 2XQ0A 3ZL1A 2EYTA 2JK5B 3G6JB 3ZDYE 1NLDL 4MAYC 4HIJA 4KJWC 4PJXA 3AT9A 5GSVA 4Z7OB 5FO9B 4UM9A 1CYGA 4DAGH 4EUPA 1OLZA 4WEBH 5C8JA 5DFAA 2MKLC 2BOCB 1JHLL 2V3DA 2OR9L 2IXQB 2D7NA 4ENEC 2Z34A 4MD5B 4HP5A 3L4YA 5GPRA 4F2MA 4PRID 3GIVB 3B6SB 4DFHA 3B2PA 2UUDH 2J44A 1C7TA 3CN1A 5HYJE 3ZKXB 4WLCA 2X5PA 3S35H 3C6SB 2ZX6A 5E5RB 3FK3A 4HULB 5ICYB 2PYEA 3PWNB 5E2VL 4KITB 1M7DB 1CFQA 1OANA 5LNGA 3C5ZA 3ARBD 4P2QD 5IESL 1A0QH 4PIBA 3RG1C 4NUPA 2EXWC 5AEAA 3RIAK 2QVKA 4RWYL 2VR4A 2FYVA 2IWGA 2R0KL 4ICXA 4XNZB 2VRQA 2H5UA 1KJ2A 3OLEA 4P3CL 5K33A 5IVXA 4FS0A 4J2QA 3HLAA 5DJ2A 2AXGB 3CDFA 3BVTA 3RX5A 5JIQA 2PCFB 4BZ1H 2TSAA 4DZBB 1ZA6A 3MRMA 1MVFA 4NO3B 4X6CB 2IDTA 3NK4A 3ZHFA 5A2JH 4UTAH 3MLXL 1T0NA 1FYTA 2VW6A 1FFRA 3L9EA 3CCHB 4L3CB 1QP1A 1XF3A 1MW2A 4KI5D 2HG0A 5KANI 2Y2WA 3OVUB 4I3GA 4U05A 3P77B 1N8OE 1YYLL 3KBHE 1CTNA 5DRWA 1R5WB 3QDJA 1G5GA 1Y18B 2RD0A 4X4MA 3OZ9H 2CO7A 2ZX8A 3HC0A 2VH5L 2F6AA 4LLVA 4AKPA 3SYPA 2ICEC 5D7JA 5DQDH 4BFBD 1WICA 1AGCB 4KC3B 4ODXB 3CVCA 3MJ9L 4YXKH 3SDYH 2WLIB 2WVTA 3MRKA 3X1EA 2VZVA 5GRVL 2Z6FA 3UADA 2XRAH 2VC2H 4Y1AE 5DMIL 4H20H 3NSFA 3VH8G 3D4ZA 1RZPA 4KROB 4KTYA 2XZCL 2YA0A 1A2YB 3MV9D 3BVNA 1WYJA 3OAWA 4D8PA 1CFTB 1AGEA 4XHJC 4DTGL 5I1LA 1D7FA 2FUQA 1YN7A 2GEEA 1NWOA 3HUJF 1ZSDB 3BIKA 2BVTA 2E6PA 3QQ3B 1TZIA 4NJAH 2X0UA 3ATBA 3SB3A 5JR1H 2BJMH 3MMEA 2AAAA 1JWSB 2NUTB 3UJIL 4ZMNA 1JMXA 2C3GA 2BX5A 1IC0A 3QEUA 2HLFC 5EBLA 5I6OA 1TENA 1F4YH 2DWSA 4XNZC 4F7CB 1SLUA 4L29B 2W88A 3BIBX 4KZDH 4MAUH 3K6SA 4EJ1C 2VWEE 2BVPA 4OZFH 1XR9B 3KPLB 1HWGB 3KYOA 1S9WB 4MZRA 2YWZA 4RGOL 2DD8L 1HZKA 5TPWH 5DD5H 1R17A 4JY4B 4LOVA 5C0BB 5INCB 1QKZL 1IKOP 1U92B 1YCSA 5IJDC 5DZNA 4B0MM 4O5LL 3NTCH 2V7NB 3HFFA 3ILQD 5E8NA 1DLFL 4FQJH 1NAKH 5SWSA 3QZPA 4X80L 1OQXA 1QWHA 3BDXA 3BMWA 1N0XL 4Y9BA 3AB0C 3AFLA 3O3AA 1HDMA 1X5GA 5HPMB 2HKFH 4PGZA 4NERA 1MI5B 2ZNWA 1HH9A 2YBGA 1QLFB 3LB6D 2DMGA 3VFSA 1URZA 3MGAA 2ZUWA 1UA6L 4M02A 4DZ8A 1TJIH 3M7OA 4WK4B 3IFPA 4XOAA 4KZCA 1HE7A 2AJUH 3VI4B 1CL7I 3TP4A 2FO4A 5JW4N 2XQYK 4ZPTA 1RJZA 5CGMA 4I18C 4Y4FC 1LM8V 4BD4A 1IO4C 5BRZD 4B95C 2A0LC 5L2KB 4MBOA 5HVFB 2ZKWA 1P7KA 2TAAA 1ZAGA 5D2LB 5E4AA 3OKLA 1IGTB 4ZOBA 1NBZB 5F6IB 4P9HL 3L4VA 2P8MB 2E7CA 3A4FA 5HI3D 3DYMA 2XTJD 1JHKH 2BNRA 4OV5A 4TV3A 4HSAC 4JFVA 1F3JB 4X42A 2CO3A 1IM3A 2NY5L 1TZGL 1NEPA 1DVFB 2RH0A 4JGMA 4RRPG 1BBDL 1TPXB 4ZODA 5DFWH 3VMOA 4PR5A 1OGPA 2AP2A 4X5RA 4LP8A 2ADJB 2Z92A 3IRZA 5F0LB 2AV1A 4YXHH 5HSFA 3SDDC 2BZ7A 3VTMA 3TF4A 2BVEA 2HLFD 4I5BA 3Q44A 1I1AB 43CAB 4L8DA 4ZXBA 5FUCC 3HZKB 5DRNA 3K6OA 1H3XA 1I9JH 3CTTA 4OLUL 3ARTA 4Z7NF 2CD0A 2HLEB 1I53A 1EVTC 4QRQA 3TCLA 5ADOL 4AWJC 3A4EA 1LEKA 3AS1A 3GZKA 3LX9A 3JTSA 4QHMA 4Y9GA 1LNUA 4TUUA 3AACA 3QJQB 1E50A 1GCFA 3BZDA 2XNAB 2WAHA 3BQVA 4DEPB 7CGTA 1F4XH 3ULSB 4BYHA 4YQXL 1AHMA 2Z31B 5SWSE 2RCSH 1I9IL 3QXTA 3VMPA 2BVYA 1JWUB 5F6HJ 1F00I 3TH2T 2NX5B 4NP4H 5FUOL 4ENED 5GS0H 2OZ4L 3GMPB 1MRDL 4M4RB 4M43L 3PWPB 4XNYL 4C4UA 1IU1A 3BYYA 3EYFB 3DTXB 1RU9H 3CLEH 3KLAB 1EBPA 2A38A 3TO2B 1AXSB 3RU8L 3VXNA 3VXTA 2B39A 1DQTA 3IRCA 3UTZB 2XG4B 2ZCZA 3KPPA 4EZLA 2KKQA 3F2LA 3C8HA 4X6BB 5E8PB 3RILA 5KYWA 1IIKA 1U8PB 1BJ1H 1OD7A 3QARA 4ELME 5E1HB 2PCPA 2V9TA 4Y4FB 2ZUSA 4XPHL 1GGIL 5MP6H 3TBYB 1F11A 2MKWA 1RZKH 5KANG 3ZGHA 4A6YH 5ITFA 5F6IC 4HJUA 3WDHA 3VB8A 3ZE1B 3GXMA 1NAMH 2Y24A 3F8UB 3TA3B 1T6VN 5C7XL 1YEEH 5J3HC 4ODTL 5HI5D 3TYGL 1P1VA 1LO5B 3T2LA 3G6AA 4MLSA 1F97A 3IPBA 3CSGA 5CJQL 5H37A 2AJ3B 5AZEH 1JGIA 1Z0MA 2X6AA 2HVKB 2ZUQC 2ESVE 3HG0A 3PPSA 4GQPH 3CNKA 5I75C 1FVEB 3RWHA 1RZ7H 4IEFA 5DVOA 3BH9A 2YUWA 4Y88A 3NAAL 2AXWA 1FO0H 4JR9L 1GOGA 1ZVYA 3IGLA 4YSQA 2CJSA 2RIKA 3TA3A 2FJUB 5KOMC 1KGXA 1UENA 4HVBA 3AQYA 1UJ3A 3APFA 2VXSH 3ME0A 15C8L 4NNPH 4LL9A 3IU4H 4NT6A 2D0HA 5JO5B 1FL3B 2DM2A 4D3CL 1TO5A 4XBPB 3WAJA 2JLLA 1KIUA 2EXYC 2X9ZA 3W2DH 1SXAA 4Y5XA 3HB3B 1U8PA 5EOTA 1J7VR 2ZYRA 4APXA 1IM9B 5JHLA 3GSNL 1KCWA 4X6BA 4YHZL 4POZD 1BPLB 4NBXB 3E6HB 4LHUD 1E2VA 2W65B 2Z8RA 3EJRA 3ARSA 5DD3H 1IBZA 4RWYH 5GGQH 3TO2A 1AMXA 5KSAA 3KLAA 5FYJD 1B4RA 5FX3A 5DJ8B 4NQXA 1B6DA 2FQDA 1G9MH 3B9DA 3IPEA 3QEGL 4NCC1 5EORH 2BC4B 5F1IB 3G7TA 5ADOH 5E6IA 5JQ6L 4RFNB 3U0TA 4YBQD 1IT9H 3WUWA 4PMFA 2DKMA 5CZKA 1D5RA 2EDMA 2Y7QB 4PV9A 4AKOA 4LLMA 5GIRA 2EC9T 4CSSA 3D18A 3P0VH 5E8EA 4H5SA 2AJZA 4ALAC 4G8FA 2YC1B 2IWKA 1TQSA 1OZTG 3KJ4C 2WIMA 5LCVH 2HTLD 3LEYH 1KBKA 1U3ZA 3QFJD 3CFQA 5CLWA 2WWMD 4I0PC 4ZFGH 2R1XA 5KVDH 1TTGA 4U1LA 4HWEL 3F01A 4Y5XC 1QMUA 4X7TB 1IL1B 2X2UA 1EWHA 4PBDA 4XMZA 5EOCH 5IQ9A 1RIVH 1UM5H 3BDBA 3Q8BA 3S7GA 1AIFA 1PL3A 2OS7A 3B7TA 4L5FE 2FT6A 5AVTB 1ZIAA 2V2XA 4LCYA 5J13C 4C8XA 5JPMB 2PW2A 3QR0A 2R56H 2ZXGA 5IR1A 3S6CA 4P49A 3KJ6L 3H9SB 3WKYA 2WSPA 3T0ED 1QRNA 3SCMA 1MFEH 2BNRB 4JHAH 5SWZE 4K7PH 4NZTL 2P8MA 4WW2B 5AUMA 4ODSH 2IAMC 4PRDA 3OKLB 1NCWH 4HJIA 3V0EA 4DGYL 4M7ZC 3M17B 3SKJL 3ZT7A 4LF3A 1RUKH 3GSUB 4KKLD 1AJ7L 3CN4A 1KNOB 4NAJA 3V0WH 1XZWA 4ZPTB 1OF0A 2OBGA 4LSVL 4EKJA 3KLHD 2C5DC 4M9PA 1WD9A 4WO0A 3EJCA 4JCMA 3NDZE 4LPYA 2EDJA 3QFGA 5CKAA 3S48A 5I1KH 1ES0A 2B3IA 1HH9B 3SDAA 4M1DL 2PXYA 5HPMA 5FHAL 3HNTH 5J56B 3W11C 5DFTA 1CTMA 2WCSA 3BE1H 4P46D 4YDJA 1BQHG 4GRLB 1NMBH 5CSZA 1WIPA 4MA8L 3SGJC 3FH5A 4PPTA 1OWRM 5IFJA 2V7NA 1XO8A 1NTDA 3CVIL 3QWNA 4F7TA 3GSUA 2DS4A 2FEJA 5F9JA 4J3OH 4OD2B 5CIPH 4JY4A 4Z7UF 1KSRA 2WK2A 1CDJA 2V7HA 3RDTB 5BUPA 3PHOA 2HFEA 4QRFA 2BVPB 5FYJU 5CUSH 1KCKA 2PP9A 2WQRA 3K6SB 2WXOA 2G2RA 1NFDF 3SDAC 5HDLA 1A7PL 1O9VA 2VISA 4MWFA 5D7IE 5EUOE 4CJ0A 1BVKA 1UT2A 4OFQA 2YKLL 4TVPL 2ZJSL 1EZVX 5K9QI 2E0PA 2QPSA 3L3HA 4OZFA 2V2XB 2VUOA 1G4MA 4QRPE 3EOYG 3QCVH 4YX2L 5KVGE 5C0CD 1AIFB 2FHBA 4YE4L 3ARFD 4JANB 3MLZH 2W60A 1EJFA 2HFGL 1HSAA 4PJ8A 1INEL 3VRJA 4PB0H 2OR8A 4U1LB 2X6BA 4V1DB 1N7MH 4P5TB 1D2PA 1KYDA 4AUYA 4BSJA 4ZX6A 3V7MA 4FJ6A 3VDAA 4D8PB 1DE4B 4U1JB 2YWYA 2O61A 1NOFA 1BQKA 4QMEA 5DD1L 1F2XK 5IHUH 5FGBC 3STZB 5DFVD 4H5SB 3V4PA 2X44D 1G6RB 4MXQD 1U2CA 3D18B 3FFDB 1TLKA 3V0AC 4JFPA 5BS0B 4LLMB 3GQFA 4HUMB 1T7VA 4A7GF 2OXHA 1ZSHA 3K0YA 1IBYA 2YSSA 4CN6A 4EZMA 2HKHL 3KE0A 3N43B 5GGVY 1PFCA 3RGHA 5DS1A 5DJ8A 1OLLA 3IS1X 3X3FH 4P4KC 4WKZB 2EZ0C 5CJ5A 1DSYA 1Y18A 4PREB 4JHAL 4XPFH 1R5WA 3QDJB 3UERA 2J4WL 4RZCA 2JF1A 2N1KA 4NN6B 1SFDA 4N8VB 1I1FB 3MLXH 4QRAA 2CAKA 3DIFA 2R0KH 1L4IA 1TTCA 5EOTB 1D7CA 3U46B 3LCYA 3B2UD 3CXHK 3O0RH 3T8XB 3V10A 3AQDA 3VWKA 2CUMA 5EOCL 4JFED 1TTUA 2UY6B 4NO3A 3UAEA 1OAZH 3BD3A 4KQ3L 4PV8B 4FP8H 2QTVA 1XH3B 1IUZA 2BNRD 3NA9H 3GBML 3ZMNA 3ZUCA 2PCFA 2D3JA 4K8RH 4AV5A 3VQ1C 3LRSA 2F5BH 2HG5A 2AKRA 2VRAA 2EYRA 2G60L 5ICZB 2CO6A 2XN9B 3EDEA 3F7RA 5J9PA 5TDNB 1Z9SA 2Y5EA 4YSRA 4IBUA 4YSEA 5BRZA 5ILTL 4MB5A 5C0DB 4MJ5A 2HVKA 4NSKA 1TCMA 4ZNEE 4GY4A 3PWJB 4RH4A 1Y6KR 2R69A 5J7CC 1HZHL 1U41A 2VABA 1KCSL 1YAZA 2W0FB 3CWGA 1RUQL 3C6SA 3PJSB 1Q0XL 5I19L 2MOVA 4BH7B 3T0DA 3HBGA 3M88A 3DVGA 4OTXL 4X8JB 2YOAA 4L1DA 2NQCA 3HA0A 3H3BC 2XYCA 1U8JA 3LHAA 4M7KL 1QHQA 5DUPL 2EH8H 1OM9A 4U6VH 1M57B 2PUQT 4QAMB 3QWQB 2BVUA 4UM9B 5MENB 3Q3GA 3SYQA 4L18A 1IC7L 3PQYE 1NGZA 1IMHC 2PTTA 1Q4NX 5C07A 4BKSC 5A43C 5E8PA 2HFFB 3D30A 4FQ1L 4PRIE 2VXUL 4Y16D 4N86A 2PWFA 1X5KA 1N0XH 2C8NA 1T0MB 4L48A 1YUHB 1UG9A 2NR6A 2WXLA 3MLZL 1AXSA 1H0DB 3VXTB 3MA7B 3H55A 4NFCA 1AS7A 2F18A 5AKVA 3IFLL 1MZYA 1SLWA 2OQJB 3U4KA 3N50A 2NX5A 4JO1L 2J88H 4A68A 1RK0A 4E41E 1T4WA 2PCYA 2Z31A 3OQ3B 5D72L 3MHZA 2H1PL 3CMOH 2YUZA 4ZAKA 1H3UA 1EZVY 1FL6A 2YD6A 4QTHB 5I73C 5HYSG 3RPIB 1VFAB 2BXZA 3VM7A 3W9DB 2EUVA 4MSWA 2VN6A 4O51B 1UTDA 1TIUA 3Q2LA 1EAPA 3X3GH 3IN2A 3JTSB 3JV0A 2FT7A 2XKSA 4NUJA 2Z31C 5JW4R 4O2FB 1USZA 4HXBH 4G42A 3ARBC 3NPSC 1R19A 3UTSB 2A9ML 3HZ3A 3HE6B 1EK3A 4L8DB 5FUZL 1L9TA 2WYHA 1DLFH 1RZGA 1T0PB 4I5BB 4M8VA 5ACMA 43CAA 2BP5M 3U25A 1G9NH 5CNHA 4GT7A 3U4BH 1NFIB 1V3LA 4G80B 4UQ3A 5BS0D 1FI8C 1KGCD 3MSPA 2ZP0T 4FZ8H 3S34L 1DLHB 3WE6A 2ADJA 2Z92B 1Q94B 4ONGL 3CVDA 1RZFL 4V1DE 5AZUA 3BVWA 1JJUA 4GP8B 4U49A 4IDJH 1SZNA 3E0GA 1FGNL 4OV5B 3AWEA 4YZWA 5IB4B 1SVZA 2GTWA 3DV4A 3IBOA 5C08B 2DMBA 3GXFA 4LAQH 3WN6A 5CGYD 4KI1A 2AXHA 5DEZA 5D2LA 1F5WA 4XRCA 1UGNA 4MCMA 1YEGL 4LGRB 2B16A 2JCCA 1KLUA 2GIMA 4N2MA 1MFDL 4G6JL 2ICEA 3EH1A 1JS4A 3SEPA 3B7SA 3A6CL 4X2UA 4PTUB 4HSCX 4EEEA 1JPSH 1PLCA 1UXLA 3QZWB 3ZTJG 5JPNB 3T1WA 2Z3FA 1FNGA 5SX4I 1IGIL 1X3DA 4XMLL 3OMNB 5I8OL 4E41A 1OB0A 2QHLA 2YKKA 2W9EL 4DKFL 3FN9A 4JPVH 4X6EB 3ZDXB 4ZK8A 1G84A 3M1OA 2PPCA 2X4UA 5IJVB 4B50A 2H32A 2JXMB 4FQ2L 5HHNA 2IDSA 3KPSE 2NOYA 4HXAH 3SPHA 5KAQF 3INUL 3P0YH 4NXKA 1U92A 5MI0B 1EV2E 4LLYA 3PL6B 2GHZA 3TBTA 3UZQA 4GP5B 2EVJA 4LFHD 5MEPA 3KYOB 1SVBA 5T5FH 3S35X 5HDBF 3QUXD 2X0VA 3DO4A 4M03A 4IMLB 3CIQA 4AZUA 5FGSA 3EJQA 5AAMA 2XICA 2Z7YA 4WHYH 4PRAA 3LOWA 1KIPB 1A6PA 3WG7B 3KPRB 1HI6B 1KPRB 1HZLA 2WQAA 3GBNL 3GEWB 4UT6A 4LP4A 3SDCA 3U36A 3ULUH 2DQFA 5TFSL 4M3JA 4K73A 4XMXA 4YHKL 2R4SH 3IJ9A 2FCBA 5L88L 1FV1A 1KGJA 2C9AA 5MEQB 5G55A 2EYSA 3ERXA 3ATDA 4LHUG 1UCBL 2ZTBA 4FXKA 3N0PB 2FNWA 4LQFH 3HB3C 4G6KL 4RSVA 1SUJA 5DJAB 2XY1A 2ISDA 4WEEA 1JDCA 2KLTA 3DMMB 4E5XG 1BXUA 1N5YH 3SOBL 4ZMPA 3C87A 3IJEB 3BVNB 4R97B 3L4TA 4TQEL 5HHMB 1AQDB 4MVBC 2WSDA 3NA4A 5IJKA 3F84A 3TIDB 3TO4D 5EF1A 4KXZH 4AGOA 3N55A 5DR5H 1DFBH 3GRGA 3JVGC 5I2IB 3QJTB 1OSPH 3A21A 1XF5A 5CJXC 3L7FA 1SF5A 2OL3A 3FNKA 3O2WL 1VJSA 2E4TA 5KYWB 4ETYA 4PGBB 4HW6A 1A22B 3B2DC 4ATTA 2W9LA 4PCKA 4PJXF 1AXTL 2BNUB 3G6DH 1HWHB 2AHIA 3ARUA 1ECYA 3KPQB 4OZHF 1WFJA 1N7ML 4ZZFA 1Q9OB 1WZAA 1E65A 3LIZH 1RUPL 1MH5B 1YO4A 2IVFC 2G0LA 7PAZA 5JOEA 4NOBA 1P6FA 5D9SA 1OTSD 2HJFA 5E99H 3DURA 1BZ7A 1BZEA 3HPJB 1EXGA 4KMQA 3MROB 1ZGLB 1QFWL 5T3XL 4DETA 3MRMB 5FV1L 1UM4H 3DPBA 4MDJB 5DK0A 3N0AA 2X40A 2ZKYA 1N64H 1NUGA 1D5MB 3CZNA 3G5VB 5MI0C 1KJ2B 1JPGA 3WHE0 2FT8A 3PL6D 1TVDA 3GO1L 1K8DA 4K4KA 4LARH 2XPGB 4AEHH 1IAKB 4HG4K 1FH5H 4M7LL 2CXKA 5E0QA 3OXRB 4MNGA 4HZLB 1PCXA 2I25N 5KVGL 5J1TC 3T04D 1WBXB 1W9XA 4MS8C 1A6WH 3VWJA 4AIZA 1PZUB 1GY2A 4FHBD 4X9IA 3CFBB 1HTYA 2YPVA 2HMID 3JZYA 4QT5B 1F02I 1S7UA 2W81C 4ZX3A 3MRQA 2P8PA 3QJXA 4HOZA 1IC5L 1RFDH 3HRZB 3L3IA 3WNLA 1MIML 4HOWA 3NK3A 3B6SA 5I18H 4OZ4A 4F2MB 1BVLA 3FQTA 5INDA 1BD2E 3C6LB 4AQ1A 4C56B 3GPSA 4PLJD 1SHXA 3IJ8A 3N9GH 3M1BB 3EYSL 4G9FD 4NAQA 2BPBA 1TG8A 1J5DA 5AW1B 3WEXB 3AXLB 3MCKA 5B21A 1ZANH 1PBYA 1FZOA 2P1YA 1B4LA 3FRPA 3BLPX 2OMYB 4FQHA 2DIJA 1MHCA 1O7SA 4X6CF 3MRPA 1EHNA 4HGWB 4QXUH 3DK0A 4HIEA 4ZUUA 1YEDB 1KBVA 5FK9A 1JIBA 3B8SA 4X5QA 1UM6H 2RACA 4D9RE 5H4ZA 1NEZB 2QKIB 4JFZL 3ARYA 1CI3M 1DJZA 2HMIC 1MCKA 4MQXD 1GGBL 2ITCA 2A6IA 1P4BL 2EIZB 4CC4A 2Z8WC 4HOMA 1O6SB 2OJZL 1XGRA 4UIMB 1FO0B 2MTPA 4H25B 1JNNH 1Z9OA 1CLOL 4XX5A 3CFJA 3H42H 4Y2OB 3EFFA 3TNMB 2X1PA 4HIQA 1PDKB 1WF5A 4XPAH 3HS8A 1MCEA 4N1HB 5TFSH 2X1XR 4LDEB 4ZMQA 2OL3L 1QBMH 2Z4TA 1Z0NA 3FTVA 3HS0C 4Z7VA 2BSED 4X5WB 2YRBA 3NJMA 1FNFA 5BV7H 3KDMB 1FVCB 1JHTB 4LEBA 3PRZA 1MJJB 1T1XB 5LXGL 1HAUA 1OAYL 2BCMA 2WNGA 2R0LL 4R96A 4NLAA 4ZTPH 2CDEA 2BHYA 1BVNP 1QA9A 4XTRD 1XF4A 4M7KH 5DUPH 4YZFF 5F93C 3U30B 4ZAKC 1U3HB 2EEAA 1BXAA 3R06B 4MA7H 5DQ9B 1OSPL 3APNA 4CUCA 3AG4B 2NXZB 3BKCL 1PAMA 3CFKB 4WGWB 5KSBF 4I1RA 3HNVH 1W6WA 4JDTH 4AXWB 3QZNA 3QBTB 2OMXA 4FQQA 1AKPA 1L0XA 3QULB 4J3UA 4J1UB 4AL8C 4KU1A 4WUUB 1W15A 3FQUA 3SDXE 4MXVF 3OR7A 4X4KA 1X9UA 2FSEA 3FRPG 1WIUA 3TFBA 5EEVA 1K6QL 5CR1A 3Q6GH 4ISVB 3O8XA 2Q87A 4RMQA 4TVPD 5FECB 3SE3A 1FZMA 4LRNL 2I07A 2ZPKH 3P02A 3TNNB 3RE0A 1PCSA 2XN1A 3HI5L 1SXBA 3TFKC 4YFEA 1TMCB 4TNWK 1RLBA 5A3IC 1QYGH 3NRQA 3GJEB 3WNPA 1TUPA 3FW6A 4KRPC 3SZKC 2A9CA 4K3EL 2A74A 3VXRA 3HG1B 1K4CB 2G5BA 4NBZB 2JJTA 4EDXB 4MA3A 4FKEA 3TT1L 1UURA 1GHFH 1TZOA 1M6OB 3NQKA 2XACC 4P3DA 1AC0A 4OCRH 1IGIH 4D9RD 5C0JA 3GHEH 3UXFA 4URKA 5DSCA 2G2NA 3S36X 2VMDA 5IHUL 5T1KA 1A7QL 1OOWA 4BM7A 4RNRB 4EIUA 1FFOB 3ETBJ 1U3YA 3TBCA 1D7BA 1E42A 4JQVA 5C09E 1M7IB 3PUCA 5I8OH 3QDAA 2R23A 4B9CA 4IS6B 4MASA 2BSTA 3ISRA 1A65A 1VZHA 4KXZI 1TFHA 1XGPB 1KG0B 2F8OA 2R9HD 2RFXA 4CAGA 3FQWB 3R4DA 4R90H 4F8NA 4MMZB 4RGOH 3CHPA 4AEFA 3MNZA 5GJTH 3EFDH 1IGCH 1FZKB 2BW5A 2OL3H 4PG2C 2XQYG 3NTCL 2EC9U 1BIIA 1UB6A 3PDGA 5HBBA 4QXTA 3CFDB 4WV1B 4KVPA 3UZVB 5IUSA 1HSBA 1T22A 2VLLA 3GSWB 3QI9A 1T6BX 4FL4B 4L1SA 3KLHC 4ZDHA 3ILPA 3C2AH 4YSOA 1UOWA 5EBWB 1S9KC 1P5VA 3SKMB 1UACH 2O5YL 3K2KA 2P7TB 3D05A 5F1OB 2BWQA 3HHMA 4KHTL 3TYFA 1NIAA 1CYXA 1FIGL 5DQJB 3V4VL 4P2AA 1BP3B 2IO5A 5BQ7B 2BSEA 3NEEA 1FFOA 2ZWSA 1EXHA 2C3XA 4FGMA 1JD9A 4LVHC 2EILB 4J2XA 2HT4C 3DUHA 4OLWL 1HXMA 3NP4A 1EO7A 3VA6A 1XGZA 2YD0A 3F7PC 1ZT7B 2ZX7A 5JLZA 1EZSA 3MV11 2F7OA 3DX3A 3T2NH 1MLCA 4KUCF 1PZBA 2CRYA 4EI6B 2IGLA 2G5BB 4JFUA 4EDXA 1F90L 2ZX5A 3BKYH 4TMPA 4P2QA 1CGSH 4LAJH 4L8CB 4WGKA 3U4EA 5BW7A 4JUSA 4HIXL 2FGWH 1AYRA 2VDLH 1IQDB 1SMOA 1E4KC 1TTBA 2AEQH 2F7RA 2Y7NA 5I6NA 5B1JA 1GAFL 2WP3O 3SQBB 4PN6A 2Z7WA 1RI8A 2J88L 4X6CE 3R1GH 4FXTA 1LQBC 3GBEA 4E9TA 2LFEA 2VSKB 1HC1A 5FECA 1BQLL 3JV4A 5TJWK 3UJJH 3O8XB 5D5MA 2CDGB 4M61A 1WCBA 1VRSA 3AAZB 4I2XE 3EH3B 4HPYH 1YYLH 1CFVL 3OR7B 1EJ8A 2IPKB 4PYHA 1TJHL 2PO6B 5AVSB 4FCHA 4QRUA 3LKQA 2X1OA 2GT9A 3QULA 3G9VA 5KN5A 4AXWA 3NOIA 1ASQA 4HUWB 1GS6X 2UX6A 1CPUA 4AK1A 3C5SB 4DKEL 2OMWB 3PXLA 1QABA 2GTZB 5D4HA 5DQ9A 2OZ4H 3EBHA 3UAFA 1JE6A 3CU1A 3JYBA 4QPEA 4DUWA 4UILL 1NIEA 5F7LB 1CGYA 4OJFL 4W9JC 3RI5F 1T3FA 3ATAA 3EDKA 2JI3A 4XB8A 4CMMB 4S1SL 4YSCA 4FYRA 2N1TE 2QQLH 4DPRA 2R0ZH 1W72H 2ENYA 4TPRL 3TA3C 5LGHH 2ZXBA 4Q6YA 3SKUD 1FVCA 2BIOA 2OSWA 1HINH 1QSED 3VU2A 4TNWF 4O9HH 3BFOA 4U3XA 1NFDE 3V0FA 4BINA 3W5MA 4BWWA 2JB6A 4L3EE 5F7FA 2CLRB 2XWTA 2Y36L 4NFDA 5JNYB 4XN8A 1S5HB 5HGBB 2EIBA 3NIDF 2FBJH 2YQ2A 3TNMA 3P9WB 2CKBA 5JIDA 3CFJB 3L1OH 3MLYL 2J73A 2V37A 3S3DB 3ESOA 3L1FA 3G04B 2A99A 4O2EB 3E9TA 4WW2C 3VQ2C 4UF7C 4IKLA 3NFPB 4DTGH 2Y69B 1EEQA 4OZHB 2ZKXA 5IWLA 1YRKA 3V79C 3QRFM 1T66C 4J3OF 1NGXA 1ET7A 2QKIA 3O6ML 3ULVH 1FFPA 1MIMH 3QA3B 3KW8A 3VVVA 5I5MA 3JQOB 4L4VD 4HS8L 4PJCE 5I16A 2VDRB 1YEDA 3QJSB 4P48A 4HGWA 2QKSA 1N5AB 3GRWA 1CXHA 3UJIH 3AM8A 3KW7A 5EOQL 5KJ4A 1JDDA 3FTWA 3AXLA 1WH0A 3MCKB 3V6FA 4GG6E 1OGTA 4N20A 3MRNB 3UC2A 1GOFA 1A5FH 2KDGA 1FLRH 4AVIA 2PW1B 3C6LA 3D48R 1KOAA 4UQBA 1JRHH 1KLFB 2ROYA 5E08L 3IDXH 1C12B 1OK8A 3QIUB 5DZOA 3WIHH 2P8PB 1YPZA 1CXFA 1LD9B 2E7HA 4KROD 1AE6H 1SJMA 3TT3H 3MACH 4L1BA 4Z7UA 4FLOA 1DVQA 4O5LH 4AIZB 5BOJA 4K2UL 2NXYB 4Q2ZB 1J12A 3S5LB 4JHVA 3NESA 1N2RB 3LPWA 4NKDB 3KXFA 4JDTL 4Z7AA 1QYGL 4GMSL 2YD9A 3QO0A 1RUPH 5T3ZD 4YDVB 1DQMH 2CUHA 1F1GA 4WV1C 2WWKT 2WZ6A 2FECL 32C2B 1MFVA 1Y6MR 1TZHB 2G3NA 4J8RB 3K4AA 3KHOA 4XXDB 2A1WL 3MUY1 1ZGLA 1IV8A 4Q58C 3WKPA 1HH6B 1CL7H 3PU7A 4PTTA 3MREA 3E6FA 4P2RD 1RZJC 4GKSB 4X7CC 1Q1JH 2P47B 5I8KH 2HRLA 4K07A 5AW7B 5HHPB 1AQKL 3FF8A 5LBSA 4FTDA 3G9AB 4PJ5E 1I85A 3LXCA 3PREA 3C8KA 5I1DA 3FCSA 2Z0UA 1BLNA 3VSQA 1HOCB 4U6YB 3BP5B 2H9GB 2D7TL 3VD3A 1GA2A 1F4AA 1WS8A 3EG9B 3HMXL 4GMTL 4PS3A 1FAIH 3MRJA 2CCLA 1QFWI 1ZDSA 5LN4A 2HP4A 4TNEA 2OL3B 3AREC 2B0SL 1NANH 1XF5B 4LFHG 1WPCA 4JJ5B 4Q14A 5CP3A 5G2NA 4EXKA 3HCVB 5ITBL 2PP7A 3ULUF 4V33A 3VSVA 2AJVL 3LKOB 1JWMB 4KFZC 3TIDA 1WO2A 1XXFC 1RZIA 2BM3A 1XBDA 4LSVH 4LNVA 5AKSA 4KXCA 5F72S 4PRHA 4F37F 1F45A 3O11B 1HCVA 1M56B 4J39A 1LEGB 3RIFF 2ZXWB 4Z78A 4G1EA 5KS9E 2WN2A 1KLGA 3D25B 3CQFA 2I69A 4FXKB 1FNSL 2EYSB 1ACYH 4F5CA 3AAZA 5FOJA 4S11A 2YXWA 1ND0B 2CG9X 2CDGA 1KZYA 4IJ3B 5DC9B 1A1OA 1RK1B 4ZW5A 2ODHA 5FA4A 3RA7H 4M3HA 4YFLF 3ELAT 1CLYL 1NCTA 4HFWB 1QBLL 4GH7B 3SZ6A 4JFSA 1C08B 3AY2A 5E9DB 4JO2L 5KG9A 3MLTA 3GMOB 2Z8SA 1IQDA 2HA1A 4U1NA 3U4EB 2B9AA 5I1AB 5C0AA 1EDQA 2KS0A 4XN2A 1IGFL 2MWCA 4AYMC 4BFJA 3WD5L 5FM5M 3S9DB 4N87A 4I48B 2F68X 4EI6A 1YEIH 5CJBA 5HHNB 4OQTA 1WZ1H 4WSKA 3RVVD 3FFCD 1RV6X 1M7UA 2AJXH 2OMUA 4LIQH 1JBJA 4WW2F 4X6EA 1D9KC 4RDQF 4WHTA 1BSIA 3KWTA 3ZQ9A 4F8QA 4NQQA 4E41B 1HXMB 3MGOB 4NO0D 5T1DL 1S7XA 1DDTA 1EEYA 3FPYA 2LAGB 3D51A 3L4WA 1DJSA 4WNSA 1QSZA 1EMTL 1JK8B 5DO2D 4P4KD 3T1FA 2YSTA 2D2OA 3HAEA 4C58B 4KQ0A 1P5VB 2QADB 1UD6A 3FO9A 3A67L 4OUUB 2V8MA 4ZDHB 3EO0A 1AFVH 1FWXA 4L1TA 2JKTM 4LGPB 4JO4H 4QJ3B 4F7EA 1P4BH 1KGUA 2WBJD 2IQ9H 1R3KA 3AREB 3MRHA 4Q6IC 4QXTB 2WXHA 4UT6L 2Y7SA 5EBGA 4N1CA 3IDNA 5IB5B 2FAUA 4TULL 1E3XA 5DUMH 3LPGA 3NEXA 4IRJD 1HKLH 2BSRA 3FQNA 4WVRA 3MNZB 4PEEA 4JL1A 1WG3A 4XN5A 5F3HB 1QBML 4FFZA 1XGUA 3FO0H 2ZUUA 5AVXB 1QNIA 3MODH 4TPRH 1KG0A 2BDNL 1QLRB 4OLZH 1F6AA 2VZUA 5B8CB 5LBSH 5EEZA 4LPXA 1AGDB 3LV3A 4M5ZL 4G42B 4QDGA 3IMUA 3MV9E 4U1IB 5T1KB 3EJZD 1PZAA 3U0PB 4U0RB 3MV7E 2YARA 3FB7A 5FFOA 4PJ7B 5HDBB 4KQ4L 3TN0A 1DVFC 1VFAA 1UVQA 3BUBA 5M95B 1FORL 3LS5H 4JB9H 1FL6B 4KUZL 4KI5E 4EIBA 3AGWA 3CSBA 2ZYHA 2DBLL 4ZPVA 3X2QB 1QEWA 4DOHB 1KTLA 2I5YH 1ZCRA 3CXDL 2EDDA 2DYRB 3FSOA 2X4OA 1ZV9A 2NQ3A 3I02B 2N3JA 1NCWL 1NM4A 1N10A 2D7OA 4JFFD 3SO5A 4NZTH 1UH2A 5B22A 3EXJA 4TLTA 5E4OA 3ROLB 3ULUD 4JO5A 4X0NA 3RVUD 5KVEH 3DJRA 4OLVL 5I9QB 3U4AA 1WEJH 3WIFA 2CHNA 2AEPL 3D9AL 1WA0X 1LK2A 3C60C 1BAFH 4F27A 3TURA 1DTUA 3IDIB 5K9QG 4MRCA 2D03H 2ATKA 2ZG1A 1L0QA 4OR1A 3Q3GB 1OL0A 4J23A 4O9HL 3U2SA 1A6ZA 1SDAB 2WMPA 4HUVA 4HV8A 4Y2LA 1ESOA 3SYOA 4APQB 2OMXB 3OAZH 1CVRA 2CRMA 2IANB 2AK4B 4LLAA 4M56A 3DVGB 4NQDD 4X8JA 2F1BA 2WLHA 4FYTA 2NY3D 2JCCE 3OAYH 3SKNB 3PJSA 3R06A 1U3HA 5JOPD 4FCAA 4XMKL 2VABB 1XEDA 2W0FA 4QOKE 4NQUA 1RSYA 3BJLA 3NBNA 2CE6A 4IBTA 1PEZA 3EYOA 2NXZD 4CBZA 2UYLB 5BRZB 5LDUA 4HMEA 1NDTA 4XC1L 2H3XC 5CBAA 1EGJH 2FJFB 4Z7UE 2CKBH 1FPTH 4GAGH 4FL4C 2D4FA 4FHJA 4NKOA 3CBRA 1EO8L 1KXQA 1ETZB 1OPGH 3BN9C 4OD3H 3KBFA 1OB1A 4X5WA 4Z7VB 5FW7A 4OI9A 2OW6A 3WXVH 1RZFH 4OLEA 4PV8A 5DLMH 3JWDH 4M6ML 4E0RA 1CD0A 4QWWD 4S2SA 3SHSA 25C8H 2V3FA 4ZUWB 4Q9BA 3SN6N 1IBFA 2BSDA 4LSRH 3S5ZA 3QUYB 1TVHA 1TOXA 4YZFE 4UIMA 2K7QA 2OI9B 4TLSA 3JT2A 1DBAH 4KH2A 2IOOA 2V8LA 2UWEF 3AU1B 3H2WA 4PREA 5I5IA 4MX7B 2DLFH 1YNLH 5IW3A 4BXSV 4TKWA 4UUJB 2XKNB 2GK0B 3UJJL 5HYIA 4M8QB 5EEXA 1SDDB 1VACB 1KIQA 1PSKL 4GUOA 1MCIA 5KOVC 2DEWX 3P3SA 4PI0A 5F7HA 4N68A 5FK9B 1BECA 1WAAF 3MV8A 1KY6A 1L3WA 5FPIA 4MB4A 4GKNA 2XA8H 1ADQL 3ENEA 1YDPA 2XWJA 3DRQA 4F33B 5DQDL 1A6AA 4DWHA 1CFNA 2CR3A 2PWGA 3MACL 5J11B 2NRDA 3WKML 1NCAH 4U1KB 2X6VA 4C56A 2CO1A 4L9DA 3HZMA 1BVLB 2NXYD 2R0WL 3DETD 4XCFH 3STBA 4AQ1B 5INDB 3ULUE 3BIAX 3IDGB 3QCVL 4YX2H 2QQNH 1DQDL 1QPPA 3IGFA 3RKPA 3BQUC 5CLZA 3WDJA 2XLLA 2W9DL 2DI7A 1PD1A 4JANA 5IP4A 1R3JA 2L7QA 1KBGL 1UZ6F 1XCXA 4X5PA 3H4HA 2CJUH 4KVCH 3KG5A 4Z7VE 3L3HB 1K72A 5KW9L 2CK0H 3QEQA 1JZDC 2VERA 2P5PA 3VFRA 1O75A 2IWEA 1K5WA 1AR1C 4YNYA 1BMZA 3LAFA 4WO4C 4X9HA 3UMNA 2C26A 4W9IC 5IFHH 1HHJB 1U21A 1ZV5A 3D3VA 3FUEA 2OPCA 4HC1H 1JOIA 1LE9B 2P45B 4MDJA 5DK0B 1LEIA 5I26A 1J0ZA 4HKXA 5DYFA 2V7HB 4XT1C 1BJ1J 2O1AA 5HVHB 4OD2A 1PYWA 4UOQA 4LEEA 4AQ8A 3MROA 1QUNB 3CZJA 2AAVA 3HPJA 4JPSA 2W0PA 3TV3H 4MZIA 3TA4D 4JAMB 1TJXA 3FRUA 1W72L 3CFMA 5KTEH 3L5HA 1WK0A 1JCKA 1LWRA 4PJEF 3T6WA 2GABA 3BUQA 3NCYS 4RMSA 2CMRL 1BYPA 1TETL 1UCTA 3SPVA 4GW1A 3SODB 5I8CB 3RWDB 2K6WA 4JO2H 3HI6H 1N3NA 3MR9A 3QUZD 4JM2D 2WKOF 1S9VA 4FFTA 4ABVA 3APDA 5DHVA 2X3AA 3AMKA 2ZIDA 3BLBA 3D39D 4UINH 1B0RB 2QQLL 3VXME 5J12B 1UB5B 3S5YA 4UZGA 3VB9A 3HZVA 4YS4A 5D7LB 5IB2B 1LE5B 1E8YA 5D55A 4HX1B 5TDOB 1CBJA 1H8LA 4WTXA 3DHJA 3SE8L 3LIZL 4WI6A 1BCIA 4FQLH 4YGVA 5AYUH 3VM5A 4ACPA 1IJNA 3ZPDA 1OCZB 2AMUA 4IRSA 1I85C 2P9RA 3PP4H 1U6AL 1FG2A 1VEPA 1YLBB 2OR7A 3FUKA 4AK2A 1J5CA 1HQ4A 5DJAA 1A0QL 2BH0A 2BFVH 5E0FA 3MLWH 5JPMA 1G6RH 3S8WA 1UFGA 1OEZW 3BKML 2QPEB 1VFOA 4JRFA 3O4OB 5FCUH 4GUCA 2DQFB 1PS3A 1UWEH 5AW2B 1NSNL 1I4FB 1KJMA 5LAXA 4FQXA 2AI0H 4ODHL 3PFUA 1FDLL 5DFVC 3AZUA 1KIPA 3PFQA 1HYSC 3D06A 4XNMA 2EZ0D 2H1XA 3FL7A 3K1KC 3DX6A 5DURD 1BFVL 2FEDD 5DGQA 2JQMA 4Q9RL 4QOKA 4OGZA 5MEPB 1E40A 4IK7A 3KGRA 3TBSA 4HJJL 1J88A 3BT2L 5KVFH 4E5XB 4JRXE 3D85D 1I8KA 5H2BA 2F54D 5FOBB 5GIRB 2IALB 3O81A 3RTQC 2OX5B 5T1MA 3JTBA 3RUGF 1R4XA 3BEWA 5D1QB 5TE6L 2AEPH 3T5WA 2J1XA 4JFWA 4AI7A 1G7PA 3F58L 3Q48A 2ZSVB 3LB6C 4NO5B 3MRCB 1W8EA 4XNDA 5KSAB 1M71A 1YUKB 5IFHL 3CZFB 1NCDH 4JO4L 3HHRB 4N0CD 1YQ2A 4E68A 3EAKA 5A2FA 2Y1YA 1OSZA 1DDHA 3FU6A 4JFOA 4GG6F 1KCRL 1RUML 2NXZC 4XCFL 5DJXB 4J3TA 3U9UA 2CK2A 1M2VA 2NTFB 2NYZA 1QO3B 2ZYIA 1KLUB 2QHRH 2QL1A 2COQA 4ZMLA 4XRCB 2OMZA 4RAVB 1DJWA 1X9RA 5C7XH 4NT6B 3MKKA 3ZHDA 3S8GB 3E7JA 5I5JA 1SJEB 1NUNB 4NZRL 3MJ9H 1QFWM 1KYFA 5DO8A 1DO5A 4XMWA 3PQYB 4J3XA 3RVWD 3PF2A 4KTDH 1CICD 4S1RH 3TVMD 4KJQD 1JZ6A 4GRLD 1LGVA 1OE1A 1DLHA 1HL9A 3QS2A 4JN1L 4UDTB 3WE6B 1FGNH 3QYNA 4FA8A 4FAAB 4AT6B 1ZHKB 4JDEA 5AAPA 3IAGC 3GM8A 1J9CT 3ARGA 3G6AB 3HEIB 4AGMA 2JKXA 2LOEA 2YEVB 3H6AA 4EMZA 4XXCA 1M1XB 2Y7LA 2Q10A 2ZE0A 1N68A 4LSRL 3LD8C 1SOXA 3MBEC 4N0UB 2FIRT 4YHNA 3I6SA 3DECA 1EAPB 4CGTA 2ADGB 5GISL 3RPIA 3W9DA 1VERA 3FS9A 3ZRCC 1DVZA 3I9IA 2E4FA 4ZW3A 3UG3A 1XF2A 3N85L 1JDAA 2K45A 4QRPD 3NIFE 4R4FH 4EVNA 4ATWA 1UWXH 4DO5A 1HQRB 3IDYC 3PV6A 3U6XS 1DL7H 1EGJL 3KPPB 3MLSL 3FU9A 5H94B 5GGTL 1UCBH 3GK8L 2DJSA 2BOLA 2NYKA 1OGSA 3LRKA 4J8QA 2HVJB 3NJKA 4KPHL 2OQJA 3HN8A 4TQ8A 1COBA 5DZLA 4HYTB 5H37G 3RY4A 3DMMD 2Z31D 5T1JA 2FYYB 3PE9A 1PZ3A 2W94A 2EH7H 4LEXH 4MAZA 4M4RA 4XPTH 2CKBL 2HVJA 3B9EA 3EJYD 1I8IA 4C4BA 4ZFZA 1T0MA 1T03H 1NEZG 1FNAA 3VYOA 4OVVA 5DHXB 4F9PA 2WP3T 3LZFH 4QI3A 4N26A 4F8LA 5IMMA 4YUEL 3CD4A 5C0IB 5C07B 3NRFA 4YDLB 1NGZB 4RBPH 1KB3A 1KBBA 2ZAHA 4XVUD 5MENA 2Z1KA 4FQXC 2XNAA 1K4DA 5B7EA 4S10A 4Q52A 4XODA 3VXUE 1JYWA 5BRZE 1PLGH 4UZUA 5C0BE 4DP1X 1EDYA 5C9JA 3GM0A 3QIWC 4JW3A 5CGYC 1A9EA 1REIA 5TE6H 1M1XA 3X1BA 1T2QL 4YHZH 3RDJA 4NRXB 1N6VA 1ZTXH 4I85A 3BMVA 2NY2B 3POHA 4LU5L 3L48A 3GEFA 1PSKH 4AT6A 5B38G 3T0VA 2YIHA 1N6QL 3UABA 4NUMA 3ZOAA 4F1ZA 1JHKL 5J6SA 1ZJBA 2F15A 4LCIH 5KVFL 1DVFA 3TM6A 5IB3B 2A74C 2VR6A 2XN9A 3SO3C 3HAEH 3QUXC 5DD0H 2H0EA 3FU8A 2J2ZA 1ILUA 3O6LL 3C6LD 1OTTC 1SRDA 5IBTH 2GJ6D 2ZPKL 3M07A 3T09A 2DH2A 2X9YA 4R6UA 4KY1L 1YNKH 4R5XA 2UY6A 1KB5H 1BXVA 1MJUL 1CQYA 1MWOA 3CXDH 3UCRA 4XP6H 3B37A 4R2GD 2CGRH 3E2HC 3U46A 1KDJA 3VQLA 1P5UA 1OSZB 3VE0A 3T3ME 1NGWB 4GW5A 1AJ7H 3B5TA 4QD2E 4UQ2B 1UZGA 1U58A 5E5MA 5HXMA 4RZCB 1MI5A 4UMSA 1LVEA 2Y23A 3O6FC 3O3AB 3MRCA 4GP4B 4FQIH 2BRRH 3LS4H 3KPSD 1E2WA 1NLBL 1P4IL 3O2DL 4N90E 4XAWH 2AJSH 5AOZA 2VXQA 1QSFA 4K15A 1H9VA 4PMEA 5E8NB 4PQXA 2BNQB 4PJIE 1WVZA 3SDXF 1KN4H 4J5VA 3FH7A 2XQYA 3KEHA 3EYSH 2XZZA 1G6RA 3ZBMA 5INCA 4ENZA 4Y16A 4GRWB 1A3RL 3OWEA 3TBSB 3Q2CA 5I18L 4I1NB 1MLBA 2O61B 4NN5B 3U2JA 4BFOA 4UB0L 3DX6B 2KERA 3LXAA 4WW1A 4YPGA 1I3UA 3TEYA 4MTMA 4P4RA 3W5NA 4IKKA 4V1DA 3LRLA 4OGYL 2VIRA 4K5LA 4M7ZB 4MA1C 1JWSA 1A4KA 2VLKD 2A6DA 3HKZA 3HC4L 5PAZA 3BX7C 2LQRA 4RGNB 1RFDL 4B41A 1CXEA 4IBVA 2CMRH 3QQ3A 3M46A 2A6DB 1Q9KB 4ZUSA 1ZSDA 3AGVA 2Q3ZA 2YD5A 2KC0A 2V3EA 1HXYB 3B3IB 4PWFA 4BZYA 4JHZA 5IVZA 3SDDB 3VWKD 3W3BA 1ASOA 4WW1B 1AGEB 4PD4J 4BQ6A 5GXBB 1FGVL 5HHVH 1MLBB 4J6RL 4YGVB 3RDTA 3KVPA 4PVNA 1G7QA 2AEQL 5F9AC 3QIWD 3HZVB 1LE5A 4FI7A 4MNHB 3KLKA 2WLIA 2VNCA 4LCWE 4IMKC 2QMKA 5DXWA 5IFJB 5EO9B 1HILB 5EU4B 1B9KA 1F58H 4GRLA 1QSFB 1G43A 4K23H 5DHVB 5A6IA 3VFMA 5EU6E 1JFHA 3UTQA 1CGUA 2G4EA 4GG8A 4P5TC 4KK8C 4BFNA 3X17A 2CALA 4EQ3A 2YEQA 2Z64C 3P4NB 3SPVB 2DQ6A 4W4OC 5CGTA 4WO4A 1FDLH 3P77A 3D2UD 2BY3A 3FRUB 5SX5K 1NCIA 1UWEL 5JOFA 1AHKA 2AK1H 1BQRA 2Z35A 2VE6B 4Z77A 4FKHA 1JP5A 3O2VH 5IBUB 4IRZL 1UA6H 4ECNA 2Y5QA 1T0NB 1X4ZA 2P46B 4PV1C 3B9KB 3D2UA 4JDZB 3M17A 5BQDA 1ORSA 2BFVL 3OV6A 1WWAX 3FYEB 5EOCJ 5MERA 2GIYA 3WTYA 2HLAB 5K9JH 5JQIB 1T89C 3TTSA 2LVEA 2F58H 5DJCA 2GJJA 1I75A 1B0IA 4XP5H 3H9SA 3JTTA 4G6ML 4RA0C 5CEZE 1YECH 2MCG1 3WUWG 2YGOA 2FIKA 3WO4B 3H3PH 2A6KB 2YXMA 4YHIB 3W39A 1BBJA 1R3JB 1CFQB 4N8VG 4DKEH 1FJ1B 5LBGA 4WWKA 3LNHA 5ICYA 4NRXA 4Z7WE 4X7TA 1ID5I 1YY9C 2AJYL 3UG4A 4OJFH 2JNZA 4GXVL 4ZW6A 1XT5A 3IDGA 3S4SB 4PGEA 1WFNA 3K6NA 3ZTEA 2NY7H 2J43A 5BVJB 4N8UA 4HFUL 4H1LB 2ZOTA 5EWIL 2Y4SA 4NO2A 4PP2A 4W9LC 1P53A 7FABH 1I1AC 1ZTMA 2F5AH 1GHFL 3P9MA 4PV9B 1AGFB 2UUDK 2UXFA 3MUGA 4ZFFB 1I8IB 3ULVC 3W0WA 3QUXB 3QK0A 4LPUA 4NQXB 4M8QA 3IGAB 2V2TB 2EDQA 3ARBA 2EIMB 1JGDA 1DVFD 4XMUA 5L6YL 4W1TA 4MX7A 2E7MA 4P8QA 1IARB 1PZDA 2XY2A 3EDJA 2A77H 2YJQA 4PJHF 5E00B 2W65A 4NN5C 5G4NA 1I7TB 2X3CA 3FQYA 1IGYA 1OTUD 3ETBF 3EO9H 4FG4A 1IM9A 3D33A 1XFPA 4XCCH 4CL7A 1JZFA 1EHKB 3OKDB 1DVTA 3GI8H 4H1LG 1Z9PA 4JFTA 3VD9A 1TEGA 3TT3L 4HIIA 1S7RB 1SNRA 4N0UA 4XO3A 4KKRA 3TZVB 4OQTL 5E08H 1UJ3B 3PABA 4Y0GA 2CHWA 3ORJA 4M5YL 5AL0A 3V6OE 4FZ8L 3GMRB 2XG5B 1R9FA 4WNQA 4B96A 2WQWA 3L5JA 5LNDA 1MAML 3WJLC 3D0VA 3FJTA 1VZGA 3WJJC 4UDTA 1JERA 3MV8E 3RWJB 1KPUB 1YMME 2AJ3A 5T33L 1UXSB 3ZE0F 1QBAA 1MREH 2QV4A 3FT4A 1AQ8A 1WAPA 1IJ9A 1H8NA 1A3LH 3P4OB 3T2NL 1F4HA 3GHPA 5AW5B 3U4BL 3SKNA 1QW8A 2VZOA 5ID1A 1GJUA 5TK2A 5KUKA 1NCJA 3VXRE 3O9WD 1AZZC 2D7QA 2VLJB 4PJIF 2YD8A 2Q5BA 3BDYL 1F11B 5CZVH 4NQEB 1CL7L 2NCEA 5I0YA 2HTLC 4L8SC 5F7DA 4QRPA 5DA0B 2P42B 4HUVB 1YNTA 3L95B 1U3NA 3Q43A 4PP1D 2B59B 2OULB 2FGZA 2MQ3A 3U9UB 1DBJH 3N06B 1KCVH 2IWFA 4YDKL 4XNXL 4U1GC 3RHWK 4E9WA 4GOSA 2XIDA 3UCQA 3L5WA 5I1JL 1VADA 4FHKA 6FABL 1PZ5A 4LXFA 5FYKE 3CZFA 1LHZA 1I9EA 3ROLA 1U8OB 4MZ3A 3S3CB 4NQDA 5DRXB 3FN0L 2IBZY 4WY7L 1EFXD 2VM4A 2WOYA 1SMDA 4KVNH 4X6FA 4BHUA 3T6QC 3CFIC 1XBRA 1AANA 4AL8H 4ETQB 1A6TA 2LLGA 2Y07H 3GI9H 4GRWH 5KSVA 4DCQA 3DJ9A 1HKFA 3NJIA 1MF2L 4S1SH 2GY7B 3UO1L 2QPUA 4WI7A 4W70A 4PBXA 3PV7A 1CBVL 1MW3A 3U83A 2NW3B 4ODVH 1S4IA 5I71C 2VH5H 3I6GA 2N4IA 2VRKA 4OZGA 1N8ZB 2HUEA 1YQVH 2P52A 3D08A 3F58H 4JFQA 1X5AA 4NC2B 4RFNC 1MIEL 1JVKA 4QRQB 3TCLB 2ZNXA 3T3MB 4XZUB 4ANWA 3CC5B 1S46A 1G7LA 4BZ2H 2PMZA 4W9KC 1GGUA 3U82B 1AGDA 3LV3B 3HZKA 3MLRH 5DS8B 2MTAA 3QDME 3TPUB 3QFJE 1F6AB 4H20L 1TJHH 1F1AA 1GIGH 4ZBJA 3TZVC 3NFSH 4Z8FH 2X41A 3BAEH 4WDIB 4Z95L 3FTUA 3G5YB 4OKDA 3MKGA 2F5BL 2DMKA 1FBIH 2YMTA 1PAZA 3BWSA 4PRNA 4YVUA 5CAYB 1WD8A 1HQ4B 5AOMA 4AVHA 4XR8C 1B3IA 4FFWD 3U1QA 3L3GB 1PQZA 2EDKA 2HTKD 4DK3A 3L5XH 2GBAA 2Y9RT 1U8LB 2V9UA 1ETJA 1HEJC 4OW6A 4G6FB 2WVUA 4JRXB 1IGFH 5AFAA 4Q9QH 3AWGA 1SJXA 5AALA 3AY4C 5D7LA 3ARQA 1YEFL 4OUUA 2VMCA 4HUUB 1TQCC 2X4RB 4G6AD 4KQ3H 3VI4A 4Z7WA 4KKPA 5HJ3A 3IFPB 4AE0A 5KSBA 3TN0D 5LGHL 2YGVA 3DLQR 2YJLA 4GQ9H 4U6VL 4WFGE 3LNIA 3H0TB 1JK8A 3BCFA 4F9PC 3ULUC 3B9AA 2E7DA 4JFDE 4KWUA 2OR9H 1IEAB 1OD9A 2XKUA 1TITA 3BP7A 5EC1A 2WZPA 3VXMD 3EF4A 4Z3GA 1KFGA 3RAJL 1ASPA 5SWSB 3ZXAC 4JREC 3S96A 4AJWA 2NZ1A 2J12B 4DOHE 1AH1A 5GS2H 3L5IA 5LBSL 4KV5E 4Z7QF 3WNMA 4J6RH 4LL1A 4UU9A 5L0QB 3CQPA 1DQKA 3NIGB 1KCVL 3BSGA 4A1RA 2DTMH 2OTWA 4RDBA 4BFIB 3MTXA 4HKXB 7PCYA 1J5OL 4HH8A 1PZSA 2WQUA 3CZLA 1U95A 3CSYA 4KO7A 2EE3A 3LN5A 5B4MC 4KTGA 3GMOA 1D5BA 3VXUD 5L4JA 2Y2TA 4G71B 5C0BD 5MEOB 3Q5TA 2UVFA 3PGCA 1OHZA 1NMCB 5EBLB 4HFWA 2ARJB 1V10A 2DTSA 2VN5A 3AS2A 5GZNA 4ELKB 1WBZB 1KCUH 3FQ1A 3MMEB 1ZE3C 2YKLH 1E7VA 3JWOC 4IDJL 3OLIA 4ZX4A 1BOYA 2P5WD 2E9WA 3NGBC 5AW4B 3ZHKA 2AK1L 4FXGA 4KQ4H 4GRWF 5DJ6B 5GRVK 4OIBA 3VXSA 1KGCE 2CJUL 4GAAA 2EECA 3ILQC 3LIUA 4ZAKD 1KLGB 2W80C 5LWYH 5KVEL 4ZW8A 1YN7B 1KPVB 4YQXH 2X4SA 1G6VK 3CX5K 1BXXA 1D6VL 1DVYA 3IE9A 3O11A 5I9QC 5E7FA 3BOVA 3GSQA 3WNJA 4ACTA 3NH7H 4N2FA 5F89B 5FM5O 3LKOA 4R8WH 3MRKB 3HJ0A 5AOLA 2JQAA 4EIZC 2HRHA 3FT0A 4JHBA 3SPJA 4HG4J 3MJGX 5L2JA 3IFNH 1FORH 3LS5L 1ZANL 3ZW3A 1OO2A 1G94A 4HEPG 4PJFA 4OLYL 1KIQB 3FOLB 1SDDA 2CO7B 1BZDA 3HC0B 3CFEA 1MHEB 1TQTA 3R18A 4NC1E 2AERT 2VLRE 3EF7A 4HF5H 5DRWB 1MFUA 1P1ZA 1QW9A 1BLNB 4PJAF 1R34A 4XPHH 4ERSH 3DX7A 1H3PH 2FWOA 4NUQA 2BHFA 2XRAL 4M1CD 1MJUH 1JF1A 1FVDA 3MRBB 4AGNA 5HHPA 4XWGH 2IGFH 1XIWD 1OAJA 5F7AA 5F9DC 3GSOB 3TA3D 1V7NH 3QUYA 2EE0A 1R3LA 4OFYA 2MQGA 4UCFA 3VFOA 3FHEA 1OVZA 3VU1A 4E0RB 1TZ8A 3RPKA 3RU8H 3E3QC 4U3SB 1U4EA 3L08A 4DZBA 4CN1A 4KFMA 3WCYA 3QRBA 2NNRA 2NLJB 4IIQA 3MNMA 4K8RD 4UDUB 5D70H 5IJKC 3KNBB 3GIZH 1OM3L 4OF7A 5FWQA 3L3OC 5HYQB 3KXFB 3L3KA 4J4PA 3ZE2E 3DIDA 4GAGL 1YPZE 2UYLA 4IM8A 1NAMA 3RTLA 3ZKNC 3ULAB 3FULA 4H26B 5IMLB 3MXVH 1U8CB 2DWTA 3WEOA 3CE1A 1L0YA 2HCZX 4JRLA 4BZ1A 3QEQE 3IYLW 1CLZL 3L4XA 1KCBA 3DHMA 2ED8A 2JJSA 4N8CH 2VO8A 3FU5A 2QKIC 4MQSB 4EE2A 1W0WA 1KLFA 3DX0A 2BSBA 2AK4A 4OI7A 4MD5A 3RGBA 2QQKH 3D4YA 5DHEA 2X6CA 5MHSE 2DD8H 4EUPB 3NIGE 5FO9A 4Q9RH 5ETUB 1T2JA 2Y3AA 4PSRA 5IESH 2HB0A 4Z3FA 5EORL 5JQ6H 1F4YL 4NC0B 2VDOL 3WIFB 1E4KA 2AW2A 1P84J 1U8QB 1ZLEA 3BVXA 5HGDB 3N41F 1SXNA 5GJSL 1JF6A 3UIYA 5FLVA 4DUXA 1BM3L 3EO9L 4ORGB 3SGDH 3RWEB 3X14B 4P9HH 3RLSA 3MRDA 3DTUB 3NABL 3MLPA 2GSGA 5JIPA 3MX0A 2DIBA 2ADYA 1J9SA 1RH8A 4OCXH 5C6WH 1TYRA 1EEZB 3UTTD 5DT1L 2X4QB 1WAEA 1PG7X 2JELH 2F8VA 4TVSa 1MJ8H 5HGBA 4U6TA 1EDHA 2CLRA 2XWTB 2JB6B 3DTDA 1AZVA 5AVQB 5GRJL 1MVUA 4TUKL 5EIQA 5EHFA 2TSBA 1UOLA 3CN2A 5F0PB 4U1IA 5E2WL 4L0ZA 2OJEB 3FB6B 5AVVB 1JZ5A 4FXKC 2P80A 1NBYA 4HK3N 1CF8H 5IZ7A 3QGVA 4YHPB 3QH3B 4HQQH 2QJDA 3FT9A 4EIGB 3MLVH 4HJEA 1MFMA 2WLZA 2WAQA 4I88A 4EQ2A 1WZMA 3RDTD 2AJYH 3GLDA 4JB9L 1D7DA 3K3QA 3VFGL 5E51A 1V7NL 5F3HA 2BLFA 3FCTB 4AQEA 2VSDA 4DN3L 1HU8A 4EBQH 3BSZH 2B4CL 2E9BA 5F8RC 4YDLC 5FR3A 1OGAA 2GI0A 2VDQB 5JHDE 3SBPA 4HD5A 3ZGIA 4GG6B 3P3TA 3VO0A 4UT9L 3SIKA 4XP5L 2KLSA 3RY5A 1Q0YL 3IDJB 2LU5A 4N2AA 3OL2A 2GT9B 4LSSH 3DXAA 2K70A 4PCYA 4MD4B 2PO6A 4G9FE 3ZE0E 4D0BA 5EIIG 2IPKA 5AKTA 5AB2A 3V6ZA 2QEJA 1CB4A 5MENE 4GS7B 3OKNA 3TIEB 1FZJA 2ZKHL 1FRGL 3MI6A 3CLEL 3O45B 3K5RA 5F71A 4JGJA 1DYZA 4PB9H 4PGJA 5IV2A 4M43H 3F7YA 4RETB 1UM6L 4AY0A 2FNBA 4JX0A 5I1CH 4BHUI 4LNRB 1EEYB 3N1PC 3CFNA 4J3VA 3MGOA 2XZCH 4QXUL 1J8HA 2KZKA 1S7VA 4CGUB 3UYPA 2BW4A 4GLRI 1QI5A 2DLHA 4PRPD 2PNDA 3KLLA 1IBGL 2XXFA 3HLKA 4OJAA 4P2QB 4FMVA 1ET8A 1XZ0A 3LN9A 4PJFE 4BFKA 1BOGA 1GTFA 5GS1A 1VKXB 1QRKA 3ZL4H 3SGKA 3U0WH 1A6VL 3UYPB 4J3OG 5BZDB 1YHPA 1SYVB 4NKMB 4PRBB 1AI1L 2P24B 2E3VA 3MLTB 3NACL 4PG9B 4R7VA 4FABH 2DN7A 5AD0B 1DJYA 1EA9C 1C08A 1TT6A 4RLDA 1GGCH 3F7YB 4LLDB 3S97C 2G3ZA 3S4SG 4HGKC 4UM8A 5AZ2L 4NENB 1A3LL 1AKJB 2IAND 4KGJA 5K1VA 2YRZA 2HT2D 5LXVA 2VDOB 3CFCL 3HPLA 4XWOD 4D0BB 5DZ9A 1ZRUA 1NCDL 3QI9B 4Z78B 1GSKA 1TLMA 2PP8A 1BQHB 2X87A 4G70B 5HP5A 3FT2B 3QRGH 1WBYB 3BZ5A 1IKFH 4MHHI 3UZVA 4PJ6A 4TUJB 3W56A 3L2MA 4GG6A 3O2DA 3GB7A 1SQMA 2JKSA 5DLML 2D73A 3AS3A 1JWMA 4ONOA 4IU2B 5EUKA 2F08A 5HVHC 5J06A 4MMZA 3HCVA 4FEMA 4KNTA 2NMSA 2QADC 3J2PA 4D8OA 5EU7E 3WBDA 3U2IA 4FF9A 3BPNC 4IJ3C 3HZYA 2P5EB 1VFMA 4Z7NE 3U9WA 1T5WB 1USQA 2JJUA 2AK4E 3QE5A 4OM0H 2R0WH 4BFEA 1KYUA 3ZX1A 1D5XB 3M1CA 2PETA 2Q1EA 1HOCA 3FCSB 1G7MA 1JUFA 1IQWL 5EU6D 3LKNB 5K59F 4EOWH 3DYOA 3OX8B 3J8F7 4P3DB 3ZDXE 4K8RL 2H7WA 4LKXA 5AAWA 2CM5A 1T7ZA 3VRIB 4YVNA 2H0JA 3VI3A 2JTYA