2OV0A

Structure of the blue copper protein amicyanin to 0.75 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title Ultrahigh resolution studies of amicyanin
rcsb
source organism Paracoccus denitrificans
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ov0A00
3TASA 3AZUA 1ZDSA 2I85A 2YAHA 1L9TA 1URIA 3CVDA 3IN0A 4HCFA 5B1AB 2JKWA 3BQVA 1WS7A 4HCGA 3ZX1A 4A2EA 5I28A 1CYWA 4AX3A 4AKPA 4YVNA 1HAUA 4WTQA 3S3CB 2BW5A 4E9WA 2E86A 2XYBA 1X9RA 3PAZA 3T6ZA 4DP0X 1OCZB 3H4FA 2TSBA 2PP8A 2R7EA 4YSAA 7PAZA 1AZRA 3T6VA 9PCYA 5B7FA 2JXMA 1OE3A 2BWIA 1RKRA 2EIJB 2H3XC 2X87A 3N55A 2FQDA 5D4HA 3FU9A 2Q5BA 3H4HA 4KNTA 3UABA 4GY4A 5B7EA 4UAHA 1JVLA 1NPNA 1A8ZA 3X1NA 1IUZA 3CVCA 1E30A 5ANHA 2YAMA 1PNCA 1BXAA 4F7KA 2GIMA 4M4RB 5I6MA 1MZZA 3FSWA 1AZCA 1HAWA 3NP3A 2ZONA 5EHFA 1L9SA 2BP8B 2IWKA 2J57A 2NRDA 2DYSB 3UACA 3AY2A 4HHGA 5I5JA 3ZBMA 1NIFA 5B3SB 4P5SA 1DZ0A 3NP4A 1NWPA 1WA2X 1V10A 2JFCA 3FQYA 1GSKA 2VW4A 1UATA 1J5DA 2PLTA 4CSZA 4AZUA 1ZIAA 1AACA 3JT2A 3X1FA 3X2QB 1CUOA 4GXFA 4AKQA 2ZOOA 4DPAX 1SFDA 2VW7A 3FSZA 2J5WA 4A67A 1KDJA 1CURA 4KO9A 4BDVB 7PCYA 4M3HA 3EH4B 4BWTA 1NWOA 1YLBB 1J9SA 3IBOA 1AQ8A 2W8CA 3MX0B 1WA1X 4JHVA 2QPDB 3NJKA 5AZUA 1L9PA 1ZV2A 3T9WA 3WIAA 3C75A 4X4KA 3PLYA 3QQXA 1J5CA 1ASQA 4G7RB 3ERXA 2HX8A 2EILB 5D4JA 1JOIA 4PCYA 1JZFA 4YSDA 2XX1A 3NT0A 4DPBX 1E5YA 3WG7B 3GYRA 2PP9A 2XV0A 3NYKA 2VM4A 5FC9A 2UXTA 3N2JA 2IWEA 1SF3A 1W6WA 3UAEA 3CVBA 2WO2B 1W8EA 2YAFA 1FWXA 3AG2B 2CCWA 1KGYE 1ET5A 1OE2A 3AW5A 4A2DA 2BWDA 1SFHA 3S8GB 2HX9A 2H5UA 2VSKB 4HZ1A 1SF5A 1ZPUA 1IBYA 1BAWA 6PAZA 1AZNA 4DP1X 4HCIA 4YSCA 3RYMA 3TBBA 2EINB 4MFHA 2YXWA 4RH4A 5E9NA 1L9RA 1JZEA 1V55B 3T6XA 4AKOA 1BXUA 2GC7C 3GDCA 2VSMB 4P5RA 3X1EA 3WI9A 2FQFA 4KOBA 2QDVA 4YSOA 1E65A 4BXSV 2IDTA 2R7EB 1EZLA 1OV8A 1PCSA 1RZQA 2FJSA 3KW7A 3NJJA 4G7SB 2DWTA 4KO5A 1DYZA 2FNWA 4DPCX 3DIVA 2CJ3A 2IDQA 1AS6A 4KO7A 2XU9A 1JZIA 5B1BB 1N70A 3DTUB 3ASOB 2Y69B 1JZJA 2YAOA 2VW6A 3OMNB 1GW0A 2PPFA 4L0PB 2A3TA 1FFTB 1I53A 1AOZA 3TBCA 5AFAA 1IKOP 1B3IA 1BQRA 3L45A 1ADWA 1EHKB 1PF3A 3WNIA 1JERA 1A3ZA 5B7MA 4DP5X 2LLNA 5IY5B 2BW4A 3NJNA 3OMAB 4HAKA 1NPJA 1ASPA 3X1GA 1NIBA 3UADA 2YQBA 2HXAA 4A68A 2DWSA 4F2FA 3FU7A 3SBPA 1MZYA 1SHXA 2UXFA 2FWLB 4BWWA 2UX7A 3NJLA 4FAAB 3FPYA 3NJIA 4DP9X 2CBPA 2PPDA 3PAVA 1V54B 1PZAA 1CC3A 3S3BB 3FQ1A 1NZRA 5F7BA 2MTAA 2GHZA 1N68A 1NDTA 3G5WA 1M56B 2VM3A 1ET8A 3FU8A 4A2FA 2GC4C 4JKNA 5B1KA 2OCCB 3QJQB 1RZPA 1NIDA 3NJFA 1GY1A 3SQRA 1KCWA 2BP0A 3EF4A 5I5MA 3NJMA 3FSVA 5B1JC 2PPEA 1TU2A 3CG8A 3IE9A 4YSTA 2UXGA 2P80D 2YAPA 3S3DB 3S8FB 1IBZA 2EIKB 3FS9A 1ETJA 1J9TA 2I7OA 1VLXA 3NSFA 4BWUA 2IWFA 8PAZA 1OCCB 4HIPA 4YSPA 1QNIA 3PXLA 3OM3B 1MDAA 1ILSA 1ZIBA 2AANA 1QHQA 1L9QA 2XXGA 2X88A 3JTBA 2J56A 5AKRA 1XMEB 1AIZA 1OCRB 1KCBA 3ABGA 2PCFA 1JXDA 4YSUA 1TEFA 2ZWNA 2IDSA 3T71A 2BZ7A 1A4CA 3EH5B 2WSDA 1NICA 4E9VA 1JZGA 4KOCA 2HX7A 4N4YB 3T6WA 4KNSA 3TA4D 3AG4B 1AAJA 1HFUA 3AG3B 2EIMB 3NSYA 4GP5B 2ZXWB 2OV0A 1BYOA 3FYEB 3EH3B 3UAAA 5PCYA 1PY0A 2YXVA 1SNRA 2FT8A 1M9WA 2XUWA 1M57B 5I26A 4E9YA 4YSEA 5I6NA 2WO3B 1PAZA 1NIAA 3FQ2A 2W88A 1XB6A 5B1JA 4E9RA 2P80A 3AG1B 1JVOA 1ID2A 1A4BA 5D4IA 3ABMB 3ABKB 4NAJA 2XX0A 3ASNB 2BO0A 3TU6A 1ILUA 2MRYA 2XLLA 3HEIB 1BQ5A 4YSRA 3ZIYA 4YSSA 3MBWB 1SJMA 5TK2A 1AR1B 4ENZA 2VN3A 1GS8A 4N8UA 2FT6A 1A4AA 2Q9OA 2YAQA 4HALA 1NIEA 2DY2A 3FU7B 4YVUA 2FT7A 3QPKA 1BEXA 2IAAC 2AFNA 4CSPA 3SBQA 4K9JA 3V9CA 4PAZA 1A65A 2XV3A 2J55A 4NB7A 2XVBA 1KDIA 3V9EA 4FA7B 5PAZA 2QPEB 1BYPA 4DP7X 4W9ZA 3NSDA 1XB3A 1J9RA 2DV6A 1SDDA 4Q89A 2BP0B 1NTDA 2VMJA 2B3IA 1XB8A 3H56A 1PLBA 4DP2X 2IDFA 4QLWA 1JXGA 2GSMB 3EHBB 3GXUB 5TK4A 1AZBA 3CDZA 1F56A 2IDUA 4G71B 2GBAA 4NERA 4E9QA 1CYXA 2XWZA 1FA4A 5I6OA 1WS8A 3OD3A 4E9XA 2AZUA 4E9SA 2FQGA 3IEAA 1QLEB 2HRHA 4KO6A 2QDWA 4JHUA 1GYCA 2BZCA 2Y1AA 3ZDWA 1AS7A 1KV7A 2XXFA 5I5IA 2FTAA 3NSCA 1W6LA 1PZBA 2QT6A 4W1TA 1ASOA 3NJGA 3SBRA 3QJRB 1PLAA 1TEGA 3HB3B 2PPAA 3OQRA 4TXVB 1KBWA 4G70B 1WAEA 2DYRB 1X9UA 4BK5C 1E67A 2PP7A 3BVDB 4DP8X 4Q8BA 4YSQA 3FYIB 2HZHA 2RACA 1E5ZA 2IH9A 2XV2A 3UGEA 1J9QA 3D12B 4A2GA 2BP8A 2HLEB 2GB2A 1JZHA 4ZK8A 4GYBA 1OF0A 2PPCA 3FPXA 4WKXA 5F7AA 2AVFA 2N0MA 4HHWA 1L9OA 3PCYA 1TKWA 3FSAA 3OMIB 3QJVB 4F2EA 2UXVA 2UX6A 2YAEA 3NJHA 1GS7A 1GS6X 1ET7A 1AZUA 4EF3A 2AZAA 1OOWA 3KW8A 2CAKA 3PPSA 1AANA 2HRGA 1OCOB 5I6KA 1AS8A 4BDVA 1JXFA 3FT0A 5LDUA 1PZCA 4AI7A 1WA0X 2OJ1A 1R1CA 1KBVA 6PCYA 3DKHA 4G72B 4BXVA 4GP4B 4KNUA 4DP4X 3ABLB 1AG0A 2IH8A 4QKTA 4GP8B 4UF7C 4A66A 1GR7A 5A7EA 2FQEA 2CALA 2GI0A 5I6PA 1SHWA 1KYAA 1NINA 1PLCA 1SDDB 3IN2A 4G7QB 3WNJA 1AG6A 4A2HA 2BHFA 3CZUB 1GY2A 3QJUB 1OE1A 4UANA 4E9TA 3QJSB 3U25A 3CDZB 3QJTB 1PNDA 2CUAA 1ZDQA 5I6LA 2I7SA 1PMYA 3WKPA 3X1BA 1BXVA 1IC0A 4YL4A 3WKQA 2TSAA 1T5KA 1MG2C 2PCYA 1BQKA 1MG3C 2B08A 2H47C 3PAUA 4DP6X 1RCYA 2YARA
chains in the Genus database with same CATH superfamily
3B5HA 4L4TE 2WGXA 4R7DB 5KN5B 1N12A 2CO4A 3MOQA 4OQTH 5I9QC 4BQ8A 4JVUA 2VDKL 4A2EA 5D7JD 3ECWA 5D1XB 5AL8A 5ICXB 3WDJA 2FBJH 3DBSA 4AKPA 4NJ9H 1U8CA 4PMEA 2GJJA 3A67L 1NGPH 1EHXA 5JO5B 3T6ZA 1XBRA 3T5WA 3LRSB 5DHVB 4PQXA 4EQ3A 1J88A 3KH3A 4MRBA 5HHQB 2JK5A 3ATEA 3BD3A 4FCHA 4PMFA 4K5OA 3A4FA 1ZLDA 2C9QA 2CJTA 4D0CB 4U0QB 2W9LA 1OLLA 1YDPB 1CI3M 3CVCA 1YC8A 4A37A 3VDBA 4C56A 1SUHA 2OXHA 3S36X 5JORA 2PR4L 1EBAA 3T0WA 5CBEA 3SE8L 1AZCA 4IU2B 5FR3A 2FLBT 3BKCH 3FO0L 1CICC 3K81A 5F7KC 3S5YA 3BVTA 2EEFA 3UTTD 1DL7H 1FSKC 4O9HL 5FDYA 1MCIA 5LNEA 4YS4A 1AY1H 4XXWC 1DQML 1XCQA 1H9DA 3NIGB 4BFNA 3ZBMA 5IKCB 5IQOA 2XKNA 4PRHA 4EIZC 1DZ0A 4G80B 1Q90A 2NTFB 4KNQA 4LSSL 1DQDH 4RFOL 4RNRA 3FTVA 1AACA 4KRPD 2YPVA 1ZT7A 2YD2A 4AKQA 3VXRE 3BWUF 4YJZL 5HYSA 4XI5D 3GSUB 4ZPTB 1LWRA 2YRPA 1YEGH 3L9EA 5DYOB 1RUAH 5DUML 4PI2A 1RZIA 4Y16D 3US0A 4Z95L 3PF2A 1OTUC 5EWIL 1WA1X 3HI6L 4IJ3C 3NJKA 5SX4I 2C7FA 4YHMH 2EDMA 4OF6A 1L9PA 3ZZ1A 3P4NA 2BVQA 3VFWA 3WTYA 5DD3L 2OR7A 1BZ8A 1A3LH 2IADA 7TAAA 4G7RB 2DM7A 3R19A 3BC9A 1F58L 1NCDH 3FQTB 4FG0A 3NT0A 1ZWIA 3ILQC 1D5BB 2VXVH 4B53A 1X6NA 3ISRA 4B0MM 3OX8A 4UIMB 3HAEB 1JNHB 2F5AH 5BRPA 3CVBA 4TSCL 4WHCA 4KK9D 1FO0L 3D39E 3ZDYF 4C47A 1HKFA 3MLUL 3WNNA 2KS0A 4L4TD 4PJ9C 1FNGA 3SO5A 4FQJH 4TQHA 7CGTA 2X2HA 4M7JH 2H5UA 3GWJA 1DBAH 3CXDL 2CNZA 3BXNA 3O3EB 4NGHL 3LXCA 1Y6MR 5ACMA 4Q0XL 1ZPUA 3PQYD 4W9LC 6PAZA 1KIPB 4ZQTA 3O6LH 2Q6WB 4RBPH 4ODXB 3P11L 32C2A 4X7FC 1MWOA 3SCMD 4MFHA 2RBLA 5EOCL 3KGTA 2A6JA 4HIHB 3ROLB 1SXAA 2IWGA 2NT1A 3VXOA 1V55B 1UB5A 3G5XA 1HC1A 2ZCZA 4K3JH 1M7DA 3MCKB 3HG1E 4OFDA 2QDVA 2EDLA 2XA8H 2C7UA 2R1WB 1D5XA 1O6SA 4AEFA 3NJJA 1UM6H 1BQLL 4U1LA 3MRMB 3WD5H 1YA5A 1U9KA 5I30L 1QUNB 2XWJB 3G5ZB 5DZNA 5C0IB 4IBQA 1HHJA 5GJTL 2I24N 4HKBA 4RWHA 1HWWA 3N43F 5D2LA 5LKNA 4NWTL 4WUKL 1TJXA 2ZXDA 4L3EB 5FLVA 4TUOB 4DVBA 5JXEC 2JCCB 1CFTA 2RMNA 1MCLA 1A4JA 1XGRA 1KB9J 5TF1L 4TNWK 1JCVA 4Z0XA 1E4JA 1PIGA 1W16A 1IM3A 5B7MA 2V0AA 1PYWB 2BW4A 2VLKB 3RQ3A 3ARED 4F1SA 5KYUB 3JWOH 4RGMC 3UAJA 2VNCA 1N5YL 3FT2A 4RMUA 3F6LA 4GAYA 1E40A 1DUYB 4M8VA 3RVXD 4YO0A 1ORSB 2VISA 5L2KD 4AENB 4EO5A 3QHZL 4DP9X 4KTDL 2X12A 4LBEB 4CW1A 5IG7A 3L5IA 4OLWH 3IXTB 1N6QL 3DXAA 3V0VA 5J5EA 1DQIA 3GZQA 4J4PA 4WNSA 1OAXH 4WK2B 5D7JB 4PTUA 4YOKA 5TGBA 4JMNA 3M86A 1F4WL 1HCVA 5FUCC 5TE6H 1ZCRA 5F96H 1INDL 3V5HB 3DDGA 2QPSA 3RNQA 1CFQB 4XH2B 5D1ZC 4ZMPA 5EU6E 1A2YB 2NW2B 3FK3A 3FSVA 1OAYH 2R15A 3RI5K 1KY6A 1R5WB 4FQ2L 5BW7C 1XSJA 5ALCL 3VI4F 1KIQA 4X7EC 2BHYA 2D7NA 2XZAL 1PD1A 4DKAA 4TVPE 3JXAA 4K9EH 3D3VE 1NBZB 3BKMH 3D39D 4JFQA 4YHNA 5DJXA 5FAAA 4F7PA 2EDWA 3MXVL 1DDTA 2AABH 5EFIA 3DVIA 1EK3A 3ML8A 4YBLB 4GG6A 3B9KB 4QXUL 3SBWC 3EO9L 4MQXC 1V3KA 4LSTL 3S0PA 2A1WL 4XPGL 1OALA 4OBSA 4UQDA 5HGDB 4GUPB 4U33A 4LDEB 5JIMA 3QIUC 3QH3B 1ZANL 3UTTB 4JY5H 4XHJC 5C86A 3FB8B 2PR9A 2DD8L 4BYHA 4D9LH 3AJ7A 5E0QA 4EN3B 3HG1D 5E95B 1P6FA 4N28A 3FQXB 3HIZA 3IKCA 4H5SB 1KCBA 2YMXL 3MFGB 1O7DE 2DI7A 3QIWA 1OTTD 3KPSE 3O8XD 4F8OA 3FW6A 4I2XE 4K7PH 4KRPB 1OCWH 4OFYD 3RVUD 1LK3H 4PJHF 5E1AB 1EGJL 3APCA 4O2FB 2WXPA 3IMWA 3DX7B 4XOAA 4Y2NA 3L3HA 3FYEB 3TCLA 1QSFA 4APQC 4ZUWB 4ZMWA 1U3YA 2GBVA 1I3GH 4OD3H 1OLZA 1A1NB 1E9PB 2MHAB 4LIQE 4G8GE 3PPEA 3T2NL 4BFIA 2R1XB 2BERA 1TJMA 1PAZA 2O5XL 5D1XC 3ZKMC 4GSQA 3BP5A 5E00B 1A4BA 1YMME 3ZDXE 4HOMA 1BSIA 1MHHB 1KB5H 4YC2B 2YWYA 4JY4A 1MFCL 4JGMA 1ILUA 2ATPA 5IVNA 5EUKA 3DBXA 5GGTL 4NKMA 4PW9A 1RHFA 3FH7A 3OJDB 3FT1A 1KB9K 1LO0L 2KQMA 1IM9A 1GS8A 4KAQL 4N3UA 5EC2A 2H26B 1NEZB 4GRWF 3FOMB 1T4KB 5JHDD 1MFBH 3VFSB 2YMOA 3BGAA 3PWPE 3QPKA 5KAQG 1I7TA 2ZPKL 1SXNA 1ZVYA 2QFRA 3GT6A 3PQYB 1KBKA 4JO1H 5HY9A 4AUUA 4JFUA 4DT2A 3J7HA 3MGOA 3IVKA 3SCMB 4DOHE 5FA3B 2J55A 4QOKA 3LKRB 2XVBA 5J12B 5JR1H 3UJTH 1JYXA 3OKDA 1X5KA 3HBQA 3NSDA 5MEOB 4FFZH 2X41A 1UH3A 3DPBB 3TPUA 1JGLH 5AZ2H 5E8EA 4NFBA 4KJWD 4DWHA 3F3HA 3H56A 3MNWA 2XG5B 4NQCA 3MV8E 4ENEC 4Z7VE 4JDEA 2H2SD 3EYSH 4R5VA 5TK4A 1DCLA 3WEAA 1LO4L 4ZUSB 3CDZA 4JFED 1A47A 2LW3A 3RDTC 3T4YA 4XO5A 5EZIL 2HH0H 4UNUA 1CE6A 1U95B 2QQQA 2Z35A 1E9QB 3LRMA 5C71A 3CCHB 3FCGA 5KSBE 1M7XA 3B3BA 4O5LH 2JJTC 3CLEH 4U1HA 4NKIL 3ZMRA 3KHOA 4MCYA 4UDUA 5KJ4A 3MRLB 5HDQH 3T09A 4K7PX 5I1JH 3HR6A 4HMDA 1K5NB 1UYWL 3W1ZA 4WFHD 3CMGA 3OMZA 2YGQA 2L0DA 4NI3A 2VLRA 3ZDWA 2NUTB 1FBIH 3QISA 5CMAB 3O4LE 3TNNB 3ZJAA 1JWSB 3B56A 4KV5E 4MA3B 1W0VA 2FTAA 3AREB 3T0EE 3B4NA 3K0YA 3E3QE 1A7NL 3HVNA 4U6HB 2QR0A 1ZT4A 5FO9A 1MRCH 5IEHB 1TSRA 4AYBA 1HSAA 2A77L 2APSA 5MENB 3E7JA 4M00A 3EJJX 5GGUB 5L2KB 1FV1A 5FKPB 5JDSA 2E76C 2J8HA 2R2EA 2EDJA 3EJYD 3H54A 4M7LL 5I0ZA 4FFYA 1WT5A 2Z31D 4KWUA 4X9BA 4Y1AA 4G8GD 1NANH 3RTQD 3FJTA 4PGJA 3SOTA 5D71H 4QRFA 1U92A 3CHSA 3RUGF 4WI5A 3KCPB 3FQRA 2BP8A 3QQ3A 1TQCB 4X6EB 1YMMD 1I4FB 2C9RA 3KEHA 4J23A 4PJCF 5CWSB 1JFQL 4OJFH 4G8AC 1C5DB 4YDJB 4X6DA 2OBGA 3WUWG 1F90L 3KGRA 1LK2B 3IAQA 1RZKH 3LB6C 4AM0Q 4Z9KB 3UEZA 5B3JF 3K71A 3FMGL 1ZK5A 4B9KC 3QJVB 5CSGA 3QR0A 2OMZB 4M03A 3STZA 1CPUA 1JPTL 3I02A 4H25B 4JO3H 3U36A 2NYYD 4C83A 4OB5H 1GS6X 3VB9A 3Q9PA 3AMLA 1E7VA 4PJFA 4EEEA 2VDQH 4RAUA 3OXRA 1UM4H 3RVWC 4JKWA 1N7ML 2HRGA 5F0JB 3ARDC 1XGZA 1T22B 1KPRA 1XGTB 2GKIA 1MVUA 1URZA 3PV7A 4K5MA 4G9FB 3PDGA 5FB8B 4R0LA 4DP4X 3HG1B 1ZVSB 5GS1A 3ZXAC 1MJ7H 1JHKL 3WFEL 5KVMC 4KZEH 4A66A 3TESA 1PKOA 3F7QA 1OP3H 2FQEA 3OV6A 4P2QA 5E9DE 2WBWB 4YGAB 4RLDA 3ZQWA 3KBHE 3O8XB 2I9LB 3L9YA 4JQVA 4XPFL 3II2A 3C60D 4W81A 3AADB 5L8LB 3EDEA 1XQ4A 1QR1B 2XPGB 2HVJB 3CZUB 4CU7A 3B2UD 4W9DC 4WF7A 5ADPL 2ATAA 4Z7WB 3W56A 3UG3A 1KLUB 3QJSB 3GM0A 3N85L 2QV2A 4PIRF 5CZKA 2V3FA 5LVEA 3QORD 5A6MA 4PJAE 4FI8A 4RAHA 4YL4A 2AJ3B 5CJXA 4U1JA 4JKPH 4A7GA 2W5PA 1BQKA 2F7OA 2PWHA 4K3DL 1Z9PA 2H8PA 3LQAC 2WXQA 4JRLA 4EZLA 5D7JC 3GZKA 3WKML 1IC5H 4NENB 2WHVA 2H32H 2OCFD 3ATFA 2UWEE 3KPPA 2A9MH 3HBZA 3QQ4A 4IRZL 3RVTD 3T0ED 5I28A 4UT9L 3Q0HA 4X7TA 1OPGL 2V5TA 1CYWA 3ARTA 1CLCA 3MU3A 4HJJL 3S3CB 1ZE3H 2VZUA 3K6FA 3PAZA 2QQKL 1W9XA 4HWEL 2ZG1A 3GB7B 2YUVA 5DWPA 1KBPA 4K3EH 4ELMA 3RIAF 4UOQA 6TAAA 1NC2D 2XICA 4HYTB 4K15A 2EEBA 2JXMA 3JWDH 1G0DA 3QE5A 4FFVD 5IP4A 5JHDB 4NDMB 2ZYIA 4LASL 1X4ZA 3H4HA 3UABA 1XF4A 2EEDA 4YBLC 5DJDA 4I7ZC 3SIKA 2R23A 3X1NA 2BVUA 4KK5D 1M1XA 3FUJA 3RX7A 3W81A 4AM0B 4F9LA 3K2IA 5F7YC 5CKAA 1CIDA 1IGIL 1NMAH 4HFUH 1JNJA 1RZ8B 3GMMA 2YD9A 1OGPA 4TVSa 1ODAA 3EOAB 2A74A 2VDML 3U48A 5IQ7L 1I31A 3QK0A 1HH6B 3LIZA 4PLJD 3WFHA 1HINH 1E9OA 1FGNH 1ETA1 1PKQB 3A6CL 3LQAL 2F5BH 3CZGA 2AQQA 4X6CA 3RL1B 4DZ8A 4W9IC 2NX5D 2PKDA 4LEBA 4JO2L 4OZIA 3FO2A 1RY7B 4P5SA 4RDBA 4ZX5A 3TV3H 4JFEB 1V10A 4EKXA 5AW6B 4KRPC 3CLFL 1GZQA 3EDKA 1GGCL 4S1SH 4I3SL 3KS0J 4OAWB 4ZOBA 2FDBP 1WEJL 2E27H 2WBJD 4B3EA 3ISYA 1R9FA 2AKRA 4XI5C 3ZTEA 4UNVA 3MAWA 4GXFA 3OF6D 3OKYA 3ZQXA 3CQFA 1SFDA 4GBXD 1XF5B 2APWA 1NCJA 4YXLH 1M4KA 4FJZA 1X4YA 4JR9H 3MRRA 3EZ8A 2VR5A 4PJEA 2ZUQB 1U8NB 2W8CA 5E9DD 2DB8A 4JHVA 4UB0L 3L8QA 1Y18A 3HN8A 2EE0A 1U0QA 4WY7L 1N8OE 3IJYB 2BIMA 5JOPD 1S3KH 5LGHL 3T8VA 5JPNA 1KCVH 3SYAA 3E8UH 4YC2C 1DDHA 4A2LA 5FPIA 3K2UL 2ED6A 3SQBB 3RGVB 2ZUTA 4OD2A 2G0LA 3PGDA 5LBVA 4KK9C 4D8PA 1RIVL 3BUTA 3Q5YA 4G11A 3T4AA 2Z31B 4AMXA 3D4CA 4QJ5B 3FUEA 1GOHA 1T7VA 2EVJA 3DURB 4I18B 4D8OA 1ET5A 1YEJL 1YMMB 3GM8A 3VH8G 3FHEA 1OK8A 3SCMC 4JJ5B 4L3CA 2KYIA 2XG4A 5J12C 4DP1X 1DLHA 4Y9EA 4L5FL 5T1DH 3VXNA 5BUPA 5KBLA 3VTAA 4D3CH 3V6ZA 2FJHB 1D6EB 3FCTB 5ABAA 5I15H 1S9VB 4OT1H 2EDHA 4WZ9A 3W39A 3QI9A 1DVFB 3OZ9L 1E5BA 1UA7A 3B2PA 3WS6C 4Q56A 5DD0L 4NJAH 5C3LD 2EDXA 4BXSV 2V5RA 1WP6A 1SDYA 4G7SB 1BZQK 2Y7MA 4HF5H 5SV3A 1Y6NR 4LLMB 3ULVE 1NKOA 4ZTPL 4LPUA 5HHXH 5L4MA 1TZGL 1H5BA 3IRPX 1QFPA 4UDTB 1RIHL 3RWCA 3C6SA 3DTUB 5KVDH 3MCLH 1XIWA 1EXUA 1OAUH 3TX4A 3NQIA 3AQYA 4FS0A 4POYA 2EICA 2XI9A 1WAPA 4JE4B 5E1QA 3L3KB 3KM1A 3AXLB 3L9BA 2A3TA 4EZJA 1FFTB 3NK3A 3IE4A 3U9UB 1IKOP 1B3IA 3C60B 1QHOA 3AREC 1AP2A 2D3NA 3ZR6A 1A3ZA 4K71B 1ICTA 3GPSA 4WKZB 3V4LA 4CAGA 4DP5X 5CEZH 2ORBH 3IETB 3F7VB 1DBBL 1ASPA 5C0CA 5KYXB 4EI5D 3RVXC 1J5OL 1BFTA 3QORB 5HGGS 2NXYB 1YNKH 3CDYA 4N2DA 4PJXF 5F7DB 2I9TA 1XF3B 2XC8A 2MQGA 5HVFB 1R3KA 3QIBB 2PMZA 3U6RA 1NL0L 3OZLA 1BWMA 1WWAX 2E7BA 4MSWB 3T0EB 4EVNA 4ZMVA 3FC8A 4XWGH 1KTJA 1XCWA 1TQCC 3WSQL 2QHRH 1RZPA 4GAJH 3G9AB 2QADD 4XNDA 3M1OA 1R5VB 5I5MA 1RZ7H 4MX7A 1CDJA 1DE4B 1M71A 3O45A 3JV4A 4YZFF 2WZ5A 4BZ1L 3P0VH 2UXGA 3TYFA 4HUMB 4MNGB 3VWKD 1Q9OB 4AZ8B 3S3DB 2DQDL 2W60A 2HVKA 3BAIA 3GRWH 5D8JL 2R0LH 3NSFA 3TBWA 1XTMA 3CSGA 1PQZA 1FH2A 2DL2A 3B9DA 4HISA 4P2CG 5ACZB 4NQSB 2F53A 4GRLA 4DK6A 5ITFA 4JFXB 1L6ZA 4P2RD 1F02I 3LMJL 2AI0L 1O7SA 1ZS2A 3C2SA 4PN6A 2ZCHH 1YJDC 3GSNA 4JFFE 3VXME 2IC2A 4MWFA 5MEQB 4CMMB 2NX5B 3JTBA 4WUUB 1OAQL 3BWSA 2KZBA 4JPKL 5FKAA 4QHKJ 5DLMH 1OTTC 4N20A 3T3PB 1TOXA 3O8XC 1ZLSH 5IFAH 3F5WB 3MFFB 3KZ8A 2OX5B 3MOAH 2V7HA 3RLSA 3MJ9A 5GGSA 4WI3A 3BLBA 1CVRA 4S1RL 2WBJB 3RVUC 3HI5L 2ARJQ 4TN9A 4ZW3A 1JGDB 4GBXB 1JUFA 2DDQL 3MJ8B 4K8RD 4NYLA 3F7KA 4MDIB 1I9IH 3SQOH 3E1F1 4G43B 3JWNG 5BZXA 5IJKA 2BVEA 3PWNB 1E4XL 3L1OL 5CS7A 2JB6B 3NSJA 4E9YA 3HAEH 4XX1E 2W0FA 4UM8A 4KKQA 3HTLX 3UZVA 2QTVA 4XNMA 3G04B 3S96B 4LQFL 4XP6H 4JFVA 1UQSB 4EUPA 3QAZB 3T1FB 1H3PL 2X4PB 1E8ZA 4PGCB 4MAZA 2I5YL 4NAJA 4RAVA 4O58H 4OCLC 3OAUH 3TU6A 3ZE1E 1QHPA 3HEIB 3MUJA 1HZHH 1SN2A 1SMDA 4KK6D 3BP7B 2BNUA 2OYMA 4L9DA 3ZTNH 1G5GA 2CKBA 4JFWA 3FH5A 3GLDA 1MFNA 3LZRA 3MRJA 4ISVB 3T6QC 2LHAA 1Q94B 5CSZB 2HT4D 2UWEB 3BZ4B 4WFEE 2B9AA 1BM3L 3WUWB 4M9OA 4D7PA 2VDLB 1QSZA 1Z5LB 1TZAA 1FL5B 4NQVA 1F2QA 1PJ9A 7FABH 2R4SH 1DEDA 3CV5A 5I71B 4PWHA 4ZTOH 1E7UA 3WIIL 1HH9A 4QLRA 5JW4Q 4WWID 2QPEB 5K1VA 5C7XL 4U6XB 2W91A 4KJWC 1E4KC 4PRNA 4N2OA 4ZJ9A 5LGJA 4F91B 4DCQB 4LKXB 1HCYA 2WLHA 4AIZA 2XJLA 3VSQA 2H2SC 5L0QB 4MXVF 1GJWA 4IIQA 1H3GA 1YNLH 3MROB 5IB4A 3V4VB 3JT0A 1GPOH 1IIIA 1UFUA 3NEXA 3NTCL 5I73C 1D5IL 4N8CL 2H9GA 4LVOB 5DFAA 2FEJA 3MVSA 2QSCL 3OD3A 1RU9H 2WKGA 2VSDA 4IKKA 5DGQA 4ZMOA 4PY7A 1QQDB 2DH3A 1QLEB 2P5ED 3PIQA 4XCEB 1DJHA 3ARFD 5FV1L 5KS9A 4UTAA 4YHOH 2ZUQC 3BI9X 5I17A 5E23A 1C1EL 2FYVA 2RFXA 3O9WA 4PB0L 5IZ7A 5DJ8A 5FS5A 1JVKA 3ZGHA 4H8WC 5LBSL 5F3BB 2WJ7A 1N4XL 4OV5B 1DBML 1LO5A 3BO8B 5F7EL 4LLVA 3IF1A 3BP4A 3ZYIA 1RHHA 1F13A 2YXFA 4KFZC 5IEKA 2DMCA 3KYOB 1OP5K 3BPCB 3RGVC 5E8NB 3RNKB 5L6YH 4M8RA 4JKMA 4F15B 4WEBL 4HXBL 3Q1EA 4OF7A 2Z31C 4MYWB 4WGWB 5DXWA 4QNPE 3RTQC 4JRYB 2VDOH 4MQ7B 3IU3B 5FYKU 1QTYT 4I18C 3HZKA 4R5TA 4BBWA 3ZKXB 1NOAA 2WXMA 1KB3A 4QO1B 5GGVH 2E3VA 1I1RA 4DN4H 2QADB 1A6PA 4EIUA 5CJ5A 1KJ2H 4O00A 1I1AD 5TH2B 4KK8D 3U1SH 4EOWL 2R1YA 3FONA 3LJ3A 4MDJB 1CWVA 5KSAA 4P5KB 1T2QL 3RWGA 2DLIA 3IMRA 4NO2B 3RHWK 4IBTA 3Q8EA 3QUKB 4PV9B 5K9JL 1F3JB 1ZK9A 1MFEH 3Q5TA 4ILDA 1G7IA 1WC7B 1A7OH 2W92A 2PO6A 2X4RA 3VQLA 5DHEA 1HK6A 4H8WL 1MVYA 2CDGA 4B9CA 4X0KA 1X44A 5EU7C 4WFED 3RY4A 4FNTA 3HC2A 3SYOA 2XWTB 1U8IA 2PCPB 3TBTB 3LKSB 4DQOH 4NP4H 4P2RB 3UPRB 1AS8A 4OCSH 4XN9A 1WFNA 2H45A 5F3HA 1OB0A 2OR8A 1MQKH 1QO3A 1IU1A 3QDMA 2P8MA 1E6JH 4N5ED 4A6YA 1R1CA 1X7TA 3ZW3A 4OLXH 4F3FA 1F6LL 1XV8A 3P9LA 4QXTA 1W0YT 4C56D 3O11B 4GI9A 3AU1A 5JXAH 2OMXA 3WGUB 5KVGE 4LSRL 2X53A 3C60C 4IMLA 5CEYA 2GI0A 1PU0A 4K71C 1HXYB 1UD3A 2BSED 3KAAA 1CD0A 1KYAA 1K72A 4XVSL 1P7KA 3B2UC 3PU7A 1RLWA 2OMWA 1SBSH 3MXWH 1GY2A 1V3JA 3FTZA 1X5AA 5E8OB 3QORC 2K4AA 4X4YB 2NXYC 1ND0B 3JTSA 3QUZA 4J8RB 4PRHD 4QHNB 4FQQB 4TPRL 4PJHA 1HWHB 4UILL 4WEEA 4PG9B 3QIBC 1G94A 1A4KA 1RCYA 3T0EC 3RVTC 2O1AA 3E3QC 3QS3A 4UZUA 4C4UA 1L9TA 1QR4A 1GC1C 2HN7B 3F84A 3N04A 1H8LA 4M62H 4NEHB 3RBSA 2CK0H 3EGXB 4RMRA 1PZ5A 4NRYA 3S2AA 5IW1A 3FU0A 1RULL 4NUGL 2FO4A 3KL5A 1Z0NA 4LDCA 2E86A 3R18A 3D0VB 1AXSA 5K39B 1NANI 3DXAE 1E27A 4F20A 3S9DB 3KNBB 4WNJA 1X4XA 1DEEA 4FFVC 7PAZA 2D73A 2B1AL 3VH8B 2UY7A 5IM7A 4LCWE 3ILPB 4TULH 2ID5A 3TH4T 1NBCA 1JNNL 4K7FA 3ARSA 4KK5C 5JMRA 5GRUL 3MKKA 5B7EA 4UAHA 4N8PA 1NPNA 1K5WA 4K3GA 3GS7A 4OGYL 1IUZA 4AYFA 1DUZA 3L6FA 3ZE2E 3OKLA 5H37A 4B9GA 3BN3B 3INUH 4ORZC 4JCMA 3GJFB 1BXAA 5K93A 4YE0A 3N91A 1LHZA 2E0PA 3FSWA 5TJWK 1HAWA 1VENA 5CINL 4F5CA 3LOWA 3X12A 1G7QA 4IJTA 4CGUB 1T89C 3KLDA 3K91A 3IGUA 1RIUH 3GEWB 2R0WH 1J05A 4A7SA 3CNKA 2O26U 2O5NA 1MCKA 3CFKA 1NGQL 1WA2X 5A2LH 2WBJC 1VIWA 2FD6L 3LH2L 4LXFA 5D2NB 1J5DA 1VACB 4LMQI 1GAFL 1T20B 1TQBB 2WJ5A 4U1IA 3UZQB 4GBXC 1QVOA 2DWDA 5TFSL 2VZ3A 4OCWL 3RIAK 3MRCA 5CP3H 4LGPB 2P5EB 3TJPA 4KKPA 2EIBA 3BAWA 1YECL 3DK0A 3Q6FB 2BS8A 4ONFH 3DWTA 5J56B 2JKNA 3EH4B 3N50A 3VYOA 5E1HB 3BKYL 3EJTA 3KVDD 1SY6A 3BEWA 1Z9SB 4PS3A 1O6TA 4WTXA 1I7UA 2W65A 3IPEA 2X6MA 2Y7NA 3QAZC 1T04A 5TDNA 2AJZA 1NA8A 5DEGB 1GYAA 4PM1A 4GIAA 5IB1B 2BDNH 5IB2A 4RFNB 2Z64C 4ECNA 2IG2L 3BAJA 1SZNA 1T2JA 1FIEA 3I6SA 2NNCA 2EDBA 3AB0B 1IM3D 1I8KA 3WJJC 4OM0H 3UDWC 3NZ8A 4OCYL 5DK0A 3UG5A 1JS4A 3DSFH 3SGEI 3UL4A 3UAJD 3V4PA 5GRJL 3A5VA 1S9XB 1S9YA 4N0YL 1R5IB 1KGYE 3RTLA 2YKLL 4KHTL 4U4IA 2NUPB 3Q1SL 1MNUH 1I1AB 2HX9A 2RR3A 4NHUA 1XL4A 5F8RC 3SKJH 3ES6B 5I71C 4OM1L 2BY2A 3RUGA 3FAXA 3CFEA 1CLZH 2D31A 2P49B 3DXAD 1QEXA 4PJCA 3FT4A 2VXUL 3THMH 1U8CB 4LCWD 1JI1A 5L0QC 2IH3A 5AOZA 1U8KA 4QOKE 4WJ5A 1J9CT 2FJSA 2JK5B 1G7LA 4LVOC 2DWTA 3ZDZF 2HRLA 4XVJL 3QUMA 3OXSA 4JY6A 4TSAL 4GXVL 3UZEA 2CJ3A 2IDQA 2AITA 3L81A 3W57A 5EPMA 3BPOB 1RVFL 4HBCL 4ZS6D 1JZ3A 1BMWA 3QUXA 4C56B 5DMIH 2NXZD 1DQKA 2OXHB 4OZFH 5L88L 3L08A 4KHXL 5JORB 2PPFA 3LPOA 5CBEB 2IFFH 4F8LA 4ODVL 5EZJB 3GC3A 4U31A 1P84J 1ADWA 2MIZA 5GRVK 2NY7H 4EI5C 4AJYV 5IJBC 5C7ZA 1XCQB 1R75A 3WY3A 2YUXA 1S7UA 4HIEA 4F15C 2XKNB 4PRHB 3KVPA 2CR3A 4JS7A 4A68A 4FLSA 2O30A 1AVAA 2DTML 3PFUA 3QDJA 5CF3A 3QIWD 3OTTA 1CXHA 4KDWA 4RNRB 4PRIA 2YRBA 3L7EA 1ZT7B 3T3MF 5KVFH 3HHSA 4PWEA 1KOAA 1PZAA 3ZKXC 4WTWA 5LGYA 2FHFA 5BRQA 4LSDA 4FKEA 3G5WA 2QADC 2Z0UA 2ZUXA 1T6WA 4A2FA 3FFCE 3J27A 4TKWA 1QSFD 1OGAA 1RZIB 3EBIA 3VRJA 4ANKA 1KC5L 4TNGA 2OXGB 1QLEL 1WWCA 2ZX6A 5AG9A 1FZKB 3P4NB 3ASWA 2BVQB 4R5XA 3VFWB 2VABA 4IBYA 2EH8L 1UWFA 2IADB 3IE9A 4UT6H 1MWAA 1IGML 4JFZL 2YAPA 5AQ0A 2OM5A 3TWYA 3L4YA 3IXAA 2BOBB 2AEPL 5DYFA 4HV8A 3EJZC 1ZWIB 4X6DE 4BWUA 4M7KL 1KELH 3SE9H 2CGRL 3MA7A 3OX8B 1VHPA 5D93B 1IM9D 3GNMH 3MLXL 3OL2A 3AQXA 1FNGB 3F7YA 3MUGA 5TE7H 5A6IA 2YLHA 1V7MH 4F2ME 2FBOJ 2H3NA 3BXNB 4N2LA 4QXVA 2ESVA 3IFNH 2XXGA 4TL4A 1XMWA 3SJVA 3BP6A 4YHLL 1CVSC 32C2B 5JLZA 2HT3D 1TJHL 3P2TA 2A6JB 3MLVL 4QOKD 1F3RB 2O93L 5IWLC 3LN5A 1UB5B 4HK3N 3G5XB 4JO8A 1UG9A 1BYNA 4HCRL 1F86A 2R0ZL 1M7DB 2L7QA 1C5CL 8CGTA 2M2DA 3H6JA 4K8RC 1CDUA 2C7UB 2G3XA 3NN8A 1D5XB 3TBYA 1L9NA 1O6SB 2K3HA 4XAWL 3VMPA 4PREA 4FXKB 4JKLA 2X09A 5F7FA 4H1LA 2F08A 4MLIA 1HCZA 1S78D 2R0KL 1LTXA 2B4CC 5DS2A 2R51A 1HHJB 2VDPL 1WFTA 2VR7A 3JZ7A 3WELA 2W80C 5D2LB 1NIAA 4DGVH 2DQJL 4DVBB 1LP9E 5IQ9A 1CFTB 3FO9B 1DBKH 1A4JB 1XGRB 2VLRD 4KK6C 4Z0XB 4F9PC 4HC1H 3KE0A 1UT9A 3WXWH 3BH8A 2MRYA 3S5LA 1IM3B 1ZA6A 5FGCE 2APVA 3SPVA 4AIEA 1P69B 2R59A 4L9LA 3BLKA 3PS6A 2FECL 5E8DL 2HT4C 5KYWA 3MLSH 3FT2B 3M7OA 4KDTC 1P84K 4GAYB 3ULVL 1B4JH 2EYRA 2VC2B 4X7SH 2XZQL 4ODSH 4TNEA 4YO0B 2FT7A 2VISB 1BEXA 4XO3A 4ELME 3MCG1 4IDJL 4K8RL 2CO1A 5HHVH 3ZU8A 4FQ1L 4NZTH 2NW3A 1EUUA 4F57L 5BOJA 4Y1AD 5I8OH 4YXHL 1KDIA 1SJVA 4PTUB 5TGBB 3FB6A 3MLZL 5DD6A 4W9ZA 3RY6A 3CIAA 2VT0A 2DV6A 3MNMA 1A6ZA 1K8IA 3RNQB 2P8PA 3QXDB 1KPUA 4TQEL 3RU8H 4B50A 2VMJA 1XB8A 5JIDA 2IDFA 2EACA 1KIQB 3GXUB 1U33A 2F1BA 4IOSA 1TQBC 1JGVL 4X6CE 2WYZA 1QLFA 3V0EA 4XP4H 3TBSA 2OSYA 4JFQB 4OZHE 5DJXB 4F7PB 1FA4A 3DTDA 3VFTA 5CUSL 3U1QA 4GG6B 4H20H 2NXZB 5T3ZD 2AJSL 3INOA 2XYCA 1M2OA 2OP4L 2VDRB 3QPQD 2A9AA 3G7TA 4JM4H 4UUJA 2AJXL 4DESA 4UBDD 1PG7H 3K72A 2FJFA 4KX8A 3GHEH 3OKMA 4NT6A 5EDSA 4B0MB 5CLZA 2WINA 4BE5A 4RFNC 5AVXB 5EF2A 3BKJL 3W0WA 3UO1H 3NIDB 3QIWB 4P07A 3ULUD 2PYFA 3AB0C 3HNVL 2QQLL 2H1PH 3PJSA 4BQ9A 1RK1A 2DN7A 4UTCA 3BLPX 4PJXA 5F7NC 4Y19A 3K5RA 3L3HB 3TWCH 2WW8A 1I1AC 1QSFB 1T7YA 1FVCA 2ZXGA 4KK8C 3UYOD 3HJ0A 1J9QA 1DN0A 2DQTH 1AO7A 1NBYA 3C8DA 4ICXA 1OF0A 5BO0D 3WFCH 5C2BL 4BFIB 1KIRA 1J8SA 1JP5A 4WNQA 5F0MB 1A1MA 2QEJA 4CA4A 4QRRE 5GHWH 4N2MA 5DJ0B 4M6ML 1I9JL 2WNWA 1RMFH 4JK0D 4FNUA 4JY4B 4QEGA 2YD1A 2ATPB 5EUKB 1MCJA 3ZMEA 5BV7B 3DBXB 3CFMA 4YDNA 2CD0A 2F18A 4ZG1A 4AGQA 4PB9L 1IM9B 5EC2B 4N5EC 2C9VA 3SSGA 3BPOC 3HNSH 1MRDH 3BPNB 4LB8A 4V33A 4XBEH 4LEXH 4Y9BA 1I7TB 1JF5A 4AQEA 5D9SA 4DKFH 4JRFA 2P4AB 1I7RA 3X17A 3PY9A 4MBRA 3SD5A 5HY9B 5JIIA 1EAQA 3MGOB 4JVPA 1VZHA 3IVKB 2N4IA 4QI3A 3QJXA 4YE4H 3NUKA 1WBZA 1T66D 3T8XA 5IHWA 1GHFL 4GQZA 5CILH 3FXIC 3OKDB 3UERA 4AGMA 5B38A 4Y7OC 3TPUB 1AJ7H 1Q4NX 4WW2A 5E8EB 2WXGA 1EO8L 5JYLA 1PG7X 4NQCB 3MNWB 2OL3A 4XMPH 3HPJA 3DV6A 4JDEB 3NCFB 1JXJA 5LJYH 3I50L 3CDZB 4URTB 1GOGA 2V2TA 3L5HA 3T4YB 1F18A 3JV6A 1BXVA 1CE6B 4ODHL 2VN7A 2Z35B 3R4RA 2EP6A 3CFIC 3PWJA 1QRNA 5KBDA 2AXGA 4JRWA 3CDFA 4U1HB 2DYPA 3DX1A 3HFFA 2I85A 4MCYB 4UDUB 2CA4A 4KMQA 4ABUA 4HPOL 4RBPK 4HCGA 1WS7A 4HEPA 3GI8L 3OBAA 5HHPA 2VLRB 5IB3A 1XXFC 3ML9A 4FA8A 1TVDA 1X9RA 4AT6A 2ZF9A 1W0VB 2ZKWA 3EO1A 5MEPA 1KNOA 3UO8B 2QR0B 1ZT4B 5FO9B 1A3RL 1G9MC 2ADFL 3MHZA 1JTPA 1SOXA 1HSAB 4FKKA 1IILE 3IDMA 2EYSA 2YD6A 1CGVA 5D7KE 1OANA 4NNYA 3VNYA 1FV1B 4MNQA 5JDJA 5JDSB 4XGZA 4YLBA 1S7TA 2R2EB 4OQTA 4J3TA 1DCEA 4KZDL 4I13B 2VAJA 2YXMA 3OJVC 4Y1AB 2ZOLA 1QYGH 2FH8A 5LCVL 1MZZA 2N56A 2NDGA 4JZNB 1U92B 4QRRD 3VJ6A 2IPKA 3FQRB 2BP8B 3QQ3B 1H3TA 1HILA 4N9GA 3BN9D 3P2DA 1LO2H 4X6DB 4JG1H 5EOTA 4ZDHA 2B59A 5F0PB 5B3SB 5IHLB 3K71B 2BJML 4U6VH 1GGBL 1QNZL 2DBJA 4Y1SA 4ELKA 3QI9D 3AU0A 3STZB 1RD6A 3I02B 2VZOA 5GISH 3U36B 4C83B 4HA1A 1QFWI 3X1FA 1S46A 1CUOA 2FE0A 1FP5A 4PJFB 4OCNC 2PW1B 4RAUB 3OXRB 1BBDH 1HT6A 2EDTA 2C1PA 1KYUA 3B7TA 1KPRB 3U0PA 3QZWA 1MVUB 2AGJL 1QEWA 2HTLD 4A63A 4HT1H 4IRSA 4WCYL 2B2XH 4AGLA 1XIWD 3HG3A 4UQBA 2FLRT 5GS1B 5B39A 4LQ1A 1ZTXE 4RDQF 3AS3A 4XMVA 1L7IH 4P2QB 2CU9A 1ZTMA 3MZGB 2EE2A 4X4ZA 5IHZB 4TTDC 3UJIL 5ADOH 3HW7A 3QEUA 3QYMA 1YAIA 1DQJA 3O0RL 2PP9A 3UAJC 4BQBA 5TTRA 3ZVVA 1AGBA 1W6WA 3EYQD 2WO2B 1VFUA 5C0CD 5I8CA 3I6KA 1WFUA 4KY2A 4OTXL 3EXLA 2BRRH 3MUUA 4U1JB 1UWEH 4WWKD 5AOMA 2DIBA 4CN4A 2H8PB 1HEZA 4GMTL 4XN5A 3JVFC 2ZXEB 3Q44A 2OMBA 1OSPL 1MAMH 5KVGL 3QARA 3KPPB 3QQ4B 1CLYH 1L9RA 3N41B 4X7TB 4B9IA 4LSPL 2ITDA 1BD2E 4H0GA 1VFOA 4P5RA 3BYTA 2JKJA 1HSBA 4XMKL 4KC3B 1MCNA 2ICEA 1I1CA 4ELMB 1MI5A 2EKSA 2ATKB 3HS0A 1LVEA 1XF1A 4MJ6A 2ZAHA 4ONHA 2CPUA 5EZOL 5EORL 4DPCX 2JXMB 3DIVA 5FYLH 1XF4B 4FERA 5JQHC 2Q87A 2DAVA 3N6YA 2NXZC 1OKEA 3A67H 5DJDB 1FI8C 1NFAA 1KTRL 1NMBL 2FL5B 2R23B 4AEIL 1M1XB 3O3BA 4FG2A 3PP4H 2VC2L 4OZGF 2F53D 4GRLD 3GMMB 4Q14A 2HJKA 4YHZL 2A74B 1KTKE 1AXTH 1JE6A 1G7HA 2IV8A 2J73A 3SD2A 2JE8A 2V5SA 1A7BA 3C12A 4XNZB 3WFHB 2ZIDA 3M17B 1E9OB 4IKLA 4X6CB 3BEVA 5D5MB 5KS9E 2AHIA 3A22A 1C12A 4HAKA 4DZ8B 1IFHL 4H8QA 4X99A 1N10A 5FOBA 1J0IA 4OZIB 1DP0A 3QIWC 2X9WA 3FO2B 1FFQA 2YQGA 4H8VA 3NIFB 1CDHA 1OHQA 3M7FB 3SE8H 1KCLA 3N1MC 2XN9A 3FO0H 1TR7A 3GXTA 2Y36H 3WCYA 2K78A 4WI0A 2AKRB 4O9HH 4ZNEE 4MZ2A 1AC6A 5I1LA 1FC2D 1V3LA 1DQMH 5K59E 1PZUB 2GHZA 1NDTA 2Y2TA 3RDJA 4XBMA 3MRRB 4PJEB 1PSKH 4XN1A 1CGWA 4Y89A 2K45A 2LFGA 4HJEA 3FUKA 2CO6A 1G9NL 3RZCA 3D50A 1Y18B 2WQAA 3ZY7A 4ZUTB 1KEGL 5JPNB 1T0MA 4MJ5A 5HDRA 1DDHB 2BS9A 4OD2B 3T65A 1CJYA 2O6EA 3BWZA 3MRBA 3ESMA 3K6OA 3PGDB 1C5BL 4Z95H 5BV7C 3HI6H 5GZOA 1NFDF 2IIJA 4D8PB 1HJCA 3T4AB 4L1BA 1G1OA 2YSTA 4GO8A 4EKJA 1B4LA 2FWOA 5DD3H 1WITA 3S6CA 2E9BA 3BPNC 1WHOA 4QWWD 4RVBA 3ARVA 2GSIA 1F58H 4OF8A 2AJYL 3SDXE 3I6GA 3GSVB 1BWWA 2HT3C 4L3CB 3FZUC 2XG4B 1P5UA 3RB5A 1DLHB 4OLVH 2QV4A 3VXNB 1ZA3A 3FTSA 2WBKA 1OCRB 5I1AA 1ZY9A 2X9YA 3MLUH 5K69A 2BZ7A 3QI9B 3W39B 1JPEA 4JX0A 4PWFA 3PL6A 5FF6A 3CXDH 3LNEA 4NGHH 4PBWD 3C9NA 1U93A 4JPWH 2X6CA 3CC5A 4XPHL 4WVRA 4JO4L 1N64L 3P11H 1S78C 3DNKA 2DQ6A 5EOCH 4V1DA 3L4XA 4LHQB 4NXKA 3DVNB 5CCKL 4OI7A 5BV7L 1LO3L 1M9WA 3TO2A 1IT9L 1H5BB 3RWCB 3C6SB 4J1UB 1XIWB 5GSRA 1EXUB 4WI6A 2CIIA 1PEZA 5IHBA 3FQ2A 3ELAT 3SODB 3U7YL 1DBJL 1BQLH 1J8RA 3DGGA 4PJBE 3TH2T 3CZSA 4M1GL 4KH9A 4AQZA 2IAMA 2ZWYA 3O9WD 3G5YA 1AP2B 5I30H 2X6VA 2V3EA 3O0LA 1Q0YH 5GJTH 4EPSA 4QXGL 4QHLA 5TK2A 2B77A 2Z7UA 5DRNA 4NWTH 5C0CB 2MOQA 2GEQA 2YO3A 2YAQA 3FTXA 4XNQA 4Q52A 3P0GB 2IMMA 5TF1H 3HPLB 3W11C 5CR1A 4G1MA 5I1EL 5EEZA 1RJLA 2X6BA 1WT5C 2K4WA 2I9TB 4OSUH 1AGCA 2F9BT 4KKAD 1R3KB 2JELL 3NFNA 5T1KD 3U6RB 1FZOA 2DS4A 1KB5A 4EVNB 1NLDH 2N0KA 3DTXB 4JDTL 1OP3K 2A4CA 4OFQA 4DW2H 3DC0A 5BRZA 3LPPA 4ABVA 1OGSA 2E7LA 1NTDA 4KTDH 4MX7B 1RUKL 5M7QA 1M71B 2LE9A 3O45B 2E74C 2H1LM 3GIVA 4HAFA 5EOQH 1AZBA 1OSYA 5T5NF 2HRPL 2OKMA 2DOCA 4ZAKA 2J25A 4PWKA 2W60B 3KPTA 2PO6D 2HVKB 1INDH 3JWNH 5F71A 1CCZA 1IGFH 4G8FA 2WC7A 3TBWB 4Z77A 1PQZB 5EEYA 3QPQC 2MJWA 4GUCA 1KYDA 1HHGA 4FQ2H 2F53B 4GRLB 4LCUA 5ITFB 3LPGA 2Z0BA 4UQ3A 4JHUA 4UBDC 2GJRA 4FFZA 2XZAH 4L3FA 5DFWH 2XN0A 4XN8A 3GSNB 4FFYL 4R0LC 3QDMD 5F97E 2XWBA 5KYNA 3VFGH 3AUWB 3AACA 5GS1C 4MWFB 1HI6A 4HLZG 1PZBA 2QT6A 4N9OB 2Y3AA 4QXUH 2WXKA 5FKAB 3EO9H 3ULUC 4LSTH 2VWEE 3CK0L 4UIKH 1BQHG 3MLPA 4XPGH 1IJNA 3HBGA 4JQVC 2YK1L 2P24A 4R4FH 3H3KA 5GGSB 5F8QC 2FWSA 3G6JE 4LFHG 4OVVA 4HWZA 5BXFA 3MRKA 2LQRA 2QPFA 3HCVA 4JDZB 1MXDA 2DD8H 1JUFB 3AM8A 4AQAB 2GSGA 1NCGA 4FYTA 4NYLB 4UWQB 1HIMH 2VXQL 3QUZD 5CJXC 4ADGA 3KWTA 5ECGA 3P0YL 4UAOB 5T3ZL 4XOBA 1MCBA 1XBDA 4ZK8A 5C92A 2D9CA 2PPCA 4UM8B 4AYSA 3L3GA 4XNMB 1D5ZA 4BSVB 1SJXA 1EGJH 1ED3A 5I1CH 1KLGA 4EUPB 4B7LA 3OMIB 2WLLA 3C2AL 4N8VA 4TUJA 4N6RA 3Q5OA 2NQCA 5SWSA 4RAVB 3VTMA 4HPYH 1UD4A 2VMDA 1EJOL 2WAHA 2BNUB 3KW8A 3QXTA 3T2NH 1TQSA 2CKBB 3ULUL 1ZHBB 2I60L 2O5XH 1N6UA 1S4IA 1WH0A 2YUZA 3H9SE 3MRJB 3N1QC 3VMOA 5DZLA 4F9LC 3ZDYB 3ZLQC 4IK6A 2J7LA 5C0BA 1MFCH 2GK2A 4MB5A 4NQVB 3S35L 5LAXA 4KQ4H 3H7LA 1T66C 3PDOA 5CR8A 3UIYA 1NCIA 2A74C 2I07A 4ZD3L 1GR7A 3JUZA 1LO0H 1U6AH 2DEWX 1WWWX 1HH9B 4KAQH 2Q10A 5EIIA 2C4FU 5LLIC 5E5UB 4GQ9L 4AVHA 4RMTA 4PRNB 5LGJB 2OLDA 2DICA 3ETSA 4XPTL 2PN5A 2ZYRA 3VXQA 4AIZB 4FQXD 1UB6A 2Y07L 5JHMA 1X7QA 2AERT 3D8MA 5IB4B 5IUSA 3Q2NA 4I0PB 4JG0H 2Z6FA 4JHAL 3U6XS 1MY5A 3KPRA 5J6HA 4NSKA 2H9GB 1GYUA 3NMEA 3X1BA 1QI4A 4W9HC 1AQHA 4U2YA 3B43A 4YHIA 1FYHB 3LS5H 2UVFA 5EU4B 3N40P 4XX5A 4PY7B 2W81C 3PIQB 4X0NA 4YL9A 3PP3H 2ZWKA 3GBML 3QDJE 5C07E 1N0LA 3CQQA 3N43B 5I17B 1CF8L 2A5UA 1LO4H 3N9GL 4YVNA 3O9WB 5EZIH 5DJ8B 1MAKA 1MRFL 2LABA 1NCNA 4WFGE 4H1LG 1LO5B 3FNKA 2JQZA 4LLVB 3IF1B 3BP4B 4Z7IA 2R7EA 1RHHB 5JPNC 3A23A 4YSAA 5DJ2A 3X3GL 3H85A 5IEKB 1CI5A 9PCYA 5D5MA 3J2PA 4S1DC 3LIZL 5DC4B 1N19A 2XOTA 3I75A 3V0HA 1PD0A 5KJ7E 1RI8A 3QWQB 2NCEA 3ETTA 3T4AC 5DD1L 5I23A 4JRXE 2Q3AA 1RQ5A 2H32A 5SX5H 5T3XD 4M02A 4PRPA 1DVUA 5ANHA 5DHXB 1X9LA 3S5LG 2CPCA 2NYZA 4F7KA 2J88H 3L54A 2CMRL 5B8CA 3KWXA 2A77H 4HGKC 3BN9C 1BGXL 1FJ1A 1KGJA 2ZUWA 3AAZA 3KJ4B 4AGPA 4HOWA 5FHAL 1SYVB 2NRDA 2R1YB 3FONB 2C3XA 3PFQA 5DR5L 5MERA 4PV8A 5KSAB 2N7BA 3MR9B 2JMRA 1GGYA 3RWGB 4M7LH 3E6FA 2ENSA 2EYTA 3QI9C 5FLUA 1XF2B 1I85A 3GMLA 5IMMA 4IOIA 3ETBF 3B9VA 3WIHH 5A2KH 4AL8L 1G7IB 1YPZF 2ESVE 2OR9L 2PO6B 3VI4B 2X4RB 4JUTA 5C6WH 3ZYJA 2DQIL 2CDGB 4LKCA 4X0KB 5EMYA 4L1TA 1SPDA 3M1CA 4P5TA 1U8IB 1UGNA 4H26A 1USQA 1F90H 3FMGH 1H5BC 3EOBA 1QO3B 1XIWC 4A55A 2LR4A 2QGCA 2P8MB 3QDMB 4A6YB 1H3WM 4NO3A 5FEBA 1DZBA 4F3FB 3V7MA 4DF9A 1R33A 3P9LB 5DJZA 2AQNA 3QZNA 4QXTB 1XH1A 3AU1B 4RGNE 5E6UB 3UC2A 2OMUA 3FN0L 1FZMA 3T08A 4LFHD 4XC1H 3EUDA 2VN5A 2BOLA 1NM4A 4FLQA 4IMLB 5CEYB 4ABWA 4J3OF 2HWZL 4HKJA 3FBQA 3VD5A 3EYQC 1P7KB 1U8HA 3MJGX 2OMWB 4Q7DA 4X50A 2WOYA 4YDKL 3V6OA 4FULA 3MRPA 3WFEH 3JTSB 3QUZB 2CCWA 5KZCD 5C0DA 3TT3H 5HHOA 4PJHB 3QDJD 5T1MA 2YEZA 1SFHA 5C07D 1CN4A 4XPFH 4PRID 4HH8A 5GIRA 1A4KB 2AQPA 2AVGA 1J12A 3OC5A 5F7WC 3EJSA 3H42H 4YSCA 3Q8FA 4WFGD 5A40E 5BOZG 5ADPH 3VI3F 4RH4A 1HL9A 1PZ5B 4NRYB 2XWEA 4YHPA 1OWRM 1OGAD 2FO4B 3N42F 4DO5A 2YSSB 1U30A 1AXSB 3FQUA 1A6VH 2MCAA 2C4FT 1RP9A 2PETA 1E27B 1IKNA 2YPLE 1DEEB 3WKMH 4L4VE 3HMWL 1UA6H 4ZBJA 2X4TA 2UY7B 5IM7B 4IRZH 3T2QA 1BVLA 4H2CA 4YSQA 1EWHA 4UT9H 3QDGA 3APMA 4HJ1A 4K7FB 4XWOD 2JKRM 2C9UA 4NX0A 4Z8FL 4ODUA 5TQ0L 3TOPA 4GRWB 3V5KB 4GRLC 1YY8A 2D7QA 4AYFB 1DUZB 1HOCB 3GBNL 3L6FB 3OGCA 3OKLB 4MXWL 3UOAB 3N44F 4M3KB 3GRBA 5C08B 5L7XH 2XZCL 5H8DA 2FIRT 3MDJA 4NC1C 2ZXBA 4GFXA 1O7VA 5AFAA 4HGWA 1KJ3L 4L48A 5CCGE 4LASH 1QLRA 4O2EA 2ZKMX 4BK8A 4LSUL 4XN2A 3X12B 1G7QB 1NUGA 5IMLB 2ESVD 1A66A 5CFHA 2P5PA 3SJVD 1J05B 3ZQ9A 3T8MA 3CFKB 3HJEA 3NCYS 2OZ4H 2HXAA 3WTXA 4F2FA 3V0WL 1S7WA 2VDMH 1L0PA 4N2AA 2P7TA 2WCPA 3BGFB 1EJ8A 5IQ7H 3SO3B 4ZX6A 4B9JA 2AV1A 4U1IB 2V9RA 4FAAB 1QVOB 1BM7A 2DWDB 3A6CH 4DUXA 4UTBH 3DX8A 3FCBA 3MRCB 5ILTH 3TFKD 2SEBA 2Y06L 3BWUC 2VR6A 4JO2H 2Z3FA 5B38G 2EABA 5IJKC 5AZEL 3HHMA 1QPPA 3UP1A 4UAOC 1FLRL 1UH2A 4RGND 3TV8A 2DLHA 3QC5X 3CLFH 1NIDA 1IZJA 3BEWB 5I66A 4PJ7E 1I7UB 2W65B 5EO1A 4DTGL 1T04B 4ZSOE 5TDNB 1DSFL 4TQPA 3GSNL 2VJXA 3GKWH 4GJTB 1VDGA 5IB2B 3B2DC 3RB7A 4CDHA 4RQQA 2VJ0A 4YQXL 1O75A 4HEPG 4UB0H 4PVLA 3KPOB 2O6DA 3NZ8B 4QWWC 5DK0B 4D0CA 4WY7H 1N5AA 2XY1A 3V4PB 4NKQB 1S9YB 2ZNXA 4URKA 3U4AA 1YEFH 3K2UH 2IGFH 3GINA 4NHUB 1BOYA 4G6ML 3DJ9A 2ZUUA 5D72L 1YEWA 3D52A 2X88A 3RPBA 3RUGB 1RIVH 2MPAH 4LE8A 3U7WL 3TEXA 2D31B 2PCFA 4PJCB 5A1AA 2ZWNA 3FT4B 3GRWA 4FLOA 4GOSA 5IKCA 3MGAA 1WRFA 4LO9A 1NCCH 1YEJH 4U1MA 2ZX9A 2NTFA 4IIQC 2DIJA 3CE1A 3T6WA 2IH3B 5A2BA 3MUHL 4YUEL 2F8XC 1INQA 4P0DA 1U8KB 3FQWB 5E6IA 5GGRY 3VFMA 3L5JA 4U0RB 3KPNA 4WJ5B 5TD4A 2DQUL 2CQVA 3VSVA 2QKIA 1G7LB 3VG0H 3SKOA 5CGTA 5LAPA 3CTTA 4IOSD 1NLBH 1PY0A 3OXSB 3QUMB 4JY6B 5FYKE 3IS0X 3GSUA 2XUWA 3BH4A 2UYLA 3F6JA 2CKBL 5EPMB 1CGSH 4DO4A 1CBVL 3QUXB 1HN1A 4W9KC 2PWDA 1JV2A 35C8L 4H40A 2FGWL 3O9WC 3NCEB 2EDOA 5DZVA 1QRNE 5IQNA 1ULVA 4ZTPH 3L4TA 4NQDB 4JO5A 1NUFA 1OY3B 1Z0MA 3K4ZA 3VWJA 5J4MA 3QZWG 5EN2A 1O6VA 2BNRA 2VOTA 5DEZA 4BV1A 1S7UB 3D25A 4HIEB 1A4AA 4HALA 4HKZA 5KZCB 5AVSB 3KMDA 4OGAC 3HAEA 4TL5A 4QRPE 5BO1L 5B39G 2R56L 1TTAA 4M48H 3EFFA 4KKAC 4PRIB 1SVCP 3BIBX 5I8KL 3L7EB 2EXWD 3DVGA 1E3FA 3FN3A 5DU7A 3HHSB 5KVEE 3TFBA 2Y5QA 4M8QA 1MSPA 4K07A 3COOA 4N25A 4R97B 1GTFA 3PGFL 4KXZH 4Y19D 1JHLL 4HIJA 3S37H 4ES9A 3KJ4C 1IQWH 1K9TA 3V52H 1OGAB 5IROA 3MYJB 1RAMA 3Q05A 5KSAC 1PPIA 3ROLA 2YD0A 5K9OA 1AO7D 4FZEH 3TCTA 4PVNA 4UTAL 4CSTA 3IPFA 1PZ3A 1NL0H 1WFJA 2E4TA 1RPKA 1MWAB 2PO6C 4P3CL 1F56A 3RWHA 1E8XA 5C0RH 5HVWA 3IXAB 4K3HA 2QMKA 5CNHA 4HV8B 1A7RL 3MCYA 4W4NA 4WI2A 3P73A 3CFBB 1TLMA 1J10A 2FK9A 5E08H 1KBGL 1DSYA 3MA7B 1WDAA 3C5JB 3D07A 4BZ1H 1EAOA 3F7YB 1QPXA 2WQ8A 2DQDH 4TUOA 5G4OA 3PYCA 1BV8A 1MIML 4XO8A 3HN5A 2H3NB 4MVBD 2ESVB 4TRPL 2EDQA 3SJVB 4KRNA 1U8JA 3BP6B 4PHXA 1FRGL 3DX3A 4W1TA 1JF6A 4R8WL 5JLZB 5GRYA 4NUMA 4YHKL 3LMJH 4Z7NE 5E4IA 2AI0H 2WXRA 1CU4L 3LN5B 3L3JA 1BAGA 1DUYA 4OF3A 2BFVH 4LPYA 3L16A 3O6MH 3QUZC 3MACH 3TBYB 3NN8B 1OAQH 5D7EA 4ZO9A 4I1NB 4BCZA 3HRPA 4GLRH 2VSCA 2GAZA 4M4RA 4FQCH 5DA0B 5DD5L 3AWEA 1J8HA 4H1LB 1RZFH 4RGNB 4FE9A 3IXTA 4HETA 2ZXAA 3WN5A 4DIXA 5D7IE 5IVXF 5IFHH 2XJKA 4S1RH 1JZ6A 1ITBB 1X5LA 4JFHE 3HI5H 1QRND 2IANE 4P48A 1LEIA 2DYPD 2DDQH 3WY4A 4OLYL 5IQ9B 5JIHA 3BRDA 1G6VK 2HFFA 2JQMA 4Z6AT 4ZX3A 2GHWB 5HDWA 4LOVA 2ZKHL 3L1OH 3BH8B 4MQSB 3S37X 2BMKB 1ZA6B 3S5LB 4LK4A 3QHFL 3SPVB 4XNXL 4L9LB 1AANA 4WI4A 4EIBA 5I6KA 1U2YA 5KYWB 3FCSA 3LPFA 3B1UA 2D0FA 1NFDA 3BUBA 4LQFH 3O2DH 3EIFA 4BDVA 1KJ2A 2WWNA 2JNZA 1IBGL 3B9KA 1H3PH 2EYRB 3U0TA 5LDUA 1J0HA 4L05A 4M5SA 3V2AR 4FABH 1WA0X 2I5YH 1PLGH 2XQBL 4AV0A 2IJ0C 1MI5E 3FDWA 4MNQD 3FUDA 4YDIL 2K7QA 3VU2A 4UQ2A 3OKNA 1OO2A 3EJCA 2NW3B 1GCYA 2E75C 4UNIA 5FIEA 5ICYA 2CALA 4Y4KA 3FB6B 5DD6B 1A9VA 5DUPL 3RX5A 3ETBJ 5DF0A 1BM3H 1A6ZB 1MN4A 1K8IB 2IOIA 3IT8D 5FO2A 4PJ8A 1KPUB 1YEHL 5TPWH 4ABQA 4RISH 3QJUB 2J8UE 1OE1A 3LVEA 4AVKA 4B5ZA 2G3NA 2Z7WA 3BAKA 3BGFC 3SO3C 2EVHA 3QCVL 2Y5EA 5T1LB 1QLFB 3I74A 5I19L 3TBSB 3VQMA 3K1KC 4EDWL 5A2JH 2X4OB 2UVEA 4P57A 3VFTB 1ZHLA 1A1NA 1TNMA 4K23L 5HHME 1IC7H 2OSLA 2XN9E 1AGFA 3LQZA 1IJ9A 3SKMA 1D5IH 3ILEA 4N8CH 4UUJB 1E3XA 5GS2H 2WVSA 1U4FA 3UPAA 1G0YR 4S0TD 2AQ3A 4GG8A 3NEEA 3K72B 2WUCL 2FJFB 5E00A 2HKHL 4IRSD 1OCZB 3OKMB 4NT6B 5E2VH 2TSBA 2O6FA 3W5MA 1HHHA 2MPVA 1ADQL 2J43A 3HFMH 2WINB 1FFPA 2W9DH 1RKRA 2EIJB 3W0WB 1QSVA 3TZVA 2PYFB 4KNTA 1BPLB 1UOKA 4PJGF 4PB0H 3UROR 4M6NH 3O41B 5LBSH 1N4XH 1W72H 2VLJE 2VRAA 5T8IA 1E30A 1DBMH 1RK1B 3PJSB 3QJFA 2LT9A 4JFDA 5F7EH 1J1OL 4P2OA 1NCBH 2DLEA 4PJXB 4Y19B 1TTFA 1MW0A 4X5LA 3F65A 4TVPH 1PCXA 3CHPA 4ODWA 4UT7L 5I1HH 3TCXA 3SGDH 4AG4L 5E2UH 1AO7B 3DX0A 1MCPH 1NBYB 4PJ5A 2G4GA 3AY2A 3P40A 3GGWB 4DGYH 2CDFA 1KIRB 4WNQB 5B7FA 1A1MB 1SY6L 1QSEA 2XG5A 4JQIH 3KL0A 2JLLA 2ZYHA 1UT2A 5AVTB 5TDOA 3QG7H 3DPDA 4QDGA 4ZFZB 5T5FH 4U0RC 3CQPA 3CH8A 2ZOOA 1P2CA 5F72S 2VW7A 2ZX5A 2ZWSA 3M6DA 1MI5D 4QYAA 2F54A 3LRHA 2UUDH 3UZEC 2IEPA 5HD8D 7PCYA 4PJIF 2OSWA 5K9JH 3W82A 1BREA 1IC4L 1K5NA 5T3XL 3QR1A 5A2FA 3QUXC 2MNWA 4JPVH 4KRMB 2GJ6A 5AOLA 4RA0C 3ZT6A 5D9SB 3V4PL 1GL4B 2C34A 2D4FA 2D8KA 1Y0LA 3T2LA 3C75A 1I7RB 2NMSA 3QFGA 3TNNA 1JWSA 3GMNA 1CF1A 5I1DA 1VEOA 1WBZB 1TJGL 3T8XB 3L2MA 3WL9A 3L4CA 3BZFA 2QLYA 3VX1A 1FH5L 3NQKA 4OJCA 5CP3A 1C8QA 3WNOA 1D5MA 4HS8H 5B38B 4GKZA 4LIQH 4YEFA 1HQRA 1T5WA 2H2PD 4MS8D 4WW2B 2IWEA 5JW3L 2OL3B 3N0PB 3HPJB 1QFHA 3DV6B 3CX5J 5ACLA 2X9ZA 4LSRH 5HHMD 2KPWA 4WGVB 4BKTC 3OKEA 2V2TB 4LLWA 3JV6B 1KULA 1EQWA 2XN9D 4QRSA 2Z92A 3WLBA 3SB3A 3PWJB 1QRNB 5I0WA 1BAWA 2AXGB 4R97C 1AZNA 2F19L 4MZRA 3QUML 5FW8A 1C5DA 1XAUA 4LARH 4EI0A 2Q76A 1BXUA 3C5ZA 4TPRH 5HHPB 1R3HA 4FGMA 5IB3B 3OR7A 2X38A 3EDFA 3IU4L 4JDVA 1HE7A 1E4HA 4KOBA 5DHYA 3NBNA 4AT6B 5DVNA 2KKQA 3FL7A 3RZCD 3EO1B 3JTTA 4HWBL 2IDTA 1FYTA 4AIOA 1I75A 4KO5A 4FDWA 2A0LD 4XWOC 2DQEH 3IDMB 2H6OA 2EYSB 3E1ZA 3SHSA 5GS0L 4NUGH 2RCSH 4ZT1A 4NNYB 4F8NA 4MNQB 1N70A 2UZXA 4XGZB 1JN6A 1S7TB 5GZOD 4L8CA 1CFNA 1W8OA 3BQUA 5TE4L 4G9FA 3OMNB 2D3LA 1IQDA 2ZOLB 5AENA 3RGBA 3L4UA 2AAAA 1T6VN 1C7TA 4LAQL 3VJ6B 2IPKB 4V2CB 1XCTB 4IM8A 1QWUA 5BCAA 4W4OA 3RIFF 5IY5B 1HILB 2ENYA 4OGYH 4XP5H 4TOYH 2I9LA 4Z76A 3DO7A 3WYRA 2JKLA 5EOTB 2Q2LA 2B59B 4ZDHB 4NUPA 3RWFA 1IFRA 4DEWA 3N06B 3UC0L 2HVJA 1GTNA 3P9MA 4ELKB 5L2JA 2UXFA 4QGTA 4NLHA 3LAFA 1HOEA 1J5HA 1ZHNA 2A9CA 4Y2OA 3UBXA 1O0VA 3PL6D 4OZFA 5EIIG 1XHHA 3CN1A 2OULB 3OLIA 4APXA 4ZMNA 3FQ1A 5ELIA 1FAKT 4FYQA 4RGNC 2XTJE 2C1PB 3TEUA 2VM3A 1SXZA 3U0PB 3ISWA 3QZWB 4V1DD 2A9DA 2FD6H 2WK2A 3LH2H 4NFDA 1EBPA 4HBQA 1QEWB 1VADB 1VERA 6FABL 1GAFH 5CJBA 4IRSB 3SPGA 2BWQA 4XNYL 1FNSL 5TFSH 1K4CB 2R4RL 5AW7B 4XVUD 5B39B 5ESAA 5KTEH 1YECH 3GB7A 2GCYA 4JB9H 1DSWA 2CHZA 4P9MH 2XPYA 1KPVA 3BKYH 4HQQH 5EEVA 1MFAH 1XH2A 4L9LC 3QEUB 5IBUG 1DQJB 1U91A 4NDMA 3HOGA 2NY5C 2J1ZA 1AGBB 4MB1A 3I9IA 2NQ3A 3BVXA 3V10A 3UAFA 3I6KB 1GGIL 1NGYA 1G7JA 5AW9B 3P9WB 3KWWA 2AANA 4L8SA 1CBJA 5DQJA 1QHQA 3MNVA 1L9QA 4P59H 4UT6A 3CX5K 1HEZB 5AKRA 4FQIL 2QVMA 3ECVA 3QZMA 1QBML 1JYNA 3I84A 3RY6C 43C9A 5GRJH 4UOW1 3BAEL 2VR9A 2X5PA 3WXVL 2ITDB 2V7NA 4FHJA 4KHTH 1HSBB 3O2WL 2HX7A 3GSOA 2CRIA 3Q1SH 2ICEB 4LSQL 2ZUSA 1IAMA 3ESPA 4OM1H 1MI5B 3HS0B 4XP1H 2E9IA 4MJ6B 4ONHB 4L0YA 4DEPB 4HU2A 3BCFA 1V8HA 2P42B 3Q2CA 3KXFE 5EUOE 4ZAKD 1SNRA 25C8L 2EO9A 2EDEA 3RJQB 2NNFA 3UYPA 2FIKA 4YSEA 1ZLWH 2NY5L 1HWGB 2V37A 3O3BB 1I1YA 5GZND 2F58H 2HJKB 2OMTA 2NY2D 2W0PA 4LMQE 1MREH 4U1NA 1G7HB 4TSAH 1Z5YD 1H8SA 5IGXL 4K2UL 2ZF8A 4PLOB 5JIPA 1EZVY 1P5VA 1BQ5A 3E6HA 2B1HH 5GRVL 1C12B 3SE6A 3SQBA 3AT9A 1K6QL 4X99B 5FOBB 3HUJF 4MA8H 1Y1DA 2K0RA 4KHXH 4LL9A 2Q86A 4Z7UE 5JQ6H 2X89A 2IPTL 2EXWC 4I77H 4LCVA 3CN2A 4ODVH 2XN9B 4GUOA 5DO2D 2DI8A 1IAII 2ZOUA 4WI0B 5F1OB 5HDBF 3KM2A 5TQ2H 3BT0A 4HUCA 3V4UH 3L7FA 5CU9A 1BIHA 4UINH 4FTVE 4HC1A 5CJOL 3EKCA 2LAGB 1HXKA 2K6YA 1KCUL 3ZKND 1S9VA 3VI3A 1V3MA 4NM8L 3ARQA 5L9DL 1DVFA 3D85A 1MCHA 1NOFA 4XAKE 9CGTA 5ICZA 1NAKL 1EXHA 4NRZA 2XBZA 5F6HI 4XC3L 3LEVL 2IDUA 1T0MB 4MJ5B 4NQEE 2D2OA 2XTLA 5BVJA 3HG5A 3T65B 3VRIB 5D7SL 4NP9A 2DLFL 4HUUA 3F58L 4Z7OF 4M5TA 5DFVD 1HYSD 4BJLA 2EVIA 5LXVA 2FWOB 5H35A 1HTYA 1IGMH 2E9GA 1Z6JT 3EADA 1FORL 2GSIB 4QY8A 4YAQA 4LVNB 1UD8A 5E6RB 2JTYA 3I6GB 1EZUA 1W6LA 4M7KH 5C0BD 3ZE0E 1VEPA 1P5UB 2CGRH 1YQVL 3OWEA 3VB8A 1ZA3B 4P3DA 1S8DA 2VQ4A 5I1AB 2ZXCA 1NSNL 2VN4A 2K1MA 4ZW7A 5D96B 3BSZL 4WW2C 1AXIB 4J2XA 1F41A 3CMOH 3KXFD 5FF6B 2EXTA 3KYKH 1YYCA 3C9NB 1U93B 1OARH 3CC5B 1DTUA 1UZ6F 4RGOH 1WBYA 4MZIA 3GD1C 1F1AA 2W59A 1UURA 3KPRD 4V1DB 1EERB 1R24A 4N90D 3AGWA 1PY4A 1M6UA 3BDBA 3S34L 2AMUA 3TO2B 2GB2A 4HCRH 4X7CC 3STLB 1J1XL 1C5CH 2VN6A 5GSRB 3QRGL 4TNFA 2DWEA 4W70A 2CIIB 4NAMA 5BMFL 3D0LA 1R5VA 3WE1A 3OSVA 3DGGB 2J4WH 1T0NB 3QEGL 5IMOA 4F2EA 2FAUA 2IAMB 4OGXL 2UX6A 1QX1A 3QHTC 3U79A 2R0KH 3G5YB 1GS7A 4MNGA 1Z1WA 1AZUA 1LL1A 4G8IA 4KXZI 5I76A 4QHLB 3B7UX 5MP6L 1DVYA 1YUKB 2C9PA 5DRNB 4LLQA 1MKFA 1JZ7A 4HS3A 1T5XA 1IE4A 1YVLA 1UXWA 4XNQB 3DMMA 4ZO6A 4G1MB 1QBAA 5C0EA 1RJLB 6PCYA 4X8XA 2WGNB 4Q4EA 3LKNA 2IH8A 4PRPD 3NFNB 5DI8A 5ICUA 5E8DH 1FZOB 1F3DH 1KB5B 1QRKA 4WUUA 3ULVH 4LLDA 1T1YA 1E2VA 5F9JA 3ESVF 1NINA 1H3UA 5BRZB 4NQED 3LN4A 4IDJH 2DJ4A 4J6RL 1Z9MA 3I2CH 4YXKL 2CLZA 4FQ1H 4MAUL 4E9TA 3GIVB 4OLZL 1I8UA 2D03H 4F57H 1OB1A 2HLAA 3MLZH 4ZAKB 3MJ8A 3DUSA 5J1SC 1U58A 2ZSWA 3ZDZB 3PAUA 4JEGB 1VGKA 2ZTBA 3D51A 4G8FB 2P26A 3B6SA 5KVEL 4Z77B 5C3IA 4TQEH 4P5TD 2QVKA 1HHGB 3B1TA 5B1AB 4LCUB 5KVDE 1KGWA 3BQVA 4OKVB 3PUUA 5CM1A 5IQMA 2NY2B 5JW4M 3S96A 1I1FA 4IRSC 1WLHA 3H9YA 4OQTL 1IO4C 4HXAL 3WKYA 1YRKA 3BSHA 1U42A 2FBJL 3M07A 2R69H 2Z1KA 1HI6B 4NJ9L 5CUSH 4GLRI 5EOCJ 5I18L 5JXED 1YHPA 3MRIA 3IJHA 2YGPA 1NGPL 4ORGA 2AJSH 2H3XC 4RMQA 3RKPA 2OP4H 5CEZE 1T4WA 2DM3A 2GG1A 3V55A 3FU9A 4WO4A 2HB0A 2P24B 4RESB 5D1XE 5A7BA 4G2AA 2BCMA 5KYYA 1KJVA 5E7FA 1OF2B 4HWZB 5D7HA 5BXFB 3MRKB 1Q9WA 2HA1A 3HCVB 2EXSA 4RDQG 1B6DA 5IVOA 4PBXA 5EEUA 2GSGB 3VRLF 3T3MB 3T2OA 2YPKA 3FT3A 5KEZA 5DVKA 2P52A 3OAZH 3BKJH 5EHFA 4CU8A 4KJQD 4KKNA 4OFVA 4OVUA 1A7PH 1Z9NA 2QQLH 3HNVH 3LZFH 1UUNA 3NH7H 3L3GB 2H41A 2AK1L 1EFXD 4MMXA 1DL7L 1D5ZB 3ZRCC 1ED3B 1KLGB 3TT1L 3V4VA 2WLLB 3A3YB 4N8VB 4TUJB 1NGWA 5JNYA 5SWSB 2ICEC 1ZIAA 3X2QB 4KDVA 3HS0C 1A6TB 1AD9A 1DQDL 1VRSA 3IYLW 3L5XH 4YFEA 4OW6A 5HD8C 4Y0GA 5EZPA 5C2BH 1Q1JH 3NIGE 4NKDA 3VAEA 4FFTA 3IBOA 3DROA 3QDGD 5JYMA 1E8YA 1AQ8A 4RMWA 1EEYA 2JJSA 4R90H 4HGMA 3Q8CA 4FP8L 4OGZA 4MQXD 5C0BB 1BLNB 3QNFA 4E41A 2O5YL 2ARJA 4ZQKB 5LAXB 3PDOB 4PJDF 2PXYA 4AV4A 2I07B 2QFPA 4YHML 2BM3A 5HYJA 4LOFA 4L37A 1JWMA 1CTNA 1JZFA 1GMIA 2Z34A 4ERSL 1A3LL 5EIIB 1FFRA 2Y7LA 1SOKA 1E5YA 1CS6A 4R96A 2H2PC 2J1KA 2OFQA 2VDQB 3AT0A 4MS8C 3GYRA 3S3SA 4QHUA 3W9DA 1XGQB 2XFXA 3VXQB 2F8IA 2CLRA 1UB6B 1X7QB 3VU1A 4YGVA 2VXVL 1DVXA 3KPRB 4JRYA 3TONA 5J6HB 4NSKB 2F5AL 2X40A 3IU3A 1GHFH 4ZXBA 4NXSA 4XVTL 3IFLL 1B4RA 2VZTA 2OYKA 3BFOA 4EQ2A 1XZ0A 4K73A 4ZMTA 4YHIB 2B14A 4FQJL 4M7JL 5IVXA 2H6PA 5TH2A 1PX8A 1BJ1H 2YFOA 5EF1A 1VESA 1N0LB 1RV6X 1ONQB 4L1HA 3FQ4A 3JWOC 4NO2A 2NY3B 2GC7C 3GDCA 4NFCA 3CD4A 3RZCC 5H94A 2Y9RT 5CEZD 2G9HA 2XRAH 4QRUA 3KWVA 4ODHH 3S3PA 3GTNA 4K3JL 15C8L 2R7EB 3TEWA 5DJ2B 5ITBL 1DYZA 3ARBA 2XA8L 1FN4A 3R4DA 5KSVA 2V33A 1WPCA 4LGSB 2JV6A 1UM6L 1EAPA 2GPZA 5CHNA 5GZOC 4L29A 2VUKA 4I3GA 3WD5L 3UPRA 4U3HA 1AZZC 1RZJC 3A0OA 4ADIA 3HS9A 2H32B 1OD7A 4PRPB 4BKSC 4E36A 2YOAA 4WWOA 5LN8A 4LVNC 5B8CB 4ZFOL 1I53A 2RD0A 4NPYA 2BSSA 2AEQL 1YO4A 1TNNA 2MQCA 3HG4A 1FJ1B 2Y6SD 3AAZB 4ZI8A 1P5UC 1CL7H 1GGTA 1QWHA 2LLNA 5MERB 3MBWA 3OMAB 2XBDA 3MO1A 4K9EC 4PV8B 1YYMH 1TMQA 5AW5B 3X1GA 3L48A 3E6FB 2EYTB 4YBQD 4L3EE 5DQ9B 3GMLB 5D96C 4ANWA 2V9TA 5IMMB 2JCCE 5LCVH 2FEEI 3PL6C 3LKPA 4M7LT 3RKDC 2KPNA 4FQQA 4LKCB 1TTGA 3FPYA 3NJIA 5MHSD 4LRNL 1RUMH 1CIUA 4P5TB 2VLKE 1JD9A 1NZRA 1UEMA 4H26B 5SWQA 4PG9A 4PH8A 4O4YL 3ZE0B 5LBGA 1TITA 4OLWL 2BJMH 3EOBB 1MQ8A 1HL4A 3NJFA 1YCSA 1RZJL 2BP0A 3WBDA 1KCWA 1HNGA 4NO3B 4XVUC 5TE6L 5IT2L 5F96L 2BY1A 2GUYA 1WAAA 5DJZB 5LNGA 3CG8A 2LTQB 2P5WA 2HMID 4P04A 5LQBH 2FRGP 2IAMC 2OMUB 1FZMB 3LZLA 3BCDA 1IBZA 3EFDL