2OV0A

Structure of the blue copper protein amicyanin to 0.75 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Ultrahigh resolution studies of amicyanin
rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ov0A00
1AS7A 5B1BB 2FJSA 1PCSA 2NRDA 1RZPA 3X1NA 2GHZA 1JZGA 1X9UA 4YSOA 2J5WA 4E9RA 5B7MA 2XV3A 1KV7A 1RKRA 2IWFA 1SHWA 3S3BB 1BYPA 2FT6A 2PP7A 1GW0A 3CG8A 3IN0A 3NSFA 4DP9X 4GYBA 4PCYA 2A3TA 3MX0B 2QPEB 4E9YA 3CVDA 2XVBA 1AS8A 2DWTA 3FQ1A 4BWUA 4QLWA 1MG2C 4HAKA 2XWZA 1NWOA 1HAWA 1PZCA 1MZZA 1A3ZA 1CUOA 5I6OA 1I53A 2H47C 4YSRA 3EH3B 5I6MA 1OV8A 1EHKB 3WNIA 1JXDA 1SNRA 3ABGA 3T6VA 4BK5C 4BXVA 3WKPA 1WA0X 3CZUB 1L9PA 5I5IA 4UAHA 3UABA 2AZAA 2FWLB 2FQEA 4JHUA 3ABMB 3U25A 2YAOA 4KO7A 1IC0A 3WG7B 1URIA 1ET5A 3WKQA 1AZNA 1JERA 2Y1AA 5I5MA 1ZIBA 2HZHA 4A2EA 1AZCA 4L0PB 1ZDQA 4AI7A 3QJQB 1SJMA 3X1EA 1XB6A 2CAKA 1IUZA 1NICA 3NJFA 5EHFA 2QT6A 3PLYA 3FQ2A 1AIZA 1BAWA 2J55A 4BWWA 3AW5A 4WKXA 4GY4A 4BWTA 1EZLA 2EINB 4HALA 4PAZA 3DIVA 3CDZA 4GP8B 1OE3A 2YXVA 1JZJA 1V55B 4AZUA 3SBQA 1BXUA 1OE1A 2W88A 3TASA 2HX9A 3D12B 2W8CA 3NP3A 4Q8BA 3NSCA 4BDVB 2BP0A 2DV6A 4G70B 3T9WA 8PAZA 3TBCA 1NINA 2YAQA 2GC4C 1WS8A 1AAJA 1KBVA 1AZUA 1NIDA 1XB3A 3UADA 2HX8A 5PCYA 3FSAA 4A68A 2DY2A 1NWPA 1PMYA 4KNUA 4G71B 1BQ5A 2VM3A 1E65A 3N55A 4P5RA 4MFHA 2VW4A 3CDZB 7PAZA 4AKOA 2QDWA 1NPNA 1N68A 5PAZA 3KW7A 3PXLA 3PPSA 1OCRB 2BP0B 6PAZA 3ZX1A 1A65A 4JKNA 3HB3B 2FNWA 3ZBMA 4AX3A 2BO0A 1SFHA 2XXFA 3OQRA 1XB8A 3FQYA 3G5WA 4F7KA 1ZPUA 4E9QA 3FU9A 3NJGA 1MZYA 2H3XC 2HRGA 4A2DA 4EF3A 3C75A 4KO6A 1AANA 4NB7A 4CSPA 4ENZA 1IKOP 2QPDB 3TBBA 1BEXA 2ZWNA 4Q89A 4CSZA 1ILSA 1KBWA 2FQGA 2XX0A 1ASPA 4G72B 1TEFA 2IH9A 4YVNA 1OE2A 5B1AB 1BQKA 3CVBA 2BWIA 3FSZA 4YVUA 5D4JA 2CBPA 2R7EB 1GY2A 2PP8A 4HHWA 3EH4B 5I6LA 1E5ZA 1OCZB 2RACA 1ET7A 4NAJA 4YSUA 1ID2A 5B7EA 5I6NA 2UXGA 4A2HA 2XLLA 3ZDWA 1L9TA 1M57B 2IDSA 2XU9A 4YSDA 2OV0A 2VSKB 1KCBA 1OF0A 4DP7X 2PP9A 3T6XA 1AOZA 2IWEA 3NJNA 1JZFA 2PCYA 4YSAA 1E5YA 1ZDSA 3UACA 1NIAA 2H5UA 3FYEB 1PY0A 2YAEA 4DP0X 4FA7B 1OOWA 1GS8A 4G7SB 1E30A 3OMIB 1QHQA 4KNSA 1ZV2A 1RZQA 3FSWA 2UX6A 1J9TA 2FT8A 3ABLB 1SF3A 3FU7B 1L9SA 2BP8B 2XYBA 2DYRB 1ADWA 3ASOB 4DP1X 4BDVA 1TKWA 2HX7A 1HFUA 1AG6A 2GSMB 2I7OA 5E9NA 2BW4A 3X1GA 1J9QA 3FPXA 3NJLA 4M4RB 4W1TA 3N2JA 3RYMA 1WS7A 1A8ZA 2BZ7A 2X88A 1KDIA 2XV2A 3L45A 4FAAB 4BXSV 5ANHA 1GS6X 2E86A 4AKQA 2IDFA 5I28A 2YAPA 1T5KA 1ZIAA 2CUAA 2ZONA 2PPEA 4G7QB 1WA1X 2B08A 1FA4A 1GYCA 3WNJA 1GS7A 2ZXWB 4TXVB 2X87A 2BHFA 2VMJA 3ERXA 1J5CA 3SBPA 1A4CA 1M9WA 2XV0A 3X1BA 1PLCA 1SDDB 2YXWA 1QLEB 4NERA 1ASOA 2UXVA 1PNDA 2FTAA 3H56A 3PAZA 2JFCA 3OM3B 2I85A 1ETJA 3JT2A 3IE9A 1A4BA 1DYZA 2EIKB 3AZUA 2IDTA 3SBRA 1WA2X 4GP5B 1HAUA 2QDVA 5AFAA 1AS6A 2UXTA 4DP5X 4YSTA 4DP2X 2J57A 3QJUB 1ILUA 1JZIA 1AG0A 3NJJA 3FSVA 1PLBA 2HLEB 2UX7A 5I6PA 1JVLA 1PNCA 1M56B 2VM4A 1CURA 3S3CB 4F2EA 2R7EA 4M3HA 3WIAA 3H4FA 2FT7A 2WO2B 1PAZA 3NJKA 2OCCB 2TSBA 1FFTB 3NJMA 4A66A 5AZUA 2EILB 2TSAA 2JXMA 1OCOB 3ABKB 3DKHA 1BYOA 4E9VA 1IBYA 2EIMB 5B1JC 1CC3A 2FQDA 1PZBA 2PCFA 2XXGA 2CCWA 3EF4A 4X4KA 4A67A 2YARA 4KOBA 3BQVA 1JVOA 4A2FA 1AZRA 3UGEA 1L9QA 1L9OA 2GB2A 2WSDA 1OCCB 4GXFA 5D4HA 4HIPA 1J9RA 2PPDA 4KOCA 4DP6X 5I26A 1AR1B 3MBWB 1BXVA 3FU7A 2FQFA 3NJHA 2BW5A 2CJ3A 1XMEB 2BP8A 4W9ZA 2AANA 1KGYE 1E67A 1TEGA 4YSSA 1NIFA 3GXUB 1UATA 1NIEA 1PLAA 4HHGA 1AQ8A 1GR7A 3WI9A 3V9CA 2LLNA 3S3DB 2Q5BA 4YSQA 6PCYA 3DTUB 2IDQA 2AVFA 3QQXA 3T71A 3X2QB 4E9WA 3FYIB 3KW8A 1KDJA 3OD3A 3X1FA 2HRHA 3NSDA 3QJTB 3T6WA 1GY1A 2P80D 3BVDB 5TK2A 4YL4A 3ZIYA 1L9RA 4E9SA 2VW6A 2ZOOA 5I6KA 1V10A 1R1CA 5FC9A 1SF5A 4P5SA 4AKPA 1SDDA 2YAMA 3AG1B 3AG4B 4HCFA 1J5DA 3PAUA 4YSEA 1NIBA 1GSKA 2XUWA 3GYRA 2HXAA 3AG3B 2EIJB 3EHBB 2PPFA 3OMAB 1YLBB 5IY5B 2Q9OA 1BXAA 1SFDA 2BZCA 5F7AA 3FPYA 2YQBA 3NT0A 4F2FA 2YAFA 5B1JA 4KO9A 3S8GB 4YSCA 5AKRA 2OJ1A 3NJIA 1KYAA 4G7RB 4HCGA 2IH8A 2GBAA 3FU8A 3PAVA 1ASQA 2P80A 1TU2A 4N8UA 1IBZA 4ZK8A 1NZRA 3QJRB 2GI0A 3TU6A 2XX1A 1W6WA 2UXFA 1W8EA 4RH4A 1ET8A 3NP4A 4HZ1A 4KNTA 4QKTA 3ASNB 2B3IA 2DWSA 2Y69B 3IEAA 1CYWA 2IWKA 3UAEA 1QNIA 2JKWA 1SHXA 5B3SB 4YSPA 5D4IA 1MG3C 9PCYA 2CALA 4E9XA 2PLTA 2VSMB 3SQRA 3V9EA 4DPBX 1JXGA 1AZBA 5B1KA 4HCIA 2MTAA 2IDUA 4KO5A 3PCYA 1J9SA 1CYXA 2DYSB 1X9RA 1AACA 1JZEA 4DPCX 3IN2A 2VW7A 4WTQA 3AG2B 2IAAC 3FT0A 1MDAA 1A4AA 4DPAX 3QJVB 4JHVA 5F7BA 3GDCA 1BQRA 3NYKA 3AY2A 4GP4B 4K9JA 5LDUA 1JZHA 2I7SA 3FS9A 3EH5B 1VLXA 2VN3A 3HEIB 3S8FB 1NTDA 1DZ0A 1JXFA 3OMNB 2WO3B 1NPJA 1PF3A 1PZAA 2N0MA 1WAEA 4A2GA 3H4HA 4N4YB 2J56A 2AZUA 3QPKA 3TA4D 1V54B 2PPAA 1B3IA 1F56A 5B7FA 2GC7C 4E9TA 2AFNA 1NDTA 2MRYA 7PCYA 4DP4X 1KCWA 5A7EA 3NSYA 2YAHA 2GIMA 2PPCA 4UANA 1RCYA 4UF7C 3UAAA 3CVCA 5TK4A 3T6ZA 4DP8X 2BWDA 1W6LA 3QJSB 1N70A 3IBOA 1JOIA 5I5JA 3JTBA 1FWXA
chains in the Genus database with same CATH superfamily
4YDJB 5F1IB 5HBBA 2BNRA 1D5MA 3WNPA 4UZUA 1DLHB 2HKHL 1JZDC 4TLTA 1FO0A 2VISA 3SE3A 3ULSA 2YBRA 2YR3A 2J5WA 3I6KB 2H6PB 4GO6B 2XV3A 5IHZA 2BSED 4LSTH 5ISZD 1XGRB 3SYAA 2APBA 4YE4H 3CK0L 1MUJB 2W91A 3RVTD 1UOVA 1Q72H 3H85A 2QPEB 5KS9F 5IQLA 1IVLA 2ADJB 2JIXB 2I5YL 3UGUA 2P47B 5TDOA 1WYJA 3O6FD 2I07A 4UQDA 2CO1A 5IP4A 1S5IH 3X3FH 3QIWD 3QHZL 1M05B 4OQTH 3EH3B 1AZVA 4NWUH 2VKXA 1A3RL 1WICA 2VWEE 2H32H 5DJAA 3ZGIA 4XP6H 1KTLA 3CZUB 5JLZB 4ESKA 1GYVA 1KY7A 1G7PB 1CQYA 1ZXKA 3FT2A 4PJFF 1F58L 2AJVH 2XG4B 1N0XL 2V2XB 2ZCLL 4ORGA 1HKFA 4RFNC 2HKAA 3OZ9L 3T3PE 4A2EA 4K7PY 2IXQA 2EIEA 1EEUA 3MLSL 3DBSA 1OCWH 2DIAA 2QT6A 4FFZA 4GRLA 4HWUA 2AQ2A 5F93C 4AJ0A 2BVOB 4E42A 3HN8A 3ZE1B 4PWGA 2JCCF 3GLAA 2NY0C 1AMYA 3M1BB 4ZS6D 4WKXA 1X9LA 4L8BA 1EZVY 2WKOF 3TH2T 4KKCC 1DQMH 4Z7WF 3VXRB 4XMKH 2ZCZA 5F88A 4F9PA 2P44B 5C07B 1X5JA 1HHHB 1TR7A 2QQNH 1JRHH 3NP3A 3S48A 2WQ8A 4ZYKA 5IHWA 4AG4H 4V33A 3SDDB 3ZTEA 1KXHA 3ELAT 2ZUVA 3EBIA 5MERB 3RFZB 2C4XA 4KVCH 1P69B 3FQNA 4K94H 2OK0L 1K4CA 5C0EB 5EF2A 3BWUF 5GZOA 3BLPX 1AXSB 2MQ3A 3L3DB 3L5JA 3LZRA 1BIHA 1XCTB 4QHUB 5CN2A 4GXUM 4AYBA 1VA9A 4X6DA 4NPYA 3TV3H 4JFYB 5LBSL 2GSIA 5T1LA 3OVUB 4K7FB 3EGDB 5LCVL 5JW4N 2ITCA 3QHTC 4OZ4B 1N68A 3EJUA 7FABH 3GSXA 4PYGA 2DWDA 1FE8H 3LQZB 1QFUH 1VRSA 4AYSA 3WTUA 1ODAA 3ARBA 1RURL 3MCKB 3WD5L 3HC2A 4JE0A 4NI3A 3UTSA 1JWSB 2IIJA 3ETSA 4L4JA 4RMTA 2WW8A 2QZQA 1HQ4A 3AXHA 5F71A 5FWRA 3SDAC 3S35X 2AJUL 4QF1B 2V2WA 3UZEA 2P8LA 2X89D 3O3EA 4ENZA 5IMOB 5IEKB 2VABB 4GS7B 3MLYH 4L8SC 5I8CB 4Q89A 5J1AB 1W8NA 2XX0A 4IDJH 2HP4A 4MDRA 3QYMA 5F0PB 1ZHKB 4X7CC 1S6NA 1LDSA 1I8MB 2VE6A 5CD5C 4NSKA 2VGLM 1RZFH 2PP8A 3MTRA 3MA7B 3ROLB 2AERT 5C2BL 3IGAA 4W4OA 1ID2A 3DX0A 4UM9D 5I6NA 4L3CB 4A2HA 4G9FD 5FF6B 1CB4A 4JQVA 5E6IB 2EC9U 3V6ZB 1KFGA 2R1YB 1S7VA 2AEIT 3RGVC 5IM7B 3SYCA 3BT2L 3RY4A 4OCXL 5JQ6L 2YRLA 2G3MA 2ZICA 4I3RH 2WWKT 4WJG3 3FQTA 5I1DA 3MRFB 4N0UA 1GS8A 2L8AA 3Q8FA 3L6FA 5BV7L 1YMHB 5ID0A 2UX6A 5JXAL 1A6TB 3APDA 2A74B 2YA2A 2XYBA 3H0TB 3Q7JA 4IHOA 1ACZA 3LOWA 4H1LA 2EADA 4XH2B 1HFUA 3T3PB 4NOFA 2MHAB 4HV8A 5CO1A 3ZKMD 1HZHH 4FQCL 4P9HC 3HG2A 2OKMA 3X12A 1N9PA 5D1QC 2XWXA 4GKZB 2F7OA 1TETL 4YDKL 4MAYD 4WNQB 4BCYA 4X6CB 4RZCB 1HN1A 3IAGC 3V4LA 4L0YA 3J07A 4YHIA 1K5NB 1BLNB 5JOPE 5HJBA 4Q14A 5BVJB 4LCWA 5GGRY 1BCIA 2X4TB 3F6JA 2DQMA 1KXQE 1X5LA 4UILH 1J5CA 4F8LA 3SGDH 4NZRL 4U1SA 1BZ9A 2CR0A 1XGZA 4Z0BL 3STLA 1NCAH 1ZS8B 2OMBA 2H1XA 2ZSWA 4G11A 3TX4A 4WFGE 4ZMPA 2QLVB 4HGMA 1QTYT 3PIQA 3MDJA 2WLLA 2XWDA 1BHGA 3FK3A 2PTVA 5LBGA 5CWSB 3PS6A 4KQ4H 1RL1A 3GSWA 5D2LF 2XZAL 2YMXH 3SGEI 5IVXB 2XPGA 3CU7A 3AQZA 1EGJH 1AKJD 5TH2A 1NMBH 1ZVSB 2OP4H 3PQYE 1I75A 3VXMA 4MZ2A 5JIMA 5GSVB 3VGDA 2HT3C 3EOTH 2DZEA 2WBJB 3H4FA 3JVGA 3DSNB 5HI5C 3MFFB 4O58H 1LYQA 2W60A 1PG7W 4BSWA 2HLAA 3TN0C 3ZY7A 4QJ5B 4X4YA 1UWGL 1QBAA 1SXSA 1HKLL 1PKQB 2P1YA 2MFNA 1JL8A 3PAYA 3C8HA 4MLSA 3G04B 4HOWA 2E9WA 1T80A 5C8JB 4JAMB 3BP5B 4DF9A 2ZOLB 1MRFL 1CFQA 5LN4A 3EF4A 4CSTA 4XPTL 3ZTJG 2DD8L 1RK1B 4EN2A 4ETQA 4JJ5B 1NCIA 2MNWA 1MCWW 1P7HL 5IHUL 4U0RC 3CVHB 5DHDA 4J4PA 3LZLA 5D4HA 5D7JB 1ACYL 4HZLA 5ITBL 4A37A 4JY5H 4AJVA 4JFZH 2VAAA 4MCZA 2H45A 1ZCRA 1AFVH 4JCLA 1EDHA 2MNJB 1RP8A 1P5UC 5AOJA 5ECJE 1KJVB 3C60C 4TYUA 3EZJB 2Y5TA 3WS6C 2YUXA 2J8UF 1JF1B 3L9RA 3SIKA 1LQSR 3UTTD 3GD1C 4NZFA 3KLKA 3QJFB 4WJKB 4RRPA 3VFWA 1O9WA 5INCB 4KK6C 3BWSA 3X2QB 5T1DH 4FEIA 2K4AA 4OFPA 3F5WB 3X1FA 5D7KE 2VLKE 4LCVA 2A38A 3TZVB 2VW6A 4WI0A 5I6KA 3TC9A 1ES0A 2WVVB 4YGAB 5DQJB 3VXSE 4IRJC 2FH6A 6TAAA 2CJUH 3PAUA 3T0EC 1ANUA 1RHFA 5D1ZA 4CVZB 3FTGA 3QDME 2HLFC 3H1ZA 1O6SB 2P8MB 3D52A 3GMRB 5CEZE 3NEXA 4Y8DC 1HNFA 4RLDA 3TO4A 3T2QA 2X09A 4OIBA 4LOFA 2BZCA 3SGKC 5F7MC 4NP9A 4N25A 3AWEA 3FTWA 2YAFA 4GG6E 4ERSH 1J9CT 1BIIA 4GSQA 2IADB 5EIIG 4WHTA 1A6VL 4NO2B 4M7ZB 3R06A 2Y07H 4G7RB 4M29A 2NR6A 3KWTA 3RHWK 4NFBA 3RWFA 3K6OA 1ASQA 4R0LB 4KAQH 2NY2C 3HG1A 3AUWB 2AQQA 1FZMA 3CFNA 4PFEA 5JTWA 2QVKA 1SHMA 4OD2B 3BDBA 2VZ3A 4FMKA 1KPUB 5FO8B 5J9PB 4NNYB 2NY3B 5CCKH 4O4YH 4NIYE 1CPUA 1LO5A 2R0WH 3CVIH 4X9IA 4IGBC 3UAEA 3AAZA 1R0AL 3ZKNC 4B7IA 2V17H 4Q9QL 1F18A 4GMTH 1GGIH 5KYUA 1NCBL 2CRZA 4WRLA 5EZLA 2VLLB 2C9VA 5GGTH 2XWCA 1G1YA 2Z31C 3CN0A 4J39A 3EYOA 2IDUA 1HE8A 3VGGA 3LPGA 1DEEB 4PJDE 3G5ZA 1MDAA 5I2IA 4NKIL 2QKSA 3QJHA 1NDGB 2O6DA 3WN5C 3IFPB 4QHKI 3O2DL 2DH2A 2HH0L 3O6FB 4AGLA 4H88H 2HJKA 4IJTA 4PRHA 3BQUD 4LVOB 3PNRB 3BUTA 3T8XA 4R2GB 4XN4A 4WTZG 3V7MA 4MD4B 4PB9H 3QIWB 2NW3B 2MNUA 4JRYD 4PWKA 3ES6B 1KTCA 3CSFA 4LP4A 1KENL 2ADYA 2VDNB 2YPLD 1EBPA 3BEWA 1YEKL 4OI8A 1QR1A 2ZCKL 1FNFA 2IOOA 4U1JB 4XMLH 1S9XA 3L5IA 5LKNA 2WV3A 2F54A 25C8L 1QKZH 1QTSA 3IJSB 4IOIA 3N50A 4NAQA 2AZUA 2DTML 3HRPA 4WEUD 1I8KA 1WIOA 2AFNA 3QQ9C 1ZA3A 2DIEA 2N1TE 1F2QA 1BX2A 4OUUB 2Z91B 4AYGA 4FCHA 2D03L 3ARDB 5C9JA 4P2RD 1EMTL 3WNMA 1EHAA 1NMCC 1PLGL 4XB3A 1CDHA 2CKNA 2JVUA 5DFVC 3RPIB 2WAQA 1S9VB 2CA3A 1A0QL 3BW9B 2YS4A 4FQ1L 1U8OA 4L9LC 3OAYH 4IIQB 1PTZA 3C5JB 1CXKA 5HI3C 2XQBH 1JZGA 4KDTC 4IU3B 3AREA 1E7VA 2VLKB 4Y7MA 1YEJH 2PO6C 3LEXA 4IKIA 4MB4A 1XIWB 3ML9A 5AVVB 1Q0XH 3GO1L 4KDVA 1X5YA 4BUHA 2NY5L 1TCMA 2VDKH 1A7RL 1F2XK 2HTLD 3WHXA 5GRVK 3X14B 2DQEH 3Q1SL 4N2BA 4EJ1C 3LEVH 2APSA 3SDXE 1OP4A 3ETBF 2CPUA 3OAZK 3QDMB 3IDGB 1JNNL 1S7SB 3SCMA 3HI5L 4LDOB 2AXFA 1WC7B 5DRNB 3QCTL 4Y9GA 1CU4H 1ED3B 2F74A 4KJPC 5IOKA 4XMXA 1L9PA 4JRLA 2YSTA 1SBBA 2XTJC 3X13B 4GG6B 4PV9A 2VRQA 1OK8A 3TM6A 5DHVA 1N7ML 1XGPA 4YXKL 4E5XG 5CGBA 2R0LL 2F53D 4GI9A 2XFXA 3G3LA 1U8PB 3VG9B 4QRUA 5I66B 5L7XL 1AH1A 2Z8RA 1SY6L 1UQSB 4PWEA 3ZGHA 3FBQA 2HTKC 5I18L 1JZ6A 5EEXA 5DJXB 4E41A 2R69H 1EHLL 1DVXA 1M2VA 2Z65C 3I02B 3HLAA 4IRSA 4BZ1A 4BWWA 5E8OB 1K85A 3DGGB 3ARFB 4O51A 3SKUD 3AWGA 3BWZA 4HFWB 4PM1A 3QIUA 3MRQA 4AL8C 4BH7A 4NUQA 3DJTA 4JM2F 1P53A 2CHNA 5DJ6B 5I30H 2C7FA 5JOFB 1A8JH 1NA8A 3ZR6A 4ZOEA 1HI6B 3A67H 3FH8A 2G2NA 4LL1A 4NQQA 2DV6A 1WTGT 5C09A 4OFIA 4PJDB 3S35L 3UJTH 5G55A 3I6LE 4ZUWB 1V7ML 2FK9A 3RWIA 4UM9B 2G5BA 2IANE 3CQQA 3TIDB 2WTPA 4XNYH 2WXPA 2IFFH 1TVBA 2NUTA 5KYWB 2NY4C 5PCYA 1MVFA 2BWQA 3C6SB 1YZZA 5JHDA 1UB6B 3VFPA 3KDMB 1UC6A 2JQZA 3B9KD 3L3GB 1KELL 5TDNA 3SB3A 1BQSA 4QYOA 3QI9B 1UM5L 1OPOA 4K8RC 2P5EE 4PLKC 5I19H 4D0BA 1D9KB 1IJNA 3BVWA 2GAZB 5T3ZL 3KS0H 1PW3A 1PD6A 3S96A 1XGRA 4CGTA 3L3HB 5FYLL 3HB3B 3VVWA 1L7IH 2Z7UA 4L05A 3C08H 5E5UB 1K6QH 2X1QA 4AY0A 1UD3A 5K69A 1QPPA 2BY3A 1HH6A 3QIBD 1MCRA 4PJ6A 2YFOA 2P26A 4FL4C 3ARGC 2C4FU 1CE1H 2FE0A 4NKOB 3MRCB 4XXWC 1KBWA 4NN6C 1Q72L 5DHEA 4JDEB 3RU8H 1CF8L 1QFWH 3MLRH 1P5VA 4Q58C 5DUMH 5KSAA 3GMOB 5FUOH 4L37B 3RGHA 3TO2A 5JW3H 3IAQA 1G7PA 1S5IL 2I24N 3X3FL 5I71C 4ZX5A 1I9JH 1ZHNA 3I2CH 3SQBA 2XU9A 1DQQB 1MLCA 3OAZH 1T0PB 1ZTMA 5HTSA 1KCBA 1OGTB 1BGXL 4NWUL 4NQEE 5M94B 3FC8A 4HGWB 3FQWA 5CSBA 3S97C 4XP6L 1RMFL 1B4LA 2GQHA 3FAXA 4ZMWA 3T6XA 4PJGB 3GZOA 5GJTH 1TZGH 3EH2A 1JTPA 4C56E 3W9EA 4AUYA 4FNPA 3L1OH 1KTDA 4UQBA 2VERN 3C6LC 2Z7YA 3GSVA 1HOCA 3BC9A 1EFXB 2MQCA 1U8IA 1AGCA 1XGTA 1VENA 4U6VH 3VXRA 1PKOA 3FU7B 2NY7H 1R19A 4EZLA 2I9TB 4NM8H 5C07A 1H15A 3GIZH 4N1CA 1HHHA 1KWGA 1UA3A 2CDGB 3LMJH 3D69A 2EEBA 3NCYS 1HS6A 3UTZB 4LB8A 4APQC 3NTCH 2PN5A 2NXYD 5DLMH 5JHLA 1D5ZA 5MERA 2X88A 3B2UD 4M1GH 3L45A 4FAAB 1HCZA 2HVJA 1DQML 1NEUA 5C0EA 4XMKL 2ICEB 4AKQA 2XY2A 3SKNA 4LGRB 1JV5A 4R7NA 2K6YA 1IU1A 1XCTA 3IDNA 2QQNL 1JRHL 4ALAL 3TIEB 3N85L 3KHQA 1FORL 4PD4J 4JFYA 3EGSA 5D2NE 5KVGE 4AG4L 1X5GA 4NUMA 3EGDA 2FHBA 3OLEA 1N26A 1MJJA 3DUUB 4WSGA 1H3GA 1ROCA 4KVCL 4LVNC 1G6RH 2HJFA 4K94L 1WAAF 4PS8A 5T3ZD 1IC5H 3PL6C 1F3JB 4TQEL 1INQB 2JJTC 3OMZA 1FRGH 2IH1A 3LQZA 5EDXA 5BV7B 1NAKH 3TBVB 1X7QB 3P2DA 5FYLD 4PRDB 5F6IC 2IANB 3F8UB 1Y1UA 1LO4L 1KGWA 1P0SE 1ZT4A 4PREA 4K73A 3RIAF 4P3WA 2CD0A 4HJJL 4QF1A 2QDVA 5HDBE 5DRXB 5I24A 2UXTA 4OIIL 1FGVH 3QXAB 1XWVA 5FA3A 5IMOA 3CC1A 7FABL 5IEKA 1HHGA 1D2PA 1F4XH 2LLLA 3K72A 3VWJD 5I8CA 1FE8L 1S7WB 5CIPB 4WWID 1QFUL 5J57B 5E9DD 1DVFD 3VXQB 1URLA 1ZHKA 2EYSB 4QNPE 5A6LA 1XCXA 1I8MA 2P5EB 3OC5A 4CBZA 3UC0L 3NRPA 2IQ9H 1MIML 4QT5A 1TQUA 3MO1A 3MA7A 4OLEA 1YHPA 1NBZB 3R1GH 3QO1B 3ULVC 2P8PB 3FRPB 4TMPA 3PXJA 4M7JL 4L3CA 4UQ2B 5FF6A 4GQ9H 4LQ1A 5E6IA 2WJ5A 4AOFA 3ABKB 1YY8B 4QCIA 2QMJA 4Z3GA 4BKTC 3D07A 3V6ZA 5EEUA 1RZKH 4POUB 2EO9A 2GW5A 3GNML 3VD0A 2DJ4A 4I18A 4MQ7B 3RKDD 1RZFL 2C3HA 2X4NB 4FG2A 1OAKH 4H26B 3FFCD 3M7FB 3HFML 5F7EH 4A39A 1BG9A 4IK6A 4PD4K 3RHWF 5HGBB 1G7HA 2XICA 4UTBH 2AS5M 1A6TA 1NCOA 1MFEH 4EE2A 1WBXA 3CFKB 2DYPB 3QK0A 4QRBA 5J6HA 4JKKA 3VDBA 2F18A 4I3RL 4KJYA 4B9ZA 3DJ9A 4HUKB 1SLXA 4NQEB 4Z7NE 2IAMB 4A7GA 4GUQA 3HTLX 3SDCC 1BOYA 4HUMB 5BS0A 1FFOB 1T2QH 5MEPB 4GKZA 5IFAL 1NEPA 4HPYH 4ZDHB 3S3DB 3NIGE 1CGYA 3MJ9H 4S0TD 4TQPA 1G1OA 4X6CA 4RZCA 4E9WA 4AUUA 1WHOA 2W0FB 1XT5A 1K5NA 2YKLL 3BAEL 5BVJA 4IBYA 2WLIA 3EJZD 3HAEH 3CH1B 2BOCB 2ZOOA 4KMQA 3DNKA 2P5WE 4Z0XB 3LV3B 2R83A 2Z64C 1I7ZA 3U1QA 3DVGB 4JPVL 3U2SB 2D73A 2ZWKA 4AZ8B 3RPKA 5E94B 1ZS8A 3LXAA 4PTTA 3ZYZA 4KTDH 2M1KA 1OAXH 4WUUB 4CDGC 3RWHB 4JFHD 4OCRL 3VRJB 3BZDA 2LV4A 1OHQA 5AZ2H 4D9RD 3K6DA 5CWSA 4QRSA 4D7PA 4UILL 3TCLB 4LARH 2VDRL 5IVXA 1RVFH 1T1XA 1QSZA 3CC5A 4L1BA 2HG5A 3FPYA 4NQVB 2IGTA 3QG6B 3A5VA 3HG4A 1DO5A 1SOXA 1H5BA 4MMXC 4TUJA 4KO9A 4YZWA 3B56A 5EF0A 5HVHB 1SEBA 3I9PA 3QQDA 5D2NB 4CC1A 2V8LA 1Y07A 4IBLT 3N06B 5DHYA 4N87A 4LNRB 4KQ4L 3OXRB 2A4CA 2QR0B 2YMXL 4J3OC 4Y1AA 3MFFA 1FN4B 4LPYA 4XZUB 3ILQC 2C3WA 3LHPL 4M1CC 5FYKU 1EGJL 1AP2B 1PKQA 2GG1A 4QUOA 1B2WL 5F6HJ 4DGWC 4L23A 5MEQB 4EUPH 4W9CC 2XWTB 5IW1A 2OP4L 3S37H 4Z3JA 4JAMA 4LRNH 5A2KH 5C8JA 3TBWB 5HDBB 4QOKD 2R2BA 2QLYA 3EOTL 3BSZA 4WGWB 1KPVB 1MG3C 1E5UI 2L0DA 3CVHA 3QZWG 4ZTPH 4E9XA 1HXMA 1CTOA 3HI6L 4R7XA 3TH4T 3E2HB 2BIPA 1FZJB 5D7JA 4BA8A 2P4AB 5B1KA 5DT1H 2WIIB 3ZL2A 1BJ1J 1MJUH 3AGWA 3FFDA 1DN0A 2BY1A 2QGBA 3MLTB 3CMGA 1KYOK 4RAUB 4HWEL 1A4AA 2ZG3A 2BH0A 3DGCR 2FX7H 3TVMA 1KJVA 3D3VD 3GDCA 3EOBA 3QULA 5B38G 5T5FH 4MWFB 5KYXA 2EDRA 4XNBA 2I7SA 1P4IL 4PW3A 4JFZL 1NCNA 3QJFA 2NX5A 1AFVL 3DX1A 4NUJB 2VN3A 3UBHA 5CJQL 1FNLA 3OR6B 1RZJC 1XXDC 1R3KB 4DIXA 1JXFA 2AAVA 2LQRA 1MEXH 2M8XA 4KKCD 1PF3A 3F5WA 2YD8A 1SEQH 4PBXA 2CK0L 3H4HA 2NZ1A 2ARJB 1ZWIA 3ARRA 1T20B 3CQPA 1CVSC 3KXFD 3NPSB 4KKPA 3HZMA 2GC7C 5AVRB 2WVVA 1I1AA 5HGHB 1FZOB 43C9B 2AXGB 4UMSA 1OSZA 2YGPA 4ZPTB 1WWBX 4XAWH 3V0HA 1QQDB 4Z7NB 4Y16A 3QQ3B 1JN6B 5EOQL 4FYRA 4DVBB 4JO1H 3SGJA 4UIMA 3WJMB 4J23A 4PRBB 3SN6N 4Z77B 1G6VK 5DURD 5GQBA 3L54A 2OL3A 5EU6D 1RZPA 2AMGA 1G0DA 4MBOA 4G6JL 5IQ9A 3N40P 1H6FA 2CJUL 3RJOA 3V0VA 1KCVH 2PCXA 4PVLA 4X83A 4JJOA 1RZIB 1GKOA 2P5WB 1XF4A 4C47A 3KH3A 2A3TA 2Z7ZA 4RNRB 1A6UH 1FAIH 4HJEA 1N2RB 5D70H 4L2YA 4ZNEA 2JB6B 1H3XA 4HAKA 3DRTB 1FHGA 2EDLA 1U93A 4NKDA 4S11A 3NCCB 2QVFB 4JFFE 4MXQD 4ZX3A 5E08L 2DM3A 4JN1L 5F7KC 4BXVA 4CMHC 1FZKB 4G9DB 1NBYA 5EA0H 4KAQL 1AC0A 5KVEH 2BNQE 3B9KB 1IVTA 4LRIC 2R23B 1HILB 5DK0B 2FJHA 3NZUA 4N8VB 4HPHA 5I0XA 2DLFL 1YN6B 1XH2A 3HS9A 3EDKA 3O8XD 5A43C 2O6FA 4JANB 2ODHA 3INUH 3U7YL 1H8NA 2BSEA 3WSQH 1A02N 5ISZA 3CFBA 4L0PB 1XVSA 2R0WL 3CVIL 1JZ8A 2I25N 1I1YB 1ECZA 1BSIA 1NDGA 3O2VH 3WV0A 2VXUH 3IFPA 3PLYA 1S4IA 3BO8B 3TURA 2Y7NA 2V17L 4G80A 1BAWA 2V4LA 2J55A 3O6FA 5LAXA 2CXGA 4HSCX 4HPOL 3RGVD 4ORZC 5A2JH 4Y5YC 1T3FB 3HN3A 3ECBA 5C0AD 4MD4A 4OGXL 3QIWA 4JM2D 2LU4A 3OWRA 3EFFA 4Y9FA 2NW3A 2AV7B 5IMKA 1T22A 2EDBA 4WFFE 2YUVA 3HZVB 1F8TH 3JWDC 1NKRA 3DROB 2DEWX 2VQ4A 3LIUA 4Z3HA 4AYMC 4KI1A 1ICTA 3IJSA 3IMUA 1TKWB 1USQA 1JI2A 3T9WA 3QHFH 3L4ZA 3Q3GB 2B39A 3FN3A 1XSJA 3QWOB 2AQTA 2Z91A 1IKNC 5ILTH 1FNGB 1UT9A 5CN1A 1AAJA 1NIDA 2AVGA 2DQFA 4PSRA 2UYLB 3QXUA 3VFVA 1A1MA 3FO2A 3KPLA 4ZX4A 1J18A 5F70A 3ZMNA 1B0IA 3FONA 4A7SA 1BM3L 1S9VA 5AG8A 1QKZL 4U4IA 2GUOA 3BZEA 2BSCA 1G7IB 1IQDB 1L6ZA 3KL3A 5IF0A 3IDJB 1FCGA 5FW7A 2CH8A 3CDZB 5T1MB 3S3SA 5MHSE 2YJLA 5DC9B 2EE3A 5TDPA 3O6MH 2YEVB 3KM2A 4IU3A 3RI5K 5B8CB 5BZDB 3WN6A 2CJSA 2VR8A 1TJHH 3BD4A 3KR3H 3ZX1A 1IE5A 1XIWA 1MOEA 1UM4H 3IF1B 3EO1A 5E2VL 4R96B 4R7VA 3RJDA 2XXFA 3KPPB 1LK2B 3MHZA 4G8GE 2A9DA 5E4EB 4F7KA 5DUBB 1CGTA 2BERA 3QRFM 3MRMB 1A14L 1NC2D 4N3UA 2XQBL 4C83B 4LLUA 1BVNT 2ZAIA 5DGRA 4XPGH 4R7DB 1IKOP 2NSMA 5D8JH 4DGIH 4LLQB 5F0LB 5F7NC 4TUOB 3UTPD 1TEFA 1ED3A 3CVBA 4KFMA 2VDKL 1CGSH 5BQDA 4GLRI 3H7BB 3QDGE 3ESUF 4IOFD 5T3XH 3U2IA 3ZT6A 2DQEL 2Y6SD 2XQYG 3NABH 3LEVL 1T7ZA 3MV01 2HT3D 2GTWB 5F89B 5HI5D 3FU0A 4ZMVA 1L9TA 3TBYA 5ESVB 2GT9B 1UZ8B 1U8PA 2E6PA 3QNYB 1CCZA 5I66A 4L3ED 4ZFGL 4HXAL 2QHRH 1O9ZA 3ULVF 5DJXA 3NJNA 4HKBA 1MCKA 3BRDA 1Z9SB 2XTSA 3VGAC 4G7YH 2BCKB 1E5YA 5E8OA 4JFFB 3LKOA 4H25A 3QG7L 1IAIL 4CVUA 3WJLC 3QA3B 1N0LB 1U92A 1Y1DA 2X89A 3ZQ9A 3WUWB 5BJTB 3LIZH 4LESA 5C6TH 3OL2A 4BCZA 4M1DL 4ZJ9A 3WMSA 1SUJA 5E9DB 3SPVA 3CLWA 1XH0A 4GIAA 4XCCH 5E4IA 2OQJB 2R69L 4YXLH 2BZDA 1HI6A 3UGXA 4PJDA 3L17A 3CLFH 2PW1B 4QRAA 4AQZA 4A04A 1J8HD 4G8FA 4UM9A 3C2AH 5E7FA 4Z18A 4BFKA 5MI0C 4XXCC 1I8UA 4TUKH 4FQXC 5F1NA 4GT7A 3RPBA 5KYWA 1QSFD 1VCBC 3C6SA 3FB8B 3QDAA 1GS6X 2WBKA 2YQ2A 2H32B 1IFHH 2TRHA 3KDMA 3VB9A 1IM3D 5I30L 4M8QB 2ZONA 3A67L 4X4ZA 4KK6D 3GRBA 3L3GA 4BK4A 1H3TA 1E90A 1CDUA 4WI4A 3UJTL 1SJVA 1O6VA 4XNQB 2IPTH 1E28A 3IXTB 1D9KA 4QMEA 4GRWH 2KQNA 2GJ6E 3ZKXC 4XNYL 5AYQA 4NERA 2IFFL 1BAFH 1ZSDB 4NWTL 4YLCA 1ASOA 2C26A 2WUBH 3BCFA 3H56A 4WENB 5ABAA 3L3HA 4B9JA 4FMFA 4LEBA 4M5YH 4HDIB 2WWNA 3NEOA 3CHQA 4D0CB 4PGCB 1YVLA 3PJLA 2Y25A 3OBAA 2FEEL 2VOTA 1LM8V 1RIHL 1XF3B 1MCWM 2FWOA 1ZLSH 4KROB 2VTFA 4XWOC 4RGND 4ZSOB 5I19L 3FCSB 2V5TA 3V5HA 5BNXD 1ILUA 2XIBA 3CV5A 4NKOA 2VM9A 3MRCA 4B9GA 4LFHG 4QXGH 4UIKH 1PLBA 4JDEA 2VDPH 4HK3N 3MCLH 1PNCA 4GSDH 1YEGL 1YNTF 1K6QL 4KZDH 2BMKA 4L37A 1Z9LA 3IDUA 2ADIB 3DHPA 1T0NB 5LBSA 2QSTA 4ZUVB 1FFTB 5LCVA 5FFGA 3LQAL 4ZOAA 4XN9A 1E9PA 1OM3L 4X6FB 3VRLE 3STZA 5MEOB 1HHKB 3K1DA 4JHZA 3TJHC 4P46C 3RU8L 3DSFL 3KCPB 3K6IA 3T4AA 4OZIA 1QFWL 2C1OB 4U3HA 4PJGA 5DUML 5KAQF 4U3XA 4XTRC 2AC0A 4PWJA 3UOAB 1L9QA 2OPCA 3FF8A 4LSDA 3FQ4A 1S9WB 5IV2A 4JPIB 1MH5A 3U79A 2JWYA 1I9JL 1MRDL 3LS4H 3BKMH 1AKJA 3L81A 4FG6C 1XCQB 4FLQA 1N4XL 4J3XA 3QDGB 2Z31D 1E8ZA 2BJMH 4KZCA 4NN7C 1GAFH 3FU7A 4FXKA 3KYMA 1TTCA 4N5EC 3QUML 5K59E 2CDGA 1YECH 4PJ8C 4ZO9A 3B3BA 1TZGL 2HN7B 5CMAA 2W59A 1N64H 5DJ8B 1XZ0B 5TE4H 3PPEA 4OKDA 5E99H 4CNIA 4U6VL 3DTUB 3AWFA 1JGDB 3DYMA 1RAMA 4KY2A 4J3VA 4WNJA 1T89C 4OT1H 1LILA 1JPTH 1GGBH 2EXYC 5BMFH 1U36A 3BVDB 2DMKA 4HU8A 1WCBB 3BPNC 4ONFH 3NTCL 1XQ4A 4X9FA 4DAGL 1NJ9B 4Z7OF 3OX8A 1MCOH 5GGVH 4PSPA 4KXCA 2AK1L 3OHXB 1FVEA 3AG4B 4M48H 1Q1JL 4QRTB 1J5DA 1MWAH 1LO0H 5JR1H 3G08A 1X7QA 2QADC 3M88A 3CCHB 4WQOA 5A7BA 1EERB 3HBGA 4M43L 3EHBB 1RHHB 3HRZC 4WNSA 4H8PA 4KK5C 4GEJA 4XMPH 3CN2A 4I3SL 3O3BA 4JFTA 5DFVD 2X4PB 5DRXA 3JWNH 2JV6A 4CADB 3UTTA 2JNZA 1QUPA 5DRNA 3JV4B 5G5DA 5B1JA 1IFRA 5HHME 3U2JA 1FRGL 4PWIA 5CIPA 3MQIA 4KTYA 1FIGH 1NAKL 2VXVL 2Y06H 3VXQA 1YPZF 4AVKA 2XKNB 3A6OA 3LB6C 3H3PL 4DGUA 3MGOA 3OKOA 3L95A 2EDQA 5HYJE 1T7XA 3U48A 5LLIC 1NBZA 4MJ5B 3H2WA 4Y2DB 3GSOA 3P0GB 4N3TA 1E43A 1DE4B 3FRPA 2UXFA 1FGVL 3T2NL 3SE3C 4ZX6A 2D0HA 3NOIA 4QO1B 1T4KB 1CN4A 2OMVB 4X5XB 1GCFA 3WE6B 1DSWA 4WI7A 1DSYA 2VLJE 5DRWB 3R7QA 4IRZL 5D7IE 3HMXH 3FH5A 2KDGA 4G5AA 2FHFA 1RERA 2IQ9L 5CSZB 2X4NA 2X4SA 1LP9A 5LWYL 3CZKA 2XNAB 2VCOA 4H26A 5DUJA 3N5AA 2JJVA 4LVEA 4PG9A 5JO5B 1KT2B 2J1YA 1W0WB 4U1NB 3U6RB 4WK4B 1L0QA 2L04A 2WLYA 3MLZH 4KTEH 1G9EA 4JR9L 2KUTA 3MLVH 2PWHA 2NLJB 1VGEH 3CFKA 1QI3A 1MCBA 3B3IA 3ESPA 3QJVB 4O9HL 5JPMB 2E7CA 2QGEA 4HW6A 2JB5L 5I0YA 3VNZA 3F7YB 1W16A 4PGEB 1OAKL 2HTKD 1JMZA 2IAMA 2VLRD 1KIUB 1ETB1 4GRMA 1JRHI 3FS9A 1FFOA 2ZG1A 15C8L 3BD3A 4PJCF 1OARL 2Z4TA 3RJQB 3TYFB 5L4FA 4PS4H 1JHTB 1UVQB 4ZDHA 5A2CA 2H1LM 4KI5C 1S9KC 1CJYA 5I1KH 4PWFA 1K9TA 2W0FA 5I9QC 3OF6D 1KIQB 4GRLC 4N2OA 2YMTA 4N8PA 1SRDA 3D0LB 1ITBB 3CH1A 2UZXA 5DZPA 2WLZA 1CTMA 4N0CC 2GJJA 5F9WC 4Z0XA 3LV3A 4HIHA 2GYSA 1BOGB 5HI4C 4MBRA 1T2QL 2QELA 3U2SA 5DA4A 1U8JA 1LDPH 3FXIC 3K2UH 1G94A 4R97C 4AQ1B 2HWZH 4AZ8A 4BZ2L 4M02A 5E24E 4K7PX 1K72A 1HZLA 4N85A 2DQJH 4WUUA 4ELMF 3OSVA 3RWHA 5F0MB 4M6NH 2X9YA 3P77A 4F9PC 1AO7E 1MVUB 4GQZA 4G59C 4QRPE 3BQUA 1AS7A 2F1AA 4BEIA 5D1XE 1A3LL 1R24B 4FYQA 2NRDA 4NQVA 4APXA 4DNLA 3Q8EA 1NPUA 1QASA 4HLJA 4OV5A 1I9IH 4WWPA 4Y4HD 2CR3A 4F3FB 1OXYA 2YPLA 5DZVA 4DP9X 1LNUB 3BH4A 3VXUD 1NOLA 2AQ1A 2BC4B 4X0KB 5GZOC 2XVBA 1AS8A 2DI8A 1R3HB 1ZK9A 2KMWA 4Y88A 5I82A 3WS3A 2PYED 1FN4A 5HDOA 1RVFL 1JXJA 3G6DL 3MLPA 1VAHA 1GSMA 2A9MH 5J56B 5A1AA 3F62A 1ACCA 1WWAX 4KX9A 1RSYA 5CAYB 5H4ZA 1ZMYA 4QY8B 1VZHA 3I9AA 3N1PC 4P2RA 1HEJC 2ESVD 3GF8A 2OXHA 1SNRA 3ARGD 1EIBA 3JTTA 3HKFA 1FJ1B 2WOYA 4PG2A 3MRIA 3ARBC 5KVFE 2V9RA 1BVKB 2X10A 3DTDA 4WI8A 5HHMB 3EFDL 3ABMB 1NBQA 1RUQH 1IILE 2YAOA 4OD3H 4K2UH 5KBNC 1I3VA 5AVSB 2YPVH 1V7NH 2WIIA 4IBQA 3UZEC 3ULVL 2RQEA 5IMMB 2ZUQC 4ZMXA 3GMNB 5KS9A 2GJRA 3CXHJ 1N59A 5HYJB 4XVUC 3AS0A 4RAUA 3X1EA 1S3KL 2XVGA 4IMLA 4JDZA 1FNSH 1K3ZA 2W95A 1PFOA 2WVTA 3LN4B 1TTUA 2F8IA 1UB5A 4JPKH 4MWFA 4ZTPL 3GZPA 2VLJB 3UPRA 1KB3A 1VHPA 5D7IB 1MJUL 4YHOH 3R19A 1BJMA 1CFSB 1VJSA 1A6WH 5GGSB 5C6PB 4JQVC 1WE5A 3VFUB 2N01B 5EO9B 3D33A 3C6LD 3U0PB 3D8MA 3U9PL 2FX7L 1FV1B 1KCLA 1T6BX 4L4VD 3F3HA 5E00B 2BSDA 4PJFA 2W8CA 3KLLA 5KZCD 2H6UA 2ARJA 4NENB 2CDFB 4BYHA 5D93B 1N18A 1Q38A 4GUOA 1JFQL 3P9MB 2EVIA 1I7TB 4EVNA 4AV4A 2FIRT 1JV2A 1OT4A 2A73B 3SY6A 3T0DA 1NGXB 2F53A 4XVOA 4NNXB 5HGHA 3MLWH 2AXGA 43C9A 4ZMZA 5IB3B 4J3BA 4TM9A 3ZDYB 3DWTA 3SGDI 2Y0SA 4ZPTA 2JCCA 1MEXL 3O6LH 1T1YB 2F9BT 1SEQL 3BPCA 1A9BA 5I1HH 4R5XA 3O2DA 2ITEA 2WKOA 3NVQA 1L0XA 1BQ5A 1NEZG 4G43B 4XHJC 3ZLQC 1XR9B 3ZRSA 2GEEA 2JE8A 4YHKH 4B60A 3NDZE 1G43A 4Z7WA 4MGXA 4OCMC 2QVMA 5CZKA 4BA0A 5CLTA 4RIRA 3DDGA 2X70A 1NC4D 4ODXA 2PTUA 4BK5A 3QORD 2P5WA 3MZGB 1ZK5A 1MI5D 3CXHK 3II2A 1HHIA 3T4YA 4G6AD 1MQKH 5E8NB 4JO1L 4RGOH 5SWZD 4MB5A 4AEIL 2JB6A 2DLEA 5FB8A 3DRTA 1IGCH 3NMEA 3PU7A 5F7DA 1C08B 3MV9D 4GFXA 4EZMA 1AO7B 4G8IA 2X41A 1KCVL 2ZWNA 2A9NH 4QRPB 4RRPM 4WI9A 4RMSA 4TNFA 1U91B 4RDQG 4UYPA 5D1XB 1PG7X 2PWDA 1A6UL 1NUDA 1FL3B 1FAIL 4JDTL 2Y7MA 3SD2A 3B9KA 5D70L 1GY2A 3NK3A 1HILA 3V0GA 1XH3B 4TPRL 4XX1E 1BD2E 4N8VA 5I8OL 4RA3A 3D30A 3CGTA 3KYAA 4WV1B 1KN2H 4PCKA 3ULVD 2Q3ZA 5FXCH 3WXWH 5BZWA 1Q9LB 2ZWYA 4KDWA 2EDFA 4OJYA 4POZC 4M9PA 1I1YA 2ZF8A 4G3YL 3QUXB 4OU3A 4MTMA 5EA0L 1SJEB 5EB9A 2R27A 3PP3K 4XPAH 3ZL1A 3BO8A 3BHBB 2FCBA 2HFFA 2DJSA 4FCAA 1TO4A 1ZDSA 2H5UA 2PMZA 3JVGC 4ZT1A 4CILA 1OOWA 3D4YA 5SWQB 1UTDA 5JQHC 1NFDE 5DJ2B 3WSQL 1YN7A 3CJJA 5HD8C 3NZHH 1FLRL 2IMMA 3O2VL 1Z3RA 2CU9A 4K3DL 5C2UB 2QV2A 1NANH 5HHVH 1TKWA 4X6BB 5KOMC 4LLVB 1AG6A 5E9NA 3ZMRA 4A55A 3CD4A 3MODL 5HHXH 4E0RB 3W11D 1HDMB 4UT6H 2QZ5A 4LSQH 4J4PC 3JUZA 1XX9C 1LE5B 3VD5A 3V4UH 4NO0D 2YZ8A 3HC4H 3MRKA 2UY6B 3WTVA 1H6UA 3CHPA 4QTHB 3CFCH 1MIEH 4YEFA 1KB9K 2WZ0A 1SY6A 5K9QG 1NDMB 3X11A 2ALWA 1RU9H 1PJWA 2X4RA 5JOEA 1FA4A 2Y7QA 4BHUI 1J05A 4NKMB 2ZXWB 4F8NA 1IQDA 3CFJA 4I2XE 1KIRB 3IDJA 3AC0A 3UO8B 1CLVA 3MRDB 4MJJA 3MTXA 5BZDA 4B3VA 3T65A 4JJHA 5DD5H 3VFMA 4V1DD 2YLHA 2AKRB 2JFCA 1R47A 4J3UA 2XBDA 4UAOB 3ZT7A 3CZFB 2W07B 1YSOA 2XWBB 1A2YB 3S2AA 1A4BA 3IF1A 5HY9B 1TXKA 3P0VH 4M7KH 5B3JE 5FYKE 7CGTA 1ESOA 4EIBA 2W65B 3OKKA 1Z0NA 4AMKH 3O6ML 1O7SA 2IC2A 4QGYA 4R7DA 5F7HA 1CR9H 4PHZA 5IJDC 5T5NG 2CIIB 4X5PA 1TJHL 2F6AA 3KR3L 3I75B 3FTSA 5D6CA 4ZAKD 5D1ZC 3BP6B 3PWLA 2CGZA 3P11H 3B2DC 2ZX8A 1CURA 3S3CB 3F7QA 5DK2B 1U41A 1GMEA 2FT7A 5BOJA 4X8XA 1PAZA 5J13B 4QTIH 2WCSA 4ENED 3TO4C 1IT9H 1R34A 4XPGL 2FX8H 3ZZQA 1ZHLB 1UZ8A 2GT9A 3CZSA 3QNYA 5D8JL 3NIFB 3BUDA 4YX2H 3ZHFA 2YRZA 2FQDA 2SODB 2QVTA 5CKGA 1FVDB 4JPSA 1E6OL 5F7LB 3V52H 1CGSL 4AQ8A 1JVOA 3IJYA 2NR6C 3BIKB 3EAKA 2XWRA 3UGEA 3TA3D 4XMTA 2A6DA 2YRPA 1FH2A 2Q1EA 4LOEA 4MNQD 3VI4F 2NTSP 1HINH 3OGOE 3UG5A 3D50A 4LHUD 4NNPH 4JPQA 1HSBB 2PPDA 3VWJA 5BJTA 2Q8BL 1ZA6A 2JJSA 3ZO0A 5FUCC 5E9DA 1BD2B 2HKFH 4HF5L 3PGDB 4NFDA 4LEOA 1L6PA 3N0AA 4HIXH 2Z3FA 4MD0B 1MCIA 4X7SH 5H37G 3PDOA 1GPOH 1UATA 2YA0A 3QBTB 2PW1A 3FQUA 1KZQA 3U0WH 5BRPA 2NUPB 3VG0H 1N8ZB 1WZKA 1VGKB 2LLNA 3CU1A 3LIZL 2Q8AH 2JLPA 4JHWL 1P4LB 4UDUB 2E8YA 3FB8A 2NXZD 2Q2EB 4RFOH 3GBLA 5LAPA 1MHHA 4XHQA 3KPRD 4XCCL 3FYIB 4YXLL 4YK4C 4NQDE 3P2BA 1JHLL 1NFDB 1FL6B 2QHLA 1FH5H 2O5XL 1EEYB 3CLFL 1QNZL 1BF2A 1P7KB 1R1CA 3C2AL 1IJ9A 1WT5A 1IBGH 3BP4B 1F3RB 4TUKL 4HEMA 1S7TB 4QHLB 3L3KB 1WH0A 3RWEA 2NNAB 2MOVA 2LGNA 4J6RH 3GYRA 1X7TA 3PDGA 3RL1B 4LCUB 3VTTA 4D0CA 4ZFZA 4PGCA 5DC0A 5BZXA 5DSCB 1AD9B 3WDIA 6FABH 1XF3A 1HTYA 1MAKA 5IY5B 1JGUH 1AHMA 4ZSOA 1H6TA 1XGUA 3CDGA 3VJ6B 1JJUA 3U1PA 1M7XA 2XTLA 1BAFL 3F7LA 5KTEH 1RZGA 4FHKA 2B1AH 2VXQH 1YA5A 3B7UX 2M2DA 4B9FA 4YSCA 3S8GB 4KC3B 3VFSA 3P0YL 4I2XB 4JO4L 5FYJU 5C7XH 4PJ5D 1U58B 2N4IA 3IJ9A 1L0PA 2ADIA 2NZ9C 3HZKB 3NCJH 3AT0A 4OLYL 4ZUVA 4YGVB 1B4JL 4X5RA 1HHKA 1OGAE 4Z9KB 5L8LB 1NFKA 5TGBB 3AREC 4QXGL 3WUWG 2UY7B 1IAII 4NPJA 4WJ5B 2QBWA 2OYPA 3MCLL 1SHXA 4IJ3B 3L5WA 3TCXA 3TNNB 5JPNB 4KQ3H 3ULUC 5EOCJ 1SJHA 2VKWA 5CJ8A 5DYOB 3A4DA 1S9WA 1T2XA 4GG8B 4C4KO 4D9QD 3VSTA 3VSUA 4JFOA 1Z32X 4U33A 5JIQA 1R3LB 1O7DE 3U9WA 5IB2B 4Y4HB 1G6RB 1VIWA 3BZ4B 1D7BA 1W72H 5D7SL 3QDGA 1IGFL 4K7PL 4GW4A 1FC2D 2X9ZA 3AG2B 3SCMC 3K5SA 3H3BC 3ZDXE 2H4EA 4HK3J 4HU2A 4MJIE 4H8WH 4OTXH 4HS3A 5IJVB 1IL1B 5E2WH 2PYEB 3R7RA 2X2IA 4OJFH 5AVWB 5JHBA 5KOVC 4F7CB 5CLYA 3ECVA 1UADC 2E7DA 1F11B 4NS0A 3QXTA 4JCWA 4F58H 5C0FA 2AEPL 4L0ZA 2CCLA 1GAFL 3RB5A 2OTUB 1AXIB 2W0LA 4QOKA 3GJEA 4AYFB 1G7JB 1YECL 2BRQA 1U3HB 1HCYA 3M1CA 5CLWA 1ZHBB 2RAMA 2NW2B 4IRSC 1F56A 1D5RA 1N64L 1PEZA 2X53A 3PWVB 4JMNA 2PR4H 4K9EL 3OB8A 3MV7D 5TE4L 2ZNWA 1KGCD 2CO7A 3W5NA 2FEEI 3PHQA 5E99L 3ESNA 4NBYB 3UAAA 1TQBC 3QIUC 5FLUA 3CCHA 4OT1L 5E1QA 3NSJA 4W9JC 1AGBA 2L3BA 4JDVB 1JPTL 1GGBL 1LE9A 2DM2A 4XCEB 3BGMB 1F4AA 4MA7H 2NT1A 3GEWB 4ONFL 3W0WE 5IW6B 2GI7A 4CADA 2VR3A 4WEMB 1I8AA 4HKXA 3OGCB 4NQDB 1FDLL 1MWAL 1IX2A 1LO0L 5JR1L 2EO1A 3NSFA 5GRYA 3W37A 2XKNA 3DLQR 5FFOA 1E3XA 3BXNB 3VE0A 2EDNA 5IROD 2WMPB 5B39B 2Q10A 4X2UA 4XMPL 2WLHA 2YGVA 3CHXA 4JN2A 3KXFA 4AL8H 4NC1C 5JUEH 1IBBA 2NPLX 1QFWI 4MCMA 5A2BA 2Y2TA 5AZEL 1I53A 4QO1A 3CIQA 1JFHA 2BSBA 4WWOA 1FIGL 2LABA 2Y1ZA 3GJFK 5DRWA 1UXLA 2CIKA 2MSPA 4UCFA 5DDHB 1WA0X 4KV5E 5IQMA 3RB7A 5I15L 1TQCC 3ZHNA 4JFXB 1ZANH 4JHUA 2XNAA 4OB5H 4J28A 5AYUH 3WG7B 4YPGB 2DQDH 2Q76B 1ET5A 2AXHA 3U6RA 4PLNC 2FJFB 2VSCA 5DMYA 2P43B 4P2AA 1KBKA 1MCEA 3BVTA 1X6NA 2X6UA 2OR8A 1LLAA 4YHNB 1YNKH 2ZUWA 3SKMB 3L4UA 1PYWB 5LGJA 2Z34A 1ML0A 2ICCA 3VXOB 2WZPD 5KSAC 1J48A 1OGAB 3F7VB 4WW2F 4AWJC 1BQHB 4RSYA 5ECGA 2VC2L 1Z3GL 4XN8A 3UBXB 1H8LA 5IHHA 1EGJA 3TYFA 5KVEE 2VERA 3L48A 5IIEB 4PV8A 1VGEL 1MWOA 4EZKA 3AGVA 3VH8G 4ZFOL 2LOEA 3IPFA 1OE3A 2PYFB 4Q6YA 5AW6B 1KTKE 4BRJA 1KIQA 3PUCA 4QJ4B 4P5TD 2WLNA 3DECA 4U1MA 4G1EB 2Y5EA 1QWNA 2VITB 3ARQA 4N90E 4EDWH 1KLUB 3O8XA 3ZDXB 3MBED 4HC1H 4KHTL 4GBXD 3BUIA 4PS4L 4N20A 4MJIB 5AB2A 4DGVL 4KX8A 4FA6A 2C3XA 1PVHA 4JO2H 5JW5B 5C0CD 3BJLA 3SJVE 4FQXD 4OZHF 1MCPL 4UV7H 1BYNA 2J6EH 2JKNA 4HEPA 4FQJL 5GS3A 4PJXE 1M1SA 4PY8J 1E9QB 3NA9H 4I85A 3CZEA 1Q9WA 1R24A 5C0AA 5DCCA 4Y4FD 5F72S 1WITA 4JM2A 4WHYG 3UIYA 1LDPL 3K2UL 3DVNB 2HWZL 2O61B 1PL3A 2K3TA 4F3FA 3U30C 1OCRB 4PHXA 1TJIL 4OZGE 1BEYL 4WHCA 4CC4A 4X0KA 2YD6A 4NQSA 3S5YA 2MTPA 3EYFB 4P5KA 1R3HA 5AOMA 1CLYH 1F1AA 2GK2A 1OT1A 3GHBH 2ATKB 4TSAH 2MPAH 2OSXA 2AV1A 1RIVL 1WK0A 2V5SA 1RUKH 4LHJB 5EOCH 2C9PA 1WZ1L 1AY1L 1V8HA 4NO0B 4QY8A 2XVKA 1ILSA 4MAUL 3W0WB 2F68X 2V9TA 3ALWA 1PX3A 5CR1A 1ULVA 1FJ1A 4TV3A 3K8KA 1N19A 1N6UA 4LLAA 4O2FB 5TPWL 3Q8CA 2AJXH 2X4OA 2WWMD 5I6LA 1OCZB 1ET7A 3BUQA 5HYEA 2E59A 1G9HA 1IGIL 4QRRD 4EI5D 5E2TL 4GAGH 3CXFA 5IMMA 3DX8A 3GMNA 2PNDA 3RVWD 5HYJA 1UFUA 5EU5B 4BHUA 1RZ8B 4V1DB 1Z5LA 1FSKB 3TP4A 3GJFH 1UCBL 1MVYA 4N6RB 1OQOA 2E4TA 1TUPA 3LN4A 4RGMC 3RTQB 3TJHD 1OAUL 2C3GA 4M8RA 1JZFA 4ZS7H 1HEZA 4X9BA 1TFHA 4F7EA 4LLMA 1HXYA 3TPUB 2LT9A 4K2UL 2VLJA 2LR4A 4X6EA 3BPOB 1NC2A 1V7NL 1UASA 1YUKB 1DQLH 2X7LA 3EDFA 4B9IA 4D9LH 4NUPA 5EU3A 4JO3H 2BXZA 3VQLA 5T3XE 1OT2A 3VFUA 5E6IC 5DD6A 5DEGB 4FZ8H 1JZ4A 4FG6D 5LHDA 1FNSL 1S78C 1L9SA 1ZEAL 2ZWSA 2QSCL 1A1NA 4HSQA 4JM4L 2VL5B 1HESA 4LKCA 4KJQC 4CU7A 4NENA 2XJKA 2CDFA 1Y7VA 2GSMB 4JPKL 4I18C 4LPWA 2ZKXA 4N5ED 1TMQA 5H8DA 4IU2B 1I7TA 3N0PB 2A73A 4LLWA 4N2KA 4PJ8D 3WO4C 1NGXA 4YHOL 4NNXA 5DYFA 4L1HA 4JVWA 2QTEA 2AJSH 2FZ3B 3HUJE 4L3EA 1PZ3A 1T21A 2OCFD 3GGWB 2WK2A 3VW3H 1DL7L 1U2CA 3JV5A 1ODUA 2WINB 2G9HA 2NY6B 3BWAB 4MCYB 2YSSA 5I8KL 4AMXA 1SHSA 1JTOA 1K5WA 2NZIA 4QWWD 2OYLA 3ZE0F 4DSYA 4FABH 2FLBT 1A4CA 1GC1H 3IGUA 2XV0A 3X1BA 3T08A 3MLWL 5BO1H 2R56H 3N9GH 1E7UA 1MCNA 3FTYA 3PP4H 2PXYD 2FTAA 4ZUSB 3UBXI 4PP1C 2JKSA 5I1HL 3NGBC 3PHOA 2OS7A 2EIKB 5GIRA 4EIUA 4ODHH 4GP5B 1UD5A 1CTNA 3SJVB 2CDEB 5JDJA 1PSKL 4DP2X 1XTLA 4UQ3B 4F2ME 1AG0A 1QSFA 3NJJA 1CDCA 4PJXB 2KZKA 2NXZB 4JBSA 3C12A 4EN3D 3C09B 1IM3A 1MQKL 1Z7JA 2X2HA 4RGOL 2VO5A 3C8KB 2YUWA 2P3YA 4IEFA 3OJDB 4YAQA 1XH3A 5KANG 4FFWC 5C97A 1IGCL 2APTA 2H0EA 4OZGB 4EAEA 3MXVL 4DCQA 3P4OB 3V79C 1MF2H 1H5BC 3FOLB 3ISRA 2B9BA 4G2AA 1EBAA 4H4NA 3QWQB 3SE8H 2XXGA 1SJEA 4DEUA 5FGBA 3BHBA 4HSAC 2AXJA 4P06A 2ARJQ 3QCVL 5FOBA 2QPSA 4GKSA 5I1AB 3GM0A 5J6SA 1BQUA 4XBEL 2Z92B 3D2UD 3UDWA 3IAPA 2FX9H 3E6HA 4Z7AA 4G6KH 5DJ2A 1OLZA 2KHAA 3HS0A 1D6VH 3LNFA 4KOCA 4KXDA 3SGKA 3WXWL 3ZE2F 1IGMH 3MBWB 5C1MB 3ULUF 1QI5A 4B9PA 1EO7A 4XPAL 4B5EA 4L5FH 4N2DA 3WXVL 2AANA 4LAJH 3G6JF 1S9YB 3AS2A 4PGDB 1B4RA 4HHGA 2B4CL 1HDMA 1SXNA 4LLYA 4BFBD 4JRXD 5D7JC 4ICXA 3QZPA 3V9CA 3VXTA 3WNOA 1LE5A 1YUHB 1E27B 1I8IB 5D5MF 2A5UA 1LEGB 3US9A 4J3OH 4QTHA 1NCTA 2CO6B 4MMYB 5LBVA 1NDMA 5GXBB 3KW8A 1KDJA 2XXCB 2LE9A 2E75C 3GMLA 3TVMC 4I5BB 2XT1B 3HZYA 2JK5A 4UT6L 4JG0H 5GZND 2CJTA 1SF5A 3V4UL 2YAMA 3P69A 3HC4L 5DJYB 2IBBA 3D0AA 1TO5A 2FD6H 3O4LE 3QT2A 4CVXA 4BV1A 2AKRA 1ND0B 4YXHH 1M7IB 2MQ0A 3FB6B 2W07A 3D0VA 4XGZB 2XWBA 2ZXEB 1MHPH 1RU9L 1IV8A 3BAKA 2R69A 4HUXA 5HY9A 4HJUA 4M7LT 1YLBB 3H9YA 3HUJB 1JGEA 3W39B 3VX1A 2F8XC 1BXAA 3ZN6A 2W65A 1EA9C 4GQPH 4QGTA 1I1AC 4KRPB 3HCVB 4RWHA 2CIIA 5AD0B 3LZPA 3OZKA 1G0XA 1PZ2A 5AKRA 4JGNA 1XAKA 5CLXA 4XO5A 5DO2D 2ITDB 4AT6A 4NRXA 3BP6A 1LMIA 1IQWL 3FU8A 3MUJA 4Y16C 3P0VL 4LSUL 4M7KL 1U4FA 4KPHH 5DFAA 4AVHA 4AMWA 3FAWA 1TU2A 3DETD 3SGJC 3IMSA 4NYLB 4P99A 5F9OH 5GZOD 1K4DB 1THCA 2V5MA 3QO0B 4N1EA 1WBYB 3IS0X 3F7RA 1FYTD 2FEJA 2PCPB 3POHA 4TSCL 4AMKL 4ELMB 5AUMB 1NAMH 1ZHLA 5BRZD 4ELKA 1CR9L 2J8UE 2BIIA 5DWUH 1N6VA 3JQOB 1GJUA 1U8QA 1U0QA 1QNIA 4PJIE 1FVDA 5CJBA 2BVEA 4M7ZC 3VGBA 3QAZB 4JFED 1HYSD 2CGYA 4Q9RH 2VZ1A 1VCAA 1CXFA 4QTIL 3KBPA 2XPYA 4DKTA 2A77H 4ZOBA 1GHFL 5E8EB 1YAIA 1SN0A 4KVNH 3VA2C 3JSSA 4GRWB 2VDQL 5JIIA 1HSBA 1K8DA 2BOLA 3WJJA 2GSGA 2BIOA 3QXVA 4W81A 4YX2L 3B2MA 1HQRB 2EXWD 2X3CA 1SVBA 1QFOA 3PGDA 2BS8A 4JHVA 1MNUH 4R3SA 1K2DB 2K78A 4Y5XA 1PD0A 2B77A 2XQYK 2Y1YA 3FT4A 3SE6A 1PZ5B 1TVDA 2FHCA 2HJLA 2JKXA 4EOWH 4F57H 5FECB 5J11B 4Z6AT 1N8ZA 3LKSB 1VGKA 4NNPL 3WKYA 3EH5B 1F4YL 5TD4A 4UDUA 4C54A 5E7BA 5K9OA 2EDYA 2ZUXA 4JFUA 1VB9A 5BXFB 3VO0A 1UXSB 2VDPB 3LSOB 2WO3B 4Q2ZA 3EGXB 1WAEA 1FL6A 2PWEA 3G5VA 2B20A 4Z3EA 1GPOL 1EEYA 1QA9B 5A16A 2W94A 5AOIA 3O6FC 3U0WL 4LVOC 4E9TA 1P7KA 4U6TA 3VG0L 5ITFA 3BP4A 4I0PD 4QHMB 1KOAA 3QIWC 2ZIDA 4GT0A 4QHLA 4FOMA 4MA3A 1PD1A 3T6ZA 1DANT 4RFOL 1H3UA 4LSSL 2BWDA 1J1OL 2W9EL 1H9VA 3ZE1F 3QUMA 5GGSY 4LCUA 1GZPB 1FH5L 3BUYA 3JTBA 4OGYH 5DSCA 2FSEB 4ZFQA 1OTTC 5F6HI 3ENEA 4UTAH 4Y2OB 3VJ6A 1T2JA 1IBGL 2D3JA 2JKLA 3CZNA 3GXMA 5HHQA 3STBA 4PJHB 3DUSA 3ARDC 4BSVA 3Q0HA 4TVPE 3IGFA 1GW0A 3IN0A 4UU9B 3WTSA 4OQ1A 4J6RL 3Q6GL 4JS7A 4HX1B 3RNQB 3MX0B 3O3DA 2D7QA 3OF6A 2YMOA 1WRFA 3REVB 4HKZB 4P5TB 3HZKA 3O4LB 4PJBE 1JGUL 2DH3A 4ODWA 4M7LH 4NAMA 4PH8A 3MBEB 1Q90A 4GBXB 4ATTA 3ELQA 2A6JB 4F1ZA 1AJ7H 1T5WB 3NAAL 3KCWA 2OR9H 4JRWA 4FF9A 2UY7A 1INEL 3NESA 4C4BA 2JH2A 2WLJA 5C7XL 5ADOL 3UZQA 1XIWC 4X8GA 5KYYB 3BYTA 3CX2A 3A0OA 5DYOA 2EKSB 3KPSE 4BKLB 3FQRB 3ARSA 5C0IB 1URIA 1KLGA 4FKHA 2EDMA 4Y4FB 2XG5A 4W6YB 1NGYB 5IB2A 3H42H 4Y4HA 4F7PB 1IGYB 1J1PL 4ZMQA 3JWOC 2NNRA 3GHEH 1MWAB 1ZDQA 2A4ZA 4XMVA 3KWWB 2WUCH 4PGBA 4XO4A 5AVZB 1IUZA 1RUMH 4WEEA 2Z93B 1R5WB 2JSFA 4KQ3L 4ZFFB 5IJVA 3QQ4B 4RMWA 2PYEA 5E2UL 3VXMD 2DQIH 1DBAH 2DLTA 2R0KH 3O0LA 4F7CA 2LFGA 1B6DA 2AJYH 1BZQK 3H6AA 4GAYA 3V4PH 4PJIB 1F11A 3CDYA 1BVLA 1R6VA 2E9JA 3GMQB 1EZLA 4ODUB 5C0BD 1NBCA 1W72L 3HC3H 1OIOA 2HVKB 3KYOB 5DEJA 3ZO9A 3GK8L 1I1RA 4O2CA 3CE1A 3VG9C 1ADQH 2YD5A 3JYBA 4BQBA 2TAAA 2OTUA 4OZFG 4WFEE 3DJZA 4AZUA 4AYFA 3F64A 2EZ0C 4GAAA 5EUOE 4IRZA 5FEBA 1U3HA 2HX9A 3BUPA 4H8WL 4OTXL 4A63A 4BDVB 4Q6IA 4FHBD 4HMDA 3IDYB 3FOMA 2NW2A 3TBCA 4X4MA 3IS1X 1Y0LB 4EI5B 3D9AH 4UNIA 4I9XA 1HIML 2CKBL 2VDOH 3Q9PA 4U31A 4XBPA 4PRIE 5I0WA 1MAJA 4QHNB 4WK0B 4ABWA 1YMME 1JWUB 3KPQB 2DY2A 1EAOA 4EI6B 4JDVA 1J0JA 4LHQB 1PAMA 4MA8H 1R4XA 2WVUA 1TYEB 3G5YA 5CGYC 4Y19B 2J72A 2PR4L 3EBAA 4OM0H 2AXWA 3OGCA 4OCYH 3DO3A 4UOW0 1CG9B 2WLMA 4V11A 5CBAB 3NK4A 1YYML 1A65A 1DJIA 4JKNA 4L4VA 1CICD 1WHPA 3T3PF 5J7CC 5B39A 3GINA 3QSKB 2WNWA 2OMTA 5F0JB 3BRGC 1GIGH 1T6WA 2Z35A 1A64A 3VXNA 3KZ8A 4LLDB 2XZQH 3FMGH 4AEHL 1FFPA 3D09A 3QDJB 3MGAA 1D9KC 2OMWB 1OTSD 3BRFA 4X6CF 2QPDB 4BZ2A 3WY1A 2Q2LA 3G9AB 3RDTB 2E6QA 1UJTA 3WO3B 2H3KA 2WXIA 1MLBA 3GC3A 3HHSB 1BQKA 4YFDB 2ZOKB 3BN9D 4L3AA 4PUBL 3HAEA 5GGRB 5I1LB 5JUEL 2P48B 3LVTA 1J8SA 5HHOB 2UXGA 1KEGL 2XSKA 2IDSA 3ZKMC 4I77H 2DPKA 3B7YA 3TO4D 2PXYB 5E1AB 3BEVA 2EIBA 3QORA 4PJBB 1MI5A 1PYWA 2ODIA 2J5LC 3C5SB 3MMEA 2ZX7A 3P73A 5CEZH 3IKCA 5IVXF 4RFNB 5SWZA 3W1ZA 1MNNA 3GRWH 1ZANL 1RK0A 2CLRB 1KXVA 1WWCA 4OB5L 5LXGH 1PY9A 4G6FD 1JNHB 4GKOA 4G1MB 5KJRL 3UBXA 4P3DA 1H0DB 1R75A 4XCYA 3VRIA 4JPWH 3RX8A 5CP3A 4KNSA 5D1QE 3HG3A 1BWWA 2YIHA 1KIPB 5DMJB 3KPSB 3BYYA 2NY0B 4F8QA 2PYFA 3K4ZA 5L4MA 2G3ZA 3T4AC 3BDYH 3I3BA 2P24A 3ARPA 5L8JB 2DLIA 4W1TA 1AIFB 1KYUA 5AOZA 4BJLA 3LH2L 3BLBA 1A8ZA 2GJZB 4EUPA 1FHNA 1XAUA 1AE6H 1C16B 3SKOB 3OLDA 5EV7A 3OKEA 4U3SB 5IHLB 4FXKC 3HPLB 2Z9TA 1G87A 1GYCA 3WNJA 3AADB 4Q97A 5LQBH 4QRFA 5MENE 2FGWH 2X87A 2IH3B 4EDWL 3D2UB 2OJZH 2H6OA 3MCYA 3HA0A 5EUOB 1YYCA 2EEAA 2YXWA 2VN4A 5T1JA 1QLEB 2O61A 3IKKA 5FYJE 1DDHA 1SM3H 4JO2L 2DQCL 2GBTA 2W9DL 4OLXL 1UA6H 1OW0C 4LPCA 2CO4A 2OMXB 5GRUH 2I85A 3MOBL 3W9DB 4UV7L 1UH2A 2G5UA 2ROYA 4FDWA 4OW6A 3PE9A 3EYFA 1KFAH 5IESH 2YPKB 3NA9L 4PRIB 2VT0A 1TJGL 1YMMB 4BKSC 2D8KA 4IW4C 4XNUH 4NO0A 4LBEA 1FFNA 5EDSA 5IR1A 4HS8L 4FNSA 5EEZA 5BV7C 5FK9B 3S36H 3SDAB 1LEIA 2OM5A 4MQXC 1J0YA 1CLYL 3PFQA 4TSAL 2DIJA 2MPAL 4Z95H 1B2YA 1EV2E 1RUKL 4XVTL 5EOCL 3K8MA 2YD0A 5HHNB 1BQHG 2EILB 4XVJH 1UURA 5C3TA 1N3NB 5I0VA 3IU3A 5DQDH 4E9VA 4V1DA 2KPWA 1C5BH 3AB0B 3MR9A 5EORL 3CFDA 5B1JC 3VNYA 4M5ZH 1QLFB 1NKGA 2WB1A 4X4XB 5JORB 4A67A 2AEQH 2X3AA 3O0RH 1EX0A 1P4BH 1J8HE 3U46B 4DKDC 1NLDH 2GK0B 3T8MA 5JZ7D 4BRVA 1EJOH 1S7QA 4S1SH 4N5UA 1RJYA 2V9UA 3RX5A 5BPPA 3D05A 5GSRB 2H2PD 1P1ZB 4FXTA 4ZAKA 2GKIA 4DHLA 4ZS7L 4PS7A 2V37A 3GBEA 1KBBA 2R4SL 5T33L 3PWUB 3REWB 3GXDA 1AQ8A 1DQLL 5AVTB 4D9LL 4P9ML 4H8HA 3I6GB 5L6YL 4LCIL 3T0EE 2DMGA 2DQGH 5EO0B 5KJ7E 3GGWA 3C9NA 2OMZA 4LOVA 5ANME 1U33A 1KLFA 4CN6A 3DO7B 2HRHA 4DKEH 4MCYA 1QACA 3U1SL 5D1QB 3TA3A 3L4TA 4XO3A 3QEQE 4FMVA 2DI7A 4S1QL 2FGZA 3DI3B 1RI8A 4X5WB 4MNQA 1ZVHA 5E5LA 2AQPA 4P5SA 3O6KL 2IAMC 5JYLA 4LHUA 5EUKA 1NFAA 1QG3A 2Y7SA 2AJSL 5AB1A 4HK0A 3VW3L 5ALCH 4YSEA 4KJWD 3EKCA 3V0JA 3IFLH 4XXDB 3UERA 3NN8B 5H94A 2IBGA 1MCQA 3CBKB 3E38A 3PABA 4BFIB 3OMAB 1E42A 5SWSD 4NRYA 4FABL 2Q9OA 4UOW1 1GC1L 2DQTH 2Y22A 2QGCA 4WWKD 5BO1L 3N40F 1T0MB 3ARZA 3K80A 1F5WA 3LKRB 4UQ3A 3ORJA 2Y2WA 3PP4L 3S4SG 5F9JA 2FAUA 5MENB 1T6VN 1VFBB 5ADPH 2YJQA 4L4TD 1CDJA 2WP3T 3KPRA 2K9UA 3P1VA 3WNKA 2V2TB 3WFBL 3JZYA 2I9LB 1UKSA 5F9AC 2HB0A 3K6NA 2AHIA 3UG3A 3QVAA 4PRPD 3GSUB 4OZGA 3KBEA 1P84J 4OKVA 4AUJA 3L3IA 5KBPA 4PYHA 1FL5A 3OWEA 1I4FA 3ZDZE 3GI9H 5HVHC 1EAPB 3WFCL 3IEAA 3FT3A 5KUMA 3TN0B 2OX5A 1S8DB 1YEDB 4YPJA 3V2AR 2QSVA 3CSTA 9PCYA 2PLTA 2VSMB 1KCUH 2EICA 1HE7A 2Z92A 5BUGA 1JK8B 4YDIL 3QUZB 1AZBA 2JIXD 2K9FB 4CVWA 2F1EA 4HJIA 2MTAA 4ZOCA 1MFMA 4H0LC 2X38A 3A4FA 4J3SA 1MF2L 1NOFA 1FNAA 4PJ7E 2XN2A 2VW7A 2AI0H 2OCJA 3ML8A 5ICUA 3FO1B 4ZQTA 4XNXH 4ADGA 4PJ5A 4OI7A 3LPOA 5GHWH 2R4RH 4PG2C 4K9JA 1S9YA 3AFLA 4JKPH 3TT3L 2FX9L 1FNHA 1P5UB 3E2HC 2D0FA 2IBZX 2DQUL 4NO5B 1YUHA 1I8IA 4ACPA 5I8EB 1IGML 1LEGA 3C60B 5ENWA 4ANWA 4ES8A 2CO6A 4MMYA 4X80L 4R4ND 4GG6F 2BNUB 1AGDB 3IMRA 2VR9A 4TNWF 1MAML 3WUZA 4ZW3A 3U7WH 2J3SA 1T1ZA 4UT9H 3O2WL 1JWMA 5KVDE 1V5JA 2EEDA 4I5BA 1KJ2H 3OKDB 2YFNA 2GVYA 4QXUH 4MNGE 4XRCB 1BZOA 3S5LG 5DJYA 4MD5B 1P84K 4UOJA 4Z78A 1RCYA 4MDIB 3B6SB 1ND0A 3OXSA 4NUGH 5EBLB 1JHKH 1VADA 3DJRA 2ATPA 3AS1A 3FF7A 3LN5B 2YEQA 4AYEC 2ISDA 2G3XA 4PJCA 3VXRD 4CC0A 4HWZA 3T0EB 4MA1B 3W39A 2E4FA 5C07D 2Q3XA 5DMGD 5E8PB 4BZYA 4JEGB 2ZG2A 3NPSC 4B5ZA 5AYTA 1UCTA 1SBSH 2XN9E 3G6AB 5ANMB 2WNXA 1LO2H 3HCVA 3LIZA 4JL2A 4E9RA 1JD7A 3HBZA 4JZOB 2IQAA 5DR5H 3VFGH 2FT6A 5AD0A 3SDDD 2AEWA 2EH7L 4YXHL 4GYBA 5EIIB 3KJ6H 1ETA1 2VJ8A 4JZJA 1MHPL 3PRZA 4PJDF 4CU6A 1IFGA 1SOQA 2XTJE 5FKAA 3GBNL 3NDYE 2FB4H 4P2QE 4XNMA 4F8PA 2CMRL 1D5BA 1WBYA 1ZT1B 3MV7A 4ELMA 2WTRB 4YN3A 5AUMA 1A3ZA 5FW8A 4O02H 1GOFA 2XACC 5I6OA 2XIDA 2NY2B 5I1CH 3IJEB 3LDBB 1E4XL 5I6MA 1OV8A 4UNTA 2IALA 4BK5C 3KEDA 4TRPL 2CBMA 3TOPA 2JKJA 2F8OA 4XC3H 3U0TB 5KVGH 1PIGA 4NC0B 4FJ6A 4KRMB 1A9EA 4J12A 1JK9A 3THMH 1KPRB 2HRLA 4OFVA 1LO3L 1CL7L 2OMUA 4FA8A 3BWUC 1JERA 5HJDA 5DWUL 5EU4B 4Z7IA 3FULA 3EOAA 1OL0A 4AI7A 2B9AA 1XB6A 1UWXK 2CUIA 1E5AA 5IROA 3ECWA 3FQ2A 3T1FA 2DN7A 3HE7B 1RJLA 1XHHA 1K2DA 5IB1A 2CLZA 4Q9RL 3B9KC 3ZDZB 1IBDA 5JIHA 1PZ5A 2A77L 5FECA 5GGQH 1CIUA 1F45A 4KH9A 3LKSA 3DXAE 1NANI 2B3RA 1HL4A 1R5IA 4IKLA 4OLZH 2ZD0A 1QFHA 4C58B 4Q9CA 5BXFA 4GP8B 3DV6B 1UXSA 3P4MB 2CRYA 5JDSA 4RAVA 3SBQA 5E6ID 1KEMH 3Q9QA 5JA8B 3RIFF 2NY5C 4PJ7B 4EOWL 3RWJA 4OBRA 4P4KB 3KGTA 5A3ID 2WQAA 1Q9KB 4QHMA 4U6YB 1XB3A 3UADA 3CHRA 4RX4D 1ZVNA 3CN3A 4IS6A 1J0ZA 2ED8A 4PJGF 2X4QA 5KSUA 1QSEE 3TJPA 4X7TB 4HUUB 1PMYA 2B7DT 2ICES 3IXAB 1EAJA 3MRNA 4R9HA 1GZPA 4XBGB 2WZPA 5DD0H 4M61B 2FSEA 3SYOA 1VEMA 1JMXA 4HAGA 1JPEA 1OLLA 1NMCB 4WI2A 3J27A 4Y2OA 2QGDA 1UJ3A 3CFMA 4P0DA 7PAZA 2QDWA 1G9NL 3KL0A 4PJHA 4NZUH 3DMMB 3EFOA 3B7TA 1W72B 1TTAA 3RVVD 1AQMA 1YQVH 4UU9A 2XRAH 3SYQA 4AIXA 6PAZA 2BX5A 1ORQB 2WYZA 4L9LB 5CKAA 1N6QL 1R17A 3P02A 2F61A 4OH2A 5F44A 4MSWB 3LPFA 3FUHA 1LWRA 2C3VB 4OGYL 4HKZA 4MNGB 4P5TA 4NHUB 3VAEA 2WSPA 4OF8A 1OF2A 5K9JH 4ANVA 2ZKHH 1ETZB 1MY5A 2PO6B 3T77B 3F12B 3MBEA 2R9HD 1YJDH 4GBXA 3PDDA 3EO0B 2ERJC 3P4NB 2FQGA 1JGLH 5C0CA 5I5RA 4B95C 1SOSA 4FQXA 2CA4A 4JQXA 2XN9B 4DZBB 2X6VA 3FRUA 3ZRFC 4HIEA 4RETB 4DUXA 3QEUB 1QO3A 2WY3B 4M7LL 5E4EC 1MCJA 5C0IA 1N5AB 1E9OB 4Y4FA 3QFDB 1UKTA 3HKZA 2NXYC 5EFIB 3QP3A 4YSDA 4F7PA 2OV0A 1AJ7L 1CGVA 2KH2B 1PZDA 4PJ9D 1MJ7L 1MWAA 1KXTB 4NBXB 4HIJB 4P2QB 3OG4B 5F7FA 3MUGA 4QRQB 3S5ZA 4FTVE 4YBHA 2DLGA 2Z93A 1R5WA 3B9EA 4ZFFA 5C7ZA 2EC9T 4M93C 2PCYA 1A5FH 4ZTOL 3CBJB 4GMSH 5JNYA 4U1IB 4HIIB 4G7SB 3UTOA 2WBJD 1S5HA 2R1WB 4OJAA 1UENA 3KYOA 2HVKA 3JXAA 1X5FA 1MCHA 4NJAH 5CP7B 1VACA 3FU3A 2WUCL 4FNQA 3Q13A 4LMQI 3MV11 3DBXB 2BP8B 1UWXH 3V4VH 4TOYH 1B0RA 3CSPA 4BDVA 3LJ3A 5IQNA 5BOZG 2DJUA 4AQ8C 1JS4A 2DQIL 1DBAL 2R0KL 4UT7L 2ZYRA 1E5CA 3L1EA 3QFJE 3F6LA 2FJGB 2NNCA 5CF3A 1Y0LA 3BVUA 4OCLC 3WL9A 4QRRA 5GS0H 4EI5A 2BZ7A 3C87A 1VZGA 1S7UA 1XV8A 3HC3L 3Q44A 5HGDB 3VWJC 3MLUH 3DO4A 3FB5A 4HJ0D 1A21A 1EHNA 2K1MA 3GBMH 4FS0A 4LP5A 2JJSC 5I73B 1A7QL 3KPQA 3PJSB 3M8OL 4M6OL 2YAPA 2W0PA 5E8DH 4EI6A 3DXAB 1QTPA 1WDAA 1C5DA 1CLOH 1H3VA 1NGQH 3HS8A 4IOSD 4Y19A 2NY4B 3BKYL 1MCLA 2D3VA 2H26B 1WFJA 3ABZA 4P57A 2R39A 2EUZA 4U1GB 1ITCA 4JQIL 5FDYA 3D9AL 2V7NB 3WFEH 5EC1B 2VDOL 3K46A 4Q0XH 4MMZB 4MS8D 3QH3B 5E6UB