2OV0A

Structure of the blue copper protein amicyanin to 0.75 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh resolution studies of amicyanin
rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ov0A00
3QJRB 1KCBA 2JXMA 1JVLA 3AG1B 1BQ5A 1GY2A 1SFDA 2BP0A 3T71A 3OMNB 2UX7A 1ILSA 1E30A 2XXFA 3PAUA 3EH3B 2DWTA 1ZDQA 4G7RB 3HB3B 2DY2A 4A68A 5F7BA 4AI7A 1SNRA 4DP0X 5AZUA 2HX8A 2B3IA 4W9ZA 1KYAA 1AS7A 5I6LA 3FSVA 1JXGA 1JXFA 3QJSB 1QHQA 5B1AB 1OCRB 2IAAC 2CBPA 3MBWB 5PCYA 1NICA 3NJGA 1PMYA 2BW4A 4HALA 1AOZA 4K9JA 1NIEA 1ZV2A 4GXFA 1AS6A 2IDQA 2QT6A 2VSKB 4M3HA 2VMJA 2R7EA 4F7KA 2BZCA 1BQKA 2VW7A 3X1FA 5B7EA 2XXGA 1GSKA 1KDJA 2VW6A 4JHUA 1MZYA 4F2EA 1HAWA 1CURA 1ID2A 1NPNA 1L9OA 1W6LA 4JHVA 4ZK8A 3HEIB 3WG7B 2BP8B 4YSUA 4Q8BA 1ET8A 1NIBA 1R1CA 4BK5C 2IWKA 3WIAA 1OE2A 1PZAA 1X9UA 3H4HA 1WS8A 3X2QB 5AFAA 2XYBA 4ENZA 1OE3A 3QJVB 2W8CA 3G5WA 4HIPA 1PZBA 4KNUA 3DKHA 4A2HA 3X1NA 4CSPA 1QNIA 4MFHA 4UAHA 2AZUA 2CUAA 2TSBA 4GP8B 2IWEA 4A2GA 1ASQA 2FWLB 1J9SA 2GI0A 1AZRA 1FFTB 2GC7C 1OV8A 2YAEA 3CG8A 1BYPA 5I6PA 3FS9A 3AG2B 2VM4A 2VN3A 3S3CB 2PPCA 4A2DA 3V9EA 2UXGA 2J56A 2I7OA 2VSMB 3OD3A 2ZOOA 2YARA 1W8EA 3IN2A 2XLLA 1KGYE 3OMIB 2CAKA 5I5IA 3QPKA 2YQBA 4HHGA 4X4KA 5B3SB 4BXVA 4AKOA 2GC4C 2PCFA 2VW4A 3T6ZA 3AY2A 3TU6A 4RH4A 2PPEA 3ASNB 4YSCA 1PZCA 4AX3A 3SQRA 2ZONA 2QDWA 4KNSA 2YAPA 2DYSB 3FPXA 4QLWA 2UX6A 1IC0A 4NAJA 2FQGA 4DPAX 4F2FA 3T9WA 6PCYA 1GR7A 3CVCA 2WSDA 1F56A 2NRDA 4KO6A 4KOCA 4QKTA 3FSZA 1URIA 1AIZA 1JZFA 4AKQA 3ZDWA 1ETJA 4DP1X 1PF3A 2YAOA 1N70A 3T6XA 1J5DA 2J57A 3NJFA 4JKNA 2BHFA 3TA4D 3N2JA 4E9TA 2EIMB 4E9WA 1M56B 3UAAA 1AS8A 3ABGA 1CYWA 3NJKA 1L9TA 1PAZA 4EF3A 3GXUB 1L9RA 3FQ2A 1SF5A 2WO2B 2HXAA 4GP4B 3FYIB 2HX9A 1OCOB 5B1BB 1IKOP 2AFNA 3QJTB 4YSSA 1CC3A 2IH9A 4E9QA 2I85A 3FPYA 1JXDA 4A2FA 2JKWA 4FA7B 4G7SB 3GYRA 4BWUA 1XB6A 2IDUA 3NJJA 1J9RA 3FQYA 1ET7A 2QDVA 1HFUA 1JZGA 2YXWA 5I26A 1KV7A 1AANA 2CCWA 4DP4X 1RCYA 4GY4A 4HZ1A 1B3IA 3FU7A 4E9SA 1KDIA 2GB2A 3FSAA 1HAUA 2UXVA 3BVDB 4M4RB 3WNJA 3X1BA 4W1TA 2PP7A 2XX0A 5I28A 4N4YB 3ABMB 4YSQA 4YSTA 3PLYA 3H56A 3NSCA 1ET5A 2OV0A 1JZHA 3FU7B 1BYOA 3UGEA 1NDTA 1AZUA 3WNIA 1YLBB 2DYRB 2JFCA 1NWOA 4Q89A 1BXUA 1RZQA 3NYKA 2J5WA 3ZIYA 5B1JC 4HCGA 1AR1B 3EHBB 2XX1A 4E9RA 3NP4A 1ZPUA 3JTBA 5D4HA 2XV2A 4YSOA 1AZBA 1NZRA 3DTUB 2VM3A 1TEGA 3QQXA 2BP0B 2OJ1A 2WO3B 2YAHA 2LLNA 1IBZA 4KOBA 3JT2A 2PCYA 4DPBX 1L9QA 2Q5BA 1BQRA 1MZZA 3AZUA 1A8ZA 1SDDA 2PP9A 4YSRA 3SBQA 3FU9A 3IN0A 3PCYA 4YSPA 3WI9A 2YAQA 5I6KA 2HRGA 3ZBMA 3QJUB 5B7MA 1CYXA 1AZCA 2GBAA 4BWTA 4DPCX 2PPAA 2EINB 2YAFA 4YSDA 3KW8A 1NIDA 2FQEA 4AKPA 3PAVA 4YSAA 3BQVA 4P5RA 5D4JA 2FT6A 1GYCA 3WKPA 2I7SA 3PPSA 2BWDA 1DYZA 5I6OA 2IWFA 3T6VA 3CVDA 1A4AA 1XB8A 3U25A 1XMEB 3IBOA 2FNWA 2IDFA 3UADA 1PLAA 3RYMA 2XVBA 1OCZB 1V55B 1J9QA 1SJMA 3ERXA 1PLBA 4G72B 1L9SA 3NJIA 1QLEB 2IH8A 4G7QB 2FTAA 3UABA 4FAAB 1SFHA 1V10A 2PLTA 5I6MA 5I6NA 2UXTA 1PY0A 2BWIA 1SHWA 2IDTA 2GHZA 3S8FB 1GW0A 1IUZA 1BXAA 1OF0A 3X1GA 1ASPA 1AAJA 5FC9A 3FT0A 2AZAA 2XV0A 3AG3B 2P80D 2X88A 2YAMA 3NSDA 3TASA 4DP2X 7PAZA 4PCYA 5B1JA 2H47C 4DP5X 4G70B 1TKWA 1BEXA 1TU2A 2N0MA 3UACA 2Q9OA 2FT7A 2Y69B 5D4IA 1JERA 3PXLA 4DP9X 3T6WA 1A4CA 2HX7A 5IY5B 2FT8A 1PNDA 1X9RA 2PP8A 1NTDA 1GS8A 1SF3A 3PAZA 2FQFA 2X87A 1TEFA 1ZDSA 1FWXA 4KNTA 3TBCA 5AKRA 4HAKA 4HHWA 1A65A 1A3ZA 1RKRA 3AW5A 3UAEA 5I5MA 1M57B 1ZIAA 1EZLA 3ASOB 2AVFA 2H3XC 4HCIA 2HLEB 3EF4A 3NSYA 3CVBA 4G71B 4YVUA 1WA0X 1ILUA 2QPDB 3IEAA 4DP7X 4UF7C 1L9PA 1NWPA 5ANHA 1MG3C 2H5UA 5F7AA 1JZIA 1V54B 4E9YA 2DWSA 3D12B 1T5KA 2XU9A 3AG4B 5TK2A 1E5ZA 2RACA 3NP3A 1W6WA 2XV3A 1WAEA 3NT0A 4N8UA 3WKQA 5B7FA 3ZX1A 2EIJB 3EH4B 4BDVA 1J5CA 5LDUA 1KBWA 1MG2C 2PPFA 3FSWA 2IDSA 4YSEA 3EH5B 3ABLB 1ADWA 3FYEB 2TSAA 2J55A 4AZUA 2XWZA 2BZ7A 4E9XA 1E65A 1ZIBA 3OQRA 3KW7A 1E5YA 2FQDA 1I53A 1RZPA 2QPEB 2Y1AA 4P5SA 4KO5A 3SBPA 1EHKB 2E86A 3S3BB 3OM3B 1WS7A 4BXSV 1GY1A 4YL4A 1PLCA 4TXVB 3SBRA 4WKXA 3DIVA 4BDVB 3CDZA 4YVNA 2PPDA 2ZXWB 3MX0B 3FU8A 2BP8A 2FJSA 4CSZA 2AANA 2MRYA 3ABKB 4L0PB 1PNCA 3C75A 4DP8X 1KCWA 1NINA 3NSFA 1A4BA 5TK4A 1FA4A 2ZWNA 2W88A 2CALA 2GIMA 1XB3A 2EIKB 4NERA 3S3DB 2HZHA 3NJHA 6PAZA 4WTQA 5E9NA 1J9TA 1BAWA 1CUOA 2XUWA 2UXFA 1WA2X 2A3TA 4UANA 3X1EA 3GDCA 1UATA 1WA1X 1JVOA 2BW5A 2GSMB 2EILB 4KO9A 1GS6X 4A2EA 3CZUB 3OMAB 5A7EA 1AG6A 4HCFA 5PAZA 3NJMA 2B08A 5EHFA 5B1KA 1SDDB 1E67A 4BWWA 4A66A 1VLXA 4A67A 4GP5B 2YXVA 1SHXA 1JOIA 1NIAA 1AG0A 1IBYA 4GYBA 3QJQB 3H4FA 3FQ1A 4E9VA 1NIFA 3TBBA 1NPJA 3N55A 1AQ8A 1N68A 1BXVA 3IE9A 4PAZA 3NJLA 4NB7A 3V9CA 9PCYA 1AACA 1JZEA 3NJNA 1MDAA 1M9WA 8PAZA 1ASOA 1PCSA 1DZ0A 2CJ3A 2HRHA 1KBVA 2OCCB 3CDZB 2MTAA 7PCYA 2R7EB 3L45A 4DP6X 4KO7A 1GS7A 2P80A 5I5JA 3S8GB 1JZJA 1OE1A 2DV6A 2BO0A 1AZNA 1OOWA 1OCCB
chains in the Genus database with same CATH superfamily
3GBNL 1TSRA 3SJVA 3HMXH 4GQ9H 2LTQB 1T6WA 3OAZH 4XPGH 5JA8B 3HPLA 1GY2A 5CU5A 1K5NB 1LMKA 4YHIB 1FVDA 2O6EA 4D8OA 5IJKA 4M56A 5E1GA 4K3EH 3V0HA 2FBOJ 5D1ZA 4XC1L 4FXKA 4PS4H 4IBVA 1KJ3H 1D9KB 2AQPA 3DXAB 3D39D 1B0IA 3UDWC 4QRUA 2HVKA 1SNRA 5F72S 3ZXAC 5J6HA 4U6XB 4KC3B 4URKA 3BXNB 4KJQC 1FORL 2K3HA 1Q9LB 3NESA 2LVCA 2AJZA 2DI9A 4W9ZA 3ZTNH 1AS7A 1SN2A 5K9OB 2EH8L 2QQKH 4M5SA 4PGBA 5E6ZA 2IAAC 5FW7A 2V9TA 3BYYA 4RFNC 4NNPH 2YMXH 1MCIA 5DS8B 1HSAA 3AVEA 3QUYC 1YNKL 3U4EB 5FS5A 3I85A 4ABUA 4XOAA 2ZWYA 5E4AA 3VWKB 3K8LA 1RU9L 4G83A 4KJWD 3EOTH 2AJZB 1JWMA 1IO4C 1NBYB 3TO4D 1AQDA 2Y5TB 4ODVH 1TTRA 2A74C 4WUUE 2F1EA 4F2EA 4NQEE 2VOTA 1S9YA 5AB2A 4M6ML 3QPXL 4Q6YA 4WU5A 1AGFA 1IBGH 3HEIB 5HVGB 1CFQB 1IM3B 4Q8BA 5FUCC 3ROLA 4TTGA 2H9GA 1KB9K 1MY7A 2XHNA 2XWTB 3IXAA 3Q3GB 4QI3A 3H4HA 2IAND 2L04A 3AT9A 4RRPG 5D5ME 5IV2B 3J2PA 3BWUC 5T3XL 3SGDH 3MJ9H 2Q20A 5E8EB 5GRVL 1NGYA 4FHKA 1HWGB 5BJTA 1MRDL 4M7JH 5J6GA 4DKEL 3UIZA 3KH4A 4HUWA 2Y23A 5ESAB 3IB4A 1DDHB 2EE0A 4LOVA 1ZV9A 2UWEA 1CMOA 2BIIA 4HLZG 4UM8B 4LL9A 3MRRB 5J4MA 5D9SA 5DR5H 4ZXBB 2CBQA 1S7RA 2K78A 4XPHL 1CFTB 3KH3A 1Y18A 3MO1B 4ODVL 4S2SA 1RUAH 3ULUF 3SPGA 3N1PC 4UNVA 1E9QA 2W0KA 3MLPA 3ZT7A 3NACH 3W9DB 4PRDA 4PYHA 3BDXA 1A3RH 1OEZW 2Q7NA 4G8AC 2OYKA 2JJVA 4IOSA 2QMJA 4JKPH 3N9GH 4TSAH 1D3CA 2BX5A 3UBXA 3MGOA 4DAGL 2AJVL 3CJJA 2DF3A 4P46C 3BAEH 3T04D 1PFOA 5A16B 3T6ZA 4OJFL 4X7CC 1C5BH 1MAMH 1U8KA 2WZPA 1K4DA 3RL2A 1EGJH 3ECWA 3VXSD 2V2XA 1FN4A 5TTRA 4LLYA 4HUCA 1X4ZA 2BXYA 3VVWA 5C08E 3OB8A 3CVCA 2NRDA 2V33A 4IRJC 3UTSD 3FSZA 3MUUA 1DUYA 2ITDA 5KAQF 4XWGL 4GT7A 5I0VA 1EIBA 3VW3L 3MLRH 4P49A 1PF3A 1E4KC 3UG4A 1RLWA 5JPNB 3UOAB 2OSXA 2ADJA 4PJCA 1WCBB 4OCYH 5CP3H 1OSPH 3K2UL 3LKRA 3QJHA 1NA8A 4NUJA 2IH3B 2DMBA 5CJXA 5IHZB 2NQCA 3NJKA 2XZAH 3QQDB 3TJHC 3V52L 3QXAB 3MOAL 3V4VB 4IU3A 4LB8A 5FCSH 3QUKB 1KCUL 2LAGB 4MHHG 5CGBA 1U2YA 3CSTA 4AXWB 2TRHA 5SX4I 5HVHB 1II4E 3ZR5A 4Y9EA 1NAKH 1KTBA 4R4FL 5IQNA 2QDVA 1JZGA 1KMGA 5DJXA 3U83A 1WDAA 4NN6B 4HJ0C 3SDYL 3HNVL 2FX8H 4N9GA 4JREC 3D39A 4CU8A 3N91A 1S9WA 1B3IA 1WUNT 2J6EH 4JX0A 5F9DC 3L4UA 3WXWH 4WW2B 3LJ3A 3IJ7A 5CLYA 5IB3B 1ODUA 2RH0A 1VGKA 4M4RB 1OAJA 3S36L 4P4RA 5DYOB 3WNJA 3ZQXA 1UA3A 1ZEAL 1JAEA 3JTSB 4MAUL 3HZ3A 5DQ9B 3O6FA 2C26A 4B9PA 4RRPM 3ZE2E 2Y07H 3WNIA 4BQBA 3EOAA 4FFVD 3VD3A 4PJHA 4RMRA 1KG0B 2M2DA 1NWOA 1JCVA 2YGPA 3QWOA 1JDCA 4IGBB 4WGVB 4Y2DA 5HHMD 4NSKA 3QQDA 1FVEA 3BEVB 1IX2A 2CUHA 4ICWA 2DWEB 4MD4B 2F53D 5KVEE 3TC9A 4M9OA 4WWKD 1HILA 1FBIH 2P1YA 1KN4H 3ME0A 3QQXA 4PCKA 5E2VH 1Z9NA 1IBZA 2CGRL 1GZHA 3QUZB 4XAKE 3TM6A 1MCQA 4DN3L 1KNOA 5J6SA 4ELMB 5F9OL 1ESOA 2HLAA 2DI7A 4JEGB 2DYPD 1AI1H 4PBDA 1U6AH 2XN1A 2MQGA 3KPMA 4PLKD 5D2LB 5I6XB 4Y4HC 4L4TD 5ITFA 3WBDA 5CJQL 4AE0A 5KEZA 1IGFH 1GZHC 2YO3A 2O6PA 4H1LH 1KJ2H 1KC5H 2KZKA 3CFMA 4QCIA 3DGCR 2HLFC 3VG0L 2NSMA 4BHUA 4HMDA 1CICC 1SXBA 5F89A 4K2UH 1JTOA 3Q01A 5C0BA 4NUJB 4D2NA 2W0PA 1FL5A 3JTSA 5I6OA 4OI8A 3WCYA 4ETQB 2DLTA 5MEOB 4Y4FB 4QRQB 4B7IA 1P5UB 5AOZA 1SJHB 3BP5A 1CDCA 5CEYB 1XCTA 5DJYB 1IAIH 5BCAA 3U46A 1RL1A 3H53A 5FO2A 2V2WB 5DD5L 1ORQA 1W0VB 4FMFA 1QASA 3KPSD 5HDLA 4NO5A 1R5IA 3MJ8A 4KKBC 4M48H 5LKNA 1KBGL 2K4WA 3WD5H 1A3RL 3UJJL 1WTLA 1YHPA 2UXTA 4FTVA 3T3PB 4Y2OA 4HS6A 4N2OA 3S8FB 4WHCA 5D7IF 2J2ZA 5FC9A 4LE8A 1I8AA 5FOBA 4IRZL 1AKJA 2VLKB 5EZIH 7PAZA 4XPBL 3HZYB 2C3VB 1CDUA 5EOCL 2H47C 4RGNE 4OJCA 4QPEA 3TNMB 1C5DA 2E4FA 1ZANL 1XF2B 4DGUA 1G9HA 2GUOB 3S36X 5ADPL 2Y7MA 2YUVA 3OXSB 5E99L 1BAFL 4WY7L 1GCFA 4ZMOA 4AK2A 3CQQA 3LN9A 4YXHL 3C08L 3RP1A 2ICCA 5DFVC 4NSKB 3T0XA 5JA9A 3MLRL 2EC8A 4G6JL 5IW1A 4RAVB 2CRZA 1OZTG 3BZ5A 3JWNG 4M48L 2E27H 4HAKA 5T3ZH 3TO2A 5I9QC 4YFLF 2JB5L 3WYRA 1IILE 3AW5A 2VKXA 1NC2B 2VN6A 4U33A 1JF1A 4KXAA 4Z7WE 2L7JA 1ACYL 4BZ2H 1I3GH 2OR9H 3SE8H 3PPEA 4A63A 1FORH 4MHHI 4OAWA 2G0LA 2VDNL 5L0QC 1KB5H 2QPDB 3GMLB 4GXVH 3RL1B 1QSEB 1RK0A 2C4FT 3KPMB 1ZSDB 5LXGH 5EO9A 4HDIA 3HI5H 2W5PA 4BE5A 4L1BA 5DTFB 3TT1L 2ZD0A 4CA4A 2H0EA 1FNLA 4BEIA 4ZYKA 3VWJC 3NIGE 3GUTB 3VFWB 4AQ1C 2JJWA 1RIUH 4NOBA 4RAUA 3GIZH 2E7HA 3KNBB 4ZMYA 5FYJU 1T0OA 2C9RA 3AY4A 2WLZA 1B9KA 3GSVA 2CO3A 1J0JA 3UG5A 5IMMB 4QWWC 4NLHA 4J3UA 4HIXH 4TULL 5AVQB 4D0DB 1WC7B 3WIFA 3TN0A 1YC8A 2DQGH 1MFCL 2BZ7A 2HG5A 1E65A 3NCMA 4MQTB 2J88L 1NLDH 4JN2B 4OQ1A 3NZ8A 1EUUA 5C97A 1OTTC 1IEBA 1L4IA 4H20L 3BUQA 3GZOA 1KTRL 3TPKA 1WWCA 3QIBA 1SXSA 2YD7A 2DKMA 3QXWA 4F5CE 1MHCB 3D85B 2X7LB 5AQ0A 4AIZA 1PFCA 2YSSB 4WNQB 5DEFB 4UUJB 2WXOA 3TCXA 1S3KH 3HE7A 4XNZB 3RX5A 5I66B 4LDEB 4PJEF 5CZKA 1TTBA 1EERB 5TPWL 1E4XI 3QEGL 1AQKH 1KJVB 4JFFB 2WJ5A 3CSFA 4XB7A 1EAJA 4XNMA 3CV5A 5E5RB 2IFGA 3SE3C 4GEIA 5BNXD 3LMJH 4KI5F 2A3TA 4YXKH 3F85A 3BISA 3EJYD 3H8NA 1BBDL 2YC1B 3BKCL 1UATA 1BVNP 2YEZB 3SGKA 2A74A 2ZF8A 3GHEH 4I18B 1E43A 1F45A 3FUJA 4GG6A 4GFXA 4Q58C 3EAKA 4AYFA 5FPIA 4LCIL 1M7UA 1ED3B 4NJ9H 5I8OH 3TTSA 4PJAA 4DAGH 3PU7A 2YQ2A 4Y19A 1WD9A 5FM5O 1I7ZA 3FU5A 1UKTA 4RBPH 2MQ3A 3V5DB 4C83A 3P3RA 5HHOD 3BWSA 3QHZH 4KAQH 1H9VA 5KVMC 1BQUA 2MJWA 1A7OL 1BW8A 2XZCL 3IDJA 2X38A 3I74A 4Z76A 1LQSR 5L8KB 4JFEA 3W39A 4UQIM 1FVCB 2WAHA 1MDAA 1Y0LA 2JB6A 3N41B 4F80A 1DZ0A 3E6FB 2GTWB 3WNKA 5DSCB 5E9DD 3MKGA 3SCMB 4ZFOL 1ZA6A 4PEEA 3C6SB 3GTVA 3T1WA 3VQLA 5DZPA 5I1GL 3WOVA 1T1XA 5AW1B 1CL7L 5I1KL 3IDGB 4LASL 4L3CB 1WZ1H 2ARWA 2ITCA 2WBJC 5CD3A 3L9EA 4LHUD 3QUMH 2H8PA 5IW6A 2VL4A 1VJSA 5DJZB 4AMKL 3SQBA 3AG1B 2R27A 2Q87A 2UY7B 2QMKA 5FXCH 4AV0A 3EFDL 5GJSL 2XA8H 1JZ4A 4GW4B 2YQGA 5HYIA 3C60B 3UBXI 3VXSE 5EF3A 2GCYA 3RGVD 4JHWL 2G3NA 3WKYA 1LO4H 2EXWD 3EH3B 2DWTA 2YSTA 1UOVA 5HHME 3ZE2F 1GJIA 5CEZL 1UASA 4AI7A 4PJIB 2VUOA 1OB1A 1LLAA 5D1ZB 4HOZA 3OQ3B 4QHLA 1GIGL 5HHPB 3PWVB 3AMLA 2WUBH 3RWCA 4XTRC 2HPOA 3P4LA 5BRZE 1WLHA 2VDQL 2K6ZA 5EUOB 1K3IA 4GRLA 2ZUUA 1PKQE 4NRYB 1C12A 1AS6A 2QT6A 3VRIB 4IIQC 3HE7D 4JQXA 4P3DA 1ZA6B 3RZCD 5INCA 4WTWA 3QFJA 4AYSA 1UA6H 2VLKE 3B9EA 3RX8A 1CVSC 5J1AB 1TZHA 2V5YA 5JDJA 4NC1C 3N04A 2B4CH 3LH8A 4N2EA 4O51A 4Y4KB 3COOA 5F1NB 2EIZB 1D5MB 3AQYA 2V5SA 5DZNA 4JHWH 4G6AD 3SDCA 5F70A 3WNNA 3IPFA 1CURA 3BJ91 3W0WE 4JM0A 3I02A 4YHNA 4HEPG 2J1WA 3QQ3B 1GGCL 4BK5C 1MCRA 4Y4FC 2COVD 5DHVB 1NMCC 1O5DT 4PV8B 3TO4C 1O7VA 2DQIH 1IGMH 1AC6A 5E6IA 5CCHE 2MNWA 2H6PA 4PJ7F 5C09E 2F58L 1S7WA 4HJSA 4JO2H 4K71B 1RZ7L 1CGSH 1UXWB 2R4RH 1JHKL 2D0HA 3MREB 4FP8L 5T3XD 3WLWD 4EAEA 2CJUH 3MR9B 1QZ1A 4YLCA 3QH3A 2FGWL 3U4EA 3QG7L 4IBUA 2DYPA 1EDYA 1AZRA 5EC1A 4D7PA 1EHNA 2I25N 1NDMB 1NLDL 4JKMA 4LZKA 5ICZB 1YDPB 1NKGA 4GRWB 4MQXD 5KVGE 1BFVH 2F7PA 3LRLA 4RGOL 1JZ3A 4MXQD 3BAYA 5CU9A 4A2DA 2F74B 4FYQA 1LEGA 3PDOB 3BOVA 1A0QL 4OM0H 1W8EA 1G7QA 1TIUA 2F7QA 2HKHL 2WV3A 4K8RD 2I9LB 3MV7B 5A2LH 4AE1A 3KDPB 1CXKA 2ZWKA 4P3DB 2CDGA 1KGYE 3CCHA 4GKZB 5JXED 3T77A 5LQBL 2GVYA 1CFQA 3GSXA 2F53E 4XBEL 4P9MH 2YQBA 1IKNC 5IF0A 5TE6L 4BXVA 2DQIL 4N20A 3RA7L 1RULH 5F1NA 1VKXB 1T83C 4LLQA 1FNGA 2PCFA 2VZSA 3UTOA 4XPTH 2PXYD 5FECA 1CLVA 3UTTA 3M86A 3REVB 1ANUA 2WD0A 3D3VE 1HJCA 1PZCA 4UQBA 4QHLB 3EJYC 4OLZH 4GJTB 1OK8A 2IBGA 4N26A 3FPXA 2UX6A 4Y1AE 3WS6C 4PJCF 1A6UL 5JW4R 1K4DB 3RL2B 1LO3L 3CLEH 3KXFA 3WIIH 5LGJB 4LLQB 3PHQB 1H3PH 4ZSOB 3GEWB 2DKSA 1QI5A 1EJOL 3DXAD 4GSRA 3MLUL 3VVVA 2BMKA 4JPKH 2OI9B 4GBXC 3MLSH 2VGLM 4L9LC 1SOSA 4HAFA 3DOIA 2DBLH 1QEXA 4Z0XA 4PCTA 1AXTL 2HRPL 3CGTA 4ODTL 1AS8A 2NCMA 4UM9B 4XTRD 3GXUB 3LZNA 4WY7H 4P5TA 3KXFB 2HXAA 4CW1B 5KSUB 3WDHA 1IAKA 1OCOB 4QD2E 1D2PA 5DHVA 3NZHL 1BMGA 4HUXA 4YDVA 3SDDB 1MEXL 1B4JL 3EIFA 4FA7B 4LPUA 4YDLC 3IDXH 2ESVE 3CSYA 3US0A 2F1AA 3O6FD 5EH1A 4LCUB 5DGRA 1T03H 3V4PB 4X9IA 3RNQA 2CXKA 3NJJA 4OF5A 4Y4KD 3LKOA 5E08L 3UBXG 3KPNA 4W9EC 4YHMH 5D7HA 2DTMH 1KBBA 1WTGT 3SKJH 4AQEA 4F8OA 3Q5YA 4IMLA 3HBGA 5CS7A 1N4XH 1YSOA 2C9VA 4HZ1A 2QFRA 4R90H 5I18H 4KKRA 1JDAA 4S1QL 2P5EB 5GGSB 3RY4A 1U2HA 3DVFA 2FHCA 2ENYA 3NA4A 1LJMA 4U7SA 1AFVH 1HAUA 3TBSA 2N0KA 4HUVB 4OZGA 1GHFH 4U0RC 4TNGA 2WXJA 1FYHB 2DMHA 3P4OB 3B43A 5KW9H 1HSAB 4M1CC 5DEZA 2RALA 2PMZA 3FB6B 3THML 1SUHA 1RZQA 3NFPB 5IROC 1ZTXL 2KZWA 3HCVB 2XX1A 4Z3TA 2FK9A 1PYWA 1QFPA 2YUZA 5D4HA 2BIHA 3NDYE 4BSJA 1S7VB 3HFMH 4YWGH 3WE6A 4QRPE 4G6KL 4CNIB 6CGTA 2JQZA 1R3LA 4FKEA 2VC2B 2F15A 4YK4B 4LHUG 4NO3A 4OZGE 2NY5L 2GBVA 2HCZX 3SQOL 3UBHA 3NFPA 5GRJL 4DSYA 4KZ0A 5F7DB 5IM7B 3QJOA 3ARTA 1J7VR 1V05A 1IV8A 5EU4B 3SCMD 2GSIA 3FRUA 2XYCA 4LL4A 5J3HC 5J6GB 1W0WA 4MAYA 3D06A 4KPHL 3LZFL 5GGQH 5C7XL 3GSNB 3L8QA 5IFJB 2FT6A 2OYMA 5JIMA 4XNDA 3A22A 4QCIB 4UM9A 1PIFA 2HKAA 1SQ2N 4X6CF 3L3IA 2ENJA 3L3DB 4IHOA 3DBSA 4Z7UA 5HDRA 4F7PA 4L8SA 2DKUA 1JVKA 3S97C 2GJPA 3MX0A 3O4LB 5DWUL 2WXQA 1XEUA 1TTGA 3V4PA 1UUNA 1IGIL 5GS0L 3NJIA 2YD2A 3VNZA 1JGEB 3HB3C 3F05A 2WLMA 5IKCA 3CHPA 1CO1A 5CO1A 4TUKL 3C5XA 4WFFE 4OIAA 1PCXA 4DK6A 4PJHE 1V3MA 4MB4A 1Y6NR 3WU1A 2R8SL 2ZCLL 2W07B 4PRHE 1JZ7A 1MNUH 3OC5A 1A1OB 4LHUA 1ASPA 1FG9C 3WIHA 2E9JA 3OGCB 3T09A 5K9JL 4H2CA 3BH9B 3TASA 5FO9A 4C56A 1FP5A 1TTCA 4JHBA 4YDJA 1ZTMA 2BIOA 3HOGA 3SDAD 4EDXA 3MGTB 4HH9A 1NJ9A 1XFPA 2J12B 3EDDA 5EOTA 3RGVA 4CDGC 1S3RA 3DX4A 3FCBA 1JV5A 2C3VA 2XTLA 5DJXB 1GGYA 4QRQA 4WEUD 2WJ7A 1P5UA 3D1MC 3RX7A 5JORA 4BRJA 1SMOA 4JE0A 3D39B 5FYLL 3BYTA 1PYWB 1RD6A 4EIGB 3ARUA 1S9XA 3NVQA 1FWXA 2OSLB 4KTDL 1WO2A 4N1CA 4ANUA 1DLHB 2CHZA 2BFVH 3DSFL 4MXWL 2FIRT 4WSKA 2OYLA 3ZN6A 3LXUX 3HB3D 3D0VB 2MMXA 1W8OA 1LM8V 2XVLA 1HL4A 4JCLA 3VXMB 4PJBF 3LY6A 3QXAA 3QO1B 4F91B 2MPVA 3V4VA 1DBAL 3RB7A 1ACCA 1DEEB 1BVKA 3GXTA 2J2ZB 1WA0X 2Y5EA 4UF7C 1ERNA 2NY2B 4YHPB 1P5VA 5ANHA 2H5UA 4B5EA 4JQIH 3BZFB 2K7QA 5E00A 2JELH 2DWSA 1IIKA 5D1QD 3HNSH 2WOBA 5ERWA 3GT6A 1JZ6A 4WI4A 4PIRF 3FDWA 1P7KA 4JFDE 4POYA 4WFGD 1G6VK 2RQEA 2A1WL 2E8YA 4YLBA 5FCUL 3ZDXF 3VCLA 4OJAA 2DTML 1UZGA 1J5CA 1E6OL 3HW7A 3O3EB 1MWAA 3WEXA 4AL8H 4BFBD 3RWJA 2GFBB 1NJ9B 1UOKA 2W94A 5D2LA 5ITFB 3DI2B 4IGBC 4WWPA 2GI7A 3D2UA 3X14B 5IQ7H 2JKXA 3WHE1 1NCBL 2QADC 4D0DA 1WC7A 4P2RD 1W72B 4B9KC 4OQTA 5JIPA 2EC9T 3FCTA 3HIZA 4AY0A 1WS7A 4RZCA 1GY1A 2H26A 1IMHC 1WAAF 2XKNB 3KE0A 4JRXD 2X5PA 3ARDB 4FMKA 2UZPA 4XMTA 3G5XA 1QNZH 5C0JB 5AKSA 5DO8A 5CZRA 3G04B 4ZTOH 3O2VL 2QSVA 4ZAKD 1TNMA 1KCWA 2ICEB 5EO1A 3W9EB 5I6XC 4P2QB 4NUGH 3OWRA 3ZHFA 1XGQB 2AXGB 1DLFL 2VLLB 1P5VB 2OZ4L 4OLXH 4CKVX 1FIEA 2EIKB 3U0PB 4OW6A 5FGCB 5JOFB 3B2XA 1ECZA 5E9NA 1ACZA 4JFFD 4MRBA 1H19A 4OJYA 4DGYH 1J9TA 1ID5I 1GYUA 1OPGL 1WFNA 3EGDB 4WK0B 1B6DA 1MJ7H 3WFDH 2NLJB 1WJ3A 5JIHA 5E5MB 4P2OC 1UM5L 4G6MH 15C8H 4XC1H 1GS6X 2VQ1B 1JPTL 1X5YA 3TEWA 3WTTA 4E41B 2ZAGA 2DMGA 4MYWB 3VXUE 2FZ3B 3I9PA 3LH2L 5AVTB 1XH2A 1IVTA 3NTCH 3S4SA 3BGMB 3A4FA 2VJ0A 2FJFA 1JOIA 3D0VA 5LAPA 3ATFA 1IBYA 3L5HA 3ME0B 3ZHLA 3GSRB 3LEXA 4PUBH 4LBEB 3WSQL 4WUKL 3BSZA 2QKIA 1ADQH 5T1KB 3PL6A 1OGTB 2PTVA 5DUBA 4XNAA 3NJNA 5ALBL 1ASOA 2CJ3A 3VTTA 2QSQA 5FYKL 3Q2CA 3L45A 5CJBA 1THAA 2FRGP 5JHLA 2RR3A 3MYZA 3ROOA 4RSYA 3OLEA 2YGOA 3RUGA 2DQUL 4DERA 3R4RA 1C7TA 4XX5A 1FFOB 4TPRH 1MUJB 2H1PH 1OCCB 4DO6A 4FQPA 4HEME 1AXSA 2W9DH 5ISZA 3NIFE 1A5FL 3QJRB 2X3CA 4WLCA 5HHXH 4HC1A 3HS8A 1QSED 4F15C 1VIWA 3B2UD 4GLRI 5GZOD 5FW6A 4M8UA 4PRBA 5DHMC 4MS6A 1XCTB 4TQPA 5G4OA 5DJYA 2VDOL 1NGPH 4IHBA 4NIYE 1CG9A 3UYPA 4ZFOA 2XTJC 4Y16A 4LMQE 4YXKL 1OAKH 4X7SH 4DP0X 5B3JF 1LK2A 5TQ2H 3TVMC 1QSFD 3A3YB 3LSOA 4GIAA 4N6RA 4QRPD 4WCYL 3BPLB 3QDGD 5L2KB 4J4PC 4JR9H 2BNRE 5B1AB 5D1XB 2Z92B 5F6HI 3VGGA 2B5IC 3HN3A 1BQLL 1RUPH 5F9JB 3NJGA 4YQXL 3BAIA 2KUTA 1F90H 1NC2A 3MLZH 3GD1C 2VSKB 3LPWA 5JNYB 1KXVA 2AXHA 5BVPL 4NFBA 5IW6B 3PWJB 2X9WA 2ZG1A 4FQXD 5SWZB 2V3DA 2WP3O 1H0DB 3LSOB 3MJ6A 5DUPL 1EHAA 2O61B 3GBEA 2EDQA 4LVOB 4P3CL 3PHAA 4HISA 4JHUA 3TH4T 4CBZA 4PS8A 4KQ4L 3VTAA 4G5ZL 2VXQL 2F5BL 4NXKA 2ZXQA 4Y2DC 5BMFH 4GG6E 1J5OH 2IWKA 3LN4B 4O2CA 2BSRA 5GPRA 4MCYA 2Q76B 5JDSA 4B9CA 1WS8A 1DN0B 4L9LA 2BVQB 4WU7A 3L9BA 4FZ8L 2P45B 4XP5L 5AFAA 2Y7OA 1DSWA 5JXEA 1Z5LA 4F2MB 1J8HB 4N0CC 4Y5VB 2QHLA 4H8UA 1RAMA 5T1LB 2CPCA 5LAXB 2X6MA 4Q9RL 3GBNH 1YYLH 2CCLA 2Y22A 3HBZA 1EK3A 3L5XL 4IOFD 2DL2A 3GK8H 4TVPE 3Q5OA 2FJHA 5DD5H 1S7WB 1KWKA 4RVBA 3N3EA 4KX7A 1ND0B 4PRHD 4G6AC 3AU1B 3G7TA 4ZPVB 5DMIH 5K69A 1SM3H 4P4KA 1TZHB 4A1RA 1BVOA 2VSMB 2W38A 2PWEA 4ZS6D 1C5BL 1MAML 2NX5A 1OT2A 2QZ5A 1LXMA 3KPQA 4X6CE 4Z7OF 4Z0BL 4PLJC 1TQBC 1WH0A 5DVKA 5FX3A 3OMIB 2WUCH 5IJBC 3Q06A 3I75A 3GB7B 5I5IA 5K1JA 5KOVC 2MFNA 1FIGH 1HCFX 2V7HA 4XMLL 4ZMPA 4KXZI 3MLXH 1MW2A 2YKKA 4L29A 4PHXA 4P8QA 4HQQL 3O45B 2VW4A 1RFDH 2VC2L 2ZKHH 3NK3A 5LCVL 3IFPA 3S3PA 4CVZA 4UQ2A 5FGSA 2E6PA 1BAFH 4QJ5B 4YSCA 4M6OL 3B1TA 3QIWA 4JFYA 1MLCA 4NAMA 5JZ7C 1EX0A 4QUOA 2Q76A 3O3UN 5LGJA 5DVNA 4EI0A 3N44B 4KGLA 1CN4A 2P52A 4FCAA 3LN5A 2VXTL 4AMXA 3WTVA 2YEQA 2FQGA 2K6YA 1ODAA 2A4CA 2VIRB 3QORA 6PCYA 4OZGF 1RZ8A 1OSPL 1CBVL 1F56A 4KOCA 3AREB 5DRXB 3KBEA 2JCCB 4TNFA 1F1DA 4DP1X 1FPTH 5I66A 4Z3GA 3K7UA 4J2QA 4JFPB 1UB6A 1E28A 4XN8A 3T6XA 3INOA 4NNPL 2VABA 3I9IA 4APQD 1OK0A 3G5ZB 2ED8A 4JY4A 4M29A 2Z0UA 1XSJA 3KL0A 3SDXA 4ZFFA 5D7JB 3G9AB 3ETBJ 2WYIA 1D6VH 2DJUA 4PH8A 2E4TA 5T5FH 2X89A 3DHUA 3RG1C 3VXNB 4HJ1A 4NN7C 2O5ZH 1WISA 2X70B 4GP4B 2MWCA 2BSCA 5ABDE 4LQ1A 1A3QA 3BWZA 3CH1B 5MEQA 5ESQB 5H35B 1BIHA 2Y36H 1DJGA 2JMRA 3WL9B 4AH2A 3FRPG 4G7VL 1CE1L 4TQIA 5BVJA 2XDHA 4R7LA 1LP9F 4K3DH 3VG9C 5F0LB 4MNQB 5ESVA 4LOFA 4E5XA 2MQ0A 4QHKI 1G6RA 3E7JA 4NQDA 3OX8B 5G4MA 4GSDH 5AVVB 4XBEH 2XFXB 2CDEB 4WHYH 5I74C 5L0QB 1Z9LA 3INUH 4PHZA 1XWVA 2F53A 1NC4D 3S35H 4I9WD 4ONFH 1TFPA 3BGFB 1OF2B 3K8MA 3B5TA 2Q8BH 3IDNB 4EZLA 3VWJB 4YIQB 3O0LA 1OAKL 3F65A 3FB5A 3BVDB 3G5VA 3KEHA 5MHSD 4E41D 4TVPH 4XCYB 4EPSA 2ITCB 4C4KT 1UEYA 4WO0A 3F62A 5E0QA 2B1AL 2JCWA 3EYVA 2WZAA 1KB5B 4Y19D 1DJZA 5JQ6L 1OQOA 4J3BA 1AQKL 1BFOA 2YD0A 1T6VN 3CZEA 3IMRA 4OM1H 1B0GA 3B2MA 1EJOH 2FCBA 1H5BC 2Z7UA 3IJYB 1AGBB 3I6LD 3PWLB 1DQDL 3U82B 3IDNA 1Q90A 3C9NB 2OMBA 3TZVA 4I88A 2ZX8A 3APFA 3K6IA 4M00A 3VXUD 4BH8B 4G42B 3ZTNL 2XWDA 4NRXB 1D5MA 2LLNA 1E4WH 3J7HA 3UMTA 4JGNA 4A7GF 2J44A 2BCKA 3BQUC 3Q7JA 5I23A 5JHLH 3PDGA 3AABA 4Z7UE 4AGPA 2Q8BL 1A8ZA 3QS2A 4XNZC 2PP9A 3FU9A 4JZOB 1E9PB 4XO8A 2BH0A 3MRMA 2X05A 3VXRE 3WI9A 1WHOA 2E7BA 2HRGA 4NPJA 3EYFA 3U9WA 2EVFA 1FV1B 4NAQA 3LKPA 1J8RA 4S10A 2KLRA 3S37L 2PN5A 1FVDB 4KX9A 1Q1PA 3M17A 4TUUA 1MVFA 1U8CA 5CEXA 4ISVB 1ZSHA 3BQVA 5AENA 3L9RB 5GGRY 3Q43A 5T1LD 4PJDB 1HH9B 2I26N 1XBDA 5K9QI 2A9DA 4UMSA 4EO5A 3ZE0B 3K6FA 4DJMA 5D8JH 3OKEB 2HVKB 4FNQA 4W9IC 1DL7H 4XMUA 5J6HB 2RGSA 1OM9A 4XO4A 3MKKA 4R4NC 1WWWX 4F15B 5TF1L 2IDFA 3QZWB 4DETA 5D7IB 5I1DB 5K9OA 1MCPL 1IGYB 1IJNA 3H7LA 1DSYA 3EJSA 5ID0A 2DQEL 1T3FB 4P5TD 2H32H 5F0PB 3RHWF 2H3NA 5LHDA 4ZUVA 2A9NL 3MCKA 3HPLB 3DX2A 2FTAA 1MCKA 2QV4A 2CA4A 5EUKA 3BDYL 1LD9B 5IEKA 5I16A 4GPVA 4L1TA 2RHEA 2WIMA 3M6DA 3A6OA 1TQVA 3RU8L 3VXMD 2R0KH 2J25A 2ZP9A 5FECB 5EN2A 1I8IA 4XPHH 1M53A 3MYJA 2YJQA 3VGBA 1KFGA 4DTGH 3D08A 4HWZB 2H3NB 3VWKD 2WZ5A 3PDOA 4GAJH 1C16A 3QORD 4QHMA 4Y5YA 1EVUA 2PKDA 2H9GB 1U8JA 1MLBB 2Y69B 5HHQB 4MA7L 4OFYD 3OKKB 4UT7L 1OIOA 3Q2NA 4NEHB 4QF1A 2YD3A 4IHOB 4TULH 4WI3A 4M1DH 2HX7A 1JPSH 3JVGC 3BIBX 3T6WA 3CFDA 4UV7L 5I71B 1N5YH 3IMSA 4G43A 2GITA 2XY1A 4TYUA 1SF3A 1EAPB 3PWNA 1T0MB 2X87A 3QR1A 3FOMA 4W4NA 2QQLL 5IJVA 3BFOA 5K1NA 4ADJA 1DQML 2GQHA 1DVFA 2Y07L 3B7YA 4XCEA 1SBSH 3EOAB 4AQ1A 4PJHB 3KVDD 1MCLA 4W9GC 5I5MA 5DEJA 5C6TH 1BM7A 1A7PL 3GLAA 4WEMB 4ORGA 3HC0A 4JY5H 3ULUH 1I9EA 4MBOA 4NWTL 5AZ2L 2UYLB 4JZOA 1WZMA 1CXFA 1N8ZB 3DHMA 1MI5B 4PJ8A 1RZJL 2R69H 1LO2L 3ARBC 2E76C 3I2CL 2HFGL 4N5ED 4PWHA 3SBWC 4HIXL 3GKWL 1I8KB 4FNPA 4ANVA 3HUJF 4K0OA 1E5ZA 5DFTA 2QLVB 3ESMA 5DRWA 5TFSL 4G9FD 1UQSB 3BZFA 4HZLB 3B4NA 4X6DB 1HESA 1OT1A 2BP3A 4ZNCD 2D3NA 1I8MA 3QFJE 2AHIA 4Z7WA 4J3VA 2OMTA 4XP1L 3QQ4B 1QBAA 3BIAX 4N2LA 5ICYA 3OJ2C 1Q8MA 1X6LA 4AZUA 4GSUA 3CIQA 5HDQH 3P0YL 4XMKH 4KK8D 1BIIA 4UAOC 1E5YA 3CZSA 3WMSA 5I1HH 5L7XH 5FOBB 1CB4A 1I53A 4BQCA 3MCLL 3ZKMC 3RI5F 3MCKB 2ZKYA 1LHZA 4LF3A 5I8EA 4XMWA 1B0RB 5KYYA 1UUSA 2XRAH 2WLLA 1S7XB 2L3BA 3IJEB 1YEFL 5HGGS 2WLYA 1GZPB 4Z95L 1OGAA 3WKMH 2AANA 3ABKB 4LSVL 5HJDA 1SYSA 4ABWA 3RIKA 1YUHA 3GWJA 2HAZA 2VDML 4R7VA 4UTBH 3WD5L 2ZWNA 4JG9A 5HDOA 3QZWG 2QBWA 3FTYA 2JTYA 2KI6A 1A6AA 1I1FB 3V0EA 4ZODA 1TVDA 4I1PA 2N01B 4JN1H 1LGVA 2IAMC 3IU4H 5AKVA 1P6WA 2J1ZA 3NAAH 3WS3B 4AITA 4B9GA 2Z8SA 3P0YH 4XO3A 3OJDA 4NC1E 2B77A 2KDYA 2OR9L 3SE8L 5KVDL 1A7OH 4WFHD 5CP7B 3PXJA 4D9RD 4HCFA 3AQDA 3G6JF 3P1VA 5EG6C 3KR3H 1JPFA 1SDDB 1X7SA 3HS0B 4X4XB 4MB5A 5ICXA 3JV5A 5EF0A 1YPZE 5FCUH 4A66A 3BN9C 2F19H 1H8LA 4PJGF 3EW3B 5C09A 3O6MH 3P9LB 3MA9H 5C0CD 3TBBA 1YECH 5ANMB 1G1CA 2HJFB 5AVYB 3QEUA 3L3IB 2FBJL 1R47A 1KB3A 3JT0A 4RAVA 4YN3A 5C9JA 4HIHB 4X42A 1G4RA 5EO1B 1M9WA 2OCCB 3PS6A 3W0WA 2WQXA 1GYVA 4J1UB 5TF1H 4D8PA 4EN3A 1A9EB 1JL8A 4RGMC 5IMOB 1DJSA 1XGZA 2Y5QA 3WHXB 1OP4A 3TBYA 4BA0A 5DD1L 3K2UH 4QO1A 5BRPA 5JOPE 2XN9E 4GRLD 4U1GB 3UYOD 2ZUWA 2BIQA 2Z31B 3QEQE 3VJ6B 3PABA 1T5XA 2FHBA 1MRFL 1SMDA 4KUZH 5TDOB 4ONGH 3JWDL 1M1XB 4G8GB 3B2DC 2BP0A 5HJ3B 2XIBA 4KHXL 3DBXB 1HEHC 1P84K 4MNHB 4UUJA 5DJ0A 1UD4A 4EOWH 2V9RA 4XN5A 2XXFA 4QT5A 5DT1L 3I6LE 1E6JH 1SLUA 4GAJL 2WLIA 2XN2A 1UWGL 4XC3H 3VFNA 1FO0H 4M6NL 4C54A 4YO0A 1HDMA 3CFUA 3STZB 4FXGC 1TMQA 4Y16B 3IETA 2F7IA 3E38A 4P2AA 1XF4B 5AAWA 4EUPG 1KPVA 2JK5A 3QUZD 3VGAC 1A1OA 3ZW3A 1RVFH 1YMMB 3EO0B 1IE4A 4DGVH 1UURA 1NAMB 5DS1A 3MV9D 1XR8B 1CF8L 3PHOA 2DQMA 3QQ9C 4W70A 5D7SH 3UIYA 4LCIH 4KMTL 4U0RB 4F7KA 3UTTE 4ZMQA 2FIKA 4EZMA 2QKIC 3QEHB 2XNAB 3LRSA 35C8L 2A5UA 1KDJA 3U7YL 3VRJA 2V2WA 3I3EA 4UB0L 4B3VA 3BWAB 1M3JA 4JHVA 1D9KA 1FGVH 2BCMA 1M7DA 3DIDA 3RWGB 3F83A 3L7EA 3SPVA 1NIBA 2FUQA 4HUUB 2EYTB 5F1OB 1UZ6E 2O61A 5CLXA 4PP1C 4AYMC 3FRPA 5CN3A 2M1KA 3P73A 3GJFB 3EBHA 2MOGA 1MFVA 4GRWF 4KK9C 4ENZA 5KS9B 4DK5A 4N1EA 2BVOB 3GZKA 3DV6A 4KKQA 2BOBA 3KS0J 3A24A 3F7YA 2IANE 3HMXA 4LCCB 5TH2A 3WFCL 2V17H 1E2VA 4YBQD 3MJWA 4I0PB 2CK0L 1I9RH 3ZE0F 2TSBA 4C56D 5T3XH 3ILQC 5F9JA 1ASQA 2VRQA 5F9AC 1S7QB 2VLJA 3L7EB 4FQLL 5IMOA 4GS7C 2KMWA 5T1LA 1INQB 2LE9A 1QBLL 2JI1A 2PR9A 4OGAC 3TEYA 4GFTB 4PP2A 4PQXA 3QDJE 1JIBA 3ZZ1A 3RIFF 3U7YH 2A4ZA 2DTSA 5D5MA 1GZQA 2AJSH 4QAMB 3AT8A 1C1EL 4NKOA 2IAMB 1KCRL 1J8HE 4AIOA 3H9SA 4I4WA 4UINL 2IANA 3O3BA 5FUCE 1R46A 3V6OE 1QTSA 4LNVA 3LQZA 4PJ5A 4GKSB 2F0CA 4OFKA 1P1VA 4OUUA 3O2DL 1MEXH 4Q7DA 3QR2A 5EUOE 3KDMB 3STLA 1F3RB 4H13C 3P3TA 4N5UA 1ZSDA 4J6RH 5EIVA 1YEWA 4QRBA 4FQIH 4JFXB 1XAKA 4TUJB 1B3JA 4KNSA 2YAPA 3LKNB 5DURD 1SGKA 1MCCA 3IETB 3AUVA 5I1LA 1IC4L 3OKNB 4LLVB 5E4EB 4CSTA 2VAJA 4HU2A 5B39A 4X99B 4QKTA 1MCDA 3DSFH 1WFMA 3LEYH 4PTTB 5GGSY 4P4KB 4QXTB 4K7PL 4DW2L 1N64H 4WEBH 2IQ9H 2F68X 4NC0B 3P4NB 4IRSD 1JRHL 4WUUD 1DQTA 3L4TA 3OAYK 1O9ZA 2KH2B 3ILDA 4KKAC 5KW9L 4I77L 3ALWA 4JQIA 4HFWB 1QWHA 4HSCX 4JO1L 4QDGA 3NA9L 1AH1A 2NTFB 4MA7H 3QORC 2OL3H 4KK8C 4XMVA 1IEHA 3GF8A 1CDYA 4U1SA 4PW3A 1XR9B 1R0AL 4JVPA 3TA3D 2R23B 3DYOA 5LBGA 4NDMA 3FOLB 1UG9A 5EC1B 3SPHA 1J0HA 3ML9A 3UYRL 3MRLA 1B2YA 3HRZA 2A4EA 5CILL 4UM9D 2VZUA 2LR4A 3V4VH 4KJYB 3STLB 1G0XA 4QTIH 43CAB 4FD0A 2CIIA 2EDDA 4ZW3A 4FLRA 3ARQA 4RFOL 2X4QB 3BP4B 3G6JA 1ZVSB 4FQXB 3RBGA 2CQVA 1N5AA 3G6AA 3M1BB 4YGVA 5TE4L 3HR6A 4NI3A 1DVZA 1AD0B 1FSKC 3IXTB 3CX2A 3MRBB 3WDIA 5TGBB 4BZYA 5I1GH 1INQA 3NH7L 4MCMA 4YHIA 1OWRM 2EVHA 1S6NA 3R4DA 2VZOA 1NSNH 4XP9H 1N3NA 3WY2A 3O8XD 2HH0H 4HOXA 3QULA 2ADGB 2IPKB 3VYPA 2OL3A 1F4AA 2V9QA 3UTTB 3VSTA 2HJKB 1FF5A 3UGEA 4BZ2L 3DPBB 4UTAA 3U4KA 5GJSH 1SBBA 4KTGA 4AWJC 4MAYD 1QP1A 3G6AB 3LD8B 1LNUA 1QLRB 4EZKA 3NABL 3MJ9L 3K71A 3MTXA 2VDKL 5FA4B 4PJXA 4HVBA 4D9RE 1PD6A 2VR6A 3WFBH 2ZX6A 2EJ1A 1OZUA 3WUZA 2J8UE 4OQTH 3LKSA 1TEGA 1M6OA 5EEZA 4HYTB 3DK0A 1HOCA 4FG6C 3SGEI 4MJ5A 1EBPA 2GBTA 2LU5A 1ZOXA 3KS0H 1M6UA 3S9DB 5BZDB 2EDBA 3EOYG 1FAKT 3T0ED 3V4UL 1BQRA 5KBDA 5J1TC 2PR4L 4O2EB 5HYEA 3MOQA 1I8LA 2H8PB 4L29B 3KPTA 5FA4A 2H2PC 2APBA 2GBAA 2WQAA 3IK2A 1HL9A 3KYMB 4NXSA 2IH1A 2CDFB 2FEEI 3HN8A 1CXLA 3K5SA 1HZHL 2LT9A 3KW8A 1E9PA 2F61A 3K1DA 4I3SH 3FAWA 4ZOEA 3QYMA 2XN9B 4AKPA 4GUPA 4BSVA 1HKFA 1GYCA 3RY5A 2KKQA 2PXYB 2C3WA 4JM4H 4F7MA 3VD2A 1HTYA 1WICA 2ICWJ 2KYIA 1AO7A 5IZ7A 3KPNB 4P04A 1K8IB 4OUOA 4DEWA 4O2FB 3BIKA 2J6EA 4KI5D 1QLEH 2MCG1 3LQAH 5H37H 1EGJL 5IK3B 1V55B 2O26U 3QXTA 2IALA 1M71A 1I9IH 3OKEA 3RKPA 3ATBA 3Q1SH 4P07A 2PWHA 1HVXA 1EFXB 1I7TB 4ELKB 4C8XA 1XHHA 2FD6L 4G7QB 4V11A 1HZLA 3B8YA 3V8CA 1F2QA 1B2WH 3RWFB 3NCBB 1PY0A 1BF8A 4GAGL 2C3GA 1G84A 1BZ7A 2GHZA 1GW0A 3ZT5A 4IBLT 1HCZA 1KIQB 3QI9B 5I1KH 3IAGC 2CJSA 3VE0B 2R1XA 2X88A 4APXB 2WWKO 1N9PA 3AADB 3HE6A 3KLKA 3KLDA 5KSBB 1BZQK 2J8HA 3OTTA 1WWBX 4HHAB 5AVRB 1ZXKA 5BW7A 2NY3C 5EZIL 1COBA 1VB9A 3BFWA 2FT7A 1CIUA 4LLUB 4LPXA 3PXLA 4R0LB 1BOGB 3BP5B 4R7DA 2XN9A 5CEYA 2YZ1A 2L0DA 2IMNA 2QR0A 2VDKB 4M7KL 3RFZA 2ZSVA 3JWDH 4NCDA 1N64L 1J88A 4AK1A 3EG9B 3HG2A 1PAMA 2FD6H 4LPTA 4ORZC 4APXA 1WYJA 4HHWA 1SY6H 3IMUA 4C57C 2ITDB 4KMLB 4OT1L 1ZHLA 4G3YL 3OPZH 4RETB 1OAZH 3QXUA 1UD8A 4JG5A 4JFQA 5ALCL 5BMFL 2AVFA 3HNTL 3C8KB 3MV11 2ADFH 1H15B 2DJSA 5A3ID 5I30H 3NCXA 4OTXH 2ISDA 4DP7X 1NMBH 4NCC1 3E2HC 3SPIA 3QFDB 1NWPA 1G7QB 1PKOA 2NXYB 2OMWA 4QXVA 5E94B 4ZBJA 2BNRA 1A6PA 3I6KA 4UNTA 4JPWH 3ULVE 2QTEA 4NO3B 1H3XA 4EI6A 3BGAA 4GXUM 4QTHB 4X7TB 4UOJA 1D7DA 4DGVL 5AAMC 3LXBA 5IF0B 1FG2B 1GGTA 3VU2A 1CS6A 2XV3A 2Z34A 4N8UA 4FMVA 5F96L 2ZUQB 2OQJA 5CLWA 5FWRA 1WV7T 4LPYA 3AM8A 4CGUB 3IWUA 3FSWA 15C8L 2RD0A 4K3HA 4FXLA 3OKMA 4N0UA 4GG8A 5D6CA 1UT9A 3MNZA 3E0GA 2XWZA 3CH1A 2X4OA 4YDLB 1YEIH 2DQHH 3B7SA 2ZP8A 3V6ZB 1Y6KR 1DANU 4QJ4B 3W38A 3DUHA 4ELME 3RUGE 2CJUL 1S5HA 3SBPA 3TCLB 4LEEA 4Z78A 2APTA 1AD9B 4KXZH 1BVZA 1D6EA 3MX0B 4UDUB 5I1AB 4HH9B 2OK0L 3FU8A 4PD4J 4EVNA 1RPUA 2FVNA 3MLTA 4FULA 3RJOA 3MCG1 2WTOA 1IAIM 4JY6B 1T6BX 1ITBB 1G9NH 1I8KA 1X7TA 2OJZH 3DA0A 1RHHB 4JNXA 5DVMA 3UTSE 4PJ9D 4TUKH 5E6YA 2WXMA 1IGYA 2CALA 3Q44A 4IDJH 5SWZD 5HPMB 1J48A 2GJ6B 4AZ8B 1BMWA 1T7WA 4WU5B 4WTQA 1A8JH 3S34H 5F7KC 3W11D 3ENEA 2DN7A 3T2PA 4JFEE 2XUWA 3FCSB 2Y72A 4LIQE 1WA2X 2UXFA 4QKXB 3QQ4A 4NWTH 5CXPA 1QFUH 5AZ2H 1TF4A 1YNLL 2R56L 1R34A 2DS4A 4NZUH 2WKOF 1KB5A 1F02I 1MFEL 4JO4L 2NZ9D 4N8VB 5DLMH 4RRPA 4N3TA 4WUKH 1I7RB 4ODXA 4QIRA 1ETZA 2Y06L 5GGUA 4A2EA 2H1LM 1BZ8A 1HXMB 4PS7A 4G9DB 3UC2A 3FT1A 1X5XA 3RGHA 5AAMA 2ENQA 3OAYH 4KITB 2B2XH 2A83A 3FT3A 3UJJH 4I3SL 4ZQTA 2YSSA 4U1JA 2OK0H 2OYPA 1TG8A 3QJQB 2Z65C 2J1XA 2ZYSA 1RP9A 2O30A 5J9PA 3IE9A 4KMQA 3NJLA 4NB7A 4Z7QE 2IOMA 1TQCC 4XOCA 4Z23A 1EPFA 2Y1VA 3MLWL 3CDZB 5F9OH 4RCAA 1MCBA 1AOHA 4BJLA 4ETQA 1NGWB 1N18A 5HI4C 1T0PB 1RZFL 4IOFC 5DMJB 2K70A 5E8OB 4ANWA 1BX2B 1YEGL 4PG2C 4RX4A 2J72A 3GSNL 3S35L 2QZQA 4XCNB 4AVJA 5B22A 2VO5A 3ZL1A 3EFOB 2ZCKH 1TETL 1CLCA 1ZRUA 3BAJA 3PUCA 4GG8B 1FL6A 2W9LA 1A47A 2ZUYA 5HHNA 4QRTB 3MRIB 3HG1D 4F7TB 3QRFM 1BP3B 5GGTA 2DRUA 3G08B 3MROB 2F9BT 2YHGA 5C08B 1L5GB 3L1EA 4I13B 1HOEA 3EOTL 2Y9RT 1EAQA 5C3IA 4G11A 2GEQA 4J3SA 2X0VA 1NAMH 5AZUA 1C5DB 2X1QA 5F3HB 1NCDH 8FABA 1Q0XH 1K8DA 3UEQA 1TTUA 3MBWB 1E3ZA 1YUKB 2X4NB 1C8PA 4X0NA 1KZQA 3IDGA 4HALA 1QPXA 2BW4A 5C71A 4FQCH 1KN2H 2D8KA 1HS6A 3FUNA 5LGHL 3HG4A 2D7MA 1WCQA 4JHZA 4ZUSB 5K93A 3TBTB 2EEDA 1UHVA 1G5AA 2VW6A 3V7AG 5EDXA 3H6AA 4YSUA 4N6QA 4JJ5B 1OGAB 4LGPB 1R5WA 3STBA 3KXFE 4Q9RH 2ILLA 4L3EB 4QJ3B 5KVEH 5C09D 3KJ4C 4JRXB 1OE2A 4ALAL 3PWPA 3EJCA 1CLOH 1A6ZB 2VDPH 5C2UB 8CGTA 3GI8H 4XAWH 1KJ2B 2W8CA 3ZQ9A 1K4CA 1MW0A 3VFSB 1PZBA 2EIEA 1A64A 3OGCA 2P8LB 5BO1L 3ZO9A 3O9WB 1V8HA 2V6HA 4NO0A 4FG4A 2QTVA 2HKFH 3GS4A 3SE6A 3T0BA 4PJ5E 4A2GA 4K9EL 2ZNXA 4UDTB 2CGYA 5LBSA 1UWXK 1PDKA 1ZEAH 1OV8A 1HHHB 4NQCD 4XX1E 8FABB 5KSBE 1TVHB 3CG8A 3UPRB 3RDJA 4ZFGH 3FS9A 2GAZB 2VN3A 1U30A 3LXAA 2EXYC 3TN0B 4IK7A 5DQDH 7FABL 2ERJB 2PTTA 4XGZB 3RWEB 5M95B 4NM8H 2FLRT 3FH7A 4Y1AA 4AVIA 5B38A 1UGKA 1BMZA 1HC1A 3LHPH 3JTTB 2CNZA 1E4JA 1V7NH 3MMEA 4F8QA 3SKOB 4UQ3A 2NY2D 1EAOA 2HVBA 4J8RA 4F20A 2WBJA 1A6TB 1S78D 2Z93B 2Y4SA 4PGJA 5H2BA 3D3VD 5LQBH 5D1QC 1CBVH 2EUVA 4I8DA 4PJDF 4NZ8A 3T65B 5KZCB 2ZOKB 1UXWA 2HLAB 4KNQA 4QRPA 4OCRL 1Z3GL 4AX3A 4OKDA 4XPFL 5AVUB 5BRZD 4Q9BA 2R0WH 3MV8D 3ZYZA 4UMGA 2AI0H 3T9WA 1CG9B 3D0LA 3MBWA 1ZGLP 2WSDA 3DOSB 4PU2A 4UBDD 2F5AH 2F74A 3AS0A 1DLFH 3DUUB 1XEDA 2YAOA 1ULVA 5CD5D 3WFCH 2ICWA 5BZXA 1AKJB 4Z3JA 5FB8B 3T77B 4L37A 2MHAA 2IAMA 5TE7L 3BVTA 5F2FA 4G7VH 5D7EA 1JK8A 2AC0A 2R69A 3UP6A 3BPCB 5C7ZA 1CYWA 3VFUA 3MLWH 3OHXA 1XF4A 1BPVA 5KBMA 3SDAC 3EHBD 3WXWL 4WO4C 1OAQL 5DUPH 1W72H 1FVCA 2P26A 3PWPB 1GTFA 4U6XA 5EZPA 3ULSA 1MIEH 4CVUA 2KPNA 2Y7LA 3EYOA 5IW1B 1PJ9A 2VMEA 3GYRA 3SE4A 4K7PX 5DCCA 2MPAL 3IDIA 3SYCA 3IWVA 3K4DA 4MAZA 2UZYB 3FMGH 4IJTA 5I8OL 3O9WA 1ZGLA 1L7IL 3BN9D 5J89A 3CMOL 4L8DB 3HZVA 3C6EA 3FO0H 4OD2B 5C9JB 3QIUD 3ZRFC 4F37K 4FZ8H 2UWEE 4XR8C 4QXTA 5K9KA 2P47B 1TU2B 1QRKA 5CIPH 4A39A 1RURH 5IQ9B 5MENE 3KPRE 3WAJA 4WJ5A 5C3LD 3Q8AA 4EBQL 1D7BA 1KDIA 2V5TA 1J1XL 3IDYB 5EEXA 3DX8B 4C58B 3ZDZF 4XO5A 4ERSL 1IFHH 1HQRA 4OIBA 4W1TA 3D30A 5HSFA 1NGQH 1KACB 4HFWA 2VUKA 1QO3A 2NUPB 2WANA 3EDJA 3CFEB 1VHPA 3E6HA 3U30B 2AP2A 4JRYA 4PJAF 2VERA 3UERA 4GEJA 3C2AL 4JW3A 2J8UB 4L37B 2WB1A 3QZBA 2ZOLA 2JFCA 1E90A 4Q89A 3ESUF 2IQ9L 2KT6A 1IEAB 4XP6L 1KPUA 1G7IA 5EOQL 1HI6A 1S9VB 3HPJB 1OGTA 5DUBB 2O5YL 2Z1KA 5EUOA 1MAKA 4O4YL 3DHJA 3OJMB 4MKMA 1QBMH 2VM3A 4YUEL 1RK1A 2APSA 1ZVSA 1IEBB 3LYRA 5K9QG 2ZYRA 5ISZD 2OL3L 3WTXA 1E2WA 3D0LB 4NGHL 1Q0YL 1ZE3H 3FTVA 4B95C 1M6OB 1D6VL 4M6OH 3R8BB 4E41A 4BKLA 1UADC 3KYOB 4L8DA 4UOZA 1TQCB 4MA8H 1CLYL 1MXDA 5I6KA 3GKZA 2V7NB 3GHPA 4O02L 1AZCA 3MA9L 3D7PA 1E27B 1THCA 5DVPA 3ARFA 4OFPA 1A1MA 4UCFA 5H4ZA 3F04A 4DKAA 4H25A 5KVFE 5IROD 5CGYD 1PBYA 2IXQA 4HBCH 4X5LA 4XNMB 2YWZA 4YNYB 5FK9A 4MDIA 3ZMEA 5I1CL 1DYZA 4S1RH 4GW1A 2CO1A 4WW2F 1QVOB 3VGHA 5L4JA 4JO4H 4Y88A 1M7DB 4X80L 2VXVH 1DUZA 5IMLB 3TFBA 3B5GA 1XV8A 4KZCA 4TVSa 3EADA 1NUFA 3PAYA 4AIZB 1XXFC 5G5DB 1ADQL 5IVXA 1WBXB 4LRNL 1RIHL 4FQJL 4L1SA 2L7EA 5TDNA 1TZOA 2VXSL 3QAQA 3C08H 2NY7H 1M2VB 1P1ZB 3T0VA 2IDTA 2MKLC 4MMXA 1FDLL 2A6KA 4MNQA 4XN1A 2GSIB 4G6JH 3QUXB 1NQBA 5MENA 2AZAA 4NUPA 4UV7H 4NDMB 4YBLC 2R2HB 3KYOA 4JM2D 4M6NH 5GS1B 4X8XA 3LS4H 3BKCH 3QRGL 4U1GC 5GS3A 1YAZA 4JAMB 4OCMC 4U1MB 3V4UH 3VWKC 3VXQA 4P23C 4C4UA 3BD5A 4U6YB 4NRXA 5E70A 5IB3A 2X4QA 4HGMA 4HT1H 5MI0C 3BP4A 3G6JB 4HJEA 1F11A 3NRQA 4GBXD 4C83B 2PP8A 4JRYD 1U93A 2GTZB 2W60A 4W4OA 1G1OA 5KS9E 2EDEA 3L4YA 1EWHA 4P9ML 3UROR 1C9SA 3GHBL 4O9HL 1VENA 4X6EB 3KDMA 1U58A 5JW4N 1NBYA 1OLZA 1BJ1H 2I60H 2W9EH 3ZKQD 1NMCB 4KKNA 1BF5A 5DC4B 4JR9L 1EQWA 3RAJH 2VDOB 2E5EA 1FGVL 1M57B 1TLMA 3TV8A 3BVUA 4M6MH 5IHBA 4FOMA 4C55A 4FGMA 3LKNA 3CFKB 4XNBA 3TZVC 1RZIB 2EYRB 4B5ZA 5I2IB 5HHOE 3UC0L 1JV2A 2BSEA 4FJYA 4S1QH 2CO7B 4IMKC 4Z7NE 3DX7B 1HSBB 1D5IH 4RGNC 1DR9A 3MUZ1 3QRGH 1MG3C 5IV2A 2GK2A 2YR3A 4KRPC 2YRLA 3QJZA 1U8LA 4ELMA 4NQCE 1Q1JL 3ZYJA 4TSAL 1I9RL 1XD0A 1XTMA 4FQCL 4M7JL 1J8KA 2DM7A 3KJ6H 4A6YA 4F1ZA 1X5ZA 2FSDA 3L3HA 3T3PE 1WAEA 5I5RA 4MLIA 5B7FA 5D1QE 4NZTH 3C60A 2P43B 2OTWB 1IC7H 3CFKA 2E46A 1JK9B 4NPYB 4LCUA 4B96A 4YBHA 1I7UA 4Y2DB 2V8LA 1OP5K 5B4MC 2JI2A 2XRAL 3EYUH 5E5UB 5EBLA 5DD3H 3QDAA 4DVBB 5AUMB 2AITA 1WEJL 4QOKA 2GTQA 3LZLA 4L1DA 4MQXC 3OQRA 1YJDC 3KW7A 1KLUB 5FR3A 4X6DF 1JSYA 1ZVHA 5F7YC 2UZIL 3FU0A 4HEMA 4NPYA 3EJZD 1I1CA 3KCPA 5E1QA 5EBLB 3OKKA 1N5AB 3E1F1 3M1BA 5ERWB 4XP6H 1J1OH 2DLEA 2UY6B 4JRXE 1ZWIB 3VXUB 1UEMA 2CKBH 2ZXGA 5DD1H 5D2LE 4JPIB 5C07E 3CVIH 4HIQA 5C0BB 3D33A 3LN5B 5C0CB 4FI8A 3B7UX 2O1AA 2HWZH 2OL3B 3HG3A 3QGVA 4J6IA 3L48A 4OGQC 2XXMB 1TVBA 4JS7A 3H9HB 2CPUA 4DKFL 4S1DC 3HTLX 3NN8A 4WRLA 2ZJSH 3TNMA 5F0MB 5HPMA 1A7PH 2V5MA 4CL7A 1FGNL 3S3JA 3W5NA 3D25A 2H6PB 1XF5A 4P46B 1ORQB 1E7UA 1P69B 5J06A 5T3XE 1P4UA 3HKZA 1CXIA 5KTEL 2DEWX 4JY4B 1U92A 4KKCD 1SHXA 3AS3A 4MZIA 3QUML 4AJ0A 2F7OA 5E1HB 1NM4A 1PTZA 1YJDH 1PY4A 3MI6A 3NDZE 1XH0A 4K8RC 3BW9A 1X5LA 2WHVA 3N55A 4S11A 4L4VE 3OSVA 1KCUH 3V9CA 3BUDA 3ZMNA 4M1GH 5GISL 5JW3H 1CXHA 2YD8A 3BN3B 2J4WL 1P53A 4ZQKB 4GXVL 1BVLA 4NWUH 1LO4L 2VAAB 1HNYA 3EYVB 4LQFL 4E5XB 3RVUC 2LOEA 4LT7A 2FX9H 1CT8A 1U8MA 5JW5B 3S8WA 5L2JA 3GMRB 4KY2A 3KGRA 3F01A 4N1HB 3RWFA 1BQHB 2YWYA 1Y7VA 3JXAA 1FE8H 4H26A 4MNGE 3AXLB 4UOW1 3UZVB 3VSVA 3V0FA 3VQ2C 5EEVA 1ETZB 1Z9MA 2FUTA 1JVLA 2AKRA 4OIIL 2EICA 4NFDA 4K5OA 2Q8AL 3UDWA 4Q6IA 4L8BA 4ZQKA 4JFDB 1DVXA 1UT2A 3OMNB 5D93C 2UX7A 2P24A 3QA3B 1ZHKB 4TN9A 3U36A 3NQIA 3FB5B 2OMVA 3NEXA 5JPMB 2B39A 4MA1C 3WMQA 4ZPTA 2VDPB 3ELAT 3QDMD 2XPGB 3MRJB 5JW3L 5LN4A 1NOFA 3E9TA 1VFAA 4FQXC 3FUHA 3FSVA 3N0AA 2WINA 3KCPB 1FHGA 1OCRB 4YHLH 5EU6D 2R0KL 4OJFH 2QHRL 5JW4M 5J12B 3BT0A 4ETYA 1X5JA 3M1OA 5E4IA 4P2CG 4OSUH 1JGDA 5T1MB 2H0JA 4QRRE 4PJAE 2A2QT 3KWXA 1WAPA 2ED6A 5K1VA 3AGVA 2VMJA 4FQHB 2R7EA 3V5KA 4YXLL 5CZXD 3DUSA 3H9ZA 3BVVA 2PR4H 3MNWB 3GMQA 1GAFH 4DCQB 4LFHG 4Y4HA 4Z6AT 1T2XA 2EZ0C 3CFNA 1TNNA 2HJLB 2W92A 1BBDH 2O6DA 1NPNA 5ANMA 4EN3C 5C0ND 2ESVD 1A6AB 1I1FA 4ZFOB 2ROYA 5EZLB 3BKJH 2PYED 3QNZA 3O2DH 4FA8A 3RVXC 1QHPA 1SBSL 3CFIC 3LV3A 3RB5A 1ZLVK 4PSPA 2QGDA 1ZT1A 1ZS8A 2EEAA 3C5ZD 1HINL 3FB7B 4J27A 2QVFB 3O11A 1S7VA 5FV1L 3CQPA 3JWNH 1G9MH 4CSPA 4HWEH 2GSGA 1QNIA 1OALA 4MFHA 4HCRA 4J3OF 3VH8A 3V55A 4NKDB 4OZIA 4ZUUA 2BS9A 4IKLA 3P30L 4TUOA 5GGUB 3O3EA 1WEJH 5KUMA 5KVGL 3EBIA 1R5IB 1Z5HA 1VZHA 2A77H 1Y0LB 4OLZL 4TSBH 3WTUA 1YEJL 4FXKC 3FQWA 2PYEB 3VFTB 5KG9A 3L17A 5B4MD 3N06B 2XLLA 4HD9A 4ODBD 3UZQB 4GUCA 4PJGA 4BSWB 4B0MB 2XKUA 2ADJB 3ZDZB 1P7QD 1JD7A 2XZZA 2OAAA 2OSYA 5FV2A 4NQTA 4HHGA 3SYPA 5FHAH 1EUTA 3S98A 1F4XH 4FE9A 3V0VB 3VGFA 1LK3L 2CHDA 2P49B 4XBMA 4MCZA 5GZND 4J4PD 1QSFE 1IQWL 1DBBH 3VGEA 2P48B 3V6OC 3ASNB 2ZSWA 4U0QB 5E99H 3KLHC 2JV6A 1IL1A 4PJ6A 1TJIL 1XF3B 1C08B 2BVTA 1IB5A 4JDZA 4QYAA 1ORSB 1F58H 5DK2A 1KCSH 1AR1D 4MMZC 1OL0A 3D69B 1GR7A 2CHWA 3CMGA 1UQSA 3B2UC 3U1SL 1FL6B 5GZOC 1DVFB 2WP3T 2H2SC 1XBRA 1OAZL 1RHHA 2QQNH 4BUHA 4F33A 2X44D 2M26A 2H1PL 4BFEA 4MD0A 1VEMA 3NCEB 3QEQA 4CMHC 4MDRA 4I0CC 4FEMA 3CDGB 2HSIA 4UT7H 4YZFE 4C56B 3U6RB 3RL1A 2IC2A 2B9AA 3BGMA 3DJSA 4FA6A 5C0AE 2SEBB 3QI9D 4E9TA 1KGCD 3H9SD 3WJJC 5TH2B 1EHLL 2Q2EB 3II1A 3T4AA 4P57A 1SF5A 4ZFGL 5JHDA 1YYMH 3AWEA 4NQEB 3SGEH 2Y24A 2AW2A 1IKOP 4FS0A 1DP0A 1CLZH 1ZS8B 1AMYA 4MB3A 3A4EA 3U2IA 1YECL 3MRNB 3LB6D 5F1KC 2K6WA 1N7ML 4NHCH 2F58H 5DK0B 4J28A 4N2DA 3BH4A 4PJ9A 2IBZY 3WUWB 5L4FA 4OJDH 1MF2H 4ZNEA 3R7QA 3SDXE 2E3VA 5HI3C 2WNWA 4IW4C 3JV4B 4MVBD 2D7TH 1TOXA 1FNEA 2C1PB 4UT6H 1IBGL 3DO4A 4YHPA 2HT2C 4G2AA 4WHTB 3M88A 4WJG3 5I8EB 3REWA 3ZZSA 1BJ1J 3MRNA 3P4MB 3IPEA 3Q8EA 1URZA 2PF6A 1N8OE 1Z6JT 3U2JA 4HSQA 1H3TA 2JI3A 3NIDB 2WWMC 1Z3RA 3VCLB 4KHXH 4U6HA 4GMTL 3BUBA 3D50A 5CZVH 3RWJB 1ZPUA 4TMPA 2LGNA 5BRZB 2JJSA 2QGEA 3GSXB 3KG5A 3HN5A 1ZGLB 1H6FA 2R29L 3L1OH 5GSVA 1XH1A 3SB3A 2RB8A 5IP4A 2X4RA 1E5UI 4PJIE 3P3SA 1MJ8L 3ZDYE 4D9QE 1JWUB 1W0YT 3VGAB 2DIAA 4O58L 5AWNL 5A2FA 5ICZA 4ALAC 2FH6A 4EN2A 3DX6A 2EABA 4GO9A 1A9VA 4P2RB 2XZQL 3ZTJH 4X8JA 5IVXE 3AU0A 5TF0A 3QHZL 2NUPA 3FQUB 1JTPA 4M62L 2ZOKA 2I9TB 4W9FC 5CLTA 4NRZB 4YDZA 1K6QL 3X13B 2OJEB 4FX5A 1FNSH 4MNQE 4IOIA 4ADGA 4JPQA 4W4OC 3E3QC 1TUPA 4TM9A 2ZXDA 3L2MA 4V33A 3OKLA 3WHXA 3CNKA 3DETC 4FTVD 3T2NL 3VDAA 2Q86A 1INDL 4RZCB 2QPSA 3DETD 4WAFA 5HYSB 5D8JL 5DHVH 1J9QA 1PG7L 4G8IA 2OXHB 4LSRH 3IFOA 2E0PA 6FABH 2IGFL 5ALCH 5DHYA 1QLEB 5CNHA 1N6QH 1AYOA 1FZOA 3K2MC 4I9WE 2WXIA 4P99A 5D1ZC 3ZY7A 4W9LC 1EZUA 1OVZA 1UB5A 4LSQL 2R83A 4M7ZC 4LL1A 5F1SA 1ETA1 5BJTB 5F7NC 2R2BA 5IW3A 3GPEA 1HE8A 3QFGA 1UOWA 2ICES 3VFPB 1YEKH 1ZANH 1L6ZA 3BPOB 3QAZC 3DYPA 1EO8L 1XGYL 3RWEA 1WP6A 3EZ8A 3T1FB 2YBRA 4RDQF 1EEUA 4LLDA 3MJGX 4GBXB 5FW8A 3PGCB 2D31A 4OZHF 3Q6FA 5DVLA 4WWKC 2WKLA 4EXPX 3KNBA 5KBNC 4F2ME 5LGHH 3ZKND 4U1MA 4KGJA 1T21B 3CN2A 4PCSA 3WY3A 5DUJA 4Z7VE 1KEML 4XMLH 5CD5C 2IADA 3L3KB 4KNTA 2C9QA 3F58L 4PREB 1HXYB 1SUJA 3CBJB 3O41B 2HN7B 1N6QL 1YPZA 4LO9A 3A6BH 3MRPB 4ELMF 3FFCA 3D4CA 1T22A 2AV1A 4ABVA 3AWFA 3E6HB 2H3XC 3HG1B 2YFNA 3DOHA 3ABZA 3EH2A 1ZJAA 3WENA 3N42B 4OY9A 2P5EA 5GGSA 5F7MC 1JXKA 3I3BA 2Z92A 3M45A 5IOPB 2RMNA 5TK2A 4ACPA 5HI3D 3JWNE 3VNYA 1KLGB 4QOKD 1WF5A 2WIIA 3VFRA 4R7NB 4OD2A 2LVEA 4ZFQA 1CU4L 3NEOA 5DQJA 5FFOA 1KJVA 1PPIA 3VAEA 3TEUA 1RXLA 1H0DA 4KXCA 2V37A 3HCVA 2IDSA 4LSDA 5I1EL 3MRKA 1X7QB 5I17A 3LZRA 3PREA 2E8ZA 2J55A 4HG4K 4AEIL 3DDFA 2IBZX 1H5BA 1QSEE 2VYRE 1AI1L 1DJIA 2EYSA 4J3OH 3ZTDC 5FF6A 4EMZA 1NMAH 4MSWB 2EP6A 4OLYL 1GYAA 4XN9A 4L5FE 1KIQA 1NKOA 2BSRB 2Y1AA 4ORGB 4WI8A 2DQ6A 4NQVA 4YEFA 3OM3B 5F0JB 4AQZA 2IANB 3O3BB 2XA8L 4WW1B 2ZUTA 4A6YL 1U0QA 4NN5B 3FFCB 2ZXWB 4Y5VA 4K2UL 4TF4A 1P9MA 1AGEA 3QNYB 2BP8A 3HHSA 4QLRA 1JGEA 5JW4Q 3C75A 2R8SH 4YC2C 1I1YA 1Z9PA 1A4BA 4MJ6A 1FNFA 2J3SA 2WXNA 3F2LA 4JQVA 5AOIA 4G8FB 4LVNC 3U1QA 5D7LA 4ZPVA 1M7IA 2NY1C 1BZ7B 4PJFF 5IG7A 3FJTA 4FQ2H 4F3FA 1DFBH 4WO4A 5IIEB 3CZNA 1EEZA 3ARGD 4WW2A 4IBYA 3RLSA 5CD3B 3HNTH 3UTPD 5C2BH 3QHFL 2MEJB 3DROA 5EHFA 4AYGA 1MKFA 4ZDHB 2BY3A 4MGXA 2FR4A 1LK3H 4RDBA 1UFGA 4F27A 5D7LB 2EEBA 1N67A 3I6KB 2MNJB 3QUYD 4LESA 4X5RA 4POZC 4GSQA 1KEGH 3IJEA 4FABL 4HOWA 3BKYL 2EXTA 1FZKA 3QG6A 4JDTH 3NPZB 1KTLB 4NHUA 1S9YB 2AQ3A 4H4NA 7CGTA 2APVA 5A2IH 1ROWA 1BXVA 9PCYA 4PSRA 4W9DC 4ISVA 4JQVC 2XWTA 4B97A 1WGOA 2JIXD 4U6TA 4FLHA 1O6TA 2VDOH 2MTAA 3OBAA 3T5WA 2WXFA 3U4BH 3UPCA 5JOPD 4L5FL 4C4KO 2ITFA 1U36A 3GO1H 3SDDD 1JRHH 1GS7A 2AJYL 1T20B 4FP8H 1MRCL 2QKSA 1ZLUH 5EFIB 5GS1C 3FONA 3H85A 3LZPA 4IMKA 3HBQA 2VAAA 1EMTH 1IC5H 2BO0A 1OOWA 5MP6L 5J1SC 2QSTA 5D1QA 3RX9A 3O45A 1OQXA 3UEZA 3I6GA 2ZAIA 4P9HC 2ETWA 1HH6B 5JHBA 3QIWC 3GEFA 5MI0B 2WN3A 1G7JB 1XSOA 4WO4B 3P54A 3UYRH 2WGNB 3TBSB 4HZAA 1GW6A 4QEGA 1I9IL 3EGSA 4PRPD 2E47A 4H8VA 3ARFD 3HI5L 5CUSL 4E68A 1AXIB 1RZKH 2OMYA 4ATTA 2EZ0D 4PG9B 1XSIA 3U36B 3SGJC 3NGBC 4OB5L 4LSSL 2BDNL 3I6GB 5CZXC 5TE4H 1AGEB 2R1WA 3BQUB 5HD8C 3SJVE 2KERA 2AXWA 4KROC 5GGQL 5TQ0H 1MF2L 2I69A 3B3IB 3WEAA 1NIEA 5CINL 3SDCC 5HJBA 2X9XA 4KVCL 2PTUA 5LCVA 1A7QL 3AXHA 1H3WM 3RBSA 4BKSC 3U30C 3BIKB 1LO3H 1LWRA 2PCPB 3MN8A 4OCSH 1SHMA 4PJFE 1MWAB 3SQOH 4F7CB 1WQVT 2XXGA 4XCYA 1RZJC 2HYMA 5DHDA 1BLNB 2P8PB 3HHRB 4MNQD 2I9LA 3MV7A 4AZ8A 3QXDA 1HU8A 1U8PB 4N90E 4HK3N 1G9MC 1UWFA 2EDOA 1XIWB 4CSSA 4UILH 1B90A 4N87A 3V4LA 5B8CC 1S7UA 4QRSB 4NQED 2YD6A 3VXUA 4WFEE 4JRLA 4Q52A 3DMMD 4NYLA 4KJPD 1SYVB 4OFVA 3DLQR 5AB9A 2QQLH 2VZVA 3QG6B 4JO2L 2WINB 2WUCL 2XWCA 4JZNB 3WJLA 3X1NA 1F18A 3GZPA 1BX2A 2DEYX 4JMNA 1WG3A 3WLBB 4APQB 4BUGA 1NBZB 5E23A 1NEZA 4L1LA 3O4LA 1YQ2A 1BPLB 5IMMA 1TJGL 2ZOTA 4ZUWB 2G9HB 2WCGA 4QXGL 3FTGA 3U0PA 1NL0H 2DD8H 3E80A 1IGCL 2HTLC 4JHAL 4QRTA 2UXGA 2IVFC 2BHYA 4NKMB 5CCJA 2I7OA 3ZUCA 4ZX6A 3BUPA 1BECA 1JFHA 1FDLH 2ZCLH 3KBHE 5DTFA 3RJQB 4DFIA 5INDB 5M7QA 4MJIB 5KVFH 2X2YA 5D70L 5IR1A 1B0RA 1G7JA 4XPAL 5TE6H 1UVQB 1Q0XL 4AKOA 4P2OB 3D39E 4X5WA 1C1EH 1KCRH 1VGKB 4UQAA 4HWUA 1M4KA 3S2AA 1MIEL 1MHPH 3H2PA 5BS0E 3MRHB 2WXKA 3CN3A 4I0PA 2PPEA 4PW4A 2KS0A 1KTKE 1RJCA 4O00A 3FO9A 4X9YA 4JQIL 3BP7B 2CUMA 2GYSA 4HKZB 2KL6A 4ADIA 3PQYB 3NCFB 4PB0H 2DYSB 4WDIB 2A6DA 2CO6A 2ZSVB 1U3HD 2J6WA 5L4MA 1DFXA 2W0LA 3EYQC 4JM4L 4N2MA 4TSCH 2KLTA 4KO6A 4DZBB 2C34A 5D72L 3D6GA 3UAJD 2JKNA 4LK4A 4JMXA 5L2KA 1MFAH 5E2UL 5KJRH 4YQXH 5EU5B 3LPGA 2AQNA 1AXSB 5ISZB 2DPKA 2VDPL 4R26L 1B4LA 3Q05A 2K8QA 1S4IA 2CLVA 2LU4A 3KWWB 5FKAA 5SWSD 1CFVL 4UI2A 4G9FE 4ODSH 5C86A 3ZK0A 5IQMA 4M5YL 1GIGH 4XNXH 1PAZA 4PD4K 2C9UA 3OGOE 2BS8A 2BRQA 4BH7B 4BQ9A 1E6JL 3Q8CA 3FW6A 5D2NB 3HAEG 5ILTH 4ONHB 3HAEB 4M8VA 3CXHK 3FQTB 1WE5A 2V3EA 3IYLW 3OLGA 4A2FA 1QBML 4ICXA 4P2OA 5KYXB 1IC7L 1EAPA 2NXZC 4X5WB 4UT9H 1E8YA 3MLTB 4JPVH 3OHXC 5SV4A 1L9NA 4BZ2A 5ID1A 4NNYA 3EXLA 3QIBC 4A37A 5JQ6H 2OCJA 4FDWA 4CC4C 4DZ8A 3ARPA 1KV7A 1KPRA 1Z7JA 1R3LB 3E2HB 3K0YA 2P8MA 1SMAA 2DM2A 2JXMB 4OZFA 1FJ1B 3H2QA 3VXPA 4J3TA 1IGIH 2B5IB 4LEXL 5GS0H 1DQLL 1GKEA 3L2NA 1AJ7H 4KKPA 1VCAA