2EDHA

Solution structure of the pdz domain (3614- 3713 ) from human obscurin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGRTSAMLTVRALPIKFTEGLRNEEATEGATAVLRCELSKMAPVEWWKGHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLTVRAMPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Obscurin
publication title Solution structure of the PDZ domain ( 3614 - 3713 ) from human obscurin
rcsb
source organism Homo sapiens
total genus 13
structure length 113
sequence length 113
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edhA01
1G6RH 3WFEL 4Z7VE 3D0VA 3WD5H 5JQ6H 5BVJB 4U3HA 1I7RB 2P24B 5EULV 4LLYA 5D96C 5D7JA 4EKXA 4XCNB 4N9OB 4AENA 5SWZE 2IPUG 2BERA 5DVLA 3RWIA 3VXSA 2OR7A 4L3CB 4UOW1 4I0PC 4EOWH 1A3LH 3MRLA 4L4TB 3FOLA 5I15H 4WFGD 2J8UB 1SJHA 2X4SA 5HYSA 2Z9TA 5IMOA 3DXAE 1F4YH 2JIXD 3SKJH 1MELA 1TETL 3DSFL 1I9EA 1XF4A 5TE7L 4Q9BA 1JN6A 3OAYK 4QTHB 5B8CA 1Q72L 3ARFB 3MRFB 1FRGL 1MEXH 4FQ2H 2E6QA 5INDA 3IAGC 1U3JA 3OB0K 2IEPA 3FJTA 3DO7A 4E9LA 2YD3A 3QO1A 4MA8H 5GGTL 4BSWB 3S4SB 1I1RA 1MCOH 1F11A 4GJTB 1BQLL 4PRNA 1EAPA 3RTQB 2DM2A 1K6QL 2NR6D 1JV5B 1NQBA 4GLRH 1AI1H 2WWKT 1MCPL 3MLRH 5GHWL 5A16B 1INDL 4KXZI 5EIQA 3N06B 4IRSD 1RK0B 4FA8A 1YN6B 4OV5A 3FFCD 4JFFD 5I1EH 4I5BA 5FK9B 3OX8A 1VCAA 1Z3GH 4FQHB 4ODTH 4FFZL 1WFOA 3GK8L 3MX0A 3TV3H 3INUH 1P2CA 2VERN 4KQ3H 3FB7A 3B2VH 1XF2A 1H3WM 3UJJH 4GW5B 1XGRB 4YHZL 3C08L 3VFPA 4AEHL 4U6VH 4WGVB 1OT2A 1NCCL 3PQYA 4GRWE 4K23L 2VYRE 5ID1B 3BYYA 4LNVA 4ZUUA 2XZZA 1OT1A 1GOFA 2IQ9L 2FHBA 5KVMC 5HTSA 4HIHA 4ZO8A 1T3FB 3TBWA 1BFVH 5JNYB 5DMGD 3VGFA 4P9ML 1LO2L 1IAII 1OY3B 1A7OH 4OGYH 1BM3H 1U58A 4RMRA 2BSSB 3JV6A 3QXDA 1IAIL 1QNZH 2ARWA 1YEHH 1K8IA 1E4KA 4LF3B 1T04A 4DOHE 1NBYB 1KJVB 3U30C 1K8DA 4U1LB 3IDIB 5I1DB 2ZG2A 5DT1L 4OFYA 5F3HA 2VXSH 2D7PA 4G8GA 4NKDB 5FGBC 2EKSB 5I1GH 3ZDXE 3FB6A 3NACH 2QL1A 1FIEA 4XZUB 4DW2H 2PW1B 4HWBL 1KCUH 2NX5B 4Z7WF 1UADC 1YJDL 3AGVA 3OXRB 5K9JH 2XN9D 43CAB 5HHMD 2FSEB 4PV8A 3FTGB 3TJEL 4KKAD 1FVEB 2DKMA 1N5YL 1AY1H 4IS6B 1S7RB 4RAVA 1CE6A 2DBLH 4IIQA 3FO2B 1UA6H 2HJKA 3VI3F 3V2AR 2WIIB 1S7XA 3G5XB 5FOBB 1X5AA 4MD4B 4XP1H 3UTTE 4Z7WA 3U1SL 4YHPB 5FHAH 4QRQA 4N5EC 1UKSA 1YUHB 4DKEH 1GCFA 2NZ9C 3CUPB 3W0WA 4ETQB 3QFDB 4O58H 4X7TA 1XF1A 5FYLL 3WN5A 3DROB 3MUGB 4ELKA 4X99B 5DRWA 5F1KC 4ODHL 3K0WA 3Q6FB 4JR9L 2GY5A 4DZBB 3B5TA 4TUJA 2WUBH 2P5EB 4BH7A 2Y72A 3TLRA 1LGVA 5CJOH 5TDPB 4W4NA 2BC4A 3ZZ1A 1UM4L 3SGDH 1RAMA 3KLDA 1KGCE 2XQBL 3RIFK 3X3FH 5L2JB 4K7FB 2FO4A 3CK0H 2V9RA 4P23C 3QPXH 5C09B 4FQIH 1G6RL 1A9EA 3JWOH 2I27N 5E56A 3FN0L 3C5ZC 3H7BB 2FLRT 4XMKL 1J0HA 3HC4L 1MLBB 5F7DB 1AGFA 3QG6A 1G7LB 5CGMA 3PHQB 5DJ2A 3G6AA 3QUXD 3O3EB 4WFEE 3AXLB 3P11H 1ETZB 3HE6B 5CD3B 1WWAX 2A9NL 5HDOA 4LHUD 3QQ9D 3MRHB 4QRPD 4HBQA 3RKPA 1NC2D 3QA3B 3SKJL 5F7MC 4U7KA 2MHAB 4FTVA 4ZPTB 5FGSA 4Z95H 2FJGB 2GJZB 1M7XA 2FD6H 3EJZC 3LKNA 4ETYA 4NQVB 4KC3B 4CL7A 3QEGL 3TZVA 2VIRB 1AR1C 4ZXBA 1FNAA 2Z8VC 4YUEH 1DQDH 1H3XA 1U36A 1WFTA 1I1YB 5JW4N 1MIMH 4LCUA 3L5WB 5LGHL 2VABB 5HGBA 3JWDC 1JPSH 7FABL 4NT6B 4JEGB 4OCRH 4I0PD 1G7PA 4KV5F 1YMMB 2NNAA 3EZJB 5DRNA 4O9HH 4HH9A 1TLKA 2C1OB 3U2SB 2GAZA 1I85C 1HOCA 2GI7A 4RRPA 3NMEA 2A1WH 2P42B 3R0NA 4UV7H 1AXTL 4M3KB 2C7UB 2PR4H 4KRPB 5I1EL 2MCPH 4RX4A 3Q48A 3BH8B 4MLIA 4CN1A 3LHPH 2CKBL 3TV3L 1P7KB 5C0FB 2R56L 4KQ3L 3H9SD 1FL3B 5I8KL 4LAQH 1BJ1H 3HE7C 2J88H 1MH5A 1BOGB 4PREB 4U6VL 3D87B 3DXAD 2CDGA 1G1CA 3FQXB 2B8OT 3ZSSA 1MAJA 1KPRB 4JO1H 5D4QA 2VL5B 4CADB 4FQ1H 1F3DJ 2HWZH 1WC7A 4PGCB 4WUKH 3MBEC 1EO8L 1YMHB 5M7QA 1ZTXL 3HZKA 3KYKL 4HS8L 1ORQA 2D7MA 4X6FB 1YEKH 4OGYL 4JCLA 3QH3B 2J8OA 3G5ZB 1QNZL 3B3IA 4JRWA 4XBPB 4BZ1L 5KZCB 3HRZB 1T1WA 4V2BA 5ID0B 1NC4A 5DLMH 3ZKXB 1I9IL 1CLZH 3TA3C 4HFWA 3K8KA 1X5GA 4FQLH 3W11C 5D1QA 5E8NA 5EC2B 4R4FH 1R5IA 4JFXA 1CI5A 4QCIB 3HCVA 1KIQA 4X6CF 4WTXA 1J12A 1PW3A 1MF2H 5CJXC 3GEWB 4M7ZB 1AD0A 1KLGA 1W8NA 2UY6A 5I1JH 2MSPA 1D9KA 1KCUL 3B9EA 4QHUB 1W2KT 5L6YH 3KPOA 2KPNA 1F2XK 1TZIB 2IMMA 4ZNEE 3F62A 5K9JL 4G6KL 3DYMA 4Z78B 1AC6A 4X6CA 1DR9A 4N0FA 3CMOL 2OZ4L 4GT7A 5EIIA 2PW2B 2EYTA 5JW4R 2DBLL 3FQNA 4Y4FC 4K71B 5JR1H 2WLYA 5MHSE 4GKOA 1KOAA 4BKLB 4PRPB 5JORB 3QNYB 4UUJA 4XP1L 4ONFH 2NYYC 1R24B 2VLKB 3E6HB 1AP2A 3WEXB 4UI2A 2KUTA 2DQIH 3OKKB 3QEUA 5CLWA 3MROA 1FFQA 1U41A 2AQ1A 3KXFB 4O58L 5J6HA 5FA3B 3GIZH 5HHXL 1UM6H 2Q8BL 2HVKB 3GB7B 3K3QA 4WWKB 2Y23A 3EO1A 4O02L 2EXWC 1HXMB 5HYQA 3TO4B 4PY8I 5GGVH 2XKSA 3FHQA 5EIVA 3R8BB 3CD4A 3U36A 2GJ6E 4I18B 5DA4A 2ITDB 3KPNB 4S0SD 1TXKA 3X3FL 1YEFH 4JVUA 2C9AA 4N5ED 3KPPB 3WFBL 3QPXL 5T1LA 2D03H 3RDTB 4FQIL 2YD1A 5KS9B 1EV2E 2D0GA 3MV7E 5J1AA 2MTPA 1H3PH 2DYPD 3P4OB 5I73B 1GOHA 4NQUA 4OUUA 3BPLC 1LEKA 5JA8B 4M93B 4JRYD 2GFBA 2W07A 4PJEA 1KT2B 1ERNA 3G9VA 2DJUA 3GI8H 4XVUC 3IFLH 1MFEL 4O51B 4DCQB 2Q6WB 2EO9A 3NCYP 2OTWA 5AD0B 2VRAA 4X8JB 4P23D 2NXZC 3P40A 5HHVH 3WNPA 2J8UF 2P24A 4DZ8B 3BRDA 1KPVA 2FD6L 4OM1H 3C5ZD 3CXHK 4QRUB 3QCTL 2R1YB 3DIFB 3DPBA 2A9ML 4YUEL 4EI5A 3ZE2F 4HH8A 1NANH 4L3CA 4EBQH 4TNWF 5FYKE 4OCRL 3TWCH 1AJ7H 5D71L 4LFHG 2J8UA 1EGJA 4JFYB 5C1MB 4UU9B 1NMBH 1T0NB 3MNVB 4XPBH 1KGCD 3QT2A 5LXGL 3NOIA 3U0WH 4DKAA 1PG7L 1Z9MA 4JKPL 4X6DE 3QUZA 3G6DL 2BK8A 3BO8B 3MGTB 4WI5A 4QTHA 1YEEH 4HZAA 3MRFA 2WINA 1LK2B 1RJYB 3EJZD 3TNNB 1XEDA 2Y9RT 3WFCL 1BLNA 3LQAC 1EBAA 1AR1D 1P4BH 5D5MB 3S4SA 5F21B 5J06A 4WFED 1JJUA 3JV0A 3NPSC 3RTQA 3UYRH 2AJVH 5DJZB 1R3JB 1XH3B 1JV5A 2A6JB 5AUMB 2VMFA 2E6JA 4OCYH 1ZLUK 4M8QA 1CE1L 4F57H 4M7JL 1FCGA 3BEWB 1RK0A 4C56B 3ZT5A 4GG8B 1YN6A 1M6OB 1RU9H 1S5IH 2I5YH 4ACPA 3Q6GH 3NCEB 5FK9A 4Y4KA 2G5BB 3QWOB 2D4FA 2APXA 3ZHLA 1N0XH 1P9MC 4L3EB 1OQOA 4HJ0C 4XPHH 2Q87A 4FQJL 3KLSA 4P46D 4GW5A 3S37H 1DBML 1LEIB 1XGPB 3P4NB 3OJ2C 1XCQB 1F5WA 3HE7D 3I3EA 1L7IH 1OARH 1U0QA 1NCNA 4N8VG 3OKEB 4RFOH 1X6LA 4OSUL 1YN7B 4JY6B 4JZNB 1MF2L 3MBED 2W9DH 5JNYA 1OAQH 3MV01 4Y5XB 2P8LB 4JJHA 4NJAL 4CN6A 3TH2T 3D39A 4Y19D 3QBTB 3FB8B 3RFZC 4NIKB 1T66D 5SX4H 5AAWA 3FRPG 1NBYA 1ED3B 1KJVA 5F1OB 3TA3D 3HMXL 4U1LA 3IDIA 3O0RL 5I1DA 3W11D 1XR8B 1IBGH 1OGAD 1G84A 5C08D 4NKDA 2V7NB 2EKSA 4ODWB 5CEYA 4XZUA 3LRHA 2NX5A 1RZ7H 3L7EB 4UT6L 2AKRB 4JDTH 3QDJE 4CJ1A 3OXRA 4P59H 3ZHDA 1GPOL 2YD8A 4FP8L 2JELH 4IRJC 2FSEA 4MVBC 3FTGA 4WNQB 3IDUA 3D2UB 1S7RA 2Q7YB 2YUXA 3MV9E 2PTTB 2ZWLT 4Y4FD 2D9CA 2FH8A 2WIIA 2RCSH 5FOBA 4MD4A 4KDTA 4PYHA 5HGAB 3CZFB 3BWUC 5E94B 4XCFH 1K9TA 4FXGB 1GOGA 2NYYD 1YUHA 4Y2DA 2EH7H 4IOFC 5ITFB 3CUPA 1FFRA 2MNUA 2XI9A 4ETQA 4PJDE 2D03L 5F6IC 3DROA 3MUGA 2MPAL 2AQ2A 4X99A 5FUOL 3QO0B 4LAJH 5FOJA 4Y8DC 3Q6FA 4M1DL 3T0EE 2E6PA 2P5EA 3NCFB 2X1QA 3BJ91 2GK2A 2EXWD 3JVGA 1I7ZB 2IANB 4U49A 1EHLL 4K3GA 5TDPA 4HBCH 4JRXE 3LN9A 5DQ9A 4RGMB 4HKXB 4X0KB 4XNMB 1JNHB 5L2JA 4K7FA 4RZCB 1RHHA 1ZT4B 4QOKE 2NTFB 4MA1C 2W0KA 4JPKH 3H7BA 5JHLH 1GC1L 4YHYC 1FLTX 3MPCA 3SO3B 1MLBA 2AAVA 2P7TB 4G6JH 5F7DA 5C0ND 3T0EC 1G7LA 2F5BH 2XG5A 3PHQA 1VFOA 2V9TA 5D7LE 2NY2C 3AXLA 4EBQL 3HE6A 5CD3A 5JLZA 1CICC 3LS5H 3J7HA 2HT3C 1XGUB 1N64H 1J87A 4XVUD 5LJYH 3MRHA 2GJ6D 3IDXH 3G5YB 2F53B 3T0BA 5BV7H 3QA3A 4PJBB 1VKXA 3U0WL 5T3XH 4LL9A 1B9ZA 1RHFA 1F2QA 5E0QA 1GHFH 4ZPTA 2NXZD 5T1MA 1REIA 2GJZA 1UFUA 1VA9A 3MJ9A 4NQVA 3O41B 1RJLB 2VIRA 1W0VB 1FVDA 5EUKB 5EZOH 5DFWH 5D7SL 4YEEA 1I1YA 1R3KB 5ACMA 1J5OH 3L5WA 4TULH 1P4BL 5ECJE 2R8SH 4ZFFB 2F19H 4N8CH 1SBSL 4NT6A 1FAKT 1A21A 1G9NH 5FDWB 2IAMB 3V6OA 5DS8B 4RSVA 4G9FB 4LDOB 5DF0A 4DVRL 1CN4A 1EZVX 2AJVL 4J3VA 2C1OA 4UOW0 5TQ2H 5CZVH 3U2SA 5DC9B 3WL9A 3WS6A 3QXTA 5FM8A 3AS3A 4POYA 4OT1L 3GMPA 3FT3B 4F57L 3SQOH 1J10A 3BN9C 1CLCA 3L5IA 3AAZB 5F7FA 4NBZB 3CNKA 4RDQF 3EW3B 4LSQH 1PLGH 1T2XA 2YWZA 1N0LA 3BH8A 4NZTH 2W1NA 1NCAH 1EVTC 1CR9H 5C0FA 4OUOA 1OP3H 1IGML 5DD0H 2C3VB 2VUOA 1FO0B 4DGVH 1FL3A 5EOCL 1EGJH 4YHOH 4LEXL 2YSSB 3EOTH 1NAMB 3WNNA 3UO1H 1BOGA 1UENA 1OW0C 5ANMB 5AWNL 5LQBH 3FQXA 1OARL 2PYEB 3RIAK 1KPRA 5D6DA 3U7WL 5C07A 4YFLF 2VL5A 5IIEB 4ZS6D 2X4PB 4CADA 3LS4L 2ITCB 4RFOL 5D2LA 3RKDC 4PGCA 4LCYB 2BX5A 5JHDB 1YMHA 1OCWL 3NZ8B 2XWBB 4OLZH 4LSUH 1OAQL 2QQLH 1CZ8L 3QG7L 4X6FA 3QDGD 4C83B 3TCLB 2FO1A 4K9EL 1RZKC 2D7TH 4HJ0D 2B5IB 3G5ZA 3DV4B 4XBPA 4PGJA 2NY4B 3HRZA 4WWID 2R4RH 5ID0A 3BXNB 4EN3B 4X98A 1MFNA 2N7AA 1WEJH 4DGYL 5K9QG 3BIKA 4H1LG 5EC2A 5KW9H 4MD5B 3VGAB 1WT5C 5BZWB 3VXUA 3WFZA 1KEGL 3UTSD 1BMGA 3ZTNL 3P4MB 4PJ5E 2JJSC 4QHUA 4MCYA 5HHOD 2D31B 4ZTPL 1TZIA 2DM3A 1WVZA 5F71A 4XRCB 4Z78A 4R90H 4X4YB 2JELL 2VH5H 2A0LC 2PW2A 1CCZA 1NGXB 3RU8L 1C16B 3DWTA 3WNLA 3UDWA 1ZGLP 2CLVA 4BKLA 4BJLA 3VFOB 3UBXA 4LIQH 2RCSL 4Y89A 5JORA 3QNYA 4PTUB 1ZHKB 3GKZA 4RNRB 2EE3A 4HUUB 1R24A 4S1QH 4XCFL 4NN6B 3E6HA 1HHKB 2IGFL 5ICZB 4HEME 4BZYA 3OKKA 4B53A 2HFGH 3QQ3B 3QFJD 3KXFA 1JGLL 4R26L 5FA3A 1WZLA 1MAMH 3MV8D 3BKML 4HJJH 2DQCH 2VXTL 3NFPA 4IRJD 1ZVHA 4MVBD 1HXMA 2OMNA 2J12B 1MIEH 4P5TB 4Y5YB 3H42H 5KS9F 4HEPG 3OSKA 1KFAL 3D6GA 3BSZH 3RZCB 2E27H 4PRIB 2WBJC 4I18A 2VXUL 5B39G 1NPUA 1FCCA 5C92A 3KPNA 3JBG7 3GGWB 3KPPA 4IOFD 4JFQA 2IC2A 4DGIH 1AQDB 2PXYC 4XNZC 4R3SB 3SKOB 3MLPA 3TBSB 3C87A 1ZWIB 4PG9B 5J89A 3VU2A 2YUZA 4HQQH 5GRJH 4HPOH 2X7LB 3U4EA 2FBOJ 1BAFH 1KT2A 3QDHA 2Q7NA 3IU3A 1TJIH 4L8BB 4O51A 3GJEB 4DCQA 2Q6WA 3BJLA 4WHYH 3S8WA 3K7UA 4ZXBC 5LAXB 5BV7L 5AD0A 4JM4H 3IRPX 4ZUSA 5I1AB 3CPLB 4YHML 1GHFL 5TF1H 3QISA 4DZ8A 2R4SH 3W5MA 4QRUA 1XR9B 3O6FC 1YYML 2AK4B 5E6IB 4X9GA 3DIFA 1T83C 5EZOL 4PJ9B 2UZIH 4I4WB 4U1HB 5CJQL 5JIKA 1HCFX 3T0ED 2R8SL 2F19L 5D7IE 2AXJA 4A2LA 2NY2D 4YDIL 2VUYA 2H3NB 5FM5O 4LMQI 4PG2A 1U8QB 3KS0J 3OBAA 1CICD 1KLUB 4JRXD 1K2DB 4UU9A 2H6PB 1UWGH 2HT3D 5CZVL 4IDJH 1NH6A 2M26A 4O4YL 1RVFL 5D5MF 1Z6JT 3MGTA 1F90H 3BO8A 1FSKB 2KBGA 3OKMA 5HGGS 1LK2A 2D7QA 1RJYA 1J1OH 1UZ8B 1T21B 3S9DB 4GO6B 2BY2A 1PLGL 4PGZA 4KPHH 4HKJB 4NZTL 1EHNA 1CDHA 5CEZL 3V8OA 5D5MA 5C71A 1CWVA 4S1SH 5DD0L 4HXAL 1QSED 3VD3A 5CUSL 4ZOEA 4DGVL 2MOVA 1XCTB 3EDFA 3PWJB 4YJZL 4ZAKB 1R3JA 5HHQA 1XH3A 2HJLB 3AU1B 2A6JA 5L8LB 1N4XH 5AUMA 4PJAE 1UC6A 2AP2A 3BEWA 3FO0H 2ADFH 1TVBB 5E4EB 5KANG 4C56A 4I3RH 2YMXL 3MJ9H 3BN9D 4GKNB 1M6OA 3QNXB 3ULVF 3LEYL 4X6EA 2VDML 1QRKA 4QWWC 5KSAC 2V7HB 3UC0H 3QEQB 2G5BA 1IGFH 3QWOA 1SY6A 5CP7B 2XY2A 5CSBA 1TPXB 4Y5VC 3NH7L 1MREH 4L3EA 1O5DT 1YDPB 2VDKH 3PE9A 1RMFL 3U4BH 3ALPA 4NSKB 5D2NE 3GMQB 3VFRB 2AEPH 5H37H 1XGPA 3P4NA 1OP9A 4LNRB 2R4RL 4K94C 1KV3A 4RMUA 1WEJL 3OKEA 5BW7C 3OG4B 1OB1B 2Q3ZA 4QXUL 3VA6A 1UEMA 1FLRH 1YN7A 1INQB 1E6JH 4JY6A 5GRWA 4JZNA 3RKDD 2V5RA 2QBWA 5FYJD 4UNTA 2X41A 1N6UA 1YYLH 1JZ8A 4Y5XA 2P8LA 4DFIA 2X09A 4DTGH 4XVSL 4A6YB 1HHIB 3FB8A 4GKSB 3A6CL 5D2NC 4LPVA 1ED3A 3REVB 3ISWA 2FJFB 1RZJH 4QXGH 4ZDHB 1T80A 1IC4L 3DLQR 1I9RH 3L3OB 4NM4H 3MLYL 4ZTOL 7CGTA 1XR8A 2BOCB 4LIQL 3VFMB 2DI8A 3C09B 4WHTB 3T3ME 5EBWB 1X9QA 1I1FB 3DI3B 5F7WC 4DN3H 1U8HA 4ODWA 4WV1C 5IFHH 4GBXB 1KTDB 1KTKE 3VFTB 1RZGB 3L7EA 5J12C 2V6HA 4KI1A 5FGCE 3F58H 3HG1D 2DQCL 4KVNL 4WNQA 3A67L 4KI5E 1Z9SA 4R2GC 4CRPA 2R0LL 3D2UA 3P77B 4TSBH 1NGWB 1U95B 3BRGC 3H42L 2PTTA 3OZ9L 4ZUWB 2ARJB 12E8H 5J1SC 2B7DT 2OLDA 4HKZA 3CZFA 5T1DH 2VOTA 2UVEA 1YNLL 4F7MB 4FXGA 4U31A 2D3VA 5ITFA 1GGCH 2QADB 3QO0A 5DJCA 5EU6E 1G9NC 1J8HE 5DURD 1XGQB 3HNTL 2JB5L 1QSFB 4UAOB 3MRNB 2IANA 5GRJL 1BAFL 1C5DA 5C0BB 4PJIE 3SDXB 1MJUH 1TJIL 4HKXA 4X0KA 4XNMA 3IU4L 1KTLB 1F8TH 4RZCA 2B4CH 1ZT4A 5IBLC 1I9JH 4DVBB 1BQHB 5C0GB 5DI8B 5ISZA 2NTFA 1NFKA 4H88L 2PXYD 5TF1L 2R4SL 5EUOE 4QRRB 4PJBF 4D8PA 2P7TA 2UZIL 4RA3A 2WM0A 2ORBH 3EOYG 2YD5A 3QI9B 3QQ4B 3ARFC 1B6UA 1XGUA 1PEZA 1UWGL 2LQRA 3N1QC 5GGRB 5C2BH 3G5YA 4I3SH 4A2MA 3TZVD 4EIGB 3C8KB 4ZXBD 3CMGA 1R3HB 4TSCH 4J1UB 1A7BA 1F90L 4RMQA 2NW2B 5T3ZH 1KC5L 5SWSB 2FR4B 1A6VL 1G0DA 3O41A 1RJLA 2P4AB 5C0AB 3SDDB 1W0VA 3O6FD 3GBNH 4XNUH 4M1GH 3C60B 3I6GB 1R3KA 2Q76A 4NP4H 3SGEH 3NABH 3I3DA 4ZFFA 2V5TA 5AAMA 5GGRY 4S1SL 3W2DH 2IAMA 5FDWA 5DS8A 1JNNL 4YHLL 3FZUC 4MJIB 1BZQK 2ICWB 4LEOB 5I1HH 1P4IH 4RX4D 3BGMB 4K8RC 1FGVH 4MNHB 5L2KB 3FO0L 4OGXH 3AAZA 5FCUL 2WWMC 4B50A 1D5MB 3UTZB 1MJJA 2A6KB 1M7IB 4ZSOE 2K3TA 3VW3L 3VXMB 3RP1A 2C3VA 5DZLA 3IS0X 3PV6A 3WO3B 2VDKL 2EDEA 3U4BL 2QQNH 1RZFH 5JO5B 1NAMA 2X2YA 4G7VH 1PBYA 3GO1H 5DC4B 3E1F1 5ANMA 1ZAGA 4N1HB 4NWUH 4L9DA 2PYEA 4QHLB 4GAGH 3OPZH 2WUCL 2X4PA 4WO4B 2ITCA 2F8OA 4LQFL 5EBGA 4CVXB 1T7ZA 4LCYA 5JHDA 2XPGB 1E6JL 1VGEL 4NRXB 3SCMC 3NZ8A 2XWBA 5KSAD 1QP1A 2CGRL 2EIEA 4E0RB 1N7ML 1AO7B 4UOJA 4CVUA 3DBXA 4OD3H 4WW1B 2ZCKH 4C83A 3TCLA 3VGGA 3T09A 5DUBB 3IB4A 4DTGL 4JQVC 4PUBH 3SHSA 5DJYB 1ZV5A 5JMRA 3BXNA 4EN3A 5DHYB 1T7YA 4P2QE 4XXDB 1RZJL 1I9RL 5TFSH 5E2WH 1XF3B 4MD5A 3CLFH 5BZWA 5F8RC 1QRNE 1SYSB 1SY6H 3P4MA 3X12B 3O11B 1QLEL 1BF8A 1H3UA 3B9DA 2EC9U 4YFLI 5IVZB 2H32B 4XRCA 4AL8L 4X4YA 1A7QH 4H5SB 2IBZY 4NBYB 3NFSL 4JHAH 4KGLA 3ULVH 1E4XH 5EORH 2E7HA 4DKFH 4HZLB 4TSBL 3VRIB 3P9MA 3QDMA 3DX9B 4PTUA 1ZHKA 4OLWH 4KKBC 4RNRA 4DK6A 4HUUA 4ELMB 1K5NA 2GHWB 1U8NB 1JZ3A 3JUYA 4KZDH 5ICZA 3DJ9A 3KYOB 1IARB 4U6XB 1GGCL 1BEYH 3QQ3A 5I71C 3SE3C 2E9BA 4PBVC 4JFDA 1MHPH 4I0CC 2O61A 2N7BA 5EFIB 4R2GD 3FCTB 1AGDB 4Y5YA 2EKJA 3UBXI 3FFCB 4JFFB 4LU5H 3FT2B 4YDLB 3F7QA 3RZCA 4PRIA 3PP3H 4HGMA 4XAWL 4M9PA 2W0PA 3EYOA 1MJUL 4FZEL 1NGYB 1U3HA 4D9QE 1I7UB 1F8TL 3GGWA 3L3GB 4QXTB 5E2TL 5FYLE 2FGZA 6FABL 1AQDA 1ZANL 3MODH 5GISL 1WCQA 1YJDC 4R3SA 3SKOA 1OAXH 3TBSA 1WJ3A 1CDIA 1ZWIA 2AVGA 1I8LA 4NN7C 4PG9A 3L9RB 2E7BA 4X6BB 2FIRT 1F3RB 2XG4A 3MJGX 5T33H 4M7LH 3V52H 4C54A 4LOUC 1M71B 2X7LA 3FN9A 4U1KB 2ORBL 4ZYKB 2Z92B 1FG2B 1ZLWH 4L8BA 3SN6N 1D5ZB 3GJEA 1YPZB 4M6ML 2HKFH 1A4KA 1I1AB 1OAUH 3ARGC 5FECA 5I1AA 3MRBB 1L9NA 3CPLA 4AY0A 5GS2D 1DBJL 3F8UB 2VLJD 3AY4A 5HGHB 3TCXA 2R69H 1XR9A 3LEVH 3UAJC 2NY0B 4JFZH 1X7QB 2AK4A 1MCLA 5E6IA 4BFGA 4L4TD 5FKAB 1B0RB 3GBNL 4PJ9A 1DP0A 4U1HA 2EZ0C 4NP4L 4ZFOL 3WS6C 4OI7A 1U8PA 4EUPB 3QDAA 1RFDL 4OZIF 2H3NA 4YNYB 1U8QA 1KLUA 1LO4H 4NZRH 3MLXH 2H6PA 4JCMA 3ARFD 5CCKL 5LGJB 4JN2B 1P4IL 2JJVA 3EO9L 2DLTA 1J05B 5HHMB 1FGVL 2W91A 3NAAH 2AV1B 4NUJB 2ZCHH 4MAUH 1IL1A 4DWHA 4OGXL 1T2QL 4OZIA 3BUYB 3FOMB 1T21A 2A73A 2Z31C 1CG9B 2V17L 2RFXB 3HUJE 1DCLA 5I1KH 4NQEE 1H9VA 4HKJA 3MYJB 3WJJC 2HTLC 4PD4J 2AEQL 2ENYA 4Q0XL 3PNWB 4Q6IB 4CNIB 5EB9A 4MNQD 3HAEB 5INCB 5L7XH 5C9JB 1XCTA 4AQOA 4ZAKA 3GM0A 4G8EB 3FZUD 4UTBH 4PJXB 3GO1L 2HJLA 3GSRB 3AU1A 3E3QE 1FDLL 4M6AA 3I2CH 3KPSA 3WKNA 1CGWA 4K8RD 3JTTB 3HI5L 1TVBA 1INEH 4J3WA 5GS3A 5EA0H 4G43B 2WWMD 2V7HA 5CEXB 3QEQA 2QSQA 3DHJA 4BELD 3C5JB 4N1CA 3OG6B 3Q3GA 3VXTB 3VH8B 2Y06H 1YDPA 4HLJA 2WV3A 1O7VA 1SJXA 1JYVA 2X4TB 4CMHB 2XTJE 5BXFB 3FMGH 2AGJH 4U2YA 3GMQA 3VFRA 4APQB 3ULSA 2JK5B 3HB3C 1UXWB 4J2XA 4LNRA 2D0HA 4M7ZC 1DANU 1UT9A 5HPOA 1CT8B 1KNOA 4JY5L 3E3QC 2N56A 4FFYL 1AXIB 5D1XC 1EVUA 2NLJB 5TFSL 1OB1A 3ARUA 1D5BB 1INQA 3CLFL 3K80A 1KCSH 1ZHBA 3SCMD 4GW1B 4EJ1C 4OZGB 4LPTA 3CFBB 4UNVA 1SBBA 3O3AA 4LHUB 4K71C 2CIIB 1CFTB 4PYGA 4A6YA 4EXPX 1HHIA 3O6ML 1E4XI 4GKSA 2XTJC 4NZDA 1PX3A 3A0OA 3OQ3B 1MWAA 1YEGH 1NAMH 4ZD3H 4JHAL 3ULVL 5F8QC 4DAGH 1PKQA 1VADA 4NKQB 5EORL 2B4CC 3REVA 4G7YH 3GSXB 2FJFA 5HDLA 3ZMRA 4ZDHA 1Z2KA 1TZGH 1LVEA 3L3OA 2CO7B 5AEAA 3TGXA 3VFMA 2BOCA 3IFNH 4WHTA 4AQ1B 4OLWL 5EBWA 2HT2C 3DSNA 1DFBL 5LCVL 1T89A 1I1FA 4WWKC 4I0PB 1V7ML 3NIFE 4KK9C 4QHNB 4GBXA 1KTDA 3O2VH 3VFTA 1RZGA 5AZ2H 3TO4C 4LLUB 4UBDC 3PWPA 4HK0B 4E41E 5DQDH 2CDFA 4RMSA 1EFQA 4Z7VB 1MVUB 1NGWA 2OL3B 1U95A 2W9LA 5FYKU 4HW6A 1JYWA 3C8HA 5MENA 3RDTC 2R29H 4ZUWA 2ARJA 2D7NA 2YN5A 2APTA 1LILA 3WUWB 1D3CA 2NY1C 4HSQA 4GMSL 4KKBD 4F7MA 4NQCE 5C2UB 4Z5RA 2GTZA 4JPWH 2C5DC 4BQ6A 2NW3B 3LQZB 2OX5A 3U7YH 3SDXF 4OZFG 1G7QB 4WGWB 1L4IA 3DXAB 5IW6A 3WJLA 1XGQA 2CUMA 4QGYA 5HYEA 1EO7A 5BMFH 2DBJA 1QSFA 1L9MA 1QR1B 4M7LL 2AK1L 3MRNA 3UJIH 1P4LB 2WWKO 1AGCB 2IF7A 1MCWW 4JO2H 3SDXA 3ROLA 1EHXA 5C09D 4GMTL 1DBBL 3ULUF 1ZS8A 2ZOKB 2PF6A 1ODAA 2HKFL 4XC1H 1F3DH 5SV4A 4M5ZH 4DVBA 1BQHA 1GRWA 4PV9B 5C0GA 5DI8A 2H2SC 5SX5K 4HIXH 3IYLW 5I1IH 2FX8H 1O7SA 3BN3B 4J12A 3HZVB 1CGUA 2HP4A 4WUUD 4BFIB 4LOUD 5MEOA 4XTRC 1KPUA 2B1AH 2APBA 1QSZA 4FQCL 4M00A 3RWCB 5DFTA 3V0WH 3QQ4A 3MNZB 2BJML 2E8YA 4NZRL 3MLXL 4X5LA 2Q86B 5GGRA 4H0GA 3IS1X 3C8KA 1R3HA 5C0CE 1GSMA 4DN4H 4NKIH 4Q97A 5C0DA 4J1UA 2R0KL 4P2OA 4F7EB 2NW2A 2XZQH 4UT7H 5SWSA 4NM8L 2FR4A 2YEZB 5C0AA 3EZ8A 1AGBA 3SDDA 4RBPK 4WDIB 4Y88A 3UAJD 3U30B 3C60A 3I6GA 1YMMD 4GRWB 5CIPB 2OXGA 1CU4H 3DRQB 4EQ2A 5I1KL 3B6SA 3SE9H 4I13B 1LDPL 4R97C 3ZDYE 3LIZH 5FM4A 1NCUA 4MJIA 2ICWA 3RWEB 5DFVC 1NGQH 4Z7UE 5DWUH 3BGMA 3I2CL 4MNHA 2R39A 1BJ1J 3MZTA 4K2UH 4I9WD 5L2KA 1G9EA 2DJSA 4M48L 1LO3L 4P49A 5IVXE 1D5MA 3UTZA 4O2FB 4DOHB 1LO0H 2A6KA 1JIBA 1M7IA 3VXSE 2OP4H 3VXMA 1R0AH 1JF1B 4LSVL 5I16B 1Y6NR 4F9PA 2EEDA 5JO5A 2DN7A 1QBLL 4HIIB 4V1DD 4MD0A 1ADQL 5IVNA 5TH2A 2BVQB 3PWUB 4QHLA 2DYPB 4KRLB 4LSTH 4WO4A 5IMLB 1KXTB 3ZTJG 4CVXA 5HBBA 4WI4A 3HR5B 4X8XA 2FRGP 5GRVL 4OLVH 3MRKB 4PB0H 4WU7B 2AJUH 5DUML 1LEGB 3V4PH 4JHWH 4FXKB 4E0RA 2C1PA 1AO7A 2IPKB 4JVPA 3TBYB 5KZCD 2N1KA 1CVRA 4WW1A 3UTTB 3VRLF 4R4BB 5GRYA 4NHUB 5DUBA 3WNOA 5CD5C 1UH2A 2FX7H 4P23B 4P9HC 3G08B 2VAJA 5DJYA 3V4UH 4ZD3L 3HB3D 4DAGL 3PUCA 2H9GB 3C5ZB 2LVEA 3MXVH 4G7YL 4XXDA 2J2ZA 1TZGL 2XXMB 5D1XD 1XF3A 3RIFF 1ITCA 5DYOB 4TSAH 2YPLE 5HHNB 1SYSA 4Z77B 3IETB 1BD2E 3OKLA 3X12A 1DSFH 1HIML 5AZ2L 1RV6X 3MRCB 5IVZA 2B1HL 5L88L 4ELMF 2H32A 2IBBA 3KJ6L 2G5RA 3K81A 1CD0A 4PRPD 4EDXA 4HXBH 4HZLA 5ENWB 1FYTD 2VLKD 3PQYE 4E42B 5IG7A 3L5XL 4IOIB 3VRIA 3H0TB 1FNSH 1CQYA 2PYFB 5F3BB 5DD3H 1KBGH 4ELMA 4FNLH 1CFBA 4PRDB 1U8NA 2HT2D 4R7NB 3KYOA 4Q9QH 1A3RH 2DQGH 4U6XA 4WWKD 5EO0B 1J0IA 1B0GB 3UZEA 2JJTA 4KK9D 4NKOB 1A6PA 1U8LA 3EFDH 5HXMA 3TO4D 4LCWE 3ZDZF 1QO3B 4A6YH 1K85A 4ALAH 1K4DA 1JZ6A 4UBDD 4RGMC 1C5BL 1IAKA 2ZKHH 2XIDA 1MWAH 3QCVH 2VZ1A 5DHVB 5EFIA 1G7JB 3FCTA 1AGDA 3T04D 2OK0H 3FFCA 1MRCH 4JFFA 2QKIB 3UJIL 3FT2A 3WFDH 1B4RA 3RDTD 4YZFF 1LDSA 1EBPA 2UWEE 4FMFA 1LP9B 1NGYA 4G8GE 5T3ZD 1I7UA 2NY1D 2ZCLL 5KJRL 3L3GA 4QXTA 1EEQA 3SO3C 3F6IA 4M5ZL 4XCCH 1KCRL 4O5LH 2B2XH 2BCKB 3BZDA 3QXVA 3PDOA 1DQMH 4C4KO 5IKCB 2R1WB 5D9SA 2FX8L 4P3DB 3L9RA 4HUXB 4E41D 1EAJA 4WCYH 4JFHE 1M71A 2CRMA 4TTDC 4WTZA 4XCYB 4WI6A 4U1KA 1NEZB 2DMBA 3MBEB 4ZYKA 2Z92A 1FG2A 1D5ZA 3GSVA 4HKBB 4YGVB 5HYFA 4LARH 3VDCA 4MWFB 4JGMA 1I1AA 2XQYG 4PJCE 4MAYC 4MJ6A 1LE5B 1GGUA 2CLZB 4NKIL 1I7TB 1A5FH 1QBBA 2DJ4A 4MQSB 1KJMB 5HGHA 1U8JB 1QYGH 1FIGL 1X7QA 9CGTA 1KJ2L 5FKAA 1B0RA 5CILH 1KELH 3EOAB 2OBGA 1CK0H 4EEEA 4EUPA 1LQSR 2ZZUT 1FH5H 3RWFA 3UTPE 4NBXB 3BWAB 1BVKB 3OAYH 4XTRD 3H9HB 4YNYA 3PHSA 4TVPH 3OB0H 4TTGA 3MOQA 3NA4A 2ZSVB 3NTCL 5H2BB 2XN9A 3D69B 4JN2A 4JE4B 2EDLA 3UYOD 1NGQL 1J05A 1EEYB 3MXWH 1UCTA 2AV1A 2DLHA 4NUJA 4NC0B 4KRNA 1IJ9A 2ILLA 1GC1C 3TFKC 4Z9KB 5GS1B 3BUYA 4PJXF 3V79C 1CG9A 4Y4FB 3ULUH 2RR3A 1AQKH 2V2TA 3MYJA 4XP5H 4M5YL 4K3EH 4J3OC 1QA9A 2M2DA 3FAWA 3PNWA 4Q6IA 4CNIA 3I6LD 1H8OA 2ATKB 3HAEA 2DQJH 5INCA 2XZAL 3ARDB 5C9JA 5DEZA 4OFKA 2OR9H 4PJXA 3GSRA 3NGBC 1C08A 1PD6A 3B2UC 3DVGB 1A7PL 3S35H 4X5XB 5A40E 3IGAB 5DFVD 5D70L 4KY1L 3ZE1E 3BEVB 4OCLC 2QSCH 4OFDA 1RJZA 5HVHC 1RURH 4G43A 4OLVL 2B5IC 1PG7X 3CC5B 4QRTB 3N85L 5CEXA 2AJUL 4PY7A 2NY4C 1HWHB 4JHWL 3V4PL 3C5JA 1WTLA 4YH6A 4U6HA 3OR7B 3VXTA 1NCWL 1H8NA 2AABH 4XPAH 4WI8A 5IJKC 2DLFH 5BXFA 5DQJB 3HNSL 2LFGA 3O3BA 4APQA 2JK5A 2HFFB 4H8WC 4OZGF 1Z0MA 3VGAC 1UXWA 1RZIA 3SE4A 3HC0A 1FC1A 1CT8A 4YWGH 3MXVL 3I75B 2B0SH 4KQ4L 1YY9C 3BPLB 1JYXA 3RUGE 4TSAL 4QRSB 1WIOA 2NMSA 4X7CC 5EZIL 4OZGA 2GTWB 5KOVC 2AERT 4LHUA 2BHUA 1FE8H 5HGDB 2GJ6B 4PRHE 4X4MA 1OP5K 2CIIA 2CXKA 4LP4A 1QHOA 1E28B 2NCMA 3M17B 4JKKA 5CD5D 5GGQH 4N0YL 2NY7H 4LLMB 1CDYA 4M6NH 1XGYH 4KRMB 4NN6C 4PRBA 3WMSA 5C0RL 5GGUB 2VAAA 3MV7B 3GSXA 1A1OB 5CS7A 1FNSL 5IB1B 1IKFL 4OTXL 1II4E 3SOBL 1RI8A 4FNLL 1A47A 4ZG1A 4Z7VF 4I0PA 3FONB 1NCTA 5TE6L 5DEGB 4G80A 1TTUA 1A3RL 2NY5C 4QHNA 2O5YH 1FYHB 4LK4A 1EEZB 4P5TC 4Y5YC 3S88H 3D2UD 5L9DH 4LLUA 3RZCC 3NA9H 4HK0A 4MXVF 5ILTH 1C5CH 2GSIB 2NY3C 5IR1B 5EBLB 1A7NL 3DUHA 1MWAL 1UB5B 1MVUA 4Z7VA 2OL3A 5F7EH 4MCZB 4O2EB 1I4FB 4M4RA 5C0IB 4LASH 1HILB 3WFDL 1HDMB 4OJFH 3FFDB 3REWB 4PJ8B 3JSSA 1ACYL 2I9TA 3G6JE 3H9SA 1D6EB 4MJ5B 3IDJB 1FBIL 2YPLD 3LQZA 2BSRB 1JGUH 4XCCL 2NW3A 4O5LL 5TGBB 1NGZB 3VCLB 1G7QA 3T65A 4BFEA 1BPVA 2QSVA 3BIAX 4NHCL 4ISVB 1P84K 2H32H 5C0JB 1U93A 3DXAA 4D94A 3MO1B 1F4WL 4X6DB 5I8OL 1A64A 1JUFB 1EZVY 5FUZL 1XF5B 4R4NC 1AGCA 4OQTL 2FCBA 4IMKC 2ZOKA 5IFAH 4LARL 4TRPL 1A1NB 1HHHB 1NKRA 3CFKA 1G7HB 2QQKL 5IOPB 4OLEA 1EUTA 1SYVB 2A2QT 2GK0B 1DN0B 5D93C 3V6FB 3TH4T 1QYGL 1IQDA 3HZVA 4PRAA 3QUML 1R5VB 4BFIA 1BBJA 2I26N 4UTAL 1CK0L 3MLVL 2F53D 2DKUA 4TTDD 1FORL 3RWCA 1FSKC 4HDIB 1DDHB 3MNZA 3MMEA 1DL7H 4CVZB 4GRWF 1A14L 2ENSA 4TVPL 2Q86A 4OLYL 5E6YA 3STLB 5HHOB 2FJHA 1ND0B 2VZTA 4R9HA 3C6LC 4X4XA 4F7EA 2X1WL 5HJ3B 1A7RH 4OB5H 2F54D 2YEZA 3JV5A 3H3KA 3CSYB 4Y16B 4WDIA 5CKGA 3FRUB 5CIPA 4G9FD 3DRQA 1AQKL 1ZE3C 4F7PB 1MCQA 4JJ5A 4K3EL 4YDKL 2CK0L 4PJEE 3VXRE 5I1CL 2XXCB 2X4UB 5FGBA 5C6TL 4MXWL 3DV6B 1IGIH 1KB5L 4QYOB 4LMQE 2UVFA 4JKMA 2HJFB 2Y5TB 2K7PA 4FQQA 3RGVC 3RY6A 3ZYIA 1MJ8L 3MV8B 4YDVB 3VDBA 4W4OA 4KZEH 4M62H 1MFAH 4IRJB 5I17B 1TPXC 1RQ5A 3ZDXF 4S1RL 3W5NA 4JDZB 4M7KH 4NNPL 2QSCL 3BE1L 4OLXH 1F4XH 1RURL 4O2FA 1YNTB 4U1IA 1ZLVK 3AS0A 5E1AB 4F8QA 4WY7L 2YUVA 5ITBL 4YE4H 1I3UA 4EUPH 2W9EH 1U92B 1JF1A 1H3VA 2J8UE 5I16A 2PYED 3UROR 5CBAB 3MJ8B 3UTPD 1V3KA 4HIIA 2OJZH 4ZUVB 5BCAA 1NFDF 2C4FU 2PUQT 5IK3B 4BSJA 2BVQA 5JHDD 3QDJB 4XP6L 3B2UD 4YWGL 3PWUA 2DYPA 5TE4L 5C0EB 5IMLA 2B0SL 3HR5A 3HC3H 3QRGH 3BKYH 3MRKA 4WU7A 3M8OH 3MV9B 1LEGA 1GGIH 1CF8H 3BT2H 4FXKA 2IPKA 1NFDA 3TBYA 3W81A 3W9DB 2NY4D 1RIHH 1FE8L 4EN3D 5IMKB 3L95B 2JCCE 3R1GL 3BZ4B 2R9HC 3WO4B 3HAEH 3EYUH 5B3NA 1X4XA 5E7FA 4P23A 5KAQG 3X3GL 1OAYH 3G08A 1IRAY 4Q74A 2NY7L 4PJDB 4OCXH 4B7IA 4R96B 3B43A 4OF0A 1LD9B 3C5ZA 3V4VH 4YHYB 4GBXC 4XBEL 3SDYL 5FF6B 5DK2B 1IFHH 3T0EB 1FAIL 3NZHH 4NQDE 5DYOA 5HHNA 1YY9D 2NY2B 1NDMB 3KGRA 4Z77A 1A6UL 3CX5K 3IETA 5L8JB 3BKJL 2O5YL 5EU4B 1CICB 3HFML 4JRXB 1KTRL 3AUVA 3S88L 4XI5C 3MRCA 1JF6A 2IG2H 2KZWA 3WXVH 2JF1A 3W39B 1SEQH 1G9ML 3NA9L 5JW4M 1NSNL 1ZSDB 3KS0H 1W72A 1CGSH 4KMQA 4N8VB 5ENWA 5I9QC 4PGBB 4E42A 5KG9B 4GAJH 4IOIA 1QPXA 3MREB 3RBSA 3WIIL 3H0TA 4HS6B 4LIQE 4YDJB 2AI0H 3IRZA 4NOBA 4M9OA 2PYFA 4C59B 2P48B 5F3BA 4HLZH 2QADC 4KK8C 1X5ZA 4PRDA 5CSZB 3BUTA 4OZHE 1F3JB 3RVXD 5D7LB 3O8XC 3HTLX 5EO0A 1JZ7A 1B0GA 3MRMB 1D5IH 4NKOA 5J6GB 4UAOC 3D25B 4P5TD 2XKUA 1LP9F 3DRTB 3D39E 1I85A 4PRHD 3RZCD 2ADIB 4PRID 2YD4A 4WIQA 2NY3D 5DHVA 1G7JA 3SE8H 3TIEB 5A2JH 2QKIA 2WP3O 4P2RE 3BPCB 1K3IA 4ERSH 1TCRB 3LD8C 4MYWB 5DA0B 2ZUVA 4XVJH 2HLAA 1LP9A 1TQCC 4J8RB 4DQOL 1EHAA 5FIEA 1PQZB 3GSNB 5IFAL 2F5AH 3ULUC 5ICXB 4LRIC 1G0YR 2BRRH 1WISA 8FABA 2BCKA 5E1HB 1BECA 3LAFA 2EDQA 3TO2B 5IKCA 4JFEE 2R1WA 2BSTB 2BNRE 3HE7A 3QWQB 5AG9A 4OF5A 3B9VA 5CKAA 5FO9B 1FFNB 2J6EA 1Z5LB 2BDNH 3QI9C 1Q9OB 5HYIA 2OI9C 4P3DA 4IDLA 4HUXA 4PTTB 2P1YA 2OL3H 3K4DA 3ALXA 4AMKH 1JCKA 4R4ND 3GIVB 4OCWL 3MBEA 1MRFL 4TNVK 3F5WB 4HKBA 4YGVA 3T2QA 1FN4B 1DL7L 4G5ZL 4YXLH 4MWFA 5I8EA 3WIHA 1SVCP 4YBQD 1LE5A 2ZPKH 2CLZA 3RIAF 4PJ9D 5BO1H 1JFQH 3IXTB 4OCSH 1I7TA 3E6FB 1KJMA 1U8JA 4LCIH 4F58L 5EU7C 1QPPA 5FV1L 3TA3A 3P0VL 1VFMA 4JKWA 1Q1JL 3EOAA 1UWEL 4XAKD 1N6QL 5C08A 2YRZA 3QHFL 5HVWA 5CJXA 3CXDL 3H9HA 1XFPA 2XZCH 1IGIL 4XWOC 4OM0L 2J4WH 2ZSVA 1OAZL 2FIKB 5H2BA 3D69A 3NN8B 3U9PL 4I3GA 3HG1B 1EEYA 2XACC 3MACH 1OLLA 4M62L 2EDKA 1MFAL 3C6LD 4FXLA 5F9OL 4NWTH 4RGNE 2LU4A 2YPVH 3MV11 4Y4FA 2AJYH 1CD8A 4LRNH 5DMJB 4M6OH 6CGTA 5H94B 4ZAKD 2A77H 3FHAA 1ZLUH 5DR5L 2YHGA 3P3YA 3K1KC 2ATKA 4Z6AT 3CH1B 3ARDA 15C8L 2IPTL 2VL4A 3B8SA 3QIBB 4J23A 1DUYB 1U2CA 2OJZL 3MZGB 4PJ5B 4S11A 3PGFH 1MCRA 4UT9H 3RGVD 1IE5A 5LBSH 4TUOB 4X5XA 3QEQD 5IHLB 4ZNEA 4U7MA 5TJWK 1PYWB 2HLFC 3BEVA 2EC8A 1BQUA 4ZMAT 3LKOB 4TPRH 1VFUA 3NIGE 2BFVL 5DVNA 4QRTA 1FV1B 3M8OL 4HWEH 5KSVB 3PIQB 5CIPH 3D3VE 1CF8L 3BT2L 2WBJB 2RQ8A 2VKXA 1RIHL 3HA0A 3T0AA 3V6OE 1YC8A 2HFTA 2VDQH 1OAKH 3P9WB 5DQJA 5JW3L 4PJFA 4XMLH 4UIKH 2HFFA 3WYRA 2PXYB 3L1OH 3CVHB 4XNZB 4R0LB 3TN0B 2A83B 1F42A 1TFHA 2NPLX 3I75A 5LKNA 2RBLA 4XVTL 1X4ZA 5EH1A 2DDQH 3OKDB 5I76B 2XQYK 3NZHL 4NGHH 3KNBA 2CLRB 2DQTL 1NCDL 4QRSA 2DQUH 2VWEE 1XMWA 5BZDA 3U6RB 1IMHC 2I60H 1V7NH 1EFXD 5HGDA 3HNVL 2GJ6A 2VDPH 2R1XB 5CEZD 4NO5B 3GI9H 1E28A 2R9HD 3M17A 1LNUB 1E4WL 1HWGB 5HDQL 2VISA 1NL0H 1CGSL 2ATPA 3MV7A 1A1OA 3V0VB 5BVPL 3O6FB 2DF3A 3OMZA 3L3HB 4GBXD 5IB1A 5ALBH 5C07E 5IQ7H 2BSED 3VH8G 4JN1L 5D2LE 5E5MB 4LHQB 1MFBL 1S3KL 2DWDB 3DX7A 5GRXG 4OI8A 1ZA6B 3JTSB 1EEZA 2XICA 5J13B 3QHZL 4PLOB 5B4MC 4QT5A 3LPGA 4YDLC 4XI5D 2UZYB 1GL4B 3N9GL 3H3PL 2VLLA 3GBMH 5IR1A 5E7BA 2VN4A 1UB5A 3PWLB 2XKNB 4MCZA 3BOVA 3BDYH 1I4FA 2YD2A 4O2EA 4XWGL 1LE9B 5C0IA 1HILA 3OKNA 1HZHH 3HI6H 4OD1L 4P4RB 3SKNB 3FFDA 1BQSA 3REWA 3ILPB 2AJZB 4LSRL 4KWUA 2Z8WC 4X6DF 4PJ8A 2QADD 3VXUE 4KK8D 1D6EA 1Q0YH 4MJ5A 3B83A 2YXFA 4KUZH 2HA1A 3O8XD 3IDJA 2BSRA 1T7XA 3O2WH 5BJTB 5IB4B 3IJHB 5TGBA 5AYUH 3S34H 1NGZA 4OD2A 3S98A 4GAFB 5TPWH 1QSFD 5JA9A 2VDLL 1A2YB 4ISVA 4F7CB 1YEIH 1MOEA 1P6AB 3MFFB 4F15B 5C0BD 5C0JA 2BDNL 4NQTA 3QSKB 1VACB 2EYRB 2LVCA 3B4NA 4KTDL 3H8NA 1W72H 1VESA 1EMTL 2HFEB 5EO1A 1I1AC 5FM5M 2VC2H 1MPAL 1JMZA 4LGRB 1QKZH 4DEPC 4JG1H 2FHCA 4P4KB 5C3TA 4YXLL 2NY0C 3QDGA 2ZUYA 4NN5C 3JWDH 4Y5VB 2CMRH 1MHHB 1P9MA 1XIWB 4QRRD 4DJMA 3ULUD 3KXFE 1A1NA 2HAZA 1HHHA 1G7HA 1QEWB 2XWJB 1T6VN 1SYVA 1DN0A 2R23B 3V6FA 4HCRA 3WUWG 1L0YA 1MI5D 2DQHL 4KK6C 3QI9D 4JZJB 1DQJA 1R5VA 2GIYA 5DHVH 2OTUB 3EYFB 4N0UE 3SQBA 5B39B 3RVUC 4HDIA 1DDHA 3HMWL 2XZCL 3DGGB 4L9LC 5SWSD 3STLA 5HHOA 1IQWH 4CUCA 1U8MA 1ND0A 2Y07H 4LGSB 1R3LB 4XH2B 1PY9A 5HJ3A 3PHOA 4N0CC 5D2NB 4Q6IC 4GKZA 4HIEA 2DS4A 2J6EH 3CSYA 4JFED 3TJHC 2YPVL 4PB9H 2AJYL 3FRUA 4LPYA 3AFLA 4JPIB 4F7PA 1X5HA 5E8DH 3EYVB 3O45A 1DLFL 4MMZC 1NDGB 2BVEA 2X4UA 4ZOCA 1S7UB 3JWNC 3DV6A 4BFBD 1MVFA 4K3HA 4WV1B 5LWYH 1HINL 4XWOD 3IVKA 2Y5TA 5KVEH 3WIHH 5JUEH 3PGFL 4UT9L 3MV8A 4YDVA 3QXAB 4IRJA 5I17A 4KU1A 4JDZA 5DC0A 3UMTA 4RFEB 4PJHF 4CMHC 4Z0BL 1YNTA 1LK3H 3HRPA 2ADJB 1MSPA 4APQC 3VWKC 3VFVB 5E1AA 3VGDA 2F8XC 4RMTA 3S36L 5C6PB 5ADOH 2VDQL 5CBAA 1OAKL 4C57C 5BQ7B 3BZEA 4XMLL 1A22B 4PJHA 4NQSB 4L8DB 2FATL 5IK3A 2AXGB 1WAAA 2OCFD 3V7AG 3QDJA 1Q0XL 3QIWC 3T2NH 2PKDA 4U3XA 5FGCB 2K7QA 2HLFD 4PJDF 2CJUH 4HT1L 4CDHA 4HF5H 4TUKH 3K4AA 1HNGA 2FL5B 1M7DB 3W9DA 5GXBB 4GUPB 3X17A 5AZEL 5IMKA 2DTMH 3L95A 2VDPL 4P2YA 3UXFA 3BZ4A 4W6XB 3OAUH 4YO0B 4XPTH 4C58B 3KYNB 5HY9B 5JXEA 4FABH 1T7WA 2O5XH 1NL0L 2VLJB 4R96A 2JLLA 1LD9A 1JZ2A 2ID5A 3U0PB 5EU6B 5MEQB 1QBMH 3KLAB 5FF6A 1J8HB 3CLEH 4HFUH 3GNML 3T0EA 3GRWL 1CGXA 1NDMA 1WCBB 3MLZH 5A43C 5EU4A 1QOKA 1CICA 4JRXA 3EHBC 2NY6C 5IV2A 4U7SA 5GSRB 3S97C 4PJ7E 1J1PL 2M8XA 4EVNB 3W39A 4D3CL 4K7PL 3GBML 3ULVE 1ZSDA 2VZ3A 1MCBA 4J6RH 1YECH 4N8VA 4PGBA 4LSPL 2CR6A 5KG9A 2DQEL 3EOBB 1JP5A 3MREA 2XRAH 2QLVB 3A6BL 4HS6A 1NAKH 4EIZC 2WMPA 5DUPH 1JPTL 5CSZA 4LDLB 1F3JA 1TVHB 1QSEA 4MNQB 3EDJA 3MRMA 5GJTH 1ZKAA 5J6GA 4YHKH 5AYUL 1WFUA 4HPYH 3DRTA 5B4MD 1YEIL 3DVFA 3BZFA 2R2BB 2ADIA 5ELIA 3FRPA 4X80H 4XP4L 5JIHA 1D6VH 1W72L 1KIUA 4N8PA 1FGNL 1EH9A 3MGOB 1KB9K 5JW5B 3MR9A 3BPCA 43C9B 2CD0A 5GS0C 1IGCH 2C3GA 2VLRE 4JG1L 4QKXB 3BMWA 4J8RA 1ZK9A 3NIDE 5CWSA 1FPTL 3GSNA 3ARSA 5C86A 3JWDL 1QSVA 4XB8A 5ICXA 3V7AE 3GHEH 2ERJC 1TJHH 5ESVB 3TO2A 2BSTA 2AV7B 5FO9A 2MCG1 1FHGA 2YRLA 1Z5LA 1KYOJ 1Q9OA 1OW0A 1SQ2N 5IB3A 4PTTA 3MOAL 3HS0B 4H25B 2OSLB 3BQUC 5GRUL 1I1AD 4TOYH 3GIVA 2WAHA 3LQAH 3SCMB 3O4LD 3F5WA 4KJQC 1FN4A 3I6KB 1JHLH 4NPYB 2Z93B 1QLRB 3WKMH 2NY0D 1MQKH 1MFDH 2WLZA 2Y07L 2AJ3B 3IXTA 5JXAH 3E6FA 2EIDA 3VFGL 1EJOL 3NCBB 3BPOC 1JHTB 1YNKL 2DLGA 2J6EL 3CCHB 1FFOB 5EWIL 3KLHC 4KK6D 4WW2B 5E8DL 1UVQA 3RY6C 5TQ0H 3CSGA 3CFCH 1WT5A 2BXZA 4W4OC 3GMOB 2BHYA 1Y6MR 3U7AA 2I24N 1AD9B 4L5FH 2JJSA 3HN3A 4NFBA 3RJDA 3WIHL 1J1XL 2FIKA 5E2UH 5FHBL 3HG1A 5ISZE 1C7SA 4YXKH 3VGBA 3MLUH 1NEZG 1IVLA 2FBJH 3QAZC 4N0CD 4HCRH 3O2DA 5B3JE 4MB4A 3TJHD 3GJFK 3O81A 3WFHB 5H94A 3BP7B 4P2QB 4Z7NE 1QFUH 3WDIA 5IQ9A 3CH1A 1PZ5B 3VWJC 3RX5A 3KYAA 1RJCA 1A1MB 4L1HA 2V2XA 1DUYA 3C6SB 4PJ5A 3LV3B 5I71B 1JRHH 4Q9RL 4TUOA 4JM2C 1BZ9B 2APVA 2XNAA 2YKLL 1A0QH 3Q5YA 3GMLB 3KAAA 5KTEL 3KPRE 3LKOA 1FV1A 4R7DB 4N90D 4LPCA 1FL5B 2UUDH 4TUKL 3RVWC 3WD5L 4APQD 4N68A 5JQ6L 2WBJA 4I48B 3TF7C 4HMCA 2APWA 1FZOB 5ESAB 5A3IC 4XPTL 3L3JB 5DTFB 4NZJA 1MCKA 4OF7A 3T77B 5J9PB 4NUGH 2PXYA 4CJ0A 3CVHA 3TNMB 4R0LA 3IF1B 3TN0A 4EOWL 1P7HL 1A3LL 1DLHB 3DX6B 3S3SA 1DBAH 2A83A 4WUUB 1DE4A 3QIWD 3I02B 3V5HB 3OTTA 5I15L 1IZKA 1T20A 1UYWH 4NN7B 3CLEL 4HFUL 5I76A 3OKDA 3ALWA 4Y4HB 4WHDA 4Q6YA 1K3ZA 1F4YL 4NZUH 1UKQA 2H1PH 1K4CB 1ULVA 4HD9A 3U6RA 3L3IB 4PLNC 2XOTA 2G9HB 1MEXL 4FQ2L 3WHE1 4NO5A 4UIMB 3ARGB 1Q9LB 3BDBA 5JIIA 1YQVH 3TPKA 5GZNC 3BAEH 4MA8L 4J6RL 1YECL 4XCEB 3S3PA 1T0MB 4NO3B 3V0VA 2XRAL 1P1ZB 3O6FA 1MCOL 1AE6H 3L3HA 1T83A 3ETBF 5DUPL 1N59B 4GLRI 5E5MA 1TTFA 4RAUB 1AI1L 3L7FB 3MLRL 3MUHL 1ZA6A 4YHNB 2VDNH 2AJXH 5ABDE 3EHBD 2NY6D 2V5SA 3GSOB 4Q58C 5TF0A 1RK1A 3TVMB 3W9EA 4F8TA 1IT9H 1Z3GL 2GKIA 3GSQB 4ODTL 3D9AH 4I2XE 1G6RB 3INUL 5SWZD 4H1LA 3PWLA 2XKNA 4RWHA 4X83A 4C4KT 5KVFH 1LE9A 3B2VL 3B9KB 4P4RA 4LSDA 1G7IA 2Z31B 3SKNA 3H6JA 3UJJL 1IGCL 2J3SA 3ILPA 2AJZA 1RUKH 3LVEA 4OAWB 1HH6B 4LCCB 1NUNB 1S8DB 2E3VA 3M07A 1H15B 5BJTA 5IB4A 3GMRB 3MA9H 5I6XB 1TJHL 5F9DC 4X7DC 4V1DB 3VXOB 4F7CA 3ECBB 3MFFA 1ORSB 5E2JA 1JNLH 1MY5A 1ZEAH 1RUPH 1NLBH 5C9KA 5J11B 2EYRA 1BFVL 2HFEA 4FMKA 5IVOA 1A7OL 1BM3L 4TOYL 3SPVB 3QDME 1F97A 2LAAA 5HHPB 3IFOB 5KSAA 5GS0D 3HUJB 4NQEB 4P4KA 1YEHL 1I3RB 1T7VA 1U9KA 3WDHA 4Y5VA 1MHHA 4HS3B 1MQKL 3LN4A 4FRWA 5D6CB 2R2CA 5JDSB 4GRMB 1QEWA 2IADB 2VXSL 4OIBA 2R23A 4HULB 4OLUH 1NLDH 1MUJB 4JFDE 5I1GL 2BHZA 3NACL 4DW2L 4WVRA 5BW7A 2OTUA 3EYFA 5D1XB 4KK5C 5B39A 3BQUD 3CFCL 3ARWA 3K74B 1TJGH 3N1FC 4KJQD 3OL2A 3PGDB 5GS1C 2CKBB 2VLRD 1Z9OA 3R06B 1CBVH 3GSNH 1AY1L 1E6OH 2JJUA 1R3LA 3CFJB 1UA6L 1KCVH 4RIRB 1JHKH 1HE7A 1W0WB 2XTJB 3O9WB 3PDGA 3LPFA 4UNUA 5D2NA 3UTOA 1OOAA 4U2ZA 1FC2D 2DD8H 2CKNA 1FYTB 2GT9B 5FHAL 4P57B 1T22A 3ARDC 2MKWA 4DKEL 2V5YA 3ESUF 3KLHD 4JPIA 4YQXH 4ZFGH 3FT4B 3PABB 1HKFA 4MXQC 3UPRB 5CLTA 4CU7A 1CDCA 1NDGA 5I30H 3WHXB 2CUIA 2X9WA 1S7UA 3SJVE 4KJPC 1T5WB 5FYJH 4WV1A 1JRHI 2WUBL 4ZOBA 4D9RE 3TT1H 2ZUQC 1MCSA 4LSSH 5CJOL 3SGDI 1T1YA 3T3MF 1RZKH 1UCBH 3QXAA 2FEDC 2X9YA 2X89D 5IHZB 4RFEA 3EYSH 1EXUA 3CK0L 4ESKA 2ADJA 1HSBB 5EG6C 2H8PB 4YPJA 2NZ9D 3LY6A 5KSUB 4LKXB 2ARJQ 4KDWA 3VFVA 3JWOL 2NY1B 1MCCA 4KI5F 4U0QB 4UDTB 3VJ6B 3VWJD 3MOBH 5BQ7A 4PP2B 4NQSA 5DVOA 4L8DA 2IQAB 2AXGA 2P8PB 3EJJX 3P11L 1KEMH 3LN5B 2VZUA 3PJSB 1PZUB 4AEIH 4JM2D 4GFTB 4E41B 4F2MB 5JPNB 1IM9D 2I9LB 1NGPH 4OZIE 2Z4QA 3UTTD 3O2DH 4WEBH 1NMCC 4GH7B 4ZO9A 1S78C 1WZ1H 3P0GB 2FL5A 4OGZA 1M7DA 3RVWD 4D0BB 5BVJA 4GUPA 1I7RA 1OM3H 4Z95L 1NJ9B 1ZLSH 3QPQC 4UQ3B 2VXQH 3TESA 4XCNA 3KYNA 5HY9A 4JY4B 4NQCB 1WV7T 4U6YB 1OD9A 1DQDL 1MIML 1WZKA 2VLJA 4XBGB 2W59A 1JPSL 3I50H 4M43H 3KPSE 4L4TA 3U0PA 1DZBA 5EU6A 5MEQA 1DVFB 3KLAA 4K07A 1Q94B 1AR2A 2ESVE 2VXVH 4O9HL 4F37K 1IZJA 3F7PC 4LLQB 5IROC 5IMMB 1WCBA 2A1WL 3MUJA 4U0RC 1VHPA 4UV7L 4KVCH 5IEKB 2VDNL 3ARFA 1NEUA 3OR6B 5E99H 2AJXL 1CGTA 5GSRA 4N9GB 1IM3B 2PR4L 3IDYB 4EVNA 3MLWH 4QHMB 4K3DH 2MCPL 5I18H 3V9FA 1AC0A 4FHBD 4PJ8C 5IB2B 3D9AL 4UV4H 3LHPL 1MFCH 2EE6A 5DRXB 3CVHH 4KHTH 4FG6C 2EDJA 5DD5H 4BSWA 3ME0A 2DM4A 5GZND 3EOBA 4KHXH 4LAQL 4J3SA 1TVHA 2J88L 4MNQA 1KACB 5A16A 4Z76B 4R97B 1CS6A 4JO1L 4R6UA 5BS0E 4OZ4B 4FQ1L 1UJ3C 2EE9A 2HWZL 4WUKL 1JNLL 4LLAA 4FQHA 1Q8MA 1WTGT 1JVKA 4ODXB 1PKQE 3MGOA 5JW5A 1QLFB 1YEKL 1N2RB 3SDCB 3T1WA 43C9A 2DQFB 1UACH 1XGRA 3EDKA 2DWEB 1H0DB 1CLOH 4Y1AE 4M1CC 5DLML 1TNMA 1RIUH 1CLZL 1CGVA 5BRZE 1QZ1A 3IJSB 4FQLL 5ID1A 1IC5H 1RD6A 4JQIH 4R4FL 5ESVA 1AHWC 4U1MB 5IT2H 2AV7A 2L0DA 1XZ0B 3PWPE 1NLDL 1T3FA 4HAFA 2J8HA 3LRSB 4Z7UB 5I1JL 3HS0A 3D0VB 4H25A 2OSLA 2DKSA 4H1LH 5T1KD 5L6YL 5MENE 2BSSA 5D7JB 2F58H 3VMNA 3SCMA 1VPOH 3QCUH 4RISH 5IVXB 1TJGL 3I6KA 4NPYA 3LDBB 1QLRA 2CIKB 2D4DA 3P0YH 4LF3A 4WW2F 4Y16C 3VXSB 1CBVL 5GGTA 5K93A 4OZFB 5JR1L 1GZPB 3MRLB 2AJ3A 3FOLB 4JQVA 3PXHA 1SJHB 5J7CC 4ONFL 1JHTA 5A1AA 4IBLT 5IMOB 2DD8L 1BWWA 4G9DB 1FFOA 4U3CA 2DQIL 2PW1A 2Y7QB 3F7YB 3ARTA 3E8UH 1NKOA 4ZFGL 3V5DB 2DB8A 1VENA 3GIZL 5B8CB 3GMOA 1UM6L 4KK5D 43CAA 4WJ5B 3HLAB 4GOSA 2GUOB 3O4OC 2EIBA 4TVPE 1L7TH 2R0ZH 1AD9A 1FVEA 3N50A 4JHZA 3KWWB 4IS6A 3QO1B 3TT1L 4L4VE 5J57B 3FO2A 5GGVL 2HH0H 1RZKL 3G5XA 3Q2CA 2BP3A 4RWYH 3K2UH 1PVHA 4YHPA 1TVDA 2EH8H 1RPQA 4K94H 2EICA 3RAJH 1YEFL 4HUNB 4MA3B 1PEWA 3ARDD 3BESR 3QFDA 3WFHA 1KB9J 3BP7A 1JPGB 3TH3T 3ILQC 4FN0A 4CBPA 4U1NB 4GG6E 4MXQD 1MCJA 2ZOLB 2EO1A 1H3PL 2EDYA 4DZBA 2YPLB 5DJ0B 4JO4H 1A1MA 4KJPD 1BD2B 3I85A 3LV3A 4MQXC 3QUYC 3SE3A 4I0KA 3FB7B 5K9OB 5MHSD 3TIDB 1BZ9A 3GI8L 1V8HA 3GMLA 3DURB 2FEDD 2ICWJ 2MKLC 3IFLL 2ZUTA 3WO4C 3VFPB 5JZ7C 4R7DA 4WEBL 5JXEC 3X13B 2ZG1A 5C09A 4YXHH 4I48A 5HHVL 4MA7H 1FZOA 4MDIB 4OM1L 5ESAA 1CQKA 3RPKA 2FGWH 3L3JA 3B5HA 3MBXH 5DTFA 5KSBB 1NANI 1JI2A 4HWBA 3T77A 5J9PA 4MJIE 1FG9C 2VZOA 3O3EA 2W0LA 3TNMA 1B4JH 3IF1A 1ETZA 3I50L 1DLHA 3DX6A 3QULB 3LEXB 4LCWB 5DJ6B 3TWCL 4WUUA 1AJ7L 3I02A 5L2KE 3V5HA 4G6MH 1QUNA 3SBWC 1NMBL 3LMJH 3UEZA 4XPBL 4Y4HA 3BGFC 2FYYB 3WDJA 4NO0B 3O3DB 1S78D 2MHAA 1V5JA 5I19H 1BIHA 1K4CA 3HPLB 2FJGA 3L3IA 1YEEL 3KR3H 1OPGH 5F3HB 1DTUA 2G9HA 2UWEB 4G8GB 3MV7D 3O6KH 3QPQD 4UIMA 3ARGA 3VE0B 1OTTC 3N1GC 4MAYB 5IBTH 3HPJB 1MCFA 2VABA 4UV4L 5F96H 2F54B 4XCEA 1S7TB 1T0MA 4NO3A 4KTEH 1P1ZA 3TBVB 3ZHKA 4KHXL 1YMMA 3EUUA 4YPGB 3UYRL 4PV8B 3RRQA 4ORGB 3BDXA 3IDGB 1N59A 1OSPH 1KN2H 2DIJA 1CE6B 4IIQB 4RAUA 3OHXB 2WP3T 4OCYL 3L7FA 3VG9B 1AO7E 4YHNA 5HDBE 2C7UA 3PWVB 1RUQH 1IILE 3GSOA 1RU9L 1S5IL 2I5YL 5E95B 3TVMA 2IALB 3Q6GL 1U8IB 4Q9CA 4PJCB 3GSQA 5GS2H 1MHEB 1FVCB 1P7KA 1WF5A 4N0RA 4PJ8D 1SJVA 4B41A 2X05A 4FG6D 3TT3H 1N0XL 5DRWB 1EUUA 1BX2B 2Z31A 4XPHL 5FYKD 3BIBX 3UPAA 3S37L 1WITA 4OAWA 1IC1A 3GSUB 3WJJA 4PREA 2ESVD 1L7IL 1H15A 4WFGE 2HVJB 3GMRA 4X5WB 4JFOB 1IC5L 4V1DA 3VXOA 5IT2L 3HUJF 5E00B 3ECBA 4Y0GA 1HI6B 1ORSA 1JGVH 3NGBB 1G9MC 1S9WB 2AJSH 1LHZA 2W9DL 2YXMA 1BFSA 1A9EB 3T3PE 1IEBB 4RGOH 3SPVA 5SX5H 5HVHB 1BREA 3QH3A 5SX4I 1VPOL 2Y36H 5JOEA 3ZE0E 3HUJA 1I3RA 4M1CD 5FUCE 4HS3A 2MJWA 5JDSA 3ZL4H 3WSQH 3I84A 4GRMA 4QCIA 1IBGL 2IADA 1NMAH 3MTRA 4X4ZA 1MUJA 1J0ZA 5EO9B 5BS0D 2LTQB 4K8RH 3WFEH 5D1XA 1RZ7L 1FZKB 4BQCA 4JFFE 4JDTL 4P59L 4AT6B 2EYSB 1J9CT 4HUMB 3B5GA 2DOCA 3ELAT 3DMMB 1U3YA 2CKBA 3R06A 4LCUB 4Y16D 3QXWA 32C2B 3CFJA 3S7GA 2EECA 4PRPA 4WENB 1O0VA 3K1DA 1W0WA 4F9LC 2GT9A 1FYTA 2VLKA 4P57A 3WEXA 3RPIB 2EH7L 3QIBC 4BYHA 1TETH 3DSFH 3RWDB 3AREC 1UH4A 3PABA 1Q72H 1ZOXA 1FRGH 3UPRA 3OB8A 3WHXA 2HVKA 3SGKC 3GB7A 4YC2C 3BVNB 4WWKA 5F44A 3GSWB 4XT1C 4PLKC 3RUGB 4S2SB 5CSGA 3TO4A 5GGTH 1B3JA 2NTSP 4ZOAA 4PRHB 1FL6B 4XPGH 4HBCL 1BQLH 1HSAB 2NY3B 1UZ6F 3NIFF 1K6QH 3MCLH 2ITDA 1WGOA 4LFHD 5IHZA 2F8VA 1UEYA 3OAZK 1HSBA 1VDGA 3RDTA 1MCPH 2FX9H 5KSUA 5GHWH 3RY5A 2DL9A 5K59F 5HI4C 1F4AA 4MZ2A 5KS9A 4R0LC 3ILQD 4JPKL 3TN0C 4MA7L 5ALCH 5JHLL 2CR3A 4KXZH 1WC7B 3QDJD 3VJ6A 3JXAA 4JLRB 3P4OA 4FFZH 3MBXL 3GK8H 1QBAA 4G6JL 2X1OA 2F5BL 4PP2A 2OS7A 1G7MB 2P8PA 1AFVH 2XN9E 4MQXD 3LN5A 3MV9D 3QUYD 4MQTB 4S1DC 5HHME 4X7FC 3PJSA 1TZHB 3LS5L 5JPNA 4E41A 4F2MA 1E0OB 4YHZH 4I8DA 3B3IB 4G6ML 2I9LA 2OZ4A 1N64L 4AEHH 3IDXL 1NCCH 4XX1E 5JZ7D 2OR8A 2EDTA 4K23H 5T3XL 4X8JA 4JGJA 5JXED 3S96B 5D1QB 4G6AC 4D0BA 3M1BB 4H0HB 1R5IB 1OGTB 4H26B 2IQ9H 4RMWA 5T5FH 3HHRB 3O6KL 1A6WH 2R1YA 3G6JB 1CTNA 4JY4A 4NQCA 4OBRA 4U6YA 2ICES 2RGSA 1UJTA 1J5OL 4TULL 4EXKA 4HG4K 1KJ3H 2QJDA 4N8CL 5D93B 4XGZB 1G9NL 1IAIH 4OBSA 3LKRB 1DVFA 4PGEB 5DEFB 5J13C 4JFYA 1T5XB 4N0FB 3MNVA 1T0NA 3L6FB 5TQ2L 4LLQA 1KN2L 5IMMA 3PL6C 5DT1H 5IEKA 3OR6A 3QWRD 4QOKD 4UUJB 3SQOL 1S7VB 4N9GA 5ERWB 1IM3A 3K4ZA 3TNNA 3WS3B 4QHMA 4LSQL 1MCHA 3QEUB 1OTTD 3MROB 4HWBH 5IB2A 1NCAL 3C6LB 4MS8C 4PGDB 5DRXA 3WHE0 1CR9L 2AXFB 4QNPE 1YJDH 5DJ8B 5D7LD 3I9GH 4JZOB 3TT3L 2H2PC 4W81A 1EGJL 4YHOL 5J1TC 3EOTL 5DJZA 1P7QB 2CO6B 1N5YH 1B2WH 4F15C 3VFWB 1SEBB 3UO1L 5LQBL 1Z0NA 4Z76A 3VFUB 1SMAA 4QRPE 1I8MB 4GG8A 2L7JA 3U1SH 4NC2B 1UGNA 4OIIH 3RGVB 3L5HA 3BRFA 3OF6A 5BV7B 4OLZL 4ODXA 4LSUL 4P4KC 2QQLL 4MB3A 3DO3A 1QLFA 2OJEB 1XIWC 4XPFH 4ODHH 2C3HA 3QUKB 2D7TL 1A6ZB 4JR9H 1H0DA 2VITB 1LEIA 1XCQA 3QUXC 4Z7UF 3RJQB 1QFWM 3QXUA 5I1LB 1PG7W 3ARYA 1T4KB 4PJEB 3IJSA 3VXRB 3VDAA 2BVYA 4JZJC 1W8OA 1EIBA 2IBZX 1UM4H 3CXHJ 3ZL4L 4U1MA 5IVXF 5EBMB 1NCBH 5KW9L 5A2KH 1XZ0A 4K3JH 1FFPB 3SDAB 2OTWB 3LRSA 1PKOA 4Z7UA 4K8RL 3SEPA 3RNKB 3FN0H 2XY1A 3NCCB 1NBQA 1KPVB 3FQRB 3SKUD 2EXYC 1N5AB 4XMKH 2BMKB 5IVXA 3HC4H 4R90L 4ZS7H 5B21A 3NCJH 2FH6A 3LH2H 4EI5B 1EFXB 2CIKA 2GCYB 2VH5L 1TIUA 3H9SE 4MXVE 5IHUH 3V6BR 3DECA 3F65A 4OZFA 1GZPA 1X44A 3N0PB 4YR6B 1JE6A 2A9NH 3MRPB 2V7NA 1I8IB 4S1QL 4G9DA 2OXHA 3QUZB 2HFGL 2Y7QA 3F7YA 2X4QB 1CD1B 1NBVH 2XA3A 1KIRB 2NXYB 5F70A 5IB5B 2AKRA 3V5DA 2WINB 2E7LC 4J3XA 1MAML 3QEGH 5IGXH 2E9IA 4WJ5A 1BLNB 4HJJL 3HLAA 2GUOA 3WV0A 1ZHLB 3KWWA 5LGHH 2Q7YA 1MIEL 2A0LD 3MRRB 7FABH 3GHBH 2JCCB 3BSZL 2E27L 4XPGL 5F9JB 4HC1A 5HGAA 5M95B 5E94A 1HQ4B 3MCLL 1PJ9A 5I9QB 3UPCA 2YRPA 1LO5B 4MA3A 4OKVB 4WFHE 4YK4C 5F7HA 5CBEB 3QIBD 1AXTH 2FX9L 4HK3N 1JPGA 4M8QB 4DGIL 4MNGB 3ARED 4U1NA 4PJ5D 4CDGC 5ALCL 3DX8B 2ZOLA 3O8XB 4NQDB 1MY7A 5JW4Q 2YPLA 5DJ0A 4Y4KB 4PLKD 5F1SA 1BD2A 4KI5C 2CKBH 3VFNB 3Q5TA 5L0QC 1YZZA 4HQQL 2R56H 1I7ZA 5BOPA 1D5XB 5HYJE 4HPOL 1AFVL 5K9OA 1F13A 3TIDA 5I8KH 3SGJC 5D72H 3IT8D 5KSBF 2WBJD 3DURA 4ONOA 1JNHA 2KQNA 1CVSC 3ARQA 3AM8A 3G5VB 5I75C 3X13A 3HMXA 4JM4L 2VZVA 4JREB 3LD8B 3LZFH 2EDXA 5HI4D 1BZ7B 1TQCB 5T5FL 4MDIA 3Q0HA 3TN0D 1EO8H 4OZHB 1A6WL 4CW1B 5KSBA 1ZTXH 3KYKH 1TNNA 5K33A 4HS8H 1JZ5A 4KJWC 1KJ3L 3CVIH 4LCWA 3QULA 5DJ6A 3LEXA 2UWEF 1MI5B 3D39B 2FECI 4U1JB 4S1DD 1OP5H 2OI9B 1J0KA 4BZ1H 2FECL 3RNQB 2F53A 1I9IH 4NRZB 4PJBA 4IDJL 2FYYA 2YOCA 4NO0A 3O3DA 4P2RB 4S10A 4F80A 3HPLA 4G6AD 2B39A 1J1OL 1WICA 2UWEA 3G04B 2PO6C 3VE0A 5EUKA 3GDBA 5B38G 4MAYA 4QF1B 5CEYB 4UQ2B 3HPJA 4KPHL 1EO5A 2HRLA 2F54A 1YC7A 1S7TA 3VRJB 4JFEB 2BNRB 35C8H 3I9GL 4G6KH 3TBVA 4TNVF 4G9FA 2CH8A 4YPGA 3CSPA 4AIXA 5JTWA 3CMOH 2OZ4H 4PJCF 4ORGA 4OF8A 3IDGA 4JRYE 2JE8A 1B2WL 4AZ8A 4CKVX 1N4XL 3OHXA 1U8OB 3PL6D 1NFDE 3FT3A 5GQBA 2ADFL 3PWVA 4EI6B 1WLHA 4I3RL 3MJ9L 1I8KB 3U0TB 3BI9X 5A2FA 4OIIL 4Y2DB 2IALA 1U8IA 3UC0L 3H9YA 4PJCA 1IGFL 1MHEA 1FVCA 4FQXC 4HHAB 5HHXH 4MS8D 5A2IH 4CU8A 1FO0A 1MREL 2Q8BH 4XPFL 1BX2A 2YWYA 4O02H 2YSSA 2H2PD 1MHCB 1IKNC 3GSUA 2AEPL 2QR0B 3BX7C 4ZFZB 1U3ZA 3RBGA 2HVJA 4X5WA 4JFOA 3STZB 4FFWC 5DQ9B 5IIEA 3DUSB 2DI7A 1FP5A 1NCBL 5E00A 3MUY1 4Z7QF 1FLRL 4K3JL 1HI6A 1JTPA 3WFBH 1RHHB 1S9WA 2P5WE 4QWWD 5CP3A 3TBTB 4J7RA 4UZGA 5SWQB 4KH2A 4P4KD 1YYLL 3PP4H 1IEBA 3VMPA 5HI5C 1EK3A 4X9IA 4RGNB 1XIWD 5FB8B 3EIFA 3DV4A 4P5MB 4ZS7L 2DI9A 4XP9H 3NCJL 3LH2L 1U8KB 4GAYB 1G6VK 4NQXB 2BVOB 5IHUL 3GJFB 3ZE1F 2O5ZH 4QXGL 3C8DA 5JLZB 4WW2C 5IJKA 4LLDB 4NM4L 1ZT7B 3K2MC 1U42A 1MFEH 4WI3A 5FFLA 3EDDA 5EO9A 4DN3L 4GRLC 4U6TA 1VKXB 5IFHL 1GZQB 5I0ZA 1NBVL 1FZKA 5T1MB 2D31A 4N1EA 4MMXC 5CZXC 4AT6A 5IGXL 2EYSA 3QCTH 2EXYD 1FVDB 1ZA3B 3F58L 2A9MH 1C1EH 1LP9E 3DMMA 3OJVC 3D3VB 3R0MA 4XXCC 1NGXA 1C16A 1TQBC 2AW2A 32C2A 3GHBL 4PJGB 4LPWA 3VFOA 5D71H 12E8L 3OV6A 3RUGF 1J8KA 5T1DL 5LXGH 1HHKA 3WL9B 1PG7H 4JKPH 2DRUA 3RPIA 4YBHA 1QFWH 5IWLA 3RWDA 3G6DH 3T4YB 3GMPB 1MNUH 5I74B 2X9XA 1MAKA 4J4PC 3WFCH 1NUDA 3BVNA 5FGRA 5F7NC 3GSWA 3RUGA 1JGDB 4S2SA 4P5TA 1ZLVH 4OZFH 4Y19E 1VERA 1FL6A 4PRHA 4KROC 4P46C 5C6WH 4P9HH 1HSAA 3RVVC 4GXUN 5D72L 1V3LA 5FAAA 2B4CL 4W70A 1I9JL 3MLSH 1CE1H 4M7JH 1OGAE 5C08E 2IFFH 3LZFL 5C07B 5D2LB 2ZUSA 2ZUXA 5D1ZB 1BIIB 3L3DB 3EFFB 4D2NA 4JLRA 1FNLA 1NBZB 4ZQKB 1J0JA 5C7XH 1OTSC 4KI5D 4Y4HC 1H5BB 1G7MA 3CVIL 2XYCA 3RHWK 4FQJH 1TZHA 3QIUC 1JPFB 3G6JF 1DBMH 1T66C 5HSFA 2VNCA 4HC1H 5C2BL 4WEUD 3QZWG 5LAXA 4I3SL 4LVNC 5IBLD 2DM7A 4X98B 3O4LB 3PWNB 3S96A 4TSCL 3BIKB 4DEPB 3M1BA 1CTOA 4WFHD 5F9AC 1OGTA 4IMKA 4OSUH 4H26A 5T3ZL 2KKQA 5JOPE 3VXUB 4NN5B 3SGEI 2FEEI 3G6JA 4JAMB 4UILH 1CXLA 5EU6D 4XNUL 4D0CB 4I4WA 4M1GL 1J8HD 2FEEL 3NABL 3MNWB 4RMVA 4MCYB 3S36X 4KJWD 4NJAH 3WNKA 2FB4H 35C8L 5HYJD 4XGZA 1SJEB 3W2DL 3ARZA 3LKRA 5DEFA 4PGEA 1T5XA 1K2DA 3L6FA 1UWXK 4YBLB 3AB0B 1X5YA 3RY4A 3TVMC 1HYSC 5I1HL 4TVSa 3HMXH 5L8KB 3O0RH 2CLVB 1RY7B 3S5LG 3UBXB 1JTTA 4HWUA 1S7VA 1UZ8A 4L9LB 5ERWA 4MHHI 3B9KC 3WS3A 2LE9A 1YA5A 1X6NA 4HX1B 3JV4B 2PO6D 4PJFE 5E4IA 3GKWH 4WEMB 2G75B 5HVFB 3C6LA 3QEHB 4LCCC 4PGDA 2AXFA 4UT6H 1EPFA 5DJ8A 3UYPA 3AMKA 4DKDC 2LV4A 4IJ3B 4JZOA 3ZYJA 2PETA 1GPOH 5I6XC 4FP8H 4XHQA 2QQNL 1RZFL 3PWJA 5JMOC 2CRIA 3NFPB 1P7QA 2WANA 4G7VL 1C7TA 5FKPB 3VFWA 1SEBA 4N0UB 5J11C 4M03A 4NWUL 1ZGLB 3T2OA 3VFUA 1TTGA 4GAGL 3OPZL 1I8MA 4GKNA 3T0VA 3QNXA 4YHIB 3RGVA 2X10A 2YS4A 4H0IA 5H35B 2RJMA 4PJEF 4JFQB