4LIQH

Structure of the extracellular domain of human csf-1 receptor in complex with the fab fragment of rg7155
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDISWVRQAPGQGLEWMGVIWTDGGTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDQRLYFDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Targeting tumor-associated macrophages with anti-CSF-1R antibody reveals a strategy for cancer therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH01
1YYLL 4KRMB 2VZ3A 5C2BH 3T09A 4LCUA 5EPMA 4NCC2 2V2XB 3B9KB 3N1FC 4KV5F 4U3HA 3ARED 3MUY1 1PW3A 1T5WB 3EO9H 1AGBA 1IC7H 1VFBA 1QBLL 3H0TB 5D1XC 2VZOA 2CUIA 2PW2A 1ZANH 5ECJE 4Z78A 4S11A 2WP3O 1BECA 3BMWA 4XNYL 4ZUUB 1GC1L 1GXEA 3DVFA 2ZCKL 2DKMA 3PWJB 3WFEL 2C3GA 4TN9A 4XCFL 5AZ2H 4O2CA 1YNTB 2X4PB 3PWLB 4LMQI 4LP4A 4HFUL 1IGYB 1G0XA 5T1DH 3WCYA 2DLFH 1U8OB 3ROLA 2AQ1A 4XVJH 2HRPL 2W59A 4U6YB 4JKLA 1V3LA 5AYQA 4LGSB 1LK2A 2Q1EA 3IKCA 4MCZA 4ZOBA 3JV6A 3KR3L 2ZG3A 2AV7B 3VFMB 3S4SG 4XWOC 3NIFE 3SQOL 1QBAA 3KNBA 4X0KB 3C8KA 3GMMA 2WIIA 2CIKB 3EYUL 3IGAA 3DSFL 1NKRA 2R2EB 4Y4FD 4K3DL 3HCVB 5T1KA 3VRIB 2HJLA 2HP4A 4Q0XL 5JPMA 1PX4A 1K8IA 3HE7C 4GKNB 4YIQB 3ZTJG 4RISH 5B39A 2IANB 1FJ1A 4KMLB 3RWEB 5D1ZB 2JB6B 4P49A 1ZEAL 3KYNB 1MLBA 1DJSA 3IFLL 3ARBA 4MWFA 4PB9L 1UZ6E 2B1AL 4P46C 4JQVC 1CICB 4POYA 5EO1B 3I50L 3IDGA 4DZBA 3WIHA 4OGXL 2NY5L 1YQ2A 4FFZH 4LLVA 1KJ3H 2PO6A 4E0RA 5TFSH 4K23L 4PRDB 4AIZB 1G6RH 4OLWL 1J86A 1FNEB 4FQXA 1WZMA 3WLWD 1MHPL 1YMHB 5ITBL 2DQIH 5E9DD 2RCSL 4PFEA 3AUVA 4IHOA 5EC1B 2K3TA 2CLVA 3X3GL 1RZJL 1XCQA 4LCWB 3F58H 5BXFB 4LHQB 3WXVL 3PL6A 4U1IA 5HY9A 1YYLH 1D5BA 5DJYA 2VDNL 3X14B 4XP9L 4QRPB 3VXTA 2YUVA 4CJ1A 5GS0C 3TIDA 2NY0B 3JVGA 5T1LA 1JL8A 2AK4D 1DANU 4DOHB 1XGYL 4E5XB 3I75A 1YPZF 2G2RB 2FB4H 5INCB 1QBLH 4QRQA 4RNRA 3VDAA 3VXRA 3V7AG 2A6DB 5D5MB 4RGOL 4K2UH 2XPGA 4XNYH 1RVFL 4RCAA 1GC1H 5AAMA 2V7NB 4GRLB 3UTQA 2XQYK 4XBGB 3WFEH 4P2RA 2J4WL 3FFDB 5C09E 4Z7QE 5DFVC 3RZCA 1OSZB 2Z31A 2P8MB 6FABL 4P23C 4HFUH 1TETH 3O3DB 5J89A 5KSVB 5IUSA 1FVEA 4PV8A 2DM7A 4C56D 4WY7L 1ND0A 2HRPH 4F7MA 1OTTC 1QSEE 1YNLL 4JN1H 4NO5A 4XXDA 3BP4B 1W0YT 4JVUA 4DZ8B 1QSFB 1UZ8B 3TNMB 3KR3H 4M93C 5IOPA 3ARDA 1OGTA 2Y72A 3DXAA 1F4AA 3T3ME 3EYUH 1A6UL 1QZ1A 3DSFH 1CT8B 4PG9B 2HT2D 3LVEA 5E6IC 2R0KL 4QRRB 3JWDC 3TNNB 4Q0XH 5I1HH 4AG4L 5JW4Q 3CH8A 3T0EE 1DFBL 4LFHD 3PWNA 2GAZB 1MCHA 3U4BL 5ALBL 1LK3H 5EBWB 4DGVH 1TIUA 4R90L 3K4AA 4WO4D 3UTZA 4PB9H 4G6KL 3FTGB 4B7LA 1YEFL 2B1AH 5E94A 2GKIA 5K9QG 2YPLA 5KVDL 3O6FC 3TZVC 5KVFH 3F7RA 1A7NL 1I8IA 4OGXH 1DBKL 4KMTL 1FZJA 3NCJL 1YUHA 2NY5H 4G9DB 3BD4A 3SDXF 4HKBA 1T7YA 1P7HL 5T5FH 3VXNA 1DSFL 4QYOA 3QWRA 1SM3L 5FDWB 5IROA 2P8PB 4FS0A 4OLWH 3B3IA 3K8KA 5DDHA 3STZB 1U8IA 3T0EC 1MHPH 3VGAB 3BPNB 1YN7B 3JWOC 1S7SA 3TH3T 3E0GA 2BSRA 5C08A 3WXVH 3SDAD 3VFRB 2JIXD 2HKFH 1BVZA 3EAKA 3ALPA 1HIML 2ZSVB 4ZFGH 4DFIA 4AYFA 2VDNH 4P5TC 1QBBA 5T1MA 2X10A 5FIEA 4NBZB 5J1AA 4U1LA 3P4OA 3IYLW 3MNZA 1JHTA 4TVPE 5EBMA 1FYHB 3VXQA 1MI5B 2BVTA 1QO3B 2OR7A 5C0JA 5DJZB 5IB5B 2X89D 4RGOH 4L8SC 4M7LT 3N85H 2YC1A 4X4YB 4Y2DD 1IGJA 3HZYA 4O51A 2J4WH 1NCWL 5HGBB 5LQBL 1TVHA 2GFBA 6FABH 1B6DA 1D5XB 2DQGL 1A21A 4FFVD 2M1KA 1ZT1A 1CD0A 2R4SL 3RWJB 4WY7H 3Q5YA 3KWWA 3QFJE 3QUML 4LSUL 2ESVA 1YNLH 1YMME 3T8XB 2AW2A 1RHHB 2DLHA 1N6UA 4DAGH 5ICXA 2J8UF 5JW3L 3QDGE 4MA1B 4CN6A 2OI9C 2XZAH 1A3QA 1IARB 3TO4C 5IQ7H 4I77L 4F7CB 1A6UH 2I07A 4XBEL 2R0KH 1IZKA 4I5BB 4XC3L 4ODHL 3LKSA 3GM0A 4UQ3A 3OGOE 2AEPH 4BH7B 4LGPB 2R1XA 1DFBH 4JR9L 4ODSL 3VFNB 2FHBA 1QBML 5DUML 4RA3A 3D85B 4R90H 4G6KH 2JCCF 4XVSL 1YEFH 3PHOB 5BS0B 1H8NA 3GMQB 1RHFA 4OFYA 5DA0B 4XH2B 1UENA 3HRZA 4CJ0A 1U8QA 3QUXC 4M8VA 1EO8H 1OM3L 1A7NH 4HUVB 1DBKH 5EBLB 4KMTH 4MNQA 4ODVL 1DQDL 3NCJH 3FB8B 1FNGB 5DRNB 2NX5B 4NQDD 5DMKA 1AE6L 1SM3H 4I4WB 3GZKA 5CEZE 1XGRA 4YDLC 1C1EL 3S98A 1QFWL 2IFFL 3NA9L 5FHAL 1J87A 3QEHB 1OGAD 1X5YA 5H94B 1WBZA 3DO7A 3QHZL 4OF8A 4CADB 5IR1B 4KJYA 3ZE0F 1BEYL 3S35X 5AZEL 1UVQA 2AGJH 2Z4QA 3LN4B 3HN3A 1AQKL 3LQZA 4ZUSB 3C6LD 3BW9B 2OJEA 1HIMH 2VAAB 3GSWA 4K7FB 1KTLB 1Y6NR 2FD6H 3SY0B 3H9YA 1WFOA 4P5KB 3MBEC 5AG9A 2XNAB 4P2QB 4Z7VE 3CFKA 4AIOA 4JJ5B 1UJ3A 3HZVA 1MLCA 5ENWA 1I8KA 4OFDA 4UV7L 3B6SA 1FL6B 1NGWA 5J12C 3BRFA 2FR4A 2C4FU 2HWZH 5TE4L 1U3HA 4N9GB 3RX7A 4YFLI 1M05A 1NCWH 1RJLA 3WO3B 3S36X 1H0DB 4V1DB 2K7PA 5LQBH 4X7CC 1FL5B 2DQGH 1RI8A 1JUFB 4JPVL 3V0VB 1X5XA 2R4SH 1G9MC 3QIUB 4LNRB 4PGEB 4LSUH 3QJFA 5J11B 4JFQA 5KTEL 4QTHB 4NKDB 5I1DA 4WW2C 5MP6H 4QXTA 2M2DA 3QDHA 4OV6F 3N0PB 5JW3H 4MLSA 1F6LL 2Q6WB 1PFCA 2F8VA 1DBJH 1RSFA 4NQSA 5E7FA 4EJ1C 3VXOA 3U79A 3SDCC 4M3KB 3G5YB 4Z7WE 3DI2B 1F6AB 3LKOB 4WHYH 2QADD 1A9BA 4XC3H 4ODHH 4TTDD 5GGRB 3G5XB 3CFJA 4KKLC 1CQYA 3AXLB 5GRVK 25C8L 3UYRL 4JR9H 4TSCL 3H42L 4ODSH 1QBMH 2QJDA 3MV7D 5DUMH 3QZWA 4XVSH 2R15A 5KS9B 3D69B 3SCMC 1OM3H 3RVUC 3FO0L 5DEGA 4ODVH 1DQDH 1MF2H 5CLTA 4BK4A 1U95B 1LHZA 5I1EL 2LE9A 3S3PA 3AMLA 4OM1L 1AE6H 3HG1E 4MGXA 2P47B 1C1EH 1Q38A 4O58L 2CJUL 2IFFH 3NA9H 5FHAH 5B21A 3QHZH 3P4MA 1BEYH 5AZEH 4NUJB 2C1PB 2Z93A 1KIPA 3N1QC 4IS6A 1WWAX 1VENA 1AQKH 2X4RA 3CFEA 4NOBA 3PHQA 5EUOB 4E41B 5MERA 3T0XA 5F7DA 3X3FL 5E6YA 2EH7L 1TMCB 4YZFE 5KVMC 4PGJA 4X7TA 4JREC 1I3RB 5DD1L 2PYFA 5IFAL 2BDNH 4RMUA 1A2YA 3A6BH 3DRQA 4DKAA 3VDCA 5DA4A 3BYTA 3FB7A 3CMOH 5A2KH 1EMTL 4ZXBB 3OR6B 4PP1D 1UB6B 4HJ0D 3LD8B 4PJDE 5TE4H 3UTSB 1FPTL 4HLZH 3V4UL 3P4NA 3CCHB 4O2FB 5C0CE 2NY4D 1RY7B 2GSGA 3P9MA 3TWCL 1NCDL 2EDYA 3W11C 4D2NA 1DL7L 4X7SL 5AYUL 3K8LA 4OCXH 1GVIA 1RMFH 3OKNA 1KPRA 4LF3A 3I9GL 2OSLB 3L9RA 4PTTB 3BH8B 3PABB 1A4KA 3MV8D 4LPYA 1TJHL 4NHCH 5JDSA 1IZJA 3V6ZA 3C5JB 3MOBH 3DBXA 4HWUA 4OM0H 1KCKA 3VU2A 1U92A 3BEVB 3PDOB 4KDWA 3FFCB 4KK6D 4MXQD 8FABB 4L8BB 5HYSA 4X5LA 3OB0K 3IJSB 2GI7A 1N2RA 3UYRH 4KRPD 2ADIB 3WIFA 4YC2C 4D94A 4TSCH 3H42H 2IALB 4ENEC 3DI3B 1XZ0A 5LAXA 4ODWA 1YEJL 4HW6A 4ODUA 2AV1A 4CU7A 5I17B 2D31B 4GS7B 4NJAH 5IB4A 3ZSSA 2YD9A 1R3LA 4YGAB 1T80A 3OF6D 3SO3B 1ACZA 1FP5A 3B8YA 3UZQA 3RY6C 3T0WA 5FXCH 4YO0B 5AEAA 2JK5A 1OWRM 2HT3C 1ZHNA 4OF6A 5K9KB 4ZOCA 4LKXB 3IRZA 5I1EH 4JG1H 3O0RL 4OM1H 1D6VL 3FO2A 4GAJH 3E8UL 4O58H 5KZCB 1R5IB 3WFHA 1H3PL 2BOCB 3OJVC 4JRYD 2IH3A 1T0NA 2F5AL 4J1UA 3GJEB 4NQEB 4JRXD 1T03L 1U8PB 1RPQA 1XGQB 4IMLB 5DZNA 2MCPH 1GZPB 1PDKA 2EH7H 4HWBH 32C2B 1EV2E 4UU9A 3IB4A 2P7TB 3EFFA 3S4SB 3ZO0A 4G9FE 5CBAA 2EC8A 4Z7OE 5F7EH 2VR4A 1EMTH 4PJ7A 3QAZC 4NN5C 3SOBL 3JV5A 1AJ7L 4CL7A 1TPXB 3DRTB 1WC7A 3OKDB 3BOVA 3Q1SL 1KB9J 1JHLH 1FPTH 3V4UH 1A6AB 1RFDL 3CC5A 5DEZA 3QNZB 4G8GA 2BHYA 4N8VA 2DIBA 3F6IA 3X11A 5GGVY 4JFOB 1R5WB 2VWEE 1NCDH 3TWCH 2YD7A 2VQ1B 1DL7H 1U3YA 2H41A 1INQB 4P9MH 4X7SH 5B4MD 5AYUH 3MJ9L 5H35B 3KPLA 4Q7DA 1CLCA 4YDIH 3LN5B 4QRSA 1TJHH 2NTFB 5IMMA 1HK6A 3REWB 2VRAA 4Z5RB 1J0ZA 4TPRL 4WI8A 1XCTB 5DUBB 2ZUQB 1JGLL 2YSSB 4X6CE 3FRPA 1M7XA 1N6QL 1MREL 1JTPA 5KOMC 1G7JB 1F13A 3KPRE 3GSVB 2Y25A 3C60B 2VWEC 1K6QL 3RJDA 3RX8A 1YEJH 2DMBA 4E42A 4YUEL 5BV7B 5I0DA 3SBWC 1MCRA 3QA3A 3WUWA 1S9YA 2PTVA 5D2LB 3QXDA 4JQXA 5HHNA 2DQFB 5DJ6B 2EXWD 3FO1A 3D3VE 1YN6A 2X4NA 4HIEA 5DC0A 3W2DL 3G08B 2GJ6E 3O0RH 4FQ2L 4GO6B 3E8UH 1ZA3B 4K8RL 1H3PH 2AEIT 1NFDB 3HS0A 5F9WC 5B39G 1XIWA 2AXGB 5HI4D 1BD2B 2F5AH 2VZSA 1CDUA 2EZ0C 1B90A 3MLXL 4R2GC 1VDGA 4U1HB 5DYOB 3UTTA 3A0OA 3V8OA 4FABL 2XWTB 1A6ZB 5D5MF 1HYSC 5E2UL 2NNAA 2X5PA 3VD7A 1ES0B 1HHJA 1S7XB 1TTUA 1FN4A 1FZKA 2LAAA 2H26B 2VKWA 1I8MA 3B43A 5A3IC 4YHNB 3TN0D 3GM8A 2DD8L 3TIEA 2GHWB 3ZKNC 4YXHL 3O3UN 3BDBA 5IFJA 5I73B 2DYPA 2Z35B 3O9WC 3SOBH 1FH5L 4L3CA 1AGDB 3CPLA 1AJ7H 2O61A 1IAII 4JO4L 4XT1C 3JTSB 3IAPA 3P4LA 3RL2B 2ZCHL 3PP3K 2FX9L 4HJGA 4MNGE 1RFDH 3IRPX 4Y4KB 2G9HA 5DTFB 4K7PL 3E6HA 3BD3A 1MIML 3DVGA 3NBNA 3U30B 3NFSL 5I76B 2BHZA 2AJZA 4GLRI 1W8NA 3KPNA 3MJ9H 3E3QE 2IH1A 5I1CH 4ZPVB 1KYOJ 3V0AC 2F19L 2DBLL 4MD0A 3MLUL 4XCYB 1I1FA 4OLYL 2ICWB 5EU7E 4TPRH 3GRWH 1YA5A 5HHMD 1OLLA 4KI5F 1T1ZA 4LHJB 2EIZA 4OZIA 3OWEA 4PY7B 3F7YA 1N6QH 4ORGA 1MREH 1Y6MR 4KWUA 2ITCB 2H3NB 4PREA 3DYOA 2R23A 1OVZA 1WIOA 4GXUM 2F54D 2JJSA 3EHBD 5IHUH 1MJ7L 2NY6C 5EU6B 4H26A 1Q9KA 4GW1B 3U0PB 3MLYL 1OY3B 2HFFB 2IGFL 3E3QC 2DBJA 3OTTA 5DHVB 2FDBP 3QH3A 1GOHA 4WI2A 5D2NE 1P1ZB 1G7MA 4B53A 5ADOL 3S37L 35C8L 4OB5L 2A38A 2ESVD 3QDMD 4R3SB 4RFEA 3HI1A 3UPRA 4L3ED 1S7QB 2XXMB 5EU7C 3N50A 5J6HB 3RUGE 2PCPB 4HSQA 3DMMD 3D9AL 4FQ2H 1SBBA 5HGHA 5TDNB 5E1HB 4UNUA 1K5NA 4YHOL 5C0GB 4K8RH 1Z2KA 3LN9A 2VISB 3ARVA 2W9DL 3BGMA 1H9VA 4BKLA 1MAML 5TDPB 3SGEH 1J0KA 3BZEA 3HFML 5IB1A 4ELMA 3CU1A 1AXSA 4GOSA 4ZUWA 3TV3L 2X4UA 3J8F7 3HZKB 3U0TA 3KPPB 2YPVL 5MEPA 2VB5A 4IRSA 1Q1JL 2VLRB 5D2NC 3REVA 2GK0A 5CBEB 3L3HA 2J7LA 3HZMB 3GIZH 5JDJA 5JIIA 1DVFA 4RMVA 4UDTA 2DD8H 3MRMA 5BRZE 2QSCH 4PJ9C 3L5JA 3RKDC 4YXHH 5GHWL 3V5KA 5DJ0A 1FH5H 2XTJE 5EZIH 1P4IL 2ZCHH 4QHNB 2FX9H 5HHVL 4EI5D 2VQUA 4MCYA 5J3HD 5EWIH 2E7LC 4Z77A 3IU4L 5GS1A 4K7PH 4L9DA 3IAGC 1ZVYA 1FVCA 1J7VR 4YBLC 5L2KE 2RFXA 2XWBA 3EYSL 4QOKE 4R97C 3MA9L 5IVOA 3S8WA 1EFXB 5SWQB 1HSBB 1Q9WA 4XNMB 1CDCA 4FTVA 1TZHB 1BM3H 4JFDD 1RIHL 1W0VB 3MLUH 3VFSB 2XT1B 2F53A 1N59B 2XTJC 4W81A 5DUPL 4BSVB 5EN2B 3GSUA 3B9DA 3EJZD 2D7QA 4ISVA 4B41A 2X09A 2PN5A 4R4NC 4RWHA 1VEOA 2CO7B 4DKDC 1ORQA 4RAVB 1QR1B 2HFTA 3DUUB 3JTTA 3VRLF 4L1HA 3MV9D 1KACB 5F7LB 2IGFH 2YEZB 4PYGA 4I13B 4Y1AB 4PGDA 4BELD 1AGEB 1UM4H 3S37H 4OB5H 1VGKB 2WSKA 5DO2C 5HGDB 3P9LB 2YXMA 4OUUB 3GMLA 3PE9A 3D9AH 4U1NA 4U1JB 4K9EL 4RGNB 4BZYA 5MENA 2W9DH 1JNJA 4J4PD 1JYNA 3QXAB 1MFBL 1MAMH 2G75B 3ZT5A 3HFMH 5BVJB 5I2IA 3C5ZA 1W2KT 2ITDA 2R0ZH 1EHNA 3P0GB 3QNYA 3QR2A 4WI9A 2YPVH 5C0BE 4YHIA 5JW4M 1HQ4B 1Q1JH 4M3JA 1T6WA 1JHKL 1UACL 2Q76B 4I0PD 2BK8A 1T6VN 1E28B 4Y19A 2ZOLB 1NJ9A 1JGUL 4LSDA 2BSED 3Q3GB 5ESVA 1YPZE 4PP2B 5GHWH 1CGUA 1T1XB 2OP4L 4UUJA 1P4IH 4J3VA 4PJCE 5FYKE 3HAEA 1D7FA 2D4DA 2YUXA 5CIPH 3PJSB 1CFNA 1B0RB 3ULUD 4NSKB 3BHBA 4UB0H 5ICYB 1KIRA 4PV9B 3IU4H 3DETC 3IDMB 1NBZB 2DMCA 3O2WL 3ARQA 1HXYA 1KCVH 3OHXA 3EYSH 4KU1A 1MFEL 4HH8A 3IDJA 3T4YA 1MJJB 4RWYH 4Z6AT 2F74B 3R4DA 2NYYD 1RIHH 3ETBF 2GTWB 1DN0B 1NC4A 3RNKA 1AKJD 1JTOA 2BC4B 4PRPA 1NC2A 1E27B 4QRUB 4Z18A 3RDTD 4JFYA 3L7EA 4R7DB 3OJDB 5DUPH 4H5SA 5KS9F 1UXWB 5HYIA 1L7IL 3CVHA 4JG0H 3HA0A 1MCLA 1MUJB 1AO7B 2PR4L 4EVNA 2OX5A 2I9LA 1MJUL 3FT4B 3R8BB 1OP3H 4ONFL 2Y9RT 2C3VB 1MPAL 2CRYA 3IS1X 4CW1B 3U4EA 5DD5L 5EOTB 2Y5TB 1H5BA 1IKNC 2WINB 1T5XB 2O5YL 1NFIB 1IEAA 3BP5B 4AZ8A 2IAMB 4MJ5A 1WIUA 3O4LB 1Y18A 1T7WA 2H1PH 2B4CL 5DGRA 3MFGB 1E6OH 2K9UA 3SDDA 3NCCB 4J6RL 2NXZD 3VGHA 3TT3H 1HH6A 3AREC 3L5WB 3ARFD 5BV7L 4ZNEE 5AUMA 1MFDL 4Q6IA 3QPXH 3VJ6A 2NY3B 1JNLL 5D7IE 2AVGA 4M02A 3WKNA 4PJEB 3QZWG 1ACYL 3DARA 5HHOD 5BW7C 5MEQB 4XPGL 4P4KA 4TNWF 4MJID 5I16B 3W9EB 4WU5A 3G04B 4I2XA 1JHKH 3ULUH 1UACH 1BREA 4L4JA 3O45B 1OF2A 2BVPA 2VLJA 2W0FB 5IW1A 2WW8A 2BERA 3BKYL 4M7KH 1KG0A 2JJVA 4L4VB 5DR5H 3TCLB 3L5HA 1KPVA 4LHUD 2XWJA 2OP4H 2YKLL 5F1IB 3OKKB 5DJCB 3HC0A 1NGYB 2VC2L 1RUQH 2NR6D 5GZND 4Y4FC 3UYOD 1QEWB 5F97E 4UOJA 1MVFA 2OXGA 3O2WH 5EIQA 4NRXA 4M7JL 2NY7L 1KJMB 3PWPA 3H7LA 5KSBB 1MFEH 5E9DE 5HHXL 3ZTJH 5EC2B 1PJ9A 3QB7C 4OI8A 3VRJA 3MNWB 4HK3J 1EJOL 4U3XA 2AK4E 2CDFA 3R1GL 4QY8B 1OAXL 4WI6A 2PR4H 1MJUH 3V5HA 3KJ4B 4ONFH 5FUZL 1MPAH 4F33A 5DD5H 4JY5L 4OQTL 4M8QA 3UC0L 3ULUF 5I6XB 4JB9L 5J56B 3WLWC 4EN3B 5C0DB 3QIBD 3TBSB 5ESAA 5FUOH 1A4JA 2DL2A 3OXRA 2OQJA 2CK0H 2V7HB 5ISZA 4OQ1A 2BNRA 1MH5B 3O11A 4OD2B 1CDYA 1ORSA 5D1XA 4C56E 1OP9A 5J7CC 3BYYA 5E4EB 1B4RA 1MCOH 1VHPA 1EK3A 5BV7H 1AIFB 2ZUWA 1REIA 1MFDH 3EKCA 1S7WA 1JNLH 1XGTA 1YQVL 5IMLA 1S9WB 4HX1B 1WICA 2A74A 1I1YA 3NPSB 1ACYH 4OUOA 5H37G 1NUGA 4LCUB 3W0WD 3CH1A 1ZT7A 3D2UA 5EPMB 4N1HB 3O2DH 2BY2A 5J9PA 2YRLA 1DDHA 2NXYD 2HLFD 5F8QC 2I24N 1H3TA 1AGBB 1VFBB 5HXMA 3U7WL 5TJWK 1UWGL 4JZOA 3O4OB 3BKYH 5IW3A 2PW2B 4CMHC 3QHFL 1NAMA 5JR1H 4LPVA 2ERJB 5FECA 5IVNA 3HE7A 4HCRL 5C3LD 4O2CB 3KS0J 1YC7A 2GW5A 1GOFA 3TJEL 1UB5A 1OTUD 4JFED 4XPAH 3W81A 3DV4A 4XNZB 5K9JL 5GSRA 4RSVA 2HT2C 3BXNA 3ROLB 1A47A 4P46A 4JQVA 1D9KD 2NY7H 2XKNA 5L0QB 3MACH 3F7VA 1LK2B 3DIFA 3IKCB 4MCZB 5GGUA 3JV6B 3WL9A 5HHXH 4LSQL 2CDGA 3KNBB 4WO4C 2EKSA 3C8KB 3GMMB 2WIIB 2OZ4A 3LQMA 4I18C 1MCWM 2DM4A 5T1KB 4WGWB 2HJLB 5JPMB 1EJOH 1K8IB 5D2LF 1J8HE 3EDKA 2BX5A 2UVFA 1FJ1B 3RX5A 5B39B 1OAXH 1FO0H 4OLXH 4N8VG 1HHKA 3LQAH 1ZS8A 1IL1A 4N68A 1G9NL 1MLBB 2J8HA 1R5VA 4G3YL 3ARBB 4MWFB 1C5DA 3FT2A 3MV01 3QEQE 3UC0H 5ABDE 3G6JF 4YR6A 4N0FA 4JANA 2MFNA 3MRGA 1MQKL 1QNZH 3FJTA 1UWXH 2ICWJ 5E56A 4DZBB 4MB4A 1F58L 3SDAC 4KHTL 3HNVL 4XHQA 2PO6B 1WZ1H 3F6LA 4FNLL 4E0RB 1TITA 1U8HA 4Y5XC 4RA0C 2LQRA 5DMJB 4FQXB 3BKJL 2UY7A 2A83B 4BA8A 1NMAL 5DHVH 5E8DH 4IHOB 4P23A 3RL1A 2CLVB 1XCQB 1XF3A 4ERSL 3PL6B 4U1IB 5LVEA 5HY9B 4Y2DC 4HWNA 5L7XL 1D5BB 5DJYB 3VXTB 1FGVL 3HE6D 4NQCE 3TIDB 4ORZC 5T1LB 4BZ1L 1JRHL 4Z0XA 4FFVC 2HG5A 3I75B 2MHAA 2V2WA 3U7WH 2ADGA 4QRQB 1UWGH 4RNRB 1WBXB 3VXRB 3OAZK 4YHPA 2GSIA 5E6IA 1ETZB 3QHFH 3BMVA 5C09A 3UTQB 1Z0NA 4HCRH 3ZYZA 4P2RB 3RZCB 4ZFZA 2Z31B 4H20L 2MOVA 3VFWA 3LKQA 1G7PA 4M4PA 4NQDE 1F3DH 2WWKT 4NRYA 5HVHC 4PV8B 3MRDA 3LCYA 4O00A 3QUZC 1ND0B 1QSEA 2C5DC 4Z9KB 4F7MB 1OGAE 3B8SA 4NO5B 4XXDB 3CDGA 4UBDD 3TZVA 1BX2A 4MNHA 5J1TC 4F7PA 4ZUVA 3K7UA 1HNFA 3ARDB 1OGTB 3DXAB 4HLJA 4CU6A 4CVWA 3H3PL 3WEXB 2LTQC 2YUWA 4J7RA 2C1OB 1BGXH 1YEDA 4NZJA 3T0EA 2FX8H 1MVUA 2D03L 2Z92A 3CFDA 1GGBH 3PWNB 4LVHC 4O2EA 3RI5F 1VERA 5I1JL 3UTZB 2GY5A 1JF1A 3D25A 5E94B 1WZKA 3T77A 2YPLB 5A2JH 4P5TA 1MQKH 2IPTL 1ZHKA 4MQ7B 1ZGLM 3GBNL 1D5ZA 1I8IB 3C87A 4JLRA 1KLFA 5IB3A 3RGVD 1F58H 1FZJB 4KHTH 5IIEB 3HNVH 3THML 1YUHB 4HKBB 3C6LC 2CRZA 1YECL 4FNLH 3RU8H 3QXWA 4QYOB 3FQUA 4DQOL 4L8SA 3B3IB 5DDHB 4QTIL 1U8IB 3MRLA 3PWUA 1NMAH 3FN9A 3NCFB 2VLKD 1DQQB 2BSRB 5C08B 4OGZA 4ERSH 2DQUL 4GKOA 5IESL 4U7MA 3HI5L 2DWEA 3FT3B 4NNPL 2B1HL 5L7XH 5CP3A 3IFPA 1LEKA 4GMTL 2CXKA 1PZUB 5T1MB 5CCKH 2XZCH 5J1AB 1T2XA 1J5OL 4U1LB 4TNVF 3N1GC 4BZ1H 3P4OB 4QRTA 1TFHA 3MNZB 4KVCL 1JHTB 5GISL 12E8L 4PRHD 1T1WA 2XIDA 3KHOA 1QLEL 5EO0A 2B5IC 4PLNC 3MV7E 4EDWL 3EGSB 3VXQB 9CGTA 4HC1L 5C0JB 1D5IL 1AGCA 5DHXB 2HTKC 2YC1B 1IGJB 1GH7A 3HZYB 4O51B 5I9QB 1S7VA 5E2VH 4BFGA 4XVUC 1TVHB 5F1SA 1KPUA 1WSST 3NTCL 4FQ1L 3U9UA 2QADC 1ZT1B 2EXYC 3D39D 5BOPA 1N64L 3QFJA 3IKKA 2P44B 2QEJA 1IC1A 4TTDC 1YMMA 5I75C 3C09B 4FXGA 2NY1B 3K0WA 3QDGA 3QUXA 5ICXB 2AJVL 2F15A 3MFFA 4NYLA 4OBSA 1NSNL 5BMFL 1Z9SA 3HTLX 4GKZA 1XGPA 3LHPL 3LB6D 3EBAA 2X4SA 1LD9B 2AEQL 2I07B 1AXIB 4JM2D 1YYMH 4D3CL 4EIGB 1N5YL 3LKSB 4UQ3B 1TQCC 4E9LA 5TH2A 2R1XB 3GMOA 5B8CC 4S2SA 5F89A 4JAMB 3L3DA 2GITA 1AGFA 5FKPA 3U1SH 4HEPG 3NPZB 5I1JH 5SWSA 1J0IA 2HJKA 3HRZB 1PAMA 2A6JA 1G84A 1U8QB 3MBEA 5DJ2A 3GBNH 1NGXA 1HYRC 3FCTA 3WNKA 3SKMA 4MNQB 4MAYD 2P4AB 4NFCA 3THMH 4HGWA 3INUL 5DMKB 1YECH 4XI5C 1XGRB 4PY8J 2FATH 4I0CC 4BQ9A 4QTIH 5DT1L 1WBZB 3BGFB 3DO7B 4Y8AA 3MV8E 4PRPD 1UVQB 1T1YB 3CMGA 3D0VA 3ZKQD 2Z4QB 1EO5A 4PP1C 2DQUH 3LQZB 4HJ0C 2XRAL 4ALAH 4DOHE 3HI5H 2OJEB 4NNPH 2B1HH 3GSWB 3QO1A 4GMTH 4Z0BL 2DI8A 4WW2A 4Z7VA 1J5OH 2A9MH 5D5ME 2NY4C 3CFKB 3JWNC 4KVCH 1UJ3B 3HZVB 2OMBA 2V5MA 4ZUTA 12E8H 1MLCB 2XG4A 2Z0BA 5GISH 5F3BA 1QLEH 1I8KB 1Y6KR 3EOBB 5ENWB 3ZE2F 3VFTA 3SDCA 4EDWH 1OD9A 3B6SB 5DK0A 4HC1H 1NGWB 1D5IH 5JOPD 3TYGL 1NH6A 4GQPH 2QKIA 4F9LC 1HE7A 4MHHI 5LG1A 5EZOL 4F8TA 1O7SA 3OKOA 3SDDD 1U3HB 1M05B 4JDTH 1LO0L 5LKNA 2YMXL 4JKMA 3K74B 5C6TL 3NTCH 4FQ1H 4TSAL 2R69L 4GSDL 4KK6C 1N64H 4MXQC 1OARL 1QLRA 3C8DA 3QJFB 4JFQB 2P8LA 3G6AA 5SV4A 4OFPA 2CK2A 5I1DB 4W6WB 4QXTB 4G6AD 3O8XB 2R1WA 4UIKL 3SCMA 4JRYE 2AJVH 4KRPC 1NSNH 5BMFH 1P84J 5FUCE 4NQSB 1YEIL 4M48H 4JRXE 3OAUL 3V4PL 4Z7WA 4GW4A 3VXOB 1QSVA 3RPIA 1FZMA 2AEQH 4JFFD 1SY6A 2C3WA 1FAKT 1AD9A 5SWZD 4Y5VC 3SDYH 1MHHA 1HXMA 4M1GH 4NQVA 5CZKA 3HAEG 1N5YH 1JI2A 2J5LB 3M8OH 3CFJB 3KVQA 2Q87A 3PGFL 1JNNL 3L3KA 4X9FA 2BXZA 3WSQL 3QZWB 2ZKHH 1CGWA 1WWBX 4W4NA 4Y4HD 3H3KA 4LSPL 2OXHA 1A1MA 5ETUA 5JHDB 1G7IA 2HVJA 1NUNB 5D7LA 5FUCC 4HK0A 1P9MC 4OZFA 5DEGB 4AY0A 2IC2A 4J3XA 3HG1A 3S7GA 2YRPA 2EE2A 4PJEF 3VXMD 4DN3H 1UFUA 2ARWA 4R8WL 3GKWL 1V8HA 2IQ9L 4TUKL 3NGBB 1IEBA 2VNCA 5IV2A 4JJHA 1SHMA 3K80A 3LKRB 1DBML 3P4MB 1MCBA 3B5GA 4IRJD 1JK8B 4ZAKB 5D71H 1KB9K 4ZO6A 5E2WH 1J1XL 2Z93B 3WIHL 1KIPB 4IS6B 5EZLA 3VH8A 2X4RB 3CFEB 2HJFA 4PBWD 3T08A 1DLFH 1X5LA 5MERB 5T3ZL 5F7DB 4YWGH 1KSRA 3FRUA 5J06A 4Z0BH 4OF7A 1JPFA 4X7TB 4OZGE 1HKLL 1LWRA 4FQLH 2PYFB 3LS5L 4APQD 4M6AA 1A2YB 3DRQB 4RFNB 4EEEA 1HSAA 4KROD 3FB7B 5B4MC 1LVEA 5ILTH 2E9IA 2Q7YA 3SN6N 1IT9L 3TYGH 3WHXB 4PJDA 5EZOH 5KSBF 5HD8D 1CLZL 4UI2A 3P4NB 1LO0H 5C0CA 5IGXL 5C6TH 2GSGB 4NDMA 4TSAH 1CLOL 3P9MB 4AT6A 4GSDH 3C2AH 1TVDA 4QLRA 2C26A 1MCSA 1VB9A 4IRZL 1QACA 1QLFA 1AD0A 3OKNB 1KPRB 4LF3B 4UIKH 2VUYA 3L9RB 1A4KB 3RY6A 5I18L 4DEPB 1YEIH 5JDSB 3V4PH 1XF4A 1XF5A 4O5LL 3DBXB 3V6ZB 5INDA 3EOYG 3UX9B 5ALCH 4XP4L 1U92B 1MCDA 4BSWA 1KOAA 4XWOD 4WFHD 2EXWC 4YEEA 2O26U 3RNQA 4KK5D 7FABL 1JNNH 4GRWE 3QPQC 1N2RB 3WIFB 4PJGE 3UJJL 1S7UA 2VXTL 3WSQH 1XZ0B 5LAXB 4ODWB 3WFDL 3BRDA 4ODUB 2AV1B 2GY7B 3BWUC 2BNQD 5IB4B 1R3LB 4LSPH 4PJBE 3ULVL 4M5YL 5HI4C 3NIDE 1NDGA 4K7PX 1TQBB 2ZP0T 2JK5B 5FYJD 1ZHNB 5TGBA 3L3OA 4QWWD 3GJFA 4R8WH 4Z7UE 3DX7A 2IQ9H 4TUKH 4X6DF 1PEZA 1Y0LA 1ADQH 4U7KA 3TN0C 1Z9MA 4DKEL 2IH3B 1T0NB 4DKFL 3QCTL 4J1UB 3L95A 4RDQF 5HI5D 5HHME 1C12A 2HLAA 3KYOA 4OLVH 2VITB 2X70B 4NUGL 4XP5L 1NMCC 4UU9B 1HKLH 4G9FA 3EFFB 3LH2L 1KYOK 5CBAB 5DRXA 1RUAL 5ADPH 2F54E 3OG4B 4PJ7B 1ZKAA 3TJHD 1WC7B 4P9HC 3S37X 1KJ2H 5DURB 3QDME 3CC5B 3RWCA 1TXKA 5J0BA 4G8GB 5IGXH 4L3EE 1RZKH 4N8VB 3X11B 3FONA 1BJ1J 1CLOH 4UTAL 1PLGH 3P2TA 3V2AR 4U6VL 3TA3D 3SBWA 4UV4L 3KPLB 1CDGA 4LRNL 3BVNA 4L3AA 1P4BH 1J9CT 5I18H 1NAKH 3EHBC 4QRSB 5IMMB 1MRFL 2IMMA 2H32H 3WMSA 5I66A 4X8JA 4XP4H 4TVSa 3SE4C 2BSSA 4X6CA 3RY4A 7FABH 3KPRA 1AI1L 4N5UA 1JMZA 3GMRA 4NJ9L 3GSNA 4V2BA 1KCUL 3DMMC 3UJJH 2VXTH 3WYRA 3DUHA 3WFDH 3CX2A 4E42B 3MQIA 1JF5A 3P30L 1S9YB 1M6OA 5I8KH 3D3VA 3QXDB 4M5YH 5HHNB 3WLBB 2PYED 3FO1B 1YN6B 2JKXA 2X4NB 1B9ZA 4LMQE 3IDIA 4BK5A 4HIEB 2OYPA 1AXTL 4CBPA 2EE6A 5GRXG 2GJ6A 2PW1B 3OJ2C 2ARJA 2XQBL 5D7SL 2BOBB 3O9WA 1EIBA 1KXQE 3CLEL 1S7RA 3HS0B 4PRID 3VWJD 1WV7T 1XIWB 4WV1C 4DKEH 2FEEI 4C57C 4JFDE 4LLDB 1P2CA 4J3WA 3KPSD 2ADJA 3UTTB 3VD4A 2QR0A 1NQBA 2NNAB 4XP5H 1H8SA 1HHJB 1FN4B 1FZKB 5JHLL 2HKHL 4N0RA 4EI5C 2FLBT 5J3HC 3L3IA 1HH9B 3LH2H 2CKBH 4P5TD 3RWIA 3TIEB 1RUAH 3P9WB 3AC0A 4BM7A 1FSKC 1MEXH 2R39A 2YBRA 2EDTA 5IFJB 2DYPB 3MV9E 4L3CB 3CPLB 4OD1H 1GPOL 2O61B 3MRPA 5ACLA 2X1WL 1NLDL 5FM5O 4MNGA 2YA0A 5BQ7A 4HJGB 3MRFA 3QIWD 5HVGB 2EIEA 1U93B 5ERWA 2G9HB 4ONGL 4BH8B 5E00A 3DVGB 1U3JA 3ULVF 1P6AB 3EJZC 2IF7A 3C6SA 2AJZB 1ED3B 3FOMA 5GGTA 2CLZA 2E27L 2VUOA 1SYVA 2OJZL 2IH1B 5GGSY 3P40A 4YPGA 3LD8C 4MD0B 4WTWA 2FECI 4AH2A 1MRFH 2ZCLL 1I1FB 2AK1L 5F7HA 3VXSD 1FIGL 3D87B 4UNTA 3UTPD 1AHWC 3TC9A 3RHWF 1T1ZB 2IBZX 2GIYA 2EIZB 4OZIB 2OTUA 3MYJA 4UAOC 4XC1L 3MCLL 5DQJA 4GG8A 4DW2L 4ORGB 1U8LA 1AI1H 5KANI 4WDIA 3TM6A 4NJ9H 2VDKL 4PIRF 5E8PB 1A6VL 5GGQH 2IQAA 4PREB 2R23B 4A6YA 3GHEH 2AJUL 4CN4A 1F2XK 1TNMA 1N3NA 4YHMH 5D8JL 1SEQL 4FN0A 4EXKA 5GRUL 4H26B 1Q9KB 5DVLA 1JWMA 4J4PC 3T0AA 4OCRH 5D96B 1G7MB 4LIQH 3ULUE 2AQ2A 4RFEB 3UPRB 1AXTH 3RUGA 1G9EA 2ADFL 1V7NL 4PJ9A 3DGCR 2XQBH 5D7SH 3C08L 4YFDB 5HGHB 1K5NB 4I0PC 2KBGA 4P48A 3CLEH 3BGMB 3QNXA 4J3UA 3TBYA 4IMKC 4B5EA 4GXVH 3ZDXE 4BKLB 3TFKD 3BZEB 1SVZA 5IB1B 3CZFA 3BESR 4X8XA 4ELMB 1AXSB 4ZUWB 3BZFA 2E7LA 1A3LH 1U8MB 3K8MA 1FAIL 2X4UB 2Q86A 3ARXA 3I2CL 1FE8L 5MEPB 4IRSB 3TBWA 3VI3E 3REVB 1WFTA 2GK0B 5C7XL 3ULUC 2HKHH 1GGCL 5SWSD 1DVFB 4UDTB 5BRZA 4GBXD 4YBQD 3MRMB 3W9DA 4I1NB 1DQML 3CFBA 1J1OH 3V5KB 5DJ0B 2DJUA 5IEKA 4FMFA 1GPOH 3UTOA 1BF8A 4HHAA 1RUKL 3MRRA 4MCYB 3L1OH 4MVBC 4ONGH 1KIQA 3RDTC 2X2YA 4Z77B 5GS1B 4C58B 3OBAA 1FVCB 2VSCA 5L2KA 1OP3K 4QOKA 5B3NA 2RFXB 2XWBB 5HDLA 4Y0GA 4LKCA 2OJZH 1Q9WB 4FTVB 3DNKA 2WLZA 3IETA 3Q5TA 3QEUA 2ZCLH 3ILQC 4NN7C 4AEIH 5HHOE 4GH7B 2F53B 5LGKA 1JGDA 3DO3A 1JZ4A 4H8WL 2A2QT 2DS4A 2EDWA 3NCEB 4MJIE 3GSUB 4KVNL 4U2YA 3GHBL 4XC1H 3MCLH 1KB5A 4ISVB 4DW2H 1CVSC 2VDKH 5E99L 1A6VH 1L9MA 1LILA 5FO9A 2NZIA 2AJUH 1ORQB 4G6ML 2NXZC 1SEQH 1X44A 5FCUL 5GRUH 3JTTB 5HHQA 3ARFC 4KC3B 4UILH 1EGJH 4EDXA 1N4XL 5CHNA 2FWOA 4PGDB 5F9JA 3G6JE 5D7JD 1JIBA 2EYSA 4G6FB 4L4TD 4AJ0A 3QUYD 5GRYA 1V7NH 1DBAL 5JMOC 3GMLB 4U1NB 3BT2H 2AKRA 4XZUA 2FEDD 3OPZL 4QCIA 5MENB 2ZPKL 5IT2L 2J3SA 3KG5A 3VGEA 3WKML 5I2IB 3LRSA 3C5ZB 3QNYB 5FYLL 5AD0A 3MXWL 5FFLA 3ZLQC 2QQLL 5C0BA 1QKZL 1FE8H 2C7UA 4YHIB 3ZKXC 1K3ZA 3GO1H 2E9WA 2DTML 1IRAY 5C7XH 4FXKB 3GBLA 1GGCH 4DGYL 2NR6C 3OKYA 1NKOA 5GZNC 4R7NB 4Y19B 1CD8A 5CEYA 1JMXA 1NJ9B 1OOAA 4S1DD 1DQMH 5D7LD 4Q58C 1YPZA 5F44A 5ESVB 4WUUD 3LEYH 4UUJB 4PJCA 1NCAH 1T7XA 5D72L 3HAEB 4Z8FL 5FO8A 1CFNB 4C83A 2OBGA 3FQNA 1RUKH 2DI7A 3BHBB 2P5ED 3DUSA 1T7VA 1KIRB 4Z95L 2XN9D 1JZ6A 1EEZA 1ZTXL 3RP1A 1JI1A 4XNUL 2X1OA 5IQ9A 1IKNA 4WENB 4U6HA 1HXYB 3BPLB 3OHXB 1FFRA 5I8OL 3IDJB 3T4YB 4YHLH 1SJEA 1SJHA 3U7YH 1IGIL 2IBGA 2I60L 4GG6F 1NC4B 3RNKB 2QQQA 1ZVHA 3E2HC 2PTTA 1NC2B 3W0WE 3QIBC 4KVNH 3AREA 4H5SB 1ROWA 2Z9TA 2CLRA 3GHBH 4CNIA 3CVHB 1OAUL 4XBPA 2BVUA 1TDQA 4EVNB 2I9LB 5E99H 1TTGA 3LQAC 1H3VA 2EEDA 3CGTA 4BQ8A 4G6MH 3U4EB 1KTDA 4PLOB 2FH8A 4H25A 3JV0A 1Z5LA 5BW7A 1HHGA 1H5BB 1XEDA 2R2HA 1CTOA 5FCUH 5C0CD 1BZ7B 1U2HA 1IEHA 4UOW0 2FGWL 1IEAB 3B9AA 4M6OL 4JFEE 4XGZA 4LSRH 5J13B 1CXFA 4G8FA 5KSAD 1H3XA 4X99A 2W92A 1HN1A 3O41A 3OPZH 1HH6B 5E70A 2C3XA 4PD4J 4ZNEA 1IGCH 5IT2H 4DJMA 4XMPL 2HLFC 5AUMB 5FGCE 5H37H 4Q6IB 3WKMH 3VJ6B 5JIHA 4KTDL 4C59B 1N8ZB 5D7IA 3B5HA 1MWAB 3B2UD 3FOLA 4Y4FA 1WUNT 3MXWH 3O3EA 2QQLH 1CU4L 1QKZH 4M62L 1I4FA 4MA7L 1E4XH 4P4KB 5DMGD 2ZOKA 1PYWA 2DTMH 1KCSH 4WU5B 2KPNA 4I2XB 1OTUC 3S34L 4CVXA 4LVNB 2NLJA 4OZFG 4DGYH 2NZ9D 3VG9C 1OF2B 2VLJB 3GGWA 5IW1B 4WWID 2GUOA 5KG9A 4G6JL 4OZ4A 1D9KC 4P3CL 3VWKD 1KPVB 3KPQA 1MCKA 4XVTL 3MPCA 5D72H 4Z8FH 1KF9B 2UWEE 5FOBA 3DYPA 5DD0L 1C08A 3HC0B 4X98A 3BJLA 4TYUA 4U4BA 3UO1L 3SE3C 4BFBD 5I1KL 3AAZB 3VH8G 2CRIA 4MA8L 1A1OB 3ULSA 3UYPA 4ZFOA 2KUTA 3D0LA 4NRXB 2WK2A 3BP7A 3PWPB 3OGCA 1FFNA 2Q7NA 2FNBA 5E9DA 1AR1D 3KPMA 1IGIH 1UWXK 3A6CL 2VR9A 2IPKA 1VEMA 5JXAL 1IGTB 1OB1A 3PIQA 4OCYL 4N8CL 3VRJB 2Y6SD 2AK4A 1E4KC 1JGEA 2X4OA 2CDFB 1U9KA 2NY2D 4P2CG 1WWWX 2VXVL 2X1XR 3V5HB 3UEZA 1CK0L 4HUWA 4JPWH 4P2OD 4F33B 3GDBA 4M8QB 2L0DA 4MD4A 5HDBF 3QWOA 4OFVA 5T3XD 4MS8D 1G7QA 1IKFL 5ESAB 1A4JB 1DEDA 3OXRB 2OQJB 5ISZB 3RI5K 3PWVA 2FBJL 2BNRB 4JO3L 2AERT 3O11B 4C56A 1BFVL 1ORSB 5D1XB 4WEBL 5C3TA 3BKCL 1GAFH 3HE6C 1DE4A 3T4AA 3WFZA 1S7WB 1S7TA 2E6JA 4U1KA 4KTDH 1XGTB 1SJXA 4N5ED 5IMLB 1ZA6A 1FBIL 2EDFA 1YEKL 3WHE0 2A74B 1I1YB 2HYMA 1OD7A 3EYVA 4M62H 3PGCA 2P42B 2YK1H 3CH1B 1ZT7B 3D2UB 3LS4L 1LMKA 1C5CL 1CGTA 1S3KL 1IC5H 3S34H 5J9PB 3PV6A 2X9XA 4XMKL 4R4BA 1D5MA 4WO4A 4JZOB 4MXVF 4OCWL 3OKLA 4G6JH 3ET9F 4P3CH 4I18A 5KJRL 1U0QA 4TNVK 1HEZA 1NAMB 4UBDC 1HDMA 3BIAX 5FECB 3HE7B 4XVTH 5F9AC 5CJ5A 3CFIC 3QUKB 3CLFL 4KKNA 4MDJA 5DD0H 1CR9H 3G6DH 1X5ZA 5J4MA 3UO1H 4FMKA 4ZSOE 4HIXL 3BXNB 4MA8H 3LPFA 2IG2L 4P46B 4XMLL 2H8PA 2XKNB 3F7VB 3DIFB 3PP3H 3IS0X 5GGUB 5I1IL 2WWKO 2VLKE 3DX6A 3WL9B 2MPAH 5ANME 4UQ2A 3SDAA 2JIXA 2W60A 2CDGB 4KJPD 2EKSB 3P77A 5CFHA 3VXUD 3X12A 4Y5XA 2VKXA 4N8CH 3ES6A 4M7ZC 1PEWA 2DTSA 1J8HA 2VDLL 5CGYD 3RGVC 4PRHE 1JNHA 2VXVH 4TSBL 1HHKB 1ZS8B 3T65A 1A7PL 1IL1B 1CK0H 1EUUA 3UAJD 3QEQA 1R5VB 3FQWA 1MAKA 1BZ9A 2DM2A 1C5DB 3FT2B 4Y2DA 4YLQT 4YR6B 4N0FB 4JANB 1EA9C 1QHPA 4HPOL 3ISWA 5AWNL 1IKFH 1BVLA 5FGBC 1P7QD 4OAWA 2FBJH 4JO3H 2EDQA 3D39E 1BFVH 2VXUL 4HXBH 3BKCH 3IDUA 3WN5C 1U8HB 5F96L 4KZDL 2V17H 2YD3A 4XAKD 5FYKU 4KHXL 2V5YA 1KNOA 1QHOA 2XYCA 5C8JA 1IM9D 3PDDA 4P23B 3ZL4H 1ERNA 1XF3B 1FBIH 1KGCD 5GRJL 3QUZA 3ARSA 4NQCA 5F7YC 4MD5A 1C5CH 1S3KH 2XY2A 4NZRL 5HYJD 4Z0XB 2HG5B 4M93B 1DANT 2MHAB 4HIIA 2FIRT 2JE8A 2V2WB 1UXSA 2XA3A 4XMKH 3QULA 2ADGB 3WUZA 4CVZA 1UJTA 4MHHG 4OCWH 2WWMD 5KJRH 4YHPB 2GSIB 5E6IB 4AQ1B 4W6YB 5C09B 2W65A 1X9QA 4DFHA 4PJ9D 3TO2B 4ZFZB 2DDQL 3CLFH 5F7NC 3VD9A 1F4YH 2Y4SA 3VFWB 4NQDA 3LKQB 2X44D 1G7PB 4JM2C 1R24A 4NRYB 3MRDB 2WIMA 1OGAA 1QSEB 2IG2H 2FBOJ 3IJHA 2KQMA 4GKSA 4XMLH 3L6FB 4OZIF 3EOTH 3V79C 3CDGB 5HYEA 4FRWA 2IWGA 3RWHA 3O6FB 5T33L 4FHBD 3TZVB 1BX2B 4PRPE 4MNHB 4F7PB 4ZUVB 2W1NA 3UROR 5FA3A 3IXAA 3C6LA 4HS8L 4YXKH 4KI1A 3DV6A 4H0GA 2FJFA 4HJJH 4XTRD 1G0DA 5GIRA 4KQ3L 3ECBB 1QFWM 3BQUD 4RQQA 1VPOL 1YEDB 2E7CA 2VDLH 1MCPL 1BQUA 3T0EB 4MAYC 1MVUB 5FO7A 3QJHA 2Z92B 1K4CA 2P49B 3CFDB 4TSBH 2FO4A 1A7PH 3GI8H 4O2EB 3KLAB 3QBTB 1HZHL 5CP7A 2ED9A 3B2VL 3T2NL 3D25B 3HNTL 3T77B 3QDJD 4HPOH 3HI6L 3MTRA 5AWNH 4I3GA 4RZCB 1IILE 3NOIA 1D5ZB 4FP8L 4JLRB 5IB3B 2D9CA 5E5MA 2YPKA 5EOCL 1IGFL 4JM4H 1Z9OA 4PJAE 3S97C 4CAGA 3CVHL 5DEFA 3ZHLA 3O6MH 1EERB 1MSPA 1F3JA 2VXUH 3FQUB 5F96H 3MC0A 4L8SB 3RWGA 1M7IA 3MRLB 4Y89A 3PWUB 5C86A 4LQFL 1JZ7A 3ME0A 1QQDA 4HKJB 4X6DE 1DQTA 1JPSL 4B7IA 4ETYA 1PBYA 2NW2A 5GRJH 1CD1A 4JFFE 1VACA 2DWEB 3SGEI 5EO9A 5L8KB 1LEKB 3AROA 3IFPB 5SWZE 3AS3A 5D1QD 1IAIL 3MRIA 2A6IA 3MRJA 4X7EC 3BWAA 2HT4D 4O9HH 4NZRH 4QRTB 4NO3A 2OI9B 5K59F 1T1WB 1WVZA 2LVEA 3MV7A 3TO4B 5EO0B 1P84K 5CGTA 4MDIB 1D6EA 5DGQA 2D0FA 1MWAL 4KZEL 1AGCB 4DN4L 4G6AC 5FK9A 1S7VB 3L3JA 1RUML 2DM3A 1U91A 5B8CA 1KPUB 1OQXA 3U9UB 1CVRA 3VXME 2UYLA 4CGTA 1KULA 1OAZH 3QFJB 1JJUA 1I9IH 1YMMB 3M17A 5JIPA 2F58L 4FXGB 4JZJC 5T33H 3QDGB 3QUXB 1VADA 3MFFB 4NYLB 3H9SD 3MOQA 4K3GA 1CG9A 1F3RB 4GKZB 3HAEH 1XGPB 4MYWB 3GUTA 1FFQA 4LVOC 5ID1A 1A6TA 2GT9A 2X4SB 4BUGA 4Y4HC 4HS8H 2I26N 3STLA 4YDLB 1RK0A 4Y16D 5F93C 5C07B 4OF5A 4TOYL 3HMXA 4PJXE 5C6WH 3W5NA 2P48B 5TH2B 3JXAA 3MNVA 2WBJD 3GMOB 4S2SB 4Q9BA 3SGDI 1OCWH 1QRND 5F89B 1TZIA 3TH4T 1KELL 3L3DB 1HZHH 2GITB 4QF1A 1AGFB 1LP9E 2J2ZA 3FQXA 3HNTH 2NW3A 2A73A 4HWBA 2B0SL 1U8JA 3P73A 2A6JB 4IRJC 3H7BA 3FB5A 3MBEB 5DJ2B 1NGXB 5IVXF 1QFOA 3SKMB 1DLHA 1IGFH 4YJZL 3QP3A 5IM7A 3CVHH 3TVMD 1ITCA 3OB8A 5EOCJ 4XPTL 3AFLA 3KJ6L 1I3VA 4YHZL 1BF2A 4F9LA 4Y5YC 5J12B 4OV5A 3MV8A 4APQC 4GXUN 1HILB 4LQFH 4KROC 5IKCA 1KT2A 5F7FA 3D0VB 5JOFA 3BPCA 4WFHE 2LU3A 3QO1B 5F9DC 5HD8C 2PXYB 3LEVH 4WW2B 3CUPA 5KVEL 1GHFL 4Z7VB 5D5MA 1W72A 4M5ZL 4DVBA 2V7NA 4ZUTB 1TZGH 1HWGB 4XPBH 3SDCB 3KGRA 2BCKA 2P8MA 4JFZL 3MGTA 1MWAH 5DK0B 1FRGL 2BNQE 2Y06H 4KZEH 1LGVA 4DN4H 2QKIB 1SEBA 3KXFD 3OF6A 4Y5VA 3ZDZE 3DVIA 6CGTA 3WO4C 4NGHL 5L88L 2C4FT 1RZKC 5FYJE 1CLYH 3OKMA 1QLRB 3EYOA 2VIRA 2P8LB 3HPJA 4KK5C 5JOEA 1HNGA 2F58H 4JRYA 5BJTA 3VGDA 5EU5A 2R1WB 3SCMB 4HBCL 1NAML 4FG6D 4LCYA 4F7EB 4JRXA 1P9MA 1X6NA 4NRZA 3ZDYF 4XX1E 4GW4B 4NO0D 3IT8D 4Z7WB 5C0AD 3O2VH 1FZMB 3ZE1E 2VDPL 2FH6A 4WIQA 1AD9B 1MHHB 1HXMB 2RR3A 3RBSA 1NBVL 4NQVB 4EXPX 5IBLD 1DUYA 4LRIC 3TBVA 5F21B 1FLTX 2MQCA 4QWWC 3MMEA 1KELH 4JVPA 1I9JH 3CSYB 4JPIA 2JELL 2DLTA 3VW3L 2OZ4L 1A1MB 1ZXQA 1G7IB 2HVJB 2W07A 2LU4A 4JREB 4HK0B 4OZFB 4WEMB 4NZUL 1MNUL 5HI5C 3VDBA 2DQJH 4HWEH 4ZNCD 3HG1B 2EH8L 4XPTH 3KJ6H 1CIUA 1BIHA 5CJQL 4YHZH 2V2TA 5IV2B 3FHQA 3IJYA 1T2QL 4MAUL 2X9YA 4UT7L 3RJQB 1CE6A 2GJZA 1MRCL 5GS0L 5DD3L 5TF1L 5EZLB 3VH8B 1F00I 4M43L 3NZHL 2HJFB 1EBPA 4PRBA 3TJHC 3FRUB 3WFCL 3F7PC 1JPFB 4OZGA 1JTTA 3MJ9A 5KVEH 1GHFH 1EHLL 2P43B 5DVMA 4M5ZH 4PJIE 2ZCKH 1ODAA 4XCFH 1TTFA 1YEGL 1CBVL 3PQYD 1HSAB 3IDNA 2VL4A 3TA3C 5FV2A 3GRWA 4PPTA 3SGJC 4HD9A 2Q7YB 2DB8A 2D2OA 4G43A 5ESQA 1CI5A 4NWTL 4UTBL 5GJSL 3I02A 3ALWA 4LBEB 2PYEE 3C5SA 4ZO7A 3FN3A 1A3RL 4NGHH 5L88H 5C0CB 5JW4N 3QRGL 4JDZA 3MUJA 1EO7A 4NDMB 4YC2B 4AT6B 3SQOH 4PRIE 1QLFB 1AD0B 1NUDA 3BSZL 3AVEA 4K3DH 3U7AA 3JWDL 4HBCH 1NAMH 4X9BA 2G5RA 1GZQA 4LIQE 4K94C 2NPLX 5BZWA 2GJJA 2OR9L 1LEIA 3KPSE 4LCIL 1XF4B 5INDB 2KL6A 2VDPH 3C8HA 4S1SL 2G5BA 4LARL 1ZEAH 5KANG 4BSWB 1J1PL 3BISA 4M9OA 3IFLH 4FQCL 1NBVH 1S8DA 3TN0A 3RNQB 1I1AD 5IVZA 4CMMB 4M7LL 1A6WL 3T1FA 3I50H 4PJGA 3RHWK 1B6UA 2W91A 4HUVA 3RTQD 1L6ZA 2CUMA 3VWJC 1T22A 4PJBA 4K23H 2JELH 3VW3H 3T1WA 3MLVL 5CSZA 1T89C 1NDGB 2KZ1B 5IBTL 5KAQF 4NZUH 1MNUH 5ITBH 5TGBB 3L3GA 2Y07L 2RCSH 3JWOL 3L3OB 3S88L 4Z7UA 3HUJE 3X3GH 1RZJH 3GJFB 4NN5B 3DX7B 5CJQH 1CFSA 1KN4L 1Y0LB 1S9VA 3UJIL 4YXLL 4JCLA 4N0UB 3CNKA 5HYFA 4XP9H 4MAUH 4NM4L 4UT7H 5DQ9A 5F1KC 3SY0A 3T2QA 4PJ8D 1MRCH 4N9OB 1GGUA 3L95B 5DD3H 3EDDA 5TF1H 3VXSE 4MJ4A 5CZVL 3UTPE 1J8HD 1XGYH 5TDOA 4M43H 2HLAB 3KYOB 5TE7L 4ZD3L 4NKMA 4JFPA 2FRGP 2R2CA 3QIWC 3QEQD 4NQTA 4XNXL 1EHLH 4AIXA 3PXHA 1KIUA 1RVFH 2FIKB 4G9FB 4HPYL 1HWHB 3F8UB 2EYTA 2F54A 1YEGH 5DRXB 1K2DA 3MBXL 4NHUA 4EQ2A 1CBVH 3MZTA 1HINL 3NH7L 1K85A 2I5YL 5MI0C 4NWTH 4UTBH 4YH6A 5GJSH 3SE4A 1FVDA 4PGEA 3VFGL 3QDMA 1A3RH 4QTHA 4L3EA 5CEXA 3RWCB 3QRGH 1XGUA 2P5WD 4NNYA 4R26L 3BO8B 4DUWA 1N0XL 3FONB 3DMMA 4TVPL 3OAZH 4L29A 4WWKD 5ID0A 3WDIA 5GS3A 3FKUS 2R0WL 5EFIA 1E6JL 4LFHG 2P24A 3QUZD 3DX8A 1IFHL 3BVNB 3KLDA 4NQCD 3RBGA 4AG4H 2ZUSA 2OR9H 4LCIH 2IMNA 1UZ6F 5I66B 2BFVL 4S1SH 4X8JB 1TCRA 3U4BH 5ALBH 2VZVA 1OT2A 4GG6E 1J1PH 3LMJL 2EICA 5I1LA 3MJ7A 2BSSB 4FQCH 4KXZH 4X6CB 1RZGA 5F9WB 3CK0L 5SWSE 3KPRB 4R96B 4M7LH 4WV1A 3GMRB 3ELAT 5KVDH 3GSNB 1PG7L 3O8XC 3KHQA 5JHDE 3QI9D 5I71C 4R2GB 1ZK9A 3I6GA 4B0MM 2D0GA 3PP4L 1UGNA 1A0QL 1DSFH 1R3IL 1M6OB 3TFKC 3F62A 2QHRL 3D3VB 4EI5A 3Q6FA 2ICWI 3IDIB 4K71C 2GJ6B 2FJGA 2Y07H 3JWOH 4N0YL 4ZTOL 5IB2A 3S88H 5JORA 1GYAA 2ARJB 1GOGA 4WHDA 4OCSL 3O9WB 1S7RB 3UJIH 4YEFA 4J8RA 5HJ3A 4PLKD 5CIPA 4N0CD 4JFDA 4NM4H 4GBXC 4QHKI 4YBQC 3QISA 2V6HA 1YY8A 5TF0A 3KYAA 1P2CB 5CZVH 1U58A 2ADJB 4JGMA 3V6FB 3TGXA 2XV6B 4LOUD 4N1EA 2QR0B 5TE7H 3ZMRA 4ZD3H 1A7BA 4CU8A 5CEZL 4Z7QF 2LV4A 1BZQK 5CS7A 2E7HA 4XNXH 4NQUA 3SJVD 4JY4A 3L3IB 4HPYH 4NOFA 5GSVA 2X4TA 3RWIB 3UJTL 2YN3A 3MBXH 2ICES 4ZAKC 1U36A 3ZSTA 4Q97A 3MV9A 1AHWA 2YBRB 4AENA 1HINH 3NH7H 4Q74A 2I5YH 4TUOA 3MRPB 1G9ML 4PB0L 4GJTB 1PVHA 3QUMH 5BQ7B 4LCCB 4KMQA 4W4OC 3VFGH 3MRFB 2HTKD 4L4TE 3HHRB 4R26H 1UC6A 3T3MF 5IBUB 1N0XH 3QYCA 5F7WC 4TVPH 4U2ZA 4XVUD 2NY6B 3C6SB 4I77H 3B9KD 2CLZB 1MIEL 4J4PA 2Z8WC 1SYVB 2EXYD 3SKUD 2R0WH 4XBEH 4U49A 4YPGB 2CXGA 2W0KA 3MXVL 2A9NL 2ENYA 3KDMA 4AH2B 1CTNA 2FZ3A 1RZFL 5E8EA 2DMKA 3MUGA 4WHYG 4HMDA 5IK3A 5BCAA 2WMPA 2E3VA 3LMJH 2OTUB 1QP1A 3MYJB 4I0PA 4L5FL 5D7JC 1MCEA 4WHTA 5DQJB 4GG8B 4IMKA 4ZODA 3CK0H 2EDDA 5D9SA 1U8LB 1WTLA 5I30L 4WDIB 3QUYC 1EFQA 5F7UA 1PG7H 2IQAB 1X5GA 4OKDA 2MCG1 1GIGL 5D7LE 1N3NB 4KAQL 2FEDC 3BUYA 2APTA 4WUUE 1C7SA 1PG7W 4D0BA 4MLIA 3ESVF 3WNNA 2R29L 2WUCL 4FQQA 5IW6A 2EDBA 5K9KA 1S9KC 3PP4H 1JWMB 4HUMB 1A0QH 5D2NB 1SY6L 5GGRY 1R3IH 2WM0A 3DTXA 4G5ZL 1QFWH 2QHRH 1R5IA 4LK4A 1Q0XL 2P5EE 1VGEL 1BQSA 3IU3A 2XN9E 3RUGB 2HN7A 4JHWL 1RJZA 4N0YH 4ZTOH 1NCCL 5D70L 3GJEA 4OCSH 4PR5A 3AU1A 3K2MC 2EDRA 2IAND 3TBYB 3QNXB 1URLA 5F1NA 5D1ZD 1EJ6A 4XI5D 3ZKMD 2YA2A 4S1DC 5E8NA 3BN3B 3CZFB 1AKJA 4N90D 5D7KD 2A1WL 5F72S 3RDTA 2D7TL 1CICD 1Q0YL 1JBJA 2Q86B 4UV7H 4YBLB 5JLZA 4NFDA 3TBWB 2VABA 4R97B 3TPUA 2DKUA 2BSTA 2ZUXA 4LPXA 2W9EL 3K1DA 5BRZB 1WAAE 5HSFA 3UJTH 1A02N 3W9DB 2DJSA 4JE4B 3QNZA 3CFBB 1EZVX 5I1AA 3GB7A 4J12A 2XTJB 4JPVH 5BVPL 5IEKB 3H6JA 3OQ3B 2ZG1A 1R5WA 3M45A 3L7FA 1G9MH 4MX7A 5KTEH 4LCWD 4QGYA 1IAKA 2ED8A 1KIQB 4YK4C 2R0LL 4QRPD 5D4QA 1U42A 3GSRA 5L2KB 2NY0D 4QOKB 3ARFA 3AM8C 3WE6A 3QQ9D 1F42A 3ILPA 4LKCB 4KUCF 1BOGA 1UYWL 2Q3ZA 2EC9U 3IETB 3MXVH 2A9NH 2VZTA 5DMIL 3QEUB 5HHOA 1MCCA 1RZFH 4HAGA 3KAAA 25C8H 1JGDB 3OJMB 4MJIA 4GRLD 2A6KA 1DUZA 4DUVA 4L5FH 5HPMB 2UY6A 1G6VK 1KB5B 1QVOA 2DJ4A 4PD4K 3UZEA 2IEPA 4XAWL 5GPRA 4UIMA 5HVFB 2BY0A 4ZO9A 5FO9B 5KSAC 1A5FL 5EIVA 1YJDC 4KAQH 4LHUA 3FO0H 1FV1A 4EIZC 3SKNA 5HHQB 4JN2A 4WU7A 2R29H 4J2XA 1QSFD 4EDXB 5IMOA 3O2DA 4GAYA 2FWOB 4JHBA 3UPAA 4G5ZH 2XXCB 2CJUH 3G6JA 3MA7A 2DRUA 3WNMA 3B2UC 4EUPA 5F9JB 4PJ5B 1CL7L 1T66D 3ARGB 2EYSB 2FJHB 5CD3A 2IPUG 3QQNA 4F7TB 2AXGA 2VLLA 3FZUD 1NANH 4JHWH 4QRRD 5LGHL 1NUFA 5DMGC 5JW5A 1KLGA 2AKRB 4XZUB 4QCIB 1I7RA 1KEML 2NZ9C 4WW2F 1F02I 3X3FH 1B0GA 3DYMA 1FYTB 3BJ91 4FZEL 3LKNA 1MJ8L 2J12B 1UEYA 4HKXA 3LRSB 2CIIA 3VWKC 1B3JA 4KI5D 5DD1H 5AD0B 5IFAH 3HMWL 2D7TH 5C0BB 2IBZY 1MELA 3SGKC 2C7UB 1T7ZA 1VFAA 3F7QA 4OCNC 2NCMA 4X9HA 3NAAL 5DSCB 1XR9A 4IDLA 2R8SL 1JFQL 2W9EH 5CEYB 3A6OA 3PGDA 1YPZB 3QFDA 4HWZA 4XCEA 5DTFA 5BVPH 3QIBA 4FQIL 4PJCB 5T3XE 1I7ZA 1AR1C 5ICZA 1JN6A 5EG6C 3VD5A 2RBLA 4C83B 5I8EA 3VA2C 3FQNB 3OR7A 5CKAA 1FO0A 3DUSB 3I9GH 2QQKL 4Z7WF 3U36A 5MEOA 1WLHA 2R0LH 1EEZB 3ABZA 4Y2OA 2Y6SC 2VXSL 5IQ9B 2XOTA 4U6HB 4YDKL 2NY2C 5E8OA 3EIFA 4HV8A 1JZ2A 1SJHB 1UYWH 2EE3A 1PY9A 4F58L 4P2OC 5DMIH 1MI5D 3S96A 2O5ZL 3RPKA 4PJFB 5DC4B 4N1CA 3W0WA 2PTTB 4MS8C 4UNVA 3AREB 4HBQA 2CLRB 4CNIB 3PG2A 4XBPB 4OLUL 4XAWH 4R6UA 1B88A 1W0WA 5GJTL 1A5FH 3BDYL 5FV1L 1KTDB 1Z5LB 1HHGB 2R2HB 5TQ0L 4HIHA 3QPQD 2MTPA 3DGGA 5L2JA 1D6VH 4JFEA 1CFVL 5TDNA 4N5EC 3WNPA 4P59L 5JO5A 2ZNXA 3B9VA 4F80A 1CL7H 4XGZB 1RIUL 3D6GA 1ZLSL 5TDPA 3MGOA 3GSNL 4G8FB 3S3JA 1B2WL 4BZ2L 4Z76A 5C0RL 1D9KA 4X99B 4IDJL 1T03H 4YZFF 3O41B 4M6NL 2E6PA 1KEMH 2MQ3A 3KPTA 4FZEH 5D7IB 4K8RD 1MJ8H 3LDBC 3D85D 3SE3A 2YD2A 3FOLB 3HZMA 3E6FA 3VXUE 4Y4FB 3O3EB 5BS0D 2V5RA 3HMWH 1DN2A 1I4FB 4CKVX 1ZLWH 1X7QA 2ZOKB 1CGYA 4KTEL 4K07A 3SKOA 4CVXB 2NLJB 2YD6A 1FLRL 2NX5D 1II4E 2R8SH 3Q1SH 3CSBA 1JFQH 3GGWB 1BHGA 4W68A 5KG9B 2GUOB 4TULL 2YD8A 5GRWA 4OZ4B 3KPQB 4RMWA 4FQIH 1OT1A 1E4KA 2UWEA 1INEL 4WVRA 3K46A 1C08B 5IEHB 4KJPC 1JPGA 4BQBA 4CUCA 2QQKH 1VEPA 2EDNA 4XNMA 1H3GA 3ULSB 4NN6C 2OMNA 4ZFOB 4XAKE 3D0LB 5CGYC 3BP7B 3OGCB 1FFNB 4P2QD 4EOWL 4Q2ZA 1N59A 3GIVA 3HRPA 5E9DB 5EN2A 3KPMB 1YEHL 5C0IA 5CJXC 4F58H 3UAJC 1JGLH 1KGCE 2O5ZH 5KN5A 3RIFF 1OB1B 3PIQB 3HE6A 4OZHB 1H3UA 5DK2A 1K6QH 2GCYB 3FAWA 2AK4B 43CAA 1JGEB 4M61A 4YUEH 1VFOA 4V1DD 2X4OB 5HYJE 1OPGL 4OLUH 2AJYL 1HHIA 5GJTH 2G60L 1MOEA 3QIUD 3BDYH 4CN1A 2VZUA 2DQEL 2GK2A 3IDYC 1UT9A 2CMRL 3W2DH 4MD4B 1NDMA 5TQ0H 3DVNA 3QWOB 1IC4L 4NC0B 2ATPA 4JY6A 2QSTA 4XRCB 1CFVH 4P59H 5DHYA 1ZHLA 3MOAL 3PWVB 1QFPA 1T3FA 5I74C 1P4LB 4C56B 1ZLSH 3VFUB 2YD4A 1Q9OA 4BZ2H 5IVXE 5C0RH 3BZ4A 4IDJH 4P57A 3QQ4A 5LWYL 1DE4B 3MLXH 3SQBA 4CMHB 4M6NH 4FABH 4PJHE 2VDML 3T4AB 1ZWIA 3MROA 3LIZL 5E2UH 4KK9D 3CDFA 5M7QA 1S7TB 1JP5A 2Y23A 4U1KB 3PV7A 1BWMA 1ZA6B 2WWMC 4S1RL 4F57L 2OTPA 2JTDA 3EYVB 4KV5E 3PGCB 5EIIB 2C4XA 2FSEA 1I8LC 3R8QA 2D7OA 5EUKA 3PV6B 3DX9A 4JO4H 1FLRH 2DQHL 2AJXL 4R4BB 1T83C 1D5MB 4WO4B 2QLVB 4I18B 3NIGF 4G7VL 4KH2A 1HEZB 4PV9A 1XAUA 3QDJE 1MIMH 1HDMB 4WW1A 2E8ZA 1ZVSA 3NFSH 5IHZA 3RGVA 4MDJB 1UWEL 3U2SA 5JNYA 2BY3A 4E41D 4ZSOA 1O5DT 4KFZC 4YGVA 4KGJA 2F19H 2DBLH 3AB0C 3CDYA 4XTRC 3D48R 3BQUC 1CWVA 3OAYK 4NFBA 4OLYH 2APFA 1DN0A 4NQXB 2H8PB 1QUNA 1PSKL 2B2XL 4EOWH 4X6CF 2R2BA 2VLKA 3VFOB 3IVKA 5ANMA 3J7HA 3EZ8A 2H2SD 3DX6B 5FGBA 1YEHH 4UQ2B 3SDAB 2JIXB 1MCIA 3ARUA 2W60B 3IXTA 4P3DB 4ZXBD 1TJGL 4WFFD 3P77B 1MUJA 1J05A 3X12B 3WN5A 3FT4A 1LDPL 4Y5XB 3ES6B 5CJOL 3UTSD 1MJ7H 2V9RA 4L9LC 5BZDA 2HMIC 3BIKA 4RGMC 3IFOA 1DTUA 4PRHA 1L6XA 3NFNA 2BY1A 3MLYH 1EEYA 1OPGH 2SEBA 1JNHB 2AJYH 4YAQA 4IIQB 2G60H 5ADOH 3EDEA 35C8H 2DQEH 2CMRH 2Q3AA 5DJDA 3U46A 4Y2DB 1BVLB 4YHOH 1EX0A 2C3HA 3MOAH 1KB5L 3TEUA 1BQHA 3NZ8A 4OAWB 3D39A 4HUKB 5A1AA 2R9HD 2Y36L 4HUXB 2UZIL 3FFCD 4OGAD 5D1QC 4HC1A 1XMWA 1IQDA 2LABA 2HT4C 1UKSA 1KLUA 3TV3H 2VDMH 1UH2A 1H8OA 5F9OL 3LIZH 3H9SE 3HC3L 1EH9A 1A1NA 5C8JB 2JJWA 3W9EA 4S1RH 4MJ2A 4WRLA 4JM2A 5HVHB 1IC7L 2ZZUT 1X5JA 3K4DA 2B7DT 1ZANL 4MD5B 4RIRA 3MR9B 2YOCA 1OLZA 3RGHA 1QRNE 4HIIB 2DQHH 2AJXH 3OKKA 1UXSB 5JIKA 3QULB 4CVZB 4POZD 1BFSA 5HHVH 5IMKA 3WS6C 5KZCD 3KYMB 5E24E 2LTQB 4G7VH 4QT5A 5A2LH 5T1DL 5L6YL 2W65B 4XVJL 1HQRA 2H45A 1SMOA 4MAYA 4NQED 3MA9H 1UWEH 1V3MA 4NQDB 3LEXA 2ZUYA 4LVNC 4BSJA 4LVHB 1ZLUH 4PGZA 1R24B 2KZWA 4Y16C 5F88A 1X6LA 1OGAB 3IJHB 3V6OE 4GKSB 5EBGA 3M1BA 4MVBD 3RWHB 3LOWA 3SPVA 1WGOA 2WBJC 4WJ5A 5FYKL 5F6HI 2X1PA 3U6RA 3UZVB 1N5AA 5FA3B 1F45A 2HRLA 1S5HA 3IXAB 1RD6A 1TJGH 3C6LB 2B39A 4QY8A 1ZT4A 5FM8A 2FHFA 1S78D 3DV6B 1HI6A 5GIRB 3LRGA 3EO0A 4RQQB 3ILQD 3RRQA 5F70A 3GK8L 3CJJA 5FO7B 3MSPA 4RRPA 3QJHB 3TVMC 3FAXA 1K4CB 1GGIL 4XXCC 2FO4B 2Q8BL 5I19L 2AXHA 2EYRB 5CP7B 3V6OC 4ETQA 1NEUA 2AJ3A 2HFEA 4FFZL 4MB5A 1KJ3L 3KXFE 5TFSL 5EUOF 4AL8L 1H3WM 1CXKA 1ZV5A 2FEEL 4K9EH 3SDXE 4PJAA 5E5MB 2YPKB 1KB5H 3JUZA 1AIFA 5DEFB 1MHEA 1MFBH 2B5IB 1F3JB 2X6MA 4EI6A 1KV3A 1CDIA 1YY9D 3RWGB 5F7MC 4AK1A 1FORL 1M7IB 4QHLA 2QTEA 5F9OH 4X6DA 3ZHKA 1QQDB 3HC3H 3C60D 1F97A 1SMAA 2E5EA 5C0AE 2NW2B 1BPVA 4JFFA 2QADB 4FZ8L 4QXUL 1CD1B 1VACB 5EH1A 1CYGA 2FB4L 5SWZA 1MHCA 5EO9B 5CLWA 1JGUH 4F37K 3MRHA 3MRIB 5I75B 2VTFA 5EZJA 1NPUA 2A6IB 3MRJB 4JZJA 5TPWL 3BWAB 4K2UL 1GC1C 4NO3B 4MZ3A 4F8QA 3ARPA 4PUBL 2QSVA 3MV7B 3RIAF 3ROOA 3TYFA 3MRNA 1D6EB 1QPPA 1TETL 4Y4HA 2N7BA 2YUZA 5L6YH 4MXWL 4FG6C 2JLLA 5FK9B 1BD2D 3L3JB 5GXBB 5KBNC 1TQCB 1PD6A 3EYFA 4JN1L 1WZLA 4MZ2A 3I3DA 1U91B 2FECL 5B8CB 1ONQA 1CCZA 3VXMA 5FA4A 2BP3A 2UYLB 4D0CA 3U9PL 3D18A 4MSWB 2J8UE 3M17B 4U0RC 4S0SD 5IBLC 4IRJA 1RIVL 1VADB 2E9JA 1RZIA 1CFTA 2X42A 5FYKH 4L8DA 3I6LD 1CG9B 4X4ME 5I1HL 1L7IH 3VI4F 3GUTB 3FO9A 5ID1B 1A6TB 2GT9B 3TCXA 1XR8A 2L4OA 3STLB 1RK0B 1LK3L 5SV3A 4DGVL 2CKNA 1ADQA 1DR9A 4Y5YA 4PJXA 5DJAA 3GI9L 4PTUA 4ZFOL 4APQA 3S9DB 3GK8H 1C16A 4Y4KD 2O5YH 3MNVB 1J18A 3D1MC 3LPGA 3PQYE 1GGIH 5KVFL 4GRMA 4L8CA 2Q8BH 1TZIB 2JCCE 3ZZ1A 4IOIA 1LP9A 2YA1A 4M6ML 5I19H 4QF1B 2NY5C 4LVEA 4YDVA 2B4CH 4MQXD 3FQXB 5EORL 2NW3B 2A73B 5T5FL 2UUDH 1U8JB 4AL8H 3P73B 4J6RH 3H7BB 3EDFA 4UZGA 3FB5B 1LE9A 1NGZA 2I9TA 2NY4B 4PG2C 1DLHB 2CRMA 5HYSG 5IM7B 5DRWA 2A83A 4ZYKA 5IHBA 5DZLA 4KKCD 1RZJC 3S5LA 3B83A 3FN0L 3KPOB 1UEMA 3ZE0E 1PKQE 3S6CA 2HKFL 4OV5B 1FORH 3MV8B 4ZFGL 3QQ3A 5J8OA 4XPGH 1KJ2A 4Q6YA 4LAJH 5K9OA 2W0PA 5IKCB 1KT2B 2YWYA 4AM0A 3BUTA 5EB9A 3EW3B 2YZ8A 5JOFB 3BPCB 4FOMA 5EU6D 4FZ8H 4LHUG 4QXUH 2GTZA 1J10A 4GMSL 1E4JA 1FG2A 1WBXA 1BLNA 4KKBD 4PJCF 4U1GC 3CUPB 3V6BR 1MCNA 5TPWH 4AEEA 4Z78B 1W72B 3N85L 1ETZA 4EUPG 2YKLH 5F6IB 4KRPB 2BXYA 4DVBB 3KS0H 4PUBH 5E08L 1UH4A 2BCKB 2H32A 3KLHC 4K3HA 2BNQA 3MGTB 4JVWA 2VC2H 3L5XL 4RAUA 4U6XA 1SEBB 4ESKA 4MXWH 1ULVA 4Y5VB 1J12A 4M7JH 1WBYA 4LRIA 4EBQL 4TQEL 4WFED 4DAGL 4C55A 5JXED 4QKXB 1JVKA 2XZAL 3OKMB 4PJFF 3ARZA 3U9PH 5IQ7L 2VLRD 1I1AC 3IGAB 1YDPA 2VIRB 3EYOB 3HPJB 3BZDA 4BQ6A 4HUNB 4JRYB 5BJTB 5EU5B 3WEXA 5BO1L 1RIVH 4NP4L 2NMSA 2C1OA 4LCYB 4JRXB 1K8DA 1CFQA 5M95B 4NRZB 1A22B 3RTQC 2AEPL 3R1GH 3OKEA 3GSOA 3ORJA 4IJ3C 3MRBA 4D0DA 5FUZH 2WBKA 15C8L 4JY5H 4OQTH 3GI9H 2OS7A 3BAEL 4JB9H 1DUYB 1NFDF 3TBVB 3IDGB 4MQ7A 1EO8L 3MMEB 1QOKA 4M6MH 4HH9A 5SX5H 5IIEA 4LLVB 1BWWA 5EORH 1EFXD 4JPIB 5HBBA 1NEZA 3Q6GL 4LU5L 4JO1L 1DQJA 2IADA 4PJ8C 4X83A 4YHYC 2JF1A 3T3PF 4B50A 5D7IF 5FOJA 2P5WE 2CKBA 3FRPG 5D6CA 5C0ND 3K1KC 1YQVH 3TA3A 1DQQA 2AGJL 4ONOA 3FN0H 3SGJA 4QXGL 1CXIA 2V2TB 5HDOA 3FT3A 3IJYB 3PNWA 4P5MA 2FD6L 3WUWG 4RMRA 3FB6A 1CE6B 2GJZB 4PRBB 4GMSH 1R3JA 4Y1AD 3EGSA 2EDOA 1LQSR 4U3CA 4OZGB 4PJIA 1PG7X 2XPGB 1JYVA 1E4XI 4HZLA 2HWZL 2DLEA 3I6KA 5E08H 3IDNB 3TJEH 4WWKC 4RGND 4U33A 5K9JH 3L5XH 2AP2A 4WCYL 4FA8A 5ESQB 1EVUA 4G43B 1FVEB 3I02B 2PYEA 3JZ7A 3C5SB 3UBXI 3UPCA 1LE5A 4EBQH 5MP6L 4JDZB 4TQEH 3RAJL 4R0LC 1DBJL 3HKFA 5IOPB 3FQTA 4LSQH 4H1LA 4OZHF 4PRIA 3VWJA 1HOCA 1LD9A 1A6PA 1XH3A 4JDVA 1VKXA 4ZFFA 2APXA 5BO1H 4NP4H 1T89A 1GZQB 1VCAA 3QI9C 3KPSA 5BZWB 5C07E 1LEIB 2A77L 1GL4B 4X4XA 2G5BB 4JAMA 1G9NH 15C8H 4G3YH 4OKVA 1S8DB 3TN0B 3SJVE 5DI8A 5IVZB 3BAEH 3HPLA 1UM5L 1DZBA 4GRWB 1ZGLA 1FNHA 3T1FB 4PJGB 2YWZA 4BYHA 3K81A 1T21A 2DQCL 4PRAA 1MF2L 1T22B 2P46B 3VXNB 4PJBB 4PLKC 5E7BA 4N0CC 4NKOA 3Q6GH 1PZ5A 2COQA 4LU5H 1FL3A 4JO1H 3QIWA 5CSZB 1NMCB 2ZUTA 2FO1A 1WCBA 2MNUA 3BKJH 1TJIL 3H9HA 4IM8A 4LOUC 4LDOB 3L3GB 1S7SB 3HUJA 3V5DA 1AFVL 4Z7UB 1T1YA 5C71A 2ZWLT 1CFSB 3BPOC 1JGVL 3I3BA 1S9VB 3L5IA 4QXGH 2YS4A 4HKZA 2P45B 1AO7D 1KXVC 3X17A 3RZWA 1FGVH 5DQ9B 3T2OA 5IJKC 4DCQA 3VXSA 1J0HA 4OBRA 3LRHA 1JRHH 5HHMB 5TDOB 2BDNL 3A6BL 5EBMB 3EOBA 4NKMB 4PLJD 4JFPB 3DLQR 3CMOL 4AMKL 2IAMD 2YD5A 4F15C 3CXHJ 3O4LD 3C9NA 2DQDL 5SX4H 4I9WD 3DECA 3F5WA 2EYTB 2F54B 1K2DB 4LEOA 4NHUB 2L7JA 4LDEB 4H20H 2GFBB 3PXJA 3B9KC 2H9GA 4P3WA 4WCYH 4WUKL 1RK1A 1QTYT 4MA3A 2NY3D 4S1QL 3KWWB 4PGBA 1FVDB 5DF0A 2ESVB 3QDMB 2PXYC 4L3EB 4OCXL 4HG4J 1WF5A 5CEXB 1A9EA 1RMFL 2DKSA 3O8XA 1XGUB 4NNYB 1BBJA 3RAJH 4PYHA 3DMMB 4NHCL 4L29B 3MOBL 5ID0B 1EGJA 2IANE 3GBML 2CSPA 4OM0L 3H3PH 4J3SA 5EFIB 2P24B 1E4WL 3RVXD 3DX8B 4XCNA 4LLMA 2CDEA 2BVYA 1DCLA 4N90E 4KRLB 5D7KE 4L4VD 2A77H 5HHPA 3RVVD 5CD5D 2D03H 1LDSA 4XHJC 5DRZA 5L8JB 4GG6A 1TCRB 5I1LB 3MJ7B 3NABL 3WFBL 1RZGB 1UKQA 2AJSL 2DIJA 4JFHD 1JWSA 4NJAL 4WV1B 1INDL 1UM5H 4OI9A 4GBXA 2IPTH 5JHDA 1K9TA 3EYQD 3EJJX 2DQCH 3JBG7 3I6GB 1OP5H 5J57B 4ZOAA 1QFHA 5D1ZC 4JG1L 3ZKMC 4GAJL 4DQOH 4EI5B 4LCWE 3Q6FB 3HMXL 3LV3A 1TJIH 1CICC 4KJYB 3LKRA 2J6EA 1JK8A 2FJGB 4QRPE 1FSKB 4ZAKA 4F2MA 1AFVH 1CGVA 3MLRL 5B38A 5IB2B