4LIQH

Structure of the extracellular domain of human csf-1 receptor in complex with the fab fragment of rg7155
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDISWVRQAPGQGLEWMGVIWTDGGTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDQRLYFDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Targeting tumor-associated macrophages with anti-CSF-1R antibody reveals a strategy for cancer therapy
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH01
2B2XH 4M6ML 3EOAA 4BFIB 4JREB 5E8OA 3QDHA 1J8HB 3QEUA 2DWEB 4U1KB 1VCAA 2LTQC 1T22A 2GQHA 3CLFL 5KOMC 3ISWA 4ZD3H 1KIPB 2IFGA 1EBAA 3S34L 3HI6L 5IBTL 4N0YH 5CSZA 3C9NB 4YX2H 4KKNA 3NTCH 3MBEB 3LMJH 3OR6A 1I3UA 5BJTA 4OCLC 3S9DB 4XTRD 3RJDA 1FL5B 4X6CF 3ZE0F 4CNIB 4UBDC 4JHWH 2W65A 4JLRA 5D1XA 4X9GA 1DL7L 4PGDB 5GGRY 5JOFB 4ETYA 5DI8B 5J11B 4H0GA 1D9KA 1GC1H 3BKMH 4XAWH 2N4IA 5ITFB 5DA4A 4Z7VA 3DUSA 2HN7A 4GLRH 4LLUB 4YDVB 3MJ7B 5GGSB 5F7EH 1NC2B 2UZIL 1X5YA 5GSRA 4AQ1B 5DO2D 1BJ1H 1EEUA 3S4SA 2LU4A 4YHYB 1N8ZA 1A7RH 3G6JB 2EIZB 4MA8H 3UTSE 3W39A 5GJSL 1S9VA 3LN9A 1YMME 4K94L 3RY6C 4HXAH 2JK5B 2RCSH 3U4EA 4O02H 4LEXH 3HG1E 3U7WL 5IBUG 5DZNA 2FDBP 4KRLB 1U8IB 4OGAC 1MJUH 4YO0B 7CGTA 1J5OL 1QBAA 4G6ML 2ATKA 2DKMA 4PJ9C 1H5BC 1OTUD 1WAAE 3EDJA 4NQVB 5EO9A 5CP7A 2C7UA 4N90E 5EZIH 5J12B 2IBZY 2AXJA 5I1HL 1N3NB 2R2BA 1QA9B 2RIKA 1P4BH 1WFOA 2ARJA 5E9DD 4Z76B 1IGJA 5C09E 1MFCH 5DJ0B 2A77H 1H3PL 3ECBB 1A6UH 4LP5A 1QLRB 4HS6A 2VDMH 5GJTL 4ODVH 5IB3A 5TDPA 2K7QA 2J8OA 1IJ9A 2ICWI 3MACH 3LEYL 5E9DA 3DURA 5BO1H 4PLJD 2AW2A 5HDBE 1LP9A 5T1KD 5I8EB 5JIPA 1RUKL 5JW4R 1S8DB 4LSRL 3VG0L 1A6VH 2VL5A 3KDMB 3IDNA 5FYJE 4ZUUA 4G3YL 4LF3A 3D48R 2ID5A 2XWJA 3GSUA 3UTQA 5E5UB 1HHHA 4AM0A 2C3VA 1U3ZA 2UWEA 3HUJE 3EGSB 4MXVE 1FLRH 1NC4B 1AJ7H 4KDTC 2EYSB 4JQVC 4XH2A 4KHTH 4HFWA 4MGXA 4XMPL 5DF0A 3DVNA 3SGEH 1WLHA 3CFIC 5IESL 4MNGA 3BGFB 2WUCH 3F12B 4FQXD 4FQJL 3VE0A 3QG6A 2X42A 1W72A 2X05A 1ZGLA 4MD4A 3MLTB 4OCYH 4OZGA 3SKOB 1VHPA 4XCEA 3QJFA 4Y4HC 5CKAA 1PQZA 3TFKC 3C6LD 2FL5A 2O61B 5CINH 4FQXA 3DBXB 1F97A 4UMGA 4YEEA 1CFSB 4QOKB 5GGVY 2PXYC 4G8IB 3MRRA 3SDAD 4W6XB 3MSPA 4HX1A 5JDSA 2PYEB 5J6GB 3EYVB 1GZPB 2R2EA 3C6LA 4KAQL 1LD9A 1EEYB 1YECH 5D7IB 3BWAA 1DBAH 4RMWA 3BPLC 1C5CL 3S88L 1AH1A 4XCYB 4HG4J 4AH2B 3TVMD 3SDAA 1AR1D 4XP4H 2NLJB 3VXRE 3GRWA 3RIAK 2DQJL 2VISA 4KK5D 3W9EA 1UA6L 4S1QH 3GHBL 4MAYA 2NX5B 2EEAA 3CFCL 5D70H 4WGVB 1EO8L 1R3LB 4D3CH 3TVMA 4BUGA 4HS8L 5E7BA 4RGMC 1CFTA 2OX5A 3TWCH 1UWEH 5I71C 5HVHC 3EO0A 3OJMB 1CE6A 2HT4C 1R3IL 1KEML 3FT4A 5IHZB 1A6TB 4B41A 3LKQA 1JZ4A 3ARDD 5FGRA 1N6UA 2G5BA 5JUEL 1A3LL 2UUDK 3K74B 2HFFB 1ZLVH 5F3HA 1RUAH 5E7FA 4HPOH 1EAPA 1JUFB 1LHZA 3OR7B 4U6TA 3ARDA 3MMEA 4DQOL 1E4WH 4HS3B 4L4VD 2AJSH 2HRLA 4U49A 2P8MB 4HK3N 5JXAH 5E6IB 1VB9A 4UT9L 4HG4K 2R1XB 4NJ9H 5BW7C 5F89B 4NNYA 2R8SH 2GK0A 2AI0L 2FCBA 3C8HA 3MRFA 4L4VA 4WW1A 2X4QB 4NN6C 3UJIL 4KJQC 4LVHB 1FFRA 3ILQC 2O5ZL 1YY9C 4XZUA 3AGVA 3KPOB 4PUBL 5F1OB 1QBLH 3R1GH 3TIEB 1OTSC 4G6FD 3E6HB 4JZJB 4Y4KB 2VLMD 3V5HB 5FECA 3G5XB 3RAJH 2OJZH 1YA5A 3HMXH 4Y5VA 1I9RL 3IU4H 4YAQB 3ULUH 5TQ0L 3HRPA 5MI0C 3HC4L 3HS0B 5I2IB 4A2MA 4JM4H 3WDJA 5KSBE 5H8DA 4PRPD 1UXSA 5JOPD 3LN4B 5GS3A 3G5YA 3MUY1 3WHE0 2C3XA 2FD6L 4Z8FL 1NAMA 2GCYA 5DJXB 5CLWA 4PRPA 3VFUB 5D71H 2KZWA 1R5IA 5C07E 4NJAH 3CFDB 1OL0A 4WWKD 5HPMB 3BH8A 2P46B 4KQ4H 1CICB 3QZWA 4JB9L 4LASH 4EI6A 4KVNH 5CGYD 5E8OB 1CD8A 3QEUB 5F7MC 3RFZC 4TPRL 1T22B 1OM3H 3QXUA 1FNSL 2PUQT 3L1OL 4WWKA 4Z7WF 5T1DL 2GTZA 1J1XH 1YZZA 3FCTA 1RV6X 4WFFD 2I5YH 5CSZB 2ZNXA 1WTLA 5KTEL 3BX7C 2KPNA 2X4RA 1MFAH 4PRID 3V6ZB 2VLKE 3BJ91 3MOBL 4HMEA 1UZ6E 1WIPA 3O6ML 3BVNA 4GAYA 2OTUA 1S7RA 1CK0H 4NZRH 2EDBA 3LN5A 3BIKA 4PRIA 1TVBA 5JHDE 2JF1A 4Z7VB 2NXZB 3BPOC 5I66B 1KELL 2HN7B 3B3IA 1KCRH 4ONHB 1DBJH 5L6YH 5GSRB 3OL2A 1MCLA 1OQXA 2OCFD 1NEZG 2YA2A 3U9UA 5FOJA 1N8ZB 1YNTA 3RTQD 1DANU 3W39B 2J8UF 1PBYA 5C0CE 2QADD 1S9VB 5ACLA 1E28A 4YQXL 2RGSA 3H3PL 4NQCE 3T2NH 2HJKB 3U4EB 3VXMD 1CXLA 2AERT 1BJ1J 1MCWW 2DQTH 1VA9A 4ZUVA 3RTQA 2Q20A 2GJ6D 1FZKA 4X6DA 2BJMH 4K23L 3EOYG 2F53D 4BJLA 5KVGH 3MV01 3RVVC 3CXDL 5I1DA 3V0AC 4YUEL 5EULV 2EEBA 4YGAB 2GJ6A 1CGTA 2HFGL 3DGCR 5EO9B 5CP7B 4HPYH 4WTXA 2C7UB 3PABA 4UOW0 3M8OL 2F53A 3MGAA 1PYWB 4CVUA 4LFHG 1YPZE 2NY7L 2R2BB 3WKML 1NCWL 3CFKA 3VD4A 3TJHC 2ARJB 4NHUA 1IGJB 2KL6A 3LEVL 1F2XK 3IDXH 3CFEA 1YEGH 4JFXA 1YDPA 4XPGL 4HS6B 3WMSA 5GS1C 2EYTA 5TDPB 3PL6C 4HJ0D 5EUKA 4P2RE 3QUMA 1RHFA 4EUPG 5E9DB 3DURB 2V7HB 4K7PX 2EDKA 3FJTA 4M43L 3EJYD 1LP9B 2ILLA 4RA0C 4AIZB 3D0VA 1A1MA 4ZFZA 3QUMH 3MA7A 1B88A 2VL5B 3IDNB 1W2KT 2V5YA 1P6AB 3BAEL 4LF3B 3GSUB 2XWJB 5IBUB 3RKPA 5T1LD 2UWEB 5T1KB 2X1OA 3FQTA 4LFHD 3BMVA 1F42A 4OCXH 5I19L 4HT1H 4HFWB 4WFHD 3DVNB 3KNBB 4U0RB 1CDYA 3WIIL 4MNGB 5CJQH 1U3YA 5T1LA 1XCQA 3HI5H 4YHKH 4XPHH 4I3SL 3QG6B 2P4AB 5FO9A 1W72B 4IBLT 1MCWM 2YA1A 1ZGLB 1CXKA 4U1SA 3DVIA 3QWOA 3QIWC 2FWOA 3PGCB 1DVFD 3QJFB 4XCEB 5ANME 1YYML 2WSKA 1PQZB 1KG0A 1NUFA 2J2ZA 2Y06H 3STLA 4FQXB 2WBKA 3NIDE 1DLHB 3NAAH 3MA9L 4JO1H 5SWZD 4CUCA 4BZYA 3MRRB 3HNTL 1DVFA 4HX1B 4AENB 5E99L 5JDSB 1W72L 4DUXA 2R2EB 3C6LB 5I73B 2ZCHH 1LD9B 3BWAB 4LEOA 2X40A 4CRPA 3NACH 5SWZA 1KIRA 4QRSB 1F4YH 2OQJA 3PQYE 2YSSA 3K2UL 3SDAB 4O00A 3VXOA 1H0DA 2VISB 3W9EB 5GGUA 5HHQB 4L9LC 5BVPL 4X5XA 4JFYA 5L8KB 3ARWA 2LABA 4M02A 3ARGC 4HGKC 1GL4B 2ZCKL 4JRYE 3TVMB 4AMKL 3S37L 1X5KA 3P0YL 4G7YH 3UJTL 5DQJA 5IROA 4FXKA 3EO0B 4HUVA 3FT4B 2VXUH 3V79C 4O9HL 4X8XA 1EFQA 1XF4B 3LKQB 2V7NA 1JGVL 2G5BB 5DUPH 1PSKL 2Y36H 3V6BR 5EN2A 3BPNB 3QWQB 4PTTA 4ENEC 3K3QA 4XVUD 2EKJA 4S0SD 5F8QC 5F3HB 4RGND 1ZS8A 4QXTA 2APTA 3DETC 1EAPB 4FMKA 3NCMA 4KJPD 3PXHA 5C0DA 1NKRA 3ARDB 1JWSA 3FN0H 3MMEB 2NR6D 5DJ2A 1Z0MA 4XNUH 3L5WA 4QHKI 4AY0A 3TYGL 4MMZC 4R0LA 4U6VH 4URTB 5DFVD 3TA3C 4N0CD 2M8XA 5LWYH 4L4VB 3EO1B 3Q1SH 4WW1B 3MUZ1 4D8PA 3PWJA 3ZHDA 2VDOH 1AGFA 4HC1L 4XZUB 4F37K 3D39E 1NCCH 2EDDA 3MUJA 1KEGH 1AI1L 1F2QA 4YC2B 5DR5H 4AYFA 4A6YA 3CDGA 3TT1L 3N85L 4JDVA 4X99B 4HIXL 5FECB 2X6MA 4Y5VB 3MLVL 4HBCL 4DN4H 4A6YH 3DROA 4ZG1A 3BKYH 4G6FB 3A6BL 3PGFH 1P9MA 1UXSB 4C57C 4FQCL 2BSSA 3G5YB 3GZKA 4LKXA 5B22A 3CSGA 1O5DT 5J57B 4N0FB 1NAMB 2GCYB 1KCKA 3G04A 3FO9A 3UC0H 1ZLVK 2W0KA 4BELD 4PRPB 4NGHL 5IGXH 1HQ4B 1A14H 4MJ2A 4XAKD 4QRTA 1R5IB 3UZVB 1KTLA 3BH8B 4NSKA 3T0XA 4EI6B 2DQIL 5GGTL 3BP6A 1NCNA 4D2NA 2QR0A 1WV7T 4V1DA 3TBSA 3X17A 5DVOA 3RGVD 3MXVH 2GTZB 2IPTH 5TQ2L 3FCTB 4PB0H 3HNVH 2M1KA 6FABL 1OD9A 3P30H 1YYLH 2X4RB 1IC5H 2D9CA 3QXWA 1EGJA 3RGVA 1EVTC 4M1GL 4D0CB 2AXHA 2PR4H 3RY5A 3BVNB 2OTUB 1S7RB 4L4TD 5DFWH 2F8XC 3BIKB 1EGJH 4LU5H 1RI8A 4PRIB 1TVBB 4BK5A 1RU9H 3DX7A 3SE3A 3B3IB 5JZ7C 3MXWH 3OWEA 2E6QA 3NMEA 1JF1A 4LL9A 5C0BE 3S36H 4PJAE 4L4TA 1QQDA 3VGHA 2P1YA 5IEKA 2VUOA 3D18A 3U9UB 3EYOA 4JKWA 1C08A 1LK3L 2P44B 4M93C 3T1FB 4MS8C 5D7SH 4OCRH 1G84A 3B8SA 1UKQA 1HHJB 3L95A 3EOTH 1Q72L 3C09B 1V05A 4XBPA 4G6JH 2C26A 3FQUB 4ZUVB 3RTQB 2QADB 3WNNA 1FZKB 4ODWA 4M00A 2C3HA 4OZHB 2W0LA 3QXAA 4XNYL 2R0ZH 5MEND 4JHAL 4KMTH 2L7UA 1R5VB 3TN0A 4PJFE 3VXMB 5I1DB 2XQBL 4BA8A 2GJ6B 5F9OH 1FRGL 5GISH 3B9VA 4JO3L 2F53B 1E6OL 4Q97A 4G8EA 1MELA 3ZYJA 1CWVA 4WU7A 4NHUB 1RZIA 4TUOA 4PJ5E 1YQVH 2AP2A 3CFEB 4JFXB 1I9IL 4H20H 4JFDD 1FYTE 2DBLH 2XNAA 1NEZB 3UXFA 2DRUA 3H9SE 5EUKB 4UOJA 2NMSA 3TNNA 2Q76A 5C08E 5IUSA 4B5EA 1NMAH 4Q6YA 4JZNA 4RMRA 2Q3AA 4JFDA 1MCPL 3D0VB 1A1MB 4ZFZB 2VH5L 3MA7B 4KI5E 4NZUH 2Z93B 1IAIL 3F65A 4S1RL 3ZSSA 3QCVH 1NCAL 4C59B 2D7TL 2QKIB 5F1NB 3FQTB 5CD3A 4P23C 4ZDHA 1KBGH 1OTTD 4ZNCD 5TPWL 4PJCE 4ZO6A 2X09A 3RKDD 4YGVB 5FYKE 5T1LB 1XIWC 4NWTH 4LBEB 1KN4H 5FO9B 3F6LA 3O6FC 4PS4L 5IM7A 2HVJA 4JG1L 4U1SB 5IFAH 3QHZH 4NRYA 3STLB 4U1GB 1KLGA 3HE6D 3AY4A 4TUJA 4H1LG 2WLYA 4YXKH 4EUPB 1HINL 4FFVC 3RPKA 4Q9RH 1VFUA 4ZFOA 3S8WA 1DVFB 2D9QB 3QHFH 1FDLL 4P3WA 5T1MB 1NGQH 4FTVD 3FO1A 4ETQA 1CLCA 3DV4A 1GGIL 4LEOB 4UV7L 3HE6A 1KIRB 4Y19E 3VWJD 4Y5XB 2OQJB 3NABH 1K9TA 4POUB 1Q38A 1MPAL 4B53A 3VXOB 1H0DB 2R29H 3QUZC 4FTVA 3ZKMD 1V7NH 2DWDA 3T3MF 4JFYB 4MXWL 1JRHH 2CH8A 1NGZA 4YWGH 3K81A 3UP1A 3WO3B 3VWJA 1KV3A 2IFFL 5DQJB 1MNUH 4OIIH 2Z8WC 1Y6NR 4YHIA 4FXKB 5C2UB 1NLDL 4HUVB 1SYSB 3QPQD 5FKPA 1Q9WA 2G5RA 4M61A 2WLZA 4LCIL 5IMOA 3IDJA 3QDGB 1IMHC 2NY6C 5B4MC 2V7NB 1WIOA 4IOIB 2BOCA 1DFBH 5EN2B 1T2QH 4PTTB 5I1CH 4OI7A 5F7FA 4H1LA 3RIAF 3O6KL 2YC1A 4QXTB 2R9HD 1JZ3A 3IDMA 1A8JH 1RIUH 3U2SB 1J0IA 15C8L 5C0DB 2OR9H 2RBLA 4N8CH 4Q0XL 3LKOA 1RUPH 1SM3L 1BAFL 3QEQD 3L5WB 4RGNB 1JPTH 4OM1H 4AK1A 3ZE2F 2W0FA 4I2XE 1FGNL 2EXYC 4XCFH 1AKJD 1UC6A 4D8PB 5IFJA 4N5ED 2J88L 2Q86A 5TF0A 3DYPA 3QEQA 1AGFB 2Z92A 4JM2D 4X4ME 4OZIA 3BN9D 2V17L 4FZEH 1LNUA 1QFWH 2BFVL 4IRZH 5EC2B 1DUZA 1AKJA 3VFGL 4K94C 4Z95L 2QQLL 3RWIA 5HI5D 4DTGL 4TULL 1FE8L 1X5IA 4A6YB 3CDGB 3MRBA 4JM2A 1DJSA 1E4JA 1H8SA 4JDVB 1AQDA 1QR4A 1MH5A 1TETH 5E2WL 2EDLA 4NWUL 3MTRA 4M3JA 2XKNA 4W68A 5J1AA 2WWKT 1A1OA 4EZMA 1EHNA 1ITBB 2YRPA 2VITA 1CE1H 2HVKA 2BSSB 2OI9C 5CZXD 1DZBA 5F1KC 1MREL 4HLJA 1RULH 1F4XL 4LOUC 1G6VK 4YBLB 5SV3A 1N7ML 4MJIA 5E8DL 2F9BT 3FO9B 2NY1D 3K8LA 1FFNB 2IBZX 3C5ZC 3O9WC 4OM0H 1LK2B 4QRTB 1XGPA 4X80H 4DEPC 4LLQA 1ADQL 4MCZA 2YXFA 1H3XA 3CX2A 3F7RA 4GW1B 4NSKB 5LKNA 2D0FA 4FZ8L 3RWDA 3U36A 4EIGB 2YPKB 4L8BA 3KR3H 1OAUH 2OTWA 3B4NA 3S96A 3L5XH 3LH2L 3BP6B 4KI5C 2QR0B 4KY1H 1MAML 5HHXH 1R0AL 3TBSB 3ARBA 1JMXA 4GMTH 5IVXA 1RZFH 4MYWB 3T2OA 4JFHD 2OJEA 4LMQI 4HWUA 5F7NC 3O4LD 3CMGA 2F54D 2Y9RT 2PKDA 2FBJH 2DTMH 5L8JB 1F6LL 1RJZB 4PRDB 2B4CL 3K1KC 5KVDH 3RGVB 4PJXA 4DKEH 3V6OE 4U1MA 3O4LA 1AC0A 2F54A 3V4UL 3HHRB 3H3KA 1HCVA 2DLEA 5AWNL 2O5YH 3DX7B 3U0WH 4PJ8A 1TJIH 1DSFH 2FBOJ 4HFUH 4TSAL 4G5ZL 3T3PF 5AZEL 7FABL 4P2OD 4L4TB 1QQDB 5J6HA 1V7ML 5IEKB 4X9HA 3EYOB 5IT2L 1C08B 4K3EL 3KLDA 2CR6A 2A1WH 4GSDH 3ALPA 1P53A 1X44A 3L95B 5E08H 1N0LA 3AS0A 5IB2B 1H3VA 4P2OA 2DS4A 3VI3F 2D4DA 1ZWIA 4M6AA 1AXSA 4Z6AT 5L2KE 4ODWB 1I8LA 3ARFD 3QXAB 3FKUS 2APBA 3W11C 1IM9D 1N5AA 5CGTA 3D1MC 4ZTPL 3CVHA 3GMQA 5DMJB 4RX4D 1CIDA 1XZ0A 2DQFA 4OQTA 1NGYA 2DQUL 3ARFA 2CLVA 5MENB 4KUCD 4TTDD 1FZJA 4DW2L 4RDQG 1F8TL 3UYPA 3GEWB 4RX4A 4M8QA 3F58L 4WU7B 4OQTH 1RZIB 3CD4A 5FA4A 4EIZC 2YD3A 2OL3H 2NCMA 1T6VN 1EK3A 3ZE0E 3D5OF 2AV7A 4XPBH 3RZWA 3IDUA 4F3FA 2BHYA 4DGIH 4OJFH 4MAUH 1OQOA 1O0VA 1T1ZB 1XGQA 2YN3A 5EOCH 2YUXA 3TNNB 2Q76B 1KB5H 3S7GA 4JZNB 2YUWA 3DPBA 2IG2H 4H26A 1LO2L 2R4SL 2Z4QA 5LCVH 3CIQA 1KENH 2QQKH 4LHUG 1BQSA 1OAKL 1W8NA 2VO5A 4UI2A 2Q8BH 3MJ9L 1MFBL 3T77A 2VZ3A 1MCOH 1FFPB 3MLYL 4K7FB 4QTIL 4W6WB 2DIAA 4ZDHB 4XNXH 5IF0A 5C92A 3CSPA 3RVXC 3NCYP 3WO4B 2A6IA 2DL9A 1KIQA 1MLBA 4MJ6A 5IHLB 5E6IC 5IM7B 1B2WH 2HVJB 3WDHA 1RZKH 5CZVH 4JY5H 1NBYA 4GAGH 1ZANL 4ODHH 3WXWH 3P3YA 4AEEA 5IHUL 1LO0H 1E27B 3WFBL 3UCRA 3SCMD 4I8DA 1KLGB 2DMKA 4F7CA 4TUJB 4LVHC 1T4KB 3V95A 2VDLH 3KXFE 3MJ6A 4ZFOB 1RUQL 3LSOA 4XX1E 3CMOH 4CBPA 4ETQB 1GXEA 4WHYH 2WAHA 1IC4H 3DV4B 3PIQB 3QISA 4ZOCA 3SCMA 4QXWA 3OBAA 5F3BB 3RNKA 1G9NL 1QNZL 4X7SL 4Q74A 5FCUH 1SBSH 1YEIH 4FTVB 3ROOA 5GRVK 4C56D 1FVDA 4GBXD 1A5FH 1P4IL 4IOFC 3IJSA 4Z7UB 4MVBC 1NGZB 3VFTB 1T1YA 5HHOD 4XVTH 2CJUL 3VWJB 2EECA 4PIRF 3ELAT 4H8WL 4JQIL 5D5ME 3SKJL 3NCJH 3BD5A 4POZD 2B1AL 3IDIB 4WO4D 4C56A 4LPYA 4GBXA 3OXSA 4YHIB 1HXYA 3G5VA 3RUGA 1HH6A 5ITBL 5FKPB 5ISZD 1JBJA 3S5LG 4KUZL 4M61B 5IMOB 2LFGA 1DQQB 4RA3A 3V6OC 4U31A 4WO4A 1DBBH 5BMFH 2BOCB 2XA8H 3RDTC 1CICC 3SE4A 5ISZA 4H1LB 3VFRA 2YC1B 4XPFH 2B7DT 4GXUM 1EH9A 5HHNA 5DA0B 1CGSH 4JG0H 3V4VL 1FIGL 5L0QC 2QHLA 5LXGL 3LKOB 1G9ML 3MBXL 4OD3L 1QBBA 5D2NC 2YD2A 5TE4H 2AEQH 4LCWB 1QHOA 1JK8A 5LBSL 4XB8A 3BEWA 4XHJD 2W0FB 5HDOA 4M48L 3WFEH 2H3NA 4U6HB 1NANI 4NO3A 3T04D 5IFJB 4JVUA 3FOLA 3QFJE 1ED3A 3ZKXB 5KS9B 3QEQB 3CZJA 3O6LL 4PJIA 3WXVH 4OZIB 2BNUA 5FAAA 2OZ4L 3JTTA 3ZL4H 1YEHL 3SGJC 1AKJB 1IKNC 3RWIB 5ETUA 4FQPA 2NXZC 3C8KB 3N9GL 3QXTA 5C6WH 1FGVH 1N6VA 3K7UA 3S5LA 4D0BA 1R3JA 2EEDA 1U41A 3MRBB 4JM2B 3ZE1F 1J88A 3PP3H 1S3KH 3ORJA 1U8LA 5F70A 2XRAL 5GGQH 5J1AB 1FO0H 2BSTA 4UTAL 3ZYIA 2FGWH 3U9PL 4LLVA 4OZGF 4GXUN 2VITB 4JJ5A 4NCDA 4Y2DC 3P4NB 3VXSE 4WI8A 3HR5B 3IFOB 2HVKB 4LLWA 5DUML 4Z77A 5GZOC 4PLNC 1EX0A 3AS2A 4PG2A 1XF5B 1MIML 1U93A 2F19H 1MRDL 4F37F 4P5KA 2IPKA 5ERWA 5I1EL 1U91B 1WCQA 4N1CA 3KWWB 1XGPB 2OSLA 4MCZB 2E7CA 4ZO9A 5AZ2H 1NGPH 4UV4L 2M2DA 3T4YA 3UO1H 5I17A 2NY1B 1CQYA 4U3HA 4LSSH 4O58H 4L8BB 5AEAA 4ZUSA 3WYRA 2OTWB 1DQTA 5EU5A 3ETBF 5IVXB 1A0QL 2OJEB 1WF5A 3QAZC 3VD3A 4YE4L 3QCUL 1DDHA 3RHWK 4E41D 1XR8B 3OAYH 4PJXB 1TXKA 2ADGA 3MODL 2F54B 5DJ6A 4FFZH 4EVNB 2VIRA 3BRGC 5IW1A 2XZQL 4ZFGL 4E41A 5GS2D 4OFYD 3IT8D 2WK2A 4ZS6D 1JFQH 2VR4A 2MFNA 1DQMH 4R4FH 4DGYL 1OGAD 4RFOH 4MB5A 4W6YB 3EIFA 1H3GA 1DN2A 1S78C 4PJBA 2WMPA 4OFYA 3D3VA 1MCRA 2W9EH 5FYLD 4JPKH 1OW0A 2CGRH 1OGAA 4FMFA 2DLFH 5F21B 3QG7L 4MQSB 3HB3D 1ZWIB 3QRGL 2AJXL 4PRNA 1MJ8L 1AXSB 3AS3A 2EDFA 2WP3T 4JPWL 1G7HA 2EDWA 2BXZA 1HWGB 3W81A 1BZ9A 3GSNH 4FHBD 4QNPF 5FYLH 3CVHB 4P2QE 3S35X 1IGFL 3ULUF 1XZ0B 5J1SC 4Z7WE 2DQFB 1NGYB 1IAKA 3ARFB 5FO7A 2CUHA 4XMKL 2AGJH 1IM9B 3BZDA 1G6RA 1FZJB 3K2MC 3OXRB 1OP3H 4JDZA 5B3JF 4PJGA 3VU2A 2I26N 5EA0H 5FA4B 2BVPA 3JWDL 1G6RH 1P7QD 2AV7B 3WLWC 2HYMA 1LO3H 2APXA 5E2VL 2ICWA 3LKRA 3SDDC 1XGQB 3VXTA 3CH8A 4D9RE 1ZHKA 4X6BA 5J3HD 1NMCC 1MFDH 1QSEE 12E8H 2UYLA 4GKNB 4QXGL 3X13A 1P7QA 5JW3L 4PY8J 1N5YH 5ABDE 1T2JA 1R3HA 3WFHA 2GK2A 5DJCA 1K4CA 4FG6C 5EOCJ 3T77B 1U8OA 5F44A 4UAOB 3RVTC 1Z5LB 2VE6B 1H3TA 1B0WA 2YUZA 5IF0B 5T3XD 1ETZA 3T0EE 5GGSY 5L88L 5CBAB 1IEBB 5I75C 2A6IB 1KIQB 1QBML 1MLBB 4MJ6B 4S11A 3QQ4A 1M7XA 3GSXB 1HEZA 3SDYL 2CR3A 3QO0A 1NBYB 1IBGL 4PJEF 1MIEH 1RVFL 1LDPL 4EDWL 4ESKA 4F7CB 3QI9D 1FG2A 1OLLA 1Z9SA 1CL7L 2ESVE 3LSOB 4L3CA 5LGHH 1JZ2A 2B2XL 1AXTH 1VFBB 3MRMA 5DWUH 5F9WC 3SCMB 3QI9A 2EZ0C 5F97E 4YXHL 2JJTA 1WSST 3RNKB 2Z35B 3OKKB 4PTUA 5K9OA 3TBTA 1T21B 3ROOB 5DHXB 1FVDB 3IJSB 1YNLL 3FO0H 4KTDL 1T1YB 1OGTA 4S2SA 1AE6H 3GSRA 4I1NB 2R0LH 4X6DF 1FBIH 5IG7B 4LRIA 5D7LD 4HZLA 4O4YH 4LDOB 1T83A 5C0FA 1HXYB 3RUGB 1HH6B 1OSPL 3JV0A 5SX4I 3A6CH 2MQ3A 5HHOB 2EDRA 3ZKQD 1VGKB 5C0ND 1ACZA 1BGXL 3JWOH 3QB7C 3WKNA 4WO4B 4MWFB 4LMQE 3EDDA 3ET9F 4HCRL 3QNXA 3C87A 5ISZB 1BBDL 2CKBA 1A7RL 4OCSH 4N68A 3Q6GL 1A7QL 3GB7A 3QUYD 5BOPA 3B5TA 4NKQB 2NY2D 3DV6A 2IQ9H 3PHQA 3MLUH 2X44D 2WQRA 5D1QD 2WBWB 3WUWG 1JK8B 2CKBH 4ONFH 2JJVA 4HXAL 2RCSL 4Z7OF 3DIFB 3MRKA 4ERSH 4RAHA 4JKPL 1FVEA 3QUYA 4LCYB 1CLZL 3FOLB 5I1JL 1XEDA 1ED3B 2W1NA 5D1QA 3D25A 2NY0D 4NRZA 3FOMB 2BNUB 1MJUL 3O8XC 3JTTB 3PG2A 4OD1L 5ETUB 4JY4B 1S7WA 4O2CB 1RFDL 2A0LC 1BOGB 3S5LB 4D0BB 4QRPD 1R3JB 25C8L 4M5YL 3GO1H 1IAIM 2ZJSH 2H2SD 1EA9C 4JHBA 4F58H 3DX6A 1P4BL 1U8LB 3MNWA 4AEIL 4UNUA 4K07A 4QRPA 4ZXBC 1U36A 2Z8SA 1PKQA 3JSSA 4WFGD 3FZUC 1IT9H 3FB5A 4LLWB 1T3FA 1NCBH 3AB0B 3LZFH 3MACL 4Z77B 2HT3C 2I60H 2A38A 3QEHA 1U93B 3KPSE 4ZO7A 5EBMA 3WUWA 5I8KL 4JAMA 4P5KB 3KPMA 2GJZA 2BXYA 5ERWB 3U46B 2EE6A 5FDYA 5HJ3B 2OSLB 1VACB 4XPTH 3WN5A 3T2QA 3T4YB 5BS0D 5I17B 4IRSC 4IS6A 3OSKA 2DB8A 1YEKL 1TZIA 5IB5A 4L8SB 5EU5B 4JGJA 2ZUTA 3V7AE 5I6XB 4JVPA 4G8FB 1X4XA 5EBLA 4Q6IA 2FX9L 5BS0A 3E6FA 5E24E 1DDHB 2JE8A 5FIEA 1Y6MR 4EN3D 3OAZH 1BM3L 4G8GD 2VUYA 3X14A 3K46A 4J23A 5DJ6B 3KYAA 4KJWD 1CF8H 5FV1L 4EN3A 2VIRB 4G8GA 2HH0L 1CGWA 5IW1B 3V52H 3V9FA 3PP3K 1LE9A 4E41B 1RZGB 5DJDB 3ZTJG 4P57A 4BSWA 3IYLW 2H9GA 4NQDD 1ZLSH 2O5XH 1P69B 4HXBH 5E70A 1YECL 2MPAL 2BY2A 5EIVA 4JPIB 4DN3H 2X4OB 3DXAE 4PJBB 3X3GL 5I18L 4WTZG 1TPXC 5A3IC 3WD5H 3X11A 4YDKL 2HLAA 4S1QL 5D70L 4KQ3L 5J0BA 2X4SB 4M62H 4GOSA 4PRNB 2YZ1A 5BZWB 1F45A 1UWEL 4XP9L 4DZBA 1G7HB 4TUKH 4UQ3B 1BZ9B 1MAJA 3MNVA 3SO3B 2X4NA 5AAMA 4WCYL 4G6KL 1FPTL 1URLA 4P46C 5HD8C 4PJ7A 2ATPA 5HHPB 3Q0HA 3W9DA 4G43A 4NKIL 3W2DH 1G6RB 2D31A 4JDZB 4Y5XC 1HE7A 2FECL 4PJGB 3P4MA 3LAFA 5IJVA 1BPVA 4UBDD 3OAYK 5DRNA 2VLRD 2BVPB 3KGRA 3VH8G 3VXUA 5EBWA 5E4IA 4NJ9L 4B50A 1EZVY 1PAMA 2R8SL 1XF2A 4WI4A 1KCUL 4WTZA 2ICWB 3LKRB 3VXTB 2WIMA 1ZHKB 4X6BB 1J9CT 2UYLB 4RGOL 5K9QG 1P7QB 5SWSA 3UJJL 1N2RA 4XGZA 2X4PA 1E0OB 1R3HB 3WFHB 1QACA 1K4CB 5ECJE 3EFDH 1Q0YL 1X6LA 5BV7B 1U8JB 4F7EA 4KU1A 1CLYH 1U8OB 4PP2A 3REWA 5EU7E 3TJEH 4OUOA 3HMXL 3ILPA 4ZYKA 1ETZB 4JN2A 1B9ZA 2ZOLA 3RY6A 3ULUL 4APQA 5A2JH 5E8EB 4OGAD 4RNRA 4M7JH 1ZV5A 3QQ4B 3IRZA 4PJ9D 5BV7L 1HEZB 2AJUH 3QO0B 1QUNA 1UEYA 4TVSa 3VH8A 4Y1AA 3MFFA 1I85C 2J6EH 2VMFA 3V4PH 5B39G 1FG2B 2CK0H 5D71L 4PJ9A 4YXLH 2NXYC 1H5BA 4P9MH 4H0IA 4NJAL 3DRQA 1OP3K 4UNTA 3M1BA 1MFNA 1ZTXL 2X70A 3DO7A 4KQ4L 4L3CB 2E5EA 5T3XL 4X6FA 5C8JA 5DYOA 4B7LA 5AG8A 2CXKA 2EDNA 5JIKA 3QI9B 4JRXE 5IQ7H 1QSZA 3OX8B 3NA9H 2V5MA 4IRJA 5K9OB 1I1CA 3TBTB 4OFVA 4OLVH 1WITA 4YIQA 3N1MC 1GZQA 4N1EA 5FM5O 1M71A 5MP6H 4BUHA 1C8PA 1AIFA 5CBEA 1DLFL 4FNLH 2ICEA 3KPPA 4AL8H 3GSRB 1MFAL 1CFBA 4GXVL 1HZHL 4ELKB 5HSFA 4HZLB 4WEUD 2P5WD 5F7UA 5C0FB 1CGVA 4MJ5A 3EUUA 1X4ZA 1CK0L 4N0UE 2CDEA 1FYHB 3HZMA 5DTFA 5D7LB 2P5WA 4K8RC 1N0XL 2F74A 4L3EA 3QNXB 4KDTA 4GW4A 2NY3C 4JQVA 4NFBA 2B4CC 3U82B 4F33A 5CEXA 5I30H 1J1PH 5FK9B 4Y4HD 4BQ8A 1MCIA 2XZCL 3TFKD 1OT1A 4KROC 3GB7B 2ICES 1GRWA 4MA3A 4I0PC 3DV6B 2PXYD 4D9QD 4M6OL 3T2NL 4Y4HA 1CXEA 3DTXA 5F1IA 3MRKB 2DQTL 3QUYB 3EYUL 2QSQA 3C5SA 2A9MH 2NY2B 3P9MB 4XNZB 1A6ZB 1YNKH 2PXYA 5D1QB 5A2IH 3D25B 1BFVH 4NM4L 4NRZB 1P6FA 3G6JE 4BZ2L 1OD7A 2CLRA 2IPUG 1Q1JL 5KAQF 5JQ6L 5CEZE 1K4DB 5C9JA 3BGAA 2OP4H 1CU4H 4IIQC 1GGCL 3T3ME 2NY0B 2H32A 3MRHB 4O2FB 3T08A 4NUJA 3DYMA 2CDFA 3MNWB 4KTEH 2F5AH 4ZOBA 1Z0NA 2HT4D 1JGDA 2SEBA 4UT6L 4EXPX 3T1WA 1RIVH 4I4WB 4QRPB 4KJYA 3VD9A 2X10A 4P4KC 5DUBA 2XQYK 4FQQB 5BRZE 3FB5B 1B4JH 5GRZA 1T3FB 3DUUB 2XTLA 4EI5A 5ESQA 3QEHB 4HJJL 1QLEH 1INDL 2VAAA 5EBMB 3WUWB 4JAMB 1RJYB 1MCCA 5JNYB 3KPMB 4UIMB 1TJGL 2GJZB 1HOCB 2DQHL 2JJUA 4N9OB 1SQ2N 3E1F1 1D6EA 2Q1EA 1MLCA 3WN5B 4O51A 1MVUA 4Q9QH 3GKWH 4NC1E 3N06B 5KSAB 3AAZA 4IS6B 3WE6B 4GRLC 1TZIB 4ZAKC 4NFDA 4OCXL 1ZEAL 1IARB 1WAAF 4HT1L 3ZE2E 1QR1A 1JGEB 2EXWC 1T89A 5EBLB 1HDMA 5ADPH 4KJQD 1DEEA 5CJQL 5BS0B 3E6FB 3ILQD 3HI5L 4KMQA 1YY9D 3CCHA 2CD0A 4I77H 1KPUB 1UVQA 2Q8AH 5CJOH 3X14B 1FVCA 2GIYA 4QRRD 3BE1L 1SEQH 1Z9MA 4KKCC 4R8WH 4N0RA 1OTSD 3TIDA 3P4OA 4FFWC 3WNPA 3NAAL 4JO1L 4EN3B 1Y0LA 4G8GB 2DQCH 5J13B 1CXFA 1G0XA 4QRRA 1DBML 4XP5H 4BSWB 3ZMRA 3UAJC 2HMIC 1BQLH 1DQDL 1Q9OB 5CJBA 4RWHA 5ACZB 4NKOA 1P1ZA 4WHDA 2QHRL 2PTTA 4NUGL 4NCC2 3GSWA 1P7KA 5IMMB 5FHBL 2B39A 4NQDB 5AUMA 3TZVB 1DBKH 4MXVF 3RHWF 2HLAB 3I6LD 4QOKE 2BDNL 1ROWA 1IGTB 3UTTE 4FQIL 2PYEE 2Y07L 3MLSL 4KZDH 4G7YL 1PFCA 4HUUA 2PTUA 3QDME 2DM3A 4HWBL 4DZBB 3W0WA 4QRQB 2HAZA 3CNKA 1L7IH 3TH3T 1G9NC 4GW5B 2VXUL 1UFUA 3MNVB 2X4NB 5MEOA 3QQ3B 1INQA 3MNZA 1X5XA 2HKFH 4P5MA 4HF5H 1KJ3H 2BHUA 3CPLA 4JM2F 4S1DC 1KGCD 4PJ7B 2ATPB 2ZSVA 4MNQD 1WIUA 3H0TB 5IFHH 3NH7L 3AMKA 4TN9A 3W9DB 2LTQB 4G43B 4O2EA 2BOBA 3BQUB 3BDBA 4XP6H 5GRJH 2ZPKL 5E8PA 5IJVB 5DRNB 5HHMD 4MNQA 1IAII 3EW3B 1OAQL 3P0VH 4XNUL 1KC5H 4MJ4A 5EBWB 1GOGA 4U6VL 1XF2B 5LWYL 5ICZB 2VLRB 4P3CH 3VJ6A 3OHXB 4OCWL 3HAEG 1EHLH 2YMXH 3QULA 3T3PE 2GAZA 2R23A 1N2RB 3ULVL 3LS4L 3FQNA 4XGZB 3EO9L 1PG7X 2X4PB 1G9MC 4XC3L 3VMNA 1IRAY 3H8NA 4UT7L 3TESA 2MQ0A 2VYRE 2D3VA 4F7EB 2R0WH 1EEQA 4TVPD 5IVXF 3REWB 1AHWC 1YJDH 2XIDA 3ILPB 4ZYKB 2ADFL 4JN2B 2ZOLB 1BECA 4P59L 4D9LL 3RPIA 4QXUH 4F2MB 1OWWA 5CWSA 3RVVD 2VDPH 3MRLA 2O26U 4RNRB 2OTPA 1JV5B 5ADOL 4R4NC 4YDIL 4J3UA 1MWAA 2GSGB 4PV8A 1GIGH 3MZTA 4PV9A 4GS7C 3O2DA 1AFVL 3VH8B 1S7UB 3GMNA 3PNWA 3MFFB 4HKZA 4TVPH 4HKBA 1BX2A 3TJHD 5IGXL 4PJ9B 1H5BB 2HJLA 3DRQB 3U4AA 4BH7A 3M1BB 1V5JA 1QKZH 1TQBC 2A6DA 2X70B 1QEWA 5A2FA 1UCBL 5C8JB 1A02N 2VLJD 5DYOB 3PL6D 3O3DB 4NHCH 2PCPA 2R0KL 5KSUA 4QRUA 4YHNB 4NC1C 3MXVL 1JI2A 4L3AA 4Q9BA 4YIQB 3CJJA 4PB0L 2VLJA 1GZQB 2H6PB 3ABZA 3PL6A 2Z9TA 1HH9A 1NUDA 2ICEB 2VDNL 4WEBH 4XWGH 1SBBA 1D5ZA 4R90H 4O5LL 2VL4A 1BHGA 4UDUA 4OLZL 2PR4L 1H8NA 4MJ5B 3IFPA 4OGXH 1CD1A 5TE7L 3LS5H 3GSVB 1N4XH 5DD5L 2CDEB 1BVLA 3TEUA 3HZMB 5DTFB 3MROA 2P5WB 2F74B 3GJFA 2XV6B 4GW4B 4JFFD 5B39B 5E1AA 1YN7A 2YKLL 3FT3A 5CEXB 3QIWD 1ND0A 3D6GA 3SDXA 4FXGA 3N1FC 5E2UL 3I75A 3HE7C 3GMRA 1EEZA 5F6IC 3RWJA 1U8MB 4RMQA 2DIJA 1NFDA 5E94A 4JFFA 4MA3B 1REIA 4M6NH 1C1EH 2Q7YB 3QIWA 4Z7VE 3PWPD 5CP3H 3TM6A 2YD6A 3DTXB 5F1IB 3TH4T 5I1GL 1T2XA 4S0TD 3FQWA 4OFIA 3MREA 1F90H 5DVMA 3C5SB 3QXDA 1XGRA 5L7XL 2PXYB 4M7LH 3HC3H 4ODSH 2E7MA 3C60A 3PP4H 3R8QA 3PWPA 3WIHL 3BXNA 2UV3A 4WDIA 3H2WA 2HFEB 5J89A 1J87A 2DM4A 5GRXG 5C3TA 5C9JB 2YWYA 5F9OL 2HTLC 1FN4A 3BPLB 2DJSA 5TE6L 4FABH 1R3KA 3ARGD 1EVUA 3Q5YA 2AQ2A 4QHKJ 1W0YT 2FZ3A 2H32B 2K7PA 3VXPB 2CDFB 3H9HA 1S7QA 4L9LA 4NZTH 2CRYA 4WUUA 2I9TA 1AP2A 4PJDA 4PJHF 1YQVL 1BD2A 3IFLL 3ARGA 4I0KA 2SEBB 3MRJA 3ARUA 4LSPL 2DBLL 4MX7A 5DUBB 2Z31C 4MB3A 4RGMB 5FHAH 2AAVA 4JGMA 5I71B 1F58L 5HVHB 3KLHC 2XI9A 5GRVL 43C9A 4YEFA 4ENED 4EEEA 5EUOA 1NMAL 2VAAB 3DETD 5DRZA 1CGXA 1GHFH 1DQLH 1D6EB 1SY6A 3VFSB 2BZDA 4ZFFA 1MVUB 3JWDC 2E8YA 3VFOA 5AYUH 4K7PL 3RJQB 5E9DE 5FKAA 1E6JH 3TA3D 3I50L 4MD5A 1LP9E 1MHHA 3NCBB 3BT2H 4WVRA 4NQCD 2FHBA 5BQ7A 3CCHB 4S1SH 4UQ2A 3UTSB 1WFNA 1U0QA 3PXJA 4NKMB 3TA3A 1FVCB 3FFCD 4NN6B 5IFAL 2UWEE 1BEYH 3U4BL 4TQEH 2DKSA 2MCPH 3RWGB 3TIDB 1HYRC 3P4OB 4TSCH 5A2LH 1JHLL 1I75A 2D2OA 5DHYA 5GS0C 2WIIB 3PHOA 5J8OA 1UXWB 1OOAA 3ZE1E 4GRWB 1RJLA 3Q6FA 3FFCA 3GI8H 4QRRB 4Q9RL 3VFNB 3QHFL 1QHPA 4GQ9L 4MB4A 4MA7L 4NFCA 4HK3J 4LARH 2BVYA 1HKLH 3TO4C 3ZDZF 4OZGE 1V3KA 4NKOB 1P1ZB 2PTTB 3PWVB 3NABL 3HC0A 4NM8H 5MI0B 3GSOA 1V7NL 4M7KH 4J1UA 32C2A 2XZAL 5AUMB 5DT1L 1AY1H 3MLWH 5KG9A 1FJ1B 4YWGL 4HLZG 3GNMH 3MJ8A 4L5FH 4R7NB 5HVFB 1Z9OA 4Q2ZA 4BFBD 3MO1A 4HUUB 1MNUL 4LLAA 4PJIF 1NL0H 5MERA 1P7HL 1CT8A 3UYRL 2PETA 5SWQB 2F58H 2E9JA 5MEOB 2ZOKA 3MNZB 2DN7A 2E27H 3GBMH 5D9SA 3ZDYE 3CPLB 1MCDA 3RWEB 2CMRL 2XA3A 2ZSVB 3NIDF 1T2QL 1MI5D 4JFED 2FJGA 2L4OA 2AJ3B 5SV4A 4F9PC 5I9QC 2KBGA 1VGEL 2AJYH 5E8PB 4N8CL 1PKOA 1RUPL 1MI5A 4JFEA 3VMOA 2A2QT 4X5LA 4EOWL 5ESAA 3AVEA 5E2TL 4F57L 5KSVA 4OM1L 5DJYA 2FO4A 3OAUH 5D1XC 5FYJL 3FHQA 5JZ7D 4LCCC 3UTPD 3CSBA 3VJ6B 1XH3A 1D9KC 3WFCH 1G7JA 5ALBL 2VXSL 4KHXH 1HIMH 3QULB 3B5GA 4FOMA 2GAZB 2R23B 5HPOA 4JCMA 1U42A 1ONQA 4FZEL 3RI5K 3BPOB 1QFWL 4MS8D 3I85A 5T33L 2FATH 3ULSA 4HLZH 2ZUUA 1VEOA 3OPZH 1I3GH 1AXIB 4P2CG 5DQ9B 4L4VE 1TETL 4JN1L 3OKNA 1PG7H 1UB6B 3PWUB 4UIKH 1DEDA 5CWSB 3MRLB 1PZUB 3DMMC 4JFQA 1U95B 2BRQA 4QNPE 3U30C 5EORH 1MWAB 4PV9B 5LQBL 5D1ZA 5EZOH 1NCDH 4NNPH 3GMNB 4OGYH 3PNWB 4RISH 4HKZB 5DZLA 1UWXH 4HKBB 5INCA 1MSPA 5EZLA 5F6HI 4JO2H 1J1OH 1BJMA 3I6KA 3NFPB 4H25B 3WS3A 4TOYH 5B3JE 4U1HA 2A6DB 4HUWB 1QEWB 3HAEB 4MA1C 2VLME 2WV3A 3LQMA 1L9MA 4DOHE 1N26A 1OAUL 3F7YB 1MHCB 2OR7A 4LAQH 4OI9A 2VQUA 1MCJA 2PCPB 1YY8A 5KSUB 2D0GA 3H7BA 1KCSH 4PRPE 5GS1B 5DXWA 5JOPE 2VLJB 3PL6B 1HH9B 2FBJL 5D6CB 5E5MB 4LNVA 4M4PA 3LIZL 2MTPA 4OSUL 1CFQA 1D5ZB 3H7LA 3PWNA 3IS1X 4UDUB 3DYOA 1NPUA 3EYQD 1VEMA 1N64L 1UACH 1I7UA 4OD2B 3IFPB 1QYGH 4P23D 3D39D 5TDOA 2QBWA 1JNLL 4WU5A 2O5YL 3IETA 1BVLB 2BNRD 1TJIL 1HI6A 1XIWD 3GBNH 3Q3GA 5TFSL 1TLKA 3GJFB 1RZJH 4HFUL 4P23A 4WHTB 3O6FD 5I8CA 3FT3B 3OB0H 3LOWA 1RIHL 3EJJX 3I3BA 1IC7L 3LB6C 3I75B 2BNRA 3GMRB 1EEZB 1NFDB 5LG1A 4ZPTA 4JFFB 3O6FA 5E08L 4PRIE 2H41A 3QIWB 4FFVD 3D9AH 1HQRB 2WUBL 5IK3A 1T5XB 2H1PL 3FQWB 3PHSA 5KSBB 2EDJA 3MREB 4HJGA 2HKHL 4BZ1L 3FO2A 1XGRB 5DEGB 3ZYZA 2YPVL 1PLGH 3AUVA 3M17A 2KQNA 5EO0B 1PY9A 1Y6KR 5FGCB 5CKGA 4WDIB 3QUZD 1ZXQA 1LEIB 1NANH 4E5XA 2NQCA 3GUTB 5C07B 5KVFL 1E4XH 1R3KB 4X98A 4YK4C 3RU8H 3VCLA 4DAGL 2AJZA 4KZEH 3ALWA 2FZ3B 2JELH 3QUZA 4YDLB 4MAYC 2H45A 1Y18A 4OLXH 2EH7L 3H9HB 4L9LB 1S7QB 4X6DE 3F8UB 1GGBL 4PJDB 3HMWH 3CK0L 3SE9L 2OL3L 3BISA 4OFKA 3ARGB 3PJSA 3UPCA 1CQKA 5I8OH 2NY6D 5B4MD 4MX7B 4PPTA 4QHNA 5DHVA 4NNXB 2X4TB 2GJ6E 4M3KB 4DGIL 4MAUL 2FX8H 3F7PC 1T7ZA 43C9B 1L4IA 1C5BH 1KB5L 2F53E 2Q87A 2DQDH 5EUOB 1DN0A 2IG2L 2AV1B 2DQEL 4M6MH 2B5IC 5DRZB 3SQOL 3C6SA 2MHAA 1B0GB 1F4WL 2YRLA 3MRPA 4ZFFB 2EICA 5C0BD 3CLFH 4BFIA 2Q8BL 1J8HA 3HI6H 1EZVX 9CGTA 5FKAB 5ENWA 3VRJA 2NTFA 4XNXL 4OLUH 5FM4A 1X9QA 4Z7OE 2OR8A 1MHHB 3MYZA 4MD5B 5C0BA 4BQBA 4OZ4B 4W4OC 5JORA 1OSZA 1SY6L 3MZGB 3LKNA 5DD0L 5JOEA 5F7KC 4UQ2B 1DL7H 4R9HA 4ELMA 1RZKL 3FB8A 2YRZA 1WZMA 2DLIA 1FL5A 4ACPA 3SY0A 4NQCB 1LO0L 4PGDA 5EOQL 5DHYB 3S98A 2VC2L 1KCVH 3Q6FB 2UZIH 3ULUC 3FFCB 1QLFA 3CMOL 5GJSH 5I1KL 5BV7C 4YPJA 1UJ3C 1KIUA 4KPHH 2XPGB 4WFHE 3FB7A 3NFSH 1X7QB 4UB0L 3HC0B 1K6QL 5HYSG 4LOUD 5HTSA 2ERJB 3GSOB 2W07A 3C5ZD 3MRIB 3O9WD 32C2B 4J1UB 1JGLL 3UBXG 5KG9B 3U7WH 1TQCC 4PJCF 5C08D 3MJ8B 3C08L 2OXHA 1J5OH 4Q2ZB 3MO1B 4G6MH 1ZE3C 3C5ZA 3O9WA 5SWZE 5GPRA 4JR9L 5MERB 5HGAA 4KI5D 3L3KB 1U8IA 4MCYA 4YO0A 4LDLB 4YZFF 4H88L 5I1IL 5I1HH 2ZOKB 3NCYS 4NQVA 1DBBL 2DL2A 5D9SB 5BMFL 1DE4B 1M7IA 2QSCL 2XA8L 5EH1A 2FJGB 1H3PH 3VXQA 5FM8A 5GJTH 1QA9A 1JYWA 4PLOB 4DJMA 5FYKD 4R4BB 1TVHB 4X5WA 5E95B 1Q8MA 2Y5TA 3ECBA 3LEYH 3SKNB 2VWEC 1OARH 1MI5B 5TE4L 4LVOC 5KSVB 1RUKH 5DJYB 1FIEA 2FO4B 4LSRH 3G5ZA 3VG0H 2EDQA 1C12A 5FEBA 4RAVA 3UBXA 1G7JB 1EFXD 3BKJH 1AGBA 2W92A 1CDUA 1Q0XL 3ZL4L 3B5HA 1T1WA 4U1IA 4XMPH 4EBQL 1L6XA 3ESVF 4FQ2L 4RGNE 1B3JA 1EFXA 1FGVL 5HI3C 3RIFK 3GJEB 4FQJH 1S3KL 2FLBT 2AK1L 4M93B 4WNQB 3UDWC 2P42B 4HULB 5GGQL 1WWCA 4MXQC 2FIKA 1TMCB 2XY1A 3F12A 4J2XA 1CL7I 1FO0L 1IGIL 3W11D 5CCKL 2FGWL 2XACC 3D2UD 4DVRL 1CDGA 3OJ2C 3T65A 4ZUTA 2V2WA 1XGYL 5EFIB 5A16A 5D2LA 4ZNEA 2W91A 3DBXA 4NQTA 5F7WC 4HIIA 4LSQL 3CLEL 1CFSA 5INCB 4XNZC 1A3QA 5EZLB 4PR5B 1D7FA 5JMRA 3I6KB 1C5CH 3S88H 3MPCA 5FFLA 5J6GA 1UJTA 5ID1A 5T3ZD 1GZPA 4U1HB 1JIBA 1EEYA 3UO1L 2DQJH 3TNMB 4XCYA 3GHBH 3MLRL 2IJ0C 3CFCH 4U6YB 4WY7H 3U7YL 2CKNA 1YY8B 2OK0H 5LGKA 2KUTA 3H7BB 5IW3A 3NPSC 2UY6A 3MV8D 1R3IH 1KEMH 4BQ6A 1CFQB 1ACYH 1DQJA 3PWNB 4LRNL 4XAKE 4OFDA 1QFHA 2HA1A 4V1DE 1A3LH 1JPST 5TDOB 1A6TA 2J4WL 2VXVL 3MV8A 4OFPA 4WU5B 3RVXD 3DI3B 3GFUA 5DSCB 1HI6B 4OKVA 1A6WL 3Q3GB 3VGDA 2VKWA 5E6ID 3SE8H 4DQOH 4P23B 4WI9A 3H42L 5CJ8A 5C6TL 3D39B 5KSAC 5SX4H 3HLAA 5I8CB 2JJWA 3TCLA 2CO6B 2BNRB 3KYKL 4NBZB 1PGRB 1CR9H 2P8MA 1XIWB 1A9EB 5E6IA 4ZPTB 3O6FB 5F9AC 1UWXK 3OKEA 3TCXA 1U8HA 1EMTL 2O5ZH 5IMKB 1WWBX 5IK3B 3C2AH 2X4QA 1KJ2B 2YUVA 1UADC 4R6UA 3FO2B 1A7NL 4L4TE 3GSNL 5CGMA 3DVGA 5GGVL 1G9EA 1QFUH 3C5JB 2CIKA 2LVCA 3TIEA 4NO0D 4XC1L 1I9RH 4IOFD 4E5XB 4RFEA 4MVBD 4X4ZA 1U3HC 2FJFA 4X98B 5TQ0H 2AGJL 5CUSH 1KJ2L 2AJZB 1JYXA 3VRLF 1YUHA 3QUZB 3BRFA 3L7EA 2R56L 1Y18B 4YAQA 5IVNA 2VAJA 5EA0L 1I9EA 5FF6A 2FD6H 5CHNB 3V7MA 3TZVC 5HI4C 4HZAA 4PGEA 5DHVB 1JVKA 5L2JB 1HSBA 4AJ0A 1I3RA 3HRZB 4QHUA 2K1MA 4ONOA 3MV7D 4ZPVB 3RDTD 1CICD 5GHWH 5KN5B 2YD7A 1DN0B 2VKXA 4CMMB 4JB9H 4OBRA 2NY6B 5GIRA 1XGTA 3CFDA 3OB0K 1IILE 1N6QL 3VGAC 4GKZA 3FTGA 5JW4M 2Y7QA 4TPRH 3MV7A 5FOBA 1CICA 2APFA 1FNSH 1ES0A 3L1OH 4XVJL 4H0HB 4K3JL 5T1DH 3OKYA 3NIGF 4L1DA 1JZ5A 4Q58C 5ENWB 5EU3A 3VRJB 3BRDA 3BQUC 2NTFB 5HYJD 5KTEH 1JPFA 5C0BB 4JFDE 4PJAB 5D2NA 1CGUA 1OSZB 4R0LC 5JORB 3MOBH 3ULVC 3WHXA 3LKNB 3O6MH 2C3GA 4OV6F 4ELMB 5HYJA 3V6ZA 1MRFL 5LGJA 3FB8B 2NXZD 3ARPA 1MCNA 3SY0B 2YD9A 2AJVL 1KELH 3DHMA 2C1PB 2LAAA 5C86A 1HN1A 1D5MB 1QLFB 5I66A 3NIFE 3I02A 2V9TA 4ONHA 3G9VA 4PJFB 4MMXC 4Y2DD 3JTSB 3THML 3G08A 5DWUL 4XCCL 2I25N 3FB7B 5JW4N 5GZOD 3H3PH 1IGML 1AC6A 2P5ED 4RIRB 1CD9B 1UM5H 1SJEA 4Z5RA 1T03L 4DGVL 4YBHA 3TPUB 3VA6A 1ZHNA 1TDQA 2OI9B 3EFFA 3OJVC 2HJKA 1BFTA 4K23H 3FN3A 1FFQA 2P5EA 2VR9A 4X6CA 1UM4L 1EERB 3C5ZB 3O9WB 4O4YL 3TYFA 2FECI 3MCG1 4X7TB 1BVKB 5HGAB 1F4HA 3FQRB 3A6CL 3G6DL 4MCYB 4DEPB 3M8OH 2V9QA 5C08B 4UTBL 5DMIH 4FTVE 4K2UL 4JDTL 2NY7H 3JWOL 1NCWH 2IGFL 5HDLA 1M7IB 1X5GA 1PYWA 3VXQB 3OKDB 4XPGH 3QT2A 1P84J 2D4FA 5E0QA 3LRHA 4X5WB 2Y5TB 1LGVA 2ZUWA 4M43H 3MLUL 3FB6B 5C0JA 4ONFL 4F9LC 2NZ9C 4BYHA 2B0SH 2V7HA 3G5ZB 4Z7QF 2JTDA 5LAXB 4ERSL 1C12B 1ZHLA 2K9UA 3TP4A 4RAVB 4XI5C 3UBXB 3BAEH 1C16B 2X7LA 4AIZA 1S78D 4QF1A 4CMHB 1AGBB 5D5MF 4OI8A 1VPOH 5GQBA 3I9GL 5CD5C 2IBGA 4JFOB 1T1WB 1NMBL 5I19H 4U1IB 5T1KA 5FYKL 1BIIA 3AC0A 1EFXB 3WIIH 4GMSL 3MR9A 3GO1L 2ZJSL 43CAA 1A21A 3WV0A 3KNBA 4C58B 4ZSOA 3RX7A 2FIKB 3QEQE 3N1QC 1YYMH 5F9JB 1P84K 1WT5C 3BOVA 3D69B 3PGCA 1IT9L 3T65B 4F7PA 4ZUTB 3LZFL 2V2WB 1LO4L 1NEUA 3P2TA 2I60L 5A16B 5D2LB 3HNTH 3TN0C 2B1HL 1AD0A 2BCKB 4X6EA 4BQ9A 1W72H 4HIIB 1DLHA 3RI5F 3D2UB 2HLFC 3UX9B 5IP4A 4AENA 2DDQL 4LCUA 2IAMC 5ID1B 5JMOC 3K2UH 2E6PA 2ZSWA 3WLWD 1MEXH 4WW2C 3V5KB 5BVPH 4QRSA 3KHOA 3SDDD 1FNHA 1M05A 4MJIE 4AMKH 5HHQA 3S37H 3P0YH 3KYOB 4EDXA 3VGFA 1R6VA 3KPLB 3GRWH 3WFDL 3SDDA 2CRMA 1I7TA 4FG6D 2M26A 4O9HH 4Q9CA 3QFJD 3W82A 1IFHL 1DQJB 4L4JA 3RVTD 2QEJA 5T3ZL 2P7TA 2V2TA 1XF4A 5IVXE 3MV8B 2UZYB 3QFJA 4HH9A 1B0RA 3QWRD 2A9NL 4OKVB 3SJVD 5C2BH 3B9EA 3K8MA 4R2GC 3T0WA 3HLAB 4DN3L 1C5DB 1OCWL 3TCLB 1VFMA 4JFHE 4PJXE 3VG9C 3O4LE 2F54E 4HC1A 3B9AA 3QWRA 3WD5L 2YS4A 3QA3A 3SJVA 1TCRB 3T0DA 3RBSA 3OKEB 3ROLB 1U8HB 1XGUA 4XMLL 4HC1H 3EO1A 1JJUA 1J05B 1NLBH 2EZ0D 4M5ZH 1BWWA 3ARSA 3DVGB 3QPXL 1D5IL 3TT1H 4PFEA 3N85H 2CIKB 2EDYA 3MLZL 4I0CC 4MLIA 1AQKL 4ORGA 1GJIA 2UVEA 4JY6A 4RFEB 2GKIA 3MLVH 3U0PB 3IS0X 2FJFB 4HBCH 3MV9E 4FQ1L 4X99A 1A9BA 1EXUB 2QSTA 3A6BH 1AGDB 3REVB 1YUHB 1A47A 3EBAA 3L7EB 4FQCH 4NO0B 3S35L 4XHQA 5FF6B 4PGEB 5MEPB 2R69H 1HSBB 4YNYB 4I5BB 4NGHH 5GGTA 4N0FA 1I3RB 3ZZ1A 4QHUB 3K8KA 4LIQE 4TYUA 1FNFA 2LU7A 1OP5H 1HQ4A 2DQIH 5GIRB 4PG9A 5GGTH 3OKMA 1XGTB 1L0XA 4B7IA 1BJ8A 1NAMH 4HHAA 2BVTA 4GKZB 3FTGB 1ZT4B 2Y7QB 3FHAA 3RDTB 3MV7B 5FOBB 1CYGA 3QNYB 1ES0B 3EFDL 4IDLA 1CLYL 2AK4D 2W59A 5TQ2H 1BIHA 3SOBH 5EU3B 5L0QB 4CGTA 2GT9A 2VZOA 1JPFB 2CPCA 5D2NB 2R9HC 4KKAC 1WBXA 4M1GH 5FUCE 2AK4A 3WHXB 4UILL 3O8XD 2JIXD 2IEPA 2NY5H 5HYJB 5LGJB 4X4XA 4D0CA 3FRUB 2A0LD 5D72L 3S36X 1T7XA 3EHBC 2A73A 4P2QD 2J6EL 3ZTNH 3O8XA 2JIXA 1YC7A 5T5FL 4P9ML 4NBXB 5DS8B 2ITDB 4LSDA 3I02B 3N1PC 2GTWB 4PJHE 1HYSC 1LK3H 4ZXBD 3BESR 1PJ9A 4P2QA 3SDXF 3G08B 3RVUD 3V0WH 3FZUD 1HKFA 4DK3A 5KANG 3WHE1 5A2KH 2PO6B 2HT3D 1CLOL 1NFDF 3NA9L 4NT6A 5ICYA 2FO1A 3T1FA 1Q72H 1SJEB 1NFIA 1HHJA 4Z5RB 2PF6A 4ZXBA 1JYNA 4Y2DB 2WWMC 2IMMA 4YHOL 1ZHNB 3EFFB 5MP6L 4XNYH 2DMCA 5IBLC 3FQUA 4JHAH 1S7XB 2P5EB 4JQXA 5F7DB 4X6CB 5FB8A 2BRRL 4IRSD 1WVZA 3D85D 1PEWA 3TYFB 4OZHA 2XQBH 1OAXL 2FX7L 1R5VA 2EDXA 4U0QB 3VXMA 4JO3H 4MHHG 4LHQB 4ZTOL 3MJGX 2DQGH 3ARBC 4KRMB 1LEGA 4MZ3A 4U2ZA 1MCKA 1J1PL 1WWAX 1TIUA 2J8UA 2X4UA 4C56E 1I9JH 3QAZB 4RMUA 1NH6A 3RUGE 2Y6SC 4CVZB 2JB5L 3T0BA 4YHZH 5SX5H 1NEZA 3SDCC 4PP1C 5C0JB 4GO6B 1KXQE 1SMAA 2IADA 1MCPH 2NW3A 2QQNL 3LPFA 3GIZL 2XWBA 2VH5H 2XFXA 5IJKA 5KVEL 1R5WA 1FSKC 1ZHLB 5ISZE 1IAIH 2NNAA 4S1RH 2X7LB 4QF1B 1YNKL 3GM8A 4PJ8C 3ZDZE 1BFVL 4G7VL 1NCAH 2D7TH 2Z93A 5A3ID 3MCLL 1CU4L 2QKIA 5F1NA 1BIIB 2C9AA 1K85A 3MR9B 43CAB 4LQFH 4PS4H 4ZSOB 4KTEL 4YGVA 1ZT7A 3GSQA 1I1AB 4PJIE 1D3CA 4LBEA 1RIVL 3LQZA 3OG4B 3QUKA 3IDYC 1J12A 1EUTA 3X12A 1I8LC 4GRMA 4F7PB 4P46D 2V9RA 5HD8D 4IMLA 3BFOA 1HINH 4M9OA 2EIEA 4IM8A 1NJ9B 1AD0B 1FDLH 1F4AA 4X6EB 4UOW1 4CVXA 5D8JL 4EUPA 4YHLL 5GRUL 2H2PC 2XT1B 1RMFL 4UV7H 4P46A 4LCUB 1G0YR 5T1MA 5K9QI 4JKLA 2ZSWB 3GKWL 1MPAH 2AKRA 4LSTL 3RIFF 3WS6C 1RSFA 4EUPH 2P45B 2BNQD 4Y5XA 4ODTH 5D7KD 2ZP0T 2VZSA 3KHQA 3BPCB 1KYOJ 1M05B 4YDLC 1L0QA 1GPOH 5IB4A 5D7JC 2VZTA 2IFFH 5HXMA 4EDXB 5C0AD 4DKFH 1II4E 4I77L 2F8VA 2BNQA 4K3GA 4KXZI 1NLDH 3GI9L 3QDGD 1GYAA 3SDDB 2WM0A 4HIEA 5CJOL 1I7TB 4LCIH 3RRQA 1SEQL 3BKCH 1NMCB 3I84A 1SYSA 5C0AA 1G7PB 3S6CA 2I07A 2P7TB 4XNMA 1QFOA 3QDGA 2V2TB 3QFJB 4HH9B 1B0RB 4XP5L 4HW6A 4IOIA 1ZLUH 1SM3H 1RZKC 3U2SA 4R26L 3U0TA 1A7PL 5DQDL 5I75B 2IAND 5IVZA 2C4FT 3QA3B 3SJVB 2NXYD 4E41E 2J88H 1YN6A 1BBJA 5FM5M 3RZCC 5EU6D 4W81A 1FNEB 1XGUB 1KYOK 3OTTA 5JHLL 2IANA 3GIVA 1TZGL 1I85A 2BFVH 4HQQH 3VXSB 3VFGH 4Z95H 2QQLH 4PD4J 4DTGH 4TULH 3D3VE 1FE8H 4OB5L 5EU6A 5EC2A 1U8KA 3RWFB 1OGAE 1YEDB 3N1GC 3M45A 4HF5L 1KJ3L 5E2WH 4NWUH 4ORGB 5F9WB 4JY6B 1IGCL 3DSFH 3OQ3B 4X8JA 4FS0A 3BZEB 5FYLE 1A9BB 1FFOB 1FORH 3B9KC 4LSUH 1OHQA 1ADQA 2ERJC 1XFPA 1MJ7L 2AXFB 3W5MA 3Q2CA 4OTXL 1N7MH 5E8DH 3VD7A 4GBXC 5DMKA 5CIPA 4K8RD 1ADQH 4J3OC 5L9DH 2NY3D 4P3CL 1FFNA 1OPGL 1LK2A 1RPQA 1EHLL 2ZG3A 4PJGE 2HJFB 4PG9B 3OKMB 4KROD 4HHAB 1JWUA 3LH2H 4GW1A 1R0AH 4I0PD 4WV1C 2YPKA 4PD4K 2BY1A 5EWIL 5EDXA 1KNOB 1FP5A 3CXHJ 4NN7C 3R8BB 3OKLA 1LE5A 2GT9B 4CU6A 4R97B 1BOYA 2FJHB 4FP8H 4I0PA 2FEDC 1G7QA 1WBXB 4H5SB 2FLRT 4QWWC 1ZA3B 1EAJA 1RURH 2AK4B 1QO3A 2XG4A 5K9JL 1RJZA 4LGSB 4PRDA 2N56A 1MF2L 3V4UH 3L9RA 5EC1A 1UYWL 4MQXC 4X4XB 5I16B 5J56B 1JNNL 4NZDA 1JPGB 3B2VL 2A73B 4KKBC 3O8XB 4TSAH 1ZMYA 5IWLA 2JIXB 2OXGA 4G5ZH 5AZEH 1WZKA 7FABH 1X6NA 5DD1L 4KGJA 5C0RH 1V7MH 4IIQA 5IT2H 1YEFL 5DRWA 2W9DL 4P2QB 4P4KD 2G2RB 3I2CL 1CG9B 3OV6A 1SJHB 3QCTH 3HFML 3JV6A 1K8IA 5I15L 3HZKB 1JNJA 4NHCL 4NT6B 5ICYB 3WSQH 1AO7D 1UZ8B 1NFIB 4ZXBB 4P4KA 5IB2A 3QO1B 1OP5K 4DZ8A 2BSRA 4PG2C 4RWYH 4P5TB 4WEBL 4QTHA 4XWGL 4ZTPH 3IXAA 5FB8B 1AO7A 1K3ZA 2C5DC 3UEZA 1RUML 4GRLD 1S9WA 4ZAKD 2DQUH 5AYQA 3LS5L 1I1RA 3GK8H 2EXWD 4DW2H 3T8XA 3LD8C 1F8TH 1BQHG 1ZVYA 1VKXA 4IRSB 3D85B 3F58H 4OCNC 4GRLA 3O41B 5MENA 4PGZA 1LEGB 4HWEH 1IEAB 1UH4A 2XN9D 4KKCD 2J8UB 4MZ2A 2X4UB 3NFNB 1MQKL 4FFWD 5E2JA 3CGTA 4UUJB 2V5SA 2P24A 3MJ9A 2IADB 2NW3B 2XN9A 1LO2H 2R4SH 3UAJD 1T1ZA 2HMID 4KKLC 2XWBB 1TFHA 2XFXB 1R5WB 1YQ2A 4P4RB 5F72S 1F90L 4K9EL 1O7SA 2NNAB 4GAJH 3DX8B 4KGLA 1OAKH 4F15B 3MJ9H 1MFBH 3HC3L 2FH6A 3MLYH 4QTIH 4NRXA 4PREB 5CILH 2WW8A 2APVA 1JTOA 4CU7A 1KN2L 5FGBA 1V3LA 2HTKC 1FFPA 4K7FA 4MDJA 4FABL 2AQ1A 1OW0C 1BQHA 2YPLD 1TPXB 2FR4B 5ILTL 1GGUA 4NZTL 1A4KA 1BQUA 3S3SA 1ZT7B 3GSQB 4JANA 4PRHD 4ELMF 2EH8L 3LQZB 3QUKB 3WFBH 5DVKA 4YZFE 2YPLA 3X12B 4GRMB 3UTZA 4S1DD 4IMLB 1RUQH 3UZQA 5JPNB 1E27A 4CVXB 3O2VL 4PRHA 2VDKH 1NBQA 1T4KA 3HTLX 4QT5A 1P2CB 3CVIH 4TSBH 4P46B 1RZ8A 1JP5A 3QUXC 4X7FC 3QBTB 3ARXA 1QNZH 4X7SH 4QRPE 2AKRB 3PIQA 1FH5L 1KTKE 3QDJD 1PZ5A 2XWTA 4HH8A 3G6JF 4N0UA 1PKQE 3UMTA 3UZEA 1P4IH 1VERA 2YD4A 5F3BA 1G1YA 3E2HB 2PYFA 4IDJL 1FAIL 4K71C 2CJUH 4WIQA 1JTTA 4H8WH 3SKJH 5C3LD 3OF6D 5IB4B 2B1AH 3QDJA 4Z7UA 2CK2A 1GOHA 4WFGE 3VFTA 2BVOA 1F3RB 1FG9C 4S1SL 2BNQB 4ZUWA 2G9HA 2V6HA 5HHVL 4HIEB 1DUYB 1VEPA 3HPLB 1T04A 3IDIA 4KUZH 3OF6A 3QIUC 1MFEL 4TSCL 4YR6B 5C0AB 5ICXB 4KK6C 2I07B 1I1YA 4XNMB 1DQQA 5CEZD 1AD9A 4KK8C 3SBWC 2PTVA 2F5BL 5BS0E 5DK2A 3QHTC 1J8KA 1A4JA 1AHWA 5LXGH 4TRPL 4XP1L 1G9MH 3MBXH 4LCWD 4OD3H 4L9DA 4ONGL 4R4ND 3VD5A 3QRFM 3U0TB 4JJHA 3DLQR 4NM8L 2KH2B 3INUL 4LLYA 4M7KL 5IVZB 4H1LH 4HDIA 2ZZUT 5F7LB 4M48H 5JXEC 1AY1L 2OZ4A 2HRPL 4G8GE 5BRZD 2I27N 5EO1A 5EIIA 4LCWA 4K3DH 1YN6B 1GVIA 1BBJB 1MAKA 3GNML 3O6LH 1S5IL 4U6HA 2IANB 3GIVB 1KJMA 1YEHH 4OLEA 1NL0L 5KS9A 3IVKA 2LV4A 2X1XR 1I8KA 2NXYB 3N9GH 1KFAH 2F58L 4WJ5A 5EU6B 1U8KB 2Z0BA 5C0IB 2E27L 3GBML 4XNQA 1WTGT 2DYPD 3C8KA 5BXFA 2JJTC 1NAKL 4X8JB 2D7NA 4UTAH 4MNHB 3U9PH 2XYCA 1ZHBA 4Z78A 2DI9A 2DYPA 3O2WL 2AJYL 4WGWB 5DUMH 2QQQA 4HGWA 3P4NA 1MIMH 3HR5A 3IFOA 1FZOA 3JWOC 5D2LF 3AREC 3RQ3A 5HYQA 1EO7A 3OAUL 4PJ7E 5CIPB 5DMKB 2MOVA 4HUMB 5FUOH 1XF5A 1ZLUK 4R7DA 5FV2A 4KHXL 4UV4H 1HIML 1U91A 3FMGL 4FFYL 4UU9A 3KWWA 1JPSL 3HE7D 5D7IF 1UH2A 1JWUB 1L9NA 1X3DA 3VXUE 1RZ7L 2NY3B 4QEGA 4J7RA 1A0QH 3LKSB 35C8L 4YE4H 3QCUH 2VXTL 3HE7A 4LP4A 4KROB 3OKLB 1LE5B 1PG7L 3UTTD 2ZNWA 3MUGA 3WDIA 4I0PB 5JQHC 5E56A 5SWSE 1G7QB 4UZGA 4K8RL 1QO3B 3MODH 5A40E 2JJSC 3W5NA 1XR8A 5GRYA 3L9RB 5EC1B 5EORL 4L1HA 4XXCC 2HTLD 2XZQH 4ZFGH 3VDBA 2ZUYA 2IC2A 1XAUA 1OLZA 1TJHH 5EZOL 4RISL 4DGYH 4EVNA 4JPVH 4CMHC 4JO2L 3VRLE 4P9HL 4IIQB 2XTJE 1K8DA 5DRWB 2Z31D 4JCLA 3KLHD 3JV6B 1K8IB 4NO2A 4Y1AE 2AJXH 1LEKB 1G7IA 1MJ8H 2EDOA 4NO5A 3VFVA 4P4KB 2Z31A 5TF1L 4JPWH 1EJOL 4DZ8B 2BSRB 3AU1A 4QTHB 1SYVA 3IXAB 1AO7B 1IGFH 4FRWA 3RVWC 1NBVL 1A7OL 1S9WB 4KH2A 5DGRA 2APWA 3NIGE 4HGMA 4GFTB 1E4KC 3RL2A 3T8XB 4WUKL 1VKXB 4LLDA 3FAWA 3GBNL 4GRLB 1RZJL 1UH3A 1IM9A 4ZAKB 1SVZA 3CVHH 1FNLA 3OXRA 4Q6IC 3JWDH 4Z7NF 3KYMA 4HIHB 3IF1A 3VW3H 5HYIA 1IE5A 3DX9B 4YFLI 5E2VH 4LIQH 5DD3H 5GS0D 4NZJA 4QXGH 2P24B 1GAFH 2P8LB 3D9AL 2XN9B 4UINH 5JW3H 2P5WE 4L3EE 3ARZA 2E9WA 3TO4D 4GKNA 1IQDB 4JFZH 2BY3A 3BHBB 4NRXB 4Y8DC 1KT2A 3GHEL 5E1HB 3TO4A 2GUOA 1TNMA 4MDJB 1E4XL 4E9LA 5L88H 1TZHA 1Z5LA 1IVLA 2VE6A 2ZKHL 4I18C 4X0KB 3BZ4A 4X7DC 5HY9A 1BQHB 3PDGA 2R1WB 4OLXL 5CBAA 1A4KB 1IEBA 4KVCL 4GKSA 3SDYH 4D9QE 4DVBA 2PN5A 1INEL 1IBGH 4JANB 1YC8A 1LDPH 4EDWH 3GSXA 2YPLB 1NDGB 3UTZB 2FX8L 3OGCB 1CFVH 3ZSTA 2ZCLL 4IHOA 3S4SG 1CL7H 1U8PA 4NC0B 4PRHB 4Z7VF 4LHUD 4QT5B 4V2CB 4DK6A 2W38A 4WENB 3VI4E 5EBGA 1K5NA 1RZ8B 4YXHH 1JWMA 3NZ8A 1VFBA 1IZJA 3GGWA 3PV6A 4F9PA 1PZ5B 2XWTB 4N0UB 4Y89A 4LHUA 2YK1L 1FL3A 2NPLX 5D1XD 3SKUD 2Z35A 1U6AH 1YNLH 1RQ5A 3OKKA 4KTDH 4OLUL 2PYFB 3C8DA 3NZHH 5DJ8B 3QJHB 4HUXB 4U6XA 4CN6A 1T21A 1V8HA 5I76A 4Z7QE 1D9KD 4Q7DA 3BDYL 5DK0A 3DHJA 3QDJB 3EZJB 1YEEH 3WEXB 5B3NA 2BVOB 1MVFA 5IIEA 4ZUWB 1OSPH 4HCRA 2G9HB 4LCCA 5F6HJ 2N7AA 1T04B 5IG7A 4N1HB 5DURD 1WEJL 1BGXH 4WWID 4CN1A 3L5IA 3P11L 3P73A 5HHOA 4HCRH 1I1YB 1QVOA 1VGKA 1AD9B 1KCVL 2CIIA 4MWFA 1BBDH 5DK2B 1ORQA 3Q6GH 1A4JB 1A7QH 1AHWB 4IMKC 3DMMD 4KPHL 1DANT 5IHBA 1A7BA 4APQC 3NFSL 5H2BA 1J0ZA 2BHZA 2XTJC 3NGBC 4LLYB 3KPRE 4HDIB 1JF5A 4JKPH 4Y8AA 3DMMA 5EO1B 5EIIB 4GRWE 1CLZH 3QQ9C 4QRRE 5I1JH 3DIFA 3GMMA 2KZ1B 1LP9F 4GS7B 1S9YB 2EC8A 5CEZL 4LCYA 5D93C 1KJMB 4OD1H 1RD6A 5BRZB 1WZ1L 3IVKB 3FOMA 1I8KB 5C0GA 1RFDH 3WJJC 1RK0B 1U58A 3L7FB 4WJ5B 2UWEF 1TQBB 25C8H 4M5YH 4XNQB 4JY4A 1X5LA 3BW9A 4RQQB 4O2CA 5BXFB 3U1SL 1BOGA 4YPGB 1MUJB 4KRPC 4IRJC 4AEIH 1ZHBB 2PO6C 1LQSR 3I6LE 4Z78B 3W0WE 2DYPB 3MOQA 3TF7C 1Q9KB 1OARL 4GG6A 4HGWB 4AEFA 2VB5A 2E7LC 2BSED 1UM6L 1FZOB 5I8KH 5HVGB 5HYQB 1MRCL 1JTPA 2ZUSA 3PDOA 3B6SB 3P77A 3BKJL 4R7DB 1JZ8A 4UU9B 1ODAA 3U46A 3LB6D 2FHCA 3QEGL 5HJ3A 1WK0A 1VACA 3LQAL 1KGCE 1YEKH 3O3EA 4MNQE 1A3RL 4N9GA 4ZS7L 2FX9H 1IAOA 5HYEA 3MC0A 1ZLWH 4N8PA 3CFBA 3QR2A 3QFDA 1JE6A 4L8SA 3VDCA 3HE7B 3BP7B 3ZDYF 4G8FA 5F6IB 5HHME 5KJRL 1BM3H 3O45B 1PDKA 3MUGB 3NCEB 4U1LB 2C3WA 5FUZH 3X3FL 1I4FA 1CN4A 1H3UA 5IB1B 5I74C 2HH0H 4ISVA 3UTTB 1Q9LA 4G42B 1T66C 4HKJA 3BDXA 4PB9L 4NBYB 4MAYD 3VGBA 2MPAH 3MRNA 3E3QE 3QDMB 1RZGA 4TNVK 5DJDA 4Y2OA 1P5UA 2BVQA 4Y16C 3X3GH 5I18H 3LKPA 2RJMA 3KS0H 4TVPE 1K8DB 3S3JA 3NPZB 4JPIA 4YDKH 2X4OA 3KLAA 4F7TB 4KQ3H 4WY7L 4U05A 4NO2B 2OK0L 2ENSA 3SGKC 4HWZA 1G7IB 4NO5B 1PX3A 3VFVB 4JHZA 2X4SA 2A6KA 2Z31B 1I1AC 2ZUQC 4XP9H 2GITA 5GS2H 4EI5C 3KJ6L 4KV5F 3DOSA 2BX5A 3AU1B 5F96H 4GH7B 1SYVB 4KC3B 1ERNA 5BZWA 3O4OC 1ACYL 2NTSP 4WCYH 4G6KH 1FPTH 4UQ3A 3MYJA 5KW9L 5FA3A 4NKIH 3V0VA 3RL2B 1UWGL 1OAZL 2FEEL 3HNSL 4AG4H 2VLJE 4Y88A 5HHPA 2AEPL 3FT2A 4Y0GA 4LLDB 1X5AA 3SE8L 1JHKH 2VXQL 1T89C 3KYMB 3IF1B 2MWCA 5TDNA 5D96B 4W4OA 4XVSH 3U79A 3EDEA 1CR9L 1KCUH 4G9FD 4OT1H 2V2XA 3KPQA 3CH1B 2I9LA 3ULUD 4RGOH 3QZWG 4XRCA 3P0GB 2EIBA 3UJJH 3UBXI 2R1YB 5M95B 3EJZC 3C2AL 3OZ9L 3RNQA 1KTRL 4BSVB 4G9FA 3HN3A 5TGBA 3HMXA 1XF3B 1T6WA 3TBVA 1NBZA 5JR1L 1Q0YH 3SDXE 1FV1A 5DLMH 3R06A 1QFUL 4J3TA 1NFDE 1KT2B 4JFFE 4J4PC 1NGWA 2VDRL 3TO4B 1U8JA 1UJ3A 2GUOB 2ED8A 3MGOA 4FN0A 4QGTA 5DGQA 1TZHB 3BZ4B 5CUSL 5HGGS 5HY9B 5GS0L 3UPAA 1G7LA 3KG5A 5BV7H 4GKSB 1CDHA 4DVBB 1KPRA 5E8EA 4ALAL 3PWPE 5FGCE 3U6RA 4JO4H 3BH9A 2MQCA 5HBBA 3RA7L 4RFNC 4CW1A 1ORSB 4IHOB 5GHWL 1U8PB 1D6VL 3TC9A 1ZTXH 2GI7A 2YHGA 2X41A 5T3XH 3EOAB 1LDSA 2EE9A 2XZZA 3E8UL 3M07A 1NSNL 4WUUE 4PJDE 1S9XA 2FHFA 1K5NB 1BD2E 1JWMB 4LSVL 2EO1A 3TGXA 3NZ8B 2DLHA 3GGWB 3JV5A 1LILA 3PV6B 1NFKA 5I9QB 4LHUB 1FL3B 3IAPA 1JGUH 1J18A 3OX8A 1DLFH 5EUOE 4U6XB 2R2HA 4ZD3L 4I3RH 5I76B 1CDJA 2EKSA 5DVNA 4BFEA 3OR6B 1HZHH 4GXVH 5DK0B 5BJTB 4N0YL 4YX2L 5IIEB 1QTYT 3NTCL 4L8DA 5D1XB 4JLRB 2W65B 3FAXA 3LMJL 4PJEA 4LCCB 4OZHF 4ELKA 2JCCA 1H3WM 1D9KB 4X83A 2DM7A 4JHWL 4LPVA 3DUSB 5HI3D 1YJDC 2ADJA 3P73B 1N0XH 1QVOB 1GC1L 3BKML 4XAWL 3WNMA 4MXQD 5D7LA 2CIIB 3S4SB 5DURB 4V2BA 5GSVA 4E0RA 2XZCH 2RAMA 1ORQB 4WI7A 4WI5A 2HP4A 5F7EL 3E3QC 2HWZH 2J5LC 5FK9A 3UDWA 2HFTA 3MRCA 4M6OH 1JYVA 5H2BB 4MA8L 1UM5L 4P0DA 4R97C 3BIBX 4KDWA 3EYUH 3DMMB 5F9DC 3U30B 3FFCE 4O02L 2B8OT 3GMMB 2AQ3A 4BZ2H 4NM4H 1DR9A 4LEXL 1Q1JH 2ATKB 2N1KA 5JQ6H 5MHSD 3P9MA 1A6ZA 5FCSH 5C0GB 1GGCH 1U58B 5DMIL 5FO8A 4WFED 1U3JA 4MA1B 1K4DA 4ODUA 1DCLA 3BW9B 4CDHA 5EZIL 4JGUA 5CLTA 3MRHA 4O2FA 4UT6H 2VSCA 3VMPA 4J3XA 4MQTB 5IB3B 1MFCL 1OB1A 2ZWLT 2A77L 4NIKB 1A6UL 4NQED 2VDML 4I4WA 4PYHA 4GG6B 1Z3GH 2DTSA 1W0VA 4ODVL 1U2CA 4HJJH 5E00A 2YD8A 4I13B 1INDH 3EYSH 4ODBD 4FQQA 4LVNC 3GDBA 3DUUA 1P5VA 1TJGH 3HCVA 2B0SL 2DQHH 5BO1L 1J11A 4P5TC 4P48A 1F6FB 3PDOB 4NQEA 2GW5A 4X7EC 5FXCH 1F6AA 4ZUUB 5KSAD 3P77B 3SHSA 3UTQB 1RJYA 5JNYA 4N8VG 1HHHB 3IDGA 4UIMA 2C3VB 4AM0B 1PEZA 1HOCA 3L6FA 1A6VL 1VPOL 4LPCA 5D6DC 5IQ9A 5E03A 1P4LA 3O3EB 4N9GB 1ZEAH 1MI5E 3K1DA 4JFEE 4XH2B 5KSAA 2ARJQ 3WE6A 1IAOB 1FLRL 2X1QA 1AJ7L 3CFBB 5IEHA 3QFDB 4Z0BH 3VE0B 4A2LA 4KHTL 2VR5A 4CN4A 1JGEA 4K9EC 2EE2A 4DUVA 4MD4B 3QH3A 4OZGB