4LIQH

Structure of the extracellular domain of human csf-1 receptor in complex with the fab fragment of rg7155
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDISWVRQAPGQGLEWMGVIWTDGGTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDQRLYFDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting tumor-associated macrophages with anti-CSF-1R antibody reveals a strategy for cancer therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Macrophage colony-stimulating factor 1 receptor
total genus 48
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH01
2DOCA 2FHCA 2PW2A 3BGMA 3VG9C 4KAQH 5C0BE 5SV4A 4U3CA 4M1DL 4R4BB 2W9EL 2ZCHH 3QDGA 1U8JB 4ZAKA 4CN1A 4M6NL 3B9AA 2IQ9L 5B8CA 3N9GL 4ZS7L 2DLFH 2EXYD 1BZ7A 4YC2B 1TZHA 1NAKH 1RZKC 4YPJA 4N8VA 3FCTB 1I1AD 4MJIA 3S96A 5C7XL 1A3RL 1CDYA 2XN9B 4IHOA 3EOAB 3HE7B 4R2GC 5JDSB 1MFNA 4D0DB 5SWSB 2KQMA 4TOYL 1RV6X 3QI9B 5TJWK 5C92A 1FZJA 1JZ6A 1WBYB 3HFML 1K5NA 1S7WA 1YY9C 2EEAA 5KSAC 1F4XL 1JJUA 4OLVL 1E4WH 1PYWA 2VOTA 1IEAA 4OLUH 4FQQA 4JPKH 2XZAL 5DRXA 1RUQH 3U6RB 1YMMB 1VESA 3RU8H 5I73C 2LV4A 2C5DC 3G5ZB 3NACL 4WUUB 1OGTB 1TNMA 4TUJB 3OB8A 4GKZA 4MJ6B 5EIIA 3G9VA 2EXWD 3TPKA 2Y5TB 1EEQA 1VADA 4XNQA 4C56D 2JELL 4HT1L 4NHUA 2DAVA 3NIDF 3CFCL 1RK0A 4FHBD 2DQCH 3T0ED 1BOYA 1IGJA 3PABB 3SDXF 1CE6B 3HS0A 1UJ3C 5I1CH 4H88L 1AC0A 3PGFL 4MAYD 5HHME 4KVNL 1PLGL 3LS5H 3QWOB 4A2MA 3STLB 2HJKA 4YXKH 4F33B 1IGCL 4WI7A 4Y4FD 4LVOC 4JFEE 5CP7B 4JDTL 4XVSL 1VGEL 1OPGH 3O3UN 5C3TA 1PW3A 2BOCB 3FHAA 1IBGL 3R1GH 5HHVH 3NIGF 4CKVX 3BGAA 5CZVH 2MQ0A 2ZSVA 4JM4H 1HIML 5F70A 1OP5K 3MV8B 3QUYB 4CVUA 4OV6F 5D7LE 4MZ3A 2EO9A 2VC2L 5JTWA 4QRRE 3QNXB 4N8CH 1ED3A 3NCYP 2XACC 1JFQH 5DUML 1CLZL 2UY7A 3QAZB 4JFQA 4JVUA 1VACB 1OARL 2CSPA 2R2HA 4QWWD 4FZEH 3B2VH 3RA7H 1V3KA 2IPUG 1Y0LB 5ESQB 3U0PB 2ICEB 1AKJA 1DVFC 3FO1B 3G6JE 3QIBA 2BSSA 4ZO6A 1YEJL 5TF1L 4JFEA 4G8EB 1INQB 1T83A 4X98A 4A6YL 4HIIA 2QADC 1DBMH 2FX9L 3S8WA 1KN4L 1F4WL 2JB5H 25C8L 3ZYZA 4ONOA 3O6ML 1IEHA 3I2CL 5D70H 4TVPL 5DVKA 1IZKA 4FQXD 1QPXA 3RDTC 3T0WA 5GXBB 3VXMB 5ESAA 5FM8A 4PUBL 3C87A 2HTLD 4OM1L 1J0JA 3L7EA 1FH5H 2ZCLH 3TYFB 4WEUD 5GRJH 2Y4SA 4DGYH 2YHGA 2YPKB 2BVPA 4ZPVB 5C0BD 3U1SL 2G9HB 3LEYH 2I9LA 1U92A 3K1DA 3TBYA 3CSGA 1HHHA 4TSCL 1NGZB 3VFUB 4M1CD 3D6GA 3HNSL 4LHUD 1FG2A 3GMNB 5DK2A 3HNVL 5AYUL 4L5FL 4OM0L 3DO7A 1RQ5A 1XIWC 5SWZD 5DI8A 4PJ5E 2YD2A 4JDVA 3G5VA 2K7PA 3ARXA 1RZGA 2K1MA 5GGUB 4ODSL 1JZ2A 2Y1VA 5LGKA 2YD8A 3NIFF 1RUKL 2XN9D 4JLRA 1B6DA 4JRWA 3FQWA 1H8NA 4LQFL 4PJCF 3UPRA 4HKBB 4WEBL 1WCBA 5HGBB 4PGEA 3GKZA 4EN3D 1DEDA 3QXUA 4NQEA 1FNHA 4G6FB 1P7QA 4D9LL 3P77B 1C08B 4K94H 4MA8H 4NZUL 2BNRD 1PVHA 4OIBA 3KPOA 4IM8A 4NDMB 4U6HA 1M7IA 3GMMA 3C2SA 4PJBF 5DURB 4F7MB 5T5FH 4PY8J 3OL2A 2VDOH 5DMGC 5A2KH 2IANA 4WW1A 3HZYA 2OI9B 3MLRL 1YPZA 3H2WA 2A6DA 4XC3L 3SKNA 4C56B 5EUOE 1ED3B 5F6IB 4MB4A 1A7PL 5FGRA 3L9RB 4K3DH 3T0EB 1P7KA 5IT2H 4GRWE 2VR5A 1ZK9A 1GZQA 4EXKA 5C6PB 5IEKB 1OB1B 5HHMB 1L7TL 1U42A 3LEVL 2OR9L 5KANG 3UPAA 2F8OA 4GRMA 4BKLB 3BOVA 5DYOB 3L5XL 5JW5B 1LMKA 2DWDA 4WVRA 1CQKA 3I50L 1BM3H 4BH7B 1CT8B 2VZTA 2APTA 2DD8H 4ONHB 3HE6C 4FQHA 1HOCB 1AQKL 4KK6C 1P1ZB 4JHWH 4PGDA 5HHOB 1I8KA 1X5AA 4WU5B 2M8XA 5C09E 1YY9D 3MCG1 4U1JA 3FQTB 1LO5B 5KSAD 3RWHA 3PDDA 1F4HA 1WTLA 1ZLWH 4JVWA 4NC2B 1FE8L 1A1MB 4PJEF 1N5YH 4RIRA 1NEZG 5E8OA 2A77H 5ENWA 2R2HB 5T3ZL 4TYUA 4OLZL 2B5IC 5E8EA 5GRWA 3MCLL 2GJ6A 5F1NB 2AABH 3J7HA 2DQJH 3WIIH 4KMQA 5JQ6L 5IQ9A 3QQ4A 3EDDA 3L3HB 3QO1B 5F7LB 3CFEB 3CSYA 4GRLA 1OCWL 2ZUQC 1GOGA 3S37X 1RFDH 5DI8B 5E99L 3TCXA 3RA7L 1U6AH 3GRWH 4KHTL 1MSPA 4I5BB 4OZIA 4JQVC 1K8DB 1CD1B 4FQXB 4YZFF 2XNAB 2FJGB 2YC1B 1LGVA 2HMIC 1FO0H 1AP2A 3ZDYE 1YEIH 2V2WA 1KTKE 4H0HB 4PG9A 4OZ4B 4MNQB 3NFNB 2JTDA 4NQXB 4ZPTB 1MHHB 1TQBC 5D7LD 4FNLL 1LK2B 3V0AC 5F9WB 1EVUA 4HWZA 1HWGB 1WF5A 3FB6B 3TEUA 4PJ9B 4Z95H 5C0BB 4WHYH 2DQJL 1N8ZA 3BFOA 2RR3A 1AD0B 5DQJA 1T1YB 4AM0A 4PJHB 1A5FH 5HGHB 3LKSA 1GSMA 2ERJC 3BW9B 4NOFA 1MRDH 3DIFA 1CR9L 1FRGH 3PHOB 4LLVB 4G8GB 2BY1A 3UXFA 5DS8A 1GGIH 4OM0H 3EOTL 3GK8L 4L3AA 1IM9A 2JB6A 1H0DA 1B4RA 2J88H 3CDCA 5CD3A 3CUPB 2OK0L 5E1AA 1KIPA 2QSQA 4KZDH 5F9OL 1W72H 1PKQB 2XXCB 1F6AA 1YYMH 2QL1A 4I9WE 2P5WA 1A0QH 2BC4A 4YHZH 5D2LF 1ZVSB 5I76A 2AAVA 3I02A 5LGJA 2HT3D 4WUKL 1TVBB 4MXQD 3B43A 1T2QL 1JWUA 1S7UA 1FIEA 4PV8B 4AZ8A 1F4YL 3JV6A 3H9HA 4K8RL 2F19H 2XQBH 1W8OA 1FC1A 4PJDE 4RWYL 3CAFA 1NL0H 3CFIC 4JLRB 5C1MB 3SDCA 1WUNT 2UYLB 4ZXBA 4YFLF 3DI2B 1W0VA 5B3JE 1DQDL 3RAJH 4NC0B 3U0TB 3PWVA 1PQZB 4LFHG 4LSTL 4NKDB 3PWNB 4X8JB 5KSBE 1NBQA 3S5LB 2IFFL 5IQ7H 4X9FA 3QO0A 3FO9B 3TZVD 2NX5E 3T04D 3U30B 5JA8B 1JYVA 4L4VA 2XRAL 5HHMD 1KENH 1UKSA 3PL6D 3MRJA 3VXME 3VFNB 15C8H 1KIRA 3FRPA 5B3JF 3HPJA 4BYHA 1WC7A 2C4FU 3P0YL 4K3DL 1WVZA 4ZUWA 2X09A 5I8EB 2FWOA 2AK1H 1B4JL 1IKFH 4K3EH 4BSVB 2MTPA 4LARL 2EIDA 5I1IH 4XP5H 5J6GA 5DJXB 1K8DA 2QHLA 2CR3A 5EU6B 4OSUL 4U7SA 4GT7A 4YHNA 4Z7UF 4L3EA 4OZGA 3JWDH 5CKGA 3L3DA 1IZJA 1RD6A 1G0YR 3QFDA 2JIXB 2AV7B 4RISL 3VD7A 5CJ5A 1TCRB 4P46B 1UM5H 2DYPB 5HTSA 4XVJH 3GBMH 5DJ8A 3T3PE 3JSSA 4XMKL 1FSKC 1CDCA 3IDUA 1CI5A 1K5NB 1S7WB 3LEVH 5JOEA 1P69B 3A6CH 2E7BA 3NCYS 4WFHE 2WUBL 3WNKA 1CDHA 2DWDB 2Q86A 1CD8A 5MERB 1WAAE 1HSAB 4HV8A 4MSWA 5AG8A 3X17A 5I15H 4OCRL 5I1KL 2WMPA 2BNUB 2HFTA 2J8UB 4KTDH 4YC2C 4B0MM 4Z5RB 4OLUL 4ZS6C 5C0FB 3L5HA 1OTTD 2YD1A 2HH0H 4OLEA 2E8YA 4TQEH 4NP4L 3TYGL 1R5VB 2AP2A 4FRWA 3EYVA 4JG1L 4PG9B 2Y6SC 2DTML 2PR4L 4MNQD 3W39A 2XZCL 4JANA 1F42A 2X41A 3NGBC 4TNWF 4HMEA 2DICA 2Z31C 1C7TA 4OV5B 1BPVA 5DD0H 1LEIB 3QNZB 4W4OA 1KLUB 3RQ3A 3VXSE 1CXHA 3KPSD 4N9GA 5EPMB 2Y36H 1J8HE 2ICWB 2GITA 5TDNA 1NCAL 1S5IL 4HH9A 4L4TB 1GIGL 1JGDB 4LNRA 1VFAB 1JL8A 2VDML 2A6KA 5IB1B 4GG6E 3C6LB 3MR9B 2YOCA 1ETZB 2WIIB 3MLSH 3BRDA 4N1HB 1JPSL 3FQRA 1LP9A 1TZIB 3BDYH 3SPVB 1KTLA 4O9HH 4YHLL 3CNKA 5DJZB 3IRPX 3IU4L 4G9DA 4TNVF 3ZSSA 3EHBD 1AGDB 1S8DA 1S7SB 4IOIB 3QH3B 3OR7A 3V5KB 3W5MA 5K9JL 3P11H 4WWKC 2D2OA 4WI8A 1XIWD 5DSCB 4ISVA 4YXHH 2CKBH 4PRHB 4JY5L 4D0BA 2OP4H 5C0DA 3OHXB 2NY5C 1CZ8L 1OTSC 3GSNA 4P3CL 4JFXA 3VI4F 3ULVH 4DTGH 2ZUTA 5C71A 5I30H 1R0AH 4JM2B 4RNRB 3B6SB 2CD0A 3KWWA 4O58L 3PWJA 2B4CC 4P46A 4DKAA 1GGBH 3U4BH 1FAIH 1FL6B 1OQXA 2NCMA 5IMMB 2NY1C 1MREL 4LEXL 2I9LB 2AS5M 4GKSA 4Z0BL 3O4LE 3UEZA 1MHPH 4WU7B 1ERNA 4C59B 4HLZH 4K8RH 3RPIB 1QFUL 1JMXA 3BP6A 3CVIH 1AO7E 1AXSB 1DBAL 3HR6A 4UQ3A 3W9EB 3V4UH 1MHEB 3FTGA 5JPNB 4UUJA 3IDGB 1A2YB 4YHML 5TDPB 4XBPA 4ELME 2WW8A 1IAIL 3C2AH 5INCA 4Q0XL 1EHNA 1INDH 4RFEB 4DK3A 2JIXD 2VUOA 4PRPA 2RHEA 1RUQL 3VDAA 3TBWB 1HHIA 2BFVH 2P8MA 2X10A 3BUTA 3MJ7B 1BVLB 5C0JB 4PJHF 3FB5B 1NAMA 3DUUB 2DBLL 4KK5C 2PTTA 3MUGB 5DD3H 1UH4A 3BUYA 1PZ5A 2B1AL 1ZA3A 3ZKND 4PJXA 1X4XA 3HUJB 4WW1B 5T3XE 1OY3B 3G6DH 3SPVA 2ITCA 2Y9RT 3QR2A 3RWGA 4J8RA 3QUYA 5FK9A 3BGMB 3N06B 5F96H 3GSXA 5J1AB 1KCVL 4ZO8A 5GGVY 5BQ7B 1NUNB 5ADPL 2BERA 3FAXA 4XXDA 3ZE1E 5HYSG 2ESVD 3IDJB 3C5ZB 4Y1AD 1ROWA 5IFHH 3QXDA 2VZVA 1FL5B 2DLEA 4RGOH 5F7UA 5CD5D 3NIGE 3U82B 3L5IA 3O4LA 4FFVC 4L4TA 2HMID 3QNYA 3LQZA 4MD0A 2F5BH 1HHGB 2CRMA 4ACPA 4DGIL 1CT8A 1Z3GL 1I9JH 1CWVA 3E6FA 4P4RA 3BSZL 1ZLVK 1IC7L 2HG5A 1DSFL 4XVTL 2A6IB 3BIBX 4XCEA 5BCAA 1ZHKA 4G6KH 4HKJB 1FFPB 2Z31A 4NCDA 3QUKA 5DJ2A 1HH6B 3QEQA 1FVCA 1IC4L 1EMTL 2X4SA 1CLYH 2BZDA 4XHJC 5KW9L 5C70A 1I3VA 3PQYB 3IXAB 1UB5A 5T3ZH 3OAYH 4DUXA 4JO1H 4E9LA 4K23L 3OKMA 4NNPL 3MRGA 5A2LH 1OVZA 3K7UA 3UBXG 3C5ZA 2VSCA 2FECL 2L0DA 3AY4C 2Y7QB 3TNNB 5A43C 5MERA 2VRAA 4Z9KB 5JHLL 4U6VL 3ETBF 5B4MC 4NRZB 3CDGB 4FQJH 3BZFA 3RIAF 3C08L 4ENEC 2AJVH 3DWTA 1MHHA 5HXMA 1K4CB 4RCAA 2AXGB 4FP8L 4RAUA 3VFSB 4P49A 1F3DH 1CCZA 5GISL 3WXWH 3P4MB 2HT3C 1KLGB 3S34L 2R2EB 3GIVB 4MXQC 2CLZB 4ODTL 2EYRB 4UT6L 2Y72A 1X5ZA 2GSIB 4MAUH 3U79A 1VPOL 4FTVE 4HKBA 1VFBB 1V7NL 3MJ9A 4JN1L 3HI5H 5FGSA 5KVDL 3GM8A 3DX6A 3BN9D 4BH7A 3P77A 4EOWH 5IKCA 3U9PL 3L3JB 5TE6H 4N9GB 4RAVA 4RFOH 5DUBB 1WIPA 5C6TL 3K3QA 4XPHH 1JHTA 2QTEA 3HMXL 4YQXH 1FZKA 1ZSDB 2RBLA 1U0QA 3DYPA 3FQUA 3O9WD 1EHAA 1WWAX 3TFKC 2P5EB 3P73A 3TVMD 1A4KB 2WQRA 5IV2A 5JW4N 3VH8A 1C7SA 6FABL 1F90H 4JFPB 4EQ3A 2DS4A 1UGNA 3QFJA 2CH8A 3VFTB 2EC9T 2HA1A 2MWCA 3TIDB 4ZTPL 3EO1A 1UCBL 3FFCD 2ZUWA 3IKKA 4NQED 3WHE0 4KJQC 3I3DA 3QDMD 4M5ZL 1CFSA 4RFNB 1JWUB 4NQUA 5D70L 3KYKL 5FHAH 1NC4A 4PTUA 3GKWL 1U8KA 4DZ8B 2DBLH 1ZVSA 3TIEB 1T6VN 5GGSA 4K9EH 4TUOA 1B2WH 3FOMB 2YEZA 1EERB 1CU4L 2YN5A 1U8MB 2C9AA 2WWMC 3TWCH 1N6VA 3FZUD 3H7BB 3ZKXB 1FDLL 1J87A 1JZ3A 2NY1D 1U8PA 5F96L 1B88A 4OLWL 2CDFA 5FB8B 1KB9K 32C2A 5HGHA 5I8OH 5ITFA 4DQOL 1FZJB 4BSVA 4R0LA 5GRJL 4Z7WA 2IQAB 2MQCA 1R3KA 3ARSA 4ZQKB 2W60A 4NGHH 4ZFFB 4MDJB 5I8KL 3EO1B 3HUJA 3WNNA 3OTTA 4MD5A 1UEMA 1J11A 12E8L 4Z7UE 4FFYH 2P24A 3DV4A 2PYEB 5LCVL 4UIKH 5E70A 4KH2A 1RI8A 3AU1B 3ZE0F 3W82A 3MRQA 2EDYA 3EJYD 3QULB 4PJXF 3EYUL 2F53E 4XCEB 1NFDE 3OKNB 4HIEA 4PRIE 1Z5LA 4WENB 4I8DA 5DD1L 4TOYH 2IAMB 5HPMA 2G75A 4XCYA 2AQ3A 4JFDA 4HV8B 1OCWH 4Y19D 4QOKA 3MBEC 3T2OA 3UC0L 4U6HB 2BDNL 3PQYD 4Q74A 1T66D 2VXQH 3HTLX 1ZLSH 4BZ1H 5JIKA 1G9ML 5F7MC 1JPGA 2BY2A 3IJHA 3ZTJG 2CO6B 1RZ8A 4L8DB 3TNMB 4JGUA 4JO2H 4N8CL 5I75C 3GSOA 4ZPVA 5EO0B 2VLJE 2GIYA 1K4DA 5DA0B 4Q6IA 4O2EB 4JDTH 4FXLA 4XVSH 5E08H 5IVZA 3FB8B 5MEOB 4Y2DA 1KIUA 3RX7A 1CF8L 3TJHD 1KBGL 1IL1B 4QHUA 2QSCL 3G04A 3GIVA 1EZVY 2ICWA 4HGMA 4FZ8L 5JHLH 2GUOA 1QSFD 1AHWB 5F7WC 1OTSD 2BRQA 4U4BA 4XAKE 3X3GL 2BHYA 3SO3C 2ZJSL 3JWOL 1OT2A 1TQCB 2R4RH 4ZUVA 1ULVA 1XGRA 1SY6A 3KPRA 1REIA 5E6IC 1KCSH 3GBNL 1YUHB 3OR6A 4GUPA 2IQ9H 1NJ9B 3FQXB 4WFGE 3W81A 2AV7A 3FO2B 2BY3A 3ABZA 1RZFL 5TQ2L 4CN4A 2LE9A 1PKOA 1T20A 3TVMB 2VXVH 5FYKU 4NIKB 1QRNE 3HNVH 1FJ1A 3RWFB 3QA3A 4JDZB 2C3XA 3Q5OA 1A4JB 5L9DH 1JTOA 3QUXD 1URLA 5DDHB 2X4PB 2BNUA 1D5XA 2CLRA 4W68A 3SDAB 4XH2B 2FB4H 4BH8A 4KTEH 4CN6A 2WWKT 4JFFD 2EECA 3CVHL 1R6VA 2ENYA 4KKLD 3SE9L 3T3PF 3WS6A 3N85H 2Z35B 5IFAL 1RZ7L 2DQHL 1CGXA 4J4PD 1EX0A 3PXJA 3T0DA 3U7AA 3IS0X 3C5JB 4FQIL 1XH3B 4QRQB 1E4XI 4WNQB 3MRNB 3QEUA 1YECL 4MD4A 4PTUB 4LHUB 3VGAC 1A9EB 5B38A 3DSFH 1JF1A 2VLJD 1XGQB 5BVPH 5L2KE 4UZGA 5HDQL 4EZMA 5DGQA 2O61B 1S7TB 5AZ2H 3IAQA 1SYVB 2X89D 3QUXA 4S1SH 5F44A 1PSKH 1JRHL 3GSNL 4M7JH 5I1EH 2P5WD 4YFEA 3RP1A 1NBZA 2RFXB 4MDJA 3SDDB 5AAMA 2G5RA 3IFPA 4Y16D 2FGZA 4RISH 1LDPH 5FGCE 3FN0H 2VAAB 3L7EB 3SOBL 3I3EA 4GLRI 5D7JC 1RU9H 1IM9D 4EN3B 4G9DB 2J6EH 1RIUH 2Q8AH 4BQ8A 1B0RA 4RGND 4Y4HC 2X70B 1JHTB 1HYRC 2BNRB 5CEYA 3S96B 4NGHL 4OI7A 3CFEA 5MI0B 1UM5L 4X4XB 2G60H 3SGJA 3HR5B 3TZVC 2GUOB 1ZT7B 3EO0B 2J12B 4GAYB 4KJQD 1UXSA 1MCCA 1PSKL 5E24E 3H9SD 1I8LC 3S3JA 2YPLB 1QNZH 5HYQB 4OV5A 4JN2B 3K0WA 1FFOB 3CMOL 4XMPL 4XNYL 5EOCJ 5DA4A 2AQ2A 2H26A 4PJ9A 3MLWL 2IPTH 4QHMA 5E7BA 5EO1A 1DQDH 3RAJL 1QSEB 2D9CA 1T2QH 2X2YA 2DI8A 5SWZE 3MBEA 4YR6A 3S98A 3U6RA 3QI9D 3GDBA 1TXKA 3PHQA 5D4QA 4X0KA 1UXWA 1KELH 3S36H 1U8MA 3RY5A 1F8TL 3O81A 2UWEA 5DS8B 1FNEB 1K8IB 1NBVL 4NM8H 1S9WB 2X4OB 3KLAB 4DWHA 3S88L 1AGBB 1KCUL 3M1BA 2BVQB 5ERWB 1CDBA 1MLBA 5HHOD 5DSCA 4NKMA 5F88B 4FABH 2VDQL 1C12B 3GEWB 2O26U 3HC4L 4WHDA 2HKFH 1AHWA 1TZHB 4NPYB 1SJHA 3OBAA 4LNVA 1TTGA 3L1OL 5AUMA 1T1ZB 1DUYB 4HEPG 1NLDL 4WNQA 3BVNB 4GMTH 4MAYB 5CIPB 4P5TC 5B39A 3TBWA 1QACA 3H6JA 4X9IA 4P2OB 1VSCA 5CHNA 4Z7VE 4Q97A 2O93L 3SKMA 4JGMA 1QSFE 5BJTB 5JQHC 2HVJA 4R26H 5L8LB 4P5MA 3QPQD 3TLRA 2O5YL 2NXYC 5IHZB 2JF1A 1KCKA 2JK5B 3BXNA 4MNHB 4UB0H 4GG8B 2DL9A 2WP3O 4Y19A 4Y7MA 3MRGB 3JVGA 5CBEA 3TFKD 4Z6AT 4X98B 1SEQH 3EBAA 1G9MC 3GNML 4BQ6A 4NM8L 1UB5B 1ZS8A 3GJFK 3ZDYF 4FQJL 1HKFA 4WTXA 3MQIA 4WUUE 2GSIA 2DLTA 5EBGA 4JFQB 4KK8C 1KN2H 1JE6A 2ITDA 3EHBC 4JDZA 1P53A 1UJTA 4FNLH 3X11A 2VZSA 2VLJB 5B8CB 5LQBH 2IBBA 2X9YA 4G8GD 3MO1B 2W9LA 2CMRH 1FQ9C 2V6HA 5I0ZA 3WXWL 1B6UA 2V7NB 5IBUG 1G7MB 1MI5B 2P5WB 4PJ7B 3TYFA 4IS6A 5JMOC 2EYSA 3AREA 2LU7A 4Y16B 3NCFB 4Q9QH 3Q1SH 2NY2C 1F3DJ 5J1TC 3O8XD 1O7VA 4LRIC 4AG4L 2A0LC 3M8OH 3VGEA 4FG6C 2QADB 4YR6B 4I13B 4RGNB 2X05A 3IVKB 1D6VH 1U8OB 3MLVL 3GSNH 4IRSD 4M7JL 5GSRB 5I1EL 5IB4B 5CMAB 4U1KA 3TCLB 4MLIA 2FWOB 3MXVL 1FCGA 3QUXC 1OF2A 5DMIH 4ODWA 1YQVL 1ORQB 4BUHA 1EDQA 5IW3A 5GGQL 2IH3A 3O11A 4JKPH 3DROB 3LIZH 3JV0A 2OZ4A 1JPTL 5BV7C 4QRSB 5DK2B 3LKOA 1I1FB 3BHBB 2FX8H 3FQWB 2W9DL 4OB5H 3ZDZF 4N0FB 4JB9L 4QF1B 3PP3K 5J6HB 1KCRL 1HZHL 4LHUG 2PKDA 2I9TB 5E2VH 3V79C 3LVEA 2FZ3A 4ZAKC 1CFVH 4QCIA 3LD8B 1CLCA 4R9HA 5I1DB 3PL6B 3D0VA 4XP4H 3BIAX 5DO2C 1QFWI 4O00A 2CUIA 2ICWI 1M7DA 1MCRA 5JXEA 4PJAE 1NMAL 1FNEA 5MP6L 2A1WL 3PP4H 4I18B 2P24B 1VKXB 1AFVH 4C57C 2I27N 1XR8B 4UQ3B 4NT6B 1U8LA 4Z7QE 5EO1B 3RVUD 5HI5D 4HX1B 1IGMH 4F57H 5AAWA 3BRFA 3DVFA 4QRSA 1AGFB 4DQOH 1J0ZA 1PBYA 2EDDA 1Q9KB 1OD9A 4K94C 2A74B 4I3SH 5CILH 5CZKA 3WN5A 1TETH 3OXRB 4H8WC 4FQCH 4M7LH 5F8QC 1IC1A 3Q3GB 4D0CB 4L3CA 5ICZA 1KV3A 3PWUA 3RY6A 2VMFA 2VR9A 4D3CH 4IOFD 5IOPA 5A1AA 5BJTA 5E6ID 1MY5A 3G6AB 5EN2B 4GAFB 5FYJL 4P99A 3K74B 5J06A 4TPRH 2Y5EA 1BZ9A 5HDBF 3UTSB 4PJ7A 5EA0L 1KEGL 3N85L 2V2XA 4GKNA 1HXYB 2HFGH 5D1XD 4NZDA 4HUXA 4WI5A 3LKNB 4I4WA 3GJFA 1Y6NR 2PXYD 5HYQA 3QUZD 3OXSA 1C1EH 5KS9A 4NC1C 3UTZA 3W11C 2I60L 4KFZC 4IRJA 1FLTX 4ODXB 1ZHLB 1I8LA 4NKOB 1SM3H 2R69H 1WT5A 1M6OB 5C86A 5EORH 3HZYB 3B83A 4YXHL 2FHBA 4Y5XB 4YDLC 1K6QH 4NN6B 1U8HA 1RZJL 5EUOB 5KSVA 2AEQL 1H8SA 4HUUB 3RL1A 4BUGA 3WJLC 5EOCL 1OAYL 4AYFA 2X40A 3G5XA 2FO4B 3HI5L 5KVDH 4HS6B 2JELH 3GI8H 4EI5B 1I8MB 5EOQH 1CFNB 1JPSH 4PJDF 4L8BB 2H32B 1N6UA 1Q38A 4I3RL 2Q20A 4DW2L 4NRXB 1DANU 3QA3B 3MZGB 3WNPA 4KTYA 1QHPA 3GFUA 5GIRB 1MREH 4LEXH 3SDXB 3TBSB 1MH5B 1XIWA 1QEWB 3U4EA 1QFHA 1CBVL 3N1MC 3Q6FA 4CRPA 5FYKE 1XGTA 3CUPA 3LN4B 5F93C 3JWDL 1AHWC 3MUY1 2WBKA 5D1ZC 3H7BA 5GQBA 1YMHA 2Y7QA 1OHQA 5KZCD 5GSRA 3WFHB 2F5AH 1K4CA 4FFZL 3SE4A 3DGGA 3BP4A 5IG7A 1T7WA 3V5DB 1DE4A 4K3GA 5HVGB 1A3LL 4LPXA 3LB6C 1HDMB 4HMCA 5DDHA 4JAMA 2E27H 2P45B 4JHAH 4LLAA 1RZ7H 4KTDL 3NBNA 4WFHD 2V17H 3EYSL 3CFJA 4QYOB 4ISVB 4X7SH 4MDIB 3ESVF 5MENE 2I5YH 5TDPA 3R8BB 2R1WB 4CL7A 4DKFH 5HDQH 4WW2C 2VDNL 4HUWB 5JW4R 1P4IL 2D03L 4G8FA 4F9LA 5CIPH 3RZCD 3UTSA 3LPWA 1E28A 2F19L 2XQBL 4DN3H 5DJAB 1F4YH 4CBPA 4FFYL 2W0KA 1G7LB 1RIHH 4HSQA 4LMQE 3IJHB 5IB2A 3LH2L 4FG6D 4GBXD 4P2RB 3SJVE 5IFJB 1SYSB 5C07E 1U3ZA 2VLRA 1FL5A 4K55A 1F90L 1FNLA 1NGYB 4Q9RH 5B39G 5D72H 4JPVL 5DWUH 3Q6GH 4MCYB 2E9JA 5DMGD 3AREC 1BQLH 2EIZA 3QQ3B 3S4SB 5SV3A 4RGMB 3PV7A 5DHVA 1ZLUH 3ILQD 1QNZL 4LRIA 2H32H 1AQKH 4PV8A 1EEUA 1A6ZB 2HWZL 3UTSD 2OS7A 4N0YH 1MQ8A 4K8RC 1VFMA 1OP5H 1X5GA 3SBWC 4XBEH 4P5TD 4UU9A 3LN9A 4MNQA 4W6WB 1IKFL 4CMMB 5A3IC 2AK4D 3VXUA 2PXYB 4HK0B 4EDXA 5DMKB 3D25A 2O61A 3RBGA 4LARH 1HINL 5BS0E 5E08L 1KJ2L 3CCHA 1Y18B 4U1HA 1A9EA 4MXVE 4L8SC 1MWAL 1N0XH 1RUMH 2VZ1A 3KG5A 2X4QA 3ZE1F 1MFAL 5E4IA 1K3IA 3C09C 3GBML 4RAVB 1DLFH 1XF5B 3L9RA 4R8WH 5F9JB 2UWEB 5BOZG 4JFDD 1MFEH 2VO5A 4KK6D 4EI6B 1UWXH 1T2XA 1R24B 3OV6A 3PHQB 4N0CC 1KT2B 1OW0C 5EOCH 2DBJA 4NBYB 2EE2A 4NNPH 4R90H 1I3GL 2XKNA 5ETUA 5D7LA 5FM4A 4DGIH 3ZMRA 5B39B 4PY8I 1SQ2N 4G8EA 5KSUA 1UXSB 2AVGA 3GSQB 1WJ3A 2BRRH 2D7TH 4UNTA 5JORB 1A02N 3DURB 1WC7B 2P8PA 1X5JA 4OI8A 2APFA 5T33H 4XCFL 3BKMH 1FORL 4LLDA 5I74B 4MNGE 3ORJA 2V5SA 1UWEL 1L7IL 1UACL 2FH6A 1DN0A 5LBSH 1U36A 4X80H 2B39A 1J1PH 3L5JA 5IB3A 1FN4A 4Q0XH 5FFLA 2O5YH 1KB5B 1AR2A 3JZ7A 2HLFC 1IKNA 5TE4H 3VXTA 4EVNA 2GAZB 2WINB 3UJIL 4L4TD 4DVRL 1IM3A 5CIPA 1QSFA 3BQUB 3FOLA 3HN3A 2X4TA 1Q9WB 1WFOA 4IRSC 5HVHC 1NDGB 4JFFA 3T4AB 3RVVC 1FVCB 4PS4L 1OTUC 5CJQL 4OKDA 3IU3B 2BOBA 1N6QL 4X99A 4YK4C 1RHFA 3LN4A 4QXUL 1A6TA 4P5KB 5D7SL 5F89B 5CAYB 5DVNA 1WITA 1KFAH 3FONA 4UV7L 5JLZB 4FMFA 2YXFA 5CSZB 4ONGL 4WGVB 1K8IA 5ITBH 2GTZA 4PJAB 1ZS8B 4ZXBC 2NXYB 2J8HA 3UJIH 4DVRH 2WBJC 2A38A 1FORH 3D2UB 1KN2L 5I1LB 2DM4A 3ZL4L 3RNQA 2OX5A 5HGBA 2P5ED 4MQ7A 5CLTA 1NC2B 2VLKE 3HCVA 3UTTA 3X3GH 3ES6B 1U8OA 1LO4L 4Y16A 5D93B 4H1LG 4DKEL 4HXAH 5GGSB 2MQ3A 4JM2D 3GKWH 1Q9WA 2X1WL 2NY0D 2GITB 1BFSA 2D4DA 4LGPB 4WDIA 4XNUH 4YHPA 4L9LB 4P2QD 3PWPA 4PJ8C 3HC3H 4LLWB 1C8PA 1BFTA 3F7YA 1G7JB 1WZ1H 4HH8A 4LQFH 1FL6A 3RVUC 1CICD 3HMWH 3KJ6L 4AT6B 2C3VB 5FCUL 1PEZA 4XTRC 4G9FE 1OSZB 3Q6FB 4ZNCD 1UWXK 2EDEA 4MCZB 1MJUH 5CEZD 1JBJA 3WFCL 3MJ7A 4PV9A 3CMOH 1OPGL 5IFAH 1KPUA 2P5EA 4HFUH 3PQYE 4AL8L 1QFWL 4JFYA 3V4UL 4GRMB 4EQ2A 3QEUB 4N0YL 2ARJQ 3E3QE 5F7NC 4XMKH 1ZGLA 3ARDC 4JPIB 4EKXA 4OD2B 2EE6A 4HXBH 1VB9A 2EYTA 3FL7A 1X5YA 2NW3B 4CJ1A 4Z78B 2HFEA 4MGXA 1MWAH 2C1PA 2R1YA 2Z4QA 3IAPA 4O2EA 2R0ZL 3L3GA 5AWNL 1A7QH 3OAUL 3QUZC 3F5WB 4JGJA 3LKSB 4KI5E 4JY6A 3JWNC 3W11D 4NUGL 1P1ZA 4MJ6A 4HX1A 1QLFB 1BM3L 4F57L 2J3SA 3NCCB 4S1SL 4Z7UA 4LOUC 1CD0A 3MRKA 4WW2A 4OCLC 3S4SG 1T0MA 5H8DA 2BOBB 3LD8C 3BKJH 4RRPA 1BJ1H 4MWFA 1PX4A 2OMBA 2ZKHL 4KY1H 1P2CB 1NCAH 1Z6JT 3VFRA 4XH2A 4F9LC 4HPYL 2WUCH 2FGWH 4WJ5A 5T1DH 3MRHB 3RWIB 1NCWL 2FIRT 3KPRB 3VGGA 2M26A 1V8HA 1DQQA 3ZYJA 3C5ZD 3ILQC 5I6XB 5INCB 4RGOL 4ZFZB 4TRPL 4U1MB 3GHBH 3KR3H 1QKZL 1XH3A 1S9KC 4PGCA 2GAZA 1MCOL 4S2SB 3IU4H 4ZYKA 3S35H 1Q72H 5M7QA 4JFED 2DQDL 5DJ2B 1PD6A 1J0YA 1J86A 5ID1A 1UCBH 1UWEH 4I48B 3O2WL 4Z7NE 3EYQC 4L5FH 1WEJH 3QJHA 5ISZE 1F4AA 2C1OA 3GRWA 4KDWA 1H3XA 2W1NA 1EAPA 2IPKB 2R29L 4GKNB 1L4IA 3PGFH 3BJLA 3KYMB 5E99H 1NANI 2CO7B 2ZNXA 3ZKMC 5FO8B 3NFSH 1G0DA 2NTFB 5AYUH 5SWSE 5DEFA 3S5LG 2MNUA 2GKIA 3W5NA 2WK2A 4HDIB 3QPQC 4N8PA 1KTRL 3K4DA 4GW1B 3OJ2C 2DJSA 4S1DC 2EIEA 1FGNL 4QRRA 5DC4B 1DUZA 3Q1SL 3QT2A 3WL9A 5CCKH 4X4XA 5BS0D 2HH0L 4OGXL 2VZ3A 4C4KO 2D4FA 5K59F 1T1XA 3OKLA 4J1UA 4BQBA 5M95B 1NUFA 4NNXB 1ZTXL 3MGTB 2OL3B 3HG1A 3TJEL 4DGVL 5HI3D 3KVQA 1C5DA 3QXAB 2APVA 3OKEA 1QHOA 1RK0B 4WW2F 1F02I 3WIHH 1DANT 4HPOH 3CXHJ 4KKNA 2BVPB 2ENSA 3BH8A 3LHPH 1BHGA 5JPMA 4U1GB 2EE9A 2R2CA 3V0VA 1MJ7H 1NCCL 4YHPB 4IDJH 1NFDB 2FJGA 2YC1A 3INUL 4LU5H 1XGQA 4XNUL 1ZVYA 1KC5L 3CFBA 1KB5A 2CK0L 2WQ8A 3RWDA 2FEDD 5I1JL 1YMMA 3BZ4B 1OTUD 5AG9A 1HEZB 4KDVA 1I1YB 2AJUL 2CRZA 3QDJB 4PRPD 1UM4H 3WFCH 4DKEH 3O9WB 1MCIA 2XWJB 2IG2H 5I19L 4PJ8A 1QBAA 3VXRB 3H42H 4CMHB 1D5IL 2VZUA 2FYYA 3NZHH 1TNNA 2EO1A 3G5XB 1OGAD 3TIEA 1T7YA 2J6EL 1XGPB 1CE1H 2Q76A 4XNMB 4M03A 3V7AG 3NZ8B 4RRPG 3GUTB 1WZ1L 5DRZB 4ZXBD 4IMLB 1JWSA 4HAFA 1N7ML 1PGRB 2BX5A 5HSFA 4MX7B 5CP3H 3SKUD 3DTXB 3FFCB 3OJVC 1FIGH 3QEQE 4HUKB 3IFNH 5M94B 5J11C 4ZFOL 1KBGH 3INUH 3MSPA 2IEPA 5L2JA 4OSUH 1IM9B 4Z7QF 2HLAA 5DRWB 2R0KH 1JHLL 3SCMB 2R9HD 2GSGB 4LKXA 2QQKL 4Z0XB 5H35A 3KYKH 3TP4A 5IMOB 2W0FB 1NKOA 4LQ1A 1B2WL 3MROA 4NNYB 3SY0B 4LK4A 1HXYA 5FKPB 3UJJL 3V6OA 3O45B 3GSVA 4CW1B 5D72L 3O3EB 3WFHA 4KQ3H 1NBVH 1YEEH 4B7IA 1DFBL 3Q5TA 4KRLB 2EZ0C 1U95A 1MFCH 1IGCH 4IEFB 5A2JH 4OCRH 5I1KH 4P2CG 1J8KA 3MLXL 4WW2B 4OBSA 4PJFE 3UTQB 3MLRH 1D6EA 4ZMAT 1CL7H 4UBDD 1SEBB 1ONQA 1RMFL 3PGCB 5DHVB 3T3MF 4JFEB 4KKCD 3IFOB 4ETYA 4PYGA 1EO7A 2LTQB 4URTB 1S5HB 1T1ZA 1JGUL 2EC9U 5E03A 1MRDL 3FHQA 4NDMA 1C12A 1PG7X 2OQJA 5IMLA 4XCCL 2GW5A 3FT2B 5HHXH 4Y19B 1AI1L 1NPUA 3LAFA 3QEGH 5E1HB 4GQ9L 1P9MC 4HWEH 4G3YL 3HLAB 1UKQA 3MACH 5KS9E 1BQHB 1CGSL 5BQ7A 5FA3B 1KNOB 1CDGA 1BVKA 5BRZA 1W72B 4X6DE 3L6FB 2IAMC 4KV5F 2Z8WC 4E41D 3VFUA 3MBEB 3H9SE 1WTGT 3BH9A 4JN1H 5ESVB 1I3GH 2K7QA 5IIEB 4ZQKA 1CBVH 1WCQA 3I9GH 2WP3T 2EEBA 5EZIL 3IYLW 1NANH 4OGAC 2R0LH 4UILL 1KIQA 2PW1A 2QQQA 3U36A 4PUBH 3G6AA 5EN2A 3UYRL 1A1OB 3EFDH 3C09B 1A6WL 1IAKA 3F7VA 4NNXA 5B4MD 4OLZH 3FRUB 1JCKA 3PP3H 3DYMA 3U0WH 1V7MH 2ORBH 2BVOB 3EJZC 4P4KC 5FO9B 2X1QA 2HLAB 3JWDC 1EFXA 1WFTA 1CL7I 4RGNE 1FPTH 4Q7DA 2ICES 2HN7A 1R3IH 2W92A 5BXFB 5D8JL 1CXEA 1T3FA 3FB7A 3FQTA 4IS6B 5J89A 4CNIB 4Y4FA 4XTRD 3V95A 2OTWA 3H7LA 1U8LB 4LSRL 1MF2H 4YDJB 4M9OA 4PJ5B 5GRUH 2NPLX 1MI5D 2H6PA 1P4IH 2CXKA 4I0PD 1U8QB 5EZJA 1X5LA 3RWJB 3EGSB 5C09B 2VXVL 1CGVA 2XWJA 4PRAA 1RULH 4HS6A 3W2DH 1GVIA 4V1DA 3MRRA 5BZDA 1U8NB 1BFVH 3MRDB 1FP5A 4YDVB 4HIXL 2F54A 4UILH 5C0EA 5D71H 4NKQB 1Z9MA 3V5HB 3D0VB 1MCQA 4N8VG 3I75A 1XGRB 4NZJA 3SCMD 5CGTA 1RZIB 2XNAA 1J18A 1NGXA 2R8SL 3LEXB 3GSNB 1MHCB 3GK8H 5I1DA 4LCIL 3CMGA 4MMZC 4RX4D 4CMMA 5A40E 2F8VA 3NPZB 3DVGA 1M1SA 1NGWB 1UZ6F 4XPFH 1R5WB 1U91B 2NLJA 3M07A 3GJFB 2AK4A 4GXVH 3VMOA 2FIKB 4PREB 3SJVA 5FECA 2VDPH 4R4ND 4BK4A 4ZS7H 2E6PA 3DVNA 3TT3H 5MEPA 1M4KA 3QXVA 2XA3A 1NFIB 2DM7A 3A6OA 5EC1A 1D5MA 3DV6A 1K4DB 1JNHB 2WWMD 4D9QE 4OQTL 3BEVB 3V6FA 1OWRM 3WDHA 2ZZUT 5F89A 5D2LB 4E0RA 2Y5TA 2HAZA 2X44D 2YMXL 2FX7H 1NLDH 3QDAA 4Y5YA 3UPRB 1ONQB 1MOEA 3AAZA 3ARYA 1NUDA 4FFZH 3S9DB 3QDGE 1U41A 5DJCB 2AJ3B 4G8GA 3U9UB 1INQA 2A6JA 2OQJB 1EBPA 4EUPG 5IROA 4JPIA 4PD4K 1YMMD 4ODHH 3HZKB 2VB5A 4LPCA 4DKFL 4TUKH 4KXZI 3L5XH 4M6MH 1CFTB 1J10A 2A2QT 2G5BB 2YBRA 5DMYA 2XZQL 1UXWB 1MWAB 1XR9B 1ACYL 4HWZB 2JJWA 4LCYB 3RZCA 5I1GH 1YPZB 2ID5A 1GPOL 1CDUA 3OR6B 2F54E 3FCTA 2EH7H 4J3WA 3E6FB 3U4EB 1M05A 1TVBA 1EPFA 2XTJB 1X5IA 1Q1JL 1T66C 4X4YA 3HAEA 1PFCA 4PIRF 2DJ4A 2KPNA 1LEGB 4NQDD 1OSPH 2MPAL 2DMKA 3JTSB 3WNMA 3WIHL 3HLAA 1MIEL 5HHVL 1OAYH 5I1CL 2I60H 4APQA 3PJSA 5DD5L 5CEZL 2X7LB 3DGGB 3RX5A 2CKBL 4UMGA 2DKSA 4D3CL 1JWMA 3T0BA 3OX8B 3M45A 3MA9L 2F74B 5IW6B 5DQDH 1KLUA 4Z7NF 1DLHA 2VDKL 1DL7H 2CKBA 5EA0H 5TQ2H 3SO5A 3CLEL 5C2BH 2BSSB 3G6JF 5J1AA 1Y18A 1QSZA 2WLZA 2DIJA 1FYTE 5TFSL 4EIZC 4UTBH 1RZ8B 4L8DA 1UA6H 2GCYA 2MJWA 1JHKH 5I2IB 5CUSL 4AH2B 1QFUH 5SWQA 5HYIA 4O4YH 4PJCA 4UT7H 3TV3L 2X42A 1HH9B 3O6KH 4PGEB 2VDOL 1GIGH 4P9HC 3WLWC 1BBJA 1EA9C 5F71A 1F97A 4WFED 3HG1E 2GTWA 4DZBA 5C09D 1UB6B 3UZVB 3WL9B 1YECH 3QZWB 5EZLB 5DD0L 3H3KA 4EI5D 2ESVA 5CD5C 3PDOA 4HWBA 4FQIH 4OF3A 4J4PA 3VXMD 5BVPL 3OGCA 2YN3A 1P7KB 2GQHA 5IVNA 3RWJA 4OCYL 3KYOA 3ISWA 4Y4FC 1AFVL 2MKLC 2EDNA 1SMAA 4C56A 5GGVL 5SX4I 1U8NA 3H0TB 5CS7A 1N3NA 2O5ZL 2DLIA 4PB9H 5EZJB 3B3IA 1T2JA 5DJXA 3HC0B 3G6DL 5IUSA 1J88A 4NO0D 1OAKL 3WS6C 4HUWA 4F58L 4U1KB 4JN2A 2ICEA 1EJOH 2GY5A 2DQTL 4P2RE 5D2NE 5DJ8B 3D39E 3PWJB 3PHSA 4EI5A 3L3OB 4PJBA 1VFAA 4XNXH 2F53A 1BZQK 1F13A 1JPGB 2H2PD 1A3RH 3OG4B 1OAZL 3PDOB 5FO9A 3BPNB 5B8CC 2JCCE 2V7HA 1PZUB 4HF5H 2BNRE 4OLXH 3TH3T 2QADD 4JKMA 3MBXH 2RCSH 4JKPL 4L8CA 4G8IA 1H3GA 4UBDC 2CPCA 1BREA 4MA3B 2AXHA 5DURD 2VXTL 1I1FA 3BHBA 1MAJA 3LKOB 1GC1H 4JJ5A 3UBXB 1AKJD 1DBAH 3QIBD 1AO7D 2VLLB 2ADFH 1EUTA 4I5BA 2G9HA 2H6PB 3NAAL 4OZIB 5D2LA 3JUYA 4E0RB 4GRWF 4XP5L 5JO5A 2OR7A 2DQEH 4RGNC 4Y4HA 5TH2B 5IESH 4OTXH 1IGYA 3BSZH 4GRWH 4Y1AA 1PLGH 2ADGB 3LS5L 5DT1L 1QSEE 4IMLA 3SGJC 4WTZG 5IW1B 1IGFH 4OB5L 4K23H 1IE5A 1YEKH 4YH6A 2FJFB 3NA9L 4YZFE 5IB3B 4Y8AA 4F3FA 5J7CC 5IJKC 5DHXB 3LMJH 4CMHC 5BV7B 3WFEL 1MFBL 3JTSA 4DFIA 3B9VA 4QGTA 1MEXL 4P5MB 5FUOH 4TUOB 1MHCA 4JQIH 2N1KA 3EO9L 3V6OE 3P4OB 3PHOA 1P84J 4LLVA 1T0NB 4ORGA 4DCQA 1UWGH 3VG0H 2QJDA 1AO7A 3WUWG 4WHTB 3RWGB 3ULSA 3WMSA 5INDA 5I8EA 1NCBH 1WFUA 2QEJA 2YR3A 5DXWA 2FIKA 5D5MF 4JFYB 1A6TB 4P5KA 3QI9C 3TT1L 2JE8A 1MLCA 3DUSA 4JO3H 3RGVC 3TN0B 5KSAB 1LP9E 3DECA 5DJ0A 4PY7B 1YJDH 3VFVA 4XWOD 4XCNA 1KPVA 5E8NB 3X12B 3O3BB 1VENA 5I73B 3IJSA 4M7ZC 4H20L 3QUMA 1BZ7B 1MAKA 3WEXA 1CXLA 2IQAA 4RAHA 1HHIB 4GH7B 4YBQD 4HZAA 1A3LH 3CIQA 2AW2A 4LDEB 3NCMA 4NQDE 2HFGL 4X0KB 4NBXB 1I9JL 2AI0L 2DI7A 1SYVA 2AEPL 3H9HB 4PJIF 3WHE1 3I6KA 3LRGA 5FYJU 1UZ8B 4LDOB 5F6HJ 2GCYB 3T2NL 4KVCL 1G1YA 4G9FD 1T83C 4GG6F 1DBBH 5CSZA 4AT6A 2QR0B 4XGZB 1SY6H 1G6VK 3BT2L 4NWTL 4ZUSB 4ZDHA 1FHGA 4DGYL 4PJ9D 4OD3L 1H3VA 3EYQD 1SVZA 4LCWD 3WE6B 2XT1B 4P48A 1AE6H 2BHZA 5EIIB 2FBJH 2FJHA 5DJDA 2ZUUA 3QNYB 4HQQL 2XI9A 4GSDH 4Y0GA 1RPQA 4TN9A 3EDJA 3LQAL 1AJ7L 3DX7A 3TT3L 1UCTA 5ESVA 3SGEI 4HH9B 2YD7A 5DJ6A 1CFNA 1SMOA 3FRPG 3NTCL 4LSUL 2CGRH 4N0RA 4WCYL 1J1OL 3CVIL 4K2UL 2JCCF 5D2LE 3TA3D 1EXUB 1BEYL 4Y5XC 4P9HL 4YDLB 1CU4H 2DM2A 4B5EA 4QCIB 4ODTH 4PFEA 1OOAA 4QHLB 43C9B 3LKPB 1DVFB 1NKRA 1FPTL 1TVDA 3BDBA 2XZZA 4F7CA 2AI0H 2V2TB 3OAYK 2W59A 1HH6A 2PUQT 3CSBA 3STLA 4LDLB 3TJHC 4XXCC 4H1LA 5EU4B 1BJMA 4V1DB 3D2UD 3FQXA 2H9GB 2YKLH 2RCSL 2J8UA 3EYFA 2ZCHL 3WFZA 1K3ZA 4EI5C 1U92B 2VJXA 1AO7B 2E7CA 3P9WB 5KZCB 4PLJC 4K7FA 1RU9L 3SE3C 5ILTH 3WLBA 4N0UE 2V7HB 3U7YL 1JRHH 2X4UA 4OF8A 1OAQL 2EYTB 4BZ1L 3PNWA 4P2QB 2AEIT 2MCPL 3OGCB 4PRBB 2D31A 3BGFC 1U8KB 3UO1H 3KYAA 3DMMA 1JZ4A 2IGFH 4P2QE 4L3CB 4YUEL 3HG1D 5E5RB 3NOIA 5GIRA 3GMMB 4R6UA 3ECBA 4PJEB 1RUPH 1MJ8L 4ZUUB 4Y4KC 1KOAA 5EULV 3OKKA 3MV7A 1C5CL 1EIBA 1ITBB 2VXUL 4AIOA 4WFEE 5C08A 3EYOB 3WN5C 4K9EC 2EDHA 2YUVA 3AS0A 1JRHI 3QDGD 1ZGLP 5EU6D 4ZAKD 3PXHA 4UQ2B 1S7SA 1S8DB 4IOIA 5FHBL 5K33A 3EUUA 4KKLC 3G08B 1NMBH 1DBKL 1FZKB 1I8IB 3R06B 1KCVH 4P46D 4L9LA 1LP9B 4MSWB 3ULSB 2CKNA 3LH2H 5HGAA 2XXMB 4JR9H 2IBZY 5DJCA 2OTPA 5CSGA 3ZKXC 4KGLA 4X6BA 3SGKA 3WJJC 4IRZL 1JGVH 1LE9B 5EBWA 1B0GB 2OI9C 4NKIH 3QUMH 3BPOB 4QKXB 3GIZL 5DJ6B 5H37H 5EU3B 1G7HA 3LSOA 4YFLI 3MACL 3RKDC 3MGTA 4YHIB 1YJDC 1JFQL 5F6IC 1RJLB 4KJPC 4QTHB 1SJVA 2V9QA 4WEMB 3RWCB 5J6GB 1A7PH 2YSSB 2X89A 1S9YB 1V3MA 1N7MH 2APBA 2BNQB 4NO3B 1GXEA 1KACB 5KJRL 3S35L 3JTTA 2R0WH 4RMVA 5D7JD 5DLMH 3UYRH 2AK4B 1ADQH 3GSOB 1INEH 1YJDL 1TZGH 3QJFA 4M6OH 4XGZA 2R0LL 4V2BA 3WLWD 4IOFC 3KPRD 2NY7L 5HHOA 3EO0A 1A7BA 5J13C 1CFQA 1WCBB 3TO4C 4KPHL 4NUJB 5FOBA 3CH8A 5J1SC 2OJZH 4Z78A 4LCWB 1UZ8A 1MIEH 3DX8B 5T3ZD 3IVKA 4JZJA 2WAHA 3KYMA 1ZVHA 5HI4D 1CS6A 5CEZH 2PR4H 4FXKB 3REVB 2LABA 4KKBD 4P2RA 3VXPA 4NQVA 2PXYC 5F1OB 4OJFL 1OSPL 3WXVL 4F7TB 1LEGA 5IJKA 3NCEB 2DIBA 1N64L 2VQUA 1V3JA 1DE4B 4LASL 1MJJB 1ITCA 4L8SB 1RSFA 2GK2A 2BVEA 5LG1A 2RIKA 4H25A 4HW6A 3FN9A 5DUMH 3X14A 4LLDB 1A2YA 5C2BL 1YEHL 4P0DA 3VWKB 2EDRA 3MLSL 2BNQA 3VXQB 4JFOB 1S7RB 3IB4A 1AP2B 4NN5B 3DURA 3X11B 1JI2A 2ZJSH 1L6ZA 1IJ9A 4U1NB 4PLNC 4OGAD 2ZUQB 4WI6A 5D1XA 4PRHD 1FNAA 5H94A 1JMZA 1IAOA 2CUHA 4HGWB 4KI5F 5BS0B 4KPHH 5DTFA 3DXAA 3HI6L 5ID1B 4AEHH 2Z8SA 4NQSA 4UOJA 3K8KA 4OGYH 3CFBB 4BK5A 1TQCC 4RQQA 5EPMA 1XCQA 4FFWC 2CDEB 3MRMA 1RIUL 4MNHA 2Q8AL 1I1YA 3QDJA 3NZHL 2Z31D 3R06A 1I8IA 3E2HB 1CVRA 3FONB 1L9NA 1EAPB 3TO2A 1A64A 4NO2A 3ARFA 3BWAB 3VMNA 2R2EA 3AXLB 2L7JA 4LPVA 1R0AL 4MNGA 5KG9B 3VWKA 4NO5A 1KC5H 1HHKB 1NUGA 1RVFH 3MV9E 3O4OB 3UAJC 4F58H 3FMGH 3I84A 5I76B 2NXYD 3MXWH 1NJ9A 3GZKA 2A73B 4AIZB 2VQ1A 3MV9B 5C0RH 3LB6D 1AD9A 3QDJD 4U6TA 4PRPB 3QCVL 1J8HA 3MRFA 3ME0A 5EBLA 1EFXD 1EJOL 1FVEA 2VLRD 1KCLA 2V2XB 1DQML 5K93A 3DSFL 3GJFH 1XGUB 2NNAA 4H8WH 4RQQB 3VXTB 4KY1L 3FO0H 2Y06H 4GMSH 4ZXBB 4YBLC 5HPOA 5E2VL 1NMBL 1A3QA 5T1KD 1O7SA 4KAQL 3SQOH 4PRAB 2FX8L 5T1MB 2DWEB 1MJ8H 4S0SD 1PKQA 2HTKD 4N90E 2XY1A 2XICA 4XPBH 5D93C 2CDGA 2GTZB 2X4NB 2VTFA 1G9MH 2AEPH 5GRXG 4E42B 2JB6B 1N3NB 5AZEH 1A1NA 1TDQA 4HLZG 4XWOC 4BJLA 9CGTA 3QDME 4GKSB 3VU2A 4L9LC 4LSTH 3VFMB 1LE9A 4MQ7B 1D6EB 4IIQA 4TVSa 1FLRH 4OFKA 1OT1A 5F21B 3BPNC 4OFDA 4ETQA 2NX5D 3BMWA 4PJIA 4BSJA 5D7JB 1HQ4A 4LLQB 2X4UB 1WBZA 2E9IA 1V7NH 5DUPH 3LOWA 3MLZL 4Z7OE 4Y1AB 3O3AA 2HFFB 1NH6A 3DO3A 3SE3A 4R7DA 1T0MB 2R1XA 3MJ8A 1QRKA 1YEKL 1L0QA 4Y5VA 3SDCB 4CVXB 4TTDC 4GBXA 3L7FB 3SJVD 5IMLB 3OZ9H 1X5FA 1QLFA 2OM5A 3CLEH 4PP1D 3L3KB 1TJGH 1R3LA 1XEDA 3DLQR 4QXGL 4NJAL 5DQDL 5C9KA 2P5WE 4G8IB 3QJFB 4G6KL 5FUZH 1BQHA 2ZKHH 4WV1A 4BSWB 4HJJL 5EB9A 2H8PB 4GKZB 4JZJC 3ULUD 4BFBD 2IALB 3W0WA 3S35X 4N9OB 2ADIB 4JFFE 1F11A 3V6ZA 4G43B 4YDKH 3ZKNC 1EMTH 2NW3A 3IDIB 1CLYL 1QA9A 3TA3C 4HMDA 3MRIB 3ULVE 2J8UF 3QB7C 5I9QC 4J6RL 4FP8H 5E4EB 4K71B 3WNOA 2E7LA 4HFWA 3P0VL 5GJTL 1G9EA 1IGTB 5D6CB 3D69A 4KVCH 3BPCB 3RGVB 2N56A 3ARVA 3EOTH 1MCNA 2OLDA 3OJMB 3OZ9L 2KQNA 1N5AB 4P59H 1JUFB 3SGKC 4JFZL 3WJJA 5J12B 2B4CL 2Z31B 5TE7L 4WFGD 3CC5B 1FRGL 5BZWA 4DEPC 2OCFD 3O2VH 3L1OH 2WBJA 3U0WL 1JPST 1YA5A 4M7ZB 5L7XH 1TCMA 1A22B 5HGGS 4JFPA 1A5FL 1TMCB 1MLBB 1R5IA 2FECI 4RWYH 2OL3A 3L5WA 1A0QL 3RVWC 5F3BB 3VD5A 5FKAB 2Q86B 4EOWL 4B41A 2NY5L 4Q9BA 4YNYA 4X7TA 5F9OH 2EIZB 2C4XA 5DZLA 3VWJA 1DFBH 1P2CA 2DQTH 2YK1L 4HKXB 3QG7H 5DHVH 4YHZL 7CGTA 3V5DA 3GSRA 2A6JB 2EDFA 2F15A 3VD9A 3MRIA 3C2AL 1MNUL 4IIQB 3F7PC 3KNBA 1T80A 5GGUA 1I85C 1LD9A 1PY9A 3UYPA 4PJ5D 3M17A 5KG9A 3QHTC 3MNWB 2FD6H 2AERT 3FMGL 1A6VL 3ARGD 2ZOLB 2UVFA 3DIFB 2Z91B 1CXFA 1FV1A 1IAKB 2WBJD 3F7VB 1E28B 4JE4B 3GB7B 4X7FC 1DQLL 1J12A 1QYGH 2A83A 1D5MB 3DV6B 1R5WA 1U91A 3MLXH 4KDTA 4NQEB 4X6DA 3F62A 5HHNA 4PP2A 2DWEA 2VZOA 5CMAA 3WUWB 1DQMH 3O2DL 2NZ9D 4JPWL 4LNRB 4YEFA 4DKDC 2DMBA 4G5ZL 4Y2OA 4X6FB 5D71L 3MCKA 4XZUB 2IG2L 1HXMA 4PBXA 3WFEH 2N7AA 2IWGA 5EU7E 5F7YC 2CK0H 4XP1L 5KN5B 1A6VH 2AJYL 3P9MB 4JY4A 5GRYA 2NY1B 5HYSA 3BKCL 4WJ5B 4X9BA 1K9TA 4W6YB 1MAML 5IG7B 2YD5A 1JGLL 2PYEA 3VFMA 2DQUL 1HN1A 2BSTB 1OM3L 4BELD 3UAJD 3C8KA 1RFDL 4KJPD 4YDVA 1VERA 3UTOA 4ZUUA 1BIHA 1DN0B 3T4YB 2X1XR 5LCVH 4UOW1 4PBWD 5MHSE 4DAGH 1YEDB 3ARDD 4LLUB 1HSBA 1YEGL 1RJYB 1GYAA 1HINH 3CZJA 5CJ8A 3A67L 3PE9A 4LLYA 4PGDB 3TCLA 1U8IB 3C5SB 8FABB 1MCHA 1JHLH 3PGCA 5J4MA 1F2QA 5HI4C 4PLOB 5IT2L 1N4XL 4TNVK 1ZE3C 2X4QB 5GS1B 3PL6C 3BW9A 2BXYA 1ZT7A 4WWID 4ZSOA 3BEWB 1OARH 1U95B 1TJHL 2OL3H 1G0XA 1MRCH 3DXAE 3GMRB 3EZ8A 5DD3L 4EEEA 3OGOE 3T1FA 4YNYB 1A4JA 2X1PA 2SEBA 4R8WL 2VDMH 1BGXL 2ICCA 5I66A 1EO8H 2CLVB 3DSNA 2PTTB 1KJMB 3MUGA 4NQDB 4D94A 1E6JH 3RGVD 1XF4A 5C0AA 3C60C 3FFCE 4KJWC 4G7YH 1JF1B 4QO1A 1QZ1A 5F97E 2HG5B 1A6ZA 3C5ZC 3V4VH 1BD2E 2BOCA 3NN8A 4HD9A 4XCCH 1QSFB 4HBCH 4OZIF 1BZ9B 5KS9F 4NSKA 4TTDD 1W72A 1WBZB 5D7IE 5FV1L 1E4KA 2R4RL 1F6FB 3GO1H 4PP1C 5L88L 5IP4A 3BPOC 5DRXB 3BAEH 1ZT4B 4XRCA 3VFRB 2BJMH 1CTOA 3HNSH 5IBTL 3SDAA 1GCFA 3MC0A 4UIMA 2EKSB 3BDYL 2YPVL 1EBAA 4GW5A 1GH7A 2WV3A 4ZNEA 5F1NA 3AMKA 3IDYC 3MBED 2NR6C 4X6CA 3SGDH 1AGCB 5HVWA 5T1LA 1U93A 4J3UA 4KUCD 3B8SA 5E8OB 1RHHB 1H8OA 1SEBA 4Z95L 2B1HH 4XP9L 3HKFA 5T3XL 1LO0L 1HKLL 4MJ4A 1JTTA 4YDIH 3P4MA 1O0VA 2KKQA 4KMLB 4S1DD 5IMKA 4U49A 4X7CC 3C8KB 4ZOAA 4P9ML 3HR5A 3VWJC 1LD9B 3SDAD 4WUUA 5FUCC 4ODUA 4NN6C 4XMLH 4PJ7E 4H5SA 4K94L 4OKVA 5I17B 2VXSH 4ZUVB 1JPFA 1RK1A 4N90D 4J12A 5KVMC 4M61A 2YA0A 3VFGL 1YEDA 2QHRH 1YUHA 4WEBH 4Y19E 4JB9H 1FIGL 1TLKA 3H42L 4MHHG 3B2VL 3MV7D 3HE7A 3ZYIA 3CX2A 3GI8L 4OCWL 4HKJA 2HRPH 3UTZB 4DUWA 1RUPL 2MFNA 3HMWL 1OP3H 3DX8A 1YQVH 4P4KB 4UIKL 5GS0D 2P7TB 4GSDL 4XC3H 4YDJA 3FO2A 3SGEH 1FNFA 2XG5A 3PV6B 2LVCA 1QLEL 4ONFH 4I0PB 2E7LC 3Q48A 4QRUA 3H3PH 4NO2B 5E00A 3SDDD 2L4OA 3HPJB 4MS8D 3MREA 3DVGB 3JBG7 1VACA 4PJEE 3EIFA 4XBGA 2IPUK 3HFMH 4P23B 3ULUH 4G42A 4W70A 3G6JB 4POUB 4HJ0C 1PEWA 1ZTXH 2Q1EA 1LEIA 2JIXA 4R26L 5GPRA 4ODVL 2HVJB 1SHMA 1HSBB 1R3HB 4LBEB 1XGYL 4U1NA 2FEEL 2Q3ZA 4MNQE 3E8UH 5IW1A 1T22A 4NM4L 2Z92A 1OM3H 4P2OA 4FQLH 1WIOA 5KOMC 1T04A 2R9HC 2BSRA 35C8H 4HXBL 4N5UA 3O6FA 1KJ2A 4BFEA 3HRPA 2OTWB 5KVGL 1QSED 4OCXL 4N5ED 4M1GH 5ACLA 4UNUA 2DM3A 2YPLE 2JLLA 4OZHB 1DUZB 1QUNA 5E8PB 3S5LA 4KHTH 3PL6A 3MLYH 1RZIA 1LO3H 1T1XB 2AGJL 1CYGA 5IM7A 5CINL 4UT9L 5IK3B 4JZNA 1KELL 3RTQD 5FEBA 1TPXC 4NQCA 4JHZA 3FFDA 3U7WH 5C0NC 4FQ1L 3IS1X 4GAJL 4H20H 1WZMA 3LY6A 1BQSA 1S9XB 4TPRL 2P4AB 4J23A 3HI1B 5FO7B 3OQ3B 3UTSE 1FYHB 4OLWH 2GFBB 4YHOL 4RGMC 3KPNB 4NN7B 4Y4HD 4F7MA 3FT4A 1EEYB 4X6EA 1R3KB 2EDBA 2HKFL 2V5MA 4DZ8A 4H1LB 5EU4A 4JG1H 2A74A 2D7PA 3CGTA 1KB5H 1M05B 4GXUM 4OCSL 3X3FH 3QJHB 4S1RL 4HJJH 2XTJD 1X5KA 3EAKA 3BDXA 3L3KA 4X6BB 1NBYB 3KDMB 4XVUC 1KF9B 2IH1B 5E6IA 1MFEL 1J0KA 5FA4B 5I8CA 3HRZB 5ICXA 4NHCL 4YWGH 1HDMA 4XP9H 1FNSL 1EEZA 3QEQD 2EICA 3P9LA 3AS3A 3SDCC 3EDFA 4MWFB 5KVFL 4KKBC 1JI1A 2R2BB 4G9FB 4KUZL 2MOVA 3MUJA 3O6MH 2VWEE 4GJTB 4AH2A 2J4WL 3QXAA 1SBSH 3FB5A 1F11B 3V6ZB 5D8JH 5FAAA 3MV7B 1J7VR 4X7DC 2OBGA 1X9QA 5TE6L 1JYXA 3VA6A 4P4KA 2CMRL 1GOHA 3NCJH 1HQRA 4DK6A 3WO4B 1FCCA 1K2DB 3MJ6A 5I74C 3RI5K 5HDLA 4NQCE 4K7PY 2D3VA 5JW5A 3OB0H 3ROOA 1NCDL 2FATL 3GMOA 4NZTH 5C3LD 4YHYC 1DVFD 2X4PA 5I9QB 5D9SB 3D5OF 3VW3H 4P23D 4G42B 4I0PA 2AV1B 2R2BA 3PJSB 1QFWM 1J8HD 2CK2A 1RIHL 2R56H 7FABH 1KSRA 3UBXI 1CXIA 5EUKA 4ODBD 4IRSB 3MREB 4V1DD 4WWKA 4DEPB 4QOKE 3GSUA 1N8ZB 4PJFA 3MA7B 2OL3L 4OFPA 3SDAC 4XPBL 4H88H 1KEGH 4N8VB 3BPCA 1Q0XH 2XWTB 3B6SA 2LU3A 1T04B 2C4FT 2W9DH 5C2UB 2EDTA 4HGKC 4PB0H 1B90A 3ECBB 2PO6C 1QVOA 4M8QA 5HVFB 5ICYB 3D69B 3PWPB 5IROC 2F9BT 5F1IB 5C0CA 1KIPB 3VGAB 4X9HA 5GSVB 3EKCA 4K7PL 4CADB 1NDMA 4OF6A 5C07D 1YQ2A 2FGWL 3RIFF 2YRPA 3W9EA 1JNNH 1WK0A 4RMSA 4OCXH 4QTHA 3RWCA 2Q7YB 3SDDC 5FHBH 4N0UA 3WYRA 1RUAL 4XNQB 3WFDL 3STZB 1AKJB 3FO1A 1FL3A 1KGCE 3QIBB 3CH1B 3MFFA 1S7XB 4JKKA 1JYWA 4GAJH 3N1QC 4JFOA 1Q1JH 2APXA 4Y1AE 1NMAH 1NGPL 5HY9B 5IVXA 1YEGH 4Y4HB 1CLZH 1UFUA 2FYYB 3LV3B 1GRWA 4HUXB 4JFHE 5MI0C 4UV4L 3RWEA 4OD3H 4GO6B 5H94B 3RNKB 5EC2A 1WISA 1LVEA 4U2ZA 4YDKL 5TF1H 2XRAH 4JEGB 3ZE2F 1IQDB 4LPTA 2XYCA 4F3FB 3GMRA 2OZ4H 3O8XA 4NKOA 1CK0L 5EWIH 1OWWA 2IFGA 2XN9A 3MROB 1RZKL 4C56E 4FXKA 2FO1A 1BFOA 1KPVB 3MRMB 1QSVA 2NY3C 2CDEA 5DUBA 3GNMH 4MQXD 5JMRA 1W0VB 4PJFF 5I66B 4NUGH 4OF0A 3QCUH 1FAKT 1YMHB 4P5TA 4OM1H 3WD5L 3FN3A 5AWNH 4U0QB 4MNGB 3QUZB 4LKCA 1YEHH 4MA3A 2JCCB 3U0PA 3O3DA 2ATPA 2PCPB 2DLGA 4JRYE 4HULB 1H5BA 2XFXB 1ADQL 4JY5H 3S3PA 5EU6E 2SEBB 5KSBF 4E5XB 3R8QA 5EDXA 5I30L 4LSDA 1UG9A 3O6FC 1QR1A 5HHQA 1HIMH 3O2VL 4LHJB 2BP3A 4F37K 4S2SA 5DFVC 1RJZB 4B7LA 4TUKL 1VHPA 3WBDA 2E5EA 1MY7A 5IR1B 1G7PA 3BZEA 1QBML 3L3OA 2HYMA 3QXWA 4PJBB 2B20A 3IDMB 4D0CA 5F7KC 2JKXA 1G1CA 4YGVA 1XGUA 2NNAB 3PWLA 1MCEA 5HYJB 1CK0H 5EWIL 5FYJD 3PF2A 2OXHA 1UM6L 3QG7L 1MRFH 4R2GD 1ZA6B 2Y07H 3E6HB 4JKLA 3BD3A 1ZHBB 2R29H 1MVUA 5GGRB 8CGTA 5FYKH 3QIWC 2VLMD 2YXMA 5C0CE 5JZ7C 1DQLH 3VE0A 4UV7H 2Z0BA 1A21A 4U1IB 4RMWA 1AJ7H 1JN6B 4JY6B 3HZMA 4LSQL 1IARB 1SY6L 1I9EA 3MA7A 1OLZA 4XAWL 5L0QB 2GJ6E 1WAAF 3O4LD 2VXUH 4G80B 2FX9H 4JFXB 1ZAGA 5AZ2L 5I8CB 3I6GA 1CG9B 3VA2C 3OKDB 5FF6A 3ARPA 1RVFL 3HMXH 1CFVL 2VL5B 3T2PA 2VDRL 3IJYA 4GG8A 2ADJB 2ADFL 3OKYA 5IB1A 3C6SB 1ZOXA 3DVIA 3T0EE 3E1F1 2FO4A 3MBXL 2WBWB 3EFFA 2VXTH 3RWDB 2CLZA 4G8FB 1DLFL 5TDNB 1GZPB 5EIVA 3DBXB 3LS4L 2GK0B 4G8GE 2DQGH 2JJTA 3QH3A 4NC1E 1B4JH 5T1MA 3MV9D 5FGBC 1H3PL 3MPCA 2Q7YA 4RMUA 3HZMB 1AY1H 2QR0A 3PV6A 1BWWA 4QLRA 1EFXB 4HKXA 3T0XA 2R0ZH 3KAAA 3VCLA 2OJEB 3OPZL 1ES0B 1U8JA 4CVZB 4P3WA 3HNTH 3TBYB 1EHLH 1KENL 2ZUVA 2IBGA 2ZUXA 4J3TA 1A9BA 4Z76A 2PNDA 4L4VE 3ROLB 5IEKA 1LE5A 1DDHB 1OAQH 2HFFA 3B2UC 2COQA 5HHPB 3RTQC 1L7IH 1UACH 1CFTA 4F15C 3NCBB 3IDIA 4DOHE 3V5HA 1RURL 4LLQA 4PRHA 1LILA 1FN4B 2HKHH 4JANB 3IFPB 4AEIH 4POYA 1C5CH 5GJSL 4IHOB 3Q6GL 5IF0A 1UENA 5LXGL 1RJZA 1J1XH 1E27A 1U3JA 1IC4H 3CDFA 5AEAA 1IGTA 3RGVA 3OAUH 3PGDA 4I0PC 1GAFL 2WUBH 1XCTA 1AXSA 3WXVH 4G6JH 3V0WH 4WV1B 5I8KH 2F58L 5T1DL 2BY0A 2NX5B 3DHMA 4MXWH 4BA8A 4A6YB 4ZAKB 1SM3L 5KTEL 4XVUD 2BVTA 5CD3B 4Q6IB 2XKUA 1HEZA 4Y4KB 2AJYH 4U3HA 1FVDB 1RZJH 2HVKA 1OGAE 4P2QA 1N0XL 1RUML 3FFDB 4GW5B 3ARQA 1JF6A 1IEBA 1PJ9A 4I18C 3F12B 1FYTB 3SDCD 1KUMA 3BP7A 5IM7B 5I1AA 4JM4L 3NFPA 3BIKB 1XMWA 4FQ1H 5I1LA 3CPLA 1CR9H 3QI9A 3QIUC 3VXOA 3D1MC 1PG7H 2X5PA 4YO0A 2AXFA 1TFHA 4PRDB 1WT5C 3WKNA 1WFNA 1MCBA 2FHFA 5IGXL 1H5BC 5LGHL 3SDYH 1LK2A 2C7UA 3QUKB 3QULA 4KZDL 2BNQD 1MWAA 5IVXB 1S9WA 1JUFA 3ARTA 2W65A 2LTQC 4YHOH 3CU7A 3EYOA 3OXSB 1J1OH 3KPNA 4M5YL 5BW7A 1CQYA 4ZTOH 2GT9B 4ZS6D 3KXFE 3LQAH 1S7QB 3BISA 1TETL 4NKDA 1G7QA 4YHKL 1NCTA 5JW3L 1BP3B 3BP5A 4YQXL 1E4XL 3QPXL 2J7LA 1NQBA 3IF1B 3F12A 3VG0L 5C8JA 3BQUD 5TE4L 5DZOA 4GAGL 4ORZC 3IDNA 4QXTA 4PRNA 3T0VA 6FABH 4QHUB 1JTPA 4BH8B 5J9PB 4YHNB 3DUHA 3BKYL 5L7XL 4I1NB 4JJHA 4OZHA 2BVOA 4PJAA 3O6KL 4J8RB 5JORA 1GOFA 4WY7H 4JFZH 3UTPE 2P49B 4OAWB 5FDWB 1D5BA 3EFFB 3VWKD 3VGDA 3TBTA 1QFPA 6CGTA 1IFHH 2ATPB 1I4FB 4FOMA 4QRTB 1JP5A 5KAQF 3RUGF 3L6FA 2D9QB 4XC1H 3ZE0E 1R3HA 4LBEA 1VDGA 4NQXA 4ZPTA 4S1QH 4XHQA 3BQUA 2ZCKL 5DJYB 4HUUA 5JXAL 5EUKB 4NN5C 5DD6A 4L29B 1WBXB 2IBZX 3ULUL 1F3JA 4YX2L 4W6XB 3WV0A 1KIQB 2PW1B 1AD9B 4Y4KA 4NO5B 2HJLB 2YWYA 4JJ5B 5IEHA 2JJTC 3D9AL 1T5WA 4OUOA 2C3GA 4Z77B 1IEBB 1G6RH 5A2FA 5AD0A 3LKQA 3WIFA 1OGAA 3OPZH 4I3RH 4RSVA 4P9MH 7FABL 2HWZH 2DKUA 4R3SB 5FYLE 2AXJA 3E2HC 2B1HL 3LRSA 1D5ZB 2YRLA 2VDLL 1T4KB 1QRND 4OD2A 4MS8C 5IF0B 1KLGA 1PDKA 2AJZA 4K2UH 1ZANH 4RAUB 2VLRB 3ALPA 1KEMH 4HIIB 3LN5B 4O51A 3ZTNH 1QBLL 2AJXL 4L29A 5DTFB 2YUWA 1RURH 1HHJA 3OAZH 4F8QA 5CINH 5ICYA 2Z9TA 5T1KB 4OIIH 4LIQL 2O5XH 3CFKA 4KRPC 3TN0A 5C0FA 2HT4C 1GGCH 3V6BR 4LLWA 3RJDA 1R5VA 1W2KT 1CGSH 5B38G 3TPUB 2FX7L 1N4XH 3WDJA 1E0OB 3GI9L 2VDPL 4PJ5A 4G6ML 3LKRA 1Q0YL 4GQ9H 4HWEL 2NY4C 1BD2B 3WKMH 2ITDB 1PX3A 4N5EC 4PJ8D 3A67H 1FDLH 1FZOB 1BGXH 3JWOH 2ED9A 5ANMB 3CFDB 4K3HA 3U83A 4ALAH 1UC6A 4LPUA 4M3JA 2OSLA 3TZVA 1OW0A 4XRCB 1LDSA 5EZIH 1Q9LB 4O51B 4GAYA 1AIFB 1JGDA 1T5XA 1N59B 1PAMA 1U9KA 5JOFB 4MJID 4LAJH 3IGAA 3IF1A 1G7LA 3KPMA 1IGYB 1Q9OA 3NN8B 4LHQB 3SJVB 5FECB 1BQLL 4ZOBA 1U58B 2GT9A 2N7BA 2E7MA 4DW2H 3K1KC 1ORQA 4FS0A 1F6LL 5EC1B 1J05A 1NGWA 5EBWB 4UDUB 1LK3L 4H26A 4NYLA 4JO1L 2NY6C 3TO4D 3HMXA 4A2LA 4L3ED 4X6CB 4XWGH 5DR5L 1MI5E 3DV4B 3CVHH 4HC1A 2DB8A 4OLYH 2FBJL 4I0KA 5DMIL 5FIEA 1UH3A 3RVXD 4YFDB 4HWNA 4FXGB 4JRYA 3CFDA 3BT2H 3H9SA 3REWB 3E3QC 4OGYL 4UINL 3HI6H 2R0KL 1J0IA 3M1BB 3T2NH 2V5RA 4YE4H 4Z8FL 3NFPB 4H5SB 1OQOA 5FM5O 1MAMH 3U9UA 4LOUD 3VDBA 1DBJL 4M9PA 3TC9A 4D8PB 2V17L 4LCUB 1JHKL 2ZCLL 3VE0B 3MJ9H 3ZSTA 5BOPA 2YBRB 1XF3B 4HBQA 1MVUB 3CZFA 4HWBH 1YPZE 3RIFK 1LO5A 3RWHB 4HIHB 4MQSB 3VXNB 4X4YB 1VADB 2VWEC 3FN0L 3GSQA 5EBMA 4PB0L 2QKIB 4NWUL 3MNWA 1A7NL 2C1OB 3BQUC 2YUZA 5HD8D 4FFWD 5D7IB 3KPLA 5BRZD 3JVGC 4GW1A 5J12C 4K9EL 1OL0A 1VGKB 1NCCH 2VN4A 4MVBD 4DN4H 5HVHB 2VUYA 3B2UD 5C0AE 4PLKD 1FO0B 3ARFC 3OKDA 5FF6B 5FHAL 1BX2B 3VFPA 3OKOB 4C55A 1UKTA 4K7PX 2D7NA 2VLRE 1OGAB 4M93B 1LEKB 3ARGB 1ZGLM 1F00I 1DSFH 4WIQA 2AJUH 2DL2A 5IWLC 2WBJB 3D18B 3AB0C 3RWEB 2J5LC 1QYGL 1FFPA 1CFQB 3UJTL 3VXRE 3EGSA 5F7DA 3FB6A 1HH9A 1NFDF 3OWEA 3L7FA 1NBZB 2RFXA 2DF3A 2N4IA 3IKCA 3ZDXF 3IT8D 3MFGB 4G7YL 4P2YA 4QXUH 5D7SH 1G7JA 1X4ZA 4IIQC 3LKNA 1FFNB 3L95A 3HHRB 4XPTL 3DBXA 4HPYH 5IB4A 3HNTL 4JO3L 1J05B 1QLRB 1Z9OA 4PJGA 3KYNB 4B53A 3F8UB 4CJ0A 4WO4B 3MRNA 1WWCA 2R23A 1ND0B 4FQLL 4PJ8B 3CVHA 2MCG1 1B0GA 4HC1H 3KLSA 4POZC 2XZCH 2F74A 3GMQB 2AJXH 1D5XB 2CLRB 2ADIA 3BZ4A 4YHKH 1HYSC 4KZEL 1C16A 4QRUB 4QHKI 2FSEB 3QFJE 4HF5L 4M7KH 1MFCL 1H9VA 1EEYA 43CAA 1F6AB 4NM4H 2NW2A 2ADGA 3C8DA 3H9ZA 4MJIB 2EDJA 2LU4A 3QRGL 5HHNB 3VH8G 3ZKSD 4JCMA 4A6YA 4UT6H 1I1CA 4HG4J 1J5OH 4UAOC 1MCOH 1QVOB 3FZUC 4M8QB 4RZCA 5A16A 3T4YA 3IKCB 1JGVL 2Z4QB 1KJVA 1ZHKB 1BIIB 1QQDA 3BUYB 3ELAT 3MRJB 5DD5H 4D8PA 1DL7L 3ARDB 3O41A 4CDHA 1JK8B 4MCZA 3F6IA 1CDJA 2DDQL 2BNRA 5CEYB 3ZYOA 2YPKA 2X9XA 5KTEH 5K9JH 2Q87A 4XNZC 1KNOA 4GRWB 3ZT5A 3FQUB 1RULL 3WIIL 1CF8H 5GS0L 1JZ5A 2AQ1A 4ZSOB 3L3IB 1A9BB 4Z76B 2EKJA 1EJ6A 5IJVB 1MLCB 2YWZA 3DUSB 3BP4B 1KULA 4UOW0 3IRZA 4PGBA 3KPLB 4J3SA 3UZEA 1BQHG 4FTVD 3VCLB 4WV1C 4E41B 4RMQA 1MPAL 3HS0B 2UZXB 5EU5B 4LPYA 2ZPKL 2R4SL 2QLVB 4YO0B 2CR6A 3RBSA 2HJFA 5GS1C 5A16B 1Z3GH 1IT9H 4P4RB 1G7HB 3LSOB 5EU6A 2VERN 4OCSH 2D7QA 3T09A 3TN0C 4QRPA 1JV5A 3IJYB 4MD0B 5TDOB 2XG4A 4NRXA 1T0NA 4ZUWB 3RI5F 3RY6C 2VDNH 5HBBA 4PREA 4I2XE 4NQSB 1I1AC 1T7ZA 2X7LA 2FLRT 2J4WH 2OSLB 1S7VB 4NHCH 5F1IA 4PPTA 2RJMA 3B9KC 5CZXD 5DWUL 2PETA 5F1SA 1MNUH 2V9RA 4U1SB 1BVKB 5BRZB 3CLFL 5GISH 4OCYH 3U2SA 1FG2B 3EOAA 3GMNA 3MLVH 1D6VL 2VAAA 3SKJL 1EVTC 3BP7B 5ISZD 3GGWB 1UADC 4R97C 5E0QA 1AE6L 5B3NA 4HIEB 4D2NA 4TSAL 3MRDA 5DZNA 1G84A 2J88L 3GHEL 2OK0H 4GLRH 4PJFB 2ZOKA 4PRDA 5JZ7D 2ILLA 3EOBA 1BF2A 1LO4H 3WJLA 5EFIA 2RQ8A 2NW2B 1B3JA 3VRJB 4LGRB 5KOVC 4FFVD 3KLDA 4Z7VB 5TQ0H 1A47A 1C08A 1TJIL 1BX2A 3N1GC 5D2NA 2YEZB 1YEEL 1MCWW 1R3JB 3ZT7A 1XF5A 2DYPA 3UJJH 5GS2D 3X13B 4LLYB 4G7VH 4AQ1B 4LP5A 3MRLB 3VW3L 2XQYK 3N1FC 4HIXH 1IAOB 2UV3A 4HGWA 3MLYL 2R39A 4ERSL 4OZHF 4QTIH 4M7LT 4PRIB 3VWJB 5IWLA 3IFLL 4Z18A 4GRLC 3TBSA 5MEPB 1U93B 2NXZC 4QNPE 3HC3L 3KLHD 4F7EB 1CL7L 4KHXH 2XTLA 5EOTB 1MQKH 2BRRL 2D7TL 3EJZD 4P4KD 4GW4B 2XWBA 3UZQA 5AD0B 3OJDB 2P7TA 1DP0A 1I85A 2JCCA 4IDJL 2AKRA 1XF2A 3MRCA 4MVBC 4HCRA 3RUGA 2DD8L 3BO8B 5IEHB 1I7TA 2VL5A 1A4KA 5IV2B 4N1EA 4NFBA 2EDKA 4OQTH 4DVBA 3ARRA 3RJQB 4LLMA 5CLWA 1MEXH 2E8ZA 2YMXH 3VFTA 2V2TA 4IRJC 5C07B 3P4NB 5I19H 2D7OA 1DLHB 2R0WL 4ZNEE 4JREB 4XCYB 2WINA 3LMJL 2VKXA 1XGYH 2CJUH 4Q58C 1C16B 1BLNB 3BZEB 3MOBH 3D39A 1FFQA 1IAIM 1I9RL 1MQKL 3DRTA 1UEYA 5GRVK 1AC6A 3IFNL 4V1DE 1RAMA 1ZWIA 4XBEL 4MZ2A 3SCMC 1KTLB 2IADB 1FLRL 2BSRB 1BD2A 4Z7VF 1JWSB 2M1KA 4U6VH 4WHCA 1I7ZA 1OAXH 12E8H 5ESAB 2OZ4L 3L95B 3MJ9L 4LKCB 5FO7A 4HUMB 1NDMB 2E6QA 2HJFB 2QQLL 4QXTB 4XPGL 3PNWB 5GHWH 5IVOA 1E4KC 3WKML 5I71B 1M7XA 3OX8A 3U48A 5D1ZA 3MRBB 1CDIA 3QHZH 5I18L 2DQDH 2YPVH 1S5IH 3Q2CA 4PJBE 5MP6H 4CU8A 4MA1B 5J3HD 1IQWL 4U6YB 2YD6A 3S6CA 4R90L 4TRPH 4ZUTB 3SE4C 4QHNB 4GOSA 4ZFGH 4KROC 4KRPB 1EH9A 3F58L 4Q2ZB 1U3YA 3BX7C 3OKNA 2FBOJ 3IDMA 4OI9A 1YY8A 4LCYA 1R3IL 3C60A 3CC5A 4KJWD 2AJZB 4YBHA 3IXAA 1J0HA 3LV3A 3MRPB 1D9KC 1W0YT 4XB8A 1NAKL 1LK3H 4Z0XA 5H35B 4U7KA 3VGBA 1A7RH 1RIVL 1TPXB 2I25N 4ELKA 5SWZA 5D5MA 4L8SA 3QFJD 4WHYG 3VFOA 1VPOH 2YUXA 5F9DC 2CIKB 4WU7A 5KJRH 2GJZA 1U58A 2Y23A 2IC2A 4RDQG 1VFUA 5HD8C 2VISB 4AEFA 3B9KA 4JHAL 4UTBL 5K9OA 2XKSA 2HT2D 5E1AB 3R0MA 4HS3A 1T5WB 4P3DA 5LVEA 4M00A 3LQZB 1A6UL 4PRBA 3V2AR 3SE8L 3QWOA 4HCRH 1NC4D 4FMKA 3LEYL 2IALA 5ALCH 4ZD3H 3HE7C 2NR6D 3HAEG