4LIQH

Structure of the extracellular domain of human csf-1 receptor in complex with the fab fragment of rg7155
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDISWVRQAPGQGLEWMGVIWTDGGTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDQRLYFDVWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Targeting tumor-associated macrophages with anti-CSF-1R antibody reveals a strategy for cancer therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4liqH01
2CGRL 5CMAB 3MV01 5E2JA 4Y5XC 4BZ1H 1SJVA 4BZYA 1YEFH 1IGFL 1NQBA 3TBWA 3WUWG 4QGYA 4NZTL 5JQHC 5F6HI 4K23H 5FYLH 1SM3L 3GSWA 3VXMD 1ETZB 4LVOC 1R5VB 1B88A 4LSQH 3M1BB 4BM7A 1IM9A 1L7IL 1Q94A 1FIEA 3DV4A 3MJ9L 1I8MB 3KXFD 3PWLA 4QYOB 4DOHE 1HXYB 1I3GH 4H0IA 4EEEA 4XP6H 4EDWH 5IQ7H 3TF7C 3FONA 4ODTH 4WGVB 3L7EA 2XWTB 4I9WD 1UCTA 5IBTH 1F3DJ 4UQ3B 3C09C 5JIPA 4Y5XB 5HHPA 4GBXC 4OCXL 1SVCP 3WSQL 4ONGH 3VXPA 5MP6H 2DLEA 2PW1A 1T0NA 1GIGH 2R2BB 2WMPA 4DAGH 3BUTA 2XZQL 5E9DB 1ES0B 1U91B 1WIPA 4LVOB 1Y6MR 3KNBA 1SBSH 5JO5B 3VA6A 1P9MA 1TPXB 4HX1B 4RFNC 5F21B 1MUJB 3QJFA 4P4RB 3RKDC 4KZDH 4PFEA 3SKNA 3WLBA 4X4YA 4GBXB 2V2TA 2NY5L 3DETD 1PG7W 1C08B 1NCCL 1Z0MA 1C5BH 5IHBA 5E2WL 4N0RA 1UM6H 4HXBH 4U05A 3OPZH 4WTZA 1OQOA 3HUJA 1UB5A 4RFNB 2EDTA 5CP7B 4GAJH 5CILH 2FR4A 4OLEA 3VFPA 2OK0L 5FK9A 1G7IA 2HRPL 5F1SA 2VXTL 4HD9A 1AXIB 1J10A 3GRWA 1F5WA 2VDNH 3JVGC 2WIMA 4P3DB 3CMOL 4UUJB 1TVBA 1NAMH 1N2RB 2EO1A 2CPCA 2G9HA 2F53A 2VDOH 3LKSA 2I9TA 3B9KD 4ZO6A 5DGQA 5TPWL 2B1HL 3T08A 3QJHB 4UTBL 2HLFD 1HYRC 2Z93B 3MA9H 5I73C 5EU3A 1SEBA 1KGCD 2J6EA 1FVDB 5GJSH 5L9DL 2JCCF 3VGFA 3DROA 4YZFE 1AQKL 1QSVA 2LU4A 2X09A 2H9GA 3P4MA 1A3RH 5ADOH 2YPLD 4LLYA 3TNNB 4ORZC 4HDIA 1ERNA 4D0DA 3ZZ1A 4MJIB 1AE6H 5HYQB 1RZ7L 1G7LB 3NTCH 2ED7A 4N1HB 4NKQB 4FQIH 4AY0A 3FJTA 1H0DB 2BMKB 3IXTB 2ADFH 1MCCA 3NIFE 3DSFL 4BKLB 5I73B 3I50L 4ZS6C 4XAKD 3L3KA 4JZNB 3O4LD 1U92B 1Q9WA 1DN0A 4YR6A 3SBWC 1JMZA 2HFFA 2QSVA 3EYVB 4X6FB 4GMSH 4UU9A 4HPYH 1UFUA 4L1DA 3ILQD 3F58H 4YDLC 3D39D 5DD1H 4XPHH 1YJDL 1T66C 3EOBA 1U8OB 3K8MA 5EC2A 3TA3A 1F4YL 3NACH 1RK1B 1LGVA 4LQFH 4YHML 4IRSA 1MIEL 4X98B 1QNZH 3O8XD 1FL6B 1JHTB 3GBLA 3O2WH 4PYGA 5IVXB 1CXFA 2VLKD 3CFKB 1F3DH 3KLDA 2D4DA 4K7FB 2OXGA 4HS3B 5M95B 1MLBB 3OB8A 2I5YH 4KKNA 4X8JB 5M94B 3O3AB 3V7MA 1SJXA 3LEXA 5MERB 4M61B 4YDLB 2G5BB 1ZHLA 4HUWA 1WK0A 3G6JF 1DE4A 2G5RA 2QV2A 3W0WB 4KK6D 3BIKB 2RHEA 1JHKH 5I2IA 1OW0C 4MA7H 4RFEB 5SV3A 3VGBA 2IADA 3GSNL 3MRKA 1P6FA 3HNVH 1CICD 1F6AB 4YFEA 1E4KC 5I1DB 1QLEH 1PY9A 3CC5A 3E3QE 4HZLB 5LJYH 1VFBB 3MOQA 5EUOA 4G9DB 5GJTL 3VCLA 5IW3A 3ZTNL 5IGXL 1BIIA 5FA3B 5HI4D 4ODVH 1K6QH 3FB8B 5DMJB 1A1MA 2ZOLB 3L6FA 4Y5VA 5FFLA 5J3HD 5FIEA 5FYJD 4E42B 5BCAA 1IEAB 4J1UA 4UIMB 4K7PH 1IGTB 2DQFB 4PJCE 3I9GL 1UEYA 5BOZG 1LQSR 5C0EB 4JPVH 3SDYL 5EBGA 2HFGH 3TN0A 5GSRA 1IAOB 3ELAT 3NN8B 5K9OB 4HWBH 1TZGL 4ISVA 5KVEH 5SWZB 4OKDA 3T77A 5EU6D 1ZANL 4P5TD 2EDKA 5BS0D 2B2XL 5F96H 5DMIH 4G6JH 1BVLA 3BP7B 1AKJA 4O9HH 3IRZA 3Q6FA 4KV5E 3MNVA 4P46C 4L3CA 5EOTB 1I9RL 5ANMA 1VKXB 1FORL 1K5NA 3FAWA 2WBJB 3KR3L 3WCYA 4C56D 1TZIA 3G6AB 5DUPH 3ET9F 2YD2A 4UBDC 1Z6JT 1R0AL 1ZV5A 4FTVE 2EECA 4Q6IB 4F9PC 1YEJL 4JLRB 4ZSOA 3VE0A 3RL1A 1TJIL 3EFFA 2UWEB 2V5MA 5JR1H 3ZYOA 4F7EB 1MEXH 1T80A 5HHOA 1FZMA 4JM2F 1DBKH 4ZS7H 4N8PA 4IJ3C 4P46B 3GJEA 2R69L 4JPIB 1A9BA 3QFJB 1HHIA 1EEQA 4EUPB 3STLA 2J88H 4M1DH 3EGSB 4MLIA 3H7BA 2WNGA 4BUGA 5F7KC 3U0WL 4CVUA 4X5XA 1G9NL 1JNJA 2ZG2A 5CKAA 3ARDA 3UJIH 1B2WH 5IFAH 4XI5D 1K8DA 4LLWB 1LD9A 4DVRL 3STBA 3J8F7 2CMRH 5E8NA 5DVKA 4IJ3B 3HMWL 2R1YA 4OLUL 4DTGL 4W68A 1KN4L 3MNWB 5E9DE 4CJ0A 1QQDB 2CSPA 2LTQC 3BQUC 4OAWB 1BEYH 1F4XH 2EDLA 4MNQD 1JRHH 5DR5H 3EYUH 5HPMB 3LKOA 2AXGB 2R4RH 4KJWC 4AIZB 4MCYB 2QEJA 3I02A 4HKBB 3ZTJG 5GGQL 3QO1A 1AO7A 1B4JL 1P4IL 4QHMB 4APQD 4JPWL 2ZNWA 4ETYA 1H3PH 3FB6B 3QDHA 1S9YA 4LGPB 1WGOA 1ZLSL 3ULUD 4KH2A 1JP5A 4NJ9H 4ELKA 1MJ7H 2G60H 2FYYA 2LTQB 3PV7A 4PRPB 3JV6B 1L6XA 4YGVA 2CIKA 3V6FA 2IH1B 3R0NA 5DHVH 3MLRH 1XFPA 5A2KH 5C0JB 2UZIH 3F62A 1NMCB 4J12A 5FGBC 3HI6L 5KJRH 1I1AC 5FO7B 3L7FA 2Z35B 3OR6B 5ACMA 3KDMB 2CLRB 4O58H 1RU9L 1MFAH 4XPGH 1YPZB 3MRHB 4Q9RL 1JWUB 3NCBB 3V4PH 4KVNL 5E08H 3RUGA 3I6LE 4XZUA 3B8YA 4WEUD 4OZGF 5E8PB 4KZEH 4DQOL 2IH3A 2ARWA 3U2SB 1YYLH 4NCC1 3HPJA 1LWRA 1HH6B 1I1AB 2GUOA 2NY3B 5CP3H 4WFFE 1Y6KR 3DX7B 4KQ4L 3RVVD 3HPLB 1YC7A 2NXYC 2YC1A 5IHLB 1DEEB 3C5JB 2D7TH 5I1EL 2BDNH 1NAMA 4Q0XL 4MJIE 1JPST 1XZ0A 4FQJH 1R3JB 2B4CL 2KL6A 4QHLB 3LN9A 4HBCH 4XXCC 1NCWH 3L1OH 1QEWA 4U1KB 2XQYG 2XWJA 2FX8H 5FUCC 4NN7C 3VMPA 4E41A 4PRAA 3KPSA 2NW3B 3B9VA 4OLYL 3U30C 4WFGD 4UNVA 4P23A 2NXYB 1KLUA 1NCBH 1OLLA 1H3UA 2FHCA 4FXLA 3HR5B 1P53A 3CH1B 5D7IF 5TF0A 3LRHA 1IAIL 4PJHF 2EC9T 3LH2L 2N1KA 2NY6D 2Y07L 1ZGLA 1IQWL 1E28A 4PJ8C 2W9EL 2EDNA 4G6AC 3ZDZF 4NN7B 4OGAD 1YQVH 5IVXE 1NGXB 1HI6B 5SX4H 3U30B 2EYTB 4OUUB 1QRKA 1S8DB 1MCIA 4RAUB 2XRAH 2DAVA 3DVNB 3F7VA 4JB9H 4KKAC 4HPOH 4OF6A 4CADB 4WI2A 2F58L 4R4NC 5EDXA 2UYLA 3W0WE 5FB8A 3UPRA 1DJSA 2ZUWA 2OZ4L 1OAUH 2YA1A 1K2DB 4PJ8B 3KYNB 3HE6D 2Y5EA 4AM0A 4JDVA 2EDEA 4QRTA 4G6MH 3LS4H 2XQBH 1QFWH 1A0QL 2GAZA 3UO1L 3RWCA 2DIAA 2ZKHH 2VQ1A 4Z7WF 1HZHH 4M7LH 1E4XL 5HYJB 1QACA 3BMWA 1YDPA 5BVJB 2IAMA 2ZJSL 3P4OA 3OJVC 5DMGD 2NXZD 5HGAA 4MAYD 1WZLA 3MBEA 2BOCA 3WXWL 2DI9A 1BBJA 3HLAB 1S9XB 5INCB 1U0QA 1MCSA 3K3QA 4MA8H 5CAYB 5K59E 3FFCD 5D7SH 1VFMA 1KJVA 2C7UB 4PD4J 4H8WH 5SWZE 4MXWL 1E0OB 1UG9A 1IGJA 1B0WA 3ROOA 4JO4H 4WTXA 2GKIA 1ZA3A 1PFCA 4LCIH 4UI2A 5E6IA 4LCYA 1TQBC 3QNZA 1EPFA 4GUPA 5EU4A 2W91A 2V17L 2QBWA 4JRYA 2NY0D 4BJLA 1WAAE 1EA9C 3BO8A 3ZE2F 3BZDA 1DSFL 4HWBA 4XPBH 1G6RH 4OV5A 2EZ0D 3C8KB 4DGIH 3R06A 5A3IC 2X4TB 1E6OL 4OBSA 1HEZB 4H26A 4PJCA 2UUDK 2VIRA 1JZ6A 1FNLA 3V6BR 4WUUB 4YHKL 4DZ8A 3MBXH 1VA9A 2H2SD 4I18C 3X13A 2UWEE 1JF1A 3WV0A 4WU5B 4WU7B 4WO4A 3L3IB 5DVMA 3M45A 1KIPB 2EDOA 4JY5H 1J0IA 5DUBB 4WWKD 4HT1H 4LAJH 2RCSL 1PY4A 4F7CA 3QFJE 1NGPH 3KLSA 4ZAKD 4PGBA 2AJSL 3RKPA 1YUHB 3QDGD 4UT6H 1JPFA 2W92A 4KUZL 1Z5LB 4GRLB 4PJEF 4PLKC 4DK6A 4CNIB 4BZ2H 5J4MA 3NFPB 3IF1B 5ETUA 3NFNA 1MHPH 3UBXA 1II4E 2E9BA 1M05B 4FTVA 1JNLL 4XP4H 5D7LB 2QHRH 3U7AA 1ZHNA 3W81A 4QKXB 1AXSB 4OZFB 5JDSB 1PX3A 4P5KA 1D5BA 2VE6A 3TYFB 4IDLA 1NL0L 2HTKC 4IM8A 5I1AB 5IV2A 3U0TA 3L9RA 4XP1L 3OTTA 1FFPB 3U79A 2EDYA 3DIFB 4JN1L 3AAZB 1OP3H 3JTTB 1T6WA 1MY5A 4TYUA 4ZTOL 2QQKH 1YMMA 3WD5H 3M1BA 3WFBH 1MCOL 4UV7H 2MPAL 1OGAB 1A6AB 1CFNB 4QYOA 2NYYC 3D6GA 1EO8L 4LSUL 4ZUWB 4NBXB 4MS8D 3WL9B 3QQ4B 3FQRA 5IG7B 3MRGB 4WEBH 4PRPE 1ZLUH 3VXOA 4RQQB 4Y5XA 4GMTH 2FX7L 4RIRB 4LFHG 1EHAA 2OP4H 4DVBB 5HHQB 3FMGL 4WFED 3TP4A 3I3EA 2R2BA 5E9DA 1N6QH 2BY2A 1ES0A 4I0CC 4Z0BH 5ECJE 5B4MC 2OR7A 3S37H 1F11A 3FRPG 5JO5A 4IDJH 3RWDA 3K1KC 4HX1A 1YPZE 4QNPF 1MHEA 2VSDA 4EIGB 2JELL 2CDEA 1I1YB 4NZDA 3ZYZA 4P4RA 2X4UB 3BGFB 3DMMA 5EZIH 1N7ML 3EYSL 4QHKJ 4GBXA 2DM3A 5DHVA 3ZMRA 2JJVA 3P4LA 5HSFA 2JIXB 4NM4L 3C2AL 1T20A 4HCRL 4M6OL 1F4WL 1QBMH 4OFPA 4F15C 1EGJH 1FZOB 2XFXA 3L5WB 4HWZB 4GAFB 2F8OA 2FIKA 4K3HA 4NUJB 4HAFA 5CP7A 3LB6D 1A5FL 1CD1A 5F97E 3TESA 1LO5B 3AB0C 2JK5A 3RTQB 4LSSH 5EBMA 3BDXA 5C0RH 8FABA 1SEQH 5CWSB 3PV6B 4PGDB 3VD3A 3BSZH 1ZLWK 3GBNL 4NQCA 3VH8B 4F15B 5CP3A 3SQOH 1N2RA 2XKSA 4B7LA 5C0IA 4JRXB 4NJAL 2R2EB 1P7QD 3ZT5A 2XZAL 1A7QH 2B1AH 1PZ5B 5ICZB 2Z93A 4G6FD 4HS6A 4LDLB 5F7EH 4L3EB 1NC4A 4HLJA 5KS9A 1MQKL 3AB0B 1AY1L 4MD4B 4JFFA 4YHZH 1PDKA 1NCDL 2HKHL 5D9SB 4LRNL 2XZCH 3OF6A 4X7DC 3MROB 1ZTXH 3NOIA 2IPUG 4MJIA 1RZIB 5FUCE 2ZSWB 2C4FU 2FRGP 5HYQA 5F8RC 1G7LA 3DO7A 3QRFM 2OJZH 1J12A 3IXAA 4HFUH 4OGYL 4U1SB 2P8MA 2BSSA 1LEGB 2EYSA 5F71A 5K9KB 3KPPB 4NP4L 3RVTD 1DVFD 3DWTA 3VXTA 1MVUA 4X6FA 2I25N 4K94L 4CN1A 3O3DB 4M1CD 2X89A 3WLWC 1L4IA 3GM0A 3QHFL 4O02H 4M5ZL 4ZUSB 5HYSA 1IGMH 3H7LA 3SKUD 1YECH 4F9LA 2FL5A 5MHSD 5HYJE 4XHJD 1P4BL 5AZ2L 1JHTA 5TQ2L 3DGGA 1V3LA 5KSAD 2DQCH 3QCUH 4K3GA 3LPFA 4JFDB 1JBJA 3DVGB 4JZOB 2H8PA 4P9MH 3O3AA 4UINH 3U9PH 1TLKA 3O81A 5GS0C 2IG2H 3BPNC 1CR9H 1JZ7A 2A9ML 5TFSH 4X4ME 3O45B 1B0RB 5HGGS 5GQBA 4ZFOL 3BIKA 1IC7H 3K0WA 2VO5A 2BRRH 5E8OB 4YWGL 3UAJD 2NCMA 5DLMH 1YN6B 4RFEA 4X6CA 3GMNB 5F7DB 3STZB 3O9WA 3J7HA 3JXAA 4TRPL 4KHXH 1ZXQA 3KYMA 1U58A 4O2EB 1EEZB 3FO0H 3OKNB 2WK2A 4DUWA 4NNYB 1F8TL 3BD3A 1C7SA 2BSRB 4HZLA 4NRXB 2H32B 3BPNB 3CDGB 4ZD3H 1MWAB 4G6KH 4YIQA 4YHLL 5FA3A 3AXLB 5B38G 1CVRA 3P11L 5DJ8A 3T0XA 5D6CB 3LY6A 4MAUH 1IVLA 1HYSC 4U1IA 3ABZA 1IC5H 1IGTA 3PGFH 2DQFA 1KXTB 3ALPA 4WHCA 4KTEL 5C0EA 4XVTL 1CXLA 1E4KA 3R4DA 4WUUE 4DKDC 5F7HA 3IU4H 3MLYH 1WTGT 1GZQB 1GC1C 3O41A 2NR6D 1MVFA 3BGMB 3PWNB 1UEMA 5SWZA 1Y18B 5J1TC 3I3BA 5K93A 1UCBL 1NMAL 3WUWA 4ALAH 1GAFL 4Z77A 5T1LD 4P4KC 2HJKB 3BP7A 3VD5A 5ISZD 5C2BH 3AS2A 1VERA 2X41A 4MVBD 1WAAA 5K9QI 2WBJA 4EVNA 3L3OA 3ZTJH 3LKRB 4UIKH 3DTXB 4RISH 1JNNH 4PJDB 4KJQD 3MGAA 3G6AA 5DUMH 4HIXL 4M93C 1BFVL 2WWMD 4Q6IA 3D87B 1NBYA 5D7LE 4JLRA 4OCWH 3A67L 2ESVD 2AJ3B 1LK3L 2UWEA 1I1CA 4P4KB 3PQYD 4ZQKB 3UTSB 4PJFB 2LQRA 3ZDYF 32C2B 3TIDB 4P46A 2F54D 4JPIA 5HJ3B 2F19L 3OXRB 3QFJA 4NWUL 3EYQD 4NO5A 1CGSH 1CLZH 2HMID 2X70B 3ARFA 3HR6A 4M93B 1OGTB 2FATH 1NGYB 2VWEC 3T4YA 3RAJH 3K7UA 1MCHA 3TNMB 4ZXBB 1OGAE 4K8RL 2BY1A 3K4DA 4JHWH 3DYPA 3T8XA 3NA9H 4Z95L 1ITCA 3PJSB 4LLWA 5F44A 2QQNH 4HJJH 1UVQA 3TPUB 1NAKH 4OZIB 2V2XA 2VQTA 4R4BB 3QXVA 2HVJA 2YD7A 2YN3A 4HWEL 4R4FL 5KSBF 3MLVL 4HS8H 4U6TA 3P0YH 4LPVA 1FFQA 3ZSTA 5JHDD 1QQDA 4NPYB 2VXUH 1G9MH 3CFEA 4K2UL 2AXGA 5E03A 3MGOB 4AG4L 4G80B 4MCYA 5B3JE 4KQ3L 3O6FC 5IBLC 5BVPH 1I85C 4RGOH 2HT2D 4N0YL 2F15A 4FQ1L 4QHMA 4HHAB 5H37H 4NCDA 4PRIB 1UENA 3SJVD 5DURD 4PJGB 5JW5B 3ULVC 3WKMH 4IS6A 4MNGA 1KTRL 4RAHA 2Q76B 1ZT4A 4OZHB 1JPGB 1Q1JH 4PP2B 4OBRA 2A6DA 3VWJA 3GFUA 5J1AB 4IOFC 3O11A 4TQEH 2Z4QB 1HHGB 3HMXH 1N8ZA 3T2QA 5IESH 3O6FB 2R23A 2IH1A 2XY1A 4M9OA 1CVSC 5KVFH 3TO4D 4CBPA 3MUHL 3LCYA 2ZUXA 3UMTA 1RZKH 2IBZX 2ZNXA 4S1QL 1C12B 4R7DB 1ZKAA 5FCUH 4U6XB 4HXAL 4XWGL 5ICYB 1J9CT 1FNGB 3Q5YA 4BUHA 3EZ8A 2ERJB 1EGJA 2EO9A 2RAMA 3IFLH 4JRXE 4U1MB 3CVIH 5E8PA 3RVUD 2VN4A 5ADPH 3U2SA 5F6IC 3L5XL 4L3EE 5SWSD 1SYVA 4LSDA 4P0DA 2VZOA 1EUTA 2YUWA 4NBZB 1V3MA 4OZ4A 1AP2B 3DX7A 3HPLA 1CLYL 5CJXC 3NCMA 1N5YL 3C5JA 5GGVH 2EEAA 1XR8A 3QEQA 5I66B 2VL5B 4Q2ZB 1DANU 3BEWA 5T1DH 2F53D 2EC8A 2EE9A 4X99B 4U3HA 2J4WH 2VZ3A 2IANB 3WHXA 3DUUB 4U1KA 1I8IB 4KY1L 5F6IB 4HK0B 2FEDD 2Q7YB 4ZG1A 5KBNC 4G8FB 2RR3A 5E0QA 1T0PB 3IDGB 5EBLA 2NW3A 5L7XH 3MJ8B 3HG1B 4DGYL 5C8JA 1FVEB 4FNLL 3LS5H 3QDJB 3HR5A 4TTDC 4LARL 3V0VB 1PD6A 4CU8A 3H3PL 1EAPB 4JG1H 4WUKH 3MO1A 2J5LC 2X4OA 4LEOB 4ETQB 3TM6A 1SY6L 4P2QD 3UTTD 1OAXH 4OIIL 1H8SA 4RMTA 4NM8H 1RJZB 3CFBB 2GEEA 4I2XB 1KYOJ 4Y16A 4ELMF 3HC3H 1NGXA 4JFDE 4K8RD 1HI6A 4OUUA 1OT2A 4RBPK 1S8DA 2HJFB 2LU3A 2A0LD 4YAQB 4AT6A 1FNFA 2ZPKL 2VLLB 5DD0H 3TV3L 2K9UA 3F7RA 3VI3F 2OLDA 2GI7A 3QIWC 3RIFF 3WFZA 4Y0GA 1OF2A 3KWWB 4POZD 4PR5B 3ZKSD 2FSEB 4Y4HD 3KYNA 4I77L 2M2DA 3MV8B 2OR9H 2MCG1 3BH8B 1EO7A 2VUYA 5DQDH 4M3JA 2VLJD 1XIWD 3L5IA 3GKWH 1FYTD 3NABH 3DXAB 4HGMA 5E6ZA 5HYJA 1GH7A 1QVOB 4KPHH 1T1ZB 5D7JD 1T0MB 3PP3H 4D0CB 3QUXB 3QIWB 3VI4F 1WEJH 4PJIF 1ZS8B 4PGJA 3OKEA 1J8HD 3UTPD 3RWIB 1CGYA 3DX9B 3JWOL 1O0VA 1GRWA 5INCA 5D93C 2DD8H 4X4MA 1MWAH 2BNQA 3MA7A 1OL0A 2HRLA 4X4XA 5GIRB 2PR4L 2R4SH 1NPUA 4HKZB 4UDUB 4JJ5A 5KVGH 2R29H 1OSPH 4NQEB 1FL5A 3ARYA 5CSGA 1ZHKB 2D0GA 1IFHL 1AGDA 2MKLC 5L2JB 3VXMB 4M48L 2IQ9L 3FOLB 5C7XL 1C1EL 2CLZA 1CDHA 2NX5D 1LMKA 3BKJH 1CZ8H 5D93B 4R6UA 4LPYA 1JPSH 1RUQH 2PXYC 4RA0C 1OCWH 4ONHB 1LILA 3C8KA 3MNZA 4JQXA 5FHBL 2IGFL 4PJDE 1IGIH 3RFZC 4OF8A 3G5ZA 1HEZA 3P0GB 3UBXI 3I85A 2R9HC 4HG4K 4MNHB 3S36H 3WMSA 2YBRB 4WU7A 4WU5A 1AKJD 5CGYC 3UTSE 4PJFE 1KIPA 4OQTH 1NBZB 1P84J 4PRNB 2B5IC 1FO0H 2PYEA 3GMQB 2V6HA 5D1QD 2PXYB 3V6ZA 4FQ2L 4NGHL 1BQUA 1GSMA 1YUHA 3IT8D 2DLFH 1JV5B 3QUYD 2UY7A 2AJVL 4PGCB 1FQ9C 4GAYA 4GRLA 5LGHH 3NFPA 3IF1A 3O0RH 1MHCA 5J12C 4PRDA 3FN0L 1JRHI 4OZIE 1OAKH 4R90L 3BPOB 2B5IB 3IFNH 1D5IH 2CH8A 5D7LA 1CBVH 4YZFF 1L0XA 5LQBL 1RUMH 1CLOH 3LKNB 4JREB 5ICXB 3NCJL 5GGSA 1I7ZB 5JHLL 2VWEE 1FFPA 1RZ8B 2H1PH 4NKDB 3ARDD 12E8L 5DMYA 5ALBH 2E5EA 1I9EA 35C8H 3TIEA 2PKDA 3T3ME 1A6TB 3AAZA 1PKQB 5J12B 4GW5B 4PRIE 4YDIH 4S2SB 2D4FA 3A6BH 3B9KB 4JQVA 9CGTA 4PJGE 3BZFA 4J7RA 4LLVB 4QRPD 1F97A 1R3HB 1CFNA 4OZHE 1NGWA 4KKBD 3QNYB 3VXRA 1JF6A 4R0LC 3RWHB 1S3KL 5H2BA 2AQ3A 3WL9A 3MREB 1HNGA 4OT1H 5IG7A 3MRGA 4RQQA 1BOGB 2YPLB 3CZFA 5IR1B 1TVDA 2A6KB 3AS1A 3IS1X 5CUSH 3GMPB 1T03L 3LV3B 1YEIH 2G75A 2FHFA 3N1GC 3ARTA 1MCRA 1KJMB 3GHBH 5EA0L 3SE9L 3ULVE 1N5AA 3VG0H 3O8XC 2APFA 1S7QA 2R0WH 2B7DT 4YXKL 5T1KD 3O4LB 4R0LB 3MRIB 4MQXD 2PN5A 2X5PA 3IDXH 1SYSA 3X3GH 2X4UA 1SMOA 3HMXA 4IRJD 5FYKH 1U8JB 4OJFH 3D39B 5H35B 3S3JA 4TPRL 3MODH 5A40E 3L5WA 5INDB 5C09D 3KHOA 3O8XB 1KBGH 2DDQH 3UJTH 4HWZA 3MLSH 5J1SC 1ZLVH 3RWJA 1EX0A 2QADD 3QCTL 2E6PA 3HC4H 2DQEL 4ZOBA 2VLKB 2P5EA 2IFFL 4BSWA 1VADB 1E6JH 4MXVE 2RJMA 1FGVL 1AR2A 3RTQA 4ORGA 3QAZC 2CXKA 5BXFB 3QDMD 2IANE 4G8IA 1GGUA 4GAGL 4CW1B 3L5HA 2AERT 3BH9A 3PV6A 4MZ2A 3MC0A 1OTSC 2KZ1B 5HI4C 5I1IH 2VRAA 3O6KH 5DK3A 2YWZA 4HH9A 2GJJA 2VC2L 4JRXA 4NO0A 2DQUH 3HG1E 2BSED 4JFZL 4EXPX 4UILL 4U1JA 4Z76B 2VR5A 4ZMAT 3QDJE 4NWTL 4ZUUA 2KUTA 4YHYC 4LCCA 1CICB 3V5DB 5KOVC 1KUMA 2ITCA 1MJUL 4PB9L 5SX4I 5C9JB 3QAZB 2I60H 4JFPB 5D9SA 5BV7H 3DHJA 1IGCH 4LPUA 1B9ZA 4I2XE 1K3ZA 4FOMA 1RIHH 5E5MA 3BHBB 5HY9B 3HI1B 1NCNA 2VH5H 4RX4A 1R3KA 1BLNA 3ZL4H 1KT2B 1NUDA 4LGSB 1NFIA 1RUAH 2X1QA 1RK0B 4P57B 2FJGB 4KV5F 4DN4H 5KW9L 2JJSC 1LEGA 2XYCA 3G9AB 4F58L 1ADQH 3P4NB 4YHYB 5K9KA 1XH3B 1ZAGA 3PE9A 2VZVA 1XMWA 4GW1B 5LGJA 1QFWI 4M6ML 3KYKH 1JL8A 4Z0XA 3C87A 3CXDH 3GGWA 1PLGH 3MLXH 1P2CA 1KXVC 3P3YA 1T89A 3MV8E 4XXDB 3LPGA 1O7SA 1AFVH 4P5TB 2AW2A 3DXAE 1T83A 3R1GH 1A3LH 4ERSL 3FN3A 1MFBL 4GG8A 3D25B 5GGRA 4JFDA 5I16B 3DVGA 5ACLA 5JXED 5EO9B 3RWFA 4C56B 2P5WD 3CZJA 1X3DA 1T3FA 1JHLL 5DQ9A 3TBSB 2F74A 1A47A 3QXTA 2ZSVA 1F6FB 1BPVA 3QG7L 3SE8L 1Y0LB 5CIPB 3KS0J 1QZ1A 2HWZL 5E8OA 3Q1SH 4LP5A 3V52L 2DKMA 3QDAA 3QULB 3C08H 3TH2T 1CFVL 2C3VB 2VL4A 3GMNA 5F7DA 3STZA 1VEPA 1DBAH 4Z7NE 4GKSB 2OCFD 4O2EA 2OR8A 4NQEE 2AEQL 1KB5B 4NRXA 3VXME 2ZUYA 1VPOH 1MREH 1WT5C 3CDGA 3QBTB 1MWAA 3SDXF 4KVCL 1NFKA 4APQC 5DJ0B 4I9WE 2HTLD 2D7OA 4OD2A 5JQ6L 2YZ1A 1EO5A 5GGTH 1U8QB 3WFHA 1TITA 2D9CA 5C0BD 3SDDD 3ULUC 1F3RB 1UKTA 3WO4B 2KKQA 5E95B 4V2BA 1UM4H 3C5SB 4YQXL 1MI5A 4P49A 2OL3B 2OXHA 4HEPG 1RULL 3BGMA 4LNRB 3SGJC 1BIHA 5JMOC 2IC2A 4IMKA 1Y18A 4WY7L 4F8QA 5HHMD 4RMWA 3ZE1F 2UZXB 5C6TL 4APQB 1GGIL 1MH5B 3EFDL 4JAMB 4YJZL 3QIUD 2HJKA 2GTWB 1EV2E 2E7LA 3TLRA 1R3IH 4XRCA 1DUYA 3GSNB 5EC1B 4CMHC 2BNRD 4JM2D 3BP4A 1RURL 2DWDB 3BI9X 5DD5H 1A7OL 4OQTA 5C3LD 4P5MB 1FO0A 1CDCA 1IC4L 2VAAB 2BXZA 2BVYA 4QRRD 3MRFA 1BQSA 1GZPB 4U1GC 1AR1D 3VMOA 1EERB 1U3ZA 3HZMB 3MYJB 2AEWA 3UTSA 4PJFA 2VXVH 1A2YA 4R2GC 3TT1L 2HKFL 4OI7A 2QSTA 3FRPA 4X9GA 3QEUB 4CMHB 4RWHA 2XKNB 3OXRA 4LKCA 4GG6B 1FLRL 5JOPD 1PKQE 4NZRL 3OZ9L 3LD8B 2X1PA 1OGTA 4LRIC 4HUKB 4Y5YC 1QFUH 3EOAA 3C8HA 1D5XA 1FBIL 1YEEH 4U1GB 4Q58C 4ZXBA 3O2DH 1KGCE 4P2RB 4PJ7A 4OLVL 1BQHG 4LU5L 4ESKA 3N1PC 3PJSA 3FQWA 4R2GB 3TPUA 3SDCA 1JGLH 4Z7QE 4XCNB 4R4BA 3WE6B 2FD6L 2DQJL 1DDHB 1UYWL 2YPLE 1NMBL 4DN3H 3WEXB 1ODAA 3PABA 4G9FB 3WFEH 7FABH 1GXEA 1MFCH 2Q8AH 1RUKH 3VFVB 3LPWA 1FZKA 4EQ3A 1CGTA 1JK8B 3MRJB 1FG2B 4Y5YB 2CUHA 4LLDA 2NY6C 2OTWB 1S78D 2XN9D 3UTOA 3ZDXE 3KS0H 4HIJB 1Q8MA 2BC4A 3INUL 5IVXF 4XAKE 3O4LE 4Y1AA 3QQ3A 1HKLH 4DW2L 4JR9H 3L3HA 4PJGA 1DBBH 2O5YH 3D39E 1WF5A 2Q76A 2R56L 1JPGA 4OZHA 4LOUD 3QB7C 4PP2A 2AV7B 2WUCH 5J1AA 2NY6B 2P4AB 2QSCH 1IE5A 2CGRH 1I85A 2YPKA 4OI8A 1S7UB 5L2KD 2VLKE 4NRYA 1F2XK 1IGFH 4PIRF 1LDSA 3MYZA 4OFYD 3QIBD 4ONOA 3WHE0 4NZTH 1C12A 3PF2A 1SM3H 4Z7VB 5ICYA 1OTTD 1FNGA 1WISA 4J3WA 2NXZC 1Q38A 1L7IH 4MAYC 1ND0B 3MJ9H 5EIVA 1UXSB 4OF7A 4L4VD 2MOVA 2Z31D 1T5XA 4QWWD 2YA2A 2UY6A 1XEDA 3HE6B 3EOTL 3C6LA 5C07B 3AU1A 3MRMB 3M17B 1PZUB 4OCXH 5IOPB 5K59F 2FLBT 3ZKND 1B6DA 4JN2B 2FEEL 4WFHD 2XZQH 1JIBA 4K3EL 4LCUB 3U4BL 4WNQB 4YX2L 4X7TB 4MHHG 2NXZB 4NQCD 5I66A 1F42A 4MAYB 4LIQE 4RDQF 1JPTL 2V2WB 3VRIA 5CGMA 4X99A 1GHFL 2HLAA 1SJHB 5FYJE 4L8CB 1MNUL 1G9EA 4PG2C 1I8IA 3DPBA 2KQNA 3S6CA 2AAVA 2Q7YA 2NY5H 3ARGC 3GHEL 4HJ0D 5J11C 4G8FA 1NCCH 1YC8A 4WW2C 5IROA 3HG1A 3FFCB 2EZ0C 3LQZB 5E2WH 1FVEA 3T2PA 5CJXA 4QOKD 4F7PB 4XMLL 5KG9A 3QDJA 5I15L 3F7YB 3V0VA 3AS0A 1EAPA 3PGDA 3JWDC 5FKPA 2CR6A 4OD3L 3T0AA 5E2TL 4FA8A 2NZ9D 4LEOA 4ETQA 3CX5K 5TF1L 4A6YL 3DURB 3Q48A 3FHQA 2OK0H 4V1DB 1ADQA 4WWKC 3CFBA 1QLRB 2HRPH 4M6NL 4YDKL 2VXTH 5J11B 2FNBA 5B38A 5MEPB 2XT1B 3I6KA 4N68A 4WW2B 5EPMB 4C56E 3WNKA 1CL7L 1JYNA 3CMOH 3CCHA 4J2XA 1KG0A 4NZUL 3X12B 4YAQA 2DN7A 4P9HL 3SE4C 3OKOB 5TPWH 2B1HH 3N1QC 4OLZL 4UTBH 4G7YL 2Y72A 1RSFA 4QHKI 2V5RA 5L9DH 5CEXB 3KWWA 4PR5A 3UTQA 3E2HC 1AQKH 2X7LA 4WWKB 1FPTL 2FSEA 5DJDB 4KMTL 4U1HB 2DQHL 3MUZ1 3MV8A 4M62H 5J9PB 4K55A 3BH8A 1OM3L 4U3CA 3W2DL 1WBYB 3MCKB 4JQIL 4ZAKB 4RGNC 5CIPH 1BZ9A 1KCLA 1RZ7H 3DXAA 5FHAL 3QDGB 1QVOA 4K9EL 3RI5F 3U1SH 1T0MA 4TOYL 1SJEA 4NOFA 3DSFH 4Z7UE 4RWYL 3I50H 2E8YA 5TQ0H 3QUXA 4E0RB 2YD8A 1K4CB 1I4FB 3EBAA 1ZS8A 3W82A 2PF6A 3E2HB 4PJBA 2NNAB 3QEGL 3DX9A 4PJXB 3RZWA 1BFTA 4QXGL 1JI1A 5LKNA 1BX2A 1YJDH 4RGNB 4TSBL 5GIRA 3MPCA 2W0KA 1F4YH 4HKZA 4CAGA 4E9LA 4OF5A 5DJYA 4C83A 4J4PC 4YHMH 1MIEH 2DJ4A 1F13A 4L8BB 3HKFA 2FDBP 1ZHKA 3BKCL 5L2JA 3VXMA 3GIZL 5AUMB 5GGTA 3ULUE 1YPZF 1JZ5A 3KXFA 2A6JA 5EZLB 5A16A 4NUGL 4NHUB 5H8DA 3NCFB 2HG5B 1RIUL 1HQ4B 1OPGL 5C0DB 3BJ91 3K4ZA 3QQNA 1UH4A 5FUZL 3FO9B 4ODWA 1WBZB 3BP6B 1MOEA 4MNHA 1Q9KB 3GSNH 3HS0B 3WJLC 2ED8A 1WFTA 2YBRA 2VN7A 4M7KH 4OCNC 3KLAA 2MCPL 1HDMB 1NBZA 4HUUA 4HFWB 2Q3ZA 3CLFL 3LN4A 1G1CA 5GJTH 2AJZB 4KRPC 4CMMB 4GG6E 3BP5B 3ZTNH 5IGXH 3S5LG 4M43H 1HOCA 3D2UD 3FT3B 4MDJA 4PGCA 2I07B 4JDZB 1RPQA 3I9GH 4P2RE 1C8PA 1Q0XL 3SDYH 1EXUB 5JW4M 5GPRA 4ZDHA 1VGEL 4MXQD 3SKMB 4D0BA 2RB8A 2ED9A 3WKNA 1TZGH 3RVXD 5I71C 4G9FE 5BMFH 4KRPB 4OLXL 2EKJA 1EDQA 3D85B 4JCMA 5IHUL 4GRWB 4FQQB 3U82B 3ARFD 5IB1B 1Z3GL 1DQDH 4FFVD 1ZANH 1I7ZA 2B2XH 3O2DA 1RZ8A 5F9OL 5HHNB 1A6TA 3O2VL 2YXMA 1PKQA 5TH2A 3N85L 1I9RH 1T2JA 4GW5A 1FE8L 4S1RH 1P7QB 1U3JA 3B9KA 3KR3H 4N8VB 2AKRA 1Z9OA 1DLHB 1YYML 1Y6NR 3V5HB 4G6FB 4I3GA 5TDOA 1R0AH 4RNRB 4FG6D 3QNYA 2D0FA 3RWHA 4DGVL 1HN1A 1YEJH 4MMXC 2IPKB 3RVTC 1DVFC 2WUBL 1BBDL 1TJIH 3DX8A 1X5GA 1J1XL 3KPLB 3SGKC 3HAEG 1BOGA 3GSRA 1XT5A 3GJFB 1CDUA 3AY4C 5IR1A 3EW3B 3LKQA 3GMPA 1Z9SA 3LV3A 2R69H 1D6EB 2HFEB 1MAJA 4OFDA 3RZCD 1KJMA 3AGVA 3C6SA 1P69B 3UTZB 4Z7VE 3B43A 4ODXB 5KSAC 3O4LA 5F1NA 4XP5L 3U0WH 3BYYA 3MRIA 4GXUM 3EHBD 3VWJD 1G9NH 1DVFB 5MI0C 1AH1A 3BESR 2EIZB 5D5MF 5HVGB 4YBLB 1U8JA 1L7TL 4S0SD 2XXCB 2B0SL 1G7PA 4XCEA 4FMFA 4DVRH 3GB7A 5H35A 5C07E 2AV1B 1KCUL 5GRWA 3HMWH 2ZUVA 4CVXA 4OLUH 4X7FC 5IB4B 4DTGH 5FYJU 2WWKT 4IIQA 1KN4H 4S1SL 4OTXL 5INDA 4ZNEE 3B9EA 4CVWA 4U6VL 2ILLA 5KSAB 1GOHA 2ZOKB 5I17B 3MJ9A 2VLKA 5E2VL 1FCGA 5MI0B 5E2UL 4WJ5A 1ED3B 1VADA 3MJGX 5GGQH 1P4IH 1B4JH 4MDIA 5JOEA 4JPWH 4PV8B 1XF1A 1ZLSH 4NFDA 3DX6B 2Z8WC 5I1KL 5E94A 3ZT7A 3E6FB 3FFCE 4XCYB 2YOCA 5D7KE 1G7QB 1S7VA 3QPQD 5L6YL 1MLCA 3G5VB 1QRND 4LSPL 1CICA 3FCTB 5KANG 5F70A 5C9JA 3TCLB 5IEKA 3HI6H 4QXUL 3WS3B 4ONFL 3JV4B 2NR6C 4V1DE 5F88B 1HILB 3OGOE 1RU9H 5HY9A 3HI1A 3WFDL 4Q9RH 4MYWB 4FXKA 3GK8L 1TNNA 3WHE1 1KT2A 5E8DL 1RZJC 4P57A 4DKEL 4KVNH 1JN6A 1DBJL 2K7QA 1XH3A 4FFZL 4MVBC 4G3YL 4DQOH 1WC7A 2A9NH 4GW1A 5B22A 4KJQC 4NQDB 2C1PB 3QHZL 4KQ4H 4S0TD 5EU6A 4F7MA 1NCUA 3EO0A 3QNXB 4P5TA 5DYOB 5I1EH 4Q0XH 5BS0A 3ARVA 4X6EA 1TVHB 1Z9MA 3F6IA 2B4CH 5DA4A 5ISZB 2GTZA 3QDGE 3EYOB 5LCVL 3UC0L 1EHLL 2JJSA 4G7VL 3U7YL 2Z0BA 5EO9A 5F9AC 4C56A 4I1NB 3EYQC 4KKLC 4YFLF 4RMQA 3TBSA 3C2SA 2V5YA 4OLYH 4W4OC 4PJXE 2ESVB 1Y0LA 3QA3B 5CIPA 1VHPA 4X6DA 4N0FB 4RGNE 3PQYB 2J2ZA 3VRJB 2Y5TA 3TH4T 3V5KB 5AG9A 3Q6GL 1IAIH 3QULA 3LH2H 4LNVA 3D69B 3RIFK 5EOQL 2F54B 2OTPA 5D96C 1AI1L 2Y07H 2HAZA 2X4RA 1IQWH 4HK3J 5LVEA 4GKSA 3CDFA 1HHHB 2BFVL 3EJYD 3S5LB 2NLJB 5JLZA 2VABA 2Z91B 1NFDA 1X5KA 1LEKB 1WBXB 2BNQD 2X9XA 3I3DA 5IIEB 2HT2C 4N0CD 2VXSL 3TJEL 2F58H 5DJ0A 4J3XA 1SQ2N 4XTRC 5FOBA 2N7BA 4FP8L 1HXMB 2OZ4H 5D71L 3O4OC 3VXQA 1U8QA 3BEVA 4MX7B 3C5SA 5JHDB 4WHTA 3ARBA 4MNQA 1A0QH 2Y6SC 2EIEA 4MQ7A 1IM9B 1MCJA 4LNRA 1Q94B 3DV4B 1KB9K 1E4XH 1JCKA 5C08D 1S7RB 5KAQG 4RMSA 2ZJSH 3FONB 1T1YB 3L7EB 1KJ2L 4U1NA 4MCZA 4PJ5D 5HHPB 3SJVB 5DURB 3PG2A 5T5NG 3VXPB 3O4OB 1N4XL 3WXWH 2A74A 3GSNA 4LLMB 5EC1A 5ESQB 4U3XA 4C58B 2DWDA 5J6HA 4Y2DD 3KNBB 1JGUL 3SGJA 1H5BB 2VAAA 3VXSD 3T0BA 5CEZL 1GZPA 3HZMA 4MXWH 3QJFB 3SKNB 3MYJA 4GRWE 4X4YB 1X4XA 2V2TB 2R0KL 3QEUA 1MAML 2BY3A 2XKNA 2ADGB 2FBJL 2VKWA 4XGZA 2V17H 4X0KA 5M7QA 4XCCL 4O5LL 4QHUB 1T1WB 1DSFH 2X4NB 3U6RA 4R7NA 1E6OH 3MQIA 2FEDC 3VFPB 4PY8J 5FK9B 1G7IB 4YHKH 1CG9A 5I74C 1V3JA 2JLLA 1W72L 1T7WA 4PJ9A 1EEUA 1DDHA 1I9JH 2HN7B 1OAZL 2XTJC 5KSUA 3QWOA 2FHBA 4CN4A 3H9SA 2E7CA 4YPJA 1XF5B 2RCSH 3VFVA 1MHHB 4Y8DC 2F53B 2AJUL 3LKSB 2DKSA 1CLCA 1JK8A 3MRJA 4LRIA 4EBQL 2YPVL 3IVKA 1KPRB 3NCEB 1SEBB 3HE7D 1GOGA 3VU2A 2AJSH 4BH7A 3D5OF 1LP9F 5GRXG 5HVFB 5FO9A 1XR9A 4KUZH 4YEFA 1KENL 4XBPA 1LE5A 1N6VA 1WV7T 5I74B 3E0GA 2ICWJ 3P4MB 5F8QC 1OAYH 2XTJB 4HDIB 1J7VR 4LHUD 3VDCA 3KLHC 3TA3C 1JNLH 2DQDL 4U6HA 2FO1A 1X5IA 4IRSC 1RY7B 4KXZI 3UTTB 5MHSE 1DQQA 2XZZA 1NL0H 4HC1L 4D9RD 1QSED 1DQML 4XP1H 4M4RA 1DN0B 3KPMA 2HFFB 4FFWC 4JN1H 4HIEA 1I8KB 3UYOD 4Z7VA 2ZCLL 3ILPA 5D7JC 4HKXA 3LHPL 4ZTOH 5EC2B 3EOBB 1MCWW 3TA3B 4NKMB 5GRUL 3SDAD 1QR4A 1KFAL 5EO0A 1MCOH 2MPAH 1ND0A 4TNVF 1CGXA 1ZK9A 4LSUH 2LV4A 3HE6A 5J57B 4FXGA 3MRMA 2VDNL 2P5ED 2A77L 4AEIL 2FX7H 5IOPA 5JZ7D 4NC0B 3FMGH 1BVZA 1YMHA 4JN2A 1FYTB 4ZNEA 4NIKB 5E4IA 5D7JB 2XA3A 4WNQA 1QO3B 1DE4B 2YD6A 4X7TA 2UUDH 2OS7A 4MAYA 2XICA 1WICA 4Y5VC 4ZOEA 4GRMB 3KYOB 1SJHA 2JELH 4GQ9L 4LPWA 4L8CA 1J8HB 1N7MH 3EYSH 3IDNB 3LSOA 4NKOA 3TN0C 4I3RL 5IKCB 2ICEB 43CAB 4NM4H 3CC5B 3C2AH 4PJDF 3EJZD 4M6OH 5EUOB 1F4WH 5SWQA 3VCLB 5HVHC 5JW4R 4NQDE 1IKFL 1BIIB 2AJXL 4HMDA 3WJJA 1A1MB 3D0LA 5DRXA 5HI3C 2E7HA 4RX4D 1A5FH 3DURA 5ISZE 4PG2A 2NX5B 3AM8A 1UXWA 1QLRA 4HKJB 4FHBD 5GSRB 4LKXB 5MEPA 1TCMA 3MRPA 5D1QC 4JFOA 3RIAF 1U3HA 2AJYL 3GBNH 4ISVB 5HVHB 3X12A 2XPGA 4NJAH 4JFYA 3T77B 1H15A 2XZAH 3OKOA 5E7FA 2Y4SA 2ESVE 5CEXA 1BVLB 1AKJB 3PQYE 4OZIF 3NCYS 1FP5A 2ARJQ 3ARED 1MQKH 5I75B 1AY1H 3Q6FB 4WWKA 5DJDA 5ITFB 3BKYL 1FRGL 3OKDA 3BZ4A 4U1HA 5JW4Q 1NCDH 2HKHH 2F54E 5ANMB 4LRNH 3TFKD 5FKAA 4HWUA 1TZIB 5D1QB 1CE1L 4Y89A 4ZAKA 4PJAB 1X5HA 2WINA 5DS8A 3OBAA 3QDGA 4AQ1B 4MA7L 3VE0B 4ZSOB 4OGYH 4PTTA 3ARDC 2ICCA 2VDKL 3DV6A 4NQSB 4OCSL 1X5LA 4ZTPL 3T3PE 4GXVL 1AGBB 1FZMB 1IZJA 3D9AL 2J8UA 3GJEB 1A9BB 1HHIB 2UV3A 4PJXA 4K94H 5D1ZD 5KVDL 5GRYA 3STLB 3B4NA 4KKBC 3QHFH 3T2OA 5JHDE 2AK4A 4M5ZH 3H7BB 4U0QB 5DFVD 5JXAL 1MFDL 3VW3L 1RMFL 4LAQL 3WIFB 2WBWB 3ARDB 3HC0B 1JYVA 5E8EB 1P4BH 2EXYC 5DJ6A 5AZ2H 5TQ2H 5CBEA 4XNUL 1K8DB 4OCLC 1LD9B 4L8BA 5GZOD 4JM4L 5E8NB 3E1F1 3SJVE 2OZ4A 5AUMA 1NGQL 4M9PA 4XC1L 4QRPB 1R5WB 3CLEL 5EZLA 4K3DL 1BQHA 2PO6A 4NHUA 4MQXC 2A9MH 2AS5M 4KFZC 3I02B 3OAYK 5GISL 3BJLA 4MJ4A 1AO7B 1WBZA 1IBGH 1Q9KA 3HS0A 1ZLWH 4TRPH 5DUPL 1HDMA 4HFWA 1F8TH 5IVNA 3CU1A 2CDGB 4X4ZA 5T1KB 1F4HA 3HAEH 3RNQA 4ELKB 5J56B 1E4WL 2QQQA 2AJZA 4CMMA 2ORBL 4MQSB 4MXVF 4YHLH 3N0PB 3RWGA 2JB5L 3OSKA 1UADC 3P11H 1U8KB 2C3XA 4GKOA 4YGVB 2CIKB 1IC1A 3FT3A 3O3BA 3V6FB 2AABL 5LXGL 5D1XD 4KU1A 4JDZA 4KTEH 4XVTH 1EXUA 1UQSB 3MLUL 1P4LB 3SKMA 2YK1L 2AGJL 3RP1A 1Q9OA 1QLFB 1B90A 3HZVA 4I4WB 5GGUA 1B2WL 2MTPA 3RUGB 2F53E 5IB1A 1UCBH 1EVUA 1NMAH 2C5DC 2DOCA 2JCCB 4Q9BA 1LP9A 4URTB 3MMEB 5IT2L 2NTFA 3QDMB 1GAFH 1OD9A 3MJ7B 1CWVA 1URLA 4GH7B 2X42A 1EH9A 4RMUA 5AYQA 4QCIB 3W39B 5HHNA 3PXHA 4OGZA 2EXWD 1NEUA 4LLAA 5HDLA 3RGVD 1UZ6E 3GSOA 3SDCD 2DLIA 4P23C 1P7QA 2XA8H 1LE9B 2GSGB 2YZ8A 4HIIA 2XTJE 1NAMB 2ZZUT 5D8JL 3V5HA 1X5JA 2Z9TA 4Y8AA 4B50A 4ZFGL 4RFOL 1BFVH 4JO3L 1S5HB 4UMGA 2IPKA 4XNXL 2Q20A 3A67H 1LK3H 2QKIA 4R3SA 3KPLA 3UTTE 1QEWB 4JE4B 4E41B 4PRAB 3KPSB 3T1FB 2Z8VC 1D6EA 2F19H 2YN5A 1WFNA 4P23B 4NWUH 2HFEA 1KLUB 4J6RL 1CK0L 2MNUA 5IFJB 4YBQD 2DQGL 3QG6A 4NKIL 4HF5L 1CF8L 4H5SA 2EIBA 1DVFA 1EMTL 3FQUA 4K8RH 4CDHA 3TBYB 1E28B 5T33L 4Z95H 3MOBL 3AY4A 3OJMB 4KTYA 3TVMD 2AV1A 5JUEL 5FYKD 4OSUL 4HWEH 4R4FH 2LFGA 1YEGL 3G6JB 3MLVH 5IB4A 3T0VA 1FYTE 3F7VB 1J8KA 3V4VL 2IAMC 3CAFA 1CDYA 4K2UH 2GITA 5KSAA 4AG4H 2OJEA 2UYLB 3B2UD 4KQ3H 5FB8B 3UPRB 1J5OL 2O61B 1TJHL 2VKXA 4N0YH 2JB6A 4FQ1H 4NQXB 4L9LA 1ZT7A 1J8HE 3UTPE 4M1GL 4QRTB 5IVOA 2PUQT 4KJPD 1HWGB 2R0ZL 5CGTA 5FDWA 3RWCB 2DF3A 3ZE0E 3FO1A 1YDPB 5EUOE 1S5IL 3MLTB 5IMKB 2HTLC 3P4OB 2ZUTA 1G7QA 4OFIA 4XNMB 1NJ9A 5ESVB 3G5VA 2PNDA 5HHXL 5E6IC 4NFBA 4RRPG 1DTUA 3VMNA 5FM4A 3DBXA 2BOCB 2FX9L 1TDQA 4JG0L 3E3QC 3TCLA 5IHZB 3WS3A 4U0RC 3MUY1 2WZPD 6CGTA 2NX5E 3E6HB 4S1QH 3JV5A 4JKLA 4YLQT 1U6AL 4EQ2A 3EO1A 4ZUVA 3V4UL 4LL9A 4HXAH 4XWGH 3BPLC 4CN6A 5EOCL 3LRGA 2EDJA 1KJVB 1C5DA 4FZEL 3KJ4B 1IGJB 3ROOB 3SDDB 1ZA3B 4XPAL 1PEWA 3PHQA 4YDJA 4YBHA 4JM2C 5E99L 1EAJA 3WFCL 3NAAL 3L5XH 3DHMA 4WO4C 4U0RB 5EU4B 4XNZC 4QTIL 4X7SL 5E6YA 4JRYB 4Y7MA 4U2ZA 5ANME 5JIIA 1CLYH 5HHMB 1N5YH 2APWA 1AR1C 1CE6A 3BPLB 4FS0A 5DYOA 4OV5B 1DCLA 5I1CL 4H1LH 3R06B 5T1LA 4PJAE 3C60D 4HW6A 1HINL 4F2MA 4ZSOE 3X13B 3GSVB 4JM2B 1JF1B 2X4QA 4M7ZC 4Y19A 4KY1H 1AJ7L 2E9WA 4UT7L 5AD0B 4XNZB 3IDMA 4F7CB 5D2LF 4DGYH 3IKKA 5DZNA 4WI9A 2ICWA 1FC2D 4FNLH 1FZJA 5HI5C 2IQAB 1HHKA 4U6YA 4LARH 3H3PH 5EZJA 2VITA 3VRJA 4Z7QF 1FNAA 4MJ2A 2J3SA 1A4KB 2DI7A 1CFQB 2B20A 4QLRA 1J86A 2F54A 1SY6H 5ENWB 4OIIH 4M7ZB 1T5WA 3NIGF 2BERA 3DUSA 3NFNB 3S5LA 3UBXB 5JDJA 5MENA 2NLJA 5F7YC 3GMRB 4CKVX 1LEKA 1ZHNB 1JYXA 4YUEL 2FGWL 3OGCA 5AWNL 5FYLE 4UDTB 2BJML 5IIEA 2CKNA 3RI5K 1KTKE 4XT1C 2ZPKH 1CFSB 1WWBX 4H25B 3U0TB 1A6VL 3L9RB 3RKDD 3TV3H 1RJLA 5BOPA 1B4RA 1HXMA 4N1EA 4WI6A 4LDEB 4NO2A 5F9WC 4D9QD 1AO7E 1W8OA 4MX7A 3OG4B 4I77H 5JHDA 3EYFA 5MEOA 1YMMB 1H3WM 1UACL 3RHWF 1QKZL 3I6LD 1X6LA 1TPXC 3IDYC 4I13B 2MQCA 1S7RA 3AVEA 2BK8A 1T1YA 3DMMC 4NNPL 3FQRB 1KF9B 3VXOB 4ZFOA 3UJJL 3SJVA 3VFRB 5ITBL 3G5XB 4HULB 3NIDF 5F9WB 1PG7X 5CZXD 5F6HJ 5ESQA 4LLMA 1OTTC 4AIOA 3ESVF 3JWOH 2EH8L 3ZSSA 3IRPX 1UZ8A 5LG1A 1F11B 4E5XA 2NQCA 4YHOL 5DWUL 4HG4J 3RWDB 3HAEA 1OB1B 1H5BA 2PR4H 2FECL 3IDYB 1MHEB 4OZGB 1UKSA 3QT2A 2CDEB 3WXVL 3FZUD 5L2KB 3TO4A 4BZ2L 3DMMB 4JZJA 3RUGE 3Q5OA 1F02I 2JCCE 5DHVB 3QIBB 1D6VL 2DLHA 4F37K 3QDME 3K1DA 1IFHH 2BHYA 43C9B 2GT9B 1PYWA 2IQ9H 4O51A 2ADGA 4XCFL 1T20B 2MQ3A 5IK3A 5C7XH 1TETL 1C1EH 4OCYL 3VXUD 2XFXB 4BK4A 4QHUA 1T1WA 2H3NA 1ZEAL 2D0HA 3UXFA 4NC2B 2X4NA 2FIKB 1I8LA 5FHBH 2IGFH 3GUTA 2WW8A 3K8LA 1CD1B 1F58L 5SWSA 1BZ7B 2DYPA 3REVA 2JK5B 5EBMB 3WS6C 8FABB 3S88L 1JGEA 4R97C 4RBPH 5FOJA 2HN7A 5EFIB 3T04D 4DFHA 3U83A 5DDHA 4ZYKA 1XF5A 1KXQE 4NQCB 1UH3A 4E41E 1RVFL 3KPSE 5C0IB 3X14B 1MHHA 1H3TA 1CU4L 4YNYA 3ISWA 2NZ9C 5E24E 3TBTB 4FQ2H 4NGHH 5D7IB 3PWJB 1KPRA 4AYFA 4HS6B 4F8TA 5FGSA 4QRUA 2HFTA 5C92A 4K7PY 2VUOA 1NC4B 5KS9B 1ORQB 2ZP0T 2EDBA 3F65A 2AJVH 4JFFB 3LQAL 3NCYP 1PJ9A 4R97B 4U31A 1KOAA 3L95B 1NUNB 3T0EA 1WZMA 4QOKB 4IDJL 1PG7L 4GFTB 2VDQL 1JUFA 4R90H 3DO7B 2X4SB 1AIFA 4YO0B 4F33B 2EDHA 1W0WA 2E6QA 3G6JE 3IXAB 3QUML 4F9LC 2P8MB 4MJ6A 5LQBH 4P2QA 3MGTB 3UCRA 3UTTA 1YY9D 3RY6A 2BSSB 2EYSB 1TENA 4OFVA 3PWVA 3NCJH 5JHLH 1HIML 2ZUUA 3BX7C 12E8H 4L5FH 3VXTB 3V95A 1MVUB 5I6XB 3RGHA 4EJ1C 3F7QA 1I8KA 5DEFB 4KKCC 25C8L 4Z7WB 3X3FL 4Z7UF 4YDVB 4NKMA 2XI9A 4P3WA 5HYSB 2AQ2A 2W60B 4NNXA 1NH6A 2JJTC 2FL5B 3SKJL 3QZWG 1S3KH 3DGGB 3ARQA 4Y4HA 5HYEA 5DEGA 1OT1A 3O9WC 2ZG1A 1FAKT 4K71C 4N9GA 2VLJA 1XIWA 4NRZA 3ZHLA 2H8PB 3FT2A 1T03H 1FYTA 5D70L 3P9WB 5D7JA 3LDBB 2Y36L 3VDBA 2C1OB 1QO3A 1NUFA 3QR2A 5HDOA 5DT1L 3SE9H 5EA0H 2DBJA 1BREA 4KROD 4YXKH 4GRMA 3KYOA 4KI5C 3VFMB 4H8WC 4X7EC 5C6PB 1CDGA 2GYSA 3L3JA 4X6CB 1J8HA 4M6AA 3O9WB 3ULUF 3IDNA 3QI9A 3KYMB 4K71B 1U58B 2EDFA 2HVKB 5IKCA 4N0UB 2ICEA 43CAA 1G7MA 4TPRH 1XAUA 1A6WL 1LO3L 2VMFA 4HK3N 2RFXB 3VXNA 2OMBA 4YIQB 4CVZB 4JRYE 2E7MA 4UBDD 1V3KA 5DJ8B 5HHME 4M02A 1Q0YL 3QCTH 4U1IB 4X6BA 2DQEH 3MRDA 2IFFH 1O5DT 3ZKMC 2YD3A 2ADJA 2VXQL 5DK2A 3LKPB 1FGVH 2NX5A 4HKJA 3OAZK 4GG6F 4GAGH 4RMVA 4LKXA 2WBJC 1E27A 1T7ZA 3JBG7 4IBLT 5D72L 3O41B 4UT9L 1KEML 1KN2L 4M8QA 3SGDH 3LEVL 1IAII 4I0PA 1CFBA 2W0FB 4Q6IC 4JFZH 3TT3L 1A21A 4NN5C 3WUWB 2JTDA 4UILH 5C0GA 1G6RB 5A2IH 4UOW0 4NWTH 1BM3L 2K7PA 4Z77B 5E1AB 2YMXL 4WI7A 1EZVY 4Z78A 1MJUH 5ITFA 1OTUD 4MXQC 5BO1H 4QO1A 2DMCA 3RVXC 4PLNC 4EVNB 3L3OB 1FFOA 5JOPE 5D1QA 4KRNA 1CS6A 3VGDA 3ARFC 4PJAA 3MRBA 4GW4A 3BQUD 5GRJH 3S8WA 5CEYA 1DL7L 3D2UB 1NBYB 4NN5B 4PRPD 4YHPA 3QUYA 2DL2A 2NY2C 4WCYL 5KW9H 4J8RA 1A64A 1MSPA 4NQSA 1A6ZA 4F58H 2PTTA 4JFED 4ZPVB 1AGBA 3OX8A 2XKUA 1SY6A 2G2RA 1E4XI 3Q2CA 4NO5B 4FG6C 4HUXA 1F3JA 3ARFB 5AAWA 5BJTB 3ARXA 1YMME 4L8SA 3IETA 3T4YB 3WIFA 2NY2B 3HC0A 5GS1C 3WIHL 3FFDB 5E8EA 3T8XB 4ERSH 1OP5K 1UVQB 2V2XB 2R0LL 1XGQA 2HVJB 1I1AD 3RZCC 2XNAA 1JHLH 4CU6A 4LCWD 4QRPA 4KK9D 1R5WA 4I0KA 1HE7A 1QD0A 3DI3B 3ARBD 4QRQA 3EHBC 3VWJC 3QG7H 3SE8H 3CFEB 3VFWB 4ODUB 3DECA 2HWZH 5GS1B 1INDL 3V52H 3CD4A 5GZNC 1NMCC 4OZGE 3MUGA 4DKAA 5IMMA 5JW4N 6FABL 4QY8A 1KEGL 1CFVH 5L2KE 1JMXA 3RZCB 4OI9A 3TO2B 2AEQH 4IS6B 4MNGB 5C3TA 1ZT4B 2CDGA 5T1KA 1I3RB 3OL2A 2A6DB 3NA4A 3VWJB 1VFOA 2ATPB 1XGRA 4IRJA 3O11B 4KVCH 1U8KA 1UWEL 1N8ZB 2R23B 1KCVL 3GM8A 3T09A 1IKNA 4OM0L 5ALCH 5IW6A 5FF6B 4HBQA 1UWGL 2AP2A 1GYAA 1J0ZA 4O2FB 4TN9A 2EYRA 4UAOC 1CLZL 2NY3C 4RMRA 4WFHE 1UQSA 1P4LA 4TUKL 4YQXH 5C09A 1RULH 3MSPA 3OJDA 3QPQC 3RNKA 3CX2A 1QLFA 1S7WA 4NQCE 1S9VA 4I4WA 4WY7H 4MHHI 3PDOB 2XY2A 3WNLA 2JCCA 1GGBL 5C6TH 3GI9L 1QPPA 1GGIH 3MMEA 3QDMA 5D7IE 1QR1B 3Q3GB 3MJ7A 3EFDH 5J6GA 3S98A 5CLTA 4PJ8D 1PKOA 1M6OA 1SYVB 2W0LA 4QCIA 3W39A 4WW2F 3HCVA 5KS9E 1I7UB 3P0VL 3JTSB 4OZ4B 4UAOB 4TNWF 4JFFE 5GS3A 3ZDZE 1EJ6A 1RURH 4PJ9D 2VDLL 3WUZA 1LE9A 4YXHL 2GSGA 1AQDA 1A7OH 4QOKE 4Y2OA 5IFHL 1PVHA 4GXUN 4HGKC 1XR8B 3H9SD 1WIOA 4LHUG 3QEQB 1N59B 4KKAD 5H37G 3H9HB 3S96B 4DKFL 1IC4H 1QRNB 3BEWB 3P77A 5BRZD 1S5HA 1CXIA 4R4ND 2VLRD 3B83A 1OARL 1GGCH 3WHXB 5EWIL 3VDAA 1QUNA 3TT1H 3CU7A 4Y16C 2HKFH 5EBLB 1TTUA 3T1FA 4N90D 5C8JB 4X9BA 1FLRH 5BZDB 4NZRH 5IESL 5IFJA 1A6UL 2L7JA 4Z7WE 2LU7A 4KMQA 3O3EA 4ZFZB 5LWYL 4KK5D 3MO1B 1FBIH 2X4OB 4PYHA 5TDPA 3NGBC 3TBYA 4OLVH 4LU5H 3B2VL 3VFOB 2DM4A 4FMKA 4Y16B 2A83A 1BD2D 2FD6H 2DQJH 1BMGA 1UYWH 3GMLB 1NMBH 3G6JA 3R8QA 3O3UN 1ZT1A 1YEDB 4F57L 2Y25A 3RX5A 3U36B 4TULH 4AT6B 2BCKB 3BZEB 4U33A 5F9JA 1NBVL 5F7LB 5JXEA 3INUH 2O61A 2P5WA 3NGBB 3EJYC 1OF2B 1NLBL 1RJCA 4NQXA 1T4KA 4R8WL 2DS4A 4X6CE 4DW2H 3E8UL 2F5AL 4JO2L 2HP4A 4N0UE 3QCVL 3K81A 2R56H 3H0TA 2J8OA 3MLTA 4TNVK 5DJAB 5IMKA 4GJTB 3ZE2E 4YK4C 5A3ID 2CO6B 2YKLL 3PHOB 4PY8I 4XNMA 5ESVA 5TE7L 4JRWA 3BD5A 3MOAL 4IMLB 1A7BA 4NDMB 4KI5E 3QXAA 3O6LL 5HHVL 5IHZA 3TPKA 3OKEB 4UNUA 4ZFFA 5C0FB 1AGFB 3E6HA 3MA7B 2BNQB 4X4XB 1U8HA 4YEEA 5IW1B 4JQXC 4U7KA 4JJ5B 2GK0A 4YK4B 1JWMB 4WV1A 5JW3H 1FFNA 1NCTA 3U46A 2CRZA 5C0BA 3SDDA 2DKUA 4YH6A 3UYRL 1G0DA 1H3XA 1FL5B 2ICWI 3EOTH 2W59A 4GO6B 1AGDB 1HK6A 1HH9A 4Y2DC 1FC1A 5F93C 3MLWL 2CLZB 2HH0L 1B0GB 1RHHA 3VGAC 4K3EH 3CX5J 5C08B 3U4BH 4LSRL 4YX2H 1EIBA 4U1LB 4XVJL 3WBDA 1J88A 4GRWF 3S36X 1CT8B 3N50A 1U3HD 3MNZB 2YD9A 3QIUA 3G5ZB 1YNKL 1JPTH 4KWUA 2HTKD 1GHFH 2C26A 4GRLC 4HGWB 1MNUH 2BNRA 3GSVA 4JM2A 3H9YA 2P24B 3I6GB 3IDIB 4YC2C 4BSVA 3GHEH 4Y2DB 3QQ9C 5AD0A 2FB4L 4DZBA 3GIVA 2PYEB 1PAMA 3RIAK 3VGAB 3VXSB 1A14L 4QRRA 5HTSA 3TCXA 4XMLH 2IQAA 3V6ZB 5I15H 2EICA 3SGEH 3CSYB 1UH2A 4TUOA 4LF3A 4OD3H 3OKLB 1CDIA 4PBWD 1A4KA 2D31B 1CFQA 5E2TH 2P7TA 1RIVL 5GS0L 4PP1D 4OB5L 4GAYB 4YHIA 5ENWA 3M07A 5TF1H 4A6YH 3BPCA 1U9KA 3LMJL 1MHCB 1P5UA 4YC2B 4UQ2B 5E1HB 2JIXD 4PRDB 4M6NH 4YDKH 3HI5L 5K33A 4RSVA 4J23A 2JF1A 4JQVC 2V9QA 3GMRA 1CL7H 4L1HA 5B4MD 5B8CB 5DC9B 3HE7C 4NZUH 3LEYL 1JFQL 4UDTA 5E56A 1R5IA 4P9HH 2AK4D 1G9MC 1CFSA 4OLZH 4H25A 4QNPE 4G7YH 5GGSB 2F9BT 5GSVB 5CZKA 3DNKA 2FWOB 3PNWA 5L8JB 3TIEB 1KCSL 1FPTH 5KZCD 4KMTH 2BRQA 1JZ3A 4UOW1 2DQHH 1OCWL 3UPCA 1OM3H 3W2DH 3BZFB 4K07A 2JJWA 4JQIH 5KTEL 2ZCHL 2XN9A 3HE7B 2VR9A 4MNGE 2H26A 2K3TA 5FHAH 1L9MA 1NGWB 4K9EH 1ZGLP 3VXRB 2PO6D 5H2BB 1RZGB 4UB0L 4XNYL 1MCBA 2BZDA 2KDGA 3OMZA 4TOYH 3BGFC 4L3ED 1XGTB 3VFRA 1GC1L 3CZFB 3DGCR 3PHSA 3G5XA 3U48A 2OYPA 2G75B 5LBSL 1RZKC 3QEGH 4F80A 4LSVL 4QXGH 1N5AB 4TSBH 1S7QB 1OB1A 3IYLW 3UP1A 3OR7A 2WWKO 1QSEB 4OZGA 1CTOA 5I9QC 5L2KA 1SYSB 4Q74A 3AMLA 4OF3A 5JZ7C 3RTQC 2GJ6D 4OFYA 1REIA 3QIBA 1DBML 2WV3A 5IQ9A 3BKCH 1KIRA 43C9A 2GT9A 3GIZH 5T3ZL 2P1YA 1WIUA 1U8NA 1DLFL 1BFOA 2P49B 3D0VB 1MF2L 4L4VA 4NUGH 5IMOA 2Z31A 4I48A 4MB5A 3RWJB 4HZAA 1XF2A 3JWNC 1RIUH 3QEQE 5I9QB 1JF5A 1OPGH 2P5EB 4LCCC 4BSWB 1QRNE 1BZ7A 2AEPL 4ORGB 1KJ2B 5KANI 3NH7L 3A6BL 1ZGLM 4G8IB 4S10A 1MY7A 3BH9B 1MCWM 4BYHA 1QSFD 5EFIA 4ENEC 5IWLA 4M7JL 2EIDA 3OKKA 2MCPH 4M5YL 5CD5C 4XX1G 4HH9B 4OGXL 3CLFH 4XPTL 4PB0L 4XMPL 3X14A 4NO0B 4YFDB 2GQHA 4PY7B 1JZ8A 3G5YA 5EU5B 2FLRT 5L8LB 4U1JB 3MV9A 3TBTA 5D7IA 4ZUUB 3PWJA 3P73B 3K2MC 5DJCB 3HNSL 4PJHA 1FIGL 4LCCB 2C3WA 4AEHL 3PWUB 5AYUL 2ITCB 1I7RB 1ORQA 1F2QA 3WS6A 1IT9L 4ELMB 3L95A 3QWQB 4QOKA 1CTNA 1Q0XH 4DWHA 2IJ0C 5HDBE 1T89C 5E5MB 1VGEH 2IF7A 2X4SA 2DTML 4YO0A 4F33A 5IBUG 4RRPA 5CSBA 1R3KB 5DI8A 1BLNB 1CYGA 1NFIB 5IHUH 3MGTA 1T83C 4Y4FA 1Z3GH 1DQTA 3ULVL 4KRMB 1G7HB 5LGJB 3HTLX 4XVSL 4NQVA 4Z0XB 3GGWB 3P9MA 5F9OH 3U0PB 1P2CB 5ERWA 3O2VH 1PX4A 3SKOA 3JUZA 4OLWL 4FQHB 4P59L 3N85H 5DEFA 1W72B 2YR3A 1FE8H 3THML 4Z7WA 4YDVA 1YYMH 1KLFA 2W60A 3T3PF 4BH8B 1FH5L 4S1DD 4KAQL 1QPXA 4DGVH 3AREB 1HYSD 2WUBH 4PJIB 1BBDH 4GG8B 1AGEA 5GGRB 2BHUA 1J1XH 3N9GL 3RWFB 4HUVB 1P7KB 1T3FB 5DQ9B 4F3FA 1QYGL 2F74B 3FQTA 2C4FT 5DFVC 2ZSVB 3KPOB 2C1OA 1PBYA 1UM5L 1GCFA 2BNQE 3IB4A 3OB0K 1XGYL 5GGSY 3ZT6A 2JJTA 4HMEA 5HGHA 1A1NA 4JFXB 4XP5H 5GZOC 3VFMA 3P30L 2BVEA 5DK0B 4P4KD 3GMMB 3HZYB 3NZ8A 1IAMA 1L7TH 1SBBA 5D1ZB 3BIAX 1T22A 2B0SH 1QFPA 2HVKA 4N0UA 2H2PD 3EKCA 3ZKQD 2CUMA 1KCUH 3HB3C 1KIQA 5DSCB 3SQBA 1EFXA 1DZBA 3ZL4L 3SY0B 3DJ9A 1SVZA 3V0WL 2RFXA 4CVZA 4IMKC 4S1SH 4OTXH 2OSLA 4U6VH 5C08E 4AMKL 5T3ZD 4XH2A 4Q9QL 3QRGL 1UB6B 2MHAB 1RJYB 2XTLA 3QISA 4PLOB 5E2VH 3FOMA 3HRPA 1ZSDA 5E2UH 4OD2B 2E7LC 2ENYA 3NMEA 1ZWIA 3LKPA 3OHXA 3WFHB 3EDJA 2E3VA 5IB2A 3DI2B 3BW9A 5TGBA 3MV11 2UVEA 1VGKA 1MI5B 2LVEA 2D03L 5CJQL 2DBLL 4GSDL 3HUJF 5I1KH 2VDRL 4WDIA 2PYEE 2W0FA 3VXSE 4MGXA 5EZOL 1G6RA 1MQ8A 2HT3D 5L6YH 4LSPH 4PJEA 5E1AA 2CXGA 4AENB 2A6IA 4PRID 2BVPB 4XRCB 1EHXA 1K4DB 1DUYB 1JVKA 4QXUH 4XP9L 4ONFH 3BP4B 4Y19D 1KTLA 3HFML 3OKMB 5FUOL 1UWXK 1FO0B 3S7GA 3WFDH 2Q7NA 3D2UA 3REWA 5D1XB 3MRFB 3GK8H 4ZXBC 5E8DH 3O6FD 4AJ0A 5IBLD 1INEL 1DBJH 2ZCKL 2A38A 1A2YB 4FFZH 3SDCC 4G3YH 4ZPVA 1AD0B 1WQVT 4A6YA 4FQXD 5I19L 5DZOA 4PLJC 4B5EA 4LKCB 1INQB 1NSNL 3QHZH 5GGVY 1WZ1L 3FB5B 5MEND 1BGXL 1JNHA 2X2YA 5BJTA 3QEHA 1EJOL 3EOAB 2E9IA 3B5TA 2IPTL 1D5XB 4IOFD 4LLQA 2V7HB 5GGTL 2B8OT 3S34L 1AXTL 5LCVH 4PJ7B 3UC0H 3FFDA 3VXRE 1ZVSA 2D7PA 1EHLH 4N5ED 4G7VH 2COQA 3RGVB 3U7YH 3FQWB 3SDCB 2DIBA 2P47B 1IILE 2W65A 4HIHA 5CLWA 2VDPL 5IJKA 3PABB 4YBQC 1FZKB 2DWEB 5GRVK 4KTDL 1AD9B 2HA1A 5LAXA 3VFWA 4J3VA 1LO0L 4LLDB 3JSSA 4ODUA 4C4KO 4YGAB 2BC4B 3Q6GH 5GS1A 2IAND 4D9RE 4Y1AB 3QQ3B 1QSEE 3VGEA 2WM0A 3ZHKA 4PRHD 5EOQH 1AI1H 3F7PC 1KB9J 3L3HB 5CCKL 2BFVH 3RZCA 3IJYA 3TO2A 1FG9C 1LO4L 3L3GA 3RHWK 1CXEA 1MJJB 4TTGA 2ERJC 1I3RA 4Y4KD 5KOMC 3B2UC 2ATPA 1KPUB 3MV7A 4JPKL 3RPIB 4EIZC 5GGRY 3CFCL 5I8EB 4JDTL 1G7JA 2VXSH 3TJEH 3C6LC 1AGCA 2YPKB 5HBBA 1MPAL 5FF6A 4NRYB 2P5EE 3UX9B 4FP8H 3B8SA 4KJPC 5D71H 4O2FA 3SE3A 5I0ZA 1ZA6A 3MFFB 4EDXA 2SEBB 1DQLL 3OJ2C 1GGYA 2J7LA 3PDOA 3VJ6A 5K9JL 3U4AA 1T5XB 4XBEL 1T2XA 5H94A 1A7NL 1KJ2H 1QR1A 2V9TA 3C6LB 3Q3GA 5L88L 3EUUA 3AU1B 3IFOB 3K46A 1CDJA 4MA3B 2DYPD 2LAAA 1I7UA 1N4XH 3AC0A 3JTSA 5IROC 4G8EA 5D6DC 2V7NA 2Y9RT 1A3QA 2C4XA 5BV7C 3B3IA 4ELME 1X5FA 4YXLL 2NY7L 3QZWA 5T3XL 2GIYA 3QYCA 1JGUH 1N59A 3S96A 3H9HA 1QRNA 4JHBA 2L4OA 1RI8A 4LHJB 3VRIB 5CEZH 4WI3A 1N3NA 2HLAB 3NFSL 1FNHA 5JA9A 1X5AA 2APVA 2P8PA 3T65B 4JANB 4EN3D 3VI3E 3PL6D 5FV2A 1BAFL 5T5FL 2BNUB 3ARSA 2R0KH 5GRVL 4H20L 4H0HB 2CKBB 1MAMH 1AHWC 3UYPA 2FBJH 5BV7B 1NUGA 2BOBA 3T0ED 1VESA 2Q8BL 4XCCH 3UPAA 5BZDA 5KG9B 3KPQB 1KPVB 4EXKA 1QFWM 3C60C 4O5LH 5HD8C 2BP3A 3PGDB 5FKPB 5I18L 4ZFZA 3NPSC 5CBAB 4M8VA 3MCLL 3CPLB 1VENA 2ATKA 4UV4L 3PWPD 4RDQG 4NQED 3VFOA 3GO1L 3VI4E 3FTGA 1U95A 4PJIE 1QFHA 1W72H 1JGDA 1MJ8L 5B38B 3I6KB 4A2MA 1B3JA 2X40A 1OAZH 3GMLA 5CD3A 1AHWB 2XXMB 5DJZA 3CCHB 3UDWA 1KG0B 1YEDA 3EDDA 5IEHB 3U36A 2AJUH 1DANT 4TSCL 3C60B 3T0WA 2BCKA 1Z9LA 2E9JA 2VOTA 4EBQH 2YPVH 3BUYB 4EZMA 3BZEA 3NPSB 5FA4A 4QXTA 3QUXC 3UTQB 2X7LB 3RDTD 1JGVL 1KENH 5CFHA 5HDQL 3RVWD 5C9KA 4X5WA 3SCMA 5ABDE 5C1MB 1A22B 5I8CA 1BZ9B 3SDXB 1IGYB 2DQDH 2PXYD 4EUPG 2XIDA 5DJAA 2FIRT 3C09B 3DVIA 3PHOA 1SJEB 1V5JA 4XVUD 4WENB 1FFRA 3G6DL 1U8MA 2R9HD 4HC1H 4IMLA 1DQMH 2P45B 4LIQL 4FQLL 4NDMA 4PJBB 3SGDI 5CGYD 5FYJL 5C0FA 1AGFA 3QI9D 5FM5M 5EORL 3RA7L 5KSVB 1BX2B 2ZCLH 2D2OA 1MI5E 3LHPH 1NCAL 5IW1A 5IF0A 5GRUH 5EB9A 1CGVA 1KFAH 2DJUA 4X9IA 2VJXA 4NT6B 1JWMA 5DJYB 4C83B 2RQ8A 5IM7B 3IDUA 4PGZA 2ZG3A 3BWUC 2R1WA 5CZXC 4OIBA 2O5ZL 1Z0NA 2A77H 4AEIH 3S35X 1TFHA 4WGWB 3N1MC 1RAMA 1B0GA 2A6JB 3KXFB 2BSTA 5A16B 4KUCD 1OY3B 5C08A 4U1LA 3FZUC 3RUGF 1CT8A 5FO8B 4L29B 5DVLA 1VFUA 2IALB 5F7FA 4PJ5A 3X17A 5JNYB 3F12A 1X6NA 4I0PD 1U8IB 5T3XD 3DETC 2AXJA 4GQ9H 3QXUA 4M62L 3BE1L 4ODWB 4HGWA 3MACL 2P24A 4BFIB 3I6GA 3IDIA 2QQLL 3SPVA 1KCRL 5I76A 4JVPA 4Y2DA 3KLAB 4I3SL 2PYFA 4I3RH 3FRUA 4HUUB 1ONQA 3BPOC 3LN4B 4NCC2 2RBLA 4N1CA 3U1SL 3VXSA 2IMMA 3MXVL 2W9DL 1IKFH 5TQ0L 2AJXH 1B6UA 3CSYA 3GSXA 1XGUB 1HOCB 4Z8FL 4JREC 3OKLA 4MDJB 2D31A 1KB5L 4XWOD 4Z5RA 4OF0A 2BVOA 4PJ7E 2EKSB 4H88L 1YNTA 4UQ2A 3VXUB 5KSBA 4ZDHB 3HZKB 2QR0B 3B9KC 4IHOA 4D0BB 2HLFC 5B8CA 2AJYH 4X7CC 2A73B 4G43A 1HHJA 2Z8RA 3CFDB 2VDML 2Y7QB 4NYLB 1KC5L 4G5ZL 5A2FA 4I8DA 5GSVA 2Z92A 5F3HA 2OL3L 4HJGA 2NY1D 2FWOA 1N0XL 4Y1AE 3BKYH 1FRGH 3LIZL 1U8LA 4XX1E 4LVHC 5TH2B 5DA0B 3PGCA 2I26N 2O93L 4EKXA 2VB5A 3S35L 3NIFF 1R3LB 2AKRB 2L7UA 5L8KB 4XPFL 1CE1H 5I1LA 1KSRA 1YY9C 3HE7A 1D3CA 5TDOB 3ULUL 4HEME 1RZGA 4MSWB 1M7DA 1C16A 5DF0A 3DX8B 1XGTA 4M7KL 2VDKH 2GW5A 2WANA 5JPNB 1MCLA 3IAPA 4OCSH 3GSRB 3ILQC 3MRNB 4ZTPH 4GXVH 3LKQB 4JCLA 3D9AH 2EH7L 4LASL 4LHUA 1M7XA 3KPRA 3SO3C 4P3CL 3IKCA 4LVHB 2Q1EA 5FYKE 1MCPL 3OAUL 5KVMC 5KVDH 1OTSD 4M43L 3TWCL 4HMCA 4IIQC 3C6SB 3GSUB 1IAKA 3R8BB 4HQQH 3CVHL 1TJGL 2GJZA 5JXAH 4MMZC 1QSEA 5F1NB 1MFDH 3VW3H 1RMFH 3C5ZA 4LAQH 1V7ML 1FL3A 5EO1A 1QG3A 5F7UA 4MA1C 5CZVL 2CRMA 4XNUH 1G7PB 4XCEB 4JM4H 3GB7B 4C55A 3SO3B 5BMFL 5C70A 1NGQH 5JIKA 3SDAA 4CVXB 4XC1H 4XC3L 4PTUB 4ZODA 4KK6C 1J1PL 3CLEH 4IIQB 4KROC 1DQDL 4Z18A 3VWKA 3C9NB 4K3DH 3CK0L 2Q86B 3D0VA 3T2NL 3FB7A 5IB5B 2ENSA 3DLQR 1CICC 4OD1L 4I5BA 4WJ5B 5GS2D 4MA1B 3S3SA 1TMCB 5GISH 4S1RL 4MDIB 1KJ2A 4KXZH 2FGZA 1LO2L 1PW3A 3CUPA 3ULSA 2NY5C 3A0OA 3BAEL 5E94B 4KROB 3QO0A 4XB7A 1E4WH 4PY7A 5EU5A 5J3HC 3BT2H 4W4NA 1FDLL 2ORBH 4PJCF 2FBOJ 1S7VB 3P73A 2JB5H 3CFJA 5DJCA 2DICA 3QPXL 1MLCB 7CGTA 5AG8A 1FYHB 2NPLX 4FQPA 2AABH 3PWUA 5LXGH 1FNEA 1I7RA 5IEKB 1YY8B 2CKBH 2MJWA 4ELMA 1ZVHA 4ODSL 1F90L 4TNWK 2CLVA 5BZWB 3MLUH 1EHNA 1EVTC 3EIFA 5EOCJ 3H42L 5ILTL 3WN5A 4P5TC 3O6ML 2YK1H 2AGJH 3ROLA 2A2QT 2DMKA 4FXKB 1KNOA 2W9LA 1JN6B 1PQZA 4NZJA 1OTUC 2Y23A 5GRZA 4DUXA 1MFEL 5IT2H 4O2CB 1NKOA 1G7HA 1WC7B 2KQMA 4CU7A 4M3KB 1NLDL 3U0PA 3C8DA 3LQAC 4FQHA 4D9LL 1W72A 2GSIA 4X80L 2NZIA 5EU6B 4F7MB 4L4TD 3BXNB 3EO0B 2AXHA 5I1JL 3PUCA 5MEQB 5D8JH 5BS0B 3GNML 4X6EB 4BH8A 4ZFGH 4L3AA 4RFOH 4OM1L 1J1OL 5AZEL 3SDXE 2GTZB 4W6WB 4KDTA 4JO3H 3AREA 1CFTB 4XNXH 4PJIA 1IQDA 1K9TA 4HUVA 4KJYA 1P7KA 5DJ2B 15C8L 2CD0A 4YPGA 4KK8D 3BQUB 4PJBE 1V7NL 3IAGC 3KPOA 4J6RH 3A6CL 1CK0H 1YJDC 3OAYH 2IEPA 4X6DB 1JWSB 2DQGH 4NKIH 2IWGA 4HF5H 5JPMB 4XI5C 2Y5TB 1RUPL 1CF8H 2PETA 4MB3A 4JFEB 4JFXA 4OZFG 3QUMB 3ZE1E 2VERN 5DK0A 2IFGA 3GMMA 1EMTH 3HZYA 1H3VA 2X4RB 2FEEI 5T33H 4HC1A 4D9QE 5D1ZA 3WO4C 4KK9C 3MOBH 2FO4B 1H9VA 3HN3A 4P99A 1IEBB 5JLZB 3ARBC 5JUEH 3GI8L 5DSCA 2VABB 4OSUH 2Z8SA 3SY0A 1YEGH 1NFDB 1FSKC 1OAQL 5EH1A 3KXFE 4N8CL 3V4VH 2A9NL 2EC9U 4EOWL 4W70A 1UB6A 1S7XA 2JKXA 1RJYA 2MHAA 1IL1A 4P2RD 5FOBB 1J5OH 2BVQB 1TJHH 4R2GD 3VXQB 2N4IA 3BEVB 4LCWB 3BOVA 2PW2B 4ZO7A 4MD5B 2FJHB 4M1GH 3FO2A 3JWDL 4G9FD 3ARBB 4WHTB 3SGEI 3H6JA 4MNQB 1T1XB 4R96B 3ARPA 2R0ZH 1U42A 4LSTL 4MQ7B 3W11D 1FSKB 4H0GA 3BWAB 3DRTA 1Q9LA 2X10A 2OI9C 1S5IH 1YEKH 2M8XA 1X7QB 4U1NB 1TTFA 4MCZB 1HQRB 5HHXH 4AENA 1D5MA 5F72S 2FX9H 2BVPA 1CL7I 1K4DA 4JG0H 2A74B 5J6HB 2CUIA 3BRFA 3VXUE 3OKMA 1U6AH 4HV8A 3V4UH 3LD8C 5J06A 5EOCH 3G08A 5DTFA 5D1XA