2B59A

The type ii cohesin dockerin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG1196: Chromosome segregation ATPases
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/structural protein
total genus 33
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2b59A00
2JH2A 3F2LA 2VN5A 2VO8A 4N2OA 4IU3A 2XDHA 3BWZA 2O4EA 2CCLA 4DH2A 2VN6A 2W1NA 3FNKA 4FL4B 4UYPA 2B59A 2BM3A 4WKZB 1AOHA 4FL4C 3KCPB 1ANUA 1QZNA 1G1KA 5K39A 3KCPA 3GHPA 4UMSA 3L8QA 4UYQA 4IU2A 5AOZA 5G5DA 5LXVA 1TYJA 1ZV9A 4WI0A 2Y3NA 4U3SA 3UL4A 2OZNA 1OHZA 2ZF9A
chains in the Genus database with same CATH superfamily
4KHXH 3T2LA 2ATKB 1Y1UA 5LNGA 4GW1B 5KYWA 2B3IA 2OMZB 3NN8B 2HTKC 2VIRA 3LKRB 4JRFA 1JGDA 3C6EA 3DOSB 3ABLB 2DMKA 8FABB 1YC8A 1AI1H 5DURD 4P23A 1YMMB 4KJPC 2BC4B 4LNRB 4L37A 3D9AH 4NENB 3UZVA 3A6CL 5CJ5A 3QYNA 1URIA 1RL1A 2Y22A 4W9HC 2X9XA 2G5RA 1TETL 1Z3RA 3ECBA 4IOSA 3VD4A 1CFVH 2Y7SA 4GG8A 2X9YA 2EIZB 4YC2C 1OF2A 2OW7A 4AE0A 4HKZB 2R8SL 4HSQA 3VRLF 3BPOB 3F64A 1E28B 1WZKA 1WITA 3FYEB 1G9MC 3QEQB 5FOBB 5KEZA 1IC4H 4QRTA 1FVDA 5DGQA 1UQSB 1W6WA 4KZ0A 1IAIM 1VF5C 2ZYIA 5DFVC 1T6VN 4HAGA 5LXGH 3GMLB 2J6EH 4NNYA 1JV5A 5LO7A 5C9JA 1W91A 4HWBA 5CF3A 4U1JB 2K7QA 4OFQA 3GMPB 4FNLH 1MQKL 1CPUA 1G1YA 1KGWA 5B21A 5I18L 4BKTC 3F62A 3W57A 5I0WA 3BPLC 3WTUA 3CSYA 2F5BH 4HUWB 4NN6B 5HI4C 4KQ4H 5IJKA 4WY7H 1MCRA 1KCBA 4ECNA 3DMMC 1S7RB 5AZUA 3SPGA 1MFDL 5CZVL 1UH4A 3BC9A 3WAJA 1N0XL 2RALA 5FYJH 2ZOKA 5AAWC 5FF6B 2BOLA 1KC5H 2VN3A 3FMGH 3LVEA 3VI4F 3ABZA 1HHJA 3NJLA 4RLDA 1E2WA 4IU3B 4WFGE 3CN4A 4JG9A 4KMLB 5FS5A 2QADD 4WUUE 3F6JA 3DX1A 4AKQA 1M56B 2ADGB 2P80D 2Q9OA 4I0CC 3NIFB 1JXDA 2ENQA 2G5UA 3EYVA 3JWOH 4XVSL 4CSTA 1JI2A 4FNTA 3BVXA 5C08E 3WKML 1THCA 4X8XA 4PTTA 4TUOB 5B4MC 2AZUA 4G7VL 3ZRCC 4NDMB 2Q87A 3NCEB 2X38A 3S4SA 1M9SA 1EHAA 5D8JH 3M6DA 3BEWB 3L2MA 4DW2H 4YBQC 3AUWB 4XTRC 4JFDD 4MDRA 3C6SB 4FTVB 3HNSL 4KJQC 1OGAD 1ZCRA 1FWXA 1IAMA 3AUVA 3BCDA 1X5GA 3TIDB 4KKCC 1CD0A 3U30C 3UYPA 1INQB 2EVGA 2XBZA 1FCGA 3QDAA 1NUFA 3TNMA 3NAAL 4X6EA 1YQVH 1NANI 1VHPA 4YSAA 5F9WB 2J1ZA 3B8SA 2VC2H 3L5WA 1I9RH 2ITDA 1Z1WA 4G8GB 2Q20A 2WXLA 3QH3A 3IMSA 3D25B 1DYZA 5KJRH 3II2A 1U93A 2CNYA 3EW3B 3DGGA 2V9UA 3AQDA 3HBPA 4PJAB 3A4EA 1KTKE 3K7UA 5C70A 1P0SE 5IOPB 2WWKT 3DBXA 4LXFA 3WNKA 1BZQK 4HAFA 4ZOAA 1IM3D 3DX7A 1N3NA 4HULB 3HA0A 2FT7A 1G4RA 4YXLL 4OM0L 3MLVH 3HZYB 3QHFH 1TQBB 4JM2F 5E6ZA 4UTBH 2XG4B 5L6YL 5E8EB 1MAMH 3T0AA 5J8OA 3EUDA 4Y4KD 4ABVA 3U6RA 3EBAA 4PB0H 3D08A 3RWEA 3ILPA 3ULUF 5DMKB 4IBWA 4FQQB 4NKQB 1RPUA 1CDHA 2DIJA 5HHME 4PU2A 2EICA 2ZNXA 3NZUA 5DD0L 5HGBB 4L8BB 3UCQA 4XP4L 2GITA 5E5LA 5I5IA 2J57A 5C86A 1S46A 3CHSA 2P80A 4H2CA 5GZND 3OHXB 2K6WA 3CN3A 3TT1L 1WIUA 1KCVH 1G9ML 4EI6A 4Y5VC 1BP3B 2WTOA 3KWWB 1T4WA 4ONHA 2RAMA 1GS8A 2OSLA 4JFEB 4AH2B 3M7FB 4U6HB 3TO2B 3B2MA 5IJDC 4IRJC 2ROXA 2VQ1B 3RBGA 2P47B 4ZJ9A 2X0WA 3NZHL 3RZWA 4IBQA 2OMNA 2DTMH 3R4DA 4NQXB 3OB8A 3S3PA 1FNSL 4JFDA 5DYOA 1S9YB 2A73B 2EIKB 1EO8H 3FB8B 5LUMA 3BMVA 3O45B 1OGAA 2XQBL 3QDME 3S5LG 2R2BB 1F58H 4JRXB 4D0CB 2HKFH 1KPRB 1N5AA 4LPVA 1OM3H 3TBVA 4NWUL 4ZMLA 1R3KB 5E00B 4I5BB 1KYFA 2HKHH 4RRPA 3FT9A 3RJQB 1FQ9C 5AB9A 1MG2C 1WQVT 4NQDD 3GM8A 3RIFK 3MYZA 3US9A 2J6EA 3T2NH 1IQWH 1MI5D 3AREC 3LZRA 1SHMA 1F00I 3VFUA 5HP5A 1RZ8A 4HIIA 4R84A 1E7VA 3LZQA 4HFUL 4KROC 1M57B 4QRSB 4PRPB 4HCFA 1VRSA 1AZCA 2UUDK 3SYOA 1WAPA 5IQNA 1XT5A 4ENEC 3B6SA 2WP3T 2YAQA 3P9LA 3AVEA 5IVXE 4JE4B 4YSPA 4QXTB 2BIHA 4TYUA 2XXFA 3BAKA 3OLGA 3ZE1F 3QK0A 1E6OL 3IF1A 4FKEA 3RRQA 2CIKB 4HX1B 5JXED 4ZO9A 4FMKA 3U4KA 3QCUH 3WGUB 4Y4KA 2CUHA 4MHHG 1LE9B 4YAQA 1NAMB 4GRWF 2CGRH 1GSMA 3WO4B 2HVKB 3HEIB 3MLXH 1WBXA 5DDHB 3CUPA 4B9KC 2CLZB 3SDDD 5BUPA 1M7XA 2QDVA 2Y2YA 3TCLA 3S8GB 4QHKI 1CDGA 4BZ2A 5GZNA 1KTRL 2DI9A 1NFIA 5AOMA 4E9QA 2Z1KA 3P40A 4NYLB 1RK7A 5AKTA 2QQKL 1BBJB 3EAKA 1OGTB 3PAUA 3OJ2C 4JCWA 3FPXA 4LO9A 7FABH 2W59A 1KTLB 4X4ZA 1UWXH 3H3PH 2XWCA 1OE3A 3BQUC 4HSAC 3ZU8A 4GQPH 2VDQH 5FDYA 3WY2A 5IR1B 5E8DH 4FADA 5IIEA 3GK8L 5E2VL 3SDCD 5HHOB 1IAIH 1K5WA 1WGVA 4JPIA 5KANG 3QPKA 1OAJA 3MRGA 5F7WC 5C0BB 3UPRA 2V5RA 5C0AE 4MGXA 4F58L 2WQSA 2BNRD 4DVBA 1OHZA 3MQIA 4M5ZL 1A1OB 3WCYA 2X4UB 1II4E 4JDTL 3TTSA 4FQLH 4M7LL 5DTFA 3ASNB 4FQIH 4UOW1 3I84A 4NQDA 2DOCA 1AXSA 4F5CA 2HVJA 4NB7A 1FFPA 1MI5A 2BVQB 3RPIB 4PWEA 5C0RH 1F6LL 3FZUD 4L18A 1QFWL 1ASQA 4NHUA 4LPTA 1KTJA 1IBHA 1XEDA 5CEYB 4M93C 2DLFH 5I1AA 3SQBB 4M6NH 1A3LL 4K5NA 3EDKA 5B38A 3KBEA 3T0DA 3LSOA 1A22B 1R3JA 1D5BA 4TOYL 2PW1B 3CIAA 3L95B 4PS4L 1RZFH 4UQIM 3HLAB 2OL3L 4UTBA 3IN2A 3NJHA 5GGVY 1M3JA 2YD2A 1QTSA 4EJ1C 5JXEA 5HGHB 1I7UB 4HMCA 1QPXA 4FJYA 1HHHB 2E47A 4P2RE 2H6PB 4M9PA 4HOXA 3ZR5A 3QGVA 2J8UB 4J3SA 2BCKA 3FQNB 5J9PA 5E08L 4E0RA 1HHKB 3PWVA 4AZUA 1KEGL 4CC4A 3WTTA 4PRIE 2EH7L 4QJ5B 3GIZL 4NRZB 2AJSH 4LLMB 1HQ4A 4B9IA 2E46A 3MBWA 2GSIA 1EEZB 3DRTB 1BQSA 3C5ZB 1URLA 2ZE0A 3HG3A 1XGTB 1H8LA 3QXAB 1EJOH 1MHCB 3FOLA 2YUVA 4XCCH 4DVRH 1YNTB 3EYFA 4ZUVB 5IY5B 1IE4A 3CSGA 5H37G 2E6JA 2DQDH 3L3JA 3VD3A 3FFCE 4Y19D 3M17B 4DN4L 3MBEB 3O41A 2PP7A 2VAAB 3QWNA 4KZDH 2IPKA 3SDCA 3ZUNC 4LDCA 3QVAA 3ULVE 3K71A 1DANU 1UUSA 1QR1A 1B3IA 5I8OH 2DWTA 2APFA 3B7TA 3CDFA 3ULUH 5K9KB 4PJCE 4L3FA 4KITB 1N18A 2VR7A 1JZHA 3NP4A 4UT9H 4K73A 1RURH 1KBKA 2BNRA 2HJFA 3TZVD 2GUYA 4MQTB 4WWPA 2B77A 5AWNL 2B9AA 3NSXA 4I3RH 1CGXA 3K1KC 2QGDA 2UY6B 3ZDYE 2CDFA 4KNUA 3TXAA 5ECGA 1GZPB 3STZA 2WIMA 3CTTA 43CAB 5DJAB 3MV8B 2QR0B 2AABH 4HJIA 3RX8A 4NN5C 5F9JA 3QI9B 5T1KD 3U2JA 2XTJB 3SE8L 3X2QB 4JFYA 3LRSA 4P4RA 3VSVA 3F2LA 4XAWH 4CKVX 4AG4H 4R2GC 4GW5B 4JFXB 3V5HA 2H1LM 1GGUA 3VXRB 2CK2A 1V05A 3R8QA 1Q94A 1TQCB 2PXYC 2WUCH 3E80A 3IK2A 3UTZA 4Z7WB 3RVUC 3A23A 3DECA 3GHBL 3IKKA 3IN0A 4P5TC 1N68A 4AXWB 5J1AB 2CO4A 4FERA 2H2PC 3GGWB 3WNNA 2DJMA 4PVNA 5ADOH 3S0PA 1NCOA 4PJ9B 4E9SA 4HV8A 1KIUB 3VVWA 3I9GL 2GJ6B 1DJSA 3B1TA 5GISL 4B50A 3LPOA 2IXQB 3W37A 4R26L 5HDBE 4L48A 2WLIA 4UOQA 2WO3B 3VFWB 5CFHA 1U9KA 3G5XB 4V11A 4MA7H 1XGYL 4PWFA 2WINB 3QNZA 4JM2D 4PG9B 2C3XA 4NNPH 1IIKA 3FUIA 4XMWA 4XC1H 4Y19A 4ZODA 3MRQA 3FW6A 1N2RB 1T0NA 1FAKT 3ULUD 1L0YA 4GAYB 3QUYB 1J1PL 2EXTA 1RIHL 3VI4A 5JNYB 1IGFL 4OIAA 4KDTC 5IB4A 1BGXL 2P8MB 5EZJB 2QSTA 3G6DL 3QPXL 3TZVA 1NGQH 4WGWB 5E5UB 2UZXA 5C09D 1CLYH 1A6UL 1NFDE 4U6VH 3I74A 3IJYA 4I0PB 2Z0BA 3VX1A 4S2SA 4OT1L 4HLZH 2QFRA 2HG5A 2WLJA 2XV2A 3KPNB 3CWGA 3BUBA 5F8QC 2AV1A 3RWCB 1A7NH 1QRNE 2AMUA 1S9VA 4NZUL 1P6FA 5T1KA 4LMQI 3B9AA 5AYTA 3BVTA 5E1QA 4DQOH 1NSNH 3NRQA 1H9VA 2YD4A 2AJZB 2NTSP 5ABZA 3FHQA 4X7SL 1GZQB 3RIFF 3L3GA 1CIUA 1E3XA 2E8ZA 5SX4I 5DJ0B 5H8DA 3OPZH 4OF6A 4CVUA 4XZUA 1USZA 3EHBB 2B4CH 2OMVB 1T83C 3N2JA 1PFCA 1PY4A 1W72B 3O0LA 1D6EB 2BOBA 3RX5A 3V55A 4M1GL 2HPTA 1YMME 2NT0A 5TPWH 2JCWA 1ES0B 5J6HA 2JKRM 2VW4A 2Y5QA 4OGXL 1G7HA 1NLBH 1KWKA 1N59A 2W0LA 4Y16B 1CCZA 3K6SA 4Q9RL 2VDPB 2F15A 4A6YB 1FL3A 3R0NA 1JHKH 3CN0A 1UM6H 3RP1A 2OMWB 4FXKB 1WBZB 2KLTA 5I8EB 2GJZB 1VGKA 3NACL 3N06B 5DJXB 4MQSB 1R34A 5EBWB 1XF5B 3SQOH 2YEZA 1J5CA 2AF2A 2H9GA 4X4YB 1LNUA 5I6LA 3C5SA 2XWTB 5JHDB 2X4TA 5EO0B 4JM2A 3OC8A 2FEEL 3HG1D 4O02A 5E9NA 4IHBA 3KLQA 4JQVA 4LIQE 2AQ2A 3FB7A 2FO8A 4YE4L 3KXFD 2EVHA 2YXVA 1UJ3C 1YYMH 4R3SA 3P77A 1JGDB 1IGTA 4DN3L 4FABL 3EOTL 4UT9A 4X6DB 4JM4L 4DFHA 3RJDA 4AGLA 3BKML 2DM7A 5F0LB 1DE4B 1KPVB 4L37B 3MJ8A 5C09A 2GHZA 4LK4A 4YFDB 3UZVB 4HWEL 4A63A 2MPAL 3OWEA 3VFGH 3FU5A 2PLTA 3DX4A 4PFEA 2F68X 3GPSA 3ECBB 4LT7A 1HOEA 4UUJA 2GEQA 4GG8B 3VYOA 3GF8A 2RQEA 4UOJA 2KPNA 1UOVA 4YDLB 2IG2H 1X5JA 4WEUD 1HE7A 3IDYB 2P28B 4HUVA 4J3BA 3CFDA 3H42L 4GXVL 3NCJL 1KV3A 2DLIA 3VXOB 4B7IA 4NNXB 5FYJU 4WI7A 3NIFE 1CO1A 4NKIL 5JIPA 2J8OA 4NNYB 4ZTPH 4RAHA 5I74C 5EF1A 5CN2A 1LO5B 1NC4D 1PYWB 3V0HA 4R83A 4OLYH 1LGVA 2ZX9A 1KCUH 1HYRC 4M6OL 5CJOH 2RMNA 1IKFL 3A5VA 4ZAKC 2WNXA 3L1FA 4N2AA 4X6FA 5A2JH 1R1CA 2QKIA 5HJGA 4XPGH 3SBWC 4ZX4A 4WAFA 2AJYH 5F3BA 4FTVE 4LRIC 4FHJA 2IH3A 3K6DA 1A1NA 2R69A 4HCRH 4J8RB 3F7KA 1CE6B 1IT9H 4XOCA 5IMKA 5FDWB 3QDJD 2FVNA 1RV6X 4WTWA 4MAZA 1NCBH 4FFYL 3GKWL 3Q5TA 5AYUL 1YAZA 1U95A 2D4DA 3OWRA 4GMSL 4TRPL 1TJHH 4EXKA 5IQ9B 4KH2A 1DL7H 5LLIC 3GB7A 3HG1A 3LV3A 4G8GE 4JJ5A 1PIGA 4AEIH 3EYVB 2I9LB 2WXRA 1N26A 5DUML 1MSPA 3MRJB 5E99L 1QG3A 1JSYA 3KXFA 1FRGH 2CO7B 2ORBH 2FGWL 2FX9H 2XWEA 3OGOE 3D07A 4S1QH 4ERSL 3TYFA 4O2FB 4PJAE 1SQMA 4X8JA 3HBZA 3WS3A 2EE0A 4MXQD 4G6JL 4LLQA 3CFBA 3GUTA 3LHPL 1KXVC 3QORB 3VQ2C 4LLUB 4UM9D 1AGFA 2X87A 3OAYK 1Q1JH 1BZ9B 2YZ1A 3GBML 3HC4H 3MRBA 2NY6D 1VERA 2AHIA 1GGCH 3FO9B 5HJBA 2YXMA 3BD5A 4W9GC 5F1OB 3UYPB 3L7EA 1E30A 1K2DA 4BUHA 1QLEB 4A2LA 3TNMB 1EGJL 4HCIA 5D1QB 3QP3A 4X6EB 1XGRA 2DBLL 1RZKH 3A21A 4LSDA 3CG8A 2IWGA 2C7FA 2W65A 4XOEA 4G3YH 5D55A 1HH6A 4YHNA 2HRPH 4FQXC 4N0UB 2QTEA 3FQUB 4ZS7H 1T5WB 4BYHA 4N8UA 3BESR 3NYKA 3GNML 3QH3B 1CDBA 4H8VA 5F88B 1A6TB 3KYNB 15C8L 1F4XH 3EO1B 5ITFA 1U93B 1NANH 3HB3B 1AE6H 4KQ3H 3PHQA 1NC4A 2QSCH 4M6ML 3EDFA 1NUDA 4JFEE 3WIHL 3VRJA 2BVUA 4C54A 2DEYX 1GR7A 2CJUH 2CWRA 3P4OB 1QRKA 2YN3A 4EDXA 1GAFL 1T2XA 3INOA 3ULVC 3DROA 1TITA 1N3NB 1IFRA 4UV7L 1RPKA 4A7TA 2E7CA 3UPAA 5ISZB 4WO4B 1TO5A 2IDSA 1MWAA 3T3MB 5EPMB 1M6OA 3BN3B 4JRXE 5EEYA 1NKOA 2ZIDA 1JUFB 3U6RB 2QLYA 3RWEB 4UIKL 3QDJA 2WVVB 4YHLL 2J5LC 1OTSC 4PJ7B 2IAMB 3L5IA 3UYRH 1SEBA 1UATA 4FGMA 1R0AL 4BWUA 4XODA 3WG7B 3SKNB 2VXVL 1LEGA 2TAAA 4PCTA 5JHMA 3L6FB 5E8OB 5D7IF 5M94B 2UUDH 2W88A 1GMIA 3FCBA 4X6BA 2PWGA 3MDJA 4JHAL 4P3DB 1DQQA 2AXFB 3EYUL 2R29L 1VFAB 4PRPE 4E9LA 5A6LA 1TR7A 2WBJB 1A4KA 4JPSA 2DQEL 3KLKA 5EWIL 1UD5A 1G7JA 1G6RB 3BLBA 2I27N 3F7PC 1QFOA 3QRGL 2FO4B 2MQ3A 4UM9A 4JDEB 2DQCL 3FTYA 4XHJC 4P2OD 1D5ZB 4JFDB 4W6YB 5AD0B 2HUHA 5F44A 3W5MA 3RL2A 1LD9A 4BSVB 4LE8A 5CBAB 1N5AB 3N1PC 1MCDA 5KBMA 1RD6A 1TLMA 3QRFM 3OVUB 1Z32X 2K78A 1EDYA 3BHBB 2DTSA 3MRMA 5IK3A 5T1MA 2XV3A 1RZ7L 1UFGA 1HIMH 5KTEH 4K3EL 1WH0A 4J6RL 4LAQL 4XNBA 5K59F 3L1OL 2VZOA 3WUWA 2OCCB 3BIKA 3FT3A 1I7RA 3PNWA 3MV9A 1CBVL 4P8QA 2HLAA 1EEYA 2XZQH 4UT7H 4Z0XA 4N0FA 5IHUH 5HI3D 1JZ7A 2BP3A 2DMBA 5F21B 2X1QA 4UBDD 3IAGC 3ZTNL 2ICEB 2NUPB 2E9GA 2A4ZA 2WZAA 1PLCA 3V52H 4F2MA 3T65A 4CKQA 3K2UL 2X89D 3ZMEA 5HHOE 4UT6L 5IF0A 1G9NH 1GGIL 3T4AB 4HCRA 3PHAA 2DWXA 2YWZA 4NZFA 4S10A 4Y4KB 5IVOA 1DBKH 1ZVHA 4LCYB 4EDWL 3MXVH 5C0BE 4AW4A 4LSVH 3BWAB 2XU9A 2Y06H 3MYJB 1BBDL 3TPKA 4DEWA 1CDIA 2EJ1A 4YWGL 5CFAA 1H3WM 3ETSA 3TFBA 3QNXA 4PRHD 1A7RH 2IGTA 3UXFA 2P5ED 5FOJA 1Q0XH 3NK4A 2O5NA 3LJ3A 3QJFB 4GO9A 4JZOA 3T0EC 3BAIA 1TFPA 2J56A 1YSOA 1EJ6A 1NJ9A 2CBMA 4FKKA 1YEDB 4LCVA 3WHE1 2VUKA 1ZT7A 2I24N 1A6PA 2ZF9A 5J57B 1YN7A 1HI6A 5B1KA 3QJZA 4HJEA 4KK8C 1PU0A 4Z77B 2OMBA 3VM5A 2YMTA 4Z7OF 1K8DB 4LEXL 1MNUL 1GMEA 1L9MA 5C0ND 5IIEB 2MHAB 4LB8A 4P2OA 2P52A 5C0EB 3HR6A 1PPIA 5AG8A 4WEBL 3JWNH 5AKRA 1NIAA 3MGAA 3S97C 3ULVL 2H0FA 1BOGA 5AZEH 4QRPD 3VRIB 4ILDA 3FSOA 3UPRB 3U0PB 2J8UE 4DVBB 5TK4A 1JGLH 5TDNB 2OQJB 3BZFA 4JRYB 3QFGA 5FKAA 4BCYA 4KTDH 2WQAA 2NXZC 4NT6B 2XZCH 5IWLA 1FF5A 5HPMB 4OZIB 3AM8A 3H0TA 4Y9GA 1J05B 4XPFH 3CLEL 2JKSA 4OV6F 3UC0L 4XN1A 5KVGH 3FQRA 4BJLA 3FB5A 2J3SA 4HU2A 3GI9H 3S96A 2NXYC 1C9SA 3V6BR 3WFZA 4KTEL 2ZOLB 4PJBB 1Z9SA 4YSRA 2C1OA 4JKMA 2UXTA 1OB1A 3NIDF 5I1AB 3L3KA 4N8VB 5D7JD 2VDOH 2XTSA 3TEYA 1KGIA 2NSQA 3D4GA 1CFNB 4CNIB 4MMXA 2E0PA 3O2DL 1R3JB 3HNVL 1D5BB 2MH4A 3D4CA 5DQDL 6CGTA 1JFHA 2EABA 1RIUH 1N8OE 2X89A 4FQPA 3CGTA 3GMMB 3P0YL 4AMXA 3AWGA 2YD9A 1A3RL 3WNMA 1OAQH 2G30A 2BIQA 4S0HA 1HAWA 2KMWA 4JQXC 1FFOA 3EDEA 2FX8H 1EMTL 4CU8A 5PCYA 4PRHA 5T3ZE 1N6QL 5DRNA 2P5EA 1P6WA 3IWUA 3K8LA 4KPHL 4KO9A 4L5FE 3OLEA 2F58L 4TLUA 4HC1L 5GGRY 1AZNA 3DHMA 5GRVK 1MCFA 3UZEC 5EEVA 2GSIB 5I28A 7TAAA 5ICZB 2X3CA 3MV8E 4LPYA 4UQ3A 5DEFA 3RX9A 3ZIYA 4V1DB 4GUPB 1RKRA 1OE1A 2Z0UA 1GHFH 2XTJE 3EYFB 2P3YA 4D3CH 1TTAA 2BRRL 3ZW3A 2ZWLT 4X2UA 2WYTA 5DEGB 3IEAA 2PP8A 3VXRE 3TWCL 4DPBX 3QQNA 2B9BA 2IPKB 3BN9D 3SDCB 4RZKA 5DHVA 1B4TA 1AYRA 1TQTA 5DHEA 5MHSD 4Z7WE 1UACL 4OFIA 5F7AA 1E5CA 1PX8A 4QRPA 4APQD 2F1BA 2HJFB 3NA4A 5I26A 1KTCA 2DW5A 2ZXCA 3CN1A 1A6AB 4G6AD 2F5AL 4XP1L 4AOFA 3DC0A 3HE7B 1UURA 3DDFA 4AYGA 3TVMD 4M56A 3MCG1 3N42B 4HALA 4I8DA 5EG6C 1MHPL 2VLKB 4PGBB 2GJ6E 3GXUB 3STZB 4A68A 1E4WH 1BVLA 2P44B 3O3UN 5C8JB 4JFSA 2J88H 3P30H 1ZKAA 4MA1B 2DQGL 1JP5A 1Q9WA 5DRZA 5F7UA 4GINA 5F9JB 5KBNC 1IGIH 4UILH 1JNHA 4X98A 2CDEB 1FLRH 1MAJA 3L17A 5JIMA 3LRSB 4P4RB 1ACZA 5ACZA 3MRKA 4A38A 1R17A 2ZP0T 4AWJC 5D7JA 3MNDA 4BUQA 1WFUA 3GO1L 3RVWC 3T6ZA 3MRIA 5EO9A 5SX5K 1Q0YH 4DETA 1UEMA 3AT0A 2E7HA 4LF3B 3UTZB 1NOLA 2NR6D 5ES4B 3V0JA 5LB1A 4BSWA 1ET8A 2BWIA 4AQ8C 4XO8A 4BCZA 4JL1A 1XTMA 1A4JB 2H3KA 3AQZA 4PCYA 4ADJA 5FIEA 5D96B 3B37A 3VGAB 3FRUB 1TQBC 3OAZK 3S4SG 1NLDH 3LEXA 2A6IA 4XHQA 4HV8B 4QY8A 1I8IA 4KRPB 1P5VA 3W9EB 4EAEA 1U8NA 1MJ8H 1D2PA 1K4CA 5I1JL 5TQ0L 4RMTA 2EEXA 1HINL 1SDAB 3HMWL 1CS6A 3ATFA 4F7PA 5KG9A 4IYKA 3DYOA 4F3FA 4FG6C 2EYSB 1NL0L 3JYCA 1D5MA 2OR9H 2HFGL 5JUEH 3TEUA 3QUXB 5TTRA 1A9BA 4Y19B 1AIFA 3MRQB 3TV8A 3CZEA 1F11A 2ARWA 35C8L 4HJTA 4HPOL 2PMZA 2ZUYA 5ALCH 1CDYA 2A38A 4A37A 2CE6A 5IHZA 3ESMA 2DQHH 2HVBA 3HZKB 4LIQL 3BPNB 2FZ3A 4QTHA 3IFOB 4ESKA 2AJ3A 3O6LL 4APQA 5IJBC 2UVFA 4KMTH 1ZT4A 2AK4E 5C0FA 2XWBA 4ZFOA 2A6DA 1ZTXE 3NOIA 1DHKA 1BQLH 1QD0A 4H13C 25C8L 3TVMA 1I7TA 1MVYA 3IJYB 4GIPD 5MP6L 4HK3J 1YNKL 2NDFA 4X4XB 4E9TA 1AS6A 2I60H 4HKXA 1BG1A 1J1OH 4W4OA 4K94H 2B0SH 5EBLB 1IGCL 1DQVA 3CFUA 1Y6NR 3QUZC 2OKMA 4XBMA 5T1KB 1J9SA 5D1XE 1XF1A 1DQDL 2CO6A 5EO1A 5F93C 5BOPA 4NZRH 3VFOB 2DH3A 1QMUA 1MPAL 5JHDE 4U05A 2VYRE 3NBNA 4JCLA 5IFAL 3B2VL 4K3DH 5DZVA 1KJMA 5HHPB 4XZUB 2DMCA 5IBLC 4TNWK 1KGCE 3PUCA 2NW3A 2ZP8A 4I3GA 4LGPB 2EACA 2NR6A 1YEHL 2NY1B 4KI1A 1DSFL 1GW0A 5HHXL 3A24A 3VXPB 3VXTB 4X6DE 2FLMA 4HEMA 2ZKHH 1ILUA 4JO1L 2BOBB 4IIQA 5DMIH 1FO0B 3K4AA 3UAEA 3VFSA 5J6HB 5I30L 3BT2H 3OKDA 1KBPA 3B2XA 2BMKA 3I2CL 3LN9A 1DVSA 1MLCA 3IDGA 4FI8A 1A02N 5KS9F 4ZTOL 1C5DA 3MROB 3VDAA 3MJWA 2Z4TA 2X6AA 3K6SB 5E6SB 2A6JA 2YC1A 3CC1A 1NOFA 3RUGF 2APXA 4J8QA 1T0PB 2O5YL 5IFHL 2YEZB 2WCPA 1Y6MR 3FQ1A 2BHYA 4MB3A 3OR6A 3C5SB 5DMGD 5DO2D 4Q2ZA 2X4TB 4OVVA 2AXJA 5BO0D 1INEL 3KM2A 2ZUXA 4N87A 1MCBA 4RRPG 4O02B 3BMWA 1K3ZA 2B2XH 2AEPH 2FQEA 3GMNA 3VTAA 2R15A 3BPCA 3EYQD 2DY2A 3MNMA 1VEMA 3HHSB 5T3XE 3P77B 3GXFA 1U8JA 3EJJX 1WT5A 5I23A 4YHPB 2AKRA 2MRYA 4NAQA 4XCYA 2X3AA 3Q1SH 3RWFB 4H7VA 3L48A 4X5RA 4B9JA 1T1YA 4GRMA 5C09B 5D7IA 2BK8A 4XXWA 4GAJL 2IEPA 5E6UB 5I6NA 1ZEAL 1NWOA 4KXAA 4PRAB 4HJUA 4HZAA 4Y5YB 5E4EB 4TV3A 1X5MA 3IU3A 2OFQA 3IGKA 2Q3ZA 1YEKH 4BHUA 1OAXL 3UACA 4HUVB 3AS1A 1JGEB 3CFDB 4Z7VA 3VG9B 5J11B 5DK0A 5J89A 2IDTA 3DX6B 2EUZA 5LCVA 3UMTA 1JYNA 4OI7A 4K5LA 2AC0A 4ZPTA 5DGRA 2OK0H 2RD0A 3FUDA 5ELIA 3STLB 4MMYA 3SGJC 5A3IC 4V2BA 3KYKH 1TZGL 1U8KA 4QO1B 1CXLA 3IT8D 3KYMB 3RE0A 3WD5L 3UDWC 3BVUA 4LEOB 5FR3A 2L7JA 4HUUA 3US1A 2X2IA 4F7EA 3OB0K 1S5IH 3ABGA 1BYNA 3NFSL 4OCMC 2QKIB 4R96A 1FNEB 1U91B 1XO8A 3GI8L 1NBZA 3BW9A 1A0QH 3X1BA 3MR9B 2IH3B 3VD5A 2CDGA 3V0WH 3OKEB 2J1YA 3K72B 2AV7A 4OCNC 3MRNA 2X2YA 3BUYA 4OTXH 5FFGA 4DERA 3BKJL 1FFNA 4JFWA 2YKLL 3AXHA 5D1QE 3EOAA 3T3PF 4ZOEA 4XWGH 1YEIH 1AXTH 4RDQF 4M8RA 4XPTL 1JWUA 1M7IA 4ZNEE 2HWZL 2F7IA 2IDQA 4N0UE 3O2WL 3GB7B 2VERA 1O0VA 3LV3B 4YSDA 3ULAB 4AENA 3IDJB 3C5ZC 4F2FA 5L8KB 4R4ND 1SN5A 1AG6A 1QOKA 3U0WH 4J3VA 2Q1EA 3T2QA 3TBSB 2FEDC 4GRWB 3GEWB 2I5YH 3PFQA 2MCPL 2GBTA 3BUPA 4MCMA 4XPAL 3MOBH 4LLQB 5FK9A 3KGTA 3GUTB 2YEVB 4J4PC 2IGFL 5D4IA 1J1XL 3ZTEA 2OTWB 3F01A 5BOJA 5IEKB 3SPIA 3K6FA 3U9WA 4ELDA 3OZ9L 5B38G 2B8OT 5FGBC 1CLVA 5ISZE 1SY6H 3MRBB 3KJ6L 3KHQA 4JPWL 1AKJD 1J0YA 1QSVA 4MAYD 5F7MC 5EOQL 3QPQC 5DQ9B 3O6FA 3RWHA 4P5RA 5I1EL 1PKQA 3II3A 5ID0B 1K2DB 5FUCC 2XZZA 3KHOA 4RAUB 5DJCA 4YXHL 1ODUA 3DVGA 2P24A 4HK0A 1E2ZA 3KPLB 4PJ7E 3RZCB 3ZDZB 2WCSA 3B9KD 2YLKA 2RHEA 2B5IB 3DX8A 5HGAA 1NAML 4QWWD 1XH3A 5AVYB 1MCQA 4FA6A 4PG2C 3RKDC 3QZMA 4PSPA 3ARGD 4MQXD 4HBCL 1UXSB 4JZJB 2VDNH 3JZYA 1RZIA 4P57B 4P9HC 3QI9C 5HY9A 2XTJC 3C2AL 1G5AA 2K70A 2E7DA 5IMMB 1CDCA 1ETZB 1GA2A 2K4AA 2VLLA 4KKLC 3W11D 4RQQA 4M4RB 1JNJA 4BFGA 1OCOB 1CTNA 4KZEH 4JLRA 1DQLL 2Z6FA 1ZLVH 2Y1ZA 3DROB 1LVEA 3FQYA 1NAKH 3Q8EA 1OP3K 1IC7H 4HUXA 1XGPA 2R2EB 2X12A 1MWAB 1M6OB 4QF1A 4NFCA 5CR8A 4DGUA 4Y4FC 3QDJB 4GXUM 3NFNA 1SN2A 3RPBA 2AJUH 3CX5K 4PJ9C 1TQVA 2XT1B 2V33A 5LBGA 2AXWA 3V6ZA 4PVMA 4X80H 1LEGB 1KYUA 4I85A 2OP4L 2IH1A 3VU2A 4MNGA 2AMGA 4PS8A 1RZPA 2UYLB 4X6BB 1G0YR 2E74C 1C8PA 2A9ML 1OVZA 1CFSA 2YGPA 3INUH 2EIDA 5DJ2A 1UOKA 3GRWH 3HAEB 3NZ8B 2XQYK 2ZOUA 4G59C 2Y36L 2IFFL 5C07D 3MLTA 3CVHH 4BH7A 3QUYC 4HXAH 1BECA 4GKSA 4JGNA 2NY6B 1DLFL 3ARFD 3DIFB 1AKJA 1UJTA 4G70B 3CXFA 4MAYA 1I3RA 4H8WC 4UQEA 4HMDA 2ZCZA 2YGOA 4DESA 3LHAA 1O9WA 3TEZA 1V3MA 2DRUA 2YN5A 3WAKA 3V6OA 1JPSH 2D03L 4I0PC 3MRMB 2LR4A 4G42A 4KNSA 3TJEH 3MRLA 1NM9A 2CA4A 2VDKB 3B9KA 3L5XH 2MTAA 3M1OA 1P5UA 4K5OA 5AW0B 1CGVA 1BXAA 1J8HD 1B3JA 5IROC 3MODL 2WD0A 2ZX8A 3ARGA 2BSRA 4XCEA 1SDDB 3BIKB 1OT1A 3PWUA 2P5WD 4HIXH 4XVUD 3K2MC 1L5GB 3PNWB 5KYUA 3MV9B 4GSDH 4Z0XB 1EEYB 2FO1A 1FPTL 4N0FB 1AGCA 4AYSA 3ESPA 1YYLH 1INDH 1YA5A 2G0LA 1GIGH 5C0GA 1V8HA 4OLVL 4P4KB 4XRCA 1LK2A 3GMRB 1R46A 3EHBC 4J1UB 4F2MB 2NW2B 4OB5L 3OMNB 2V7HA 3SEPA 3FT1A 3CDYA 4ODWA 2OZ4L 5IF0B 1HX0A 1EEQA 1OD7A 1E4XI 1QNIA 4OIFA 4DKFL 1IFHH 4U6XB 4UYPA 2KUTA 4YX2L 2ZXBA 2LLGA 1T89A 2VNCA 1BVNT 2K1MA 2N7AA 1RMFL 1ILSA 4JRYE 5E8PA 1KIPB 2PPCA 1JWSA 2WBKA 3B7SA 5L0QB 4GI6A 4Y16C 1IIIA 3S88H 2R0WL 4JZOB 5T3ZL 4OZIE 3O3BB 5CUSL 5CGMA 4L5FL 1HFUA 2NNFA 1T04B 3QJXA 4QPEA 1ZT7B 2HT4D 3IS0X 3AY2A 4N68A 4U7KA 4Y5XA 5FYLH 2GI7A 1SXZA 5EU4A 1HI6B 4WWKD 5IV2B 4PJBE 3RYMA 1IAOA 1FV1A 1ZIAA 2MNUA 2FYVA 1TO4A 4TUJA 3V5DA 5I1DA 5L88L 4OCSL 2OS7A 5DFTA 5DFAA 5I1HH 5IVNA 1RU9H 3MA7A 1E40A 4Z78A 2KS0A 4RA0C 4U1KB 3HE6D 4DP5X 5INCB 2VDRB 1JTTA 5C07A 5HHQA 4KQ0A 2V2XB 4L2YA 1SY6A 1RUPH 2FQFA 1ICTA 4WWNA 1N7ML 2VL4A 5KYNA 5IMLA 5FGRA 4MZRA 5LQBH 1T2QH 1FI8C 1JVKA 2OTUB 3ARFA 4PD4J 3LZNA 4AYDC 5C6WH 4F37F 1SHWA 1VFOA 4WNJA 2V5YA 1DFXA 2JCCF 3BZFB 3GMQA 2PTTA 3CXDL 2X1OA 1QZ1A 3N1MC 4M48L 2L04A 1J8HA 2DKSA 3WIFA 2CSPA 5I0VA 1UWEH 4YDLC 2UZYB 3ILQD 2TSBA 2Z8WC 3IDYC 2P5WA 3HS0A 1SJHA 2Y3AA 4GMTH 5D4HA 2QL1A 4AT6B 3FUKA 5I8KL 3G9VA 4F7KA 3SE4A 1CLCA 1KXTA 1UD2A 1UM4H 3WNJA 1Z9SB 3MGTB 2C1OB 1OTUD 3QNYA 4V1DE 1OB1B 3F7VA 1PLGH 4LSTH 4XNUH 4GRLB 3VH8A 3ZOAA 2CMRL 4PLKC 1LE5A 1H15A 4HIHB 1SF3A 2QZQA 3U7WL 3D0AA 3UABA 1MF2L 5GGVL 1A7OH 3B3IB 1TEYA 2O5ZH 1JPGB 5D71L 2Z3FA 2BLFA 3LIZH 5EF0A 4XB3A 5JLZA 1F2XK 4KNTA 3RWJA 4EBQH 4FQHA 5AW4B 4HH9A 3VI3F 4Z3HA 4U1GB 2AGJL 2E27H 4FFTA 3V0AC 5AB0A 4D9LH 1FFOB 1BQRA 1KF9B 4PREB 4FFVD 5B1CA 4PRHB 1KN4H 4H8WL 4JS7A 1N4XH 2P5EB 1YEJH 4MJID 1KFAL 1E3ZA 1XVSA 2R4RH 4I1NB 2VLKE 1FH5L 5KSUA 2ZSWB 2R1XA 3S34L 1X44A 1D7FA 4RMSA 1FN4A 2H6UA 3CIQA 3OKNA 4LPCA 3E6FB 5DEFB 2BJML 2J55A 2MQGA 1M3IA 5AW8B 4WWKA 3MLWH 3B1UA 4ICXA 1CBJA 4G7YL 5IT2L 1P53A 3K6NA 4L4JA 4ICWA 4NO2B 3PWPB 5LGHH 5KS9A 4QHLB 2DEWX 1XAUA 3HE6A 1DQML 5F7NC 2R4SL 2X28A 5FX3A 5I1CL 4K7PY 5DHYB 5DHVB 4NM4L 2VZVA 3RUGA 3VRLE 4R97B 5DR5H 2XFGB 1G1CA 1DCLA 1BFTA 3ME0A 3WO3B 3LQAC 5EU5A 2ERJB 3VXMA 4N2HA 4BZ1H 3S3DB 4LKXB 5A2IH 3OAZH 1MJUL 4P46B 5TF1H 3KL0A 1WCBB 5B3JE 3PHOA 1W72L 1RSFA 4M7KH 2FUQA 1ZTXL 3Q5YA 3OAUL 5EU6E 3DPBB 5K1NA 4MQ7A 2V3EA 5K9JL 5ESAB 5DMJB 3N43B 5D1QC 5DVNA 5CP7A 4AIOA 4U1NA 5KBPA 4LCCB 1AD9B 1RUQL 3IBEA 3ZR6A 1LYQA 1Q9WB 5DRZB 2VDPL 4A6YL 3WTWA 3NCYS 5JHLA 2WB7A 1WSST 3MRKB 3W0WB 4PV9B 3V4PH 3UBXI 3MV01 2VCOA 2QVTA 4Y19E 1ZT1A 3HB3C 1YJDH 5LBSL 3UJIH 2ICWI 4GS7B 1OARH 2V2WA 5B39A 4Z7NB 4Q7DA 1A3ZA 5JIKA 2JKXA 4JG1H 4QI3A 1M7DB 3VACA 5IKCA 3L9RA 4GNKB 2HKAA 2FYYA 5LKNA 4J12A 5HYJD 2VJ0A 2RCSH 2F1EA 4BDVA 4HZLA 1C5CH 4ZS6C 3BE1H 3LEXB 3SO3B 1WLHA 5KZCD 3SKUD 4MJIA 5I0DA 3FQWB 5L4MA 2OXGA 5KYYA 4P2QB 2C3GA 2EH8L 1K4CB 1A1MB 4Q6IA 4F7PB 4HLZG 2WVTA 4XWOC 4JN2B 5KG9B 2NNAA 1JPFB 2IAMC 1UZ8A 2BY0A 4WI4A 5CLYA 3REVA 5I66A 4FCAA 4GW4B 1D5MB 2CBTA 4ORZC 1FDLH 3Q3GB 2QADC 5EORL 3AXLA 1MFEL 4LSUL 2AS5M 3E9TA 3QS3A 1GYVA 5D6DA 1BJ1J 4I77L 4Z5RA 1A9BB 1Z2KA 4XN9A 1IFGA 5GGTA 4AC4A 1F11B 3BH9A 1BQKA 5DD3H 5D2LF 5IHZB 1QNZH 4A2DA 1ID5I 1KPUB 3QEGL 2FZ3B 1SVCP 4XBPB 1MHEA 4ZPVB 1UGNA 5T3XL 4M6AA 3RVTC 3ARDD 1IZKA 1FL6A 3NESA 4FEMA 4WWOA 5ANMA 2A6DB 4PYHA 2VN4A 2X4OA 4K2UL 3ZMNA 1HKLL 4MDIB 5F7BA 1I7TB 1E5YA 3KCPA 5G4OA 3M1CA 5JOPD 3DLQR 4PHZA 3U48A 2X1XR 1HKFA 2CNZA 3UTPD 4HKXB 4XN7A 4ABQA 2AEQL 4DGVL 2Y4SA 3VWJB 3UPCA 3UL4A 4TVPD 2GTWA 4DTGL 1E43A 2XWXA 2QDWA 5I6KA 1BJ1H 3GT6A 4BFKA 1K8IA 3FAWA 3H3KA 4NGHL 1SHXA 5DS8A 1KCLA 1J9RA 3T08A 4M5YH 1GGBH 4ZFQA 4AJWA 3WTVA 3CLFH 3IDMA 1BIHA 2QBWA 1YECL 3HOGA 4XH2A 1TNNA 2GJPA 3LIZA 2ZCKL 2BSTB 2NW3B 1B0RB 5J5EA 2AJVH 3NZSA 1NM4A 1F3JA 1CLOH 2ICEC 2XPYA 1DBAH 5HYJA 3VFSB 2K3HA 5BV7B 3OKDB 4X5LA 1WVZA 2BMKB 3SD2A 3NP3A 4NBZB 3LQAL 4HETA 1MLCB 3IDGB 4JY6A 3AACA 2CBPA 3E6HB 4Y4KC 3HZMA 4B96A 4C56B 1K4DB 4WW1B 3CZKA 1XF4B 2FT8A 4DKTA 4GKOA 4QRBA 5EU3B 2WAQA 3CDCA 1C16A 1FL5A 2F19H 4URTB 1JF1B 3ZIMA 2WWMC 2XNAA 3MJGX 1UHVA 3UO8B 2NZ9C 5EZOL 1MLBB 1QLEL 3T6WA 4Q2ZB 5GZNC 4TN9A 1KZQA 2ZJSH 4D9QE 2A1WL 2E7MA 3DSFH 2ODIA 4AYFB 3GMNB 2Z7ZA 4WEMB 4AGNA 3QQDA 1V5JA 1RJLA 3CFTA 3WNLA 3WUWG 1AGEA 1WZLA 2WZ6A 3RA7H 3A6BH 4J7RA 1MJJB 4Z3TA 2QQLH 2BM3A 3KLAB 4BZ1A 1T03L 1BDYA 4JREB 1TTBA 3ARDA 1JXFA 3U7YH 5C3IA 2I85A 1T1YB 2NY7L 4GRMB 3BZ5A 5JYMA 3QCVH 3FBKA 3D0VA 5HHVH 3EGDA 4FQJH 3UX9B 2WYIA 2YGVA 4QCIA 1C08A 5FA3B 5GJSH 1THAA 1F6FB 3NGBB 1A4BA 3HI6H 4AKPA 3CPUA 2XA8L 3GSRA 4JX0A 2HLEB 2ZXWB 1AQKL 4GLRI 4M61B 2BFVL 2KH2B 4JCMA 3SKJH 1YN6B 3P3TA 5DA4A 2BSDA 4AYBA 3LQMA 4Z7VB 3QIUD 1T4KA 2CHDA 5DK0B 4ZUSA 1OP9A 4WTXA 4HG4K 4FG4A 3I3BA 1JD9A 2YPKA 4HIQA 4MMYB 4G80A 4ORGA 4NUJB 5MEND 4F27A 4QMEA 3SOBL 1KJ2H 1UCBL 4Q0XL 4MKTA 1Q9KA 4WV1A 1KENL 4Z8FL 4UNIA 4Q56A 4LGRB 1Y0LA 4WDIA 3DTDA 1D5XA 5JXEC 4R96B 1G6RL 4AMWA 3IJSB 2E5EA 3MLSL 4OV5B 4RAVA 3T04D 4WTZA 1ZE3C 2ENPA 3BW9B 3GTVA 4FHKA 4Y1AB 3SIKA 4QHPA 3WS6A 3TA4D 3NT0A 2AV7B 3HS9A 4LLWA 4CC4C 2IJ0C 5IEHB 1K5NA 3WL9A 3BUYB 4BFRA 2J8HA 3CX5J 2FATL 3L8QA 4PB9L 2NX5B 3WSQL 3K81A 4YH6A 1YY8B 4ALAH 1SM3H 2SODB 5FW7A 3ZDZE 4L8SA 1W2KT 4AENB 4HOWA 3QCTH 3N1QC 3TESA 1WWAX 4ZD3L 2H1XA 4YHMH 3QO1B 4F7MB 4L8DA 2J6EL 5KVFE 1LO4L 3QULB 5JW5B 3VCLA 1LMIA 2L7EA 3Q8AA 1DEEA 1UD3A 4N2FA 4N2DA 4GAFB 1BZDA 4F8TA 3GMOA 1OP3H 4MCNA 3KWVA 1WWCA 3KW8A 2GTZB 5EUOB 3SDCC 5KJ7E 4LCIL 4LEBA 3B56A 3ZDXF 4BFOA 4A7UA 4ELKA 5I8CA 2RA1A 1WF5A 1S7WA 3KPSD 4KVPA 3CDZB 4N2IA 1PZ5B 4WHDA 4NN7C 4G82A 4OF8A 2PWFA 3O6FB 3RWHB 2WJ5A 4HPYL 2Z64C 3OGCA 1TG8A 4D0DB 4L4TB 1B0GA 2X4NA 2HX8A 5ESQA 3O2VL 1YDPA 1NGZA 5DJCB 1AO7B 3WTXA 3VMPA 2K9FB 3N85H 4HK0B 3ARPA 4JDVA 3QIUA 5TQ2H 3MZTA 3BSHA 1L7TH 4A55A 4XMKL 1MCKA 2CAKA 2P7TA 4MA1C 4DK3A 4TQEH 4KY2A 5BMFL 2ALWA 2FL5B 2NYZA 4M4PA 5ICUA 4BZ2L 3EUUA 5MENA 3GC3A 2JCCA 3WJMB 3FH5A 1JRHI 2VLLB 4EQ2A 5KVDH 2QFPA 3BKCL 4Z9KB 4HS8H 4X6CB 4B5ZA 1AGDA 3I6GB 2PR4L 5EEXA 3US0A 4P5KB 3NA9H 4TKWA 1G84A 4GUOA 1P7HL 2DWSA 4ELMF 4YDNA 4TLTA 3NEOA 1TYRA 3GYRA 4DKEL 3V7AE 4LCWB 1YUKB 4XXCA 4NUQA 3VB8A 2H7WA 3OKYA 4AC2A 3BDYL 2GW5A 3NUKA 3M8OL 4POZC 2NZIA 1ADWA 4U1IA 5D96C 4K71C 3VGAC 1RZJH 1G7LB 3EYOA 3NFNB 5AZ2H 4AYMC 4TULL 5C0CD 2PO6D 5GRZA 4LARH 1M2OA 4MNHA 1GOHA 4OD1L 4WFFD 4EVNA 3PIQA 1TPXB 4G72B 1AP2B 2YPVL 4OJEH 1TVBA 2GYSA 4M62H 3EJZC 3WFCL 1F1GA 5DXWA 3RY6A 3QFDA 4LASL 5D93B 3VI3A 5CMAA 4MNGB 1MREH 3RVXC 4LP8A 1ZLSH 3MV9E 4Q4EA 5DJYA 3U9PH 1D7BA 1FSKB 5I17A 4HIPA 1CFSB 3QUXC 4PP2A 3LX9A 1MELA 4JG0H 1RVFH 5C2BL 4JMXA 1CICD 2FGZA 3QR1A 3MLTB 2YRLA 4GI9A 5AUMB 3BP6A 5E9AA 3BPNC 4F2ME 4BM7A 3KPSA 4GKSB 3V4VA 5ENWB 1JWMB 5BW7C 1AKJB 3LPGA 1WZAA 1UM5L 4IBZA 2AXGA 3PJLA 4NM8H 2DDQH 1CL7L 5IB1B 3IB4A 2DQFB 1LO0H 4XPHL 1NCCL 1ZA6B 3MLUL 4ODSH 4ES9A 3C75A 5EULV 1ZVSA 3AZUA 2IWFA 3MRLB 2B15A 4PJIF 3TGXA 3B9KB 2QSQA 4XVOA 1P5UB 3OLIA 4NO3A 1TSRA 1I9IL 4B9FA 3EKCA 1FNAA 1FZKA 1HEZA 3L1EA 1UH2A 3PWLA 1U0QA 4XCEB 2WV3A 4RGMB 1A6ZA 3EZJB 3PWUB 3UP1A 1YLBB 2FCBA 2HFFB 1JOIA 1UKQA 1KJ2A 3EH1A 4IW4C 5E24E 3ZRFC 3RGVD 4K3GA 1V7NH 3FQ4A 3P4NA 2WQWA 4ODTL 4Z7QB 3MJ9L 5FGCB 4LSPL 1RJZA 3JTTA 3KS0J 4XRCB 1LK2B 2XLLA 4NCC2 3SJVB 3ZKNC 1TVDA 1FHNA 2NY1C 2V7HB 5E5MB 4NHCH 5BXFA 3L7FB 1A21A 4C8XA 4ODWB 5ILTH 3K91A 5L7XL 4ODXB 4KVNH 1PS3A 3ZT6A 3JWNG 3T8XA 2HP4A 4RA3A 4X0KA 2BVPB 3HG4A 4G8EA 4Y7OC 5C0CA 5CN1A 1Z5HA 2JJWA 2FAUA 3FTXA 2PO6A 4X5WB 5DC0A 2VR4A 5A6MA 3DOIA 4DEUA 4MYWB 5E8PB 1JWSB 1U8OA 1G9HA 3JV5A 3SBQA 4MD4A 3ECQA 5CILH 2YD0A 1E4XH 4X9YA 5T5FL 4I87A 5KSAB 3VSUA 2E3VA 4ATTA 3HLKA 2VISB 2E7LC 1SBSL 4U1SB 4WSGA 4XNXH 2X05A 5GIRA 1CT8A 1YRKA 1IBFA 1ZLUH 3V9EA 4D9RD 1WV7T 1IAOB 3FT0A 5I1DB 3KS0H 2XACC 4YO0A 4XR8C 1MDTA 4MNQB 1CICA 4FZEH 1G7MB 1DEDA 2FJGA 3CMGA 4FLQA 3ET9F 4JQVC 1FBIL 4LL9A 3W56A 5HHQB 1MEXH 3SE9H 4BXSV 4EKXA 3E2HC 3W9DB 5C0IB 4O9HH 4TMPA 1X6LA 1HXYB 2H45A 2F7RA 3V6FB 1KN2H 2O5XH 5E2WH 2Y07H 2BNUA 1NBVL 3HBGA 3MAWA 4WEEA 3JZ7A 3NCBB 4NZJA 2YWYA 3RNQA 4JEGB 1BXUA 3N9GH 2B1AH 4PLJC 1A6WH 1UA6L 2D3JA 1I3GL 3KPPA 4AVHA 4IDJL 4TVSa 5EH1A 1VENA 1NMAL 2FIKB 2P5EE 3MVSA 4Y5YC 3UTSD 2UXFA 2A74A 1ED3A 5E4EC 3WIFB 2OAAA 3NQKA 2WGXA 3FULA 2Z91A 2DJ4A 5F1IA 1QTYT 1L4IA 5CBEA 1ZXQA 4GP4B 1U8HB 1ZXKA 3DUHA 3DYPA 2CPUA 3AG2B 3G6JB 5J11C 3MX0A 4P9MH 4FS0A 3VG9C 1KXTB 1DBBL 2XQYA 5CM1A 2X9ZA 2V3FA 3RGVA 3EG9A 3X1GA 3CZFA 2Z4QB 2EXYD 4C4BA 5JPMB 2WLHA 1LEKA 3VH8B 4DGYL 5JORA 1PQZA 1ZGLB 2XJKA 3PWPE 5C71A 5T1LD 1LE5B 4N0YH 4IDLA 5BS0A 3P1VA 2EDTA 4U1HB 4MCYA 3ZL1A 1FAIH 2CQVA 1UT1A 2N3JA 2WXGA 3C08L 2O26U 3O3EA 1B2WL 1BD2D 5DJZA 2CHXA 3RWJB 5I5MA 5JLZB 1S4IA 5MEOB 1ZK5A 4FYTA 2HXAA 4HH9B 4Q58C 1PTZA 2G60H 3LPWA 1WTGT 4AYID 4IBSA 3J27A 4KK6D 5AKVA 2QKIC 3EGSB 5F0JB 5GRJH 3ZKSD 1S7SA 4W93A 5E9DB 1YO4A 5DCCA 3E3QC 3BSZH 3U1QA 1JDAA 4OIIH 1CGTA 2V9RA 1BX2A 2CCVA 5AW5B 2NDGA 4OSUH 1ZS8A 1FN4B 3ZTJH 3OKNB 4H2AA 4TUKL 2E86A 2VQUA 1PDKA 3C9NA 1XIWB 5IBUB 2DLFL 1MZZA 4WSKA 3W0WE 1DJZA 1AD0B 2FSEA 4OFDA 2QPDB 3G5YB 1KDIA 1MCEA 3GSOB 4MX7A 1UH3A 3BVNB 4Z7NE 3LN5B 1TENA 4JFHE 1IM9D 3OPUA 1X7QA 5L2KD 1D7DA 4LVHB 2MFNA 1RSYA 3FFOA 3VXMB 4G1EB 5CHNA 4GQRA 3VVVA 1XCQA 3Q6FB 2BWQA 2ZUTA 1Q72L 4CC1A 3IXAA 4LHQB 2QQQA 2W1NA 4PJDB 1FO0L 4Z0BL 3ERXA 3UTSA 4F1SA 4P2QE 3KH4A 1WFOA 2EXWC 4BE5A 1CFMA 1TCMA 1KWGA 1NOAA 1NMBH 4H1LB 4U1NB 5BVJA 4EZKA 3FJTA 5TF0A 2ZWYA 3JTSA 2R0ZH 2Y72A 3O3DA 2B5IC 3FOMA 1RUML 3LRLA 5KN5B 3FAXA 5CLXA 4YMPA 1ZHLA 1HE8A 4LL4A 5T1LA 3OXRB 3U0TB 3AU1B 4ADIA 1J5DA 3IJEB 2A6KA 4PWJA 2DI7A 1G9EA 4ISVA 1IAKB 4O02L 1E9OB 1BD2A 3MACH 5E6ID 4TSBH 5EOCJ 1N12A 3BAEL 4CU7A 2ZD0A 2FYYB 2NZ1A 4Y2DD 2O6FA 3U36A 3LS4L 4JZNA 2FE0A 5FGSA 3HR5B 3K4ZA 4CC0A 3QJOA 4YDKH 4UI2A 2ESVD 1JCKA 4KAQL 1SBBA 4ODHL 3MI6A 2G9HA 3NG5A 1DQIA 2XG5A 4TNEA 3CH1A 4OLUL 1R24B 3ZE2B 3I50H 1B4LA 2KHAA 2XN9B 3ULSA 1SJEA 2OXGB 1XWVA 5KYYB 4Q6IB 2UVEA 2FSDA 5JXAL 3WFEH 3GTNA 4BFIA 3REVB 1K85A 4EOWL 1KSRA 4M1CD 4QTIH 4RGND 1O7VA 5I75C 2R7EA 3FUMA 3VW3L 3RU8H 4MA8H 4MWFA 3O9WD 4AZ8A 5JO5A 2R2HB 4K3JL 4Z5RB 3G7TA 4KI5F 4FI7A 4PUBL 3BH9B 3RHWF 2ZUWA 2D7OA 3TN0D 4JFFD 4C57C 5EOCH 4H26B 3T0XA 5HJ3A 5HD8D 3VA6A 1QSEB 3NJNA 2VRKA 3ISWA 1KLUA 1IM9A 1MHEB 4HCGA 5L2KA 4XT1C 5LDSA 3PRZA 1GL4B 1EXHA 4XP6H 4UTAH 5JW4M 3IFNH 5ANMB 1U92B 2BNQD 2BFGA 5AAMA 1XGQA 1OP5K 4H88H 2JKJA 3ZTCC 1WFMA 3KLSA 3REWB 2NY6C 3HRPA 1MFAL 3S36X 4K8RH 2FJFB 2ZOTA 3AT8A 1EXUA 2P8LA 4C56E 5SWZB 2RB8A 5JQHC 3K46A 4N2NA 4CGUB 4EUPH 4F57L 4N8PA 4KX8A 4DUVA 4FD0A 1MVUB 3P2BA 4RSVA 1XGUA 4YC2B 5FKPB 1A6VL 3QUKA 2R69L 3GZQA 3VMOA 4OD3H 4P3CH 3U4EA 4HG4J 5DS8B 2OMXB 4JM0A 4RISL 4YHZH 3IDMB 2FLRT 3I6LE 4C55A 1QFWI 3FN0L 4YGVA 3KGSA 1FJ1A 4OCXH 1Z3GL 2KZKA 3CV5A 3LZFL 3BXNA 4OZFH 5E6IA 4EZJA 4B95C 3OG4B 2R1WA 1XF2A 2FJHA 2NRDA 4MB1A 2J1WA 1ADQA 1BVZA 2CH8A 2VXUL 4K9JA 3SCMA 4Y2DA 5E70A 4XBGA 4NCC1 4MD0B 2OX5B 3BJLA 2NY0D 3QIBD 2ESVA 2VLME 5KZCB 2HMID 4KUZL 1ZA3B 4UOW0 2HA1A 3D69A 3BSZA 4FQ1H 4JY6B 4YBHA 4I2XA 4HWZB 3SYCA 5LWYH 3OZKA 4L1SA 1WAAE 3SE3A 4P48A 1X5XA 3DMMB 2ZKYA 2W9EL 4OM1H 1S7UA 3HFMH 5D9SB 5IQ7H 2VT0A 3BUQA 2FH6A 1P4IH 3F00A 4LOUD 2JXMB 2PYFB 1KTDA 4GKZA 4M8QA 3S36L 1XH1A 2XNAB 5L0QC 1FGNL 2WXIA 4ELMA 4Z7VE 3FO0L 3WXWL 1R3HA 3VYPA 1YEGH 3ABMB 1IEAA 1SYSA 2DLEA 4HT1L 3O9WA 5FB8A 4EI0A 4E9XA 4L3CA 2PF6A 4J3UA 3EFDL 3N55A 3TO4D 1GJWA 4WW2F 3ZQ9A 1BFOA 2IWEA 1WYJA 3OD3A 4JFFA 4JKNA 4GEIA 3AG1B 1AGEB 2XOTA 3A47A 2DQTH 5EZIL 2Z35A 4ZUUA 3PP3K 3F58L 4KRNA 5KVFL 1RK1A 1H8NA 3SY0A 2FQDA 2BNQA 1IC5H 4WIQA 3EFOA 3HUJF 4K8RD 3OV6A 3TA3D 2X0VA 3GWJA 3EGDB 2WVSA 1MJ7H 3GPEA 3DXAB 2YA1A 3EBHA 4OD2B 4QCIB 4LVEA 4Y1AE 1A7BA 3T2OA 4X5XB 1KJ3H 4H25A 2Q6WB 1MWAL 4BRJA 4M1DL 2BS71 2E76C 2W95A 4KY1H 1BF5A 4WJ5A 4OCWH 1BF2A 4M02A 1DLHB 3VWKB 3AM8C 2J25A 2BW4A 2NX5E 2ZUQC 3FF7A 3RWDA 4OJDH 2YPKB 3UAJC 5CKAA 2VZ1A 2AI0L 2VLJD 1HWWA 4GLRH 2CRMA 2B39A 2HFTA 2VLRB 3ZZ1A 1BFVH 1U30A 3U7AA 2W07A 5HI3C 3L9BA 4XN4A 4Q97A 1W16A 3UBXA 4UBDC 4H0LC 4GRLC 4PJIA 1P84K 2R0KL 2CD0A 3FS9A 4BUGA 3BP4A 3ZL4H 1QHQA 3DK2A 1JVLA 1PCXA 2NY4D 3AFLA 5T1DL 1OAKH 1Y0LB 5FO7A 2ZOOA 3BRDA 5SV3A 4NQVA 5EUOE 1VZHA 3QIBA 5GRXG 3VFMA 1D5XB 1HZHH 3EYSH 3O0RH 1R75A 3LDBB 3KNBA 4U1GC 1GTFA 3N0PB 2ZKXA 3A67L 4I48B 4NAMA 4OZHB 4TSCL 5GGUB 4LLWB 3RJOA 3QDHA 3VM7A 4F8NA 2V0AA 4L4TE 5CLZA 4AMKH 2GIMA 4LPUA 1AO7E 4MCZA 1TJXA 3AITA 5JOFA 2Z1PA 4ABUA 3T2PA 2FHBA 4LLDB 4L8SB 3OX8A 4X7TA 4LKCB 1BQHG 3EF7A 3GBNH 1TQUA 1PCSA 1Z9LA 1ZLEA 2F0CA 2VDKL 3TO4A 1H3VA 4XAKE 4R5VA 5B7EA 5JHAA 3R1GH 4HOMA 3G3LA 4CVZB 3NH7L 4IOFD 1AQHA 2MOQA 1YPZF 3O8XD 1QI4A 4XGZB 4S1SL 4M43H 1VJSA 5MEPB 5J1SC 1DEEB 3DV4B 4IU2B 4X6CE 5C0NC 2ADFH 4DO4A 3SKOA 1QAWA 4KKAD 1XR8A 4TLKA 5ICYA 3TA3A 1S7WB 1GXEA 1EJFA 4R97C 3FUFA 4OFVA 3GS0A 1HILA 4LCWE 4XO3A 12E8H 2ERJC 4X9HA 2WTRB 3WLWD 5GSVA 4B0MM 3V0FA 4EUPA 2ZP9A 4MD5A 4RFOH 3OGCB 5FYKD 1B0GB 1JXGA 5CWSB 5ESQB 1CE1L 1NGZB 1PG7W 4N0CC 2OSWA 4OFPA 4W9ZA 2H1PH 3VGBA 1QFHA 4AM0A 2LAGB 1QEWA 2MTPA 3UJTH 3QXVA 2VZ3A 2VITA 1I9JL 1GGTA 1MIML 4JO2H 4MXVF 1VZIA 3UBGA 1OK8A 3TT3L 1OOAA 2VLJA 2A5UA 4KHTH 3EJPA 5D7SL 3AREB 4MNGE 4GPVA 5MENB 3PQYD 4PJ8D 1IU1A 2ODHA 4JQIL 1CFQB 1NIBA 5DD5L 1L7IL 2CHNA 1E42A 1MFBL 2OW6A 4GS7C 4HGWA 4KVCH 3F3HA 1F42A 3JQOB 3C60A 4PRNB 1JRHH 4YJZL 1J7VR 4K9EH 2EECA 1S7XA 2VDRL 4DF9A 2DQMA 2V5MA 5AW3B 1YEFH 4OQTL 4LFHD 1NGPL 3A4FA 3OSKA 4U1IB 3OM3B 3A3YB 1WA1X 4AQ1A 3D18A 3EYOB 1WFIA 3SO3C 4O51A 1EA9C 2BDNH 3B2DC 3CHPA 4MNHB 4G8FA 4GG6F 2VE6B 2JJSA 1UVQB 4C4UA 1U8IB 1CR9H 1TVBB 1I75A 1TFHA 4JPQA 3LXAA 2AAAA 3O6KH 3QFDB 4LCUA 3VXQA 4Y4HD 3SGDI 4AIZB 3HC2A 2MKWA 2FD6L 4UCFA 3SDAB 1QLRA 1P7BA 2I07B 1SFHA 4I3SL 3DVFA 3O8XA 3ATDA 4PP2B 2AQTA 1CU4L 3V5KA 4Z7QE 2FEEI 5FGCE 2QHRL 4Z3GA 3BN9C 3W39B 4JY4A 2OMTB 3BQUB 3KDPB 4OJFH 3BP6B 1U3HD 3SJVE 1FZJB 3V4VB 5LAXA 1HSAA 3IPFA 3MZGB 1JYVA 4XNMA 2G3MA 1PG7X 2NTFB 5B39G 2X70B 2D7MA 3PF2A 1CXFA 3FT4A 4PP1D 3VDCA 3TVMC 3II1A 1VA9A 4XXDA 4KI5D 2J1XA 5DMYA 1N5YL 2AAVA 5HI5D 4PJEF 3OHMB 2YQ2A 1EH9A 1NCJA 2WLZA 4ZX6A 3BO8A 4W4OC 3SGKA 2A0LD 3VWJC 4Y9BA 2V17H 3QHZL 1ND0A 1SQ2N 3A6CH 4NQCD 3L4YA 2ZF8A 3PQYA 1I9EA 4PJ8A 4EI5D 5DYFA 4HU8A 2Q86A 2Q8AL 1F6AB 3A4AA 5E6RB 1MCOL 4M93B 4NKDA 1MCPL 4MNQE 2R8SH 3QRBA 1I8LA 4UINL 3DURA 3JVGA 3N50A 3MV11 3HN5A 4JAMA 1QPKA 2NR6C 5C2UB 5L2JA 1XF3A 2OZNA 4E9WA 3UG5A 3IXTB 1BXVA 2VH5L 4IIQC 1XZ0B 4F7CA 2O61B 4HP5A 3WMPA 2WUBL 1ZGLP 1I1AB 4WK2B 2MOGA 2G2NA 3U46A 3QQ3A 2A2QT 5BV7C 1JGVL 2M83A 2ZTBA 4RDQG 4QYOA 1MQKH 4U49A 1PG7L 4GYBA 2AW2A 3IMRA 3RWGA 3NEEA 1WUZA 4G7QB 5TE4L 1DVFD 1R19A 1K6QL 4CW1A 3UZQB 3LQZB 2VQTA 1N64L 5A1AA 3O11A 2GUOB 4Y4HA 2RH0A 2EXSA 1E4JA 3AXIA 3GHEL 1U8CB 5GIRB 1CT8B 3ZE0B 1JXJA 3G6JE 2ITEA 4CAGA 1RHHA 4WK0B 1MFDH 5CZVH 2FQGA 4W9EC 3QUMA 3ARYA 4UT7L 1QFWM 1N0XH 1NTDA 4YHIB 5AVWB 2BHZA 1CXHA 1LDPL 4GBXB 1CF1A 4S11A 2JFCA 5AB1A 4KJYA 2DKUA 5G55A 5LG1A 1EUUA 4UDUB 1U3HA 4E68A 4XCNA 1WT5C 2LLNA 2Y6SC 1ZJBA 3I6KB 3PFUA 3FO1A 4N90D 4Q74A 2R0LL 2WXHA 4JREC 3VXNB 3NMEA 5D72L 1QUNA 4MKMA 1Z5LA 2LAAA 4ZYKB 3S35X 4BWTA 2YO3A 3K6IA 3VXSD 5KOVC 4XVSH 5DUBB 3LKOB 4OGAC 4H8HA 5D7KD 4B9YA 2Y25A 3SY6A 4G6ML 1SRDA 3CMOL 4OUUA 3WKMH 4PLOB 5IUSA 3KPPB 1CGSL 3DGCR 4G7VH 5E9DE 3FFDB 1D5IL 3NGBC 4JNXA 3GSVB 5IREA 2A74B 3J2PA 4JPVL 4B9GA 1T66D 3KBPA 2Z91B 4Y9EA 5CBEB 3L4CA 2GIXA 3KPRD 4TTDD 2GG1A 3GSXA 3QQ4A 4NQCA 1TF4A 5HVHB 4ZUWA 4EI5A 1HL9A 3KPTA 5LBVA 3HNSH 3FU7B 3EG9B 2AANA 3OKMA 3CZFB 4K7PX 3EJYD 3CDGB 2J4WL 5AQ0A 3FO2A 1MCWM 1NC2D 3BWUF 1PQZB 1J8RA 4HBQA 1EHXA 4YHYB 3NAAH 5BS0B 4MCYB 5LGJA 3RIAF 2W94A 4Z7UF 3MUGA 1H8OA 5DJZB 1RUKL 1DDTA 1J5OL 3FNKA 1TJIH 4KKBD 3VXME 4E5XA 2YGQA 4P5TB 3LH8A 5F96L 4X99A 3F5WA 5JPNA 2CBOA 4NPKA 3IJHA 4QKTA 1I8KB 3S35L 4PJDE 3E8UL 4LHUB 4I9WE 4FXGA 5E4AA 4KFZC 2DAVA 1CMOA 4BD4A 2QQNL 3L4WA 4ZXBB 5EBMB 3PGFL 1NFAA 1QYGL 3EJSA 2DD8L 4YXLH 4LDLB 4OM0H 5DO2C 4RZCA 5L6YH 4O4YL 1PDKB 2BERA 3PDOA 1EJ8A 1KXQA 1IGJB 5HXMA 3EYQC 5D5MF 1BJ8A 3W2DL 1OL0A 3HC3L 2J6WA 4H8PA 1QX1A 1G6VK 3D2UB 4K7PL 4MX7B 5DD0H 2Z7WA 1DDHA 3PDGA 2DZEA 1JNLL 4XP4H 4AVIA 3VXSA 5KSBF 2KYIA 2YQGA 5CHNB 4KC3B 3TT1H 1BWWA 1G9MH 4TVUA 1I85A 4BKLA 3BSGA 1VKXB 2APSA 2LVEA 5T5NF 1WD9A 4PJXF 2P4AB 4KV5F 4WW2A 3LZPA 4NEHB 3O6FC 2BH0A 3ZE2E 5BV7L 2XN9E 3NZHH 4DPCX 3HNTL 1EZVX 2JKTM 4WTZG 3KPRA 5BVJB 3HPJB 2UWEF 4OLXL 5CAYB 1FP5A 1FNSH 3FB6B 3JTSB 1U3JA 3QO0A 4YZFF 3N41B 5LXVA 2PABA 1JHLL 2XQBH 4D7PA 1AR1B 3HUJA 3CSTA 3NVQA 5DJDB 5DHMC 2JWYA 1SFDA 1GHFL 1ZHLB 2WN3A 1NC2A 4NWUH 1VFBA 1Q9LA 2OXHB 3WN5B 1HJCA 1KGJA 1T1XB 3BFQG 4WRLA 1RUAL 2OI9B 4JN1L 1QSEE 4W6XB 4ZQKB 1N6UA 2X44D 2YPLD 4Y88A 1A3QA 3VJ6A 4CVWA 5J6GB 1OW0A 3K0YA 4HFUH 4JZNB 5JZ7C 1S3KL 1ZV2A 4XNYL 3DDGA 5GHWL 2Y7QB 3U1PA 3IMUA 2FJSA 1SEQL 5E1IA 1YY9D 3QXUA 1J48A 1JPST 2G9HB 1IBGL 3D0LA 2XG5B 3H6JA 1BAGA 3CH1B 5IG7A 1F4YL 2XVGA 3B2UC 1T7WA 1QBML 3LNDA 1UD6A 2EDFA 4JO5A 2F53E 5BRZB 2MSPA 3HN3A 2CBQA 5SWZE 3QEUA 5HDWA 3X11A 4DZBB 5LJYH 5DRWA 1E6OH 4RDBA 4ZW8A 3ZKMD 1E9QA 2PCPB 4MWFB 4AZ8B 4NQTA 4W9JC 5D93C 2Y5TB 5DK2A 5EC2A 1L0XA 5MI0B 3AC0A 2GY5A 4FFWC 1I1YB 2P8PB 2WKGA 3S6CA 1U58B 2OBGA 1FSKC 5LCVL 3DHUA 5HJ3B 1KDJA 1WD8A 1BFSA 4S1RL 2OJEB 1IM9B 5DD1L 2EEBA 4YHOL 3TU6A 1R5VA 3SZKC 1Q38A 3VG0L 2QQKH 2AEOA 3EGXA 2Z7YA 5DFVD 4Q4IA 1NGWA 4JFVA 2NUTA 1IBYA 4WCYL 1E9PA 2PPEA 4PM1A 3ZSTA 2BP0B 2FIRT 1YPZA 1OSYA 2L0DA 2RGSA 1WISA 5G5DA 4DP0X 3E1ZA 3PGDA 3V6OC 3JV4B 5ICXB 3LEVL 3NJJA 3GK8H 4UDTB 3PL6D 5E2VH 3WLBA 4X83A 1L9OA 5E56A 2VRQA 3B9KC 1E5BA 3WJLA 2LT9A 1P5UC 1X7SA 1DJYA 4JL2A 2GVYA 5HI4D 1JYWA 4MQXC 3SDXE 4RGMC 4Q6YA 4F58H 1FZOB 2GBUA 4N20A 2WVUA 4M5ZH 5EHFA 1PSKL 4JDTH 3W11C 4M7LH 4XNQB 2E9IA 5JIQA 2H32A 2GK2A 3ESUF 3BXNB 5E2UL 3IMTA 1XF2B 2N01B 2DQHL 2FJHB 2YPLA 3SCMB 1U2YA 1NDGA 2YLHA 1F56A 2WXMA 3SDYL 3HVDA 1TJMA 1GJUA 3H2PA 3H9SB 1QFWH 3P0GB 1PZCA 3SPVB 4QOKD 32C2A 3I02A 1LO2L 3D69B 5JOPE 1VADA 1S7VA 1B0WA 1A3LH 1DSWA 3DXAE 5B4MD 1FFQA 3N44B 3DTXA 1H6EA 1PW3A 4D2NA 1T89C 4TOYH 3G5ZB 4PS4H 5LDUA 2OL3H 4GKZB 1KTDB 1ETJA 4M8QB 1X5YA 5CU9A 2R1YA 4ELMB 3P4MB 3FUNA 2D3VA 4LSSL 1A7QL 1SLXA 4XTRD 2BIPA 2IBBA 4J28A 2EC9U 4R8WL 4JDZA 4L3CB 3U82B 3A6OA 1S9XB 5E08H 4V2CB 4Y5XC 5IESL 4YPGA 1KEGH 1NIEA 5BQ7B 1Q9OA 4KBPA 1BFOB 2VLRE 1IE5A 4JFFB 1O7SA 3GIZH 3BDXA 3L3DB 3L08A 5GZOD 4GG6A 5I19L 5SWSB 5J4MA 1RK1B 3T1WA 3SY0B 4XP9L 4HJGA 3N40F 3TF4A 3B7RL 4MMZA 1DO6A 3ARFC 1ZDSA 3DYMA 3ARVA 2FBJL 2Y5EA 2JK5B 3I3EA 3IJ8A 4MLIA 1BM7A 3AY4A 4JFOB 3HPLA 3ALWA 4ADGA 1K72A 2C9PA 2VDLB 4NKOA 4OZHE 4QRUA 2O6EA 4IHOB 4DN4H 4XMPL 1XXFC 3PL6A 2C3HA 3RL1A 4DZ8B 4WJ5B 4ZUTA 2O6PA 4P5MA 1WA0X 5IW6B 5C1MB 3HS0C 4ZMAT 4XVUC 2CUAA 3WFBL 3BZ4A 3X17A 3QG7L 5AWNH 3WIIL 4DGWC 1MUJA 3ZBMA 2D4FA 1FC2D 2AEPL 5ERWA 1FVEA 3BT0A 3HRZA 2QZ5A 3M1BA 4R7NB 5JPMC 2Q0ZX 4ONGL 4PJIB 4E41D 2ROYA 2YFNA 5CEZE 1UWGL 4PJEA 2AQ3A 2YOCA 5DJ8A 3P0VL 3S5LB 4QOKA 3VFMB 1DCEA 5CJQL 2OMUB 2I7OA 3PLYA 3SE8H 4WVRA 2HB0A 1KNOA 4HHAB 1MHHA 3OR7A 4XOBA 1ZS2A 2APTA 5EFIB 4LVOC 4RMQA 4XX1G 3S7GA 3V0VB 5DSCB 4J2QA 2DIBA 4W9LC 4YDJA 4IRJD 3CZNA 2GCYB 3TF7C 2XFXA 3QHTC 4GAGL 4WK4B 5F7YC 3CHQA 2J72A 5D2NB 2UY7B 1S8DB 3KPOA 5JOFB 1CXKA 4E9YA 3GHBH 2Q7NA 5TH2B 4ACPA 4U7MA 5C0JA 3JWDC 5F7EL 1CZ8H 1OCWL 3QJHA 4X7TB 2F8OA 1BIIA 4RIRB 2PCYA 1S78D 2HT4C 1W0VA 4N8CL 1F4HA 4CU6A 2I69A 2PN5A 3GIVA 4MBOA 1N0LB 3EJTA 4WWKC 5MENE 4FHBD 6TAAA 3G08A 2XBTA 5GZOA 3I9GH 4I1PA 5GISH 5CJ8A 4NPYA 3OJMB 2XQYG 3DJRA 3VAEA 3HVNA 2WSPA 3IDNA 3SKOB 2Q7YA 1A7PL 1XR8B 4PW9A 3TIEA 4OJYA 4JR9L 4F9LA 1D7CA 1OTTD 1XGYH 4KROD 2F8XC 4L9DA 1Z9MA 1JMZA 4LVHC 5GSVB 4KKQA 1AY1L 2Q7AA 1JN6B 4OZ4A 2YARA 3VDBA 3D87B 5ANHA 3K2KA 4ENED 4X0NA 3TBYA 2EKSB 3MFFA 1IRAY 1J1PH 5FLUA 1QEWB 1RIHH 3I9AA 1IGFH 2F61A 1X6NA 3BKYL 3FT2A 2HN7B 1I8MA 1BGXH 3FUEA 1FZMB 3WY3A 4Z6AT 3G6DH 3QPXH 4QIRA 4XVTL 2IALA 3E7JA 3NCFB 3C8KB 1A6UH 2X7LA 1HEHC 1CG9A 1OTUC 4JKPL 4F93B 1H5BB 4X8CA 3WV0A 5BZDA 3MLYL 2Z92B 1RLWA 4KXBA 2BVYA 2XBDA 4OT1H 5HYEA 2H41A 5IVXF 4E41A 4U1MA 4DP6X 2I5YL 4D8PA 1RJYA 5MERA 1WHOA 3IGAA 4FC3E 2BSEA 3D05A 4BE6A 4NZUH 3C60B 3MV7B 4YDVA 1I82A 3R06B 2IO5A 2I32A 1E0OB 1S7XB 2F8IA 2QVKA 3CHRA 2G5BA 1YUHB 4YIQA 1QUPA 4X7SH 4NZTL 4BFNA 5E2TL 5LVEA 3IETA 4H20L 4JFZL 4FFVC 2WWKO 3OKLB 4IRJA 2MWCA 4AQ1B 3DSNB 4N2BA 4PY7B 5F7HA 4YE0A 3SPCA 4O51B 1M2VB 5JHBA 2IAND 3MOQA 1MFCL 4U6TA 4NQSB 4Q6IC 4G9FD 4Z7UA 5FCUL 1H6TA 4M1GH 4YNYB 4I13B 4FA7B 2Y9RT 5DRXA 1G1KA 4L0PB 3GXDA 1QLRB 4B9CA 2AJXL 4QHMA 4X50A 2UZPA 4OGXH 5D6DC 1KIQB 2WM0A 2ZONA 5L4JA 3V5KB 3ZYZA 3A22A 2EVJA 4Q9RH 3KJ4B 3D39B 3SGDH 3MCKA 1ZD6A 4H5SB 4EZLA 1SMDA 4XNZC 3NACH 3WXVL 3TYGL 2A4CA 1P4LB 2WY3B 4EN3A 3MRRA 4F7TA 1T5XB 1UXWA 4OCLC 2F54B 4TNVK 5TK2A 3RBSA 1B4JL 4FYQA 3NSDA 1TTGA 1VCAA 1XD1A 4A2EA 1I7ZA 3ZT7A 1AR2A 1QWUA 4GI8A 4YE4H 5DVPA 5D5MA 3RILA 4KJWC 4DN3H 1N70A 4UANA 4FABH 3EOTH 4WFFE 1RLBA 3FQXA 4JM4H 4AQEB 3BO8B 3N1FC 1RFDL 1E8WA 2NXZB 3BKMH 4GJTB 5HYQA 1BM3L 1DN2A 4LNVA 2BIOA 2CKBB 5E0FA 5KSBA 1QABA 1JZIA 4HWEH 3U9UB 3MNZA 1FG2B 4HW6A 2C9QA 5HDRA 2MPAH 3JWDL 4HD9A 3ZE0E 5GS0D 2NXYB 1JTPA 3D3VD 4CSSA 1BWMA 2XPZA 3GJFA 2EVIA 5H35B 2JJUA 1G0XA 4CMMA 2OTPA 3FU3A 4ONFL 2YSSA 5CD3A 1CJYA 5C0DB 1HQRA 2Z34A 2ADIA 2UWEA 1PZ3A 2F74B 4I18A 5FWQA 5IMOA 3H42H 4GXVH 3GXMA 3NCJH 4HH8A 4LSRL 3LKQB 3PG2A 1H0DA 2X2HA 3U46B 3QQ3B 3L3IA 4IMLB 4HS6B 4NKIH 1RJCA 5SV4A 1DBJL 4BSJA 1A65A 4LBEB 1L9NA 3CU1A 2IANA 1SVBA 4XC3L 4QYOB 3GSWA 4HMEA 4WU5A 3T77B 2H8PA 1M1XA 1X5FA 1ANUA 2EYRA 3RWGB 5CJXC 4HPHA 2FB4L 4G9FA 2GFBA 4M6OH 3V4UL 4FQ2L 1IKFH 5DWUL 3HN8A 3O11B 4G1MB 1BMZA 1VACA 3QJTB 1Y18A 2UZIL 3K8KA 3IS1X 4HIXL 3LKSA 1RHHB 3N40P 3Q2LA 3IPEA 2A83A 4G6FB 1S5HA 3AS3A 2XVKA 3QUMB 4X9GA 5HGDA 4NRXA 4I4WA 5JHLL 3R19A 1USQA 1XB6A 2WLLA 5BZXA 3ULVF 4FFYH 3H7BA 2BIMA 5DI8A 5AYQA 3GKWH 5BS0E 4P99A 4PJCF 5CEXB 4GMSH 4TRPH 4WFGD 4GY4A 3S8FB 2Q76B 4WUUD 1FORL 1NIDA 1J0HA 5DUMH 3IDXL 3RAJL 4R2GD 5E99H 1CIDA 4J27A 2FGWH 3ZDYF 1NINA 4DNLA 2X4RB 1H3PL 4ERSH 4RBPK 1P4UA 4AIXA 4G9DA 4YHKL 5FV1L 1EVUA 3ATEA 3ARSA 1PEWA 5GGSA 5BVPL 3KG5A 4OZGB 2XX1A 4G6JH 2HUEA 1KB9K 2LW3A 3LHPH 4FFZA 3GSXB 4JY5L 5IB2B 3QQ4B 4NQCB 4L3EB 2L8AA 1WPCA 3VWKC 3IFLL 3GBMH 3ZTJG 4U1LB 2X6UA 3HBQA 3D3VA 3OKMB 3EOBB 3UJJL 3FO2B 2BWDA 4TTGA 2CLVB 2FK9A 1EGJH 2JQAA 4TQ8A 1BVKA 2DBLH 4HEPG 5HVGB 5EEZA 3SYQA 2D31B 5LGJB 1BXXA 5GGTL 1ZAGA 3RGHA 1P9MA 3C6LB 4WV1C 1YNLL 4MA3A 2EC8A 3SYPA 2X1WL 4NOBA 3I75A 4UV4L 1VPOL 3FC8A 3GNMH 1L0PA 4OAWA 4AUUA 3LKPA 15C8H 3QJRB 4ODVL 1V7ML 4FJ6A 4X99B 2AXHA 5JPNB 2H26B 3DWTA 3LDBC 4M6MH 3WIHH 4HD5A 4PWGA 3WN6A 5FYJD 3WS6C 4FXGB 2CLRA 4QGYA 1L9RA 5ESVA 1KB5A 2E4FA 2YOAA 4A7SA 5HDBF 1GAFH 1G7PA 3K74B 3CN2A 4IRSD 4MRCA 5DLML 3IE9A 5I2IA 5EIVA 5C6TL 2JMRA 5BJTA 1BHGA 4HKJA 2JB5L 4L8SC 2OLDA 4RMVA 2YBRA 4IKJA 3ARBB 2L3BA 3H2QA 3P73B 3RTLA 2RIKA 4UIKH 1MRFL 4XB8A 4KOCA 3A0OA 1DP0A 2EDRA 4YHLH 1QACA 4DIXA 1TZIB 1NPJA 5HHMD 4HFWB 1R0AH 4X42A 1BAFL 3LIZL 2VXVH 4WUUA 4X8GA 4RWYL 5FA4A 3UBXG 1NFDF 4BKLB 1SUJA 4JK0D 3P3UA 4JHAH 4WHTA 3EYUH 4WWID 2R29H 1EZLA 2YUWA 4JRWA 3RDTD 4JW3A 3X12B 1L6ZA 4DEPC 2DQEH 2D9CA 2DEXX 3ZSSA 5EWIH 5EEWA 2IQAB 4Q6KA 2EDKA 3QWOA 4B27A 5BRZE 3QRGH 1HEJC 3H7LA 2DQCH 5FV2A 4ZMPA 2WC7A 2BP8B 4WHYH 3QO0B 4YSTA 3IVKB 2Y69B 3QUZB 4ZSOA 1F1AA 4ANKA 3PWNA 1NC2B 1W0WA 1IO4C 5BUAA 2ZAHA 4MDJA 3Q01A 2BSCA 3V9CA 5A16A 5IGXL 3RDJA 3FQTA 3U2IA 3ZYOA 2NLJA 1OV8A 1RZ7H 5GSRA 4GOSA 1ETB1 2IPTL 4K3EH 4DP2X 4FG0A 3ZDWA 4J6RH 4LAQH 2NY2B 4OLZL 2JKWA 2FWSA 3L1OH 4H0GA 1B2YA 3MO1B 2ARJA 5EOTB 3J7HA 1CBVH 1IM3A 4XXCC 2H2SD 1RP8A 4AUJA 5IFJA 4FNSA 2Y2TA 2A9BA 3TASA 1A66A 1PD1A 3FYIB 1G7QB 3ZTNH 4IRSA 2W80C