2B59A

The type ii cohesin dockerin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/structural protein
molecule keywords COG1196: Chromosome segregation ATPases
total genus 33
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2b59A00
2B59A 3L8QA 4WI0A 4WKZB 4IU2A 4UYPA 2JH2A 2O4EA 1OHZA 2BM3A 4FL4B 2ZF9A 2XDHA 4U3SA 1TYJA 2CCLA 3FNKA 4IU3A 1ZV9A 2VN6A 3KCPA 5AOZA 3KCPB 4FL4C 4UYQA 5LXVA 2VN5A 4UMSA 5G5DA 3BWZA 2VO8A 1ANUA 4N2OA 5K39A 4DH2A 1QZNA 2W1NA 2OZNA 1G1KA 2Y3NA 1AOHA 3F2LA 3UL4A 3GHPA
chains in the Genus database with same CATH superfamily
2GAZA 1P4IH 5EFIA 1YYLH 2FATL 2HVBA 2UUDH 3P3RA 2VLKA 3JTBA 4PY8I 1UXSB 1Q1PA 2CBPA 4MCZA 4YBLC 1JPTH 2Q5BA 2VR5A 1U3NA 4ZFZB 3CAFA 3DYOA 3T3PB 4HIIB 2D0GA 1F4WL 1MFEL 3MODL 1Q90A 4M5SA 1GC1L 2XQYA 12E8L 4ZFGH 4GXUM 2YD9A 3W5NA 3U4EA 4NSKB 4ZUUA 3QUYA 4JLRA 4KI5E 3P4OB 5DFTA 1AD9B 4YFLF 2DKUA 3HUJB 5EOTA 4IKKA 3F3HA 2HTLD 3UOAB 5C07E 4DSYA 2VDPB 4O2FB 1FFPA 2R0WL 2QPDB 5D7IA 3GC3A 2K9UA 2BVYA 4QRQB 3DUUB 1FF5A 4H26B 3O2DL 1S9YB 3QPKA 5DRZA 3IDXH 4PGCB 2R9HD 2HCZX 2RCSH 5IQLA 3F58H 5JTWA 3BKML 2ZONA 1U3JA 1MEXL 3QIBB 1J8KA 2C1PB 1OTSD 1TQWA 5IFHH 1P5VA 4NBYB 3GRWL 5DZVA 1UB5A 2YUVA 5FV2A 3U0PB 5E2WL 1PU0A 1I8IA 4JM2F 3MMEB 1MAMH 3UAAA 5CP3H 4O58L 1FZKA 3NESA 1XGTA 4WJ5A 4F7KA 2DF3A 2GB2A 2UZYB 5GGTH 1QBAA 5EN3A 2J8UF 5IW6B 1NINA 3NGBB 5IMKA 4KY2A 4JE0A 3WNIA 4KRPC 1L9PA 1ZVSB 4D9LH 5FCUH 2WIIA 1IIIA 2XKNB 3QDME 3ML9A 4RBPK 2CUAA 5I9QC 4C4KT 4NRYA 4I3RL 4B3EA 1R3HA 1F8TH 5DS1A 5AKRA 3P02A 5DRNB 1XZ0B 5IFAH 3ARWA 5IVXE 5DS8A 4N2KA 4M03A 2KQMA 1MFBL 1LQSR 4FQ1L 2J44A 4N0YH 4NM4L 1XEDA 2DBLH 3RFRA 5ES4B 5I19H 1XH2A 2DTSA 2O61A 4KC3B 4X6DA 2QQLL 3LEYL 3TJPA 1N10A 3NCBB 1KCUH 3KPLB 2V9QA 4KAQH 5EF1A 4E0RA 2H47C 4I9WD 3FCSB 1XHHA 1T1ZB 2V2XA 2DJ4A 1WCQA 3MYZA 1IBGH 4WFEE 4XMLL 1CBVH 3A3YB 4KDWA 1N8ZA 1TTAA 2ZUUA 1ANUA 5F6IC 3QJTB 1W6LA 4APXB 2WVVA 3MJ7A 4NZFA 4HBCL 4Y2OB 5AKSA 4R3SA 5H35B 5FHBL 2COQA 3NCJL 4OVUA 2OBGA 4LP5A 4BCZA 4EI0A 1CMOA 3GMPB 3QW9A 3BAXA 5EU4B 4YSEA 2WN2A 4KZCA 3UJJH 1QSEE 3HC4L 1WC7A 4LLUB 4M5YL 2MOQA 3FO9B 3IBEA 3L9EA 1JRHL 1UEMA 1XXFC 3TA4D 4JFDD 1KNOA 1ERNA 1HC1A 2YSTA 3CFKB 5E2UL 4KNQA 2D31B 4U1LB 3NIGE 5DGQA 3CIAA 1TFHA 4PRHA 5EORH 1J5DA 1W91A 1DQML 2VZUA 4NUJA 4YR6A 3CZFA 5IROD 4OGZA 1WAAA 1OLLA 2W5PA 5IW3A 1JBJA 2IBGA 5CZXD 5DZLA 5AAMC 1QPKA 3F12A 1L9NA 1AKJA 1CGTA 4RESB 1JPFA 1QWUA 1UADC 5I1JL 1CYGA 3WHXA 2F5AL 4ZTOH 3DV4B 2NUTB 4QRUB 2YUZA 4NWTH 4R26H 2DH3A 4ERSL 5KAQF 3U9PL 3JXAA 3RZCD 1OB1B 3CDZA 1AO7D 3MV7B 4N87A 3GRWH 4PB9H 3VXOB 3O3AA 2H2SD 4HKZB 4LOUC 4OJFL 2SODB 2HFGL 2UWEE 1ET5A 4GRWB 3DDFA 4NCDA 4DO5A 1QSEB 3Q1EA 2YD8A 3N04A 1A5FH 4O02A 4Q6KA 5DD0H 2XI9A 1QLRA 4I18A 3JTSA 3O4LD 4EDXB 1UD4A 3TCXA 2H41A 2NYZA 2B59A 3FQ4A 5KYWA 4ONOA 3F83A 4BIKA 2X41A 2H6PA 5HVWA 1D5MA 4JQVA 4W9HC 2EUWA 3AS1A 3CN4A 2CGZA 3L48A 5LG6A 2OJEA 3OX8B 5G4MA 4PG2A 1IMHC 4R7DB 1X7TA 1T5WB 1HQ4A 4FFZL 3NFNA 4WK2B 1QSFE 5L8LB 1MW1A 1FH5H 2XN9D 1LO3L 1QA9B 2UWEF 1LNUA 2OZ4L 4R8WL 4FQJH 1RLWA 4EI6A 1TCMA 2WQVA 2IDSA 4HC1L 1IM3B 1P84J 3B2XA 1FZJA 4LSSH 5GHWL 4I3GA 3PUCA 2WYTA 3OB8A 4QOKD 3IXAB 4QXGH 3C5XA 2E56A 4M7JL 3GHBH 4A04A 2OMBA 3OZ9H 5C9JB 4P49A 3NCFB 1CDYA 4F15B 1JMXA 3S36X 3KPTA 2F74A 4P04A 4Y5YA 2WGXA 4PJHB 1BLNA 3Q2VA 5FO8B 1G6RA 3MLVL 1R3IL 3JWDH 3LNIA 4JW3A 2IGFH 1XFPA 5GRJL 3UPCA 1JHLH 4A2GA 3VXPB 5BMFL 4K9EL 4Y19D 2C3XA 4XC1L 5B7MA 1AGEA 4U6XA 4IK7A 1REIA 4DQAA 3ZE1F 5I1GH 2VXSH 5LNDA 3L7FB 3VMOA 3O4OC 1A3LL 1JPSL 1J8HB 2WO4A 2D2CC 3GXMA 1KYFA 4WSJA 2QLVB 3QBTB 1VFBA 3RNKA 2VDRH 4UM9A 5T3ZH 1S7SB 3T1FB 4IBLT 4NM8H 4FMVA 2W8CA 1WHPA 1WFUA 1BYOA 4XC1H 4X83A 3U82B 5F1IB 4XNDA 2HB0A 4X6CA 4AMKH 4KVCL 5C3IA 5L9DH 1BYNA 2YD2A 2V5RA 4OGYL 4I7ZC 5I0WA 5BO0D 3ZDZB 1W16A 1DJGA 3WFCH 4NPKA 4YSCA 3LD8C 2EDLA 2GK0B 5DRWB 2ATAA 3CDYA 1MJUH 4HW6A 4PGDB 4F2ME 1UXLA 4NM8L 4F7TA 2YPVL 1SJHB 4J3BA 1JWMB 2XKSA 1UKQA 4PJ7A 3GT6A 4YE4H 4GKOA 1NIAA 4WUUD 3QDMA 2AQQA 4ZMVA 4M56A 3SYOA 5AB2A 4F93B 3AZUA 3I74A 3GUTB 4ZX5A 2PPAA 3L17A 1XIWB 4ZS7H 5BXFA 5DZNA 3MRNB 3VDCA 5D2LB 2BWQA 1ZTMA 1NAKL 3O3EB 3FO1A 3N1FC 5E6IC 2WBJC 4GIOA 2F68X 1IGJB 3HE7A 4LQ1A 4XZUA 2ZSWB 1F11B 4ZFOL 1IKFH 4PRPD 4ZXBD 2G2NA 2BLFA 4FQXB 5GISL 2OV0A 1NMAH 3GIVB 3CFQA 1WLHA 2VLRD 3T09A 4X9FA 2GBAA 4OCMC 1PKQA 4POYA 1G0YR 4HS8L 4OTXH 5BS0B 4JAMB 3SGKC 5FX3A 3TJEH 4RA0C 4C83A 3TYGH 3SJVE 3DSNA 1KG0A 4R5VA 1YJDC 4M7JH 4XO9A 4Y16C 2YQGA 3FCGA 3ZHKA 1RZ8B 5G4NA 3D2UA 5CZRA 4YSQA 3VFTA 5EEZA 1PY0A 1XCQA 3HR5B 3W9EB 2YLKA 1X5ZA 5HPOA 4KJPC 4UV7H 1TJHH 4AEHH 4C55A 4G59C 5IMKB 2X5PA 2Q6WA 3N55A 5K9QI 5DEFA 4X8CA 3KPRE 2R2BA 1DSFH 4JGMA 2NPLX 4N8VA 3DURB 5I5JA 3ULUH 2P8LB 1NFKA 3UFIA 1XF1A 3QJUB 5CSGA 1YO4A 3AS3A 1HWGB 3EJPA 4OZGF 4QOKA 4LSUL 2ZSVB 2I07B 2Y6SD 3HZYA 1S3KL 3GSQA 1U58A 3SB3A 3QZLA 4U4IA 1SBSH 4AJVA 1ID5I 5C6WH 2ICWB 4KO7A 4N8CL 3ZT6A 5DJYB 3X14A 2VW7A 5EEWA 1MQ8A 2CXGA 2G5BB 3MCKB 1X9LA 1DFBL 4GQRA 3DJRA 2OSWA 2EC9U 2YAFA 1MCPL 2GJ6D 3H9SB 3T65A 1T1YB 4NAJA 5EUOE 4I18C 5GRVL 5ALCH 4U6VH 2VDOL 4JPWH 1ZT4B 3FH7A 3T0XA 5AWNL 1MVYA 1JHTB 4FTDA 4HH9B 4NNPL 1Q0YL 3VRJB 1TVHA 1WWCA 2ZWLT 4EOWL 3NCMA 4YH6A 5FLUA 1G5GA 3SIKA 2WNKA 4U1LA 1PZCA 1EDQA 3UZVA 1TKWB 2NYYC 3DVGB 1KPVB 4P5MB 3O4LA 5EIQA 5HGDB 1ES0B 3D52A 2J8HA 4Q9RL 3QAQA 4AGNA 4GBXD 4UV4H 4YMPA 4QTHA 2B3IA 1AGDB 1JPFB 1GY2A 1W8EA 1W72A 4FKKA 2G0KA 2WXRA 2XIBA 5CILL 5DHYA 3ZDXB 2FJHB 1NCAH 2PPDA 4ONGH 3EBIA 2YA1A 4PU2A 5I75C 5LCVH 1JF1A 1UWXK 4YHIA 3FK3A 4JFPB 5HHOE 3B8YA 5C0CB 1IQDA 1JGIA 3T8VA 2HWZL 3IFPA 3ZRSA 4DJMA 1RIUH 1PD1A 4HUVB 1GS6X 3DTDA 5AVUB 4BZ1H 1JVLA 2ZCKL 4KI5D 4JY5L 3NQKA 3F64A 4C58B 3BGFC 3K0YA 1F86A 1RPKA 2FWOB 4GRWH 4L3ED 4OCLC 2B0SL 1KYOK 1RQ5A 4MS6A 5AAPA 4U1SB 5ICZB 2HLFC 1QRNA 5FKPB 2ADGB 5K9JH 1JZIA 5EOCH 3S0PA 4GP8B 3BUTA 3ZTEA 3ZSTA 5HP5A 3SGJC 4LESA 4ZZFA 2VAAB 4AQEA 2RA1A 4L1BA 2OR8A 3FQRA 4C56B 3ULVD 5C0FB 1I8UA 3L7EB 3HZKB 3U6XA 2MNUA 2ZOTA 3FPYA 2NXZD 4IW4C 4PV9B 5K9JL 1TJIH 1MRCL 1Q9WB 2NQDA 4WW1B 4HCGA 4TPRH 3SBRA 4P2OB 3SPVA 4DK6A 3C08H 1U33A 4MNQB 4DEPB 5EU5B 4AH2B 1IGFL 1XR8B 1G1CA 3SE3A 1XV8A 4J3UA 5E9DB 5GRZA 2CDFB 5TF0A 1E6JH 1OGAB 7FABH 1RZGB 3T2NH 3POCA 2BP8A 3CVBA 3RIKA 3GMQB 5G5DA 5GS2H 4DUXA 3NH7L 4DFHA 4PIRF 4FFYL 2O6DA 2VDOH 4JPWL 4JGJA 2YJQA 3DARA 5HGGS 2YPLE 1E28A 1ZLSH 4YPGA 1FL3B 2IOIA 3CBRA 2VZ1A 2KQNA 5DWUH 3RGVC 5JNYB 3O9WA 4PGEA 2FNWA 3OAYH 1VGEL 3LH9A 3LIUA 1YEIL 3QXAA 4NQXA 3ZJAA 2G2RA 3R1GL 3BZ4A 1DBKL 2W0KA 3BKCH 2X6CA 4WU7A 3DMMB 2X4SA 4MYWB 4KV5E 4F2FA 2O6PA 4WWPA 4HS6B 2CKBA 4FZ8L 4Z7WB 4X8JB 3KPSE 2WZAA 4XCFH 4JKWA 4QNPF 2ZOOA 4X6FB 5CJOL 3S5LB 1FYHB 4PWIA 3LKRA 1V3KA 2X05A 5IKCA 2NR6C 4RFNC 3WLBB 1AGCA 2VC2L 3S96A 4G6FB 4B9IA 4IBUA 2VLRB 3HNTL 2QVIA 1U8QB 2ORBH 3BP4B 3BT0A 4X4ME 5HHPB 5J1AA 1UUSA 4YJZL 4NQVB 2CGRH 2F7OA 4I0PC 1IC4L 2KLSA 3V4PA 3GUTA 1SJHA 4XRCB 4OZFA 2YAPA 1AZNA 2DQTL 1LK3L 2CO4A 1HAWA 1AZBA 1NC2A 4KY1L 2OA9A 5B39B 3HFFA 2QKIC 2GHZA 1L5GB 5CFAA 2I9TA 1AS7A 2E8ZA 3H2PA 4OSUH 2CH8A 3QHZH 3ZIMA 2LABA 4QTIL 3DX6A 4M4RB 4MAYC 2EABA 4PJAA 3NZHH 1V3JA 2WOBA 1ECYA 3BQUA 2PYED 1LEGA 1UTDA 4KUCF 4MJ5B 1DJSA 3V6FA 5L2JB 2KL6A 2VLKD 3NJFA 4G2AA 2J3SA 4N90D 1OZTG 5JORA 4HU2A 4AYFB 25C8H 2DTMH 2W60B 1KTRL 5DVLA 3V6OC 4X4XB 1BZ9A 3B3IA 3QIBD 3BUQA 3FT2B 1NMCC 2OK0H 2WVUA 1FL5A 4PBVC 2C9SA 2XWTB 4PG2C 4QRBA 2LW3A 3FFCA 3AWEA 1E6JL 4LF3B 2W0FB 5FO9B 3T0BA 1LXMA 4QJ5B 1R34A 3G7TA 1AVAA 2F5AH 1KTDB 1P7KB 3G6JA 3MZGB 3W39B 4BFNA 4I4WA 2P26A 2YGVA 2R4RL 1M2VB 3CFEA 3F7PC 4ATTA 2P24B 1QFWH 3LNGA 2AJ3B 4M7ZB 4CBZA 2BOCB 2OX5B 1RJLB 2X53A 4QRFA 1NAMA 3MA9H 5D8JL 2X4UA 1IBBA 2AJSH 4C59B 3PRZA 3JWNG 3ZL4L 2KUTA 4TM9A 4U6YB 3UG5A 2L7QA 5CGMA 3S4SA 4A37A 4MB1A 4KZDL 5LBSA 2F53A 4U49A 5C0EB 3QUXC 4FQ2L 4NT6A 3L3IB 5F3HA 4R2GB 4UTAA 5E2TL 4FD0A 5EC1A 1D3CA 3O3DA 2A6DA 3U9WA 3DO3A 1LD9B 1KXQE 3N42F 1NGWA 4JRYA 4V1DB 5EZPA 4AYBA 2WWNA 4K55A 4QY8A 4IRSB 4WO4A 1SDDA 3FAXA 3S5YA 4P8QA 4NP9A 2MMXA 5F8RC 3QXDB 3N2JA 4P5TD 4UIKL 1AY1L 1A65A 1U8PA 3LZLA 4M29A 2X3CA 2ICWA 4BFJA 2IAMB 3IKCB 1XIWC 3KXFB 1N5YH 4PJ5D 2UY6B 1WHOA 1ZT4A 2HFFB 2A7BA 5C0RL 4F3FB 2WUCH 3STZA 3KLDA 2LTQC 4ZUTA 3MBWA 4LSSL 5GHWH 3OKMB 5J9PB 4R90H 2HVJA 2WXMA 5BRZA 2PWHA 3FHAA 2DS4A 4JFOA 1MNUH 3CK0L 2UZPA 4LL4A 1BJMA 3TWYA 2FO4B 3WJLC 1KTBA 1BG1A 3PWNA 5A2AA 1OF2B 1K85A 1ND0A 1YPZB 3UTOA 5C71A 1IEHA 1FG9C 3N41F 3ZZSA 4NBZB 4X98B 4GT0A 3GM8A 4MX7B 2JI1A 2Y2YA 3WN5B 4BM7A 3PDGA 5FA4A 3ZUCA 2X3BA 3NIDE 4BCYA 4QRPE 4P9ML 2VR6A 2PCYA 4WHYG 1U8MB 1R5WA 4ODWA 3QWQB 1TZAA 1IFGA 5EZJA 4NUGH 1ODUA 2IMMA 1J87A 1YRKA 2CLZB 5D7KE 4HFUL 3FDWA 5MI0C 4KQ3H 4HHWA 4MSWA 3PJSA 1C16A 4NQED 1A0QL 5CMAB 5BOZG 2EKSB 3JYCA 2FYYB 3F7VA 4DGYL 2Y5TA 4CKVX 4FAAB 3MRJA 1WYJA 4QRRD 4DNLA 4O2EB 4U33A 4QXGL 3QCVL 1D7DA 4RGNE 2L0DA 5AQ0A 2VDMB 4LHUD 1TPXC 5DZ9A 4R0LB 1AI1L 1E40A 4NHCL 2YFOA 5KVGE 4KVPA 4NZUL 1UM4L 2AK1H 2FWSA 5T33H 2E5EA 1BZOA 3NIDF 3NPSB 3ZKMC 2X6MA 1JZ7A 1JNLH 3D07A 3FT3B 3N50A 1XO8A 3HZKA 4PB0H 3QIWC 1V10A 3HN3A 4N6QA 3ZL2A 1KC5H 2LT9A 2OTPA 3D3VB 4JY6A 3IPEA 3G5VB 3ECBB 1X5MA 3QEUB 5DHDA 3VGAC 5ESAA 3QCTH 4NB7A 2OMXB 2NY3C 3FTXA 2IDUA 3FUHA 4LHQB 3G9AB 1BQKA 2EIKB 2JCCF 1BOGA 5K5YA 5DHMC 3R8QA 4Y8AA 4QHMB 2UV3A 5L2KA 2BVPB 1GAFL 3PXLA 2VL4A 4EVNB 4JO1L 3VGAB 1M6OB 2Q7AA 4ELMB 5C0RH 1BFVL 5I1KH 3MO1B 3VA2C 3UXFA 4YPGB 5I0VA 4JJ5A 2YRBA 4MD0B 3O81A 4ZFFB 1YMME 3LS4L 3IVKB 1Q0XL 5ICXB 1NCGA 4P2QB 3KWTA 1GA2A 3QWRD 3W2DL 2HT3C 4ICWA 5IZ7A 4JPSA 5I74C 4BK5A 4D9LL 5IWLC 4PRPB 4ZXBB 3TASA 5I1LA 3EDFA 5FOJA 4GP5B 4TOYL 5FYLD 5CD3A 3Q6GL 1OVZA 4CNIA 1F2QA 4F8OA 2Z7YA 4QYOA 4CU6A 4W9EC 3D2UD 1HU8A 2ZP0T 3B4NA 5IFAL 4G9DA 1MHHA 3GINA 3EO0B 1BGXL 4YEEA 2FB4H 1YCSA 4QHUA 3FSAA 4WTWA 1PZSA 4YR6B 3FB5B 1CG9B 4H0GA 3ZSSA 1YYCA 1OHZA 1KCUL 4PJFA 5C7XL 5IHUL 2XZQL 3O8XD 3TBTB 1J05A 1IFRA 3AC0A 4OF6A 2VLRA 3S8WA 2BP5M 1G7QB 5IMMA 3KS0J 1I7RA 1IBGL 2ZT9C 2ZYIA 3QIUC 2H5UA 4XMLH 4XO8A 1CBVL 5EEXA 2HMID 4RRPM 2IV8A 1OM3H 1I1AD 4HAFA 5DUPL 4AYSA 5B8CC 2O5XH 1AYRA 3F7YB 2C7UA 4GQZA 4ODTH 3ARED 1S5HB 4NJAL 4R96A 4IIQB 4S11A 4EE2A 1W8NA 2XZQH 4G83A 3BD5A 3K4DA 1WISA 4X5LA 1C08A 5DCCA 3ZE2E 2YMXH 1WTGT 2FQFA 4OJEH 4MD5A 1R0AH 3KE0A 4YVUA 3FB7B 1X5JA 5DJDB 2LGNA 3O6KH 4ZQKB 3BQUB 1JG9A 5AWNH 5AG8A 1QQDB 3ZYJA 4OF8A 5DEZA 3KYAA 3H6JA 1SUJA 5IB1A 4WUUA 5AL0A 3TA3B 3P77B 4PB0L 4AYFA 1T4KA 3VYPA 4DGIH 3FZUC 3FRUA 5F7WC 1QEXA 3RL2A 4ZOEA 3L13A 2ALAA 3L3HA 1W72L 3OKNA 2D7PA 2I9LA 2NMSA 1E7VA 5DHVB 2AV1B 5LKNA 1NZRA 1HCFX 2H32B 3MLWL 5DJ0A 2VQTA 3TN0D 4M7KH 1NL0L 5GIRA 2Y9RT 3VFRA 1FH5L 1T5WA 5DD1H 3PXJA 5E4EB 4MJID 5GS0H 1KIQA 1Z5LB 4HYTB 3BH9A 4P2RD 2VITB 3VMNA 2UYLA 3ULVE 4Z7OB 3O3UN 3V0JA 3ZMRA 5F0MB 5JHDE 5AALA 5T3ZL 1K2DB 5E5UB 3LIZA 3TL5A 4XBMA 1Q1JL 1JK9B 2EH7L 3D25B 2J6EL 4GEJA 4PJAF 1PNDA 2KLRA 2YZ8A 4PRID 3DXAD 3EFDH 4JFHD 2VB5A 1XB8A 2C9XA 3KJ6L 5K69A 1HHKA 4PP2B 2NUPA 5LNEA 4PJXB 2GI0A 2WK2A 3NK4A 3SHSA 2V6HA 2HH0H 3LKNB 4XO3A 5GS3A 3NIFB 3W9DA 4UZGA 3MNWB 2PR4L 1ZVHA 3B5TA 4QHNB 1CLZH 1RVFH 3L2NA 3SBQA 3HI1B 1FJ1A 4KJQC 3DXAB 4MB3A 3PWPA 1H5BC 4PV8B 2R0KH 3DIFA 1IAOB 2WSPA 2Q0ZX 4I1NB 5TQ0H 2P5WD 3F5WA 2C4XA 2DWTA 2LE9A 2ZE0A 1UUNA 3MV9A 4QXUL 4PVNA 5T3XD 2FECI 3BAJA 4DN4L 3O8XC 2OQJB 4G8GE 2A83B 4X6EB 4LAQH 4Y9CA 1JI2A 4K3DL 2CKNA 1MZZA 3C08L 4HPYL 1BQLL 1DANT 1UA6L 1UWGH 2Y25A 2BCMA 3NJKA 4ODHL 4XHJD 5PAZA 3HCVA 1IO4C 1QBLH 2YOAA 4YGVB 3LEVH 5TQ0L 1AO7B 2LVCA 4IHBA 4XPHL 2BERA 1VZIA 4XNUH 4ZFOB 1RJYA 1XSIA 4OCYL 4YZWA 2Z35B 2AKRA 4Z76A 3DX7A 4GNKB 2DWXA 2O6FA 4HFWA 1IEAA 4E9QA 4YPJA 3TNMB 3Q48A 3WYRA 1RULH 4HWZB 3PWLA 4YHKL 3TJEL 2V2WA 3NBNA 4HGWB 1YPZA 3MSPA 4N68A 5T1MB 5SX4I 5DU7A 3MRRB 3DJ9A 5HHQA 3OJMB 2WB7A 1FA4A 2VZSA 4GQPH 1DVFA 4HWBH 1XF5B 3RIFK 1IJNA 4C56E 5D1QD 3GMNB 1OPGL 1Q8MA 4HJGB 1TQSA 3FO1B 3PDDA 5A3ID 2R2EA 1U8IB 3SCMC 3ZLQC 5L0QC 4A2HA 1DN2A 1JZDC 4PY8J 1N5YL 2NZIA 2Z65C 3D85D 1KT2B 1H5BA 2W92A 4GAFB 5FUZH 5J12B 1OAJA 2GC4C 5DD1L 3WO3B 1WEJL 3QYMA 4Q74A 1HIML 3LSOA 4KKCC 4MSWB 4NN7C 3W82A 4ZFQA 3W0WB 2QZQA 2OYKA 2B0SH 4DUVA 1G6RH 1GYVA 2H1LM 2UZXB 1R33A 2WQSA 3CMOL 4X7DC 5EOCL 4YSUA 4HSCX 5D1ZA 1E5ZA 3O45A 2XJLA 4AY0A 2ARWA 3DMMC 2R2HB 3VB8A 5DMGC 4C83B 1FG2A 1QW9A 1A9EA 3KW8A 3JWOH 4QRRE 4H25A 1PZ5A 2EO1A 2IOMA 3LN4B 2IMNA 4UNUA 2IQAA 3DJTA 3THMH 3VM5A 4DPBX 2X87A 4NKQB 1BD2A 4KQ4L 1VEOA 4Y1TA 5BV7H 2RB8A 3X1FA 3MBEC 3IMRA 2NTSP 4OCWL 3ZE0B 4EZLA 4F57H 2HX8A 1BEYH 3U6RB 4LRIA 3WL9A 1MUJB 3D3VA 2P80A 3DGGA 4AZUA 4KITB 1C5DA 1HWWA 4MA7H 5K1VA 3LIZH 2J5LB 3C9NB 3L9RA 4LEXH 1QHQA 4DEUA 3KYKH 1IT9H 2OW7A 2VT0A 5BZXA 4ECNA 1JXGA 5HYFA 2V7HA 1IGMH 5DQJA 2MWCA 4JHAL 4KVNL 5TE7L 2FL5A 2VQ1A 3QO1A 3NIFF 3X1NA 4FXKC 5CCJA 2AEWA 1YZZA 1Z66A 3F2LA 4IJ3B 1J86A 1RUKH 2Q8BH 1KB5L 2QKSA 5KAQG 2XN0A 4XWGH 2NQCA 4S2SB 2R1WB 1DFBH 4XPBL 2VC2H 3WY1A 3SPCA 3CN0A 2VE6B 5CSBA 4YZFE 2Y3AA 4JN1L 2GTZB 5FM5O 5ILTH 5IREA 3EO1A 4LCYA 1UM5L 3S3BB 1I9JL 4YAQA 1F1DA 3O41B 4OF5A 3QIUB 3AADB 3FTSA 3VFVB 2NY7H 5LGHH 1EO8L 2Z0UA 4LLAA 3S35L 1N59A 4OM0H 3CLFL 3FFDA 4NRZB 2EYSA 3K2IA 2VZOA 1OQXA 3LH8A 1BXXA 1A6ZA 2KC0A 2WP3T 5AW5B 3FSVA 1HOCA 3MODH 5AZ2L 2NSXA 3PHQB 1YEFH 4HDIA 4ZUWA 1CG9A 4Q9RH 3EJYD 4KTGA 2NY7L 4K2UL 1IGCH 4PJFB 4AJ0A 3M7OA 5L88L 2A9DA 2Y7LA 4ELKA 2YD1A 2J57A 3GMLB 2C1PA 3HG5A 3BN9D 3QJFB 2QZ5A 5C09E 1T5KA 2R1YA 3IWUA 4PRNA 3LNDA 3LKSB 3IXTA 3PGCA 2B8OT 2XN2A 4F7CB 3B6SA 5J11C 1TXKA 4L3CA 4R0LC 5GS1C 2Z7WA 4TXVB 1S5HA 1SJVA 1WTLA 3KNBB 2K3HA 4W6WB 3CHSA 3RRQA 3EF7A 4WHTA 2K1MA 1FL6A 3U2IA 2H2PC 3VCLA 3TNNA 1TSHA 1Y6MR 1J1XL 1RCYA 4ISVA 4L5FH 3HN5A 5IB1B 4R90L 3S5ZA 3UAEA 3MBXL 3H3PL 3Q8BA 2EIDA 4BH7B 1R75A 5DS8B 3STLA 3C75A 3W57A 4HJIA 1O6SB 4PJ8C 2NY3B 3NJXA 4XVOA 3B1UA 5H94A 1HJCA 2Z3FA 5F21B 2VLJB 1B0GA 3FCTB 1WRFA 3RY4A 2DW5A 3HR6A 1L9OA 3ZK0A 5L4JA 2H26A 4GAAA 5HI4C 2XV6B 2WN3A 3WI9A 4IDJH 1QEWA 5DUMH 1MJ7H 5E8PA 5ISZE 3HC3L 5CJ5A 1Z9OA 4XN8A 4ZNEE 1FNSH 1HK6A 1DQDL 2H32A 2PW2A 2MFNA 3CTTA 3BCFA 2FE0A 4DCQA 4OFDA 4J3XA 2DBLL 4OJDH 1CVSC 3NFPA 1S9VB 1DEDA 3ELAT 4BEIA 2QSCH 3DETD 1AOHA 4M1DH 2UYLB 4YBHA 1MHCA 5KSUB 2F7PA 5DJAB 1OSPL 1UENA 3H6AA 4IYKA 1U8OB 3M86A 1NGPH 15C8L 5C0ND 2Y72A 4FNUA 1VFAA 4JS7A 3BWUF 1AHWC 4ZOAA 1U8CB 3HPJA 4NHUB 1J8HE 1MXGA 1FORL 4RNRA 1TVBA 3IK2A 5E0FA 4XX1G 4QRSA 1P1ZA 4QXVA 1JUFB 4AM0A 1VFOA 1RPUA 5FYLH 3BP5B 2ERJB 1YLBB 2Y4SA 3EF4A 5E1AB 2HSIA 4J2QA 3QEGL 4DGVL 2B2XH 1G7MB 4PW4A 2CRIA 3TM6A 3TA3C 1A6UH 1OCWH 3DBXB 1ID2A 2OMUA 2Y36L 6PCYA 2ENJA 2ZCLH 4XVTH 2WLMA 1ACXA 5ICUA 1KJVA 3CUPB 1ZGLA 3OPZH 4Z95L 3FQTA 3QUKB 3O11B 2X70B 1S9XA 2LAAA 4NO0A 2Z35A 4OD2B 2DKSA 2IH3B 4UQEA 4G1EB 1WD9A 3D0VA 4B6ZA 1RZKH 5FKAA 3S96B 3HHMA 3EYUH 5TDPB 4BK5C 3BUIA 3EZ8A 3ME0B 2DIBA 4ONHB 4MQXD 1F8TL 4JFZL 1CFSA 2AF2A 2DI7A 2B9AA 3VFWA 1LDPH 4XNXL 5E1QA 4BUQA 5JPMB 4HGWA 5T1MA 5DMIH 4M02A 4HLEA 4ZMWA 4HJGA 4OCXL 4UU9A 2VDKB 3VWKA 3L4VA 2BNUA 2KPNA 1P4IL 2YEQA 3R0MA 4NSKA 2R39A 1TCRB 1YQVH 3AT9A 1I8LA 3FUFA 5B1JC 5FHAL 1OT4A 3P3TA 5E08H 2VL5A 4I3SL 1U8LA 4FXKB 3UBXB 1UEYA 2R51A 1DL7H 4LLQA 4OY9A 3UTPE 4E41E 2E27L 3FULA 4ZXBC 2BC4A 3NACL 4TTDC 5I8EA 4B53A 3IDJA 3GKWH 1F6LL 4XCNA 5EBGA 1HHJA 1QI5A 1WAEA 4WENB 2YSSB 3HNTH 1CTMA 2MHAA 3BW9B 1Q94B 2CO1A 3K72B 1DL7L 2JWYA 2X4QB 2WINA 1P5VB 3WMPA 4A6YA 4PUBL 5F96L 2N3JA 3FRPG 1RFDH 5F3FA 5BQ7A 1EXGA 5F8QC 2VKWA 2VQ4A 4U6XB 5I1CL 3IMVA 5F7UA 3GI8L 3ZKMD 4OSUL 4RGMB 3FB6A 3FONB 1C5DB 1BXAA 2YPKB 3LRSA 4L05A 4J3OC 2BVTA 5IB5B 2Z91B 1DCEA 1YYMH 4FADA 1CT8B 5EZOH 5GGTA 5BVJB 5F9WC 1X6NA 3DLQR 4Q0XL 3IGFA 5DZPA 2F53B 3BPOB 1CR9H 4LPUA 4UWQB 4K7PH 3ABKB 1WZMA 3L16A 2IWKA 5FGBA 1I31A 3EH1A 5D1QA 1OWWA 4JCLA 5T3ZD 3H3KA 2V7NB 3K8KA 1B2YA 4IGBB 5HHNB 5C2BH 5CM1A 3WAKA 4PWHA 4LZKA 4OV5A 3NTCH 2CWRA 4LSPH 2XQBH 3QO1B 1KJ3H 1MELA 4UIKH 4TTGA 5HVHB 2AK4B 5C9KA 1BA9A 3HNSL 5BZWB 2HG5A 3CGTA 5T5NG 4ZMLA 1A4BA 2VRQA 3S36L 1D9KC 5JZ7D 2EDRA 3P11H 2R1WA 3E8VA 3FTUA 4JM4L 2F54B 5EBWA 4EN2A 2J43A 4ODTL 2AP2A 1G7JA 3GI9L 2EDTA 2W94A 3OSKA 4NUGL 4X2UA 5TK2A 3ETBJ 1BVNT 3SBWA 4EN3B 1XEUA 2MIZA 1R0AL 3WJJA 1EPFA 1R3HB 2P80D 4Z77B 4HD9A 1PG7L 4FN0A 1WC7B 1KLFA 4GRLA 4LLUA 3KPPB 4UMGA 5H2BA 1WFJA 2G0LA 2XWJA 2EUXA 1YEHL 3J2PA 4LE8A 3F7KA 1G84A 1ND0B 4DGIL 1ZKAA 3GLDA 4X99A 1R47A 1WBXA 3GMLA 1GYCA 3MUUA 4DTGH 1UT1A 2GK2A 6TAAA 1P7QA 1AQHA 4JO5A 2QSQA 3MUHL 3AG2B 4NPYA 1YY9D 5DVKA 1NEPA 1GTFA 1JRHH 4JG9A 2WTRA 4WAFA 1UFUA 4LRNH 2QLYA 3EO9L 1D7FA 1EV2E 1I7TA 3DUHA 1G9NL 3VXTA 4PSPA 1CFQA 2GY7B 3GEWB 1XB3A 5EZJB 4PJEE 2R1XA 2XY1A 4HUNB 5CLZA 4MMYB 3FU7A 3P30H 5DYOB 1UZ8B 1R3IH 3AU0A 1XTLA 2F6AA 1Z9LA 1LO5B 3FTGA 4P5SA 5JXEC 4F9PC 4TMPA 2BNRD 2EDOA 2VZTA 3LKOA 4R84A 4P23B 5KSVB 1R17A 5KVFE 4G43A 5D9SB 5IQ7L 2WWKO 1X4ZA 2WTPA 1LO3H 4OUUB 4D9QD 4P5RA 4NKMB 1J0IA 2L7UA 1H8OA 1LJMA 2CJUH 2NDGA 4O2EA 1N67A 2VABB 3N85H 3SYPA 4EDXA 3CVHL 3SDAA 5JUEL 5A2IH 4RMUA 3AG1B 1ZLUH 1BZ7A 3AG4B 3BVNA 4JM0A 3P54A 3ZKNC 2F18A 5BRZE 3NJMA 1CR9L 4EUPA 4JQIL 2NY3D 1PZAA 2W0LA 2H8PB 3N9GH 1UQSB 3GSOA 3I02A 5HDQH 1NAML 4ES8A 5JIDA 1AH1A 3QIWA 5C2BL 1AQKH 1QSFD 3ARBA 3EBHA 5INCA 1FNFA 3RWGA 4BKLB 2GIYA 3SDAD 1V7NL 5KUMA 1MQKL 2MSPA 3CDZB 3T65B 4BUHA 3K6DA 4UZUA 1AOZA 2YPLA 1MCOH 3QXUA 3AXLB 4ODHH 2Z7ZA 4HBQA 4N0FA 5ABAA 1BFVH 4HUMB 4EVNA 3E0GA 4UIMA 4OR1A 4FL4B 3QB7C 4E2OA 1QASA 4ODXA 3QCVH 4FERA 1EIBA 3IXAA 5CEXA 3TT1H 4XVSL 4ZMTA 2FIKA 3QXVA 5GS1B 3NFSH 2QVKA 3HPLA 2FQDA 5LVEA 4MDRA 4N28A 1F90H 1GMIA 1YUHB 2F58H 2BVOB 2R7EA 2Y7QA 3V4VA 3ULSA 1CURA 1AXIB 5CN3A 1A3RH 3I6GB 1M56B 3DO7A 4LBAA 2KERA 3GNML 1MFDL 5E5LA 4K9EC 4MNGE 2A77H 1WICA 4QR7A 5SWQB 3HOGA 2P46B 3OZ9L 4UTBH 3EZJB 5LQBH 3R06A 1CK0H 5E1AA 2GITB 2QGEA 2BSSA 1A3RL 1TDQA 5JW3H 3WELA 2JB6B 3GSWA 1DVXA 1HEZB 1UD2A 2F8VA 3IM1A 2GVYA 3TT3H 4GUQA 3O11A 3GBMH 1UACL 2X40A 3RDTD 1MHHB 2C9VA 2CBMA 3NOIA 4Z78B 5I71C 4KKLC 5JHLH 3OL2A 1PEZA 1NBQA 5LQBL 3ARYA 3FQTB 3QUKA 4OZIF 3UACA 1OARH 2GSGB 3L3OC 1RUQL 2VDML 4JZOB 3ELQA 2IFFL 2HKHL 3B56A 5FK9B 4KFMA 4JFEE 3MLYL 4W1TA 2FHCA 5ALBL 3JV5A 3TPUB 5DWPA 3JWOL 3ME0A 3WTXA 3GPEA 2JB5H 2XWDA 3QJQB 4IJ3C 1OGAE 4WV1C 4TULH 4ZMNA 5C09D 5GRUH 5LWYH 3UO1L 1WZKA 2FR4A 2EE9A 1EHXA 1R5VA 3O3EA 2BY1A 1RZFH 4MXWL 4AEFA 1BWMA 4XCCL 1XR8A 3L5WB 4XB8A 1I9EA 3EJYC 5J4MA 1F58H 2L4OA 1EXHA 2QR0A 2EO7A 4YDIL 5JQ6H 5E9DA 3NA4A 2VCOA 4OLEA 3Q7JA 3K6SA 3QQXA 4X4MA 4XAKD 3GTTA 4V1DE 2VRAA 2GYSA 3EJUA 1JV2A 2VWEC 5IJCC 5KJ4A 4Z7NB 2IANA 5CP7A 3LQAL 1QBBA 4ENZA 2E9WA 4D94A 5F7DA 5A2LH 4L8DA 5KVDL 2JXMA 3VSTA 2EEXA 4U1KB 1RY7B 2NY1C 2DN7A 1ZSHA 4PS4H 2DQFB 3H42L 4PJ9B 1A64A 4URTB 3PABA 3RA7H 2WKOA 2X09A 4WWKD 5HYSB 1M7XA 2DOCA 1NBZA 4LLVA 4AVHA 1PZUB 5JOPE 2RAMA 1PZBA 1UXMA 2Y2WA 2G2RB 4TRPH 1YG9A 4LDCA 4BELD 5J6HA 4Y4FA 2AJVL 4NXKA 4HK0B 4LEXL 1U92A 5K33A 1OP3K 4WK0B 1OSZB 4I87A 3RVVC 3L1EA 3OC8A 3OKOB 2G75B 3GGWB 1I3RB 4X6CF 3MBXH 4YWGH 1JDAA 4YXHL 3IFNL 4TLUA 1LEKA 5I5IA 1H3UA 4KK8D 4P23C 1D5XB 4UDTB 1SJEA 4HJTA 2OM5A 3HI5H 1PVHA 3DX4A 2O6CA 5IG7B 1FJ1B 3RZCC 4FLSA 1Q0YH 1ZSDA 3ARSA 4H5SA 4M93C 2OL3L 1TZIB 3NZUA 3WLBA 3G6DL 4NQDE 2AQTA 3MV8D 3MUJA 1MJ7L 2VM4A 4IGBA 4ATWA 1GCFA 4AENB 1ZT1A 2WLZA 1B3IA 1FVCB 2CJ3A 3N44F 4WI8A 1FGNL 1GYUA 1O7DE 1RKRA 2IJ0C 4HIJB 4UI2A 4OAWA 5TE4H 3V95A 2GEQA 3VQMA 1I1AC 1QFPA 2C5DC 2J1ZA 2ZQKA 4WY7L 1DZBA 3RB7A 2NX5B 1JPEA 5ID1A 4XPHH 3KXFD 3FRPA 3RB5A 4JHBA 3Q5OA 5ALBH 2VDPH 3GRWA 3QQ9D 4R83A 4I0PA 4NKOB 4YO0A 2EC9T 2ZXEB 2WBKA 2XCMC 1SN5A 4JFSA 1T21A 3WY3A 2W9LA 1DQVA 1JHTA 1XGQA 2OP4H 1DUYA 1S46A 4V1DD 2HH0L 1LK3H 3ET9F 2CM5A 4LLYB 2Y06H 1MCPH 4KRLB 3IDGB 1I1FA 4WO4D 4YSTA 4MA1B 2DQJL 2VO5A 4HGKC 2XPGB 1TKWA 1F6FB 1J0YA 4XCYB 1U8NA 4GO8A 4NPYB 2OR9L 1ES0A 2X9ZA 1BOYA 4XNQA 4QF1A 1MWAB 5D70L 3P3UA 1R3LB 1DP0A 2E76C 4PP1C 4F58L 3QJHB 3GSQB 1K8IA 1ZLVH 2Y06L 5F97E 5C0IA 3EH3B 3P2BA 3KPOA 3JV6B 3U7WL 3S48A 3TU6A 3PY9A 4M8VA 5MEPB 1PD6A 1RL1A 2VDKH 5IP4A 2VDLH 3I2CL 3ATAA 3MV01 1AS8A 4BWUA 4KJPD 4IGBC 1J1PH 1SM3L 4K07A 1IZJA 2AJ3A 3DYMA 5AVRB 2FD6H 5DYOA 4PRAA 1BFOA 1EBPA 4HZLA 2ZXQA 4OT1H 1CQYA 4CBPA 3AJ7A 3ARXA 3T5WA 4Q9CA 2VKXA 1RZKL 4P23A 4WI6A 3X17A 5KSVA 4K3JL 1IGYB 4XPGH 4WEEA 4P5KA 4OGXH 4WEMB 3L3IA 2R0ZL 1OGTA 3UZVB 3H54A 5KVMC 3FFCD 3L3OB 3SBPA 4UDUB 5IY5B 4KNUA 3ROOA 1WS8A 3QUZA 3E80A 5C0FA 2IH1A 2MQ3A 4GAYA 2B5IB 4ODVH 4HJEA 1NCJA 2ZX9A 3KPQA 4B9FA 1CGXA 1IAKB 3DK0A 4N6RA 4PBDA 4F80A 4WO4C 5F7EL 2XVGA 4NKIH 1ZIAA 5LGHL 5FPIA 1KSRA 3PYCA 1CFTA 2H8PA 6FABH 4ZSOE 3VFOB 1SFDA 3BIBX 1GHFH 2XA8L 4XMZA 5LAXB 4RQQB 3BRFA 2AJXH 3U0WL 3ECWA 4G6KL 3N44B 5D5MB 4F9PA 2WVVB 4DKEL 2CM6A 4XBGB 2QPEB 5HHXH 3AXHA 2XKNA 4LFHG 4UIMB 4YHZH 3SO3C 1T22A 4CMMA 1S78C 1HE8A 3VD9A 5T5FA 4JEGB 4IS6A 1I1AB 1FIEA 2E6QA 2JJTC 4YUEH 3G04A 4WGKA 1NCTA 3ULSB 3ZHNA 4E41B 2CRMA 2DWDB 3HMWH 3QNXA 2HLFD 2J71A 5LNGA 3LRKA 4HC1A 4WW2C 3FQRB 4XNZB 1OGSA 4YHZL 5T3ZE 4NP4L 4EI5B 3QEGH 4DGVH 2YAEA 4F27A 5JQIB 4BWTA 3OXSA 2CGYA 3W11D 4FFZA 2FZ3A 3V4PL 4EQ3A 3CXHK 1ACCA 3FFDB 1DBAH 4NRZA 3WHXB 2WPGA 3OAYK 1RUMH 4M4PA 4K7FA 3LPFA 4Y7MA 3MJ6A 4I85A 4RGNB 4KDTA 4P2OA 3OPZL 4Z95H 5DZOA 2R23B 1FFNA 2YEZB 4WU7B 2J8UE 1XZWA 3SKUD 5CR8A 2DL9A 4MJJA 1SQ2N 3KVDD 1WT5A 4AQAA 4Q0XH 4I48A 1UKSA 4L4VD 1S8DA 5D7LA 2OMZA 3LH2H 5IVXB 2R4RH 4AQ8A 1UA7A 4Y5XC 2P45B 3QR0A 3QUZD 4MDIB 5I19L 3JTSB 3IRZA 1PCSA 3B9KC 4IBWA 4P3CH 1ZOXA 1TLKA 4LP4A 3S37X 2PCXA 2YJLA 4OLYL 4JFXB 4G80A 4W9FC 3SGEH 2J8UA 4ES9A 1E3XA 2PWEA 1WK0A 3VSQA 1QR1B 4MKMA 5CINL 1T0PB 4EIGB 4YSSA 3O2VL 1PFCA 4HJJL 3BT2L 3H1ZA 3RI5F 4S1DC 3QPQC 4Y0GA 1WPCA 2Q3AA 4C8XA 2KBGA 3IS0X 3DV4A 2E6PA 1DHKA 3F85A 2FECL 3HG3A 2QR0B 3KS0H 1ZXKA 3PNRB 1IQWH 4DUWA 4MCYB 3V4UH 1T0MB 5FW8A 2VYRE 3WIHH 5B1AB 4LL1A 5CLTA 3FQNB 4FNLH 3S34L 2ATKB 3UGUA 3KJ4B 3ZVVA 1R24A 3I9PA 3BLKA 3VACA 4NOFA 5BO1H 4YDJA 1MIMH 4L9LB 5A6MA 2VDQH 4L8CB 1MDTA 2R0LL 4FFZH 3O6FD 1MVUA 3TONA 2WLIB 3CFBA 3OAZH 5MEQA 2LU4A 5A40E 4GH7B 3TX4A 3KR3L 4HH8A 1KGJA 3EOBA 2V37A 3GRGA 2HT2D 5CBEB 2DYPB 3SJVB 2BJMH 1N64H 1X5KA 3LMJL 4HEPA 4KY1H 5KYYA 4BQBA 2OX5A 2CO7B 4P9HL 4AWJC 4MQSB 4Q6IA 5IFJB 3QRGH 4Y4FB 1X9QA 5EORL 1CL7L 4J3OD 1PLGH 5A3IC 5JUEH 2B1AL 3O9WD 2HRPL 4A2DA 4POZC 3A6BL 5AKTA 4PJHE 4NZTL 1WWBX 1TZIA 1A6TB 1D5XA 4UDTA 3UIYA 5IBTH 5JQHC 2AQPA 4TSBH 5C9JA 2GUYA 2PUQT 2A2QT 4KGLA 1G4MA 4ERSH 3NP4A 1HL9A 3AXIA 3AU1A 1LP9F 1G7MA 3LH2L 4R4NC 4TN9A 3BSHA 4F7TB 5EF0A 3WNOA 1CGSH 4EZMA 2OMUB 1QNIA 4EXKA 4P3DB 1H15B 2A4ZA 3T2LA 4L29B 4LEBA 3FU8A 4KK6C 1FZKB 3B2MA 1AR1D 3LDBB 1KBGH 2NLJA 1RIHH 5DEGA 3ABMB 4WSGA 5HGBB 3V6OE 3OLGA 1OSPH 2UY6A 3UGEA 3PXHA 3LV3A 4JM2B 1RH8A 4RZCB 2FX9H 4G1EA 2EXYC 5DUPH 1IGJA 3RNKB 1RMFH 3C8HA 2Y1ZA 1OY3B 3MA7B 3N41B 3GPSA 3RVVD 3BDYL 3FRUB 4FZEH 1TG8A 4HZ1A 4H1LB 4N2CA 4PJCF 5J8OA 4QXTA 3QDJA 4KZEL 3FQUA 3WO4C 1YMMB 2GCYA 2WUCL 1UD8A 1MFMA 4Z3JA 5KZCD 4OFYD 2BP0B 1IAII 2NR6D 3GZOA 4JGNA 2DAVA 1NIEA 3PWPD 3PQYE 1YN7A 3JV6A 1AGFB 3LEXB 4FJZA 5HHMD 4HWEH 1NAKH 5CFHA 3VW3H 3LPPA 3S88L 1KXVC 4Z7VB 5I2IA 2Z4QA 3NVQA 3PHAA 1BMWA 3P0GB 1MCFA 2VXSL 4GRWE 3P30L 3RNQB 4EUPG 5E6IA 3QI9C 4HT1L 4FLHA 5D4HA 2BPBA 3BISA 4Z7QF 4JKLA 2PF6A 3GBML 4RAUA 4PW3A 1ZVNA 3K0WA 3KXFA 4XP1L 4OZHF 3MJ7B 5JW4R 3BVUA 3GXDA 4K7PL 4KUCD 2BS8A 3PP4H 1U3HA 5DEFB 5J9PA 3RVTC 3P0VH 2EKSA 4UT6L 4XNYH 4PJXA 4PJGB 1SYSB 5D1XD 1TOXA 4DAGH 3DVNA 5HSFA 4P2AA 1F02I 3SDDD 2BFGA 3L3OA 1JN6A 3G6JF 3P2TA 4GBXA 4P59L 5TF1H 4UQ2A 3W37A 3CXHJ 2I7SA 1A1OB 1BX2A 1GAFH 2B1OA 4CKQA 3DK2A 3QAZC 5ADOL 1J5CA 2EIZA 4G8AC 1L9QA 5DFWH 4NO3A 5FYJD 3S36H 5JA9A 1E6OH 2G60H 1E5YA 3X1EA 5ABDE 3A6BH 1O7SA 1CFTB 1BMGA 1RV6X 5KG9A 3LQZB 4J7RA 3X13A 5AD0A 2WAQA 1HL5A 4JVWA 1SOKA 3CX5J 4E5XB 5L9DL 1CIUA 3VI4E 3CFTA 5CEZH 3RFZC 2WLLA 4A7SA 1U95A 1JIBA 2YEVB 2K6YA 1JCVA 2ED8A 1R3KB 1TQCC 4DP0X 2FSEA 5LBGA 1BYPA 2AXJA 4HFUH 2WLHA 3KPRD 4G8EB 4K3DH 2F58L 4NQCE 1TVHB 3TNMA 3F62A 3AREA 4B9KC 4E41A 1NFAA 1UWGL 3KHQA 3WNMA 4ELMA 1HZKA 4X9HA 3DSFL 3TFKC 1X7SA 5HJGA 1RFDL 1I1AA 4RFOH 2K6ZA 4YIQB 2JCWA 5FGCB 1X5IA 3ZL1A 2APVA 4WTZG 3K6IA 3ISYA 3Q9PA 5E9DD 5ADPL 2BOLA 2XBTA 2IPTH 1XB6A 2V0AA 1QRKA 1JD9A 2I60L 3N0PB 3HI6H 4G6AD 2JQMA 2OJEB 3HG2A 3UBHA 8PAZA 3US1A 3GF8A 4G6JL 3MRHA 1BQUA 2AJZA 1L0QA 2VDOB 4M7KL 5C09A 1JYWA 1JK8A 3RPBA 5CXPA 1MOEA 5IMLB 1S8DB 3ERXA 3P69A 4ZT1A 4JZJB 4MBOA 3LB6D 4ZPTB 1TU2A 1IVLA 4MLIA 4MJ6B 2NYKA 4QHUB 4ABWA 2WXIA 2A6JA 5I1JH 3J7HA 3TV3H 1BFSA 1Q1JH 2DV6A 3B1TA 3VE0B 5IGXL 3RU8H 2CHNA 3RFZA 2WTRB 3DKHA 2CUHA 4KMQA 3QEHA 5D7SL 2EH8L 1YEDA 4XBEH 3KL3A 1HOEA 3PAUA 5JOEA 3MACL 3BFQG 3ZT5A 3HB3D 3RGBA 3EFFA 4LSRL 3CG8A 3B9VA 4N86A 1B0IA 3Q8EA 1JTTA 1NUDA 2OSLA 3VGHA 4MZ3A 4WDIB 2PP7A 4HJ0C 4PRPA 4PV9A 4GUPA 4ZXBA 1CCZA 5I1LB 3CU1A 4R7NA 1CXLA 1X7QB 2K70A 3KYOA 4H0IA 2I25N 1GCYA 1PF3A 2G60L 2BFVH 2Z8VC 3MLSL 4EPSA 3MTRA 1GPOH 1PDKB 3D39D 4ZW5A 3BAYA 4JKKA 5DJ2B 2VM9A 3U4KA 4HETA 1BZ7B 4F57L 2YARA 3PWUB 1KFGA 4KROB 4DTGL 1WVZA 5I15L 3EOYG 5CU9A 4YDJB 4CJ1A 3A23A 2I9LB 4NLHA 3PHOB 3KYKL 2ATKA 1MRCH 5CEZD 1I7RB 5BCAA 4XX5A 1E28B 3ML8A 1OP9A 4HP5A 2APWA 5DSCB 1YC8A 3PFQA 5CBEA 4YHKH 4LU5L 2CHDA 4N2OA 3RWCA 4MD5B 5C0CE 3UERA 1UOKA 1M7DA 3L2MA 2A9MH 2EEDA 2C9PA 3TEYA 2TRHA 2CO3A 2WXHA 6PAZA 2KKQA 2PETA 5CEXB 1ZJBA 3DV6B 1JAEA 2LHAA 4HPYH 5EU5A 3L08A 4J4PD 5EN2B 5B1KA 4CVZB 1FNEA 4PJAE 4QRTA 1F11A 1FFOB 5GSRA 4Q6IB 1L6PA 5IFJA 1ACYL 2CKBB 1I3GH 1FC1A 4TSCH 3MLYH 3SCMB 2JIXD 4QCIB 4K9EH 5EBLB 3VRLF 4BA8A 2CA3A 1KY6A 4O9HL 3QWRA 2DKMA 2FGWH 4MQTB 1DVQA 1HIMH 5EEVA 1K9TA 2CIKA 4R2GD 2DZEA 4PJIA 3IFOB 4OIBA 4OZGE 1AS6A 5LLIC 2ZUYA 4M5TA 1CGVA 1P5UB 1HI6B 4XTRD 1U3HD 1K4CA 4RDQG 2MOVA 3TV3L 5CD5D 3E7JA 3MUGA 2G3NA 4J6RH 2GFBA 1JFQH 3BGAA 2VDKL 3LHPH 4N8UA 5L2KD 1GHFL 2XA8H 4U6HA 1BJ8A 1D9KB 2ADJA 3T77B 2YZ1A 1QFWI 1RERA 3BE1H 4AV0A 3PJLA 2OXGB 4GMTH 3HR5A 4OCSL 3W9EA 3BSGA 4U7SA 4A39A 1R6VA 4G9FD 2ZNWA 3D25A 5E6ID 1QR4A 3GS4A 3MV11 1E9OB 3LZRA 3PU7A 4CILA 5L4IA 1UH2A 4PJAB 3EHBC 2EH7H 2IDFA 1L3NA 3D87B 3RWFA 5LBSH 1S3KH 3OQ3B 1FRGH 4P5TA 4B3VA 3O6FA 4YSPA 2CD0A 2ITDA 2ZNXA 4OFYA 1MFDH 4PJDF 1NCHA 5CCGE 2BWIA 5D70H 1MHEA 3HZVB 1MPAL 3L1OL 4JDZA 1TJGL 4YDLB 2VXTL 3NJHA 2H6OA 4GG8A 4BH8B 4JK0D 3N40P 4FI6A 3H3PH 3LY6A 2BNQE 3F5WB 4IIZA 5EFIB 4WEUD 1S78D 3L5XL 5B38A 1D5ZA 1KCSL 3QR1A 1HILA 1IKNC 2Z0BA 2XVKA 3B7UX 3C6LD 4N0CC 3JTTA 3PFUA 1EHLH 4XRCA 5DK3A 4QXUH 1GSMA 1Z9SB 2M1KA 4MNGA 3ZTJG 5CUSH 2CCWA 2KI6A 1A47A 2WMPB 4IOFD 4NBXB 2GJRA 2YXWA 1RJYB 5KW9L 1KCSH 1OV8A 1Q9LB 4MVBC 4XCFL 3VD3A 2X2YA 3PP3H 5EOTB 1JV5B 1BQHA 4E9RA 2RBLA 3VRJA 1FLTX 3OKDB 5L2JA 5C6TH 4OZGB 3NSDA 3ZTNL 3PWLB 3VQ2C 3V10A 1BDYA 2HA1A 1KV3A 4WQOA 2ROXA 2F2HA 5HHQB 5BJTB 3RWDA 4PRHD 3TH4T 4Y4KB 5HYSA 1TMQA 4WY7H 5DFVC 1O5DT 3GZQA 2FH8A 5IBLD 5D6CB 4QTHB 1N6QL 4AL8L 3QIBA 1YEEL 4TNWF 5D7LE 3FFCE 3DBXA 4OZFH 1Z5HA 4CVXA 5HJDA 4YWGL 3V4PH 3VXRD 3MXWH 2G5UA 3V7AG 2V3FA 2FJUB 4Y19E 4LVHC 4GQ9L 3UZEC 3NUKA 4JFPA 2ZOUA 1JD7A 3BMWA 3QUYD 3TBSB 2K4WA 4PJ9C 2UZXA 1SJMA 4QT5B 4N85A 5AZEH 2CO6A 1WEJH 1G1KA 3HMXL 1KELL 3JVFC 1XBRA 2DIAA 5DD5L 3MXWL 5BUAA 1KGYE 2YRZA 4K3GA 4LSDA 1I53A 3BP7A 5J6GB 4RBPH 32C2A 1VESA 3QQNA 4GT7A 2EVHA 1IGML 3IJSA 3H42H 3O3DB 3SE3C 1LL1A 1OE2A 4C56A 4M62H 2UXFA 4TS6A 2B3RA 4FABH 3GXPA 3S5LG 1N3NB 4NGHL 3RUGA 2NRDA 2X28A 4YC2C 3VXMA 3DROA 2O5YH 1NJ9A 1QYGH 1YPZE 1MVFA 4Q4EA 4X9YA 4OI9A 1LGVA 1DR9A 3CFJA 1J8HD 1HOCB 5AW3B 3VWKD 1CFNA 2OK0L 4JG1H 4LRIC 3CVIL 2P52A 4N2DA 2UWEB 3S8GB 2E4TA 2GW5A 4U3SA 2VXUL 2AEOA 3SE4C 2W9EH 2CRYA 3EYQD 1OTTD 3GJFB 1WF5A 3OXRB 3A24A 4PLKC 2VLME 3ZTDC 5KVEL 4PR5B 1A21A 4ZG1A 4N22A 3ZQXA 3FQYA 1G87A 3B9KD 5G5DB 5E8EB 3HBQA 3H2QA 2Z8SA 1K3ZA 4NO0D 4NKIL 4EZJA 5LN4A 1O7VA 5KSBF 1JPTL 4NOBA 2BDNH 5KANI 4YHPA 3GSVA 4FMFA 3T04D 5KUKA 1RURL 3C60C 1T0NB 2LU5A 1ZGLM 3MFGB 3T0AA 4K8RL 5B8CB 4PJDA 1OB1A 1W6WA 4RIRB 4OBSA 4P5KB 2YBRB 2OMXA 1NOAA 1WGOA 1LWHA 4N2EA 1EJFA 2ZUVA 5HHVH 1MJJB 2DJUA 5I1IH 4NHCH 2V7NA 3RL1B 1DQIA 4JHWH 1WZ1L 5DJZB 4ELKB 4LDEB 2NW3A 5A1AA 1XF3B 4IJTA 4A7GF 3KPQB 4L1DA 4X6FA 4X9GA 3S5LA 2Q3ZA 4N90E 1E4XL 5IESH 2E7CA 3SE6A 2V5YA 1FNAA 1VZHA 1DQMH 4FL4C 2QQNL 3HS0B 4X42A 3WY2A 4ZFFA 5BW7C 4NO5A 4L4TB 4D8OA 1MG3C 3TBYA 5C2UB 2F54A 4S1RH 4JHWL 3ZE1B 5JW4N 2N1TE 4FG6D 1QW8A 4R7XA 2YD0A 1SY6A 1KPUB 2K0RA 5J57B 5D4JA 5J11B 1JHKH 3MV7E 5I71B 3WXVH 2HX9A 5E4EC 4CNIB 1BMZA 4PJ8B 1GKOA 5DVPA 3BZEB 3ALPA 3IGUA 4MA8H 1QSFB 5JHAA 2XWJB 1T83A 3WDHA 2OFQA 1BBJB 3GM0A 3MX0A 3Q13A 4APQD 2HFGH 2OI9B 4ANUA 2CHZA 1P0SE 1ZMYA 2AJUH 2OJZH 3R8BB 4NNYB 4Z0BH 1WBXB 3OKLB 5D1ZI 1GZPA 3MV8A 2JKIS 1PLAA 2X1OA 2D2OA 3GK8L 1JUFA 4AM0B 1E6OL 3NYKA 4JUSA 5FGCE 1PCXA 4G70B 1AQ8A 4WV1B 2FZ3B 2IWEA 2QQLH 5MHSE 2YA0A 1O9WA 2X7LB 2F74B 3HBPA 1CLYH 4IU3B 4Q97A 2ARJQ 5FGSA 2E74C 3VG0H 1BLNB 4JPQA 2R23A 1S7WB 3F7YA 2G9HB 3V5DB 5IIEA 3RVTD 1FFQA 2EE2A 1LO5A 3Q01A 3BUYB 4MMXC 3D1MC 5CLXA 1E42A 4HXAH 1OSYA 3SO5A 2Z31B 3TO4B 1BD2E 3FL7A 4U1MA 4YK4C 4B9YA 4GKSA 3RWFB 4OI7A 2GJ6A 2DB8A 3D2TA 1TZHA 1VFBB 3BD4A 5TFSH 3P0VL 2WTOA 3P77A 5IJKA 1MFBH 1D7CA 1AO7E 4ONHA 2XXFA 3S3SA 2FUTA 3UO8B 1JGDA 2QHRL 4P59H 3OKNB 5TF1L 1KMGA 4HWEL 1EAQA 4QRPB 1WBYA 3L6FA 3ZYIA 3W2DH 1QBML 3JWDC 3MUZ1 4Y1AA 1VADA 4FOMA 4NCC1 4Z7VE 3IS1X 4W6XB 4FLQA 4X6DF 4DKFL 4UU9B 1PLBA 3IGKA 4JRYB 4V1DA 4G3YH 2G3ZA 2VSCA 1YC7A 3JTTB 4BK8A 1SDDB 1KACB 3OV6A 1SFHA 2N4IA 4LLMA 1ONQB 3HKZA 4O58H 4EAEA 5ACZA 5JPNB 3AFLA 3WUZA 2VIRB 4P2YA 4P9HH 4IIQA 4CW1B 4X50A 3U0TA 1MFAL 1DQTA 1ASQA 2D7TH 1KJ2H 2QSTA 5G4OA 5JIPA 5AOLA 2DQCH 4LLDB 5FDWA 4DVRH 2JKWA 2P5ED 1B0RA 4KHTL 3SDCC 2QPFA 1PQZB 3OLIA 5KS9E 3MOBL 4PJGE 5CJQH 3SZ6A 3ZKSD 3A0OA 5BUPA 2NTFB 4K7PX 1HXKA 1BM3H 5DJ6B 3LS4H 4XI5C 2MKLC 5CEYA 2NNRA 2XN9E 2H0JA 2Z8WC 1IFHH 1MEXH 1R3JB 3GDBA 3OKKA 5EO9B 2EH8H 2WLIA 3CFBB 1ZWIA 4OF3A 2ATPA 5ESQA 1GZQB 2JMRA 1CDCA 2FCBA 3VD0A 3NRQA 2AQNA 2C26A 2WYHA 2BJML 4QKXB 1NGZB 4MZRA 5F7MC 4HAKA 4CN6A 4KZ0A 3VB9A 1JZ8A 4AM0Q 2OI9C 5FA4B 3GXIA 1QFHA 1HDMA 1TYJA 4I13B 5AVXB 3S6CA 1MFUA 4WU5B 3T1WA 4UT7L 4BDVB 3QWNA 5GGRA 4WKXA 3D48R 4FDWA 4XXWA 2PMZA 5SWZE 4ODBD 2MCPL 1BD2D 2O1AA 5DA0B 4R8WH 4PG9A 5I6KA 3S2CA 3CZSA 3SE8H 1VAHA 2XWEA 4BFBD 3ETBF 4UTAL 2EICA 3J07A 1FVDB 3DSFH 3OAWA 5I1DB 1EAOA 5IHZA 1H6FA 3NN8B 1Y0LB 2YGOA 3MJ9H 5HGAA 3ATBA 2CO6B 1UACH 3RPIA 2OYLA 4DVBA 3AROA 3WFHB 3WIFA 1R1CA 4R4FH 1RLBA 3KPSD 3VI3B 1OEZW 2J72A 4L29A 3CVHB 4R5TA 4TV3A 4AK2A 4HX1B 3QDGE 5D1XE 3FN9A 4DZBA 4JHUA 4HUXB 4GSRA 2ZUQC 3AAZB 2P5EB 5EV7A 3MJWA 4O4YL 3T3ME 1P53A 4Z7AA 1G7HB 4OB5L 2A83A 3QWOA 5KSBA 1N3NA 1AE6H 3EAKA 2QQKL 3WN5C 3JV4B 1N6VA 5D2NB 1NCWL 1U6AH 4TNVK 3SE9L 3U36A 3BVVA 1UA3A 2A6IA 3V4LA 2PWDA 1LK2B 3CFCL 3NIGF 3QIWD 5E1GA 3LSOB 3PWVB 1KGCD 3A4AA 3RWEA 4EBQH 4ZFOA 3SGDH 4MQ7A 1DQJB 3ESUF 3MLRH 3GHEH 4OJAA 1MCOL 4MVBD 4MCZB 3VI3F 4MHHG 5IJDC 2CRZA 3RTLA 2AFNA 2DQIH 1J48A 4L0PB 4HIIA 4XNBA 4LVNC 3EJSA 1KIUB 4JQXC 3U4BH 3O6MH 4A68A 1BM3L 4UILH 1FAIH 5C70A 3KLHD 2HJKB 4FTVD 4JJHA 1ZE3C 4TUOA 3GSVB 4OFPA 5CJ8A 1NBZB 3CBJB 4JQIH 3UX9B 4JCMA 5FFGA 1D9KD 1EEUA 1NTDA 3U1QA 3U9PH 4WWNA 4C57C 1LE9B 1URZA 1QG3A 1ZTXH 2QVFB 4FQQA 3U30B 4J3VA 2V5SA 4YX2H 3C5ZB 4HIHA 3EO9H 5B8CA 4F33B 3TBWA 2IWFA 4ZD3L 3D4CA 1R5IB 3QG7L 4KXBA 1YEGH 5TTRA 2NXYD 2FLRT 4HOWA 1DJHA 3CVCA 4XXDA 4Q9QL 2BMKB 4U0RB 2HJFB 4XPTH 2GABA 4L2LA 4ZAKA 2J1YA 3UROR 2FNBA 2OCJA 5IVNA 5EUOF 1OM9A 5IVZA 4KQ4H 3LTVA 1MJJA 4WW2B 3GXUB 1UB5B 3RGVD 3ULUC 4XI5D 2GT9B 1J05B 1M6UA 4MASA 4HOZA 4Q89A 1XF3A 3JZ7A 4CU8A 1I85C 4JO2H 3AITA 4HT1H 5FWRA 1GSKA 1DSWA 3BPCB 3WIHA 3QH3B 3FQ2A 4HIEB 4LRNL 3X2QB 2JF1A 3EO1B 1J11A 3I3DA 4LCYB 3PV6A 1UWEH 1KPUA 2YPLD 2HKFH 2JI2A 3WL9B 4KKQA 1AIZA 1NCAL 1T21B 2ZXDA 2LLLA 5MEOB 1OAKH 5DRNA 3K3QA 5I1KL 1HL8A 4ZQKA 2VDRL 1S7VB 2V17H 3T8XA 4CADA 1M42A 2NT0A 1QQDA 3UO1H 4P06A 5IGXH 4UOW0 2QV2A 3HPLB 4HDIB 4HWBL 4AYGA 2YAOA 4DZ8A 1U8NB 5GGVH 4DIXA 3U1PA 2H3NB 5EEUA 3MYJB 1KENL 1E4WL 1OAQL 3O4OB 1MHPH 3GMQA 4LSRH 4U1NA 4WV1A 3VYOA 5GS0D 1NANI 3TZVA 2VLJD 1IB5A 4X7FC 3WSQH 3B2UC 3BPLC 5BMFH 1YEEH 5IROA 1JZHA 2K8MA 3SEPA 4YBQC 3TEUA 2IH9A 2VE6A 4RVBA 1EEQA 3NSCA 3RWGB 3EDKA 3NRFA 2FK9A 5CEZL 2YQBA 4AIZA 1TTBA 2VQUA 4Q6IC 2E46A 4FI8A 2HRLA 3TO4A 3WXWH 4IBVA 3GXFA 4LCWA 5FYJE 3OWEA 4JJOA 4Y16D 1NLDH 3CZGA 1I1RA 3O2WH 1INEL 2WO3B 4LNRB 4G7SB 3ESPA 3ARRA 2BSEA 2GSGA 2FIKB 3FSOA 1MY7A 1SOSA 3E1ZA 3TT3L 4N2NA 4NS0A 1ORQA 2Y69B 4MD4B 3RX9A 3FXIC 4NQTA 1BV8A 3TGXA 3X3FL 1JGDB 1NDTA 2FD6L 3EFFB 3FCTA 4GSDH 2APSA 1PAZA 5LAPA 3ARDC 2MTPA 4GY4A 3FQ1A 5FM5M 4DP2X 1MRFH 1NICA 1UA6H 3HI6L 2AXGB 3WNNA 1GJIA 1BZDA 2RD0A 1QZNA 3VH8G 3IDYB 4GRLD 1WBYB 5HI5C 4FQXC 4F7EA 1A9BA 3WEXA 3R06B 4F9LA 4KJQD 4I1PA 1BP3B 3HHSA 2EEFA 3BUPA 2YGQA 3W0WE 3WIIH 1K4DA 1RIVH 2BRRH 3WE6A 3S3CB 2BSTA 3G5ZB 5T1KD 4IOIB 1QZ1A 5C07A 1FNLA 4ALAL 1PSKH 1JZ4A 3RPKA 1MKFA 5B39A 4M6OH 2ZJSL 4NRXA 3CVIH 3QZBA 5IJVB 2AMUA 5DMGD 1MCWW 4P4RB 3NQIA 1CGUA 2G9KA 1G9MH 2YAQA 1V3MA 2KH2B 3Q1SH 4J12A 5A43C 2BRRL 1A3QA 5CEYB 3B34A 1PQZA 3VO0A 4UT9A 3WS6A 5EO9A 5KYWB 3QORC 2BVQA 4FZ8H 1HHHA 4MNHB 4K94L 4MWFA 3LZFH 5IOPB 1HKLH 3GKZA 3TPUA 3P9MA 4AGLA 1RI8A 1RK1B 3W11C 3S9DB 2CSPA 2WCGA 2ZOWA 1ROCA 1WA1X 3FT2A 3O6LL 3VFUA 4DEPC 3HVNA 5AVYB 4R97C 1RU9H 2P7TB 1RJZA 4G6AC 1E5AA 1QA9A 2CK2A 2HT2C 2PW2B 2XG5A 3HLAA 5K1NA 4WU5A 5FYKE 3RVWC 4O00A 4DO4A 4KK9C 4UQ9A 4QWWC 2WOYA 2AQ1A 2NT1A 2ODIA 3C5ZC 4RMTA 3OMNB 4EIBA 1OAXH 5BZDB 4MDJA 1IGFH 1JNNH 2UX6A 3MCLL 1FFRA 2MCAA 5DT1H 3K7UA 4K73A 4LHUA 2X6VA 1U8JB 5EPMB 2WQ8A 3CPLB 5F7DB 2A3TA 4OCWH 5FO8A 4MXVF 2MEJB 5KN5B 1CLOL 1EMTH 4AGMA 2Y07L 5F3BB 4XGZA 2MOGA 2BH0A 2Y36H 1DTUA 3HI5L 1OCCB 1C1EL 3PABB 2IQAB 3LN9A 4JRXB 4UV4L 3LD8B 1FUNA 5EULV 4JO3H 5E1HB 4APQA 1FPTH 4TL5A 4HX1A 4CGUB 1TTCA 2W65A 4QY8B 5I18L 4KHXL 3UTZB 4YHNB 2G3XA 4Y2DC 4WRLA 5DQ9B 2EUVA 4J3TA 4GW5B 5F9WB 3D34A 4N4YB 4PYGA 2ESVD 3QA3B 4RETB 5IJBC 3WENA 5IUCA 1J0JA 3QWOB 4YGAB 5L4FA 4A63A 3BYTA 3F05A 3IKCA 4AVIA 1SF3A 1FORH 2OJZL 1ZPUA 5A16B 2RFXA 5DUML 5D93C 4F3FA 3AQDA 4JDZB 4KX8A 3ILPB 5DD6A 3D0VB 1U4EA 1PSKL 4LVOC 2GQHA 3VWJD 4PJ7B 3KGRA 5ESVA 2WQXA 1KIUA 1T2JA 1DQJA 3CX5K 5CJOH 2QKIB 5I6PA 5KVFH 1CLYL 4OAWB 2Q87A 4JR9L 1ZIBA 2JJUA 3BIAX 4FQCL 3V5HA 5GZOA 4F20A 4PJCE 2CBTA 4N20A 2NX5A 1MFCH 1DVTA 2PCPA 4RAVA 5EU6B 2CGRL 3RKPA 3FF8A 2YD3A 5DZJA 3TBVB 3NCYS 4KTEL 4Q8BA 1VCBC 2WWKT 3N0AA 2A74C 4BSVA 4YHLL 3QAZB 1K5NB 3LCYA 1L4IA 3IDXL 3PL6B 5FGBC 4HWNA 5TE6L 3BJ91 1DJYA 2XZAL 1U8MA 1Z5YD 1SEBB 3C2SA 2F53E 4GRWF 1OCOB 4QO1B 3AY4C 2DD8H 2ZWYA 3GLEA 2FAUA 5F0LB 4ZUWB 3TYFA 2WSDA 1MXDA 3LMJH 1WD8A 1TZOA 3QDAA 3GI8H 3APMA 3V2AR 2ENYA 2OJ1A 3AQXA 4N25A 1I9RH 4OCXH 5K59E 5CAYB 1MCWM 1NGXA 4X5RA 4HCRL 2F5BL 2B39A 3B6SB 3VFTB 3OR7B 4WFFD 5HYEA 5IHWA 3U7WH 1BLIA 1QAWA 3IKKA 4JFEA 5MENE 3H9HA 3BWAA 1A7NL 4A2FA 3IAQA 2BP3A 1C7TA 3HAEG 4EN3A 3TNNB 2P8LA 1SMAA 1WCBB 5KOVC 4TVPL 1EXUB 1UGNA 4FLRA 3IMSA 1BM7A 4IRJB 4L8SB 1IL1B 1IGIL 2X4NB 2GCYB 2OSXA 2R8SL 4PJXF 2GAZB 1LO4L 3QZMA 1RUPH 1ZANH 1XMWA 2I69A 4D0DA 3UTSE 3POHA 1F56A 2GUOA 3GMOA 4HKXA 1AZZC 4J27A 4CN1A 3N06B 2EVIA 2O4EA 4U3CA 3WCYA 3L81A 3PGFL 3HJ0A 4RISL 1JSYA 4H8HA 4X80L 3ULUF 3U4EB 4FQ1H 3PQYB 4ZUUB 3OC5A 3P4OA 4IBSA 4P46A 3FU7B 4LGPB 3ZMNA 1EAPA 1HNFA 1MFAH 2D7TL 4ODSL 4Y4FC 4AQAB 1Z2KA 1T89A 4KAQL 1ULVA 4S0SD 1T6WA 2B14A 3AM8A 3Q5YA 1K6QH 2XNAB 2JTDA 1HCYA 2A99A 4NKDB 5K9OB 1D2OA 4MMZA 4MYPA 2YLHA 3S37L 4D9QE 2F19H 5B3NA 2C3GA 3DI2B 3EW3B 3X1GA 2PCFB 5I66A 5E8EA 2WQWA 2VUKA 4Z7UE 4W9LC 3ZHLA 1B0WA 4PJCA 4Q9BA 3UAJD 5J3HC 1QRND 4WWKB 3O8XB 1ORQB 4NO3B 1NFDA 2VH5H 1YEJL 2E7DA 4CA4A 1XCTA 2ALWA 2XWXA 1I8IB 5JW4Q 4H7VA 4ZO7A 3LXCA 4NP4H 1S7TB 2DMHA 4PJBA 5F89B 1Q0XH 2QGCA 5DJXA 4BFGA 5IQ7H 4P2CG 1KCVL 1AY1H 3RWJA 3CZJA 1JYVA 3TPKA 1CE1H 5DO2D 3IFPB 2EXTA 2HAZA 2ROYA 4WVRA 3D85A 4ODUB 1C8QA 1PG7H 2RH0A 1QD0A 4IOFC 4R96B 4U2ZA 3RX7A 1SLVA 3ZTCC 2DLGA 2CKBH 3CUPA 1QFWL 4JREC 4UANA 4JVUA 2P5WE 3RL1A 4KXDA 2CA4A 1ETJA 3PQYD 3G6AA 1GOGA 3HG1A 1NDGA 2PW1A 3CDGA 4ZUSB 1NANH 5CIPB 4XODA 3P11L 4N9OB 3Q8FA 1VA9A 2B1AH 3C60D 1FP5A 1G5AA 5IEKA 1PJWA 1CE6B 4L8BB 4I3RH 3EIFA 3VRIB 1A7PH 1IKNA 3GI9H 4GO6B 4B9PA 1JVOA 3VXSD 4LVHB 3VG0L 4Z7VF 3FCSA 5CSZB 3UTSA 1CLVA 1F1AA 1P4BL 4ESKA 2XDHA 1TLMA 3GB7A 3CC5A 5D55A 1IGIH 1VZGA 1Y6NR 2LFGA 2DMKA 1FV1A 3E8UH 2PYEE 3ZW3A 4EN3C 3JWDL 2ZD0A 4GW1A 4E9TA 4MZ2A 1ZTXL 4U1IA 3ARBB 4APXA 3KPNA 4HKJA 2Y2TA 4FA8A 1H6EA 2BSSB 1Z6JT 3G08B 1UB6A 3W56A 3NCWA 3IFLL 3VQ1C 2VL5B 2NY6C 4LCWD 1J1OL 2FBRA 3WKQA 3QDJE 2KHAA 4PS8A 3UP6A 5IQ9A 4DF9A 5KYUA 4MJ6A 5KS9F 4JO8A 3BGFB 1XXDC 1O75A 5E8OA 3LQMA 4UNTA 5JPMC 1XGRB 1D6EA 2BINA 2NY5L 3IJEB 2KMWA 3P4MB 5FC9A 1W2KT 4NN7B 5KN5A 3S34H 4R4BB 3WV0A 5B3JF 3L5HA 4UOQA 4L3EA 4PCTA 2P44B 3BUBA 3I6GA 4NZUH 3QUHA 5FFLA 1S5IL 1IUZA 4QHNA 4NZTH 2D0HA 4E9WA 1QUPA 1URIA 3HNVL 4XP9H 3EOBB 1LP9B 1YJDH 1EHKB 1F4XL 4U1JA 1OZUA 2DEWX 2DYPA 2NXYB 3CQPA 3TEWA 2B16A 5GS0L 2OKMA 2FR4B 4JFQA 2D8KA 2GITA 5TGBB 2Q76A 4GW5A 4WCYL 4MA8L 1AZCA 1CD0A 4F7MB 5ID0B 3UTZA 2ZAIA 1YHPA 3HZMA 1LDPL 4RAHA 4PLJC 5AAMA 5SWZA 1M7UA 1BJ1H 1N18A 1PZ3A 5J1TC 3L95B 3TJHD 1KJMB 2XX0A 1YNTA 3N1GC 4R7LA 4UUJA 2ZOLB 2WANA 1C7SA 2OYMA 2VSMB 3DX7B 3FU6A 4ZUVB 1FYTD 3ASNB 1NDMB 3OB0H 3BAEH 1NCCH 4MCNA 4GXFA 3A67H 1IEAB 4GLRH 5ITFA 3VXSE 2Z31C 1F3JA 3PNWB 4XN7A 3RIFF 4OZFB 3RGVB 5E00B 3EOAB 5FA3A 4U3HA 1UT9A 3VX0A 4KVCH 2VNCA 2Z6FA 1BJ1J 5AOZA 2GG1A 4FXTA 4LKXA 4CUCA 4X5QA 3SY0B 4D0BB 4H8WC 5SWSE 4ENEC 1OOWA 3MLTB 1SHXA 3PL6A 1RHFA 4XB3A 5DK2A 1W80A 3WXWL 2DYSB 2YPVH 3TIDB 4NYLB 1FCGA 5GS0C 4FEMA 2ESVB 4LCWE 3L9BA 4EI6B 1QO3B 3GJEB 1OCRB 4APQC 4LLWB 3L5WA 2N7BA 1ODAA 4Z7NE 1FFOA 5GSRB 2WIMA 5EO0A 4AT6A 3U46A 1MNNA 2V17L 3RVXC 5I8KH 2V9UA 3V0GA 3IETA 3R19A 2HUEA 4K8RC 2K3TA 4DEWA 1A4CA 5IHUH 1QBMH 3EH2A 3VI3E 4UQ3A 1ZA3B 4FTVA 4X99B 5CP7B 3PP4L 4GW4B 3I9GL 4R4ND 1KTDA 1P7KA 3G6JB 5F7KC 3W39A 3T0EA 4M5YH 1E4XI 2X9WA 4GP4B 5DF0A 3QQ9C 2Y5EA 4BFIA 4OLVH 1OP3H 2CBOA 1TTFA 4QWWD 1KJ2L 5CHNA 3QI9A 1AHWA 4LEEA 1YN6B 1BD2B 3RJDA 2QT6A 2YXMA 3LJ3A 4JLRB 3UPAA 2DLFH 3SO3B 3QI9D 5IB3B 1KXVA 4M6NH 1BAWA 1U95B 2FT7A 5KBNC 4X4YB 1RSFA 3FTGB 4Y19A 5TPWH 1N4XL 4L4VE 1SY6L 3D6GA 1HYSD 4MJIA 3NN8A 3RPIB 4DVBB 4JZJC 1DUYB 3NJIA 3QJOA 4P5TB 3C9NA 5EU6E 1S9YA 1M71B 2QVMA 4IRZA 2AXFA 1HKLL 2VISA 2XPGA 1XQ4A 4X6DB 1LD9A 2D7QA 5ITBL 3D0AA 1T7WA 2BOBA 3TN0B 1U8HA 4K5LA 3GWJA 3KPLA 3KPSB 1FZOB 2AK4D 3E6HA 4NUMA 1ZHLB 3T08A 4BSJA 5HY9B 5BRPA 4Z8FL 4FFVD 4XMVA 3VWJC 1UCTA 1RU9L 2FH6A 4U6VL 3L3GB 2B77A 3KPRA 4HIJA 1OAZL 1AP2B 1U6AL 3FYEB 5I5MA 4OCRL 3CFMA 3DPBA 4FFTA 5MP6H 3QG7H 5DI8B 1ZRUA 2XYCA 3QSKB 4B5ZA 3AREC 1F90L 3QDMD 2BY0A 2VSKB 1Z32X 3MLRL 3ISWA 1I8MB 5ENWB 5DMYA 4YXLH 4FQXA 3D33A 3LN5B 2OR9H 5AUMB 1XAKA 1J9RA 1E65A 2V2TA 1N5AA 3OF6D 3P4LA 3ORJA 1XGYH 4OFVA 3AREB 4LLYA 3NSFA 4BZ2A 4XBPB 3RFZB 2N1KA 5CUSL 1FQ9C 1JYNA 1CLZL 3O8XA 4Y1AE 3I75B 2VO8A 2ZPKL 1YUHA 3MREB 2ICCA 4RMRA 3IU4H 3NJLA 5SWZD 1H3XA 4QF1B 3SDDA 2DQDH 1PAMA 2Q8AH 1UJTA 1PX8A 3ZTNH 1O6VA 2QSVA 1L9SA 4CVXB 3IXTB 2NUTA 5ACMA 3MLXL 2J2ZB 1ITCA 4NUQA 3TBWB 4H8VA 3CQFA 3QUXB 1N8OE 4Y4HA 5HHOA 4NIKB 3RWJB 3EBGA 2OCCB 3TBSA 1HSBA 2K4AA 5GXBB 2OMWA 5F71A 4NQQA 4XB7A 3CLFH 2Y5TB 2A9ML 2CDGA 3OAUH 4Y5VB 4HSQA 3WKML 2A6JB 3VGDA 2AERT 2E3VA 5CIPA 1KNOB 5AW1B 4JFDE 2M2DA 5T1JA 3ZRFC 1T5XA 4A6YH 4NXSA 1QLEL 2NR6A 3QYNA 3MLWH 1NCOA 1JXKA 4IEFB 1X5AA 2GBTA 5A6LA 1CB4A 4Y1AD 1D5MB 4QRPD 3WE1A 2I85A 5JMOC 1AMYA 2JKNA 2H26B 1VGKB 2F1EA 3DYPA 4YSDA 4WO0A 4LT7A 2FQGA 3DX8B 4DO6A 1HX0A 5DJYA 3X14B 1LO0H 3WTSA 3GBLA 4GINA 3WUWB 2ITCB 2BIHA 2QMJA 5EA0H 1K5WA 1GGBH 4XN4A 3PE9A 4K7FB 5ESAB 2ZCZA 4CADB 3QZWB 3DMMD 1M4KA 3E6FB 4TQEL 5DLLA 3MRIA 2LLGA 1DVUA 4LU5H 1FN4B 4GKNA 3IE9A 4LIQH 4NGHH 1TJIL 4XMWA 3IJEA 3P4MA 1AR1C 2O5YL 3AT8A 3PDOB 4TPRL 5DRXB 1USZA 4BQ9A 3MBEA 1ZLDA 1AACA 5E95B 5D1ZC 4PJEF 2Q7YA 3AUWB 5E6RB 5H4ZA 3DVGA 3QNZB 5C0AE 5ANHA 3QRFM 5FECB 2JTYA 2APFA 3HPJB 4TRPL 1GL4B 4NHUA 1WP6A 2JKTM 1YNLH 2VDNL 3OJDA 4U1KA 1U42A 4HLJA 2ILLA 3QEQE 4BXVA 4L3EB 1RZ7L 4X5PA 3Q9QA 4PJXE 3WS3B 2HKFL 1RUAL 3IBOA 4P4KA 2QGDA 3VH8B 3RZCA 2PKDA 3ZYOA 2R56L 4KUZL 3BH8B 3QDHA 1GKEA 4LLVB 3WJMA 1Y6KR 1DQKA 4G5ZH 4XPGL 3VXQA 4PWGA 3IDNB 1U92B 2BHYA 3U9UB 1CICC 3PIQA 3MRQA 2Q76B 2HUHA 1MW3A 4FF9A 2VMJA 2A9NL 3SYAA 3S2AA 4D9RE 3CLEH 4F7MA 2D9CA 4BUGA 3SCMA 4ONGL 3LQAC 1RULL 4QGYA 1IC4H 1CU4H 1OW0A 2J56A 3TEZA 1JZJA 4IHOA 3HZVA 2A6KB 2YGNA 1KFAH 3SGJA 3WIIL 4TVUA 4JFFD 5AZEL 3PGDB 1JZ6A 4JFXA 1QLFA 4H13C 1F42A 1TVDA 3AUVA 1MVUB 1HI6A 4ZO6A 4A66A 1QR1A 1LMKA 3FF7A 1OT2A 3MUGB 1NA8A 4PJ5E 5EBMA 4PH8A 2H1PL 1KB9K 4N8PA 1CN4A 1TJGH 5T5FH 2XXCB 3C12A 4JANB 3ZDXF 4F8NA