2B59A

The type ii cohesin dockerin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
b'KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG1196: Chromosome segregation ATPases
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/structural protein
total genus 33
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2b59A00
4FL4B 4FL4C 2W1NA 4WI0A 2Y3NA 5AOZA 2JH2A 3UL4A 2VN6A 3KCPA 4U3SA 2OZNA 4IU2A 4UMSA 2VO8A 3FNKA 4N2OA 4DH2A 2VN5A 3L8QA 5LXVA 4UYQA 1ANUA 1OHZA 1TYJA 2XDHA 4IU3A 5K39A 1QZNA 4UYPA 4WKZB 2B59A 3F2LA 1ZV9A 2O4EA 1G1KA 5G5DA 3GHPA 2CCLA 3KCPB 2ZF9A 3BWZA 1AOHA 2BM3A
chains in the Genus database with same CATH superfamily
1LNUB 5IHUL 1OAQL 5GGUA 3CFUA 3CZFB 4OJDH 5C0CA 1LMKA 1LJMA 3U7AA 5FEBA 2XFGB 2E6PA 1E2VA 1MKFA 3LQAL 5GZOA 5HHOE 4D8OA 1SOSA 1R24B 3VG0H 1WWCA 4OGAC 1CF8L 4GI9A 2FO4A 4Y16B 1NMAL 3I6KB 2NXZC 3KJ6H 4HAFA 1NCIA 3ZHNA 2QADB 2EDQA 5DRZB 1C1EL 4X0KA 3MFGB 5EWIH 3NIGB 1KDJA 1NCUA 1ZPLA 3KYMA 4X7SL 3RJDA 2JIXD 2RR3A 2YD2A 4OUUA 4WY7L 2I26N 5GRWA 3LHPL 3EBAA 5DQDH 3RY5A 1G94A 3KHOA 4MA3B 2CKBB 5MP6H 1XO8A 5B38A 3QEGL 1I1AD 2YRZA 1XIWC 4F3FA 1TEGA 3GJFK 4IRJC 3GLDA 4Y4FC 5DMKB 3PXLA 2OPCA 4X6BA 5CLZA 3OQRA 5DRNB 3MRKA 2WN2A 5E08L 3BE1H 3KMDA 3E2HB 3H6JA 5IBTH 1ZSDB 2HT3C 4J12A 3CFEA 1NAKH 4N8CL 1VENA 4HX1B 1XH3B 1TDQA 4UINH 2WQWA 1SGKA 3BSHA 1EHLH 4YDJB 3O11B 3Q6GL 5LBSA 5ACLA 4M93C 2V9TA 1XGUB 2WJ5A 4HISA 1AGFA 1EZSA 2FYYA 4PJBB 3N3EA 2Z92A 3QC5X 3D3VE 3F5WB 3NFSL 3M45A 1YJDC 1HQRB 3ZW3A 4GT0A 3TJHC 4IMKA 4QRUA 2P8MA 2QPFA 3WCYA 2AXGB 5FW7A 3HG1D 1IGML 3MNZA 3U4BH 3AU0A 4JM2F 4FLHA 1DQMH 1ML0A 5HVHB 4PJDB 2OP4H 4UM8A 2E47A 3OAUH 3Q2LA 2P5WA 1G9MC 5K9KB 2NW2B 3SOBL 4PLNC 1ZMYA 3HZKA 1CIDA 4NGHH 5I28A 3VFRB 1P4LB 2H41A 2HJLA 1IKFL 4QRQA 1UM5H 5CINL 3BGFC 4JPSA 5IFAL 5JLZA 4JRXD 1MH5B 4PTTB 4MA1B 3TF4A 1PLCA 3FW6A 4G9FD 3TN0D 4FNUA 2VLKE 4IBSA 2B5IC 1XZWA 4NS0A 4OZIE 3FQ4A 3QBTB 2LQRA 5C0AD 1E3XA 5CF3A 1ORSA 4FP8H 5DRWA 2R29H 3OKNA 2VSMB 4ODXA 1G7IA 1VIWA 3KJ4B 1LD9B 2VIRA 1N7MH 2XPGB 4X6DB 3ZL4H 1CD1B 4ISVB 1RZKC 1TKWB 4OVUA 5F7DA 2IH1B 4UT9L 4HGWA 5L9DH 3OLIA 1P2CA 4YFLF 3Q6FA 3PRZA 4LLVB 5AYUL 3D18B 1BD2D 1G0YR 4MMXC 1EGJA 2N7AA 1V3KA 1N0LB 3O3BA 5GRVK 1BMWA 4LNVA 1G6RL 1PAMA 3AG2B 4P46A 3TBYA 4U6HB 4UDUB 5HHMD 5INDA 1NM9A 5IVXB 1FFQA 1GYUA 5TE7H 2Y07H 3PQYD 2JMRA 4HWZB 4OCYH 3MRJA 2K8MA 2VN4A 3VXPB 2JI1A 1A7PH 2GIXA 2HFFB 3N41F 4XNMB 4GO6B 2CGRL 2Y7QB 4FXKA 4WV1B 2NY1B 2WBJC 3A6BH 4MRBA 2OMVB 2ICEB 1IM9D 4LBAA 3HC3H 4U1KB 3TV3L 2J8UF 3GLAA 3MLRL 1JV2A 4HC1H 1IEBB 3G6JA 3L17A 4M62H 4MYPA 4PEEA 3TFBA 4GSDL 4DZBB 2WSPA 4KXZI 5KEZA 3OAYK 4XWOC 2ZOKB 4HUWB 4QWWD 1IAKB 3FDWA 4J3SA 3NA4A 1DBAL 4M5YL 1WWBX 2NDGA 1OB1A 4I88A 1D3CA 1OAUH 3AB0B 4XC3H 4K71C 4PRHD 5DRXA 4QRBA 3F65A 1EERB 5DJAB 4A2EA 3UG4A 4BQCA 4BFJA 5I5IA 4I87A 1EFXD 3V9FA 1UEMA 4NO5B 3U0PB 4X4YA 4UQ9A 1E8YA 2HN7A 4LO9A 4LSTH 1JGIA 2R9HD 4MXQD 3F7VB 5EDXA 1P53A 5AVSB 3VJ6A 4PS3A 2VLRB 1AR2A 3MLXL 4JFFD 5DJXB 1YEKL 5TQ2L 3CMGA 3T65B 1A3RL 1H8SA 2OSXA 5IT2L 2VABA 1E9QA 3WFDH 2ODHA 3NPSB 2WAHA 3M07A 1J0HA 1EPFA 1D5RA 3EJSA 4LSQL 4G7VH 5KBDA 3HFMH 2ZOOA 2B20A 5GGRA 5EBLB 4FTVE 3SE4A 3QDGA 5CUSL 1UWEL 2VL4A 3ZIYA 1JFQL 3DWTA 5E5MA 3F6JA 4G8GB 1AGCB 4JPWH 4H8WC 5FB8A 4PJ9B 1ZVNA 3GEWB 4X7EC 4ZO9A 3HE6B 4LXFA 2WZPD 4XCCL 5IY5B 3VGGA 3FSOA 1EBPA 2DQCL 4HJJL 4UM9A 5DJ6B 1M7UA 1RUKH 3CLFH 3BW9B 1QYGH 5AWNL 4NRYA 4Z7WB 3SYPA 3V4PB 1RIHH 4WO0A 4P0DA 3WU1A 5D72H 1FZJA 5JDSA 3H9YA 3JWDH 1QKZH 5B1KA 4RRPG 3TBSA 2OX5A 1BF2A 2IMNA 4R97B 4XNQA 3QDMB 1JXFA 4P99A 4QRPE 3SDDB 3S88L 3MLUH 2YAMA 4IJ3C 1NZRA 4N2GA 1OM3L 1KIPA 3VU1A 4JO3H 1AFVH 5HPMA 4WFED 3N1FC 3RUGA 4Z0XB 2NY5C 5BRZA 3TFKC 4A67A 4TSBL 3S35L 1IC1A 1EJ8A 2EH8H 2P44B 2D3JA 3G5ZB 1Q9KB 3KGSA 4IRSD 4J27A 1A7OH 3ZHLA 3V9EA 4LDLB 1CFQB 3DJZA 4G8AC 4I77H 4Q9RH 1D5ZA 4JDVB 4Q6KA 4QRTA 1A6UL 1EH9A 3F2LA 1I3GL 4PP2B 4NZ8A 4MDRA 2BVUA 1TENA 4PS4L 3A6CL 2PCYA 1XSJA 4EDXB 4AKQA 2IOIA 4JRWA 4HOXA 5KW9L 4P2QB 2N1KA 1A65A 5F7EH 3WS3B 4F8OA 1FGNL 5CEXA 1UD8A 5IFHL 3BO8B 5F6IC 1FC1A 5J6GB 2XY1A 1BOYA 1WE5A 2FH6A 4F58H 5F97E 4GAJH 3DETC 1LP9E 2LU3A 2FX7H 1S9YA 2NX5A 3ROLA 3UTTB 5AG8A 5I1HH 1LE9A 4U05A 4MKMA 1KIQA 4NM4H 3MGTB 1UWXK 2YEVB 2WXFA 2MQGA 4LKCB 4KTDL 4GPVA 1ETZB 4QCIB 4UDTA 1OE2A 4QHNA 3L3KB 3EYUH 2GHZA 3KCPB 3QDJE 5KVDH 3AG4B 1QW9A 1A7BA 1Z3RA 4TVPE 1Z9SA 2ZUUA 1KLFA 5D2NC 2XN9B 5C0RL 2GT9A 1N59B 2FJFA 1DVYA 5EF0A 3AGVA 4TPRL 4AVKA 3IGAA 3QUZB 4KNQA 1KENH 4XRCB 1BCIA 1V7MH 1MLBA 4O9HH 5BXFA 2MOVA 3X3GH 1Q38A 3FUKA 2F53A 3RY6A 1H5BA 1F97A 4KKBD 1AGDB 5I2IB 2CLZB 5JOFA 1AHMA 3H6AA 2NR6D 2JXMA 5IW1B 4A04A 3B7YA 2Y69B 3ZLQC 2A74C 1WT5C 2ZONA 3BPCA 4R7NB 4N2DA 1IZKA 4QHKI 4XNZC 4QOKA 1BDYA 4L9LB 4RFOH 2IVFC 1AS8A 4IMLA 2X70A 1JK8B 4WFHE 1QSFA 1FBIH 2ZG1A 3AT8A 4H26B 4XVUC 3IMUA 4G82A 4ELDA 3D2UA 1DL7L 2ZCHL 4D8PB 5C0IA 5KS9E 1IQDA 4KNTA 3AG1B 5INCA 4KROB 1FL6B 2XKSA 1BLNB 3P40A 5EIQA 3RX5A 3U36B 5CZXC 1RAMA 2R69A 1WFIA 4HV8B 2CJTA 3EOYG 2QPSA 4P2AA 5BQDA 4Z3FA 3CD4A 4Z77A 5C0CB 4OV5B 1XSIA 4GEIA 4KX7A 4JUSA 4BDVA 2HP4A 3I50H 1FF5A 4YN3A 2WPGA 1WEJH 3OLDA 4H8VA 4TVSa 2AVFA 3QULB 3MYJB 2AEIT 5CIPB 2N59A 5DVKA 4DAGL 1H8NA 2VR4A 4XN5A 3BQUA 1P84J 5F9AC 4BQ8A 4MBOA 2JKNA 2F0CA 5D7KE 4X0KB 1N6VA 3O4OC 1PNCA 1K6QH 1U8KA 1FHNA 1ZT4A 3FTZA 2NY0C 3LN9A 4IYKA 4J3OF 3PWLB 4OUUB 4M7JH 3EGDB 3ZHFA 1X9LA 1T80A 5E2WH 1RFDL 3ESMA 3SDCC 3SKMB 5I74B 1A4BA 2F5AH 4KV5F 3ATAA 5TDNA 2MQ3A 3GRWL 2COVD 3QIWA 1OT4A 3PPEA 1XGRA 3IMVA 2IBBA 4I3RL 4F3FB 2CAKA 2WQVA 1PY9A 4NBYB 1OK0A 3MRKB 1G7JA 1AR1B 4OT1H 3UFIA 2V33A 4I9WD 5DQJA 1E42A 1IGJA 5DJ8A 1Z9MA 3CFEB 4FG4A 1WIUA 3MLTA 1T0OA 3GTVA 4N0UB 5J57B 3ISRA 4KFZC 5I24A 3WOVA 4IRZL 5DCCA 1J8SA 3CLEL 1UB5B 3PHAA 3SO5A 5FLUA 4YLBA 1MF2L 3W0WB 3BVVA 1AGFB 4L8DA 4PB0H 1WAAF 1IC5H 1FFRA 4LSDA 3EG9A 1OB0A 4YBQD 1G5GA 3QR1A 4PRNA 4W9EC 1YUHB 5C09A 2GAZA 3DYOA 5FCUL 2DZEA 2C4FT 4LSVL 4WAFA 1C16A 2P8MB 2H2PD 3QJSB 2J57A 3MNZB 4O5LH 4ODHH 2MCAA 2ITEA 2LU7A 1SUHA 1JTPA 3RWFB 4W1TA 1ZK5A 2P5WB 5EN3A 1KJMA 2WXKA 1NCBH 5DURB 2C3WA 4PJEB 3V0VB 3IDYC 3EIFA 3PL6A 4KNSA 1X5HA 4FQIL 5DQ9B 1ZT1A 2NQCA 4PJGE 1JYWA 4ZW6A 4N20A 5DVNA 4F9PC 3SGJC 4TVPL 4KOCA 2BJMH 3HNVL 3VXMA 1DCLA 5I8KH 3CQPA 1R5WA 5ECGA 1ZIBA 1LEIA 4NP4L 5IB2B 3ALPA 2LR4A 1UC6A 4Y1AA 3KGRA 5F7WC 3T0EC 5I1LA 1ZAGA 4QTFA 5JA8B 2YGNA 2AJSH 4KRPC 3UC0L 1ORSB 1Y7VA 4OZFA 1U8IB 2CJUH 1G7IB 2WLJA 5IHZA 3OJDA 1J0ZA 3EF4A 2VXQL 1VEMA 5BO1H 5L88L 3CU7A 5C0CE 5T5FA 1JHTA 4HGWB 1P2CB 3RLSA 3Q6FB 5IBUB 3TO2A 4TUOA 3QVAA 1N3NA 3O3BB 1F45A 1MCOH 4BZYA 2ZX6A 4IBUA 4P46B 2MHAA 4Z5RB 2GTQA 4OFYD 3FB6A 5INDB 1A7RL 3PNWB 1ZGLM 1CPUA 1S46A 2EYTA 4TTDD 4WUUA 3NJLA 4PRIA 2NY4C 5FUCE 3MRJB 5FAAA 4NQED 1CFNA 1SXSA 3CE1A 5FYKH 4XTRC 5IM7A 5LN4A 1MCHA 1Z9OA 3HG4A 3T4YA 2ZSWA 4OZ4A 3TTYA 4HOMA 1BVNP 2NNXA 1TCMA 2XWRA 4LLYA 3FCSB 2XN2A 5ALBH 1Z6JT 4OCRL 1JV2B 1X44A 3G6JB 3GMNB 3NCYP 4A39A 2GY7B 5CEZE 2ZF8A 2A9AA 4I89A 3LVEA 3VI4B 1CFVL 1OB1B 4XPTL 4E41A 1UZGA 3TWCH 4AENB 5DRXB 1OSPL 1BREA 2X4RB 5E2VH 4MD5B 2PWEA 3ZDYB 3OF6A 2Y1ZA 3EGSA 4X4YB 1Z3GL 2HN7B 4X9FA 3VJ6B 3HZYA 2NT0A 1DSFH 4JM4L 3RL1A 1HXMB 4JZOA 2VABB 1E9QB 4QLRA 1ADWA 2XJLA 4PCSA 4I3SL 4CKVX 5C2BL 4MQXD 1UJ3C 4MVBC 3GNML 4G6FB 1VFAB 1XCXA 4HEME 3HMXA 1EJOL 1HOEA 1KCRL 1FNFA 3SPHA 5E5MB 5JZ7D 1J5OL 4H2CA 1UCBL 4KMTL 4K3EL 3BEVA 2P5WE 3NIGF 3P02A 3P11L 3RURA 1UUNA 2R56L 2OTUA 4OIIL 4ZYKA 4N85A 2EIZB 5IJKC 1DUZA 2BXZA 2HRPL 5HY9A 5IHUH 2CQVA 3LN5B 4NRYB 1ZLSL 3KXFD 1FZJB 5JDSB 1UOVA 4ZT1A 1FE8L 2EDDA 3LQAH 3ZYOA 5EZIH 5A2FA 4XNQB 1UOWA 5I0XA 1S7SA 4HUXA 4ANXA 1ITCA 5A16B 1HNFA 4F57H 2O93L 3N91A 3MRCA 2CNZA 3KPNB 5IROD 5FUOH 2YAEA 2Q5BA 1BA9A 3BI9X 3ZU8A 1T1XA 5BRZB 1QPPA 1W15A 3HZVA 5JW5A 1MW0A 4X7SH 4KJPC 5JIDA 3FH7A 2VOTA 3MFFB 1XEUA 1U4FA 1KG0B 5DMGC 1D5ZB 1OPGL 3AAZA 4H1LH 5LBGA 4YSAA 4PJBF 3WJMB 2WXNA 3TWYA 3C6LC 3ARVA 3SKUD 1YMMA 1JWMA 5A1AA 2VC2L 1L0QA 4MJJA 2R4SL 3ROOB 1K72A 4N4YB 3GJEB 3D4YA 3HI6L 4V1DA 4J3TA 1CXEA 3CVHL 4LVEA 1NEUA 5EOTB 3J8F7 4PJDF 4AL8H 4M3JA 4PW9A 3ZT7A 5I15L 1BYPA 4JQIH 5JOPD 2DRUA 2WXHA 3Q6GH 4FD0A 4LCYB 5D71L 4ECNA 1NIFA 3BZDA 5AW6B 3IAQA 4C57C 5HXMA 3KLAA 1PLGH 2EXWD 5IHZB 1CDJA 4KY1H 1KLFB 3VWJC 4FADA 5ANMB 1D9KA 3QPQD 2GT9B 4KKAD 4F7TA 5AG9A 1QVOB 4NUQA 1AYOA 3IGAB 4KMLB 5TGBB 5DZNA 2R2BA 2NY7H 2FECL 3QUXB 3JVFC 2D7TL 5GS0D 3SD2A 2V2TA 2PTVA 1HNYA 3MSPA 4PGEA 1MRCL 4Z0BL 4LSUL 3BPNC 2Y25A 4YFDB 4NAJA 1T04B 3TBVA 2FDBP 4R7XA 1T22B 3V6FA 1QHPA 4X6DF 5DJZB 4M6AA 3ZDZE 3GS4A 1QABA 2QGCA 3LRMA 4GRWB 2FRGP 4HK0B 4JQVC 1USQA 1AD0B 3HLAB 4X5LA 5CN2A 5IFAH 3RWGA 1L9NA 1XT5A 4QOKB 5CEZL 3QDGE 1AKJB 2QMJA 2G30A 2R2HB 5K9JL 1YEEH 1T20B 5AKSA 1CLOL 4ZK8A 5IVXF 4W9GC 5HJ3A 1ODAA 1QBLL 3D2UB 3S36X 4CRPA 1PW3A 4DKEL 5BZDA 1IQDB 3MTXA 5INCB 2VW7A 3DIVA 5ISZD 3OKEB 5DSCA 1ZPUA 1UGKA 2W07A 2EO7A 2HJFA 3SDAB 4HHWA 3AM8A 1EEUA 2FBOJ 2G5RA 1TZGH 2Q8BL 3U7YH 1R46A 1T5WB 2WIMA 1WC7A 2BY3A 3GKWH 4H8PA 4UYPA 5CJQL 2XWJB 1B0IA 3X3FL 3ULVF 1FNGB 2JKLA 5DTFB 4ANUA 2Z31D 4TOYH 3RUGE 3BQUB 1CZ8H 3BCFA 1OT2A 5BRZE 3QFJD 4FFWC 4RLDA 3ARXA 4R8WH 1U8KB 3VFWA 3O41B 3L4VA 2E9JA 2LABA 4LF3A 4FULA 2P4AB 3IKCA 4M3HA 2CGRH 3QORA 5DVMA 4ZW3A 1M1SA 4LVOB 1PJ9A 2H1PL 2LW3A 4MCZA 4YK4C 1EJFA 3MRDA 1IIKA 4KO7A 4N2BA 4XNUL 2F8XC 3EAKA 5CXPA 2DKMA 3RZCB 3MLVH 3RWDA 1OTSD 5CWSB 5TDNB 3K4AA 4GSDH 5D1QD 4LAQL 3BRGC 5CJOL 4BCYA 1DLFH 5MERA 1JPSL 4K5LA 5JR1H 1MELA 4HFUL 3ARUA 3APCA 5DXWA 2NX5E 4YHYB 3QUYB 5DQJB 5KYXB 1QSZA 1KC5L 1KEGL 1RP9A 3OD3A 2IPUK 5C3LD 3LTVA 2YK1L 4WHYG 1ZLVK 1NGPH 2GTWB 4AIXA 2EDFA 2HTKD 4E0RB 4Z7WF 3NOIA 1YEKH 2LVEA 1AACA 2X88A 4L8DB 5TQ2H 1S9XA 4L1SA 4NO3B 1EGJL 2BHYA 2FHCA 3EG9B 1JHLL 4KRLB 3ISYA 4PRNB 3W9EB 4KKCD 5D55A 2GAZB 1IBBA 1SJHB 4ZFOB 3D2TA 5CLYA 4P23A 3LQZA 1C16B 3MRNA 4ZPTB 4L05A 2QVTA 2JB6A 1ZLWH 2TRYA 5E00A 2XOTA 2Y5EA 1CK0H 3LNIA 2G75B 2BSEA 2F53E 4XP6L 4HBCL 2IJ0C 1IGFH 1L9MA 1QFOA 5AWNH 3WV0A 3D85A 2DL2A 4JL2A 3ZKQD 3QIUC 4MKTA 1AXSA 3MX0A 3U1PA 1L6PA 2NY3B 3LEXA 4TSCL 5BZZA 4F8TA 3EDEA 3VXMB 3S88H 1QSFE 3QXDB 2D0GA 5I6KA 5HDOA 1OM3H 4JFVA 1XBDA 2JQMA 2PF6A 5GHWL 4IHOA 2LAAA 4O2EA 1H6EA 5GIRA 3HFFA 4YXHL 3U7WL 1YQVL 3G5XA 3LRSB 4WK0B 4OZFB 3P0YL 3HBGA 5ID1A 1P5VA 5FYLL 4N0CD 3PXHA 2ODIA 4I18B 3QAZB 2WKOF 2WO4A 3JVGC 1G7QB 1N8OE 2E7MA 2CLRA 2WMPA 3EZJB 2BMKA 3MRBB 4NQSB 4CN4A 4PS4H 3ZY7A 3A6CH 3PP3K 2BSCA 1N3NB 2EYRA 4KHXL 5KW9H 2XQBL 1S7XA 1PD0A 1FGNH 1F13A 2VR7A 5HHPA 2B0SL 3QNZA 3VMPA 4UNUA 1LO2L 1C7SA 1G9EA 1NCCL 1OTTD 4WUUB 2O5YH 2VDNB 4EUPA 2VM9A 4LSPL 4KDTA 3UTPE 4WNQA 3RVVD 1MG2C 5E1QA 4MZRA 4QF1A 2X6MA 2ZSWB 3DVNB 2B1AH 1S3KH 2DPKA 4WU5A 4YSTA 3OWEA 3VXUA 1T66C 4QRFA 3Q13A 4KTDH 3UX9B 3MV8D 1NUFA 4JY5L 1RPUA 1T7XA 4LLDB 2ZYRA 2PYEB 3HTLX 1A9VA 1MWAA 3NSJA 2LTQC 2XV2A 5F3FA 3S3CB 2IOMA 2Y5TA 1WFMA 1GY2A 4BRVA 3OKYA 2WLZA 4U1MB 2CO6B 4OLYL 5IFJA 3IFNH 4AG4L 2VR5A 1B4LA 1G0XA 4MJ5A 4HIXL 3V10A 5J13B 3OWRA 2DI7A 2EE6A 3ZMNA 4GQZA 3TH4T 2J8OA 3QYNA 3EGSB 2D03H 2NY2B 3QJTB 3WEMA 5E9AA 4GG6A 1IVTA 4U0RC 1PZAA 2YQ2A 3RVUC 2K3HA 3RL1B 2R0ZL 4NZRL 3K2IA 4FFYA 4JZOB 4KK6D 1XIWA 4XBGB 4IRJA 4Y4FA 5C09E 3TGXA 3ARGC 2GBVA 3FOLA 2QSVA 5JQHC 2XZAL 2LT9A 1OD7A 3V0HA 2P1YA 1XD1A 3LKOA 4F92B 5KSAD 4NUGL 5ECJE 1GZPA 3QO1B 3VDBA 3S2CA 5BO0D 1CICC 4KJWD 2ZCHH 4S0SD 1X3DA 2KZWA 4NQCD 1ACYL 4XI5C 2GFBB 1DUZB 1ERNA 5BVJB 1JNLH 5AW0B 5HY9B 2CIIB 4YVUA 1SZNA 3WHE0 3PF2A 3VGAC 2BOCB 1IV8A 5EPMB 3EFDL 2ED7A 4NIKB 1VERA 1MHEB 5CILL 5GISH 2D7OA 3CFQA 2YJLA 3BVNA 4HUXB 3E0GA 4H5SA 3U46A 1XAKA 2ZKXA 1N0XL 3D0LB 4WW1A 2X1PA 4Y1AE 4JFYA 2YZ8A 3P4MA 3B43A 3JV4A 4K23L 4N6RB 2X2YA 1T1XB 4JRYD 4BZ2H 1UT9A 2D7NA 5KWYC 4PVNA 1C08B 4Y2DC 3KPMA 5GRJL 3RBSA 5JDJA 3HAEA 2WIIB 4WTXA 2Q0ZX 3QG7L 1DQJA 5CZKA 4GH7B 3QA3A 1R3JA 1FCGA 5JIQA 3AAZB 1RFDH 4RMBA 2GBTA 2NCMA 4P57A 3KVQA 2AJZA 3GRWH 3IDXH 1YMMB 1JWMB 1SYVB 2XWBB 1NBVL 1Y0LA 4H40A 1AZCA 1TZHA 3ARDD 5D1XE 4NO2A 4PRIE 3WE6A 2HCZX 3D6GA 1RXLA 4XP4L 5I76B 5IBLC 2VRKA 2CHZA 4N5UA 5GSRA 4F5CA 1AHKA 1WCQA 3U79A 2RH0A 2R69L 2GUYA 2PXYD 1N5AA 4PJEF 1XB8A 1OGTA 1G9NL 5E51A 1SFHA 1BP3B 3CFMA 3UTSA 3HB3D 1A4JA 3HS0B 4HDIB 4MMXA 2PABA 3X1BA 1MAML 1D9KB 4E41E 3OLEA 5FCUH 4Y5YB 4F7TB 2CNYA 3UADA 4K5OA 1ZHBB 5LN8A 4GUCA 1A6PA 3RNQA 1T2XA 4AW7A 2X6AA 2QVMA 4E42A 3Q5YA 2X1XR 2AQQA 4JHWL 4PGZA 2WBJA 4MDJA 2QPDB 4ANVA 3FRPG 2ZSVA 1XQ4A 3KL0A 4FQIH 4XMWA 1RSFA 5PAZA 3IF1A 3FU7B 1ET5A 5AL8A 1LEKB 1ZLUK 3WO4C 3SQOL 1RZQA 2YPLE 4HJTA 3D3VD 5DD1L 1YY8B 2HLAA 4FQJH 2MJWA 3NJFA 2A73A 1WSST 4N8UA 5C0NC 5EIVA 2VXSL 3JUZA 4JM0A 1RK1B 3DPDA 3MA7B 4EMZA 2M1KA 5BZDB 1PZCA 2XBDA 1KCKA 2W07B 3RWJB 2VXQH 4HAKA 3TN0C 5L88H 4NZTL 3AS2A 5K1JA 3Q3GA 3CDCA 1INQA 4OLUL 3STLB 5C9JA 1MVYA 1UH3A 1WC7B 2VDLL 3G6JF 4X5XA 2QQNH 3L3GA 4GS7B 2EXSA 4OM1L 3S5LB 1WFOA 1KJ3L 4DP6X 4IBQA 4XODA 4DVRL 2ICWB 1E5CA 4N2HA 3VI4F 3D39B 1BIIB 1A7RH 2WKLA 4QRAA 5BQ7A 1KN4L 1FVEB 1K85A 3VFWB 3ZKND 1QO3A 1LDPL 4P3CL 5J6SA 2IWFA 4O2FA 4XX1G 2ATKB 4FJ6A 3ZDYF 1IVLA 3QORB 5I82A 2DY2A 5C6TH 4FX5A 2J43A 2OKMA 4WTWA 3CHOA 1GYCA 1U2CA 3MRDB 5SWQA 4JJHA 4XBMA 4NN7C 1J12A 3ZDZF 2V9UA 1R5VB 2YUWA 3R4DA 4GW4A 4U6YA 2W9DH 1QUNA 3RWEA 5MERB 4X4MA 1AGEA 5ESQA 1FVCB 2W0FA 5FGRA 3ZPDA 4DP4X 3X11A 4V1DE 1F2XK 3Q1SH 4ZW5A 2ARJA 2FB4H 1FCCA 2Y1AA 4A6YB 4W70A 1MG3C 2F1EA 1FZOA 5IEHB 2D7QA 3GSWA 4ALAH 2J55A 4WCYL 2J5WA 4BM7A 2J6WA 2HLFC 2IALA 1YECH 4MJID 5T5FL 1NCWL 4AOFA 5ABZA 4UZUA 1FP5A 4JM4H 4M43H 3NN8A 4MZ2A 3VD2A 3R19A 1S9XB 3UERA 3EBIA 1RUQL 1LHZA 1LVEA 4N0FA 5T1MB 4YSCA 2X44D 3VB9A 3FNKA 1S8DA 2R1XA 5JMOC 2H26A 4N1EA 1DVTA 3HRZC 4PJHE 4MXQC 2OK0L 4ZUWB 4FN0A 4P23B 4FNTA 1TZIA 3ILQD 5CKGA 1EJOH 2FZ3A 5AVWB 5J6HA 1TPXB 3H85A 1SEQL 1J5OH 4KMTH 1UCBH 2JB6B 3EDKA 4K3EH 5E00B 4PYGA 3AREC 3DVFA 1MCFA 3GZKA 3P11H 5DZJA 1CE1L 4OIIH 3UZQB 1QA9A 1I3VA 4P3WA 5FX3A 5GGVH 1XH1A 1LDSA 3E38A 1KPRA 3V0EA 1ZLSH 4PV9A 1ID5I 2G60L 3X12B 3SO3B 1Q0EA 3PIQA 3L95A 4PIRF 4I13B 5D2NA 1KB9J 4GBXC 2OMBA 1CFMA 2RD0A 1ZGLA 3FZUD 2ZTBA 3T0AA 4XGZA 1P5UC 5C6WH 1ZVHA 5GIRB 4WW2C 4X9IA 3UXFA 3QFDB 3G5XB 5HYSG 3ZL2A 1DHKA 2QMKA 5FS5A 3UPRA 5ID1B 1NLBL 5DT1L 5AUMB 3QCTL 1HX0A 2CIKB 5T5NF 3D5OF 1MHHA 1XL6A 3VFGL 5DUMH 5I6LA 2WMPB 2BMKB 2YGVA 1INDL 3O6FC 3C5ZA 4IRSC 4QRPD 3IFLH 5KN5A 2ICES 1YA5A 5LXGH 3GB7B 5J4MA 3FCTA 4DP7X 1BF5A 1OZTG 5HHPB 3QNZB 3BSZA 3IXTB 1NC4D 4CC0A 1ACZA 2ZG3A 4EUPB 1IL1A 4U1LA 2XQYK 4FQXC 4PJ8A 3EGXA 4QF1B 2X2IA 2Y06L 4NXSA 5I15H 3TYGL 5LCVA 2DQHL 4WU5B 4M5TA 4KPHL 4M1GL 1I9EA 3JV0A 4KZEL 1JZ2A 1XGPA 1LTXA 1SY6A 4GRWF 4AQZA 1HOCB 1MWAB 5ADOL 3Q43A 1ZE3H 2X89D 1U95A 2Q7YA 4MX7A 5JPMB 4D0BA 2Y5TB 1QR4A 3LMJL 5ICZA 2BXYA 4W9FC 1F1GA 5IFJB 3L5XH 5F3HA 1OT1A 1U91B 1OAJA 3SE6A 2X9XA 4LRNL 4MJ5B 2A9BA 2E9BA 4Z9KB 5AW3B 2D7TH 3HNSL 3OKMA 3STLA 3P3RA 4XHQA 4KQ3H 1K4DA 1IJNA 1U3HC 5B1JC 4ZFZA 1MRCH 1NH6A 3TZVB 5IV2A 3BIKB 4PWIA 1OTUD 2EABA 3GKZA 3DROB 4I5BB 3RX8A 5HDRA 2WLIB 5G4NA 3SDCA 2ZUYA 4Q4EA 2V2XA 1H6TA 4CMHB 5B3JE 4IRJB 2J6EA 2R15A 4TVPD 2CPUA 2CGZA 1U8OA 2GUOB 5AENA 3CX2A 4POZD 5ITBH 2X0WA 2VH5H 4KXCA 4RRPA 5K9JH 2G0KA 4DHLA 1CLOH 1NCJA 3C2AL 1MVUA 3EYOB 4U1SA 1GZPB 4HZAA 5E2TL 2H8PA 3ULUE 1KDIA 1QBLH 1GOGA 4NN5C 1HQ4B 4DKEH 1USZA 5D7JD 1UZ6E 4G6ML 4R26L 2WQXA 4UAOB 1DSYA 4X98B 5BZXA 3L54A 3N9GL 1ZHKB 5AYTA 3QHZL 4X0NA 5T33H 3V8CA 1N2RA 2JLPA 5I8EA 4XB7A 2GVYA 3VI3A 5I19L 3V9CA 3B3IB 3X3FH 3GJFB 1FFNB 1D5XB 1NGZA 3BVNB 4HA1A 5DEGA 5DR5H 3AVEA 5IMKA 3S5YA 4WW1B 5D8JL 1KNOB 2E9IA 3CFBA 4WFHD 4ZJ9A 4EI6B 5E1AB 5JHMA 4S1SL 2AK4D 2CRYA 1R5IB 3P2BA 2FX8L 3KPSA 5G2NA 2VM4A 1PSKL 3OQ3B 1S5IL 2G3XA 2JTDA 2CHXA 3KPMB 3N44F 3HAEB 2OULB 3DUUB 4TNGA 4UB0H 4C47A 1IRAY 1O9ZA 3LRKA 3QA3B 3ORJA 2G9KA 4XNUH 4F9PA 5I1GL 3SGJA 5BV7L 4KTEL 3KE0A 1JSYA 2DKSA 1A5FL 1QI4A 2NMSA 4P4KD 2AJZB 4LDEB 1PQZA 1QX1A 3L3HA 5CJOH 1CI3M 3MODL 1TQBB 1JPSH 3ILPA 3IYLW 4MBRA 1Q9OA 3GD1C 4M1CD 2EP6A 5I5JA 3WXVL 2B5IB 3ETBF 3T0EA 4MJHA 2Q76A 5D7KD 2QR0B 3D25A 2D2CC 4JFEA 1OGPA 1RLWA 1WAEA 2VR3A 1Q9LB 5GSRB 4ENZA 3JTSA 1RZPA 2F2HA 5DJYA 2OZ4A 5I1CL 3ABKB 3DUSA 3VXUE 3M1OA 1N5AB 3BMWA 1OGTB 3CCHA 4LE8A 2YBRA 4HFWB 3L13A 4PS7A 4TNWK 2NUPA 2WYZA 3CPLB 1QRKA 4HXBL 5E4OA 1D6VH 5A2BA 1JHLH 3PWUA 1YC7A 3BWAA 3BZ4A 3RWHA 1P7HL 3ESOA 5EN2A 4JFDA 3MLPA 3K5RA 3ELQA 4GIOA 1NICA 2NW3A 3GZOA 5ACZB 2UXFA 3DSFH 1RZ7H 3FBQA 3QIBD 1TVHB 4YBQC 3AABA 5SV4A 4X8CA 2WBJB 4MDJB 2IG2L 3D48R 4RFNB 4RIRA 4BH7A 5IJDC 4GG6E 4NPYA 2ZSVB 3HZMB 4OQTA 1O6SA 3Q7JA 1NDMA 2BNQA 3I6LE 2H2PC 4FQ2L 4ENED 1WGVA 3WHE1 1BOGB 4QHUB 4Y4HD 2R23A 3FO0H 4HQQL 3ZN6A 1RJYA 3UAJC 3DOSB 3BP7B 5C0EA 3K6SB 4Q97A 3LZFL 3ME0B 4P2OB 5FA3A 2Y2TA 3TA3B 3JWDC 2A4CA 5E2UL 4YXHH 3RVXD 4RESB 1MJ7H 4G2AA 4X42A 3L1GA 3MCYA 2AJXH 4AIZA 1DVFB 1FNHA 3APNA 3WKQA 5FYLH 1F1DA 5EF3A 1UKSA 4HIIA 4Q6IC 3H2WA 4OLWL 5FDWA 4XNBA 2NQDA 4ZMAT 2YLHA 4OW6A 2ZOLB 4RMUA 4TLKA 2AFNA 3S5ZA 4HCRH 1J86A 1GCYA 1GIGL 4OUOA 4P9MH 3CHXA 4W4OC 4ZMOA 1QUPA 1GGBH 2E27L 2I24N 4WNSA 4YDZA 3IN2A 2CRMA 1GY1A 4A2HA 1A6ZB 3B2XA 1QG3A 5MEQB 4I0CC 1HZHH 1JF1A 3K74B 4RFEB 2WZ6A 1PD6A 2QPEB 1LO2H 4UQ2B 1KGCE 4BFIA 1NCCH 4PGCB 4HT1L 5BQ7B 3ULUL 4B9KC 1SJMA 2R2EB 1QO3B 2ENPA 1FQ9C 4LSPH 4LLQB 5IJKA 1T7ZA 3APDA 3MBXL 1L0PA 5IB5A 3PUCA 5TDPB 2RBLA 3IDGB 4WI9A 1EVTC 2O6CA 1LXMA 2VZSA 4N3UA 4HIHA 2PR4L 1JI1A 3WXWH 3EYSL 2CM5A 2X40A 3T5WA 5J3HC 1ZWIA 4U6YB 1QUNB 2DD8L 3DGGA 4GRMB 1AGEB 3L9YA 5ESQB 2XVGA 3ZE1E 3X11B 2ZUWA 4AVJA 2ENJA 2ZYIA 1BQSA 1T1ZB 5L4FA 4AG4H 1BMGA 4XO9A 4FZEL 3GSWB 4Z7QE 1CLVA 4R4BA 4HIXH 4ZAKC 4M7KL 2X9WA 4RAVB 4U1NB 3U6XS 4MFHA 5B39B 5FYJE 1FL3B 2IALB 4GQQA 4L0PB 2J1KA 4Y89A 3UTSE 2F1AA 2XTJB 4GUQA 2ZXDA 4R4FL 5IK3A 1JMZA 4NZRH 5JPNB 3C6LA 5K9QG 4N0FB 5CEZD 1S8DB 1IBDA 2H26B 4OBRA 3DDGA 3L6FB 2XZAH 1J8HB 3LYRA 4URTB 1H6FA 4B9JA 4PGDB 2FZ3B 4M4RA 5J6HB 1WVZA 4ZS6C 4NUGH 4DP5X 4W93A 4YHLL 1L9PA 1Y6MR 4LFHD 2W0PA 3RGVC 4C58B 1ZV5A 3IJEB 4CW1B 4F27A 4NFDA 4M4PA 2PW2A 1ACYH 1QA9B 1VRSA 3I74A 2D0HA 4X5QA 3S4SG 4LP4A 3U2SA 4DWHA 2UUDH 4A7GA 1KPRB 5GS2H 1KXQA 4PV9B 3GBEA 2EE3A 3P4OB 1B0WA 4AEHL 5JZ7C 5D6CA 4M6OH 4FNLL 2CD0A 3L95B 3U30B 3NCCB 3VWJA 3UIYA 3VYNA 1YMHB 1HAUA 3FQTA 1M05A 4CNIA 4UQAA 3I9AA 5E7FA 1N0XH 3BP5A 1ZGLB 5DZOA 1BQHB 1S78C 3RPIA 4RQQA 4K23H 3PJLA 3RIAK 1PF3A 3EJZD 2E74C 3UP1A 4EO5A 2WUBL 4MNQA 3X13B 1IM3B 2R2CA 4WI0B 3KNBB 1ZV9A 2B15A 5SX5H 3K80A 3ZJAA 1LEGB 2HPTA 3R4RA 2C3XA 1MQ8A 4M7LH 4FFYL 3X1NA 3TEYA 4KK9C 4JQVA 1O7VA 3NT0A 4F8PA 2ENSA 4Q9BA 1RMFL 2J8HA 3WIHH 1WIOA 3C5ZB 4GKNB 1WYJA 3CK0L 4O51A 4PPTA 5IB1A 3LV3A 3VXNB 1NBVH 2VL5A 2LFGA 5T1LA 3FJTA 2A5UA 5EC1B 5JQIB 2YD8A 2Y5QA 4WRLA 1P4BL 1SOQA 3CN1A 2Z4TA 3T0WA 3CFKB 1RY7B 3IKKA 3ZZLA 4U1LB 4KI5C 1LO0L 2BOBA 4PJ8B 2TRHA 3WBDA 4MS8D 1G9NH 1EAPA 2VNCA 1L5GB 1GKEA 2IANB 3CG8A 4C4UA 2Y9RT 2VDPB 4X4ME 1O7SA 4MX7B 1M71B 1RKRA 1X7TA 2DYSB 2XA8L 4HKBA 1MAMH 1SUJA 2VR6A 4I0PB 1A4KB 5F3HB 3L7FB 1JMXA 1G9ML 2XZCL 2YUZA 3S37L 2NY0B 3MREB 1TFHA 1EEQA 3QWNA 3KG5A 1E9PA 4Y8AA 4JHWH 5C07B 4B53A 5IV2B 4PRPA 3HHRB 1EVUA 3KM2A 4IEFA 3VX0A 3TBTA 1H3PL 2WYIA 1JGUH 2CO3A 3H9SB 1EK3A 4JKPL 3U1QA 4H1LG 2XWXA 1I8AA 2WW8A 3FYEB 4TL5A 1ET8A 3SQOH 3FCUB 2BRRL 5DD1H 3DJTA 5I0VA 4NWTL 4JHZA 4HH9A 1L6ZA 4XAWL 3O4LA 4V33A 3VFOB 1YRKA 3GM8A 1MVUB 3LKPB 2WB1A 3N06B 2XY2A 4PLOB 1U8JA 1W8EA 4U1SB 2E7CA 1VADA 3I6SA 3CN0A 1AE6H 2MPVA 5FYJL 2YD0A 3RB5A 5FYLD 4LU5L 4OM0L 1QD0A 4NZTH 4X7CC 3IJYA 1FFOB 5FYJU 4L4TE 4ZTOH 5TTRA 1G84A 5D2NE 2D4FA 5KJ7E 3CH1A 3VI3B 2L3BA 5I8EB 3KH3A 5DO2D 4GAYA 3QDGD 5DEZA 3QJFA 3F7YB 4G1MA 4DVRH 2DLHA 2OSWA 3NEOA 1EXUA 1KCUL 2V9RA 1MNNA 4KFMA 5CGMA 1J0YA 4MQTB 3QUHA 1KN4H 4OLZH 3KPSB 1ZTXL 4UM9D 5D1ZA 1SF3A 1SQMA 5H94B 4P2RD 3CFNA 4XPFL 4TNFA 4JFQB 1P69B 3RGBA 1NIBA 2PW1A 1LLAA 1NBQA 3KPRB 3QIUA 4L0YA 3BYTA 1RUMH 3IAPA 3FKUS 1U8MB 2BINA 2J71A 3G04A 3QSKB 5DHDA 4F7MA 4JB9L 3ESPA 5T3XE 3VG9C 1SHWA 3HNTL 5JIMA 3WO3B 2OMXB 1EBAA 3W57A 2KDGA 4EDWH 1Q9OB 5ICXA 2Q76B 2VXUL 3EOTH 3Q8CA 3BAYA 4OI9A 1K5NA 1V54B 4KRPB 2ZCKL 2F58L 2P5EA 3D25B 2IDUA 3NIFB 1QZ1A 4XMLL 1UCTA 1AH1A 3ARBB 1DR9A 1IBYA 3DUSB 3JVGA 1KYDA 4IIQC 4TTGA 2HTLD 2OS7A 1UZ6F 5DJCB 3ZKMD 3QJUB 2DMBA 1X4XA 3EO0A 3UZEC 2NUPB 4HZ1A 4OKVA 5E9DB 4I2XB 3VSQA 3WGVB 2L04A 3QQDA 2I32A 2W5PA 5DS8A 12E8L 2AQ3A 1TLMA 1QSVA 2F19H 5EU5B 4GYBA 1LO4H 5LQBL 5AVYB 4YHNB 4Y9EA 2NX5D 3MRQA 3KPOA 1SEQH 5L0QB 5DWPA 1FSKC 3PAYA 4GSQA 3NPZB 4BH7B 4RIRB 4LQ1A 1BAWA 4NPYB 4ZQKB 1LWRA 1SYSA 3SSGA 3MACL 1T03L 4R2GC 2BNQB 2G60H 2YAQA 1OAZH 1XFPA 4K2UL 4XBPA 5GS3A 2JCCA 1FA4A 3HMWL 5CCKH 2GSMB 2R23B 4G43A 3GXIA 4PCTA 1RJYB 3LNFA 1YC8A 3FTGB 3K6NA 5EORL 5FA3B 2CXGA 1IAII 1M2VB 4MNGA 3ZTJG 2APXA 2G4EA 3O6KH 4W81A 1N8ZB 2APBA 2G5UA 4KITB 4FFTA 4F7CA 3E6FA 2QZQA 1A2YB 2HMIC 4X6CB 1QLRA 4HIIB 2CA3A 2V6HA 1HH9B 5I17B 3KLLA 2GY5A 1XL4A 3VI3E 3CZNA 2V2WB 5LAXA 3VFGH 4ORZC 4EI0A 2OJZH 3ARGA 3IMRA 4RWHA 4JFHE 4FABL 5KSBE 1KWGA 2Y7LA 3SN6N 3UJJL 4K15A 1QSFD 4N0CC 4BA0A 3OPZL 4L3FA 1JF1B 2CSPA 2DTSA 2YPVA 1F90H 4PJAA 4XNAA 5JIPA 4BFIB 3KPSE 1CICA 3BUYA 1Q0XL 3C5SA 4YE4H 4LCWA 5JUEL 4BKTC 5MEOB 5F1OB 3O6MH 1ZD6A 4JFXB 3AT0A 2DQGL 4HIHB 5DDHA 1MIEL 2QV4A 3QRBA 3A3YB 4HP5A 1TZOA 4CILA 4AL8C 1ZK9A 1JL8A 5ADOH 4KQ0A 3T0EE 3DGGB 3TBBA 3W3BA 2ED8A 4PR5B 2FQFA 4UZSA 5I23A 4XH2A 4B95C 5F7BA 4DPCX 4JFEE 1GS7A 3KYOA 1UWYA 3RPKA 3L1OL 1ETA1 1NCNA 4R4BB 4HHGA 1DO5A 4ZX3A 4QXGL 4YWGL 5AVXB 3HNSH 3POHA 3UTPD 4HLZH 3B2DC 4XP5L 3D50A 4B5EA 4WSJA 3VWKB 1JVKA 3VXRD 1XSOA 1F11A 1G0DA 3QIWD 1MFEL 2NUTB 4YGVB 4NUMA 1QW8A 4ZS7L 1X9UA 2JIXA 3CPUA 4M7LT 1HH6A 5T3XL 3B9AA 1FDLL 1INEL 3B7UX 5LWYL 4JFDE 2IAMB 3BSZL 3LSOA 4GAGL 1IGYA 1ZXKA 2OSLA 4M4RB 4KHTL 2YUXA 3C2AH 4ZUSA 3NFNA 3TESA 2YGPA 4KK6C 2ROXA 3ECQA 1MFCL 3K3QA 4OZGB 4MSWB 4Z7NB 2VDOB 3G5YB 5ID0B 4G6MH 1L7TL 2CUMA 2VDMB 2YFNA 4ZUUA 4K3GA 5JTWA 5C2UB 4JREB 4MNHA 1YPZA 1ET7A 1SY6L 2YRLA 1QWHA 2Z4QA 3QO0A 4XNDA 1HJCA 1JWSA 4FMKA 3T2QA 2CXKA 5I19H 2X53A 4R5VA 3MV7E 4XMPL 1M7IB 5J06A 3EJYC 1R17A 2IBZY 3HI5L 3DIDA 5JIIA 1RZGA 2F7PA 2W9EL 1B2WL 4TMPA 4JG5A 3ZE1F 1E4HA 5EZOL 3WHXA 1VPOL 1M56B 3A21A 2R0WL 5AZ2H 1JPTH 2FX8H 2Y4SA 4JJ5B 1PSKH 2P7TB 4MNQB 3VW3H 2C4XA 1O5PA 4OIAA 5IQNA 4ONGL 1Z5YD 3GSVB 4K3DH 2XUWA 2RMNA 4C56D 3U9WA 3V6BR 1RJLA 2FR4A 4FEMA 2ALAA 4YS4A 1F3JA 5BV7H 4G6JL 3PAUA 5HI3D 3RRQA 1KJ2B 4NAQA 2A9ML 3V5DB 4O51B 3TCXA 4BWUA 4JM2D 3MODH 4OLEA 5DLLA 1BZ7A 4P06A 3WXVH 1JV5B 1VFBA 2XRAH 4P9HH 4Y1AD 3C5JA 5J9PA 3O2DA 2DW5A 2YHGA 4YL9A 3ZKXC 3HVNA 2ESVD 3ZX1A 4JRXA 2BHZA 2WSKA 3HR5A 1WHPA 3AUVA 4HD9A 2Z8SA 2BOBB 4G9FA 3TN0A 1YVLA 4L29A 1OP9A 2BSRB 2OA9A 3J07A 3NESA 1DQLL 5CZVH 3BUDA 5E1HB 1GMIA 3GPSA 2P47B 4PY8J 5SWZB 4J8QA 5T1KD 2RCSH 1V10A 3RAJH 3ML8A 5H37H 1Z66A 1WTGT 4MWFA 1MXDA 4AGPA 2NYYC 3HHSA 3NSDA 4M48L 4PJ5A 4UZGA 1CD8A 4ERSL 4QI3A 2CU9A 2DQ6A 4HKBB 5D1XD 4KO9A 3KYNA 1HSBA 1UJTA 1Z9NA 4V11A 1ROWA 2X3CA 2WLLB 4X7TA 1JZHA 2P26A 3TBWA 2C3VA 3VXSB 3MJ7B 5J11B 4A2GA 4LNRA 2OSYA 1B9KA 3W11C 4GI6A 1J1XH 1TTCA 4IEFB 3VRLF 3P1VA 1DBJH 1HHIA 2Z93A 5EO9A 3HJEA 5DMYA 4UUJB 2H32H 3KHQA 2W0LA 4LCVA 3E9TA 1EAJA 4HQQH 4GQRA 3ZSSA 5I6XC 1GOFA 1IM9A 5DLML 3QT2A 2DLFH 5F9WC 4J3OH 3S35X 1SDAB 4W9LC 4AQEA 5E2UH 3VNZA 3OF6D 2OZ4L 1JNJA 1VADB 4P5TD 1E6OH 4CU7A 2DQEL 1THAA 1PBYA 2CDGB 1KXQE 2ZKHL 2J1WA 3ARPA 2N01B 3IJYB 4PRHA 2Z35B 1ADQH 3WD5H 4AM0A 1GIGH 2YPLD 3IB4A 1EFXA 4GAYB 1NGYA 3HRZA 4LCCB 1VFMA 3RTLA 1R3LA 1JDAA 2E27H 4YXLL 3ALXA 4P5KA 2O6FA 4JFFA 1CLYH 3QWOA 1QPXA 5GJTH 1EXUB 4IBVA 3AREA 4MNQE 2JVUA 4HT1H 4JPIB 3DMMB 4ILDA 5D1ZB 3KDMA 2XWTB 1OSYA 3PYCA 3MBXH 3TEUA 1ZEAH 1ITBB 2PW1B 4FXGC 4IBTA 5GZNC 1P7KA 3A23A 2ATAA 2QDWA 3QIUB 3HE7D 4NQXA 4NJAH 4GQ9L 3HC4L 2VZUA 3ZKNC 1HE7A 3C08L 3TCLA 4R7DA 3EBGA 4OCXH 4F2MB 5I1KH 4E68A 1EDHA 4NKIH 1P5UA 1XF3A 1MZYA 5E5LA 3M1BA 4WW2A 5HYFA 4S2SB 2AABL 3CVDA 1MJ8L 5KTEH 1DBML 2F9BT 3LKNA 4JANB 5LGJA 4MASA 4M7KH 3VFNA 4ZFGL 1I7TB 2DMHA 1W72H 4LMQI 3EHBC 3RDTC 3T1FA 1RU9L 1NL0H 1GGCH 3JTBA 3O6FA 3ULSA 4GG8B 3UAFA 1BMZA 4X5WB 4IOSA 3FT3A 3FRPA 4IRSA 4OKVB 1I85C 5A2KH 1F4WH 3QQDB 1S4IA 3FH5A 4GMSL 5DS8B 2AANA 2WKGA 4L4VA 2X1WL 3ZGIA 3BPLC 4V1DD 5B1CA 1G5AA 3BAEL 4FQHA 1A0QL 1RJZB 1P9MC 5BS0A 3KPOB 4FQXA 1KCSL 3F05A 1M57B 2O61A 3COOA 3M46A 1N64H 4NQDB 4PRPE 2BZCA 4BH8A 3DI2B 4PBWD 5CAYB 5E70A 1FZMA 4MD4B 1JZ3A 1FFPA 4A55A 2IGFL 2PTTB 3ILQC 1LL1A 3TOPA 1AG6A 4MA7L 3IVKA 4ODTL 1I1CA 4G1EB 5D6DC 4AEHH 2H4EA 2GHWB 1TLKA 2JCCB 3MOQA 4FNLH 4XOCA 1YHPA 1H8LA 4G43B 4DW2L 4FQQB 2XICA 3O4LE 1A9BB 1DQDH 3WMQA 4JY4A 1ILUA 4LOUD 4PHXA 4QXTA 4RVBA 2I07A 3GSRB 4HWEL 1UXWA 3N50A 1U3HA 5B1JA 4JG0L 3WKPA 1CG9B 4P5MA 3NSFA 1M1XB 2GCYA 1IZJA 4ZDHB 3FZUC 2ORBH 1H3UA 1OHQA 2VZTA 5LAXB 1DLHA 5HHQA 2AF2A 4G7SB 3WL9A 4GKZA 5FECB 1WAPA 1JTOA 3RBGA 1BWWA 3SQBA 1JGDB 1I9RH 4WI8A 4YDMA 5CS7A 2OTWB 2NR6A 3GI9L 3SKOB 3L5JA 3WNNA 1YG9A 5FHBH 1CICB 3CSGA 2APTA 5HI5C 3INUL 2BSTA 5D7IE 5C71A 2CBOA 4YC2B 3VDCA 1WJ3A 4LCWB 2BIIA 3GBDA 2AJ3B 2D2OA 3IU4L 2PTUA 4U4BA 3C75A 1WLHA 35C8L 4JPVL 4OF6A 3WTTA 5PCYA 5AFAA 1IAIL 1TJGL 1MY5A 1NFIA 2J5LC 2R29A 3DURB 5DDHB 1IT9H 3K6OA 1JOIA 2JF1A 2VXVL 1MRDH 4UCFA 2VN6A 1KYUA 1VF5C 2XA8H 1EMTH 1J1PL 3OAZK 4K5MA 4NZJA 3NA9L 1WA0X 4HMDA 5AKVA 1L0YA 4XH2B 2P5EE 1P6WA 1IKOP 3DXAB 3LXCA 4PLJD 4EI5C 5J56B 2J2ZA 4Q7DA 3S37H 3WFBH 2CKBH 3K72A 1JK9A 2X2HA 5JNYA 2VWEC 5LB1A 2VR9A 2E46A 2KYIA 2W59A 3V0JA 4TULL 3UDWC 4RSVA 4JKPH 4YVNA 5K9OA 3MC0A 2VM3A 2EYSA 2XZQH 3VI3F 2JIXB 1BBJA 1HH6B 3QARA 3L7EA 2AQRA 2BRRH 1OP5H 1K4CA 3OMZA 4PJXB 2Z8RA 3QZLA 4DK5A 1KTJA 2YGQA 1IGYB 4HC1A 4XAWH 1JYXA 4J3OD 2CM6A 4ZD3L 3Q2NA 1TQVA 3RB7A 1I1AB 3G5WA 4C83B 1X5XA 3RNKA 4LPVA 4B7IA 2EEDA 1T7YA 3R8BB 1A9EB 1R3KA 4PJFA 2XXFA 4UANA 4POZC 4LU5H 4OAWA 4PGBB 3NAAL 3MU3A 4GKSA 4LASL 5AVZB 3MUY1 4MNHB 5HYSA 3SD5A 3QO0B 1JWSB 5IREA 1YYCA 2ADFL 3RA7L 5KVFE 3VFPB 4A2LA 1E5BA 5IUCA 5FO9A 5CP7A 3DV6B 4Q0XL 1UYWL 4MNGE 2B3RA 4Z7UA 2AEQL 4Z78A 4YHML 2EUXA 2VZVA 5M7QA 1NOAA 1YYLL 1E28A 4CKQA 4NENB 1BEXA 5F44A 3WHXB 3ULUD 2BSED 3LXUX 4A2MA 3IS1X 1ZTXH 3KWWB 1GTFA 3NIFF 3LPPA 3D85D 4WEBL 2BWQA 2WB7A 5EUOA 1DN0B 5IVZA 3SPIA 1KYFA 3V95A 3MRLB 3OR7A 3HG1B 4HKXA 5FO2A 2MPAL 5JMRA 2FSDA 3N40F 1RJLB 5EC2B 5I6PA 1JPFA 1F3JB 2BFVL 3UAJA 3WE1A 3HNTH 4AJVA 3GBLA 1D5MA 3MJ9H 1U9KA 3QZWB 1BZ7B 4PJAE 1VFBB 1J0JA 1PEZA 1JD9A 4MD0A 2B59A 3CZGA 2ZCKH 2F58H 2FGWL 3AC0A 3TNMA 4JRXB 3K6IA 4P4KC 3HR5B 3KR3L 4Q6IA 1U58A 2QSQA 4LFHG 4N2NA 2IC2A 3MTRA 2WVTA 3HPJA 4M1CC 3VRIB 3CC5B 5C0AB 4W4OA 3LB6D 4NKMA 4L8CA 1JZDC 3T3PE 2HFEA 4ALAC 1B2YA 5L6YH 3HHSB 5DD6B 2P46B 5I16A 4U1GC 3BRDA 1TTBA 5TDOA 4O2CA 1N6QH 12E8H 4HIPA 5DFVD 3BGAA 4LMQE 3QEQD 5ABAA 4JX0A 3KYNB 2PWDA 3O8XD 1JUFA 3OG6B 3TT1L 4BIKA 1F41A 1Z9PA 2ZKMX 4ETQB 3PWNB 1BD2B 2XKUA 1P7BA 2DDQH 3AITA 5IW6B 4LNRB 3QWQB 5J12C 2CR0A 4GT7A 4X6CF 5HHMB 3ULVH 1A6WL 1R6VA 1GH7A 1EAOA 2UWEA 3PQYB 3MACH 1T03H 1PX4A 5E6UB 3DK0A 3LN4A 4NQEA 6FABL 4K2UH 5JW3L 1PZ3A 2CDFB 2Y7NA 3HMWH 3VYPA 2H6OA 4L3CB 5DZLA 2ADYA 3A67H 3C9NA 3UTQB 3WNLA 2EXTA 3QHTC 5IF0A 5EORH 2P48B 4ZAKA 4ENEC 1XF1A 3S7GA 5IUSA 4O58H 3G6DL 2FLRT 4Y4HC 3MBWA 3E9UA 1EHNA 2FL5A 1HEZB 1SLUA 2WCSA 3V4VB 3KPPB 4HXAH 5B8CB 1YPZE 3H53A 3H3PL 3CHSA 5TF1H 2FJGA 3FQRB 1LK3H 3I6LD 1JWUA 1FG2B 3FU5A 1XIWD 5EEWA 3FAWA 2ZWKA 3RVXC 2VN5A 4JG1H 5CSGA 1H9VA 2UXVA 4OZHA 3FN0L 2GB2A 2YXFA 4FEIA 4ZXBC 4ICXA 3UJJH 4P5KB 1MRFL 3QGVA 2HT3D 2GJ6B 3IRPX 1BF8A 4LPCA 1OEZW 2VDRL 2MNUA 3RGVA 4HUUA 2QJDA 4ZI8A 4XPGL 1KFAL 3KDMB 4X9GA 4NPJA 5JUEH 3MXWL 4QEGA 4F8QA 4WDIA 5ENWA 4X6EB 3NCJL 3H56A 1ICTA 1R47A 3WS6C 3DIFB 4O4YL 1MW1A 2BSDA 1AS7A 4NQXB 4TKWA 4Y16D 4B7LA 3RX7A 1NPUA 5DJ0A 5IJVB 5KVFL 1GYWA 3WFZA 3QEHA 4XP9L 3TCLB 1ZHNB 1ZRUA 1QNZL 5JXAH 2PLTA 3ERXA 2H0EA 3IWVA 3NZ8A 1P5UB 1XF3B 1M2OA 2LV4A 3N0AA 3F7PC 3NZHH 3M1BB 2YIHA 2ATPB 3PWPD 4JKNA 4WW2B 3D7PA 4AYBA 1OKEA 1MFUA 4UV7L 3DNKA 2XV3A 1BFOA 1EWHA 1BZ9B 3LKNB 4KVCL 3DV4A 4OZGF 4G9FE 4RMTA 4IOFC 4KGLA 1PZDA 1ZJBA 1ZE3C 4AZ8A 4Z7NF 4FFZL 4HS8L 4XP5H 2DM4A 1E2ZA 4R83A 5K59F 2K70A 3MO1B 1LO5A 1AI1L 5IROA 1UA6L 4A7GF 3T0DA 4RAUA 4ZPVA 3EH5B 3CTTA 1MCDA 4LGRB 4PJ5E 2C1OA 4Q2ZA 4IRSB 4K9JA 5T3XH 4X9HA 3T4AB 2YKLL 1W6LA 1B6DA 1FDLH 3NJMA 4M1DL 4PRAA 2KZKA 2V4LA 5E9NA 3V79C 3NCXA 1GL4B 3IK2A 4LSSH 1TTGA 4IU2B 1HI6A 4KAQH 1YQ2A 4JGNA 1VEPA 4FQHB 4NN6C 4BJLA 2OV0A 1MJUL 3PABA 3LH8A 2ERJB 3LZPA 1KEML 1O7DC 3NSXA 1HU8A 4FNPA 4TLTA 1ZVSA 4GFXA 3AG3B 5FYJD 2KI6A 4JDZB 4BH8B 3B83A 3UBXG 5I1DA 2C9SA 1FZMB 3QQ3A 3DX6A 2P49B 3UTSD 1EO8L 5JORB 1JZ6A 4GUOA 2CO7B 1GXEA 1RHHA 5IG7B 4ESKA 2R27A 4NLHA 3AQYA 2DLGA 4F37K 1T4KA 2DH3A 2YO3A 4J8RB 3HI5H 3ZYJA 2N3JA 2AITA 2BX5A 2W9EH 5DD3L 2YPKA 5EZOH 4YDLB 1VPOH 3EYFA 1Z1WA 1KBVA 3D69B 4NZUL 1SJEB 3CH8A 2WQSA 4PRHE 1FYHB 2JCWA 5DHYA 3EZ8A 1ESOA 1GS6X 1S7UA 3BSGA 4OLXH 4ZTPL 5HDBB 1DLHB 3W39B 3EJZC 3WL9B 2UYLA 3F6LA 4HS6A 3C12A 4HGKC 1NCAL 3SQBB 4JFFE 1F58L 4GSRA 3BIBX 1XF5A 1E65A 5J1AA 1WHOA 2ZXCA 1CQYA 3SE9L 2WP3O 3GXNA 1OLZA 1JGEA 3QUML 2KZ1B 4AV4A 2BSTB 4GEJA 2AC0A 1E90A 3F12B 3QXAB 1U6AH 2OCJA 5AVUB 1DQKA 4L5FE 1DQLH 2OMUA 3ASNB 1A7QL 3NYKA 5CIPH 4Z7VA 2AZAA 5EOCL 1IAOA 3FUFA 2BCKB 5TF0A 4N8PA 5DS1A 1W0YT 3B4NA 5ISZA 5DGQA 1KELL 4UBDD 4N86A 2PO6C 1HKLL 3E7JA 3U25A 1I8LC 4C4KO 5AZEL 5H4YA 5E24E 1ZT7A 2IFFL 4MS8C 3RWIB 5CKAA 4KK8D 5SX4H 2EDXA 1Y18A 2Y36H 2CE6A 4XPAL 4IK6A 3VXTA 1I1FB 4NO0D 4HHAA 4MMZC 2V5RA 2I7OA 1E5AA 1MCNA 2DQIL 1CGXA 1JK9B 2ZAIA 3ULVD 3FRUA 3QFJA 2J21A 1HHKA 1IKNC 4TF4A 5FGBC 1E2WA 1FO0L 5MHSE 1XMWA 3AY2A 3S4SA 2EYSB 4QXUH 1QWNA 1A47A 3GI8L 1MUJA 4L4VE 4QHLB 4OD3L 2YAOA 4G70B 1KCVL 4OFVA 4J2QA 1NEZG 1MCLA 2C1PB 4G71B 3BPOC 4DP2X 4NHUA 4Y5VC 5BS0E 3NTCL 2R0LL 4L1BA 3KZ8A 4LLWA 4AC4A 5D1QA 2D7MA 3VACA 2VSKB 3CMOL 4L8SC 1T21A 5LGHH 2L7UA 1F3RB 1NKRA 5AW5B 2G4GA 4IIQA 3RJQB 2ZXAA 1JGVL 2QVFB 2MKWA 4OAWB 43CAB 4GKSB 4NXKA 5GJSH 4CVZB 1RUAL 2FK9A 3QZBA 5FW8A 3UZEA 5D93C 4TSAL 5DZ9A 2JKIS 1JGLH 3L1EA 1IEAB 1WGOA 2I9LA 2ITDB 1W8NA 4KQ4L 1ASOA 2J7LA 1AOHA 2ED9A 5CP7B 4IW4C 4Q9CA 1HTYA 1TNNA 1I8IA 4MAUL 5MENA 4LHUG 1G43A 1J9CT 1E28B 4G7YL 1HL4A 2Y22A 5EIIB 1K5WA 5DO2C 3HW7A 3ZRSA 4DGVH 2IH3A 5IQOA 4ORGA 3MNWA 4GW1A 1KB5L 3T2PA 1FN4A 4IKIA 1UTDA 1OARL 4WEMB 5EUOB 4XX1E 4AITA 3EOBB 1OAXL 3FT2A 4L4TD 2AGJL 3II3A 3ESNA 3ZTEA 1JPFB 3G08B 3HC4H 4F15B 2P80D 5CJ5A 1YEFL 3IDMB 4WO4D 5TQ0L 4C8XA 2Z1KA 5GGSB 4DN4L 4XMTA 1ULVA 2EVJA 3HG0A 5ITFA 5FHAH 4U3SA 2WM0A 2AABH 2WUCH 1MJ8H 2EEBA 1DBMH 1CDCA 5DHEA 4FJYA 5DFAA 5AVTB 3FB5B 1W91A 1GRWA 3VGHA 4XMKH 3JXAA 4Q6IB 1UVQA 4FCAA 2VLME 1LO3L 2HYMA 3WKML 3NUKA 3HPJB 4GXVL 5HGDB 2ZT9C 4ZUVA 4HU8A 6TAAA 4HJGB 1UZ8A 1ZV2A 3PDOB 4P2QD 5KSUA 2XWEA 3ECBA 3H54A 3I9PA 3GPEA 4NKMB 3AXHA 2XA3A 4L8CB 2WAQA 1I7RB 5T3XD 2JCCF 3TBCA 4F7EB 3QG6B 5I16B 5TDOB 3FT0A 1DDHB 4GMSH 5ETUA 1BZ8A 1KIUA 4KOBA 4XN9A 3TPKA 4H1LA 2UUDK 3FFDA 1EEYA 1TXKA 3WIIL 3ZKMC 4TQHA 4U31A 2PCPB 1IU1A 3LKRA 1T3FB 3T3MB 4OQ1A 1YEGL 1KCSH 4IOIA 3IMWA 4FA7B 3JSSA 1JZ5A 5EEYA 4L5FL 4OBSA 4JDTH 4HIEA 3OKKA 2XBZA 2IGFH 5C0BA 3IJ8A 3QB7C 4MA7H 2VDKB 4DEUA 1A1OA 2BNUA 4NQEB 3LN4B 1PEWA 3QC6X 1XVSA 2AKRB 4M7ZC 4RGMC 2JKJA 1W0WA 1ZKAA 4JQIA 4K7FB 5SX5K 3OB0H 1E6JL 3C9NB 1E4WH 2P8LA 3V0IA 3K6DA 3MV8A 1NOFA 3VG0L 4FHKA 2Q86A 1P0SE 5IQLA 3Q8EA 2QELA 3KJ6L 4PJFE 1DP0A 3MBWB 4HBQA 3I9GL 1AKPA 3SDCD 3HCVB 2XQ0A 5EWIL 5HYJD 2RTTA 1K8DA 3UBFA 1MCRA 4XVJH 2A6KA 5B4MC 4F24A 1W6WA 3MYZA 4CADA 4G8EA 1DJGA 5CMAA 3BT2H 3APMA 4OFKA 3FF7A 1CD9B 5MP6L 4Z7UE 3OKDB 2I85A 4D2NA 1Q72L 3GI9H 4YO0A 3GLEA 1WS8A 4MJ2A 4YZFE 1MI5B 3P30H 4QHKJ 2FBRA 3MN8A 1YN6B 4HUUB 3WN6A 1D5BB 3BE1L 2IIJA 4RGNE 1QNIA 3N5AA 4Y2NA 3QDAA 5EUOE 1VACA 5IBTL 4WWOA 5ENWB 5FFGA 2EDYA 3BJLA 4JPVH 2YR3A 1MDTA 4DTGH 3ATBA 1BJ1H 4UINL 3FS9A 5TD4A 1TJGH 4E9LA 3BKCH 4JFHD 1EHLL 2HX8A 1JAEA 1JPGA 4NQCA 5DJ0B 2VXVH 5EV7A 3HBQA 4GUPA 3U4AA 1B0RA 2WZAA 3IMSA 3NZ8B 4PJXF 3KXFB 4X6FA 3GXPA 2YQBA 5JHDE 2H7WA 4NIYE 1PCXA 1TQUA 3U0WH 2XXMB 2ZOUA 1PKQA 3BXNA 2QTEA 3MV11 4WGVB 4QY8A 4X8GA 4S1DC 1AJ7L 3I3EA 1G6RA 4JVPA 2OXHA 4PS8A 2PP7A 1BFVH 1DQML 1LO5B 1KBPA 1RLBA 4TQPA 5FM5M 2OP4L 2X0UA 2X28A 3WTWA 2BIOA 4TULH 4P49A 3RP1A 5C0DA 4NZDA 2C1OB 4Q2ZB 3PY9A 3MGAA 4XN2A 3RFZC 2N7BA 4CMMA 4QRSB 4KZ0A 4CDGC 4NC2B 3T0ED 4LPXA 5FK9B 1SOXA 2ADIA 3VFTA 4F7PB 1HI6B 3HUJA 1WZKA 4JFED 4ZD3H 1TQCB 1ZA3B 1U93B 2VUYA 3EYVA 3O3DA 4LVNC 4PWEA 3PABB 1AZNA 2IDCA 3IU3A 2EO9A 2V7NA 3K7UA 4CJ1A 2UWEE 4PY8I 4LPTA 3NAAH 4FP8L 4LASH 1D7BA 2R29L 2BVPB 3EJQA 1JYVA 1NCHA 4MLSA 1N7ML 1CFBA 2A9CA 2ADFH 1FLRH 3CUPA 2PXYA 4JFDD 5L9DL 4UQEA 2NY4D 4Q0XH 1UYWH 3UBGA 2AEQH 4O00A 5KVDE 1FFTB 4LEXH 3V6ZB 3WN5C 4HPOH 1BGXH 5FC9A 4TLUA 2J56A 4XC1H 2Z8WC 5LDSA 5TE7L 3SYCA 3HN5A 1HVXA 4D9QE 5GS1A 2XKNB 3UGEA 4HLZG 3WJJC 1R0AH 4OCYL 4WEBH 1HS6A 4GRLC 2YD7A 1DEEB 3DRQA 1CDIA 1IGTA 4OZHE 2WXRA 3A6BL 2BFVH 2UYLB 4HH8A 1HYSC 2ZPKL 3MV7D 4HS6B 3VXQB 1BXXA 4P4RB 2WY3B 5E8DH 2BZ7A 3JTTA 2R83A 4HC1L 1SXCA 4M62L 3F01A 4L2LA 4X80H 2WWMC 3PV6A 1F4YH 1H3VA 4OF5A 4WWKC 1C8QA 1F4XH 1HL9A 2FBJL 1OE3A 2UVFA 1FVDA 2OI9B 1JGEB 5HI3C 3H3KA 1OOAA 1HESA 3NGBB 3CX5K 3N43B 3KH4A 3KR3H 2C7UA 4JM2C 1X9RA 3OXRB 3V6OE 2EKSA 4L37B 1D7DA 3QJOA 5E03A 1OLLA 4IK7A 2F74A 2A83A 4FLQA 4NQUA 2A6IA 1QLEB 2YRBA 3CFJB 1U0QA 4O02B 4MVBD 4LSTL 4BZ1L 1IAOB 5JHAA 3FQ1A 2ENQA 2Z91B 5ISZB 3D52A 2CHWA 4HKJB 2HSIA 3E3QC 3WFDL 1TFPA 3RL2B 3UAAA 5ANHA 4NCDA 2XG5A 5D7LA 3OXSA 1Y18B 4HWNA 3HFML 4UWQB 1NWPA 4WJ5A 3VXTB 1AQDA 1WWAX 2Z31B 2RGSA 1OW0C 3IETA 2UZPA 4FXGA 4WSKA 1JXKA 5GZNA 1G7PA 1QACA 1WBXB 1A6WH 3QFJB 1F02I 5EU4A 3U1SH 2L7EA 2BNRD 2YMTA 3SPVB 4WWNA 1RUKL 3CLFL 3ZTNH 1QYGL 3WNJA 5JW3H 3PHOB 4WFFE 3WKNA 2HPOA 3LRGA 5IJBC 3JWDL 4JHAH 3VE0A 1ODUA 2W88A 1HHGA 3VCLA 4NQQA 1X5AA 1G7MB 3WTYA 1OSZB 4KI5E 2X6VA 2GITA 3MLUL 1ILSA 4LLWB 5D1QB 3MRRA 2XN1A 2DYPD 3MQIA 1U8PA 3AU1A 1T21B 3G6DH 4JO3L 1AFVL 3RDTA 1WITA 4KKNA 5DZVA 1MCKA 4D0DA 5AQ0A 3OZLA 3MBEB 2EH8L 3H3PH 4K0OA 1KTCA 2BVQB 2WN3A 4ZMWA 4AZUA 4GP8B 3C6LD 3AWEA 1NANI 1I85A 1A7OL 3OL2A 5DFTA 4BSVA 1A8ZA 2XVBA 4N8VG 1XTLA 4I77L 5H37G 4P5TC 3U9UA 4MJIA 5CR1A 1SJXA 5JOPE 5KYUA 2CRIA 3MZTA 2OYLA 3X1EA 1COBA 1CDYA 1I8IB 4DKFL 4JQXC 4U1IB 4WW2F 3LRLA 2VDRH 1FSKB 2GKIA 3HKFA 1FNEA 2BK8A 3EW3B 5F7EL 4XAKE 1LYQA 2D31B 2FQEA 4TQ8A 2AI0L 1CUOA 4PU2A 3BKML 4XPGH 1JNNH 2PNDA 4GI8A 3MXWH 4GW1B 3LD8C 1FN4B 1UATA 2E59A 3B9VA 2W95A 1QLFA 3FO1A 4GAJL 3T6XA 3NCJH 4N2LA 5D9SA 2FX7L 3F7QA 3FT2B 1JZ7A 3VWJD 3TIDA 2DQUL 3IJHB 2J1XA 5CJXC 3VFMA 5EU6E 4WKZB 5BJTA 3PP4H 1I7UA 4XP9H 3UEZA 3BAXA 2AJYH 3EYUL 5FA4B 5ITFB 4NI3A 1QTSA 3EJUA 4NFBA 4FFVD 4U3SB 3HE7C 4UV7H 4S0HA 3RVTC 3ETSA 4J3OG 2NTFB 2BVTA 1AHWC 4KVCH 1EXGA 1TYRA 3PDDA 5CZRA 5EU7C 4F9LC 3NJKA 4FFZH 1UVQB 1W16A 3HPLB 4JS7A 3U0TA 1CN4A 4ZMQA 1KENL 3P9LA 4DFHA 3IN0A 1V7ML 4G6AC 4NRXA 4Q4IA 4O9HL 2CO4A 2WXLA 4Z7VE 4BZ2A 4X83A 3OKLB 4N28A 1GR7A 2BVOB 5FKPB 1N67A 5T1LD 1NAML 5ETUB 2ZX7A 5KYYB 4H1LB 2VDNH 4FKEA 3FFDB 3VDAA 1IBHA 2H0PA 4AX3A 5IQ7L 4H0GA 3GRWA 3UMTA 3NDYE 2FJHA 3BD4A 4D0CA 4QRPA 1KEMH 4IOIB 3O9WD 4Z7OE 1RERA 2ZWNA 4N22A 4I48A 1ED3B 2OBGA 5G5DB 3ULAB 1DJHA 1NC4A 4HIEB 3OKKB 3C60C 5FYKE 1EO8H 3BZFB 4W9KC 2CLVA 2BLFA 2FT8A 5HDBF 1LWJA 4KRMB 1GYVA 2X4PA 3QNXA 1W0WB 1CBVH 2OQJA 1HWHB 2H6PA 2B9BA 4FFWD 2E4TA 1CFTB 5FOJA 2WQAA 3I50L 2BIHA 2P8LB 4EI5A 2Q86B 3CBKB 3FTWA 4B9GA 2FX9L 4NOBA 1IAMA 2X89A 1XXDC 2G2PA 3ELAT 3QQ4A 4E5XG 3W9DA 4PRPD 2HRHA 3RFRA 3T9WA 4G42A 1RK7A 1K6QL 1K8DB 3UDWA 1U8LB 4LOUC 4ZQTA 2J44A 1AKJD 1LP9A 3HRPA 1FV1A 1NMCC 2H3XC 4M7JL 4UV4H 5DK0A 2QVKA 2YSSA 4ZTPH 3VH8A 4G8EB 5CMAB 3QH3A 1AQKL 1OAKL 2CHDA 5E2WL 1AQHA 5MENE 3GFUA 1F58H 4OH2A 2ZXBA 2DBLH 4L1LA 4NDMA 3JUYA 1HFUA 5AVRB 4QRRA 1YEIL 1VB9A 5G55A 2K4WA 3SE9H 4ACPA 1QFUL 5HGBB 3QUMH 2FEDD 3ARFC 4XNXH 4HG4K 3BKYH 2XNAA 4CA4A 4OT1L 1VACB 2GSIB 2WXPA 5EEXA 4P9HC 5KSAB 1I8KA 4C55A 3OHXB 4PJ7E 4PSPA 2VO5A 2X2JA 1A7QH 1B90A 5IOKA 1RIVL 5EOCH 4IBWA 2VAAA 1JPGB 4NQCB 5D7JA 4CVXA 5BW7C 2VXQA 3STZB 5CN3A 4TV3A 4PP1C 4PB0L 2QDVA 3DSNA 5GPRA 5AZEH 4AE1A 4Z8FL 1WTLA 3UACA 4XO5A 1AOZA 4XPAH 1R1CA 3UL4A 3N55A 5E6ZA 4QY8B 2FUQA 1G6RB 4UILH 2DQFB 3OPUA 5D2LA 3RZCD 4W9DC 4KUZH 3A4FA 1PL3A 3BYYA 4ODHL 4YQXL 5EF1A 3IBEA 1MAJA 3OR6A 2AK4A 1HSAA 1WZ1H 4XXCC 1C5DA 4JRYB 2P42B 3W81A 1Z2KA 5KS9A 3QRLA 5C0DB 4WFGE 3VA6A 4HUVB 3SHSA 3GI8H 3DBXA 1KCVH 2IDTA 3CXFA 1OCOB 1X5MA 1U8CB 3DA0A 3GSUA 3QUYD 4LGSB 4BE6A 3IJSB 2ADIB 2P5ED 4Z7UF 3VFTB 1BV8A 2WLKA 3ZKXB 4ELMA 3ARWA 5JQ6L 3NTCH 4LB8A 3V5HA 4YNYA 2BJML 4UQ3B 5HHOB 3PDGA 5I8KL 2XI9A 4P4KA 4Y9GA 3AZUA 4PJCA 1T1YA 4YSEA 2LE9A 4YZFF 3IU3B 3ZRFC 3IJ7A 1F6LL 2CPCA 2VQ1A 3ARDB 3FFCE 3WY3A 3RTQC 5C0BE 2AJSL 3FCGA 5EUOF 3MKKA 1H6UA 4D9LL 4J3OC 3V7AG 4RMRA 4PG9A 3HN3A 1WZAA 1I3UA 1YN7A 4TSAH 5IQ9A 4HWBH 4G5ZL 4PB9L 3M88A 3U36A 4KQ4H 3CUPB 2PXYB 2JELH 2B7DT 1MFAL 3MV8E 4OF0A 1HWGB 3VSTA 2A4ZA 3HB3B 1YNLH 1ECYA 4XPHH 3NP4A 1JZGA 4XZ4A 5FO7A 3BISA 2B4CL 1Z0NA 1T66D 5GS1B 2D73A 1KB5H 3WJLA 3PNRB 4JLRB 2YXVA 2YA2A 3LS5H 5FYKL 1H15B 3WGUB 4PVMA 1MJJB 1OAXH 2P24A 1XGQB 3DOIA 5ESAB 1EDQA 4MMYA 2F7QA 1B6UA 1PG7H 3JTTB 1XX9C 4BWTA 4DN4H 2Y1VA 2WBXA 5F9WB 2LGNA 1AXIB 1FH2A 5J9PB 1NJ9A 5CU9A 1O0VA 4AJYV 4Y4HA 3D3VB 3EADA 3IFOB 1KXVC 2AXWA 3T3MF 4BA8A 4GW5A 5AYQA 2C7UB 2NXYD 5C7XL 1AS6A 2VERA 2EVFA 4Y19E 3P9MB 5E2VL 2EKSB 3HS9A 5HP5A 1Z5HA 2YQGA 2F74B 3ARGD 2A83B 3P69A 1U8HB 2A6IB 2QTVA 4NQCE 4YSQA 3BWZA 1U8QB 4HETA 4DKAA 3NDZE 2K0RA 2H3NA 5EEZA 2ZJSH 3LNEA 1VGKA 2F54E 3GMOB 2QKIB 4YDVB 1PKQE 4PREA 3OXSB 1UXSA 3LB6C 3QYCA 3ZT6A 3ZQ9A 4WJ5B 5HVGB 5B21A 3SYAA 3K0WA 3V0AC 1YEGH 1AQDB 4NNPH 3IMTA 3H0TB 2QSCH 4NYLA 3T8XA 3MA9H 1NCDH 4OU3A 4RMSA 3WS6A 2VLKB 4HJ0D 4OZIB 1X5JA 1XZ0B 1JXGA 4J7RA 2ZYHA 5EU4B 3O8XC 4R5XA 5DWUH 4JZNA 3P3YA 5C97A 2IBGA 3CSYA 1QHOA 2PYFA 3KLQA 4FQPA 4A6YH 5FV1L 5DVLA 2FTAA 2R1WB 4X4XA 3VE0B 1E6JH 4KTYA 3HUJE 4OGZA 2LLLA 3QYMA 2YFOA 5EZIL 1HHGB 3FSVA 4QYOA 5I73B 4Y2DD 3PGCA 1MSPA 3C6SA 2BS9A 5DI8A 1U92B 2NRDA 4PY7A 2HVJB 1ONQB 2EINB 4HCIA 1U8PB 4F57L 3R06B 2VKWA 4AQ1C 3EOAB 3I9GH 5FUOL 2BY1A 2X05A 1EQWA 4TVUA 3IFPB 5EO1A 5AAMC 3UTZA 1JBJA 3TPUB 1P7QA 2XX1A 1XMEB 4ZMLA 4BSVB 2SEBA 2V8LA 4M5SA 1P6FA 2BHFA 2VAJA 2UY6B 4MJIB 1FRGH 3O6LH 4M03A 3SDXA 1KPVB 1RJCA 5IBLD 5L7XL 4JGJA 3L2MA 1NGWB 1Q72H 3W5NA 3MRHA 1NKOA 2Q87A 1FNEB 3ZDXE 1T7VA 4PBDA 2NQ3A 3AWGA 4R6UA 3MLYH 1M7DA 2RB8A 1RZ8A 3GMRB 1QBMH 4XXDA 2LFEA 1DBBL 4PH8A 3ZRCC 4AL8L 3E8UH 4AMXA 2OL3L 1TZAA 3TIDB 2A6JA 1HCVA 4JQIL 3FONA 3B9KB 4ANWA 1UA7A 1WIPA 2ADJB 4URKA 1QASA 4AYFA 4UTCA 2D3NA 2OJEA 4LL9A 2WCPA 1PLGL 1QFWI 4GO8A 1HHJA 1JJUA 4KH9A 5FGSA 4KY1L 3S37X 1DQTA 2Q3ZA 3A4AA 3RIAF 4H8UA 4NEHB 2X4UA 4Y16C 5EB9A 2QADC 1A6TA 1AJ7H 1OP5K 4FTVB 3T1WA 3GMPA 4HEMA 2CBPA 3U0TB 2NY7L 4GOSA 2JB5H 3P73A 2PPCA 1AY1H 4NRXB 3ZE2E 3EFOA 5CEYB 1R34A 4HG4J 5IEKA 4ZO8A 4NNYA 2NNCA 3SY0A 4YSDA 4K7PH 2H9GB 2B1HL 5C0ND 1P84K 3J27A 3L08A 2K9UA 5D7LE 3B8SA 1DN2A 1DUYA 4IS6A 4E2OA 4OD2A 5KG9B 2OMTB 1RUPL 1R9FA 4IDJH 3FTYA 1MY7A 1YEEL 1OP4A 2FJHB 3LZQA 4LLUA 4QRPB 4D0CB 2Q7AA 3E2HC 4EXPX 2APVA 3P4LA 2VLJE 2K8QA 3REVA 4PJ5D 3O45A 3FU9A 4OJAA 4AMKH 2B14A 2PO6A 1X4YA 2X4PB 4JDEB 1I8LA 4YDKH 2QPUA 1TZGL 3ENEA 3U7YL 1THCA 2DB8A 3GKWL 4NRZB 3O3EA 4NCC2 4UYQA 5DZAA 2GK0B 4YFEA 1BWMA 4OCMC 3K2UL 2RIKA 5IMMA 2NZ1A 4P07A 5DHXB 5TH2B 4MMZA 4TOYL 4U1JA 4EQ2A 3W9DB 1CZ8L 1RZIA 1ZHLB 3N43F 4XPBL 3L3OB 5F96H 1IKNA 4R8WL 2HUEA 3CDGA 3V52L 5FGBA 3UZVA 3GS7A 3GC3A 1FH5H 1LP9B 1XBRA 5DK0B 3QEUA 1FNSH 4MJIE 3L4UA 3VH8B 3VUAA 4PV1C 1PYWA 3QH3B 5AW7B 3WUWB 2ZPKH 1EUTA 1JS4A 1TIUA 3FOMA 2O5NA 3MUGA 4Y5VA 4AH2B 3MLVL 2E9WA 2FD6H 4JN2A 2X7LA 5E4EC 5IMOB 1QR1A 1VGEH 3S96A 3OVUB 2IFGA 4MA1C 4L8SA 1DLFL 1TTAA 2HLFD 2FBJH 2VMCA 3QDJB 2XACC 4BFRA 5JR1L 1T5KA 5G4MA 1TQWA 3DO7B 3BP6A 4OR1A 1CTNA 1NC2A 2AK1H 1HCFX 4PUBH 5JO5B 3HHMA 3GJFH 1S5HB 3KJ4C 1NGPL 1E3FA 5BMFH 4BZ1H 2VAAB 5D7JB 5C0JA 4Z3GA 4PHZA 4UNIA 4E9VA 3ARED 4HCRA 4NUPA 4LKXA 3CDZA 3HAEH 4M8VA 3SGDI 3B6SB 3EUDA 1I3RB 2AQSA 1H0DB 3DRTA 5IMLA 3H9HA 4X7DC 4E9TA 4UBDC 4QAMB 5M95B 2MWCA 4MXWL 4Q9QL 3D12B 1VAHA 4E36A 5MI0B 1EZLA 2CH8A 1HSAB 4KK8C 1C5DB 1CK0L 4GBXD 3OC8A 3QK0A 4N9GA 4V2BA 4WV1C 3UBXA 5KS9B 1IGFL 2NCEA 2NY1C 3TV8A 4C4BA 5IB3A 4P2RA 2ICEC 2HWZL 5ICUA 3MJ8B 5ESVB 4APQD 1SRDA 3ULVC 3ISWA 2P9RA 1IE5A 2EIBA 1CGSL 4ELMB 3V5HB 2QQKH 1IX2A 4RCAA 1FZKA 3Q1EA 2OMYA 1MCQA 1T1YB 4YEEA 1MHCA 4U7KA 3AB0C 4P59L 2VQ1B 2HKFH 5AL0A 4OLVL 3O6FD 2Y6TE 1CDUA 1U42A 3SBQA 4IOSD 5KYWB 1WISA 3L9EA 5H35B 5MHSD 1I8MA 1YN7B 3B2MA 5CHNA 5LJYH 4FI8A 4L4VD 3ABMB 2FEEI 5I1AA 1UASA 4BUGA 4FI7A 1X5IA 5J5EA 2VISB 3NPSC 5I1JH 4DKFH 5BS0D 2EIMB 3P0GB 1HE8A 4FQXD 5CFHA 1RPQA 5C0FA 2VWEE 5AW4B 3DGDA 5FO7B