2B59A

The type ii cohesin dockerin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/structural protein
molecule keywords COG1196: Chromosome segregation ATPases
total genus 33
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2b59A00
2O4EA 4FL4B 5K39A 5G5DA 3FNKA 4N2OA 3GHPA 2W1NA 4WKZB 2OZNA 1TYJA 4UYQA 4UMSA 4U3SA 2VO8A 4WI0A 2B59A 5AOZA 1G1KA 3UL4A 3F2LA 1ANUA 1OHZA 1ZV9A 4UYPA 1AOHA 4IU3A 2VN6A 5LXVA 2JH2A 2XDHA 1QZNA 3L8QA 2ZF9A 2VN5A 2Y3NA 4DH2A 4FL4C 4IU2A 3BWZA 2CCLA 2BM3A 3KCPA 3KCPB
chains in the Genus database with same CATH superfamily
4CN4A 1Q0YL 4IIQA 4IOFD 4KKAC 2YJLA 2DI7A 4JGNA 1QATA 5J56B 1OANA 1U3NA 1AYRA 2HJLB 2PYEA 4WW2C 3KDMB 1GZQA 3VI3A 4JG9A 4MA8L 1EDYA 3FQWB 4G9FE 1TITA 1E2ZA 1KJMB 5I17B 2AJSH 4XMKH 3FN0L 5E1IA 1QI5A 4PWGA 4TSBH 3ZRSA 1EVUA 5IEKA 1BGXL 4LLYA 4V2CB 4YHYB 1AHWA 1R3IH 4ONGL 4IHOB 1DQJB 1X5XA 5K9OB 3F58H 4UZGA 1ZLWK 3HMXH 5C71A 3LKQA 3ZKXC 1QTPA 3GMOA 4B96A 3ETSA 4GW5B 1B4LA 4PAZA 2FL5A 1I7UA 2XV6B 3L5XL 4HKJB 4M56A 4PY7B 4R4NC 1S4IA 5CINH 2F58L 5GRZA 3TZVB 4QCIB 3DGGA 1DBKL 3O3UN 4Y9EA 2CKBA 15C8L 1UM4H 4AIEA 2F1EA 5KZCD 1BLNA 3RL1B 3KVDD 4M5ZL 4NUGH 3O6ML 1WBYB 3QEUA 2HPTA 3BSZH 3P0VH 3MLRH 3MUZ1 5GQBA 5KTEL 2Z4QB 5IQ9A 3DIDA 2GITB 4G8GD 3DJ9A 5GSRB 5EF1A 2DLIA 1HXKA 3ULUF 4XC3L 4IRJD 2ED8A 4Y2LA 4XMVA 2YR3A 1HHGB 1DL7L 2ZWZA 4WTWA 1KCSL 1T4KA 3FDWA 1JHTB 1WK0A 1GZQB 5FUCC 3VI3B 3AZUA 1MFEL 2FJGA 5AYTA 2GUOA 4CVZB 1AGCB 3BKYH 4BK5C 4ZUWB 3PP4H 1A3ZA 2YRZA 1MDTA 3FO2B 4NN5B 1X9QA 4HLZG 3HN5A 4PTUA 1J11A 1I1AC 5SX4H 3A4DA 3BPOB 2YMOA 2CO7B 1IGIH 4F2ME 4E0RB 4WK2B 3E9TA 2YA2A 3OXSA 4ZW6A 4OW6A 3LKNB 4YHPA 3U46A 3UYOD 43CAB 4PP1C 1PZUB 1RZGB 3BUTA 3W3BA 3MRCB 5EOTB 1I8MA 4OCWH 1JV5B 1A4KB 3CQFA 3GMRA 4MJIE 3ZOAA 4YSSA 3BVUA 3VFRB 2IDCA 3VACA 2VLLB 2XG4A 4AMKH 2OKMA 1PIFA 2NY7H 5FHBH 3HE7C 2WIMA 2HUHA 3FN3A 1YMMB 3QYCA 1ZXQA 4MYPA 1P7BA 3GT6A 1NGZB 3G6JF 5DZOA 4JB9H 3RVXC 1D5BA 4WKXA 2AHIA 1IC4L 4UB0L 3MA9L 3Q0HA 4NN5C 2PO6C 2YRPA 3A6CH 2PYEE 3KWVA 4HWZA 4PHXA 3QRBA 4ODUB 1YQVH 4ENED 4I3RL 5T3XL 3QP3A 1F4XH 2JIXD 1L9NA 1MFCL 3NAAH 1ZVNA 3NEXA 4MXVF 5DXWA 2EDJA 3HS0B 1XGUA 3QJSB 5CSBA 3S36X 4HS3A 2J12B 2KHAA 3QUMA 3ZT5A 3TGXA 1Z5LA 1M3IA 3HKFA 4GAYB 2EDTA 2VJ8A 2F54E 3VXSE 1LO4L 4OFIA 2BP0B 3RQ3A 5KVEL 4YGVB 5ID0B 5A1AA 5C0JB 3GSNA 4ZAKB 2ITDB 5F3BB 2DOCA 3VVVA 3HB3D 1MW0A 1UKTA 2C1OB 2GTZA 2AFNA 4G82A 4JFEE 4LPCA 5I6KA 3QXUA 3S4SB 2XKNA 4L23A 1SEQH 3DECA 5EZJB 3MLSH 5AYUL 4A7TA 1WWAX 3BCFA 5AKRA 1A6TB 1NMBH 2XZZA 3BX7C 3LZOA 4V33A 2C9AA 5DVMA 2AK1H 3DWTA 1H8SA 3AVEA 3BFQG 1P9MC 3O8XB 3ZHDA 2JTDA 1GIGH 3LZLA 3WNKA 3QIUC 2YAEA 2Q10A 5DVOA 2EIKB 1KBPA 3M1OA 3QIUB 5GRYA 3UZEC 1L9QA 3P4MA 3UXFA 4JRXB 1J0HA 3RU8H 3ZZLA 5E2TL 4KHXH 1QVOB 2BC4A 3B8SA 3UTOA 4N87A 3V79C 4KUCF 3B6SB 1H8LA 1S7VB 5I1DA 3KL5A 4LKCB 1YAIA 1GGCL 1RSFA 3GINA 1S7TA 2X40A 3D51A 5JHDB 1L7IH 1LHZA 2NY5H 4GBXC 4WQOA 1KFAH 4FJ6A 2XZCL 2ESVA 4QPEA 1R0AL 4PJ5E 1RHHA 1PF3A 2Y3NA 4KKBD 4Z7NE 4DZ8B 2R59A 2EH8H 1QNZH 2BM3A 4XPAL 2AGJH 1EJ8A 2R1XB 1GKOA 5CM1A 1UWXH 3F65A 4GSUA 4APXB 2EDYA 2DH2A 1SOXA 1BZ8A 5EO1A 1A66A 4WTQA 3EYOB 1VGEL 2V2XB 4CUCA 3F7KA 1TSHA 4PWIA 4JPIB 2Q76B 4G7RB 1GGIL 3N1QC 2YZ8A 2DLEA 1F6AB 4UAOB 2LHAA 3U0TA 3IU4H 4U1GC 2ENYA 5LXGL 1T2QL 4JGJA 1BVZA 4R8WH 3CVIH 4XNUH 3UTSE 4JM4L 1E6OH 3IDXH 1S9VA 2XY2A 3EOYG 4M8VA 4MNGE 4Z7UA 5F6IC 5BS0E 2EVGA 3UC2A 4H26B 4TKWA 4IBVA 1PY9A 4Z0BL 5BRQA 5GGVL 4BE5A 1TSRA 1KULA 2ICES 3KYOA 2Q86B 4JRYE 1OGSA 4M1DH 3DV6B 3ZTNH 2AEPL 4R7VA 4CDHA 3OXRB 4BGDA 5BRZA 1JXGA 5I76A 2VXQL 4U3SB 4M6MH 1Z9SB 4PJBB 1DBMH 4IBWA 3VFOA 1VB9A 2K7PA 4G1EB 4P2RB 4PJFE 3U79A 3QRFM 1FNLA 4FS0A 5INDA 1TQTA 3QWQB 2L7UA 4PJ9A 2PTUA 4GG6F 3ES6A 5IQOA 3T6QC 1D6VH 3ARRA 4DP9X 3ZE2B 4JDEA 2NDFA 5D4JA 4Q9CA 2OTWB 3N85H 3VJ6A 4QJ4B 3UAAA 1QMUA 4F8PA 2NCMA 5F7MC 1TQCB 2QHRH 5GJTL 4ZFGH 3QQNA 5DRWA 3CN4A 4PSRA 3UBXA 1U8NB 3WUWA 2EUWA 1U8OA 2V7NB 3HLAB 2CUAA 4R83A 1WICA 2F53A 3DUUA 1MY7A 4ZMZA 2BNRE 1AS8A 1UD2A 4NCC2 5DQDH 2DRUA 2EXYC 3WFEH 5J1TC 4TL5A 2E74C 2YWZA 1N6VA 2BNRD 1BQ5A 4N0CC 5EO0A 1S9XB 4EVNB 1TZ8A 2GBTA 1ONQA 1QFOA 4HCGA 3UAJC 3GSQA 1BZ7A 4JO2L 1RLBA 1QPPA 4G3YL 3OC5A 3UPAA 3WKML 3QQ9D 2JB6B 3SKNB 1J88A 3GMLA 2E7BA 1CJYA 4LPWA 1E7VA 3FRPG 3S2CA 4X9HA 2F8XC 3QORB 1G7JB 3GSNL 2ARJQ 2V17H 2WINA 3RILA 3BVXA 2YMXL 1MAKA 2AW2A 3RJQB 5BZDB 1XZ0A 4O00A 3O45B 1CTMA 2AQQA 2CLRA 3QRLA 1E8WA 4U1MB 3ARED 3U4BH 3LMJL 3OSKA 1IBGL 4XP5H 2NY6B 2OMYA 4HEME 5GZND 5E0QA 2NY5L 1GMEA 2YAPA 1PU0A 3MRJA 3US9A 1QBLL 4IU3B 5H8DA 1I8AA 4HX1B 2E9WA 2XETA 4WJKB 1FDLH 1J1XH 5HHQA 2NY3B 2G9HA 5JQ6H 4CVUA 4DP6X 1UC6A 4M1GH 4H8UA 4C8XA 4JM0A 3II1A 3MUUA 1G9HA 1BEYL 1NCBL 1R9FA 2ARJA 3C5ZD 5EN2A 5MEOB 5HI3C 1NLDL 3EJYC 5CJ8A 4GMSH 4G72B 4U6XA 1INDL 3MVSA 3RNQB 5KWYC 3CFIC 5LKNA 4TUUA 3TO4D 1ACYL 1D5IL 2BSBA 5D5MB 2AV1A 3LHAA 3ZIYA 4K9JA 4R3SB 1UXLA 5E6UB 1NIEA 4EOWL 1PZSA 3VXUE 4HAKA 2UV3A 3MRRA 4LCCB 1Z2KA 2IMNA 4GBXD 2H0JA 1MAJA 5B38A 3V0AC 1AHWB 1S7QB 4E9RA 5FHAL 1JGDA 3GI9L 3U0WL 3MRHA 3ZE0F 4C59B 3DDFA 1CI5A 3VXMA 4BH8A 4ZW5A 4JQXA 4PRBA 4XN8A 3QHFH 5IG7B 1A4CA 5C2BL 2WSKA 1JZ3A 3BZ4A 3ZDZB 4FYRA 1UQSB 4PV1C 3WKPA 3P2DA 2UY7A 3BP6A 3FTUA 4FFVC 1S9WA 3W5MA 4O58H 4FQLL 5DZLA 4DPCX 4DN4L 4NO5A 3IFOA 2Q5BA 1CDUA 1ZHKB 4XMWA 1SHXA 4KJYA 2PWDA 1MVYA 4KKCC 5JW3H 4YSEA 2VMJA 1T20B 4YBQC 5DD0L 3D0VB 4LXFA 2XQYA 1AFVH 1RZ7H 1UENA 2DIJA 4ATWA 3E9UA 4JHWL 1JZJA 2D03H 3MRDA 3U4EA 2WXFA 2YFOA 4QXGH 4PW4A 3V0FA 3NCXA 3GBDA 1UWGL 3GS7A 1LLAA 4QOKE 5DUJA 1X3DA 3LEYL 3V95A 1B0RB 1DJIA 1NC4D 2QQLL 4XT1C 4CC0A 3ZL1A 3L7FB 3LRMA 2BOCA 1QWHA 1XZWA 1M05B 1THAA 2NR6C 5ITFB 5KYUA 3V0WH 1JGUL 3UIZA 4XZUB 4UM9B 4F91B 5HJ3A 4JANB 4O5LL 4PTUB 4K07A 1IGIL 2YD4A 4LSRH 1MRFL 2A9NH 4HC1L 4NRYB 4MKTA 4LRIC 3WS3B 1BOGA 4B50A 3PWJB 3QA3B 1DJWA 3H3PH 4LSQH 3H6AA 2ZSWB 3TWCL 4WSKA 1MFBH 2J88H 3ZE0E 2MCAA 4MD4A 5IBLC 3H7LA 3MN8A 4KTGA 6FABH 2RCSL 3CZUB 5DJ0B 1E27A 3VFSB 2UVEA 1OXYA 2LR4A 5ICYA 3FMGL 4Y2NA 4OFYD 3SOTA 3GS0A 5FYKD 4ZYKB 1F4WH 3VFPB 3VG9C 2C7UB 3PUCA 2X89A 1QBBA 2WD0A 4LLQA 4HCIA 2GTWB 1ZVYA 5IBUB 4CILA 1E5BA 3DPBB 2PYFA 5DURD 5J6HB 1XSKA 2AMGA 2NTFB 4D0DB 4PVMA 4MJID 4JMXA 4NOFA 1ILUA 5AW3B 4AEIH 1TQSA 3QG7L 3P0VL 1E5ZA 4CRPA 5C6WH 1BM3L 2ZKHH 1XHHA 4KZEH 2ADJA 3HAEH 3QIWC 5G4OA 3FT2A 3RNKB 1JNLH 4HWBA 1LEKA 1CDCA 3IDYB 4EZMA 3EXLA 1MCLA 4RFNB 2AQ2A 5IW3A 4PGEA 3AWEA 5KYYA 2B1AH 1UWFA 3CPLB 1CQYA 3GIVB 4WO4D 1MFDH 3UO1H 2X1OA 4IHOA 4FFYA 2GJ6A 1YY8A 5JPMA 3ULVL 5IKCA 3ULUH 3L54A 3I74A 35C8H 4IRZA 1RZKL 3SPVB 2XNAA 1CD1A 5ILTL 1P2CB 2O6FA 1TFPA 5IOPA 1R5WB 2NXYC 2Y69B 4NQXB 2D73A 4TSBL 3QAZC 2WYZA 3ZDYB 3SE4C 1N67A 4UBDD 4Y5XB 4OVUA 1BFOA 5D2NA 2YPLB 1ETA1 3CFJB 2ADFL 3EOTL 1EJOH 2KLSA 5F7DB 3BD5A 2HJFA 1CE6B 4DEWA 3HG4A 1O7DC 2IG2H 3CZEA 5A2JH 3GLAA 3RDJA 4WFGE 4KY1H 1JZHA 1KOAA 2FJHB 4AV4A 4IKKA 1BLIA 1ZGLB 4G8FA 4NBZB 2VL4A 3M8OL 4C47A 2Z8VC 3TESA 1Z9PA 2YJQA 1LK3L 1J8HB 4R0LC 2FX7L 3R4RA 1JUFB 4WHTB 3QRGH 1HIMH 2HKFL 3DI2B 4Z0XB 3HNTH 2NY7L 4G1MA 1NLBH 3EJTA 3LKRA 2VDLL 1R24B 2CBTA 1E8XA 1W72H 3B5TA 3MBWA 3LN5A 4GG6A 2N7AA 2CRYA 2PO6B 5FOBA 4GB9A 4NNPH 1Y7VA 3CV5A 3CPUA 3BKJH 1DQDL 4XPGL 4PB0L 5F7NC 2NUPA 4F92B 3EGSA 1NSNL 5DZVA 2OW6A 2ZWLT 3ARBC 3VFNB 1SQMA 3S2AA 4KU1A 4ZMTA 1OB0A 1XVSA 2N1TE 5DJCB 3U46B 43CAA 2W65A 3L2MA 3PDGA 2QELA 3UMTA 3DMMD 4PGBB 3CWGA 3FFCB 4LAQH 3CHRA 1XD1A 1HJCA 4Z7AA 3LRLA 1WBYA 3QEUB 3LTVA 5E7FA 1NSNH 4HOXA 1T83C 1N0LB 2O6CA 1M9SA 2VL5B 2X41A 4TRPL 4GYBA 3QULA 4XPGH 5EFIB 3MCG1 3V7MA 3N50A 4LIQH 1FYTA 4HPOL 3WMSA 4NKDA 3GSNB 4ZAKA 1JWUB 4DCQB 4N9GA 2AAVA 4N25A 1NM4A 3NCJL 4PD4K 4WFED 5B7EA 1RIVH 3MV8B 2KMWA 1WFIA 3U0PB 4N2FA 4QRTB 4M7JL 3VYNA 1OAXL 3UFIA 2JCCE 2OSYA 1M7XA 2YKKA 1MQKL 4NQCA 5AWNH 3L3JB 2W92A 3FQ1A 5C92A 4MB5A 1YEIL 4N0RA 5A7BA 1ND0A 3EBIA 2WO2B 2X53A 4JN2A 2UZIL 1WAAA 4I4WB 3SJVE 3NZ8B 4LL4A 2RFXB 3KPQA 4PJGA 4U1JB 1JF1A 3GSUB 2JQMA 3QQDA 1NGQL 4MMZC 4RRPA 3LDBB 1KLUB 2MQGA 3L9RA 1QFUH 4RFNC 1UA7A 3L4TA 4PCTA 5C09B 1FVCA 2YD3A 5C7ZA 1WFTA 2NQ3A 2YPVH 5JW4Q 5BV7C 2G4GA 1VLXA 5L8LB 5AL8A 2DM2A 3IU3B 4KUZH 2I5YL 1T66C 3VFMA 1I8KB 2Y07H 1M9WA 1SRDA 1CF1A 4ZXBA 2QDWA 3BKJL 5KVDL 5I1CH 3X3GL 2IANB 3FTWA 3QEQE 1QTYT 1TKWB 3LPPA 2PCYA 3N1FC 1JWUA 4DCQA 2F7IA 3VW3H 4GIPD 5IW6B 3H9SD 1NAKH 3WFDL 1F02I 4ELDA 3KXFD 4HISA 4ZMXA 1FAIH 5I71B 4JN1H 1CFTA 3G5ZA 3HR5B 4NNYA 3WI9A 1AGEA 1XCQB 3F64A 1UCBL 2EYRB 4PGZA 3U7AA 4XB8A 5DMKA 1HNFA 4RX4A 3VQ2C 5DS8A 1KG0A 4N2IA 4B6ZA 4L9DA 4P3CL 2EO1A 1P0SE 3KD4A 5KS9F 3DO7A 4X5LA 4M5SA 4MXWL 4K4KA 4L0ZA 5D2LB 4O51B 4ZOEA 5K9OA 5D1QC 2BIHA 4G8FB 1YY8B 4R96A 3LSOB 5F8QC 2QFPA 2CRIA 2WMPB 3NRFA 4DO5A 1B9ZA 3KYNA 4F5CE 2E4FA 4JFXA 3ZT7A 3SGKC 3N1GC 3FT1A 5C0EA 1TG8A 2DZEA 2YPLA 4K3DH 4JRXD 1FFOA 4UNUA 3LZFH 4X99A 2JE8A 2G5UA 4XVJH 1UADC 2EKSA 1AGBA 2XPGB 3MXWH 3O8XD 3SDCC 2XTJC 4ATTA 4N26A 4UQ3A 5IF0A 5IB4A 5AW1B 4B41A 1FL3B 2B4CL 1KIRA 3VXPA 1OWRM 1DSYA 3O4OB 1HILB 1L0XA 4JO1L 5FO9A 3ESUF 1BDYA 3FPYA 5ADOH 5DJZA 3VDBA 3HI5L 4JFFA 4L2LA 5IB1B 4JHWH 3P54A 4OZFG 4HSAC 4PJHE 3VWKD 2NNRA 3IDMA 4X99B 4RETB 4ZFZA 1FNEA 1RUQH 2ED9A 5GIRA 3SCMC 2F08A 1G87A 1ZTXH 4YHLL 1X5YA 3RAJH 4LARH 5E9DA 3Q9PA 2WP3O 4M43H 5BZXA 1D9KC 25C8L 5LNGA 1FSKB 1KT2A 3D18A 4RIRA 4YE4L 1KEML 4OV5A 4HLZH 4DP1X 4ZMOA 4KH9A 5D2LF 2VO5A 2VDNB 3KL0A 4EE2A 4NENA 5C2BH 1YRKA 1IEHA 3IPEA 2DMKA 5KBLA 1EK3A 2R0WL 1OSYA 4MJ6B 3HCVB 4K0OA 4LRNH 1CTNA 4POUB 2J71A 5F71A 1BFTA 3PIQA 4KK9C 3EYVA 5CD3B 3MMEB 1V3LA 4F9PA 1NGZA 4MA7L 4W6XB 3MJ9H 3OPUA 2OMTA 4DKAA 1I1AA 2VWEC 4I7ZC 5IFAH 3VGFA 4TVPE 5L8KB 3L6FA 1WZ1L 4ETYA 3V4PA 3QIWB 3MRCA 1GOFA 4Y4HD 4GQ9L 4ODVL 2BK8A 2F7QA 1HE7A 4YPGB 1CVRA 1JS4A 3H54A 2CBPA 4NQTA 1BG1A 4N0UB 4N3TA 5C0AD 1IFHL 3OLDA 5C08E 4WHYG 2VDKL 4JR9H 1Z3RA 5DA4A 2WLHA 2QKIB 2X1QA 2YD8A 3OMNB 4QEGA 4Z18A 1GGTA 3SDYH 4X5WB 3QDJD 4DETA 1QQDA 2ESVD 2CUMA 3K5RA 5ESVA 4AMWA 1VCAA 3PFUA 1TYJA 4XCCH 5BVPH 3C60C 1JHTA 3DJZA 3TCLA 3RVUD 4CSSA 5D71H 2W8CA 1MUJA 1SFHA 4ODBD 1DDTA 1RJLA 2Q7NA 1U3HC 4IW4C 4XNYL 4FA6A 2GBVA 3OQRA 2YD9A 2YGNA 4XWOD 1IM3D 2YMXH 8PAZA 3WNOA 2A4CA 2F1BA 5JHMA 4AYBA 3FU3A 1U2HA 4MB3A 1WEJH 4U1HA 5FYKE 1C16A 2CXKA 4KO5A 3MUGA 1N19A 1T1XB 1JGDB 4TVPD 1U36A 5HTSA 1XGYH 1SDAB 4XNYH 2ENSA 3DX8B 4MDIB 5CEZH 1PG7H 1D5IH 1N64L 1PKQB 1TLMA 3HBPA 4N9OB 2CHZA 4OLWL 1TU2A 5FO8A 4PRNB 1IKOP 4XCCL 2X0UA 1GTFA 5IP4A 3ZO9A 1MRDL 3K6DA 5FKAA 5FGRA 5D1XB 5FDWB 1BEYH 4DJMA 4F7PA 3NK3A 4P46D 3OPZH 3EFOA 1MEXL 1SLWA 4WHYH 1J05A 1IKNC 5AW4B 1L9MA 4D8PA 1QBAA 3VGGA 3S7GA 2QKIA 2YN3A 4KBPA 4WEUD 3V0VB 1FC1A 1GVIA 2OCJA 1XGYL 1P7QB 3ZL2A 4APXA 3QDGA 2X2JA 5HHOE 3CVHA 5AD0A 3SQOL 4H1LB 1IC5H 2HJLA 2EDOA 2PYEB 1IAOA 5L2KD 3C09B 4HUWB 4ZUTB 3MRJB 1FO0A 2BP8A 3MAWA 4J4PC 3RUGE 1FFQA 3PXLA 4L8CA 2B3RA 5ADPH 5TQ2L 1KIUB 3HC4L 5IMOB 3GSNH 4R2GC 3CU7A 1URIA 4WWPA 1B0WA 3ECBA 4MD0B 5ABAA 4HHGA 1AGDA 1UYWL 2XWDA 4UQ2B 2X70A 2XN0A 4H5SB 3DRTB 5G4MA 2FDBP 3VFUB 4XNXH 2VABB 3HOGA 3QJHA 3SDYL 4FXTA 3HI6L 1NOAA 2PWEA 3FQUA 4H1LA 1XCTA 3BMWA 1B2YA 1JVOA 4G5ZH 1N6QH 2SODB 2XQBL 2QZQA 4X5RA 1X44A 2G3XA 4H8QA 5L4FA 4PB9H 1HEHC 3B9KA 5DUBB 5C08A 1FFNB 1HYSD 1F58L 3UCQA 3VXMD 4PJEE 3PLYA 3KWUA 2CLZA 4YDVA 1YEDB 1W8EA 1J05B 4PJIE 1J8KA 5IGXH 1A9BB 1DSWA 4E9LA 1WG3A 3NYKA 1JOIA 5GISH 2VZTA 2NY3C 4GW1A 3K91A 2NZ1A 5E24E 4QNPE 1CBVL 3G6AA 2AJYL 2XHNA 3GJEB 2G4EA 5FYKL 5DMIH 3RWCA 1YMHA 1ZGLM 1A21A 4LRNL 1MCIA 4JL1A 3ARZA 3NZHH 4HKZA 3HUJB 4BE6A 1UWYA 5FA4A 5D96B 2AITA 2R0KH 3OHMB 4IBSA 3ARBA 2QTVA 1PD1A 2WNWA 2HX7A 3U9WA 5GGSY 4OLVL 4X6BB 1QKZL 1UZGA 3RWFB 4TLTA 3T8VA 3LXBA 2EIZA 1G1CA 4FLSA 4JR9L 2JJTC 3ARFA 5L8JB 2ENPA 2AXGB 1MI5A 1IFHH 5D4QA 5D7LB 4ZFOL 5K9JH 5KBPA 3S96B 1OGTA 1DR9A 2L3BA 4RBPK 3ZGHA 1IFRA 3AAZA 3A21A 4AQOA 3N04A 5CKGA 5I1EL 3VRIB 4OM0L 1FYTD 4GSDH 3VAEA 1BA9A 5ABDE 3PXHA 4MMYA 3B43A 2DWSA 3V8CA 1IAIH 1AE6L 1LQSR 5JLZA 1VEMA 1QR1A 2FT7A 5EOQH 5T1MB 5HDWA 1BZQK 3DA0A 3QDGE 3T0BA 4S0SD 2EEDA 2NNCA 3MRFB 4X9FA 4KK9D 5AENA 2HN7B 4PJIF 3I02B 1FIEA 2DJMA 1CDJA 2VSCA 1GCYA 2PNDA 2X3BA 4NPYA 2DY2A 1T4WA 2UZYA 4JN1L 4XNAA 4R7DB 3TBWB 4GNKB 3V6FB 1XV8A 2NY5C 1IM9A 1ACZA 1SXZA 2H3XC 2EDXA 1T89A 5SV4A 2Q7AA 3AQDA 4MQ7A 4K3DL 1EUUA 3MRKA 5F88A 4E9XA 5D72L 1E0OB 2E6PA 4ZUVB 2JTYA 4DAGH 2BFVH 3X3GH 3UPCA 3OBAA 4AH2A 2P5EE 5DI8B 3PGDB 1JD9A 4MRCA 3ABMB 4U1HB 4WFEE 3E1F1 2HWZH 1KFAL 5C0BD 4PM1A 3T3PE 4O2FB 4HIJB 3MV7D 3SN6N 2Y1VA 4W9JC 4IIZA 2HRHA 4JY4B 5DEFA 2YBRA 1YPZA 1I31A 2WBKA 2VZ1A 3UTQA 3QIWA 1F8TL 4JPKL 4D0BB 4DK5A 4FQIL 4GS7C 3EF7A 5ANMB 3IJ7A 3LS5H 5HDBB 3PHQA 2P24B 4JQVA 5I1JH 1BVNP 5DMKB 4WV1B 3D09A 4DKDC 3G7TA 3RL1A 5ABZA 5HYSA 4FFZH 4J1UA 2QR0A 2CK0L 4XO8A 3UJJL 1E2WA 2V2TA 1EA9C 1NDTA 3JVGC 3EO9L 1HZKA 3S3CB 4M48L 3TBYA 1CLOL 3K0WA 4JRXA 2CDFB 2B4CH 3O2DL 4H0LC 3JBG7 5C07E 5AZEH 4FI6A 3QJUB 1GZHA 4IK7A 4XOBA 2EDLA 1J9QA 1P7QA 3BKCH 2Z64C 2Q3ZA 4QF1A 1BMGA 1Q9OA 4A7UA 4JRYD 3BXNB 1CGYA 5TPWH 3K6SA 4BSVB 2OSWA 3HG2A 5CIPA 1SMAA 3KAAA 4Y1AD 1S7SB 3MUHL 3MGOA 4Y1AB 3U4KA 2XZAL 3P02A 5D7IF 4MZIA 4H8PA 3GPEA 3TWYA 3PNWB 2Q2LA 1ZLUK 5B1JC 3ZRCC 1QFUL 1GYVA 1JPTH 1XMWA 1F4YH 3L1OH 4K94L 4M9PA 4PN6A 3US0A 5E2VH 2IWGA 4JE4B 4BUGA 5IVZB 2ADGB 1LNUB 3RGVA 4LGPB 4UQDA 3ETTA 1WC7B 5EO9A 3KNBB 2IH9A 3EYOA 1H3VA 1KNOB 1ZHNA 5DJZB 1QRNB 3T3PF 3WY4A 3F84A 5EU5A 1RUAH 1WFJA 5LQBL 2H47C 1IC4H 1MRCL 4H20H 4PJAA 2DTMH 5GGQL 5D1QB 4C4BA 5IEKB 1V7MH 2XWBA 3DX3A 3VE0A 3VFMB 5B4MC 5F1KC 1SGKA 1OTUC 4I0KA 4PBWD 4KVCH 3IDJB 1JDCA 3GBEA 1YLBB 2P49B 5DQ9B 2C3VA 3UBXG 4KI1A 4PIBA 3L4UA 1UA6L 4AI7A 1U58A 4TSCL 1I1FB 2FECI 1X5LA 4L3ED 3S5ZA 4A6YB 1W72L 3RY6C 3WV0A 2D4DA 4RFOH 3KMDA 3ARYA 1HIML 2HKFH 3BRGC 2F58H 1I9IH 5I76B 5JXAL 4KUZL 2YKLH 2DTML 2WWKO 3BWAB 3MJ7A 4HZLA 3WFCL 2YQ2A 4HJ0C 4I1RA 4YK4C 4HS3B 2D3JA 2CHDA 4C83A 2Y7LA 1G4RA 4J3OC 3WDHA 3HIZA 1BYNA 4YDNA 3H42L 3VX0A 2AXWA 5T3ZL 4AG4H 5HVWA 4HIHA 5CN1A 2E46A 1X7TA 3AWFA 1FZKA 3T4AA 3BFOA 1XH3B 1L6XA 4DKTA 1HAUA 4XP4H 1NANI 3KBEA 5I15L 2P46B 3BH9B 4WUKL 3FQTA 2FJGB 1X5AA 4NZ8A 5FA3B 4OQTH 1I1RA 3K2IA 3IM1A 1GS8A 4UTAA 3WJJA 2IO5A 3VXSD 4X98B 4HBCL 4K5MA 2VLRE 4XXCA 5FW8A 3IJ8A 5I1HH 2AXHA 2UZXA 3DC0A 5AZEL 3FT3A 3M8OH 2B9BA 3ZR6A 3OG4B 4ZQTA 2ICWJ 3HZ3A 5GS3A 5ERWA 3MV9E 5T1JA 4TVPH 3VI4A 3QUXA 2EDBA 2PYED 3KLSA 2ATKB 2P7TA 3QG7H 1OP5K 3T0EA 1IL1B 5E99L 3ATFA 4X7EC 2ETWA 4XX5A 4ETQA 3ULSA 3B7UX 4QOKD 1RU9H 4XAWL 1KPRA 3MPCA 4JN2B 4HUMB 3T4YB 3CU1A 3ZDXF 5DVKA 1H5BB 1JTPA 2E7MA 3NJMA 1KB5H 4YSQA 3IT8D 4BKTC 1R46A 3CXFA 3NABH 2X4OB 4ZO6A 1MQ8A 5SWSA 4GXUM 4PRAB 4QF1B 3D34A 3QQ3B 4K3GA 3B1UA 1MIEL 3SB3A 2LTQB 3GTNA 3KDMA 2RQ8A 3QFGA 4JZNB 5FPIA 4PJGF 3SGKA 3F00A 4P59H 1YEEH 1XMEB 7PCYA 5J13C 5IVXE 1J5OL 5I8EA 1MXGA 1U8IA 3D08A 1CDBA 2WIIB 1RK0A 3CSYB 3GDCA 3ISYA 1BREA 2P8LA 1M7IB 4TL4A 3QDME 1BIHA 1BZOA 3CH8A 3N44B 3RUGB 2XV0A 3RHWF 1WD8A 4JFQB 1DN2A 1HHGA 4I88A 4N24A 4N20A 3WYRA 5KBNC 1J8HA 5E8OB 5AB2A 1TTCA 4R0LB 5KJRH 3HUJF 3RVVC 4YC2B 3HJ0A 4MJHA 4L9LB 2QSTA 3HC3L 2ESVB 3HR6A 5KSVB 4G8GE 1DJZA 1OPGH 3RZCC 2RTTA 5TF1L 2JXMA 3FRPB 2LU3A 3VGEA 5BUPA 4UILL 1HJBC 2Y06H 4DPBX 4P5TC 4HPHA 2WQ8A 1PGRB 4KJPD 1GJUA 1UXWA 3EO1B 4I5BA 5J9PA 2ZJSH 4UQ2A 4HQQH 1A8ZA 2ADGA 3TA4D 4F8QA 3OG6B 1N59A 2CIIA 3RA7L 1YEJL 4X4XB 1TMCB 1U8LB 2AEQH 2I60H 5HYJB 1OAKL 4LHQB 3LXAA 5T5NG 5LG6A 3K2MC 2E7LC 4MS6A 3MZTA 5CZVH 3L4YA 4JGMA 1DEEA 2Z35A 1G7MB 2WQSA 4HJSA 3GSOB 1IQWH 1JGVL 4XBPB 5ICXB 4MJJA 4LMQI 3ERXA 4GKZB 5E1GA 1TTUA 4LHUD 2OS7A 3V9CA 1CL7L 2CBOA 2H3NA 3RDTB 2AK4E 4N8VG 2FJFB 4X50A 4FOMA 5DD6B 4PJ7F 1U8PA 4G6FB 3UTTA 3RJOA 3MRQB 5FGCB 2DQEH 2KDGA 2Z8RA 1QBML 2UZPA 2ICEC 3T3ME 3V4VB 1AP2A 4B9YA 4UAOC 1VFAA 4YBLB 3ATAA 3QJFB 3F12B 1MW2A 5KOVC 1AG0A 5FKAB 1D5ZB 1KPVA 2IIJA 3VRLE 4Y1TA 4UQ9A 1E3FA 4XVUD 5ITFA 1QKZH 5FX3A 4HEPG 3KWWA 1TEGA 4I0PA 1UKSA 3HUJE 2IH3B 2X6CA 2K8MA 3TEUA 5C70A 4Y4KB 3JYCA 3WJJC 2RIKA 5JPNC 3EZ8A 4R5TA 4AYDC 4XNMB 1Q1PA 1H9VA 2X6UA 1A0QL 1N26A 1JG9A 5DMIL 2R9HC 2ZX5A 4OKVA 3O41A 1IBGH 1QI3A 4YXKH 4RESB 4KDTA 3ZTJG 5CMAA 2YQ3A 1Z9LA 2IGLA 3KPTA 1XF1A 4Y7OC 4XPTH 5JPNA 4NO3A 3NIDB 4U1LA 1WO2A 1OQXA 1ZT1B 1IC5L 3B2VH 3MSPA 4JFZH 3L95A 3HZVB 3S6CA 3EJZC 2VT0A 4KKZA 2UZXB 1A1MB 3PPSA 3MRFA 4ZMYA 3MACL 3FQXB 1BWMA 3JV0A 1PX3A 1NIAA 3ULAB 4Z3FA 1XF2A 2NNAA 5JIKA 1AD0B 3C5SB 4IJ3B 4YJZL 1H3TA 3D39E 2IJ0C 1NKOA 3FF7A 2NYYC 2ADJB 3MX0A 3OPZL 1CI3M 4V1DB 5IB5B 4L4VD 5KG9B 4BQ9A 5JIPA 1GL4B 3MV8E 2BVQB 1WUNT 5IBTL 5IQLA 4Q6IB 4P2QA 1GW6A 2YD5A 4OGAD 5D7SH 4ZUVA 4UWQB 3MRKB 3KW7A 1F1AA 1I8LC 1NC4A 2I7SA 1WZKA 2MOVA 3V9EA 4MMXA 3TBSA 1KELL 2YQBA 4OJYA 4POZD 5D6DA 2ZAIA 1XXFC 2E9IA 4NXKA 1GY2A 2A83A 3ARGB 4JY4A 1LE9B 3WG7B 4CKVX 1IUZA 4N2OA 1LO2H 4ZDHB 1BZDA 3BAKA 1FH5H 3MX0B 5KG9A 3T3PB 3JT2A 4Z7QF 4MJ5B 2HX9A 1MCNA 5EU6B 5I23A 4BFEA 5AG9A 2ZAHA 4WWKA 1XIWD 1U93A 2FNWA 2G9HB 3OLGA 4DW2L 2VDLB 5T33L 2GJ6D 3EO0A 2PR4H 3QZNA 1H6EA 3WLWD 5CP3H 3LYRA 1VESA 3I6KB 1S7WA 4PS7A 4RGOL 2CHNA 5DFAA 4OF6A 1KYUA 3ZJAA 5JIIA 3ARFB 3UJTH 2X4RA 5D8JL 4NBYB 3N1PC 4KKQA 3SY6A 3OD3A 3UTZB 1A02N 3BXNA 2ZYSA 4GIOA 4ZBJA 5C09D 4BFFA 1CICA 5EEYA 1MPAH 1TNMA 5J5EA 1AC6A 4NC1C 4MNQB 1MKFA 2W07B 2BCMA 4K5OA 1J0YA 1K8DA 5GS2D 3BVWA 4G5AA 3AG3B 3FZUD 4X6EA 3GFUA 1QW8A 1UZ8B 3ULVF 1J8SA 5IVZA 1T2QH 3QPXH 4J3XA 4K3JL 4OZGF 4UF7C 3RBGA 3BE1H 3NRPA 2CHWA 3G6JA 3GHEL 3Q44A 1PFCA 5GGTA 4HUNB 4ZRGA 5EEZA 1XR9A 4URTB 3RNQA 3Q43A 4HHWA 2Y0SA 4HFWA 4F1ZA 3MYJA 5IB3A 1XF5B 1JP5A 2IPKB 5C0DA 4E5XA 2GB2A 4NZJA 5FGBA 1XT5A 1XEUA 3TF7C 3RX9A 4ZG1A 1K8DB 4KROD 2OQJA 2W94A 4DOHE 3CFQA 4MMYB 4G3YH 4OIAA 2VKXA 5C0RH 3NZSA 3AU0A 4JO2H 4YGAB 4I18A 5BO1H 2GTQA 3D0VA 4AEEA 5AAMA 5D7KE 4OCNC 3TLRA 4NDMA 4B9IA 2YAHA 1YNKH 3FO0H 5CGBA 3GRWH 3RAJL 3TPUA 2ZOTA 1X9UA 3QHZH 5EG6C 2EIJB 4P23C 3L1EA 3N43B 4L8SB 5IT2L 2D7TH 3BZEB 1K3IA 1VENA 2UY7B 3BP6B 3E80A 1KBWA 3ZDYF 4KI5F 4FI8A 3TEYA 3INUL 3FOMA 1C5BH 4CMHC 1JF6A 3FCSA 3WXVH 5EC1B 4UZSA 4PBVC 4OZFA 2WXKA 3D25A 3MRBA 2E47A 2DW5A 1A3LL 4P3DA 4K23H 2GT9B 3MOQA 3TTYA 2H0PA 3ESVF 5KEZA 3VD4A 2NSMA 1PZCA 4JDZA 1IBDA 2FIKB 4L29A 3UZQB 4YIQA 4EO5A 4OJCA 1TZGL 4YE4H 2YO3A 5I19L 1UXSA 2NSQA 3UEZA 4J3UA 4OCRL 4OJDH 4F57H 4F7TA 5GRXG 2VXQH 5SWZD 2A3TA 1RUMH 3T2LA 3BP4A 3ARTA 3O6KH 1VFOA 4R90H 2OAAA 1OPGL 2RA1A 3UPRA 3S3DB 1ZLSL 2DV6A 2X1WL 4L1DA 1MCPL 1SJVA 3OKLA 1IC0A 4JQVC 1AIZA 3HG1E 5E5MB 2H1LM 4CAGA 3NSXA 4TV3A 5T8IA 5I0XA 5BXFB 1E9QB 2KL6A 3NSCA 1CPUA 3F2LA 2CR6A 5IREA 3QUZC 2E6JA 1KTBA 1VHPA 4P2OD 1KPVB 4C55A 4PJ6A 1ZEAH 4R97B 3MA9H 4IU3A 3HC0B 1UCBH 5B1CA 4PSPA 3BP4B 4ORGB 1HINH 3FUDA 1QUNA 2JJWA 4OZGA 4CDGC 1UM6L 3T4YA 4ACPA 4MMXB 3TBSB 3SPCA 5FS5A 2VXVL 2Y4SA 2BNQB 4N8UA 3D3VA 5K39B 3UDWC 5MEOA 2ROXA 2WANA 4JFXB 2J1KA 3KYNB 3GXDA 4H4NA 4NWUL 1ZLUH 1SXBA 1W0VB 2ZCKL 2WXNA 4LB8A 4L4VA 4YFLF 3UBXB 2JLPA 2KZ1B 3VD9A 5DFVC 5F1NB 4CMMB 3NPZB 4IGBD 3FU7A 3D85A 3MRNB 5DJ6B 3FCTB 2GCYA 1R3HA 4MJ2A 5AOKA 4MQSB 1PSKL 2B16A 2CKNA 1JXDA 1P6AB 3I50L 4Z95H 1P7HL 2FQGA 2HT4C 2VUYA 1RXLA 4AJWA 4Z77B 4NZFA 4D8OA 2AABL 3CQPA 1FAIL 1FHGA 4N4YB 1PKQE 3H1ZA 1SM3L 5C0ND 4YQXH 3IJSB 1E3XA 3WGVB 2WV3A 1A4JA 1ZPUA 1FORH 3TBVA 1GZHC 5KSVA 1M6UA 2CJSA 2VUKA 2VDNL 3V52H 2ADIA 1MQKH 5AWNL 3NCWA 4Z3TA 5BQ7B 2ZF9A 1BBJA 5L2JB 3NIFE 2DBLH 4U1IB 2X87A 3ZYJA 2Q8BH 3FSWA 4JJ5A 3UAFA 3GSRA 2ERJB 4NQDD 1CDGA 4CN1A 2HLAA 1BQHG 3L4CA 3TX4A 1XSJA 3N43F 3UG4A 2N7BA 4XB3A 3D18B 3W0WE 3X2QB 1KNOA 1HYSC 2A77H 4ODUA 5EZJA 3DLQR 3TC9A 5D7JB 3TT3L 4LFHG 4HJIA 1IGMH 3QI9B 3SOBH 1OHZA 3VI3F 5EU7E 3HCVA 3GC3A 3TIEB 1SEBB 3APFA 4TVPL 2HTLC 4N86A 3LEXA 4GY4A 1VZHA 4XC1H 5EF0A 3DYOA 2VLMD 1YEIH 43C9A 2BHZA 1UFGA 3CFKB 3IETA 2ZUQC 4HXBH 3OV6A 3G08B 3EBGA 4JFOB 4FRWA 4N2NA 3FZUC 5CU5A 2CBQA 2AXJA 1QLFA 2V37A 4F7CA 4JFDD 3CLEL 3P69A 2R56H 5IJCC 3PAZA 2OMZB 2AV1B 2DM7A 1SJXA 3F12A 4X83A 4X9GA 3VGAB 5KW9L 3HPLB 3LN4A 4XX1E 3RNKA 1OM3H 2PCFA 1A4AA 3Q8FA 5D7JC 1UT9A 3S5LG 4X6EB 3NZ8A 4FL4C 4U1JA 4W9DC 1ZSDA 2G0LA 5D7JD 1JMXA 3H9SE 3EG9B 3UYPA 4X8CA 3N06B 1TCRB 4AG4L 3QB7C 3TNMB 3WTVA 3OSVA 5FXCH 4ZPTA 3QEQD 2HT3D 1F3RB 5H2BB 1FE8H 3D6GA 1QD0A 2IFFL 2N7SA 1V7NL 1OVZA 4XMXA 2NNXA 4AM0B 2QADB 3APNA 5DZJA 5MP6L 3FSOA 1AZCA 3LIUA 3D69B 4J23A 1B9KA 5LVEA 1NGXA 1CWVA 4PB0H 1DFXA 2F74B 2WLNA 3B2UC 1N3NB 4RGNC 2F9BT 4YGVA 4DO6A 5I8EB 2ZWYA 1RUPL 2BCKB 1LYQA 5HHME 5HSFA 2WINB 1SJMA 1O5PA 3B7YA 4FG6C 4NRYA 1KTLA 5MEQB 3CAFA 3DVFA 4XO4A 3ELQA 1EGJA 3PJSA 2ZX8A 3C5SA 3H85A 4HAGA 5FO9B 2V9TA 3I3DA 1FP5A 2P45B 3DHMA 3CIQA 3ZU8A 4QTFA 4X7TA 1FORL 1TQCC 3O2DH 1KBVA 4H88H 2Y7SA 2XWJA 1K72A 3KYKL 1MNUH 1CLOH 3QQXA 1I7ZA 4EN3D 4DFHA 3H2QA 3C08H 4JFZL 4FFWC 1HSAA 2MQ0A 2CCLA 3MODL 4QUOA 1CDHA 4F8OA 3CZFB 1AACA 3HHRB 4EIUA 3MR9A 2A9AA 3L3OC 4FDWA 3IDGA 2F54B 1T89C 1UCTA 4Q2ZA 1JYNA 2GJZB 1SLUA 2DQJL 1UD8A 2FL5B 5I1DB 3ZLQC 1CYWA 4Z3HA 1NL0L 1OB1B 4JE0A 4O02H 5FO2A 4W9HC 4PJ5A 4EUPB 2Z1PA 1PTZA 2IOIA 3HEIB 4XZ4A 2Y25A 2TAAA 2RCSH 3EJJX 3HS8A 1QZNA 5JXEA 5J0BA 1YUHA 2NX5D 2I27N 3OC8A 3VXRB 5FM5O 2BFVL 4PG9B 5EBMB 4FD0A 5IB4B 2H45A 4I3SL 3WUWG 3W11C 1KTLB 2BHYA 4MZ2A 2D7MA 3SEPA 4ZAKD 4Y1SA 4ZK8A 4B9JA 4NQUA 1BJMA 4N9GB 2ZOKA 3BAEL 3LY6A 3EHBC 4LGSB 3MRQA 4WKZB 4WWKD 5C0GB 5C97A 3MV7E 1OL0A 2FSDA 4OR1A 3ZZQA 5F21B 1LP9B 5EC2A 1NJ9A 3TVMB 4AEIL 4F2FA 2X4UA 1JWSA 2DLFH 2R29L 4BCXA 2OCFD 1NUDA 1OSZB 4IBZA 4FLRA 4BFGA 3E8VA 1QEXA 1QLRA 2QPSA 4Z7UE 4QHMA 2QL1A 4K8RC 4FC3E 2FBJL 5GZNC 2BIIA 2WK2A 1D9KD 3HZMB 1Y0LA 2Y7QB 4R2GD 4WY7H 43C9B 1CU4L 3GSRB 1KIRB 2B8OT 2ICWB 5CILH 1J18A 4ZSOE 3BGFB 2F8IA 4LP8A 3ABZA 4GSQA 4F3FB 4NZTL 2GFBB 3U2SA 1NOLA 3S88H 4HUUA 4FA8A 3QDGD 4QCIA 1JTOA 4FZ8L 1D7DA 5GGSB 1ZHLB 2WZ5A 1I4FA 1XSIA 2ZJSL 1HZHL 3UBXI 4JGUA 1D9KA 3VQMA 4Y1AE 1M05A 1S9YA 1A6UH 1DQJA 2QGCA 3EFDH 2ZZUT 2XX0A 3LD8C 3I3EA 5ITBH 1A25A 5BZDA 4M29A 3QO0B 3HLKA 1KCRL 1N70A 4ISVA 4MNGB 5BS0B 1NL0H 2D03L 3BMVA 4N6RB 4YL4A 5F7WC 2PP7A 3TBTB 2XU9A 2LVCA 4E2OA 5DO8A 5TDNA 1W0WB 3JUYA 4Z7VE 4OZHE 1ZV9A 1BLNB 2AQ1A 3Q5TA 5I9QB 4AX3A 1JXKA 5GHWH 12E8H 4C4KO 5A40E 4X8GA 1T1WA 5CLTA 5LCVL 4YSAA 1TJIH 5KSBF 1TYEB 1KBGH 2DYPA 4WUUA 1DN0B 1MFVA 1SBBA 1T6VN 1DQQA 1G4MA 3WBDA 4OLXH 1INQA 1MJ8H 1ONQB 4Z7UF 2EXSA 3ETBJ 3PG2A 3SPJA 4HALA 3PWLB 4KJWC 2J1ZA 3IF1B 3T5WA 5H2BA 2X3AA 3QHFL 3L5HA 4GUPB 1ORQB 4UIKL 3CVHB 3LQZB 3UP6A 4WNJA 2VIRB 3KCWA 5C6PB 1TT6A 2VLME 2WUCL 2B1OA 3K4ZA 5ACZB 3DJRA 1SEBA 5FO7B 1VZIA 1S78D 3DROA 4IRJC 4HUVA 1ZHKA 4LSSL 3Q2NA 5CSGA 3ZKND 2Z65C 4QKXB 4TOYH 5EORL 1G6RA 1R3KB 1XH0A 2R69H 4X7DC 3GIZL 4HEMA 4Y5VC 5ANHA 3ILPA 2Y5TA 1AQHA 4JKPL 3ARFD 2XACC 4HPYH 4JFPA 1PKOA 1QSVA 3ZDZE 2APBA 4GMSL 2WQRA 5JDJA 4HWEL 4WFFE 2FEEL 3X1FA 5I17A 2WXPA 5I1HL 5AZ2H 2WLZA 2Z91A 3WKMH 2G75B 5D8JH 2YMTA 4HBCH 4OZHF 1EZUA 2DYPD 2OP4L 4LQFH 3O0LA 4WUUD 3VQLA 3P3YA 4H26A 2KQNA 3CZFA 4K2UL 4P9MH 4R4BA 4MA3A 2NXZB 3AXLA 2GABA 3M07A 4AGPA 1E6JL 3A4EA 3VI4B 2APXA 3DXAA 3VXUA 2QZ5A 3MV9B 2AKRB 2JQAA 1U93B 3H8NA 4NFBA 1J48A 3TL5A 1AZUA 2OMUB 2Y6TE 1V05A 5HGAA 3QXDA 1XGZA 5EDSA 3RWIB 4F2MA 2EYSA 1U8KA 1RJYA 3EBAA 3LVEA 5BZZA 3QZLA 5CR1A 5GS0D 4JO4L 2UWEB 3CUPB 4OF5A 1Q1JH 4JFUA 2J43A 1ED3A 3ZE0B 5F72S 1N5YH 1XH1A 4OU3A 1X7QA 2YKLL 3HAEB 1SUHA 5PAZA 1WZMA 3AAZB 3B2XA 4HGWB 1QSEA 2VDQL 3L3DB 3GO1H 4X5XA 3VD0A 2Y2TA 3X1EA 3BOVA 4KJQD 4M6ML 3QNXB 4OF7A 4A66A 5D1QA 4DZBA 5C0AA 2AEPH 4BWUA 3KLKA 5CEZE 5K5YA 1RULH 3SDXE 1GC1C 3D25B 4HT1H 1NDGA 3CDGB 1IAIM 3B7SA 4WTZG 2PPDA 3HG1D 4XN2A 1J86A 1BVLA 1QFWI 4X4YB 3W37A 2DWEB 3CXDL 3OKLB 1GA2A 1BVOA 1A65A 1UGNA 1JFHA 5JIMA 3EJYD 4YDKL 5CLWA 2D2OA 2LOEA 4QRQA 5DD5L 4BHUI 4H8WC 1ZE3H 1AO7A 2JQZA 2N01B 4ELMF 4DUVA 5KYNA 5DHVA 5D1QD 2BOCB 3ZW3A 3O4OC 2GAZA 3HVNA 3TT1L 3C5JA 3QXWA 2F7RA 2P5WA 3HG0A 4TUOA 2PWGA 3U7YL 3V4UL 5CD5D 4G9DA 2LQRA 3U6XA 3IETB 2EABA 2LLNA 2XI9A 1WCBA 3IJEB 3ZGIA 1ED3B 3BJ91 1E4XH 4RRPG 3K46A 4ZUSA 2RQEA 3BN9D 5IROA 5A7EA 1RZJC 1G7PB 2OYMA 4P05A 4UM8A 1N8OE 5D9SA 3TZVD 4MD4B 2QVKA 2FB4L 3LIZA 3CE1A 4E5XB 4L8BA 3S34L 3BEWB 5HYJE 2ZXQA 3JTSB 3U1QA 5MHSE 3HS0A 3A67H 3NIDF 2HMID 3GMLB 4YBHA 1RLWA 3KJ6L 1SF5A 2PCFB 3T6XA 3T6VA 2DQDH 4N90D 4DZBB 5LGHL 2J72A 4JG1H 2AJZB 4MNHA 1AR2A 4GKSB 2Y1YA 4N90E 1QSFD 1RIHL 3KGSA 2PW1B 3CFEB 3QJQB 2ZKXA 2J8UF 4EDWL 4KGLA 2OBGA 3MJ9L 5T1LA 1E28A 1AQMA 2M8XA 1RV6X 2BDNL 4W9LC 5H35A 4M00A 1RURL 2QV2A 4UM8B 1MCJA 5CKAA 1I9RL 5DZAA 4M3JA 3SQRA 1R3LA 5ES4B 5L2KA 5IB5A 1E27B 3E6FA 5L4JA 4U1NB 2R7EB 3DUUB 1TZOA 3QUMH 5DVNA 4KRMB 3RWDA 4KTEL 3V4PL 2OMXA 5HGBB 2YZ1A 2W0LA 3IXTB 2EDDA 3V6ZA 1V27A 2CO7A 5D72H 3GKZA 1WJ3A 2SEBA 1GPOL 2ZXAA 1HXYA 3CMOH 2RALA 3FUIA 4N5EC 5DJYA 3R06B 5D2NE 3VXNB 3QDJE 1ETJA 3CHOA 4I1PA 3RVTC 1S7VA 4HD5A 1SBSH 3Q8AA 2VSDA 4YR6A 1Y1UA 3STLB 1CURA 3B9KD 2JKNA 4JZNA 1A6WH 5C0AE 4AYID 5DTFB 3KLQA 4ONOA 3EJUA 4YXHH 2GK0A 1ND0B 1VKXB 3BP7A 1GS7A 2HFFB 4QRAA 4YHNB 5F7YC 1F4XL 1PPIA 4ZS7H 1C5BL 1IAKB 3D4YA 2QBWA 5DHYB 1S7QA 2DQMA 4DZ8A 1T7VA 1A6WL 1R75A 4P2CG 5AW7B 3OAUL 3PWLA 5JHAA 2P8LB 2XA8H 1AXTL 1J5OH 2YUWA 4XAKD 1FVDA 2HCZX 3ARDB 2K4AA 1CYGA 2IBZY 3FFDB 2JJSA 3PHOA 4YSRA 4MSWB 4A7VA 1MVUA 3IDMB 5D1ZC 4OFPA 4BV1A 2O6EA 3WXWH 4HIIB 1MJ7L 3P73B 1OLLA 2J5LB 3DPDA 5IFHH 5B3JF 4R4FL 4B95C 2R0KL 4K23L 3NCEB 4DP7X 2XTLA 3D3VB 4F1SA 5KSUB 3DVGB 4PJ8A 1I7TA 3NZHL 1I9RH 1HNYA 4H2AA 3G6AB 2BSCA 4FG2A 3S96A 1C12A 4FQXD 2X4UB 4NO0B 3D3VD 3L3DA 4X80H 3UDWA 2UX7A 3IN0A 5E0FA 3BE1L 3ABKB 2EVFA 3MA7B 1CTOA 4N0YL 3LXUX 1KWGA 1YY9D 5GGVY 3QULB 2FT6A 3EYVB 3CXDH 1R3JB 3FUMA 4KXCA 1ZS8B 1QVOA 4BZ1L 2ZPKH 3JVFC 2KI6A 5AOLA 4X4MA 1UA3A 4C57C 4G8IB 4PWJA 1LE5B 5ENWB 2XBDA 5C0RL 2V3FA 3DOSA 3UACA 4BJLA 5KSAB 2VR9A 5ESQB 4NSKB 1TO5A 3EHBB 4KHTL 3QJFA 4QY8A 4AL8C 1T7YA 4GOSA 1AGBB 4J3OD 5E8PA 3U7YH 2J5WA 1OKEA 1ESOA 2PN5A 4KZDH 2E3VA 1DVFB 2I9LA 2D7QA 2P26A 5CBEA 1N3NA 5I8KH 1IGJA 1JFQL 4JFEA 1WFNA 4WK4B 1Y07A 1P5UB 5HYEA 4U49A 2QQNH 4M93C 1XBDA 1XCXA 5DD5H 2GT9A 1U6AH 2ZSVB 3VFWB 2I9TA 4IGBA 4WLCA 3QBTB 3DV4B 5F1SA 2DN7A 1I8UA 5FGBC 4P9HC 4RGND 4TTGA 1AQDA 3WFHB 3TO4C 4MA8H 3FB7B 5I1LA 1XGRA 1BMZA 4NI6A 5AZUA 1TUPA 1N68A 1T04B 3AABA 4M7JH 2VN5A 3N3EA 4Z9KB 1ZT1A 3MLPA 1E9OB 3I9IA 2H6UA 4M93B 2IQAB 4JBSA 4PRDA 3ZTDC 3CX5J 7PAZA 2HFEA 1K8IA 3QQDB 4S1DD 4NUPA 3JWDH 3KLHD 3DVIA 3CC1A 2B39A 5AW2B 2LTQC 3MTXA 1E5UI 1RAMA 4P23A 3OZLA 2XLLA 3VD5A 4XN1A 1M56B 5CIPB 5F2FA 2H6OA 4IKLA 4MXQC 3SKJL 5I6XB 3P3TA 3S0PA 4LLQB 4IS6A 4I18C 3PGFL 4LZKA 1M2VA 4LFHD 3TASA 2CO4A 3PYCA 4XMTA 3BFWA 4W9IC 3EOTH 3ILPB 1NPJA 4M1CD 1VF5C 4PRPE 4YHKH 4AQAA 4UDTB 3HE6C 1PZ3A 1OEZW 2ZSWA 2PP9A 1BQLL 1XF3A 3GQFA 1AG6A 4F15C 1W8NA 2G3MA 4GXUN 2QVMA 4N8PA 5T1KB 3PQYA 3ZTJH 5D6CA 4S2SB 5I8OL 4WNSA 1VJSA 3VA6A 1L9SA 4ANWA 1YYMH 4LEEA 2C26A 4HXAH 4NAJA 4UTCA 5E8NA 3RVUC 2IOOA 4WRLA 3IVKB 3MNDA 4MXVE 4UV4L 5HYQA 5EUKB 3CCHA 5M7QA 4JDTL 3VFNA 2Y36L 4QRRD 1OSPL 4F8TA 2IWEA 1C7SA 1HTYA 2BHUA 1NCWL 4PBXA 3LV3B 3SDAC 1EO5A 3QUZA 3RWHB 2XG5B 4XOEA 4MA1B 3LS5L 3OZ9H 2D9QB 3U30B 3UBHA 5HYSB 4CVZA 5I75B 2IQ9H 3II3A 3PFQA 4MA7H 1DVFD 1A4BA 2EYSB 4N0UA 1R5VA 5HGAB 1FAKT 1QSED 2YD1A 3L4VA 3OM3B 4DTGH 2J73A 2WUCH 1RUKL 1LMKA 5KS9A 4AL8H 2HYMA 4WWKC 3UABA 3HJEA 1ML0A 4KVNH 4E0RA 1O6SA 4JFQA 4KK6C 4KUCD 1TJXA 2BNQE 1OAKH 1B0GB 2HT4D 3DARA 1W72B 1M4KA 4RAVA 3K2UL 2FEDD 3FQTB 4J6RH 1CE6A 3OGCB 1E4JA 4GW4A 3MA7A 4DTGL 4M43L 4UDUA 5LAXA 3WEMA 1HOCB 3IFOB 4OF0A 4EI6B 1ZTXL 5TQ0L 12E8L 3FQ2A 2KLRA 2IANA 1Q94B 4M4RA 4N2KA 3SD5A 1WH0A 1T03H 4DEPB 1PFOA 1QFWL 1XH2A 3MV9D 4MX7A 2Z31D 4CU6A 1VGKB 4IQHA 3OB8A 5A6MA 5MEND 2FBJH 4LDLB 1FVCB 1FGNL 4AGMA 3L2NA 1YPZF 2EINB 5BPPA 1E5YA 3DX4A 2LV4A 3KR3H 3A5VA 5E1HB 3QUGA 2BLFA 5L6YH 2TRHA 2OZ4A 3MFFA 4MCYA 1HOCA 1NEZB 1F97A 1OCCB 4M61A 3SCMB 4JFEB 4KNSA 3GEWB 5CUSL 1NGPL 4XNMA 4JHUA 2IPUK 5K59F 3FCGA 3KYMA 4MLIA 4TF4A 2E7HA 4YIQB 3OJVC 1A4KA 4I13B 5JR1L 3FFCA 2BIMA 5HDRA 3VYOA 1KV3A 2K6ZA 2EADA 1FFNA 3BIBX 3VD3A 3QH3B 3U0WH 5JW4M 4GO6B 5KJ7E 1HXMB 4OSUH 3AU1A 2ZG3A 1KB5L 2QSVA 3RTLA 4KJPC 1F3JA 2PW2A 3NJHA 5ID1A 4PRHA 2H6PA 3OR7B 1GOGA 4AXWB 1TDQA 2D7OA 3GRGA 3KEDA 1K5NA 1V55B 5CJXC 3O3EA 2WYIA 4TVSa 3Q5YA 4JFHE 1U95B 4PH8A 1INDH 1D5XA 3K8MA 3MQIA 4GG6E 3BN9C 3L3KA 1BBDL 3KLDA 3K2UH 5KBMA 4MAYC 2PP8A 3ESOA 3VXUD 5KJ4A 1CLZH 1TEYA 4GAGL 3QORA 5CN3A 2H0EA 5E8NB 2VMEA 4MFHA 1YYML 2QVFB 3KEHA 1OP5H 3ZKXB 4OZ4B 3G9AB 1U4EA 4ADGA 1FQ9C 4DQAA 3ESMA 3W9DA 1RVFL 2I5YH 2PWHA 4JJHA 2H2SD 1RK0B 3CSYA 2KPNA 4KQ0A 3T2PA 3KH4A 3IGUA 4WAFA 3BW9B 4WUKH 5FECB 4AV5A 3K8KA 4NKIH 2EXTA 1ZTXE 1I3RB 1PAMA 4PREA 4HFWB 5I15H 3W5NA 2XXMB 3B2PA 2XN9A 4N2DA 1E50A 4P57B 4Y5XA 4QRUB 2HFGL 4Y5XC 4YHOH 5FYLL 4QJ5B 5FDWA 4P2QD 4TPRH 1JZFA 5I1LB 1FUNA 4LK4A 2V17L 2DQUL 5DJ6A 1HQ4A 3D85B 3MRNA 3NEEA 1YDPB 3V5DB 4X7FC 1XCWA 3DPBA 4QRBA 5DVPA 3BJLA 2YEVB 4G6AC 3A22A 2ODIA 3IVKA 2FJHA 4TQHA 2GEEA 1Z0MA 4HH9B 5IVNA 3RVXD 4GO8A 1CXFA 3TPKA 4U2ZA 4MMXC 3O4LB 5GGRB 3VH8G 3QUHA 1NWOA 4P23B 1HWWA 1I8LA 1PLGH 5C07D 5JXAH 1DBAL 4ERSH 3SGJC 1EMTL 1T7WA 3QDHA 2EUZA 2B59B 2F15A 2UX6A 1IL1A 2PLTA 4OIIL 1JNNH 4N22A 2BY2A 3B1TA 3PHOB 3ZQXA 2WN3A 4JZJC 5KW9H 3A6OA 2H3KA 2W9DL 4XN7A 4LIQL 2DWDB 2BX5A 3EJZD 1F0LA 4ECNA 4KRPB 4PJ9B 5L88H 4KMTH 5F7AA 2ZYIA 2OX5A 2A7BA 2HLAB 1MG2C 1Q0XL 3ROLB 4NT6A 3FT4A 4Y9CA 1BVKB 4DHLA 4W4OC 1RUAL 4BH8B 2DQIL 5DJAA 4GQPH 2UUDH 2KC0A 3SSGA 1ZAGA 5DRXB 2O5YH 3GBNH 4ONHA 4AC2A 2C4FT 3C8HA 3GNML 1X6LA 3ASOB 2G2RA 3EZJB 2DDQL 5AVXB 2K3TA 2OQJB 4Z7OF 3NESA 2PPCA 3CXHJ 4EPSA 4RA0C 4ZODA 2D31B 1FFPA 1N0LA 5J6SA 2VC2H 3SDCB 1M1XB 5LWYL 5EA0L 2BZDA 2C9PA 2EZ0C 3UZEA 1HKLL 1DDHB 2D7NA 3I6GB 5TPWL 5GRVK 3WSQH 5HDBE 5ENWA 4P5MA 5J89A 3OKEA 2EZ0D 1T0NA 3Q1EA 4Y2DB 5DR5H 2WQUA 3P4OB 3STLA 3GGWB 3EDKA 3EYUH 2DF3A 2EDKA 5BQDA 1JZIA 2R39A 4Y4FC 3GZKA 2H2PC 1O7DE 3D07A 5M95B 3RY6A 1HHIA 3TH3T 1INEL 2WZ6A 2QQNL 2BS71 4NT6B 1JPGB 1WTGT 4BFRA 3K71B 2ZOLB 3PP3H 2E5EA 4RWYH 4NQVA 3LH2H 1UEYA 1QSFA 3MLUL 5I5RA 5DYOA 2C9XA 1BSIA 3UCRA 1QFHA 3L5IA 2P5EA 3D06A 4Z7QB 5IV2B 1WHOA 4WWKB 3R1GH 2OL3H 3ZBMA 4JY5H 4LLMA 3MNVA 2AP2A 4QXWA 5FF6A 3NTCL 3UAEA 4D8PB 4DFIA 1P9MA 3P0YL 1I3UA 1KIPB 3QZBA 3O6LH 1U30A 2R1WA 4PD4J 5E2JA 3PABA 1B6UA 2WZPA 4DQOH 2BINA 4PMEA 3GLDA 3C6LD 2GSIB 4CW1A 4OKDA 1UXSB 2P5ED 2FBOJ 4NX0A 1SHWA 1NCAL 1RSYA 2JJVA 2ZNXA 4U1SB 3MFFB 4MCYB 5BZWA 3DHPA 3UBGA 5KVFH 5IM7B 1GIGL 1MFMA 1V8HA 2KERA 1R17A 4Z6AT 3PWVB 3IJ9A 2X42A 2I25N 4JG1L 2EICA 3W9DB 3VXSA 2DQCH 1KENL 1UVQA 2NZ9C 4QJ3B 1XF2B 1HILA 1HHKA 1G7HA 1GYUA 2X4RB 4KRPD 1T1YB 4PJ9D 1IE5A 2JB6A 5DUMH 1HCYA 4PJ7A 4DVRL 4FYQA 1SXNA 4MVBC 2JB5H 3OLEA 4TNWF 4P4RA 2XN9B 5DD1L 1ITCA 5DK0A 3MRMA 2WBJC 1G7QB 4PGJA 5F7LB 5JPNB 3SPIA 2X9XA 2F6AA 1FYTE 2NY0C 4O5LH 1UM6H 3IXAA 2WUBH 3T04D 5JW5A 2ZUQB 1NAMB 4QRPE 2OTUA 1EGJL 1T1XA 3ECWA 4I18B 5JXEC 3HE7A 3FK3A 3FU5A 4UIMB 5E6ID 3IDIB 3N91A 3F01A 3M6DA 2NT1A 3Q9QA 1IC1A 4MXWH 2JCCA 1LILA 2BOBA 4KK5C 2Q86A 4NQED 4PRIE 4ZS7L 1M71B 1AZBA 2DQFB 3THMH 3WXVL 1NBYA 1EPFA 1MCEA 1RURH 2QMJA 3V6OC 2OJEB 4ADJA 2AJYH 5IUCA 4HHAA 3SKOB 1DVUA 3M1BA 3IFNH 1DTUA 4HT1L 3U48A 1NC4B 2MKLC 3D1MC 5LBSH 2ZT9C 3AMLA 3QHZL 1N9PA 2IAMB 2GY7B 4XCYB 3OMZA 4M6OH 4WFHD 5CP7A 3MMEA 1W6WA 1BXAA 2Y6SC 3H55A 4R4BB 3P0YH 1HEJC 2AVGA 2IWKA 2BC4B 1HHHA 2Z31C 4XP9L 1M1SA 3LKOB 1MF2H 3MLZH 4HWBL 5GRUH 1G7PA 1HE8A 1SMDA 4FCAA 4ABQA 1G1OA 1KN2L 1U8NA 3WUWB 1KXHA 3PL6B 1FBIH 3I75B 1Q1JL 1RZPA 2N56A 4O9HL 4PJ5D 1P53A 1BAFL 4MQ7B 5IMLB 2Y1AA 1U91A 2CSPA 5EPMA 2MQCA 4ZFQA 1D9KB 5CGYD 2BSRA 1C08A 3C2SA 4P4KC 1CXKA 4WWOA 2DQIH 1CG9B 3MJ9A 5DU7A 1X5KA 1OAZH 2IDFA 1TTAA 1VEOA 3ULVD 1Z5HA 3UYRH 2W60B 2E86A 4DUXA 2E6QA 3QIBA 3JWNG 3X12B 3VG9B 2DQDL 4JM2C 1E67A 2NY2D 3P4LA 1YSOA 2JCWA 3OGOE 2EO9A 3CC5A 3QI9D 1HQRA 2QPDB 1KLGB 3Q48A 1DE4B 4MNQA 3VGBA 5C08D 5BRZE 1NA8A 3VFGL 1PZ2A 2FB4H 1MPAL 2GIYA 3WIHL 2RMNA 2VRQA 2ZWSA 1LEGA 4PJAF 4OVVA 4GP8B 1E40A 2CZNA 3MJ8B 4KQ3L 2LABA 4PJFA 1WAAF 2C3GA 4H7VA 3QISA 4WI9A 5LWYH 1JBJA 4PP2A 4YX2L 2FWLB 2V7HB 2YPLE 4WW2A 4AE1A 4L4TB 3L3GA 1QA9A 4GG8B 4J27A 4OV6F 4DNLA 1TETL 3SE6A 3QIBC 1EEZB 3D0LA 3Q2LA 3VD2A 3LPOA 4X42A 5CEZL 5AVZB 3LPGA 2EIEA 2HFGH 4YHOL 1Z5LB 4N2MA 2LU4A 3B2UD 2BWIA 3NA9H 1F3JB 3HHSB 5EC1A 3LRGA 5I73B 2Z7WA 2B14A 4WI7A 2JCCF 1YEHL 3AS3A 4B53A 4HKBA 2LGNA 1YYLH 2A6KA 3FTVA 3JV5A 4MCNA 5B4MD 3VFTB 3NIGE 1N59B 3GHPA 2GC7C 3TVMC 1FL6A 4J12A 2F19L 2X4PA 3S3JA 1VFBA 3FU0A 4OLZH 4WK0B 5T5FH 1AGEB 4GI8A 1MCKA 2YEZB 3D4CA 4PI2A 4QRSA 5T5FA 3T3MB 4PJEA 1S7XA 3RWHA 3GO1L 2LFGA 2OFQA 2VN6A 3QRGL 3LNDA 5DS1A 5T33H 1JF5A 2AK4B 4G9FD 3IDJA 2YAMA 1ROWA 3BRFA 4Y4KA 5D2LA 3V0VA 3F58L 3ZKNC 2NLJA 1P1VA 4PJ8B 5DHMC 5CF3A 4UQBA 2A0LC 2QTEA 3T77B 1FH5L 1UM5H 3RWGA 3CJJA 4LKXA 1S7TB 1WZ1H 3DXAB 4XPTL 3KLLA 3GS4A 1K2DB 1EZLA 3BT2H 1VCBC 5D71L 2WOBA 2XPGA 1G9ML 3N0PB 1KY7A 3TIDB 3ZMEA 1IGFL 5C0CA 4HH8A 2MKWA 2QGBA 3BGFC 3S36H 35C8L 1I8IB 1YMME 2E9BA 4KKNA 4NKMA 1QTSA 5DQ9A 4QRRE 1CVSC 1KTRL 1G84A 1JTTA 3ECQA 1D7BA 4H44C 4QHUA 1QLEL 4B3VA 1DZ0A 1JDDA 5F6HJ 1X4YA 1YNTA 3QC5X 4LKXB 1JV2A 1YQ2A 4NI3A 3LZNA 2QFRA 5HP5A 3QDMD 2K4WA 3QDMB 2VKWA 3NIGF 2L7QA 3RP1A 5F96L 3MGAA 1NCHA 1KXQA 3QJRB 4QKTA 3OQ3B 2J2ZB 1IEAB 3NCYS 4HPYL 2X6BA 4Y4KC 3RTQC 1GCFA 3SPHA 4G43B 4JKPH 3H0TA 2DIEA 3EO1A 1D5BB 4WW2F 1JD7A 2IPTL 4H1LG 5C7XL 4YXKL 1S46A 3IMUA 3O11A 4U7KA 2BSSB 3BIKB 3B34A 5DT1L 5HGDB 2CQVA 3QZOA 2VUOA 3FONA 3OXRA 3RWGB 4AGLA 4OB5H 5BOZG 3O3BA 5AOIA 5JOFA 3WCYA 3HRZC 4BSVA 5C3LD 3DXAD 3CZLA 3HRZB 1NANH 2IPUG 1FRGL 2OI9C 2X9WA 3CBKB 3UJIH 2F18A 4JM2A 1KB9J 3KPNA 3HMWH 4KNUA 4Y89A 4YWGH 4N6QA 1XX9C 1ADWA 5F8RC 4UQIM 3DNKA 3UG3A 1R0AH 1E3ZA 1ZSDB 3RWEA 1I1AB 2J1YA 1ACXA 2J5LC 1EJFA 2ZCHH 4MCZA 1MJ8L 3JVGA 5T3ZD 1K8IB 2FUQA 5E6IB 5EO9B 3EXJA 3O3EB 2FATH 3SBPA 4KFMA 2W60A 5FFOA 3V0WL 1II4E 1B0GA 2XPYA 1U3ZA 3QXTA 4L4TA 2IEPA 2DQEL 2V9UA 3KPSD 4YHMH 2EDEA 3IGLA 3ARGD 2YGOA 5DMYA 1HWHB 5EWIH 3WFHA 5SWZB 4RGNE 4XMLL 4HSCX 4A7GA 1F56A 5E08L 1UURA 4JRXE 5D2LE 3L95B 3N42B 3CXHK 5JLZB 1NCIA 2BHFA 4NN6C 4AQEB 1ZK5A 3CPLA 1OO2A 5FAAA 5IVOA 3IKCA 4CADB 4JDTH 5CZRA 4FQQA 4ZMPA 1FGVH 4UV7H 5HGDA 2ZKYA 3BPCA 2VM9A 4YDJB 1B6DA 1QFWM 4KNTA 1X5IA 5CJ5A 2WQVA 3QIUD 3FQRA 2WWOA 1AZRA 3EYQD 4MWFA 3NSDA 1NIFA 1MIEH 4I3SH 2N59A 5HHXL 4JM2D 5LG1A 3RFZA 1HCFX 3S88L 2C5DC 3QR1A 5EU4B 4F7MA 5HD8D 1C5DB 1LO4H 1QEWA 2J1WA 1IVLA 4Y9FA 5D93B 3U9UB 2FR4B 3NPSC 3O8XC 3QUYD 3SDCD 2HSIA 1RUKH 4M9OA 5FCUL 3CFCL 2ZD0A 1KDJA 4JFOA 5D7HA 3IMRA 4O02L 4LEOA 3EJCA 2MMXA 1MFCH 5LHDA 4YAQB 4EN3C 2FVNA 2YBGA 1DUZB 1XF3B 3H9HA 3RBSA 2IFFH 2WBJA 4N2CA 2FH8A 3TZVA 4L3EE 5D2NB 4ESKA 4HX1A 4IMKA 3M17A 1JZDC 3NFSH 2G5RA 5HDQL 1UKQA 2VB5A 3Q8EA 4ZMNA 4EN2A 3JQOB 5CZKA 1FZOB 3P2TA 4LDEB 5IJKC 4OD3H 4P2RE 4PJFB 3X3FH 4Q89A 9CGTA 3GJFH 3PHAA 4YH6A 4HMEA 4R96B 3DMMA 4QIRA 3FRUA 4UOW0 2AERT 4YHIB 4NUQA 1WD9A 2J4WL 3N42F 4CL7A 3BHBB 2ALAA 3BN3B 1SVCP 5DJCA 3K80A 3II2A 2VXSH 3BP5A 3CLEH 3RRQA 5AOZA 3NABL 5HY9A 3VMNA 2XWTA 2BSDA 3HE6D 1MVUB 2DEWX 1ID2A 4UU9A 3ZDXB 4GS7B 1JI1A 2XBZA 1MAMH 5DEGB 4TNVK 5DRNA 1KGCD 1JWMA 2CNZA 3ZE2E 1HI6B 4I3GA 3TN0D 2R8SL 4MD0A 3LXCA 1P4LA 2YSSA 1XR8A 1U6AL 1UB6B 5IFJB 3MCLH 3EH3B 1E4KA 1KBKA 3VFTA 5IOPB 1YPZB 5A2CA 4DF9A 3QFDA 1EO7A 1HFUA 3TT3H 3S98A 3MOAL 5E8OA 5JHLA 3KJ4B 2WLLB 3DUSA 5FUOL 3KYKH 3BDXA 3E2HC 1BD2D 5ICZB 1BM7A 5IJVB 1HVXA 1CFNA 2YA1A 3P4OA 4H8HA 3LEVH 1XIWB 3C60A 3V6OA 3Q13A 3STZA 3COOA 4JPVL 2XYBA 3NUKA 4TN9A 2VM4A 3MROA 2Q8BL 4ZUWA 2KLTA 4EI5C 1DQDH 3BSZL 4XCYA 3TFKD 2ZPKL 3RUGF 4WNQA 4X6CE 3ZZ1A 3HI1A 4OLUH 1W9XA 3H3KA 1BXXA 1D2PA 1IKFL 5I9QC 1K85A 1QPXA 4YDZA 4QWWD 3TPUB 3K81A 4J2QA 2QQKH 1KUMA 2X9YA 3DX9A 3IMTA 4KGJA 1MH5A 3VFVB 3TJPA 4J4PA 4LCWA 5CBAB 3QPQC 2FZ3B 1I3GH 2HRGA 1HSBB 4JKLA 3WGUB 3X1NA 4JCLA 2B7DT 1QOKA 5IM7A 3GTVA 4LLMB 4I0CC 2G3ZA 5C07B 3PP3K 5BV7L 1I8IA 4NKMB 3MTRA 1HDMB 5JORB 2VE6B 1WFUA 4E68A 4MNQD 1BVKA 3ML8A 3FC8A 4Y2DD 3SOBL 2IAMC 3OR6B 1A1NB 1IKNA 5IB2B 3JWOH 3ZSTA 3MHZA 2NOYA 4D3CL 3PWJA 3QA3A 4KZDL 2AXGA 3NJFA 3GLZA 5I30H 2OSLB 1QABA 1AR1B 1MIMH 1NM9A 3GF8A 4QTIH 1XGRB 5F1IA 1ADQA 2Z34A 4P2RA 5DJ8A 1HEZB 4XAWH 1MFUA 3ULVH 3C60D 3DGDA 3ILDA 5FO7A 4JFFD 1HHIB 5C07A 3B9DA 5JORA 4GQQA 2O6PA 1SLXA 1GSMA 1HINL 2OJ1A 2QLVB 3CX5K 2VDNH 3NIFB 5I6PA 5J8OA 1BZ9A 4Q7DA 1WCBB 1YECH 1HN1A 1JSYA 4UIMA 3NN8B 5F1OB 5D1XC 3MREB 3OMIB 1UB5A 4DO4A 3EYSH 1ZTMA 5TE4H 3UO8B 5FIEA 1MH5B 1KC5L 1ZMYA 1FVDB 1RIUL 3MU3A 5D7IA 4Q6YA 3VFVA 3KLAA 3U6RB 5I8CB 4HJEA 1AMXA 1IM9B 2H32B 3ISRA 3HKZA 1MCOL 3G5VB 2FQEA 3REWB 2LVEA 2X0VA 3GZQA 4HC1A 2VH5L 5HJGA 1ZV2A 4MNHB 4FFZA 5IK3A 3CN2A 3BD3A 3QORC 1TVDA 1F4WL 4MCZB 3S35H 4TNEA 4UAHA 3MREA 4ODTH 5FB8A 1AD0A 2VQ4A 5CEZD 2W88A 1NAML 3V5KA 1UATA 4P23D 2W1NA 3E6HB 3JV6A 1MNNA 1PYWA 1MHCB 1MLBA 2BIOA 5ISZA 3V6OE 1I82A 5IMKA 2BO0A 2R4RH 4HCFA 4ZNEE 5E9DD 3KPLB 3BWSA 4YQXL 1HEZA 4GI9A 1Q9WA 1C8PA 4GIAA 4JKKA 3JWNC 4PW3A 2H2SC 1PW3A 3ZIMA 1HQ4B 4FG0A 2CLZB 1YJDC 4XVUC 4YDVB 5EEVA 5E9DB 3HZKA 3L3OA 4U0RC 1ET8A 5CJBA 1R3KA 1ZEAL 2B5IC 3WS6A 1OWWA 4BD4A 1A5FH 2BNUB 1N0XL 3V5HA 2ZG2A 4FLQA 1F41A 1G9NC 4QOKB 4LCWE 3B56A 2R2EA 2WHVA 3BAYA 1JHLH 2B77A 3AY4A 3NJKA 2BS9A 3TYFA 1FLRL 5I6OA 1SYVA 1G7LB 2H1PL 4FLOA 2ALWA 2Z0UA 3FYIB 1PG7X 4WU7B 5C0DB 3QAZB 1J10A 4Y4KD 2VAJA 2JK5B 2XFGB 4NQEA 4QRRB 3T8MA 4Y19E 1J1PL 1HK6A 1RUML 3ES6B 2QT6A 1S9VB 1CG9A 1G6RB 4LPXA 1RMFH 4HS6A 4P5KB 3V4LA 5JHBA 4KV5F 1IIIA 3WE6A 3FSVA 3X17A 3BH4A 1FN4B 4Z78B 1U8PB 4QRPD 3IDNB 3SE8H 4E41A 3CFUA 4FYTA 4U0QB 1TVHA 1I3RA 4OLVH 2X4NA 2JELH 1NGYB 3VG0H 1G7LA 3QUML 4JFSA 1BD2B 3HE6A 3VFSA 1VPOL 4JFFE 4CGUB 3SGJA 1RL1A 1DJHA 1XIWA 1ICTA 3C60B 1KC5H 3C8KA 4HIIA 2BVPB 4ODWA 2RAMA 3KG5A 2XIDA 4A2MA 3CFTA 3INUH 4NNXA 2V5RA 3FOMB 3P40A 4H5SA 4AGNA 2Z7ZA 4OF3A 4UB0H 4A6YL 5KVGL 1PNCA 3CN0A 4EOWH 2NX5A 3NQKA 1ZHBB 4GKNA 1YZZA 3F83A 4FNUA 2GG1A 3AXHA 3L6FB 4QXTA 1BQHB 4YO0B 3X11A 1O6TA 4HJJL 1YNKL 2FGZA 3FO0L 4QNPF 4X6DA 3RVVD 1NC2A 5K9JL 4S0TD 1BFVH 1EAQA 4U33A 5KUMA 4EBQH 4L1TA 5I19H 1S7XB 5AYQA 1AC0A 2W07A 5IIEB 2OYPA 1E2VA 1NCCH 4XRCB 3BZFA 4POZC 1Z1WA 1RJYB 2EO7A 2CA3A 4AH2B 4G7YH 2VQTA 3BAXA 3HI6H 4F9LC 2BY1A 4CSZA 5I2IA 2DDQH 2LT9A 4I48A 1QHQA 4Z8FL 1BOGB 3A6BL 2ZOWA 3TNMA 4JO4H 1FJ1A 3R0MA 3D30A 4HJTA 4Y4FD 1D5MB 2ED7A 2R0LL 3FQYA 3Q5OA 4OH2A 5F0MB 4HU2A 1OSZA 1USQA 3MV7B 3DDGA 2GIMA 4QTHB 4K7FA 2BVQA 2V2WB 5FUZL 5B1KA 3HPJB 2CUHA 3OMAB 3A24A 5GPRA 5IBUG 1R4XA 5SX4I 2BERA 4YDKH 3GBML 1ACYH 4M03A 3LPFA 1U3HD 2W0FA 2ZE0A 3PCYA 4WHCA 2D0FA 4WWNA 1QR1B 2F2HA 1C1EL 4LESA 4FABH 3X14A 1X9LA 2HG0A 1B2WH 2BPBA 2VLKB 3P3RA 2WVTA 2ICWA 3J2PA 4L1BA 1A5FL 1A3RH 1NCAH 5EUKA 4CADA 1WZAA 2A83B 3ARGA 2YD0A 1LE9A 1EMTH 1E65A 4UT9A 5DA0B 3EGXA 2FGWH 3V4PB 3F7VB 2AF2A 2A74C 5I71C 3S37H 4G8GA 3QG6A 4V2BA 1KTCA 1MVFA 2W80C 4CU7A 15C8H 4LLWB 4AIZB 4AEFA 2E7CA 3T09A 3AJ7A 5DHVB 5EU3B 4PUBL 4KXAA 1ZOXA 2GJJA 3ULSB 2W0FB 2YUZA 2APVA 2LAGB 2ZG1A 1K4CB 2KUTA 4L37B 3NT0A 1U42A 3WFEL 1J9SA 4WI3A 3CFDB 3ZE1B 3FAXA 3MKGA 5FYLE 3KPMB 1DYZA 1RPQA 4RQQA 4TULL 5JIHA 3WEAA 3GI8H 3IMWA 1OAJA 3FXIC 5HHNA 2WMPA 5J11C 5SWSB 3FQ4A 4BFIA 2WKGA 3E2HB 3CX2A 3M1CA 1N10A 4G9FA 5DYOB 5KAQG 2ZKMX 4EUPA 1QHPA 3FFOA 2CD0A 4NIKB 4Z76A 5C9JB 1WBZB 3ZX1A 2YRLA 3WY1A 5JHLL 5IQMA 2EKSB 2AK4A 3M7OA 1RIUH 4JRWA 2DI9A 5HVGB 4O4YH 5TE4L 1DN0A 2AJ3B 1Y18B 4XXCC 3D05A 4FX5A 3TBYB 1T22A 2Q20A 3CZJA 4W9CC 1UGKA 3SGEH 1OALA 1BWWA 4X6DE 1CDIA 5FOJA 4S0HA 1DP0A 3VH8A 3SHSA 4WTZA 4OTXH 4YL9A 5FKPA 5INCA 5EO1B 3LV3A 5D96C 1XCTB 4ODSH 2KPWA 3BP5B 5DQDL 3O4LE 4A39A 5E00A 4K5LA 5ESQA 4CSTA 2X5PA 1Q0EA 1IEBB 3T4AC 3RWJB 3BPNC 4JM2B 3HW7A 2TRYA 1EO8H 4WEEA 1OV8A 3RVWD 4F37K 2R69A 3OTTA 1LO2L 2V8MA 4J8RB 3RPIB 1JVLA 1KJ2L 2EE3A 1DUYB 2NY0B 2R4SL 5JUEL 3IU4L 4BSWB 4U1MA 2JKXA 5DK2A 4FQCH 4EZLA 2P44B 3KS0H 4JG5A 5DD3H 3IDNA 3UC0H 4BZYA 4MB1A 1AR1C 3LKRB 3OKOB 1LK2A 4AV0A 5EB9A 1DQMH 1WBZA 1SOKA 2C8NA 3L16A 2MTAA 3LNGA 5EU6E 3AITA 4JRFA 1R3HB 5EZPA 1T04A 1S3KL 1LEGB 2FO4A 4YSPA 2BWQA 3LQAH 3U7WH 4UV7L 5IQ9B 2ZCLL 4RBPH 5E4EB 1LO5A 2ATAA 1KCBA 1F3DH 3O11B 4KITB 2EXYD 1SMOA 1B88A 2FEEI 1HL4A 1ILSA 4G80A 3MV8A 5HHMD 3GRWA 3T1FA 3RURA 1K5WA 3V4VA 5FV1L 1RJCA 2NRDA 4YHLH 1QA9B 5HI4D 1V5JA 4XMLH 3RB5A 4X6DF 4ZW7A 5CR8A 4PJ8C 4ADIA 5H94A 1EAPA 4AENB 2XVBA 3BRDA 5E70A 1NFDA 4KO9A 4FTVA 4N0FA 3O0RH 3MJ8A 4CC1A 1DVYA 2IH3A 4XPFH 4J3WA 3U25A 5B1JA 4APQA 4O51A 4CVXB 4DP0X 4ZNCD 3EHBD 2X2HA 3FB6A 4U3XA 1JZ5A 2Z4TA 1G7IA 2OTWA 5G5DA 3VJ6B 4L4VE 1BOYA 2WN2A 3U0PA 1LE5A 1QNZL 1BV8A 3L13A 1XB6A 3L9RB 3VMOA 1XIWC 1VIWA 1FHNA 3QEGL 1HZHH 2XVLA 3A4AA 4R5VA 3FTZA 5AVWB 3UL4A 3MJ7B 4HZLB 1OCWH 5CCHE 3TM6A 2VLKD 4R26L 4HQQL 5B39A 4ZQKA 3SY0B 1EFXB 3UIYA 3PAUA 4FQPA