2B59A

The type ii cohesin dockerin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
KASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/structural protein
molecule keywords COG1196: Chromosome segregation ATPases
publication title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 33
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2b59A00
3GHPA 3KCPA 5K39A 2Y3NA 4FL4C 4WI0A 1OHZA 2BM3A 1AOHA 2VN6A 2XDHA 3F2LA 4UYQA 1QZNA 4UYPA 2W1NA 2CCLA 2JH2A 3BWZA 2ZF9A 2OZNA 5AOZA 2VN5A 4U3SA 4DH2A 5G5DA 2O4EA 3FNKA 1ANUA 3L8QA 3UL4A 1G1KA 4N2OA 4FL4B 4IU2A 3KCPB 4WKZB 5LXVA 2VO8A 4IU3A 4UMSA 1ZV9A 1TYJA 2B59A
chains in the Genus database with same CATH superfamily
3QEQD 5F8QC 3IS0X 3UYRH 5E6ZA 1OP5K 2DQHL 3B1UA 4ZK8A 1GZHA 4LOUD 5HYIA 4J6IA 3TH3T 3VD5A 3WHXA 4JJ5B 1ETA1 2DM4A 4MQ7B 4BFRA 3KWWB 4WFFD 4WW2C 2CMRL 1IM3A 3EBHA 4KZCA 1IARB 2WZPD 3MR9A 2E9WA 1H6UA 2Q3AA 5C0BB 2XTJD 4DTGL 2ORBL 4Y2DC 3GO1H 4RDBA 1DDHA 2PO6C 5F6HI 5F70A 1NDGA 1CL7H 5DO2D 2WZ5A 4ELKB 2FH6A 3RL2A 2H41A 2OMTA 5HDQH 5E4IA 4HAGA 4M9PA 4PCTA 1F41A 5MEQA 3MYZA 2VXTH 3APFA 3DVNA 1MF2H 1GYUA 4JFQB 4UQIM 4JFFA 1GTNA 2QQNH 4DP6X 3K6DA 4LEXL 3QJUB 3CX5J 2OI9C 4CDGC 1QASA 1VB9A 4FQXB 4WK4B 2BVYA 1HZKA 1I85C 1T89C 2PP8A 1DE4B 2CNZA 1I7ZB 1K6QH 3J7HA 2LQRA 1W91A 3HAEB 3HE6B 3HPLB 2PXYB 4Q4EA 4P48A 2XWDA 3I02B 5IR1A 4RCAA 5LXVA 1OSPH 4YZWA 4JFDE 1IC7L 4JPIB 3VMOA 1BMGA 1PNCA 3VACA 3VNYA 4ALAC 2FDBP 2HLFD 1GSMA 1HSAB 2DQDL 4IGBC 3LYRA 3MRDB 1MHEB 5AL0A 2QKIA 2IGFL 1ZGLM 3BJ91 5D5ME 1UXWB 4I88A 4PWGA 3L3HB 5LAPA 1MFDL 4M1CD 4OM1L 2H3NA 2QR0A 4IJ3B 1LWRA 1KGYE 4OQTA 3L4ZA 3W1ZA 1NCDL 4PS8A 1AXTH 3P69A 4IYKA 2R27A 2C9PA 4HUXA 1XAKA 4BK8A 5C97A 5ELIA 1SJEB 1XT5A 4Y88A 4LSRL 3R8QA 1UD3A 3JWDL 2YPKB 4KAQL 4KKZA 3D8MA 1OW0C 4UQ3B 2J1ZA 2ZUQC 4RIRB 1F02I 3ZTNH 3QIUA 4KH2A 4PR5B 1D9KC 1RZ7L 5D5MF 1X6NA 4PW3A 2GTZB 2BC4B 4G8FB 2CQVA 3GMOA 3UBXG 4APQD 5K9KB 4ACPA 4HIJA 5AOZA 1NAMB 5D2NE 2G75B 4H8WH 5IB4A 4FF9A 4F2MB 1LL1A 3T3PF 3UBFA 5L6YL 1J0KA 2EDQA 4R7DA 4MQXC 1RUQL 4HIIA 2BWDA 1P4LB 5EUOA 3U4BH 5DJXB 3X1EA 25C8L 3BQVA 5C08E 1CXFA 4BA0A 1JJUA 3LPFA 4WV1B 2HMID 4KH9A 4ZFFB 2CM5A 4HPYH 4JMNA 2I7SA 3U9PL 1FL6A 2NW2B 4ZS7H 4R83A 5DJ6B 5JW4R 4FZEH 2XWTA 2VQUA 4M56A 2H32B 3X13B 1DLFL 4M48H 5DEFA 2WPGA 1BVKB 2VR6A 2B1AH 5AVVB 5HYJE 1P5UA 4I9WD 1J0ZA 1KJMB 4G42A 3OWRA 4JREC 2VR5A 3FFOA 1YEKH 3MTXA 4ELME 2VDQH 4UQBA 2W0FA 3P3TA 5ID0B 4PCYA 3EBIA 2OULB 5F8RC 5FM4A 4FL4B 1NC4D 1WCBA 3IJHB 1Q0XH 1Z5LA 2K78A 1B4LA 2H5UA 2VUYA 3L3GA 4PREB 5EU3A 3T3MF 2B4CL 3WG7B 4CU6A 1ZGLP 4LU5H 4J3OD 3PRZA 1JV2A 4HUUB 4KGLA 1OLLA 4PJXF 3LZRA 5CCKH 1PQZA 3JQOB 2YD7A 2VDMB 3O6LL 1HOCA 5BQ7A 1MFCL 3ZHDA 2XU9A 3CZEA 4P2RA 3WNLA 2DJUA 1BVNP 2ENPA 2UZIH 4MQTB 4PW9A 1UEMA 2JXMB 1CD8A 2MSPA 4K73A 3NACH 2XZAH 3V4PB 5D93B 1C7SA 3CXHJ 3TBTA 1JI2A 4NJAH 5SWQB 2Y24A 1TQVA 2JJVA 4UUJB 4TNVF 4QAWA 1KC5L 4E9TA 4N4YB 2X1QA 3KPLB 4CKQA 4GBXA 2JV6A 4QHUB 4KUZH 2ZCHL 2A9AA 4WTWA 1KJVB 1G7JA 5C0IB 1DEEA 1OARL 2FYYB 2BZDA 3IPEA 2R51A 4XPTH 1CE6B 4WHCA 4LIQL 1B2YA 1GS7A 4TM9A 2YA2A 5F7EL 4ADGA 2YSSB 4TLUA 2XACC 3L8QA 4RX4D 2EEFA 4OM0H 1MFUA 2BNQB 1P5VB 3ULUD 5DGQA 5I6PA 1INDH 1TTAA 1PTZA 3BYTA 5DHDA 5CGBA 2CUMA 5C3TA 2EXTA 1CQKA 1DJWA 2L8AA 1QAWA 3V5HA 1HI6A 1KZQA 4KHTL 1LMIA 2BSBA 3WFDL 5E7FA 3L1EA 2K9UA 4GXUM 1LEGA 3LV3A 2JQAA 4R7XA 2XXMB 3CDGA 5K9OB 2VSCA 1M1XA 1VRSA 5EN2B 2C8NA 2D7OA 1DSYA 2AK1H 1U8OA 2X4NB 3APCA 3CSFA 3GBDA 4QI3A 3RAJH 4BQ8A 1J8KA 3UBXI 4N9OB 3WNOA 4DPRA 5FA4A 4G59C 2LU5A 5B21A 1QKZL 4FA6A 4JFYB 4HKXB 2OMZB 4LCVA 3TN0C 1QUNB 1IGIL 2HFTA 1NGYA 4NKMA 3S3DB 5KVDL 3B2UD 4HX1A 3PCYA 1RPUA 1GGBL 1UWXH 5AW7B 5C07D 1QMUA 1RZKH 2LFGA 4RA3A 3LKOA 4Z3HA 3D3VD 3G04B 3IDMB 4Y16C 43C9A 3KPMB 2X88A 2E56A 2YPLA 3M1CA 1UZGA 3AM8A 3QQ9C 1LDPL 2LVEA 2NXZD 1DQVA 4F15B 4PBXA 4UOW1 3QORC 4XP6L 1X7TA 4OJFL 4ZMLA 3RDTA 4L1HA 3NUKA 2BVQA 3ZE2B 1MKFA 2EAEA 3NTCH 5E6IB 4YSUA 2QADC 2MCPL 3AWGA 3O8XB 4A7VA 3UO1L 4G9DA 1ZPUA 1RZQA 4OQ1A 4ZO6A 1OP3K 1AP2B 4KJWC 1H19A 4O02B 4AV0A 1D5IL 2QVKA 8FABB 1TO5A 2WQAA 3Q1SH 1BQHG 4J3OF 1A4CA 1R46A 2CALA 4R3SB 2OX5B 2A5UA 3UPAA 4Z5RA 3WV0A 2CCWA 2A6IA 1DL7H 1VFBA 2HLAB 3KH3A 2ED9A 4N26A 3TEWA 3O4OB 1H6FA 2CDGB 3BPCA 5DUPL 3A6BH 4PRHE 3CSPA 4YAQA 3OJVC 4YXHL 2JKIS 1EWHA 3ATDA 3ERXA 4NXSA 5E4OA 2F58L 4DP2X 2YN3A 5KAQF 4XXCA 3SCMA 3HC4H 3P0YH 4FE9A 1I9IL 1TKWB 4LDOB 1WWBX 4TQPA 2VW6A 3RYMA 3EDJA 1DBBL 3QUYB 1G7LA 4I4WA 4MLIA 4CL7A 3LRSB 1YNTA 1E2ZA 4Q6IB 2NT0A 3MKGA 4PJ8C 4LFHD 4XP5H 3DJTA 1SXNA 5EORL 3SDYL 5EZIH 3GXFA 4DN3L 2HJLA 3N91A 2FHCA 3ULUF 5B1JC 4UT9H 2COVD 4J7RA 1TVBB 1YYLL 5D1QD 3L3IA 2C9XA 1T0OA 5LAXA 4PLJC 1RJYB 3LKPA 4K8RD 1ZV9A 3DC0A 4FQJL 4GMSH 1HHHA 3EO9L 2L7UA 5FYJD 4NUMA 3AT0A 3W0WB 2HFEB 2BP0B 1RZFH 1TFPA 3L95B 2Y7MA 3IVKB 2YXMA 2QELA 1NKGA 3FU0A 3LN4B 4JFDB 2VJ8A 1BM7A 3EGXB 3DI3B 2P5EB 1NGPH 1KENH 1T22A 4M1GL 4WWPA 3S6CA 4AV4A 5IB1B 2Q86B 5I73C 4UT7L 1TU2B 4JUTA 5HHPB 4YXKL 2V7HB 3QUKB 2WBXA 3D39E 5D5MB 2IBZY 3VFWA 2CHZA 3T9WA 4BH7A 4LSUL 3F04A 5IMMA 1B3JA 3WTUA 3VH8B 2F5AL 3RTQA 5H4ZA 3HHRB 1Y6KR 3VFVA 1CD9B 3QWNA 3BP7B 1B4JL 2N01B 4DF9A 3CFCH 4LFHG 1J8HD 2NTSP 5BOPA 2UZYB 1D5BA 1M7IB 5AG9A 1SDDB 3LZNA 2AS5M 4M62L 3KWVA 1AKPA 4F7TA 3ILQD 1FFTB 2H7WA 3WFBH 3CVHL 3FQUB 2ED7A 3GKWH 3QZWB 1SF5A 1RFDL 4JKPH 4JQVA 3QWQB 3UAJD 5IW6A 1DVUA 4HJIA 3BFWA 3H53A 1IGML 4G6AD 5D7KE 4YHLH 1G9HA 1II4E 2UXTA 3FO2B 1RUKL 4GAJH 3D5OF 3VA6A 1XD1A 4LBEA 3EJCA 4A2EA 5ALCL 4XMTA 2YD5A 4LLWB 4MS6A 2GTQA 5C08B 4ZUWB 2GJ6A 3A6OA 4NN5C 3T3MB 4GRWE 1CPUA 4NO0A 4BH8A 4PJ9D 1K5NB 4UAOB 4HWZA 4CSSA 4DK5A 3MLTB 1NBVH 3Q8FA 3MBEB 3CH1B 5FYKL 1BVOA 1OAYL 1BAFL 2OXGB 5IF0A 4FNLL 4PJXB 2C9UA 4PJCA 3VXSA 1EEYB 3OKKA 5HYJB 4L4VE 4XOEA 2VJ0A 4BQ9A 5I2IA 4DN4H 4TLTA 1R34A 2XTJB 4I0PA 4IOSD 1QW8A 4NWUL 3R06A 3QHFL 3LZLA 4ELMB 2IOMA 1LE9B 4WF7A 3UYOD 3CHQA 1GW0A 1PL3A 3B9EA 5C9JB 1LP9A 1T1ZB 5GRJH 4CUCA 2DBJA 3PP4H 3APMA 4XP9L 4TS6A 3S37X 1V7NL 1I1YB 3WXVL 3TNMB 2XZCL 3TJEH 4AYMC 5DQDH 1YNLL 1Y0LB 3KJ4B 1AGCB 2YSTA 2X4QB 4R0LA 1U91A 3WNMA 4F91B 1NUGA 3A4AA 1EJOH 2F54A 1A14H 5DD6B 5E5MA 1VADA 1VCBC 2OMUA 5KVEL 2FGWL 3WO4B 5FYKU 3MCLH 4LSQH 2ZXGA 1TZ8A 5E2WH 5T3ZE 1EERB 2VDNL 1M7DB 3SOTA 4AQOA 5IKCB 2ZAHA 2WNXA 4KK6C 3GSUB 4JDZB 2CLRA 2Q7AA 5JIMA 3RVTD 3PP3H 3QSKB 4NKOA 1YN6A 3ZHNA 3MN8A 5C0AD 4NC2B 3NCMA 4WGWB 5EU6D 1YPZE 4PW4A 3A47A 3OLGA 3MLYL 1FG9C 3CX2A 1AZCA 4LSTH 3PGCA 3Q2LA 4JVUA 3WJLA 4X83A 3EO1A 3EJUA 5FGSA 4KGJA 2H4EA 1UATA 1OAKH 4P9MH 1IFHH 3LMJH 5EU7E 3T4AA 1ZVHA 5A3ID 2X6MA 4FX5A 1CICB 4Q9CA 1SPDA 3E9UA 2HG5B 2OMXA 1OP9A 1E2WA 1HDMA 2EXWD 2EC8A 3CFEA 4WW1B 1ZHLB 5BZZA 3LEYL 5HHOE 4PD4K 3ZUNC 1OANA 4GRLD 3PWUA 4DZ8B 4MA3B 2WXHA 4Z0BL 3WN5C 3TEXA 5C0DB 1AMXA 2VKXA 2YK1H 4AC4A 1WAAF 4R9HA 3TT1L 1JNJA 2MFNA 1ASPA 2ZE0A 4LXFA 4AYFA 1N8OE 1YUKB 3WGUB 1MXDA 5EF3A 4V2BA 1FWXA 2BVEA 3ARFD 4JM2D 3SE3A 1FI8C 1A7PH 1NFDF 3SKNA 3RX5A 2BOBA 3AWEA 4ODHH 3QQ4A 2XICA 4D9LL 1WV7T 3CCHB 3E1F1 3OG4B 1A2YA 3PXHA 4FNPA 1K6QL 4UQ9A 3B8SA 4PJ7A 3F5WB 5I26A 4XNUL 1Z5HA 1M57B 2ADJB 4LOFA 4IDLA 1E4XH 4NKIL 9CGTA 4KWUA 1MRDL 5IVOA 1E5YA 3BEWB 4J3SA 4U3CA 1DQKA 4PB0L 2QJDA 1ZGLB 1S7TB 4I1NB 2P46B 3ESVF 1BJ1J 1JZ8A 3WD5L 2IMMA 3OKYA 3UPRA 5DEZA 4CU7A 5T3XD 3E8UL 4G7VL 1BREA 1NC4B 4BFBD 5GS1A 3DUUB 3RKPA 3SPCA 4IK6A 1EVTC 2H1LM 4URTB 2GBTA 1BFVL 2EDOA 4V1DD 3V79C 2DLIA 5A2LH 1GKOA 2WVVA 5MERA 2VH5H 4R97B 5HTSA 2CK2A 3BVWA 1MEXL 4JL1A 4WVRA 4F8TA 3R1GH 5E9NA 3PAZA 5CBAB 5A6IA 3RVXC 4Z3GA 5DVNA 4PYGA 4JO8A 3ZTNL 5I8KH 4WU5A 3BRDA 3GXMA 3P9MA 3PQYD 2BRRH 1BYPA 4HJ0D 4E0RA 2X4OA 5BW7A 5K1NA 2HFFA 1N7MH 3U6RA 1IC1A 3DMMC 1ZOXA 2P9RA 2VDPH 1U8CB 3M7OA 2LR4A 3B2XA 5L8LB 1EJFA 4K5PA 4JG1L 2H8PA 3E1ZA 3MNDA 4H8WL 4HLZH 2WMPA 3QQNA 3AXIA 3WTTA 2DQTH 3OXSB 4Y4HB 4XMWA 5T33L 2IH3B 4XGZB 4UTAH 3C2AH 1NKRA 3PYCA 1BQSA 4KY1L 3VJ6B 1UA3A 3KYNB 4PRHB 3IE4A 1E5ZA 2D9CA 1VHPA 3MRRA 2VO8A 4JCWA 1ZHKB 5DRZA 3KPPB 1IAIL 4FZEL 5EDXA 4B5ZA 5JIKA 3CZLA 4K5NA 1I3RB 1S7RA 4OBSA 2DMHA 3Q01A 5ESAA 3CFIC 1PKQA 3QCVL 3T0EA 4GB9A 4XNXL 2VDQL 3WIHL 3GRWL 2HG0A 3K3QA 1P7KA 4Q0XL 2W07B 2JB5L 4JR9H 1Q0XL 3RGVA 1G7IB 4WFEE 1WSST 5I66A 3PGDB 3CVHA 2VRQA 1YAIA 2OYKA 3CFJA 5DDHA 5IHUL 5F7MC 3L1OL 1QHOA 4HP5A 1F97A 4EDWL 4DUWA 1TZHA 4Y9BA 4J39A 5J5EA 4FTVD 1S7UA 3NCBB 5IW1A 4YDKH 2CD0A 1X4ZA 4OLVH 3W39A 3B3BA 1JGLL 1NCCH 2LV4A 2QVMA 2JH2A 3T09A 2BXZA 4I13B 2XVBA 4RAHA 4AXWA 4NQUA 1DBMH 2PTTA 2EZ0C 3MJ7A 3EYVB 5L2KD 2UZXB 2EUVA 1F45A 1FO0B 4G7SB 4WUUA 3BGAA 4M1DH 4NJAL 3U2SB 1XWVA 2ZWLT 3HVNA 5C07B 1N6QH 3VG0H 2XPGA 4LARL 2ED6A 3LVEA 4G3YL 3L54A 4HJGB 3QWOB 5A16A 4WI9A 4PRIA 3HZVA 2M2DA 1LNUA 2VRKA 2ZAGA 4LCYA 4WI3A 4YSDA 3N40F 4L9LB 5IESH 4KUCF 1T0NB 3ZRFC 2NXZB 1DVSA 5JXED 3QZNA 4YK4B 4ZPVA 4ZUVB 1CF8H 1EMTH 1WITA 2A73A 3EYUH 4NKDA 4XPTL 5GRZA 4AY0A 5MI0C 1L6XA 1W2KT 2AK4D 1KXTA 3GBLA 2DD8L 3UC2A 3HMWL 2QQLL 3L45A 2E9BA 4G80B 4OM0L 1IGTA 1ZTMA 1PFCA 5KBPA 3ARPA 3LKQA 2OMVA 1F8TL 1L0QA 1G7QB 3VWJC 4XVUC 1S5IH 1MZZA 2HT4C 5IG7B 1IQDA 2QZ5A 5EC1B 4X5XB 4IMKA 1TYJA 1NZRA 1MQKH 4YGVA 3D9AH 4DGIL 3MFGB 2HRPH 4N0UE 5CEYA 1EANA 2ZWZA 3ZDWA 2ZP8A 2R1WB 1BFSA 1X44A 1PW3A 3V0FA 1I53A 4E5XG 2AK1L 4YOKA 4MJ6A 1S78C 4P3CL 3CV5A 4TRPL 1AJ7L 3BVUA 4L2LA 4JDVB 1MREL 3MOAL 5E08H 1MVYA 3OAYK 3NABL 1G4MA 1WFOA 5DYOA 1T04B 2CLZA 4QGYA 3IMBA 1TEFA 4FCHA 1UQSB 3MROB 3GNML 1T2JA 4A39A 3D18B 4L4VB 4KKRA 4UCFA 4I3SL 5BO1H 1DJZA 5HI5D 2OMNA 1MCJA 4N2GA 4KKPA 1GH7A 5C0ND 3SPHA 2EINB 2D0HA 3C5ZD 4HK0A 1NC2B 4WGKA 5JIHA 1VZGA 1CCZA 5F0PB 2ZOKB 3QEHB 4R7NB 4J6RH 1UVQA 4LOEA 2JIXD 4AL8C 5H4YA 3B8YA 5SWZA 3HR5B 4Y4FD 5AAPA 1T0PB 2EVJA 5AZ2L 4JKLA 1ADWA 3FO1A 1MWAB 4JAMB 1ROWA 3IXTA 3P4NB 4YDLB 1OGTB 3GSQA 2WNGA 2X0UA 4IRSD 2MH4A 2BSTA 3C5SA 3DGDA 4KRPB 5MP6H 3WO3B 2PCPA 1WK0A 3RJDA 2GSGA 1M56B 1QO3A 5HVWA 2HJKA 2O26U 3KBEA 4H5SB 5LQBH 1JF1B 3QXUA 3GKZA 3EJJX 2I9TB 3BMWA 3NJIA 5ERWA 5DJ2B 2JE8A 1YPZB 4NQCE 1EDHA 1FJ1B 2FEDC 4F93B 3V8OA 3U1PA 4BFFA 1SMAA 3ZE1E 2MRYA 1XH3B 2O72A 2UXGA 2XYCA 5BMFH 1X5XA 3T2PA 5J9PB 3MNWA 4Z3IA 3UGUA 4F8PA 1R0AH 1B9KA 1M2VA 4HG4J 1LILA 3BE1H 4NO3A 1L9NA 1A7QL 3LHAA 4XH2B 1XHHA 3WLWD 2JQMA 2UY6B 2VAJA 1R6VA 3BPLC 3Q6GL 5HHOB 2VLKA 4S2SB 1FZMB 2EC9T 2PYED 5D6DC 1EH9A 3VGDA 3KCWA 4LESA 4FFYH 1SYVA 4OI9A 3QYNA 4PEEA 2BFGA 1KF9B 2W9EH 1WLHA 4JZJB 4OSUH 2NDGA 3NCYS 2FJHA 1JAEA 1SY6L 3H56A 4YWGH 1CFQA 5C2UB 4J2QA 1T5WB 3ELQA 1QG3A 2ROXA 5TFSH 1UOKA 2XIIA 1Q0YH 1NEZG 4LL1A 1NCIA 4FLRA 4OZHA 5LDSA 4IBUA 1QFWM 4HUVB 4GMSL 4LE8A 1EO5A 4ZFOB 2K7QA 1G0XA 4OF8A 4PJHA 5JPNC 2R23B 4H26A 4KXBA 4R6UA 2KL6A 4YO0B 2GIYA 4X7EC 2PCFB 5EEYA 3K80A 2VXVH 1CGVA 2MNJB 5KSBF 2NW3B 3LPWA 4ZMOA 2X0WA 5AD0A 4LP4A 2ZUSA 2IAMA 3MI6A 4K3HA 2XHNA 3SBQA 3WIHA 4C4UA 4ZXBB 4BK5C 3GRWA 5MEPA 4AJVA 3O3UN 3MJGX 2BDNH 3ZIYA 4MJID 1S9XA 2VR7A 4FJYA 1BF5A 5B3JE 5EEVA 2F7QA 2Y7SA 2Z4QA 4UT6H 3EYFB 3TYGL 1DBAL 2UVFA 4ONFH 2QGDA 4BDVA 4EUPB 3ISWA 4ALAL 4LRIC 3WHE0 2XPZA 3Q8CA 3EFDL 2P7TA 2IGTA 1MFMA 2A6KA 2A74A 3ROOA 5EPMA 4A7UA 3WYRA 1U8HB 2F61A 1WD9A 2P8MA 4Y4KA 3SPIA 2WWOA 4ONOA 1OGAD 3OR7A 2WLIA 1XZ0B 4FG0A 5LWYH 2XQ0A 4HBCL 1FGNH 3GSNH 1EHXA 4O2FA 1O6SA 5C09E 3S4SG 4AZ8A 3QQDB 5IUSA 1BPVA 2BP8A 5C0AB 3UABA 2FX9H 5EU6B 2V3FA 1FLRL 2AXJA 4H1LH 5FXCH 3MLUL 1N2RA 3HFFA 4GAJL 4HJSA 4PGDA 3IDNB 3U7WL 3V4UL 3C8KB 2H0FA 1AD9B 1HEZB 3BUBA 2NY0D 3TVMB 1JXGA 4L5FL 1BX2B 3X3GH 1SN2A 2P5WD 4KQ3L 5FM5O 3DUSA 1U8PB 4ODXB 5IQ9B 4G1MB 3CH8A 2WBJC 3TZVA 3GSRA 2BHZA 1NBVL 5E4AA 1TQBC 2FR4B 1XCTA 4NAMA 5MHSE 1PZUB 5IVXA 4GI6A 1ERNA 1CFVL 1A4JA 3AB0B 4PGJA 4UIMB 4X7TA 1QEXA 3A67H 3TBYB 3D85D 5D1ZA 2GAZA 2NY1D 2SEBB 3SQRA 5E2JA 2O61A 2QHRH 2OM5A 4AJYV 5J56B 1P4BH 2AJ3B 5HPMA 4PRDB 2X2JA 1IKFH 3MUUA 3B83A 5J57B 1DN0B 5IVZA 3PP4L 3UPCA 5JHDD 5A2BA 1EK3A 1QQDB 3BW9B 1OAZH 3ARFB 3QUML 4CJ1A 4XO9A 5EEWA 4K9EC 5GS2D 5I6XC 5KJ7E 4U1LA 3MYJA 3ZT7A 4UQCA 1TQWA 3CZNA 3T2NH 2AJYL 1T66C 2NYYD 3DK2A 4QTHA 1DJGA 5EIQA 4GQRA 4HLJA 4HMCA 3L9BA 1XEDA 5I1JH 3CHPA 4U3XA 5I17A 1N3NA 4P23D 4EF3A 2DBLH 5E5UB 4OCRL 2VSMB 1E28A 3UERA 5C2BH 2ZWKA 5F1NB 3ULSB 1YEGL 3TTYA 3WKQA 2CDFA 1A7NL 2FNBA 3SPGA 4K23L 5FWRA 4YHOH 4PJFE 3U9UA 2AEQH 4EN3C 3BHBA 3Q3GB 4ZZFA 1BF8A 2K8QA 3LS4H 3MRIB 3US0A 2ZYRA 1E27B 4M5TA 1BGXL 1U3HB 4WHDA 1TENA 2FWOB 1NBQA 2F19H 4NGHL 1J1PL 4ZODA 3VDCA 2C4FU 1S3RA 4B41A 4QHMB 4QHLB 4ES9A 4BEIA 3BP6A 1KTKE 1CK0L 3O2VH 2R1YB 3QIBC 1IM3D 2EDRA 2BMKB 2IFFL 3KWTA 1DUZA 4TXVB 4A2LA 3WS6A 3Q06A 3GMPB 4YHKL 3QDJA 1Q94A 4KRMB 1T5XB 4W6YB 4DVBB 5LGJA 2BPBA 4MNQA 3VXRE 1MFBL 1XSIA 3H2WA 1RIVL 4K3DH 4FNTA 4JW3A 1ND0B 5CUSL 3SGEH 4N0UB 2PWFA 1C5DB 3O9WC 2QPSA 1R3KA 5BS0D 1A7PL 3SDCC 5H35B 1I1AD 5DURD 4NO5A 3QUZC 3LN9A 4HQQH 3APNA 2JWYA 4YIQA 4UV4L 3EFFB 5EBMA 3TBCA 4OFPA 2FEEL 5HGDA 4JFEE 1SJHB 1Q90A 2VITA 3CGTA 2PPDA 1FV1B 4D7PA 1FLTX 5TH2A 4Z1PA 1YNKL 4CN4A 4KZDH 2D2OA 1QSVA 4W4OA 2V17L 5AEAA 1IBBA 4HU2A 3WFCH 2DQJL 4OF6A 1E4XL 1QVOB 2CKBL 5L0QB 3HKFA 3TFBA 1G43A 5IB3B 5DS1A 4TQ8A 2YN5A 4CA4A 1U8NB 4EBQL 4JG5A 5D7IF 2L7EA 4N1CA 4R96B 4PS4H 4ZMZA 2ZKYA 4HIHA 4OB5L 4BSVB 2E76C 3VVVA 4DFIA 2LABA 3MV9A 3PHQB 1IAOB 3A21A 2OJEA 3FFDB 4PLKD 3A6CL 1SY6A 4KTEH 2WKLA 5IB5A 3AGVA 4N5EC 4J8RB 3N06B 1M05A 4BFKA 3GQFA 4Z7NE 2VLJE 2Q2EB 1G9NL 2Y7LA 2FVNA 3QS2A 2OR9H 4Y2DA 5AAMC 2Y6SD 4OGXH 3CFTA 4G6JL 5I8KL 2PO6A 2YQGA 4ZTOH 3N04A 4OLXH 5ACMA 3ZDYF 4XHJD 2FL5B 2VDOB 3SE6A 3HBGA 5DSCB 4JO3H 3VFNB 4Z23A 2XN0A 1UZ8A 3B6SB 3BQUA 1JWUA 4FA7B 4HW6A 1OSZB 3FRPG 3PY9A 5EULV 2M1KA 5F9JB 2HFGL 1F58H 1GYWA 4XPBH 5D7JC 3V6OE 3QWRA 3BAKA 1T89A 3D69B 3EJSA 2P80A 3L4XA 4NQCB 2AMUA 1BD2A 1R5IA 4LGPB 3F7YB 3MMEB 4Q9QL 3QCTL 4RMQA 3RWIA 2CSPA 2AK4B 3OKMA 3ZE1B 4LCIL 4LOUC 3ESUF 3O2WL 1CVSC 1E7VA 4XCYB 3WNKA 1XCWA 4XPGH 4RAVB 4XMKH 4IGBA 2D7TH 5AVZB 2WAQA 4ZFGH 2DY2A 4IM8A 2YUWA 3KS0H 2HVKB 4E9WA 5EU5A 3W38A 2X4PB 5EU4B 3H55A 3QPXH 5TE7H 1XGRB 4M4PA 1SFHA 5DO2C 3VW3H 1K8IB 5C3IA 1TZGH 3ALXA 2Y06H 4JFFE 5DRWB 4AQAB 4D0CB 4DK3A 4QF1A 3IETB 1D5MB 1WBYA 1TUPA 3G6AA 3DX6B 1KTDB 3MLZL 3TCLA 3FU5A 3T2OA 1OW0A 1V5JA 3C09B 3QFJD 4D94A 4KX9A 4K2UH 4P2RD 1FQ9C 4AYDC 1S7WB 3KPRA 2Q8BH 4OLZL 3KDPB 4PTTB 5BRQA 1D9KA 1HXMB 4UB0L 3TT3L 1HWGB 1ADQL 1KELL 3FCBA 3FMGH 3JVGC 4DZBA 5DQJA 1E3ZA 4KHXL 1I7RA 2VZ1A 1KV7A 2OL3A 3IGFA 3DGCR 1EHAA 3GJFB 2EIJB 3VG0L 1BZOA 1EAJA 2HLFC 4Z7UA 2DWTA 4ODUA 3EFOA 1NDMB 4NX0A 3RDJA 3RZCB 4AITA 4NFCA 1QW9A 4RDQG 2ITCA 4AM0Q 4FG6D 1MI5E 2WVTA 5T1DH 4XP1L 3RPIB 4M1CC 4KZ0A 5BXFB 2UVEA 2B16A 3C5ZB 4ZOEA 1UC6A 3QUMA 1OIOA 2YKLH 4U1SB 2WUBH 2BOCB 4LCWE 4M6NL 4YSTA 2DYPB 4Y4FB 2PF6A 1CGWA 1GHFL 3EOTL 5CSBA 3SGKC 2W81C 3QI9B 5BZWB 4KVCH 1MAMH 3K2UL 4G5ZL 3O11A 3NJHA 5KSVA 4P06A 4IRSB 1MQKL 4NCDA 4QKXB 2WLYA 4Z77A 2G2RA 3QNZA 2ICWB 1JRHI 3BAYA 4APQC 3TBVB 3SO5A 3LZFL 4PWHA 4QTIH 4JFXA 3MGTA 5IVNA 1ZLSL 2QGCA 1CZ8H 1H8OA 5K1VA 4G8GA 3AVEA 5H94B 2ZSVB 3WS3B 4BCZA 1G7HB 2FBJL 4Q6KA 4IBVA 4ESKA 2HMIC 2FRGP 4ZO9A 4GIPD 5SV3A 4FOMA 1C5CH 2XXGA 5AQ0A 3SB3A 5E08L 4WO4B 3IWVA 2XRAL 1IIKA 1DR9A 3BD5A 3TESA 3GXPA 4N0RA 1J8RA 5BZXA 3HBZA 3L2LA 4XCNA 2O93L 5EUOF 1XF5A 3ARTA 2QQKL 4XPAL 5C0RH 5DI8A 1KCRL 4Y5VB 1H0DA 4E9XA 1KIQB 4HF5H 1FCGA 1RCYA 2DWDB 2GBAA 2YPLD 4PGZA 4RDQF 1OSYA 2HRHA 1FL5A 5BO1L 2ICEC 1M9WA 3NEXA 4YR6B 1DLHA 1I3GL 1UXSA 1AHWC 3BP5B 3O3AB 3U6XS 2CJSA 3CK0H 1COBA 2G3NA 3B9KA 3RDTD 5LCVH 3UJTH 4KQ4H 2PWGA 2DDQH 2ZPKH 2B59B 3O0RL 5T1KA 2Q5BA 2E6PA 4H7VA 5DJZA 2J1WA 4XOCA 5MENE 1TVDA 3QJFB 1OB0A 3N55A 1N59B 4DETA 1IAKA 1BJ8A 1FNHA 1KNOA 1PYWB 3TONA 1NEPA 1RZIB 4RMTA 4KRNA 1I1FB 2CKBA 3RWJB 3T4YB 4ODTL 3O3BB 3NZ8A 2DLEA 5LQBL 2EXYC 1OE3A 3K5RA 2H6PA 5KJRL 2FUQA 2WXPA 3CXDH 4PJFB 5HGBA 3K2IA 1L7TH 4NQDA 1E6JH 1QPPA 1MCNA 2BWIA 3BSGA 1OLZA 1KT2A 1TJIL 3GBMH 3F58L 3GPEA 3QE5A 3QHTC 4OGYH 1FG2A 4OD1L 5IWLA 4K5OA 4HS6A 5ICYB 2BFVL 1G7PA 1NUDA 4KU1A 3VRLE 5KN5A 3D2UA 4W9HC 1KCBA 4LPYA 4XN5A 2H9GA 4YBHA 1JVKA 4P4RB 5D9SB 5AVUB 5BZDB 4JKWA 3ULUC 2Y5TB 3CFNA 3E6FB 5AUMB 1BLNB 1AGBA 2LU4A 5TQ2H 4OFVA 3VXPA 1A7OH 1DSWA 1E8YA 2ITDB 1RPKA 4K7PY 2J71A 3HFML 2BNUA 1MLBA 3A22A 4LLYB 4PJIE 3WAKA 3QORA 2W9EL 4M00A 3PWNB 3VXRB 2BVUA 4FTDA 1ZEAH 3FW6A 3VRLF 3VRIB 5HHME 3K6SA 3NIGE 2V2TB 3BYYA 3UMNA 1L9PA 2XBTA 5JA9A 3IDIA 2VDLL 3TBBA 3NRPA 3HNSH 4I77L 2NY0B 3FQRA 5HDRA 5FUOH 1MCFA 4AEFA 4HWEH 1I8MA 4GFTB 3L3KB 2M8XA 3HG5A 2W0PA 4JFEB 4EXKA 3KPQB 1DQTA 3IMWA 3NSYA 1IIIA 3CG8A 4P2OB 1JGEB 4ZSOA 3W11D 4P46D 3QS3A 4TULL 5I8OH 3BUYA 3B2UC 4X0KB 3BH9A 2ZSWA 3D0VB 1YUHB 2H26B 2YA1A 3C6EA 4F9LC 2VDRB 2CUAA 3WY2A 5FECB 3QNXA 1OY3B 1T3FA 1MRFL 2NXZC 2WLLA 1JZ5A 3SKJH 1PAMA 5JHDB 5L4JA 4ZYKB 1SEBB 3FUFA 5F7NC 5CEZH 4ZW6A 2FQDA 3BRGC 3OR6B 4ONFL 3THMH 1USQA 1IRAY 5CILH 1Y1DA 3BT0A 5B38B 4M6AA 4GIOA 2VLJB 3RWHA 4GMTH 3SOBH 5FLUA 2AGJH 2NY5H 1ADQA 2KDGA 5DK2A 4HOMA 3BKJH 1MHCB 4P23B 5DMKB 4RSYA 3I6GA 1DJYA 4Q89A 4TMPA 5LWYL 1EAPB 4CBPA 3W5NA 2ROYA 3P30H 2QGEA 4WFGD 3T71A 1RJLA 1JWMA 1ZVNA 1LK2A 1T21A 5JO5A 5HHVL 3RBSA 2H2SD 3MV7A 3P73A 3KPNA 1F00I 4JMXA 2R0ZH 1ZWIB 2B8OT 3EYSL 2XWBA 1NCWH 5I76A 4RGND 3PG2A 3S88H 5DFVD 5JQHC 1ZV2A 3P3UA 3PAYA 1UT1A 4NO0D 2CCVA 5TK4A 3FFCA 1QSEE 1MNUL 5L88H 2XQYA 2ZUUA 3GGWB 3VXSD 1EXUA 1AR1B 2P8PA 2WO4A 2WXNA 1H6TA 4J27A 1IM3B 1HKLL 5DWUH 1CYGA 4IW4C 3A67L 3MR9B 1MNNA 1CVRA 2ZAIA 4I0PD 5GS3A 2QHRL 4AEEA 1L0YA 3UZEC 1WGVA 3GTVA 1DDHB 1P4BL 5F9DC 4O58L 1PZ2A 3RL2B 2OMTB 2N1KA 2V8LA 1LMKA 5I1HL 2QSQA 5MEQB 4LEEA 1OAZL 2Z8RA 2PTVA 3DVNB 2NPLX 1VFOA 3BFOA 4JFFB 4Y8DC 4IS6A 1FYTA 1WVZA 3OB0K 5DURB 1OE1A 3DX4A 1KB3A 3CTTA 5D1QC 2F54D 5I8EA 1YNTF 5CD3B 4K8RC 1DJHA 5CM1A 3AWFA 3MUGA 5FHBH 4X80H 3QO0B 2CBQA 3SGJC 4G9FA 1RMFH 4JFHE 4PHXA 4DKEH 2OK0L 1MCLA 3M17A 3GIZL 3DSNA 4OFIA 5IQLA 4LEOA 1JZFA 3KYKL 2OYPA 5D1XE 4YHOL 5GZNA 2AEQL 2ZXWB 2D7QA 4JRWA 3IEAA 1OF2A 3VXMD 4QY8A 4ZD3L 3MV8D 2QKIB 2A6DA 1DQIA 4WKXA 2GJPA 2WJ5A 4XCCL 3TFKD 4MAZA 4P04A 2F19L 2H3NB 2QR0B 1MI5B 2ZKHH 3JTBA 1ONQA 2WM0A 3LB6D 2J5LC 4J3BA 3IAPA 1KUMA 4HUXB 2VDPB 4K94H 4KDVA 1V7MH 3UFIA 1J9RA 3TJHD 5D8JH 3FOLA 4R4ND 4XMUA 5ECJE 2NUTA 4U4IA 4EVNA 5GGRY 4XC3L 3T65B 4TSCH 3O2VL 4MMXA 3INUL 1E5UI 4WU7A 4Z7WE 3P40A 4YSEA 1GXEA 3QIUB 3SBWC 2AJXL 2F53A 3E6HA 1JFQH 4BINA 2Z1PA 3D39D 4UDUB 2H2PD 3ILQC 4JDEB 3WEOA 3CBJB 1BMWA 3GMOB 3BWUF 3BAJA 2I07A 3DTDA 4HIJB 5D70H 3UAJC 5I30H 4OGZA 4U0RB 4G6AC 4R7DB 1RY7B 5DWPA 3B2MA 4HQQL 4LCUA 3UACA 4NZTL 5AYUH 3ULVL 4HC1L 2GJ6E 2ZTBA 2P3YA 3CVDA 2JKNA 1A5FH 1NA8A 3HW7A 1U3ZA 4WEUD 5L4IA 4AT6A 1FL6B 1R5WA 2P48B 1A1MB 3CSGA 4PJ9C 1U2HA 2XWTB 4UOJA 4CW1A 5JR1H 4PJCE 1QWUA 1OCRB 1UKSA 5DEFB 3H85A 3ETBJ 5KTEH 1P5UB 4G42B 4M29A 2N56A 2ICWJ 4JGNA 3D05A 3DX8B 3QEUA 2VR8A 4FQIH 2DQFB 3KLLA 2W0FB 1X3DA 1TSHA 4GSRA 5BV7C 1G0DA 1VA9A 3S36H 2UX6A 4QLWA 3JXAA 5KBKA 4N9GA 4QJ4B 1Z5LB 3L3GB 3LPOA 1ZVYA 5EU3B 3EDKA 4IU2A 4EO5A 4QTFA 1RZ8A 1X9LA 2V7NA 3VDBA 4JY5L 2FIRT 4MCMA 2ENJA 4B96A 3G5ZA 4H13C 1G6RH 1PQZB 1AI1H 2YXFA 1U8KA 5IHHA 2FK9A 3ZJAA 1P53A 3DROB 1EZVY 4OGXL 5CEXB 2NQ3A 4M7ZB 4MWFB 1WT5C 3DX2A 1LP9F 2XWZA 1TQCC 3DK0A 1YEHH 3OHXC 2BO0A 1BIIA 3NQKA 1AANA 1QABA 3KH4A 5C0JA 4HXAL 4F33A 3TBTB 2WLMA 4OCYH 2YEZA 2GBUA 4NPJA 3ZR6A 4UINH 4LQFH 1D6EA 3L3OC 2KPWA 4Y5XC 4AL8L 2SODB 2G30A 3OZLA 4GBXB 1FFPA 2BINA 1MIML 2DQMA 2NQCA 35C8L 3FTGA 4FNRA 4NCC1 3W3BA 3KPOB 1G7JB 1DEEB 3CU1A 4N86A 3ZKND 4W1TA 5A3IC 5ILTL 1AGDA 2VISA 5J6SA 3UCRA 5INCB 3E2HB 5LGKA 5DHEA 1FRGL 2EXWC 1KWKA 4OCLC 3UTSA 4QYOB 3BUDA 4XMKL 4MAUL 3HUJA 4OZFG 4K3EH 5DR5H 3ECQA 1OVZA 2W8CA 3EXJA 5CU9A 3O41A 4GRLC 1GOHA 2JJWA 3U4KA 4UU9A 1EO8L 4X7FC 4H8UA 4JRYE 5DEJA 3V5HB 5J3HD 2YXVA 4OCXH 4N0YH 3RGVD 2JSFA 4HAFA 4HH8A 4E2OA 1AKJA 1J86A 4JO1H 3P77A 2Y06L 3Q05A 3LV3B 4L3EE 4FQCH 4OLYL 1DQJA 3CDGB 4JM2C 1M1XB 1TYRA 2RH0A 3MO1A 2X05A 4TUUA 3TBSA 3U82B 1AQKL 2GC7C 4JN2B 1UFGA 4Y9FA 5HHMB 3H3PL 3NIGB 1SUJA 5JXAL 1UM4L 5FO9B 1ZK5A 4X7CC 3TV3H 1E9PA 2H3XC 3VXOB 2CR0A 4AYID 2J8UA 5FA4B 4HWUA 3ZSSA 1IC5L 1OPOA 4Y1AA 3WFHB 5IIEA 3R7QA 2GI0A 5F7WC 4ZW3A 5BOZG 3CHOA 3JWNE 4WUUD 1NGYB 4NKMB 5E7BA 2Y1ZA 3N9GH 5FYKD 4BCXA 2EKJA 2DV6A 4KRLB 4Z78B 1B0RA 4YHIA 3LKOB 3DI2B 3VXUA 5KANG 3E0GA 43C9B 1WZ1L 4HZAA 2YPLB 4LRNL 4LPXA 4PJ7F 1CF1A 3ELAT 3KXFA 3NFSL 5IQMA 2E75C 1M53A 1CGSH 2X87A 2OSXA 3UZQA 1OB1A 1KGUA 3SDXA 3MJ8A 3BZ5A 3RDTB 2EEBA 2VMCA 2A2QT 2BVQB 4BQ6A 1XH0A 3E7JA 1F1AA 2M26A 2ZJSH 4H40A 3ZR5A 3SE4A 3WMSA 2BY2A 1ZHBA 2J73A 4JE0A 1EUTA 4JY6B 1HYSD 1AZZC 1DQQA 2WXLA 5JPMA 2Q7YA 3QUGA 4MD0B 3BVXA 4WI4A 5GISH 5GRVL 3F7VA 4HFUL 2MEJB 2IWFA 4L8BB 4EJ1C 3D4GA 3RURA 4NP4H 2EEAA 4LASL 3DO7A 2JCCE 1Z9OA 2WZAA 2WXOA 3RLSA 4Z5RB 2R7EA 2A6IB 3CDFA 1VFBB 4F7EA 2DIEA 2WK2A 1F1DA 4DKTA 3C9NA 5ITBH 1XX9C 3BPCB 1IZKA 3CN4A 3TGXA 2VRAA 4UM8A 3ZO9A 4YAQB 4ICWA 5AW8B 1KDIA 3IWUA 4HJJH 1ETZB 1KTBA 2PWEA 1QOKA 1BG1A 5F9OH 6PCYA 3S5LA 3SCMB 1QUPA 4YNYA 2Z0UA 2XWCA 1BBDH 1E3XA 1PKQE 3T0EE 1FL3A 2IWEA 3RFRA 4RWYH 7PCYA 1BXUA 1G7LB 3BPOC 2GK0A 3IDXL 1X5LA 4I4WB 1VZIA 4BBWA 4CDHA 3IDGA 1YNTB 2V8MA 4JM0A 3ABZA 2GTWA 4ZRGA 5IM7A 4X6DE 1NCOA 5I1DA 1CU4H 1UWGH 3MUY1 3HEIB 1KEGL 3REVA 2VXQL 1NBYA 1LWHA 2YR3A 5L4MA 3L3IB 1J5OH 2CO4A 3VWJA 1UEYA 1B3IA 3IFOB 4HC1A 4MA7L 5LAXB 3LKPB 2CUHA 2HZHA 3FT0A 5LBSL 3NFPA 3DBXA 4NPYA 4UTBH 4WSKA 2XX1A 5E51A 5BVJA 2EKSA 4MX7A 1BAGA 4QRPA 2R0LH 1A7BA 5E6SB 1UJ3C 5JYLA 3NCEB 2WUCL 5FS5A 2NZIA 1IAIM 6FABH 1VGEH 1T22B 1RK7A 3B4NA 4OFKA 5FB8A 5JOPE 4DH2A 1E6JL 1RURL 4PG9A 4OGYL 4BHUI 5JXEC 1MQ8A 2N0KA 5FKPA 2PP7A 3B56A 3GIVA 4QRSA 3VFWB 3ZOAA 4BH7B 2WN3A 2P52A 2HVJB 3OLIA 3D6GA 5IMMB 3GSNB 5KVEE 1Y7VA 3L4WA 5I9QC 2Y7QA 4QRUB 3RTQB 2MHAA 3OKEA 4YSQA 3VFVB 5KZCD 1AIZA 1HH9A 2CBPA 5DLLA 2WN2A 3AAZB 1H9VA 1S5HA 5EOCH 3DURB 4GQQA 4ZDHB 3L13A 4RNRA 1DBJL 4F7TB 5IUCA 1O5DT 3LQAC 5B1BB 4NZDA 1B4TA 1B0IA 4EDXA 5IW6B 4KOBA 1U9KA 5IFAL 3EZ8A 4Q97A 3BCDA 4XCEA 5FO8A 3K8LA 1M6OA 4U6TA 5DXWA 3DX1A 2XOTA 4OZIE 4LBEB 4AV5A 5EEUA 5FUOL 2B5IB 3HG1D 3HLAA 5T1MA 2ETWA 3L5XH 4KC3B 2GJ6B 2YRLA 4BFOA 4RGNB 2D3JA 4NO0B 4PHZA 2KZBA 3ZK0A 4BH8B 2J5WA 4HWZB 1S7SA 5SX4H 2IIJA 4XMPL 4LSVH 4YLCA 1CLZL 1DJXA 1JHLH 5F72S 3TCTA 3T77A 2IXQA 1H3PH 4PJCB 1EAOA 4YGAB 2J56A 5HVHB 5B1CA 3VFOA 5I2IB 1RIUL 1ECZA 2G60H 5TE4L 2ZUWA 4YDMA 3UADA 4YJZL 3BKYH 5D96B 2YD4A 2ZWSA 5ID1B 4P8QA 1LP9B 4PV9B 1JTPA 5C0NC 3ES6B 3Q7JA 3FPXA 3NCJH 5F96L 1IM9A 1V27A 3MOQA 4ORGA 3KW7A 3VFPB 1JPGA 3U25A 2YFOA 3VMNA 3BWAA 5SWZE 1T2QH 1MELA 3X11B 4R0LB 3X1FA 1U91B 1LXMA 1OTUD 5A2IH 2EYTA 2F54B 5IFHH 4Y4FC 5E5MB 1VADB 1MXGA 4YQXL 3O6ML 2UXVA 4WWNA 3T0VA 1HZHL 3KYOA 5DC4B 4Y4KD 1KGWA 2NY5L 3L9EA 4YSOA 5E4EB 5F7AA 5KW9H 4IRSC 2K6ZA 2CLRB 4D8PA 1YMME 4NKOB 3VSUA 2D73A 1YN6B 4M7JH 3B9DA 5EC2B 3VU2A 4FEMA 5DVPA 3BLPX 4NQSB 3VXTA 2OR8A 3PGCB 4NZRL 5D6CA 3ECWA 4LSPH 5KYYA 4L4TA 2E86A 5TDPB 1E3FA 3I74A 2IDQA 2ODHA 3T4AB 5JPNA 1FP5A 1NCWL 2AJSH 2HTLD 3RVWD 1HKFA 4UNIA 1HZLA 2OMXB 5F93C 5CLXA 3TZVD 5L88L 3CFEB 4I2XA 4BGDA 2EADA 5TQ0H 3VFGH 2VLKE 3TH2T 3WLWC 4OD2A 2KI6A 4OY9A 5H37H 1OSEA 4B50A 4BE6A 1ET7A 1A6PA 4GEIA 3PWUB 1KJ2A 4KDWA 4G83A 2ZXAA 2N0MA 1XB8A 1UWEL 1K3ZA 2VL5A 1X9QA 4AYFB 1HCVA 2RMNA 2RACA 3KWUA 1GYVA 3WHE1 4B9ZA 1CL7I 4XHQA 4LRIA 4EQ3A 4Z0XB 1N0XH 4IBSA 1MCPH 3A3YB 3DV6A 3NPSC 4L3EB 3SKNB 2VR4A 1MJ7H 1QACA 1CDYA 5FHAH 1A2YB 2D0GA 2X9YA 4PJ7B 3PP3K 1L5GB 4KI5D 5I75B 3CN0A 4F7MA 1OWWA 4DQAA 5ISZD 1LE5A 4OT1H 5B8CC 2RJMA 3CZUB 2ZZUT 3SBPA 1OCCB 3VAEA 3CFQA 3VFSA 4F5CA 4X5LA 3DTUB 2PYFA 2Y07H 3H6JA 3CAFA 2Z34A 4OZHF 4FC3E 4DEWA 3AW5A 2D7PA 4PJGA 4X0NA 1L3WA 3C6LB 3UO8B 3HB3D 1JGUL 2RIKA 4PJHF 2XV6B 4DKDC 3G6JE 1W72L 3CC5A 4WSGA 2WBJA 4S1RL 4YPGA 2VXQA 5ESQA 4X8XA 2IWKA 5MERB 4HIQA 4PJ5A 1LK3H 2WQXA 4K94L 4U6YB 1R5VA 3F83A 1EHLL 1K4CA 2OJZL 4MTMA 4AM0A 2NY6D 4XMVA 3MLPA 5LBSA 2OMYB 3O6KH 3GHEL 5J1AA 2Q0ZX 1O7DE 3IDYC 3QDJD 4WU5B 2J72A 3P9MB 1MRCL 1ZANL 4E0RB 2X4OB 4PCKA 4MNQD 5IQNA 3VM7A 2HFFB 2NT1A 4PG2C 4DGUA 3U6RB 3QRBA 4EN2A 5BVPH 4U1HB 3WELA 3U2JA 1GGCL 5EWIH 4DP9X 2ADFH 4WTXA 1Q38A 2H8PB 2JCCB 5I30L 2QHLA 4LNVA 3NCYP 2WMPB 4DPCX 3OKOA 1LDSA 1IL1A 2O5ZL 3GB7A 3UGXA 2OZNA 4MGXA 4CADA 4MJ5A 3SY0A 1OAQL 5AYUL 4UQAA 5HYQA 3LH2L 2WLZA 4KVPA 3CLFH 3MRRB 4HGWA 3UL4A 1IGJB 1FNGA 2A1WH 2HJFA 2NCMA 1DQDH 3KCPB 4IJTA 4ZOCA 5DRZB 1FFOA 2EXSA 5D4JA 5C09D 4MJHA 2FD6L 1S7RB 4PMEA 4CMHB 1WFJA 3L08A 1YEEH 1U95B 4EN3A 5ESAB 2UY7A 1KCSH 1PKQB 1RUPL 2VM4A 3T0EB 1XB6A 1QI5A 3R4RA 4JJOA 3GTNA 5DZJA 2ZG2A 4CVXA 2NY1C 1E4KC 4URKA 1MCOL 4XZ4A 1P7KB 5E9AA 1FNLA 1LO3H 2AQPA 3L1GA 4F7PA 2X42A 3RGVB 1ZT7A 3FT3A 5I66B 3CVHB 4JPWL 2AJUL 2FJGB 5EOTB 3CFJB 2A77H 5DDHB 2Z92A 3NZHH 4M5ZH 1A3RL 3I6KA 1P4IL 3UTQA 3GK8H 3QXTA 5IVXF 4ZW8A 2OW7A 1TZHB 3IS1X 5BRZA 3TOPA 3ORJA 3CLWA 3UZVA 1E8XA 2DLFH 2NYYC 5T1JA 1SBSH 1T7XA 3BSZL 3W39B 1XMWA 3KBFA 4G8IA 5JQ6H 2BNRA 4AXWB 1HHIA 1BXXA 2PO6D 2PTTB 3UOAB 3MJ7B 1RUAL 3QRLA 4PAZA 4P23C 4MDJA 1OXYA 1UJTA 1WC7B 5DHVH 4N1HB 4WUUB 5DFWH 3HZYA 1I9EA 3O9WA 4Z3EA 4LAQL 3T0XA 3BVTA 5EF0A 4L8CA 1JGVH 1HHKA 3OX8A 2XPGB 2XY2A 3BQUD 2F7OA 3QUZA 4E68A 4HT1H 3OQRA 4PRIB 3HZVB 1LNUB 3QWRD 2X1XR 4LCYB 1AQDA 3HTLX 4GAYA 4ZPVB 5E8DL 4UOQA 5JIIA 2A73B 4NKDB 1AO7A 3OF6A 4NN7B 2RCSL 1KXTB 3MLSH 2CA3A 1NBCA 3TIDA 1GPOH 1IGTB 4QRTA 2VWEE 3L7FA 2R56H 3LKQB 4K3EL 1O9WA 4QCIA 1ZAGA 1IQDB 1BFOB 4DEPB 1F4WH 2FO4A 2AQ3A 4ATWA 4YGVB 5CEYB 5CZRA 2QTEA 5SWSA 4N0YL 3ZW3A 4JO1L 2ICES 1CFMA 3WXWH 1J9SA 4L23A 4BA8A 4EKXA 2R4SH 1ZIBA 1F4XH 1I1AC 4JGMA 2J3SA 4GUCA 4MJ6B 2HKHL 2E27H 2NY4D 4XN4A 3DOSA 1AC6A 1KYUA 4OZIB 4AUYA 4KTDH 3MRJA 1JDDA 5HDWA 3SQOH 1T0MA 1KBWA 3BKCH 1UD8A 2VR9A 1XD0A 3GSWA 5AALA 3U36A 4JG9A 5DYOB 1X4YA 4FD0A 2CLZB 3ZYOA 2YPVH 3P11H 3RWGA 5C6PB 1YQVH 4CMMA 3H9YA 1XBRA 2PW1A 1TLMA 4CJ0A 1KTLA 3MV9E 1IEHA 1PZAA 4GLRH 3DETD 2QKIC 3VWKD 1GC1H 1KXVC 2Z1KA 2B77A 4X4ME 1HX0A 4PLKC 1GJUA 4HK0B 1INEL 2EO9A 3K72A 3F3HA 3GC3A 1TPXB 4AH2A 2ZJSL 5CKAA 1UVQB 2X1PA 4BKTC 4C47A 1U58B 5SWZB 2WZPA 3HLKA 4HS8L 2UUDH 4K07A 2AQSA 3UTTA 2XXCB 2Y6SC 3FO0H 3MU3A 4PRPE 4HSQA 5GISL 1PG7L 1XSOA 1TDQA 3FO1B 4HK3J 4LVOB 4PMFA 5DMGD 5HD8D 5I1LB 3GSQB 1TYEB 2ESVA 4L3FA 1ORSA 2BSTB 2E9IA 3SD5A 4NP4L 4ZJ9A 3ARXA 4XHJC 2PCPB 1JK9A 1ULVA 2GSGB 4TVPE 3STZA 1LD9B 1QO3B 5JOFA 5J11B 3K6FA 3SQBA 1DVFC 1YMMB 4RMRA 4TYUA 3ZXAC 2Z6FA 4WNJA 3H54A 4U0RC 3UBXA 3CZSA 4AWJC 1BQRA 1YLBB 2MIZA 3L4TA 5I23A 2VLRA 4FXKA 4JVPA 1BD2E 1UH4A 2ZF8A 3JSSA 4ICXA 3C5JA 4LBAA 3ESMA 1FSKC 3EHBD 3JVGA 5BS0A 2MPAL 2WXGA 2X70A 5F9OL 3EUUA 1W72A 1FFRA 4ZMNA 1TZIB 2BY3A 3MNWB 4MMZC 5I18H 3ZGHA 1BBDL 2RD0A 2HX7A 1UH3A 1M2VB 1SJXA 2I5YH 3ARYA 3OGOE 1TJGL 2CBTA 1ILSA 4NO3B 1P6WA 4F3FA 3OAWA 3RFZA 3F64A 5FF6A 5B39G 1AZNA 4FYRA 3EOBA 1F3DJ 3Q9QA 5C0CE 2VLKB 1KJ3L 1IT9H 3MDJA 4AEHH 2E74C 2LT9A 3OMAB 3V0HA 4Z7VE 5DUML 5FK9B 1GIGL 3QXDA 4HU8A 1EJ6A 5CINH 5AW9B 2FJHB 2EDFA 3IPFA 2J44A 1CFQB 2BZ7A 3B9KD 3L6FB 5F71A 3SGKA 1J5OL 3KPRE 2I9LA 1MCHA 4DP1X 4L2YA 4OZHB 3STBA 4ISVA 4LSSL 4PV8B 1FHGA 4AW7A 3AQZA 5IOKA 3NN8A 5IT2L 4PJHB 4F8OA 1VFAA 2Q10A 1F42A 1RP8A 2P1YA 1THCA 2R0LL 3LRMA 1GOGA 4H26B 4I0KA 5PAZA 3RVVD 4QRRA 1N5YL 3ZTEA 2OZ4L 3QR1A 1N10A 3AADB 4YHPA 5D7LE 1NPUA 3F62A 5KS9A 1NGXA 4ADJA 1BZ9B 5I15L 5AD0B 4NYLA 2IAMB 4G7YH 5EOQH 2A4CA 5E0FA 2FB4L 1A3LL 2GUOB 4G43A 5ALBH 3ZKXC 4NQDD 4U2ZA 1N18A 2V3EA 4FG6C 2YQ3A 1QTSA 4N8CH 2H1PH 1S9XB 3FT2A 1QEWA 2WQUA 2Z35A 3AG1B 5FO7A 3V0WL 2Z4QB 2NY2D 4MNGE 4JHWL 5F0JB 2JMRA 1HSBA 4BDVB 4N3UA 4NC1E 4YE4L 3RWDA 1TZAA 1ZSDA 4Z7UF 2P7TB 5IJCC 2A6KB 4D9QD 3HBPA 2A74B 1QRKA 4DUVA 3BSZA 5DO8A 3P3YA 2BERA 5E94A 1MHHA 1KYFA 3U7YL 3HAEH 1F4HA 4Y4KB 2P8MB 5EV7A 2ICEA 4UYPA 5EOCL 1NCJA 1SVZA 2DQCH 2WLIB 1K8DB 4GSDH 1AHWA 3QORD 4PB9H 2ATPA 1O6SB 3HC2A 4GQ9H 4GFXA 4AZ8B 3KJ6L 2UV3A 2BP8B 3O4LE 4G8GE 4AQ8A 2JKLA 4XBMA 2EIZB 3DWTA 4NS0A 4PGDB 2KZKA 2J4WL 1JZ6A 1BWMA 3FTXA 3FTVA 3QCUL 2X5PA 4ONGH 1F6FB 5J1TC 2IPKA 2ZX7A 4Y5YA 2OYLA 5L9DL 3DUSB 5CP3A 3S36X 4ATTA 1FVDB 1QLEL 3TZVB 3GSRB 5DRXA 4HCGA 5D2NC 1JHLL 1AY1L 1XCTB 3KHOA 2DH3A 3QJQB 4I7ZC 3RVUC 5BOJA 4X6EA 5EF2A 5IVXB 1BW8A 1A4JB 4M3KB 4NENA 1DQLL 4X7TB 1EGJH 5D1ZB 2GAZB 3AMLA 2Z91A 2O61B 3GLZA 2LOEA 1TTBA 3BISA 5HPMB 1QHPA 3DO4A 5IVZB 1KPVA 1NAMH 1TR7A 1BOYA 1X5IA 2MQ0A 4BUGA 4NI3A 5EZOH 3Q43A 2CGZA 4G6FB 4U1LB 3MYJB 4XBPB 3EO0A 2GJRA 3I50H 3QAQA 2GI7A 3NSJA 3BC9A 3ZE0E 4JO2H 1KMGA 1BLIA 3M6DA 4QTHB 2Y2YA 2XT1B 4P59H 2PCYA 1UT9A 3WY1A 3TA3D 2XVKA 4JQIA 1H15A 5KW9L 2H32H 3SJVE 1N3NB 2MJWA 3KZ8A 4QHKI 1E28B 4DKAA 4JK0D 4HLZG 1BQHA 4OIFA 4N2KA 1UACL 2YLKA 1KEMH 3EH5B 2NY7H 3N50A 3QEGH 3U9UB 1PBYA 3BHBB 4ANKA 1A64A 1MWOA 1BEYH 5HHQA 2MCG1 1U4EA 2WBKA 2HP4A 1ESOA 3MV7D 5DEGA 2G4GA 1E8WA 4P5MA 3FC8A 4PVLA 1GZQA 2YBGA 4LPVA 4XAWH 4YDZA 1UWFA 4LDEB 3ZL2A 2XZQH 1VAHA 4N24A 2DTMH 4TL5A 1NGWB 1NSNH 2VDMH 1L4IA 2YGPA 5IQ7L 3DOHA 4EZJA 4R5VA 3BP6B 3ZRCC 3VGBA 3VQMA 3L9YA 1VFUA 3D3VA 3JWDC 1J1XL 4OD3L 1RUML 2RTTA 1DUZB 4X7DC 4DESA 3QDJB 1Q94B 4FFZH 3V6BR 5LGJB 4NDMB 5E2TH 2D4FA 3BCFA 4MNQB 5CJBA 1HNGA 3V4PH 5CCHE 3M07A 3N44B 2BY1A 3B2VH 3QG6A 5KSAA 2G2NA 5SX5K 3MXWH 5E23A 1WG3A 5A2KH 4H8VA 1JCVA 3JTSA 1WJ3A 1E5BA 2O30A 4XBGA 1R3KB 2CRMA 4AENA 4POZD 2J88H 4U1JA 1MCPL 3VD3A 4XNYH 1FYTD 1NICA 2F2HA 4L05A 4NO5B 3QDGA 5ECGA 1OTSD 3PJLA 5EBMB 5CSGA 5GRUH 4AK1A 2I26N 5HGDB 4C83A 4JHAL 4ENZA 1ZA3A 5TH2B 3GLDA 1IX2A 3W11C 5L4FA 2K70A 4P46C 1OGPA 3VM5A 1S9WA 3GMLA 4YDNA 5I8CB 5JLZA 3EOAA 1USZA 2ZOOA 3US1A 2P5PA 4E36A 4ZMXA 5EIIG 4DGWC 5GZND 2AXFB 1SYSA 1IEBA 3IBEA 4HIHB 1WBXA 4M8RA 4P2QA 3MV9B 2ERJB 5LNEA 2MPVA 4KVNH 2OJEB 2W9LA 1BJ1H 4L1TA 3MRKA 4BM7A 3CWGA 3QHZL 4M5SA 4GXUN 1O7SA 1R1CA 1XAUA 3BWUC 1LK3L 3L7EA 1NWOA 4TUKL 5H2BA 3ZU8A 4HEME 4A2MA 1M05B 4WW2B 1JF6A 1L6PA 2F08A 3T8XA 4YLQT 3ZGIA 2AQNA 4PJBE 4Y2DB 3N85L 4ZQTA 5T3XL 2VDKL 2PO6B 1ZDQA 1FVEA 1I1CA 2F5BL 4O4YH 5FEBA 4I3RL 1OWRM 2ZKWA 3DNKA 4LHUB 1L9QA 4WLCA 1FH2A 3MRQA 1JTOA 1I8KA 2OZ4A 1ZS2A 2OP4H 5I6OA 2ADFL 4XR8C 3F12A 3M46A 4JQVC 4OV5A 2GB2A 1JWUB 4YLBA 2KBGA 2OI9B 2Z4TA 5FYLH 2H2SC 5I1GH 4X9HA 3KPSD 3WFEL 4P57B 1BD2B 1R5IB 2ZCLH 1X9RA 2CIIB 2VOTA 3FFCE 2BIHA 1E6OL 1LWJA 5GS0H 3QDHA 4RGNC 1RI8A 2Q3ZA 1UD2A 2WQVA 4UIKH 1R3LB 1BQLH 2C7UA 3ASWA 3NIFF 2QFPA 1H3WM 3ARGC 4KKLD 1KN2H 3ZVVA 1YEEL 5E1AB 1KCSL 4IGBB 3VI3A 1TETL 3F7QA 3ML9A 3QRGH 4O02H 3QR0A 4I0PC 3UG4A 1A3QA 4R8WH 5CLYA 4HIXL 4Y8AA 5EU5B 1CBVH 4XN8A 3WJJC 3K4AA 4K71C 3TPUA 4Z7VB 1T1WB 5CGTA 5TE6H 1QSED 2J20A 2A77L 4U3SA 4M5ZL 2BSSA 1JNHA 5L8KB 1MAKA 1NFDA 2K4WA 3TCLB 3D4YA 4W9GC 1CLCA 1RVFL 1PFOA 1CI5A 2UZPA 1KLGA 5TD4A 1DO5A 2ZUQB 1SBSL 2E0PA 4DP4X 1J8HA 1XGTA 5D7SL 3KPRB 4ZPTA 4G9FE 1CO1A 1MJ8L 1D9KB 3WUWG 5GZOC 3DDGA 3JWOH 3CVBA 4PVMA 5EA0H 1OT2A 4DZBB 2CHWA 3PF2A 5DQJB 3BXNB 3K1DA 4XPHH 2A7BA 3OV6A 1I7RB 4NNYB 3KL0A 2OL3B 1HHGA 4WEMB 3UAJA 2IOIA 1ACZA 1NCHA 4ZS6D 1DVZA 4Z7UB 5D7LB 1FZJA 3EFOB 2CRYA 2XBZA 2D03L 1HL4A 1ZRUA 1LO4H 1JS4A 3MCKA 4KFZC 2ITCB 1T1XA 5JDJA 4HKJA 3TFKC 4FI7A 4W9EC 3AY4A 2N1TE 4X8CA 3VO0A 3AZUA 2R69L 2XQBH 4IRJA 2ADYA 4PJ9A 1FZOA 1T5KA 4GG6E 3OZ9H 3LB6C 2B3RA 1FNSL 1QYGH 1VDGA 3QUMB 3EYQC 3V0VA 2BIPA 4TVUA 3P4MA 2Q7NA 2YLHA 3LHPH 3TJHC 2FJFA 4O2EA 1WIPA 4NJ9L 4UV7L 4R4NC 1G9MC 4TLKA 1D2PA 2KT6A 3FOMA 3H1ZA 4IOSA 4BIKA 5AZEL 2IJ0C 4B97A 3VQ1C 3O11B 5I1CL 5KSVB 2VUOA 4RFNC 3WE6A 3KHQA 1DEDA 3TEYA 1RZPA 3IXAA 4PJEA 4QMEA 5I0YA 5IK3A 2H2PC 2G2RB 4BRJA 4EEEA 4F8NA 5FO2A 3U4EB 1AKJD 4JY4A 4UMSA 4M61B 2X2IA 2CHNA 3EOYG 5GGSA 4JFXB 1PX3A 2R83A 3IDJA 1XGUB 1XIWD 3MRGA 4WCYL 2R4SL 3HZKB 4OTXH 1CMOA 1F4XL 4G8GB 3FH8A 1ASQA 1FAKT 1ECYA 4P4KC 1IGFL 4WSJA 1WT5A 4K3JL 2OS7A 4KTDL 4XNQA 1JZ4A 1CI3M 3OHXA 4GAGH 5I75C 2X3AA 2KZ1B 1RERA 1AQ8A 5I0XA 3IFLH 1AGEA 1WUZA 1IBYA 3DYMA 3COOA 3PHOA 1YQVL 2C1PB 2JKTM 4XCNB 5DMIH 5AOMA 2EVIA 4KK8D 1XF5B 4RLDA 3PDDA 4LVEA 4ZMPA 1MIEH 1HL8A 1N64L 5EO9A 1Z9SA 3WL9A 5DI8B 2ZYHA 5G4NA 1H0DB 5KG9B 4NNPL 2V3DA 1TCMA 1FL5B 4XO3A 5GS1C 3MJ9H 1DLHB 1AS7A 3Q6FA 1UXSB 3CSYA 1KB5H 2WTOA 5IBUG 2QVIA 3B9KB 4MD5A 4NQEE 4WY7L 5E8PA 4TNWK 1R3HA 1ID5I 1VEPA 5GRVK 2XFXA 2GITB 3WSQH 4GRLA 4NHCL 5T1KB 1LGVA 5EZJA 1PZ3A 1BBJA 1NGQH 4TQIA 5I19L 4MRCA 3BI9X 3FO0L 2TSAA 5FGBC 2F7RA 1CDIA 1IAKB 1UOWA 4RAUA 4UNUA 4X98B 3RU8L 5AVYB 4QT5A 1X5AA 3H0TA 4XMXA 2CKBB 3ZDZE 1G84A 1DQML 4H1LG 5ENWA 2ATAA 3V0EA 2MQ3A 1VCAA 1ZMYA 4JM2A 4JQXC 5KVGL 3GDBA 1UENA 1KBKA 2LAGB 3T6WA 2IANE 3AFLA 2WXIA 3TURA 3ARDA 3RWFA 1EA9C 2XWRA 5G5DA 3FCTA 5HGBB 1VGKA 3FAXA 4NQDB 1XEUA 1MJJA 4HFWA 2AF2A 1KT2B 1TNNA 1ZLVH 3ZKNC 2YRBA 4PGEA 1ZS8A 3N42F 5D71H 4HS6B 4DP8X 2AV1A 4WKZA 1G7PB 1PMYA 3GSXA 3SBRA 3ISRA 4ANWA 5KN5B 5GXBB 1OD9A 3BD3A 1C5BH 3D06A 3D2UB 2HH0H 3UTSE 5JHLL 2H9GB 3G5XA 4JFTA 4NHUA 2CHXA 1ZT4A 4W81A 3S5YA 1OP4A 4AQ1C 1QBAA 2C3VA 1AGBB 4Y16B 1I8AA 1MH5A 3BH8A 4YHZL 4KZEH 1IT9L 2FO1A 2BNUB 4NZFA 4DCQA 4DQOH 3IGLA 1MLBB 1OV8A 1YCSA 2R0KH 5IGXH 5J3HC 3OPZL 1JZJA 4FG4A 4V1DA 5EU7C 3QORB 4ANUA 1ZXKA 3QR2A 3VD9A 4L8SC 4JFSA 2XVGA 2HPOA 2WTRA 1P2CA 3IN2A 2YAOA 2XSKA 3AU0A 4NIYE 5FCUL 3K6SB 4NT6A 3HUJF 2QADB 1T7ZA 2FJSA 3AXHA 5DMYA 3IDIB 3NQIA 1F6AA 1H9DA 3QZOA 4YFLF 2Y72A 3FQRB 2J8UE 3ULVD 3KLQA 1I8MB 1K2DA 4Y1AE 2W1NA 4HJTA 1AZRA 1XCQA 3F6LA 4EOWH 2DYSB 4JRYD 4N5UA 4XP4H 1H3VA 2QVTA 1DTUA 1SEQH 4RFEA 3IU4H 1A6VL 2D3LA 3LIZL 4JFWA 3BUYB 1JZEA 2VM3A 2XV3A 1G6VK 3VXUE 5F97E 3GS0A 1Y6MR 5EOQL 1SM3L 3KXFE 3CNKA 1YECH 1CT8B 5DHYA 4JCMA 4MKMA 4MA1C 2J8UF 2DWYA 3QNXB 5DQ9B 1T3FB 1QBML 4WWKD 3VD1A 4BFNA 4XN7A 3SY6A 1Q72L 3QARA 2JLLA 2RBLA 1YRKA 2CA4A 3D25A 2OTWA 4CSZA 1AZUA 4D3CL 4FABH 3ZHFA 1HYSC 3ARBA 4LP5A 3S2CA 4NRYA 3KGTA 5IV2B 3QULA 3ZHKA 4NKQB 3RWHB 2QSCH 2OW6A 2QTVA 4IMKC 4PJBB 1NANH 3M8OL 5DK2B 4IOFD 3P1VA 2DQCL 4ODVH 3SDXF 4PB9L 3ARRA 2NRDA 3LAFA 3FF8A 4ABUA 1WH0A 3ME0A 4P9HL 1RJLB 1JWMB 1I7TA 5HDBF 1T21B 5JO5B 1OAXH 1YJDH 3SKMA 4E5XA 3GF8A 3TASA 1IQWL 1HILA 3P73B 3IAGC 3KPNB 4PRBA 1DVQA 2X6CA 4J3OH 4S1SL 3MX0A 3ZZQA 2R69A 1L9RA 2VZTA 5L2KA 2GABA 2XWBB 3K71A 1UJ3A 2WINA 5GJTL 2HT2D 3FFCB 1JK8A 4S0TD 1X7SA 2CM6A 2DKUA 1VKXA 5GGQL 4LPCA 3O2DH 1K3IA 4J3XA 2P8PB 2AABL 4U6XA 2DI7A 5I73B 3W2DL 4CGTA 2C4FT 2ARJB 4WGVB 4KV5E 2FEDD 5A40E 4OAWB 4YXLH 4Z95H 3T0WA 3ARSA 4TSBH 5JXEA 3KLAA 3PDOA 1A22B 4NBZB 2CKNA 4IHOA 5AWNL 4N2AA 3D7PA 1U93A 1G7MA 3OKLA 2D3NA 1WS7A 3Q5TA 1IM9D 1JPSH 4QXGH 5EZOL 2ZONA 3S8GB 2X09A 1FDLL 5GJSH 1KB9J 2N3JA 2LLGA 1KBPA 5TF0A 2CO6A 1L7IL 5I8EB 2JELH 1NL0L 4X5QA 5GGTH 4XZUA 4A1RA 1JV5A 4LLMA 4QRPE 5HI3D 2RFXB 5DTFA 2A9MH 4LVOC 2XVLA 3R18A 3SDAA 1YHPA 1QNZH 2VXSL 4G9FB 4P5TD 3W82A 4XNZC 3ULUH 4XC1L 1GY2A 3M17B 5IBTH 3DSNB 3QNYB 3NYKA 1JCKA 4LLQA 2NY7L 3TBWA 1FIEA 1EPFA 4OCNC 5KSBA 1MVUA 4J5VA 2PPCA 3ULVF 1YEIL 4N2HA 1BEYL 1OF2B 2HUEA 4QY8B 3MRMA 4QKTA 2A6DB 3HE7C 4AEIL 1KSRA 2AI0L 4TSAL 4YEEA 1ICTA 2P24A 4NN5B 1XQ4A 5PCYA 1N0LA 1RU9H 4XAWL 1XH1A 4Q2ZA 1JGIA 5T5FH 3FN3A 2ZF9A 5AW1B 4ZTPH 1TTFA 3GHBL 2ED8A 5IEHA 4GG6B 4NUJA 4WJG3 4NN6C 3BJLA 2NUTB 1SLWA 3N41F 1TTCA 1I9JL 3RNQA 2VERN 1TJMA 3REWA 1GTFA 3PAUA 5LGHL 4WU7B 2X4RA 5F1IB 4NWTL 4FFZL 4ZAKC 4YVUA 2F53B 1FE8H 1FO0H 1OP5H 3ETTA 2P8LB 1NMCB 1YEFH 1JL8A 1TTUA 1NLDH 3FYIB 5HGAA 1L9MA 2XA8H 2ISDA 5C0EA 3MXWL 3FQWA 2I07B 4KROD 2Z7YA 4PSPA 4XB7A 3V7AE 4H8WC 4PJAA 3ARED 4YHML 1ZLWK 2J88L 2JIXA 3G5VA 3HI6H 3G7TA 4KTGA 5C6TH 3SGEI 2XETA 4POYA 4LCUB 2WNWA 2JB6A 4FXGC 3QQ3A 4B27A 3S3PA 4AT6B 1JRHL 2R9HD 1NKOA 2Q8AH 4CW1B 5IMLB 3G6DH 4MA8L 3DECA 5JHLA 1HH6A 1BEXA 1CLOH 1U8IB 2BLFA 3PJSA 1JPTH 4GW5A 2E8ZA 3VUAA 1QR1A 4L48A 4OKVA 1NOLA 4FQ1H 2XIDA 3FB5A 1MCCA 5IJBC 1PIGA 1HT6A 1ES0B 3GMMA 3K6OA 4N9GB 3FS9A 3SHSA 2YWZA 2B2XH 2ZXQA 3ZHLA 5JDSA 1S8DA 2EIMB 1U8MB 3NAAH 4IU2B 2KLSA 1RZ8B 1R17A 2YQBA 3QXAA 4TL4A 1FZKB 3ATAA 4HCRL 1DCEA 4P5RA 2L7JA 2YRPA 2CK0H 4RMUA 4JB9H 3SYAA 2YS4A 3G5ZB 1NCBH 2VDLB 1Q9KB 5CJ8A 3V4VB 4MJ2A 6TAAA 3E3QE 1DVYA 2NDFA 2DJSA 2PYEA 3WN5B 2WO3B 1WAPA 2Y5QA 2X2UA 2H6OA 4Z7IA 4EI5D 3QZBA 1RH8A 5TDOB 4O4YL 3N42B 1URZA 1UYWH 4FJ6A 3U30C 1MCWM 1IE4A 4BZ2L 2RGSA 3LIZA 4HGKC 3ZL4L 4NSKA 5C0JB 4F33B 2JKRM 2I60H 3ZDZB 1KFGA 3DRTA 3S4SA 5C8JA 1D6EB 1N19A 1A6TA 4PJDE 3TEZA 4L4TE 3GDCA 3OAUH 3H9SA 3MNZA 5I1GL 4BWUA 3S35H 3S96B 1OEZW 5I1AA 1NAKH 4XPFH 4F58L 1SXZA 3ILPB 1T83C 1AGDB 1YY9D 4W9DC 2HTLC 3RVWC 5BO0D 1UM6L 1NIAA 1LQSR 4FDWA 2FEJA 4LLDA 3MCYA 3UTSB 1CXHA 4FQXA 4K8RH 4EN3D 1UKTA 5I0VA 2DQGL 1I7ZA 4HD9A 1SN5A 3QRGL 1MWAH 5FYJH 4GUOA 1MHPL 1CXKA 4FQ2H 1Z9PA 2MNUA 5HHNA 4JS7A 3O0LA 4KO5A 5DCCA 1B2WL 5IROD 2YC1A 3GT6A 3MGAA 5ESVA 1FFNA 3K8KA 1MW2A 3MV01 1AKJB 3POHA 3HBQA 3RX8A 5F3BA 3KGSA 2BNQE 3P77B 1VENA 5J12C 3P3RA 3TP4A 4A37A 4QNPE 1DQJB 1YDPA 2OA9A 4DGVL 2VXUH 3MO1B 3EKCA 3TBSB 1CDJA 4TNWF 4MB3A 1XCXA 3UTPD 1UXWA 2NY3D 3RWCB 1LO2L 1E9PB 4GJTB 2J8UB 1OGAA 4TVSa 2BNRD 4Y1AB 2Z93A 4AYSA 4PWEA 4KI5C 1PLAA 4OZGA 5FGCB 2BW4A 3B2DC 2R0WH 4HISA 3SO3C 2OSWA 2YPKA 5EO1A 4OBRA 1B0RB 1MCIA 2Z7UA 4MBRA 1RZKC 3BAWA 3GBEA 4RIRA 4XVJH 4XRCB 4YHIB 3VXUB 4P2YA 4N2MA 4PR5A 4MHHI 2Y69B 5I1KH 1PZ5B 1IKNC 3KXFB 1KCLA 3HB3C 2EDDA 2W94A 2W95A 2ZUYA 4G8FA 2P5WA 3UBGA 1ET8A 3T8MA 3JV5A 4PJ5E 4O2CA 2WNKA 1OB1B 4JPVH 3SDXB 3UZQB 5CEZD 3MJ8B 1QYGL 5CHNA 5DZLA 3B9VA 3GI9L 4OLUL 5HDBB 2OCJA 1KGCE 1ZHBB 3D52A 4M6MH 2NYZA 4J3VA 4MLSA 2NY6C 1DQQB 3D85A 5GGRA 1P9MA 1QRNA 2APXA 4ZFFA 1E4KA 4X42A 4NM4L 4HEPG 3ECBA 4KMLB 4NQQA 4PJGF 5LXGL 1YA5A 1HCFX 4Q9RL 2ZWNA 3IJEA 4DEUA 1QZ1A 1MCEA 3X13A 4Y19E 3DO7B 1PJ9A 3FQXA 4OLWH 2Z0BA 2IPTL 5SWSD 4AOFA 4M43L 3ZE2E 2PPEA 2R7EB 1XR9A 4R7VA 4GP8B 4F7EB 3TO4D 1E90A 3KYMB 1J9TA 3C9NB 4E41E 1X7QA 2HKFH 4UM8B 2QKSA 3TO2A 1ZLEA 3CDCA 3S5LB 2WY3B 4MCYA 4EUPH 4W4OC 1I4FA 3MV11 1AQHA 3IFLL 1OQXA 2FSEB 3HCVA 4HETA 1RIHH 2HRLA 1BG9A 3ESPA 2GK0B 3UJJL 4U1KB 1G1KA 3Q9PA 3U0WL 2G0KA 1EXHA 2W88A 5JW3H 4D0DA 5IM7B 2BSED 5ADPL 2ERJC 1NMBL 5MI0B 3GFUA 4QHPA 3REVB 4R90L 3WJMA 4R26L 4M93B 3DJ9A 4UUJA 2V2WB 3IT8D 1NBYB 5BRZE 4GSXA 4S1QH 1WBZA 3OAZK 5IOPA 2VZOA 4NZUL 2C3WA 2Y1AA 1T03H 3VWJB 5GRWA 3BGFC 5C0IA 4PIBA 3O6FA 5CJQH 4YDJA 4HJ1A 3UTTD 3EDDA 3DBXB 4NPYB 1CE6A 1MY5A 5BVJB 2EKSB 4JM4L 4L0PB 4MX7B 5LVEA 1KXQE 4OJCA 4XXDB 2C5DC 2DQ6A 4QRPB 5TJWK 2ESVD 5AW3B 3KW8A 4PVNA 3RRQA 2KZWA 1HQ4A 1A65A 1P5VA 4MS8D 1BMZA 3HMXH 2OSYA 2DH2A 2ZIDA 1I1AA 3BQUC 3MRFB 4IRZL 3AS2A 1FH5H 4NC0B 2VLRD 3FRPA 5FB8B 1XGYH 3HI5H 3MXVL 3H6AA 1DUYA 4PG9B 3N43B 3W0WE 1AO7E 1D3CA 1REIA 3X1NA 4MRBA 1WDAA 3FTWA 5D71L 5FKPB 3SD2A 1GW6A 3KR3H 3GIVB 4QRSB 4XVTL 2AHIA 5GGVL 3U0TA 3HJ0A 4HCRA 5K9OA 3HZMB 4IU3A 3GEWB 1KBGL 1AS8A 2P5EE 1OPGL 3NJKA 2MHAB 1N68A 2BRQA 3OKEB 3P0GB 1C7TA 1FVCA 1HH9B 4KK5D 4NO2B 4NUGH 4Q7DA 4A66A 4AMKH 1ZSHA 2KERA 4ZNEA 3CLEH 3FT9A 3NH7H 1KXVA 1S5HB 2K0RA 3STLA 2EIBA 5IGXL 3OLDA 4JFYA 3FQ2A 4RNRB 4ETQB 1SLXA 4BZ2A 4FQLL 2EH7H 5DD3H 1N4XH 1ITCA 3S48A 3QIWC 4EDXB 4NERA 3T3PE 3CHRA 1WWAX 2X40A 3C8DA 3IDMA 1BVLA 1RULL 3HG4A 3MLRL 3VU1A 5KUMA 5CZVL 5FO8B 4XCEB 3RBGA 3V5DA 1M6OB 4G1EA 1YY8B 3S34H 2A83A 2NY4C 5T1MB 3HLAB 4I18C 3MREB 5JNYA 4PGCA 4AI7A 2R1XA 3I9PA 1RJCA 2XUWA 3AMKA 1S7SB 4QRRD 1U6AL 1W80A 3IU4L 1Z32X 1QA9A 1DVFA 5E6IA 3UJIH 2XN9D 3T77B 5LN4A 2Y6TE 3NBNA 1X5HA 3FU9A 4TNFA 2IQ9H 3ZT6A 3VFOB 4ELDA 1AP2A 3G9AB 4JLRA 2Y22A 3I9IA 3QEQE 4N2IA 2JK5A 1E4WH 1P1ZA 1EFXA 3D4CA 3DETC 5F7LB 5I6LA 4Y1TA 3T3ME 2R29H 3VWKC 3QDMA 5FOJA 5IMKA 3DJZA 4HH9B 4MMZA 3SYCA 1IM9B 3HNTH 4LDCA 4PJXE 2IBZX 1JPGB 4WFFE 1J0HA 5ANHA 2YD6A 3BWAB 1WFTA 3TPKA 1C8PA 3PWPA 2XTJE 3BPLB 2EYTB 1BM3L 3QYMA 1S3KH 4OCMC 2IQAA 1KYAA 3KYOB 4Y2NA 1PSKL 4LCCC 1NFKA 2WXJA 5DMGC 5HD8C 2YD1A 1V3KA 1WE5A 1UXLA 1PLGL 3MA9L 1HHJA 2ZX6A 3CXFA 4D8PB 5B1KA 1THAA 3BGMB 4JFOA 3HS0C 1QWHA 2RALA 3MLXL 1PEWA 3LRSA 5C9KA 1YJDL 4HZLA 3VXTB 1NOFA 3NK4A 4CSTA 3QFJA 4PJDB 5D6CB 2F1AA 5KYYB 4L4TB 5D55A 3JYCA 4Y2OA 4N90D 3S37L 3ZZ1A 3EHBC 5C7ZA 5JPNB 5FPIA 1PIFA 3WY3A 3MBXL 1RJZA 2EIEA 3H7BA 4MD4A 5LB1A 3FHQA 1TQUA 3TYFA 3IK2A 5F9AC 1BZQK 4I2XB 5E00A 3X1GA 2O6EA 4FMFA 1XF1A 2RHEA 2EXYD 2X89D 4M7LH 1RJYA 3UC0H 3NCFB 4AUUA 4YBQD 4BFJA 3BFQG 3V6OC 2F9BT 3UTZA 2NCEA 1KJ2B 3H3KA 1PJWA 2HFEA 3V52H 1A6ZA 4YXLL 2DICA 2AXGA 1NUFA 4UF7C 2VL5B 3BOVA 4CVZA 2VDOH 3IVKA 4BZ1L 3Q8AA 4H88H 3MLVH 1YYML 4JFDA 1IBZA 1SQMA 1CD1A 3FH7A 4GKOA 3EGXA 5IB1A 3B9KC 1QFUL 3IJ7A 3PPEA 3DV6B 2CR3A 1DSFH 5GJSL 2AJVH 4WQOA 5JW5B 5C0CD 4Y0GA 1MJUH 1MFEH 5GGTL 1M4KA 3QK0A 2OYMA 2E7CA 2QMKA 3AUVA 5LGYA 3SKUD 1A7RH 1OT4A 3RVVC 4WUKL 4F7MB 4RISH 1SLVA 1CE1H 5I71C 1LE5B 1Y1UA 3LN5B 4X99B 2X6UA 3BP7A 2VZUA 1LEIA 4X4YA 3VFSB 1UB5A 3LEVL 1AG0A 1C16A 2UZYA 3VSTA 4LHUG 1SDDA 2W9DL 4PJGB 2VL4A 2F8VA 4PUBL 3LQAH 1QI3A 4XOAA 2B1HH 1E67A 5E1AA 5IWLC 2IH1A 2NY2C 3CC5B 2WBJB 4I9WE 4YPGB 1R3IL 1BZDA 1TQBB 1QZNA 4PJ5B 5D2NA 3FO2A 5KS9F 4O5LH 4JFPA 1WWWX 1K4CB 1O75A 3RX9A 3DIVA 3SE8L 5I1EL 4YUEL 7FABH 5E0QA