1ADQL

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
213
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPPGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG4 REA FC
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/autoantigen)
total genus 41
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL01
2B1AH 4OCRH 1INDL 2R1WB 2DMCA 2UWEF 1EVUA 4I0KA 5SX5H 3IJSB 4HX1B 2CK0H 4RAVA 1QD0A 1UB6B 4ODSL 1OSZA 3BEVA 3MRMA 1LO5A 4OCNC 4NNYA 4GW1B 3OHXB 3P4LA 1CD9B 4KZDH 5ANMB 3F65A 1FIGL 1QBLL 4JCMA 3U0PB 5H37H 1VACA 4LLVA 3T65A 4LASL 3BP6B 2ZKHH 3V4UH 3HPJA 4PJ8C 3JTTB 4G8IB 1U3HA 1BIIA 3IU4H 1A6ZB 3AS1A 3VGBA 2MHAA 4IRSC 3PWJA 4LPWA 5J4MA 2XWJA 4PJ9A 3NCMA 4R9HA 2DOCA 1AO7E 4R3SB 1U93A 2Y9RT 4IBLT 4QXTB 4N90E 4XNQA 3H9SB 4GKSB 4FRWA 1BAFL 4HK3N 3QUYB 4J7RA 1RZIA 4JFZH 5JUEH 1XGPB 3PHOB 3S5LB 4D9LL 5T3ZE 1XGRA 4GBXB 2WW8A 4S2SB 3ARFC 4X6CB 3GEWB 5EO9A 4DGVH 1TMCB 3MV9B 3VXMD 5I1GL 5GRVK 1X3DA 5EOQL 1NCCL 1PEWA 4YC2C 1QLFB 2X89A 1MQKL 3UROR 5AZEH 4GAGL 1CBVH 1FP5A 1INQB 5ERWA 4WI9A 2D0GA 5C0BE 3WN5A 3RFZC 1FYTA 4XPTH 4B50A 4X7DC 3MLYH 5GS3A 2K3TA 1OWRM 1YYMH 4JO3H 4Z0BH 4JPWH 5FYKL 1N5YL 3MQIA 2FYYB 2O61B 3U48A 1YEJH 2ARWA 2OS7A 4YLQT 4OIIH 4WHTA 4P2RB 3QG7H 5CGMA 1HWGB 2IANB 4OF0A 4QHMB 1EHXA 2E6PA 2F19H 4DKFH 3B5HA 4R0LC 1L7TH 2V7NB 5T1MB 4GJTB 5DC9B 1X4XA 4ZFOL 5IVNA 1C5BL 1T7ZA 2C3XA 5ITBH 4KK5D 1FJ1B 2AJVL 3OTTA 3RTQA 1LEGA 1Z9LA 4H0HB 3QIBC 4GAJL 2QQKH 1W8OA 3JV4A 3ZYOA 4U1LB 1FH5H 1AGCB 5FO7B 1LDPH 4X6BA 4JFFE 4WU5A 4WWKD 3U0TB 4PJ7F 3QRGL 3STBA 4HLZH 1CE6A 3ARBD 1CFSA 4UV4H 4O02H 1EH9A 5D7LD 4AY0A 4QHLA 1R3HA 5DUML 1N5AA 5ETUB 3OJVC 5SX4I 2R4RH 3SGDI 3NN8A 4OZ4A 5DEFB 2W65B 2ADFL 1CQYA 2F74A 2V7HA 1VPOH 3FO1B 1Q0XL 3BH9A 4GQ9H 1YC7A 5C8JB 5E08H 2DLIA 1FYHB 1WGOA 4HK0B 4OGYL 3UO1L 1MSPA 3O4OC 2IQ9L 1B90A 5TE6L 4LSSH 2VNCA 4MDJB 2IBZY 2X40A 5HGDB 2W91A 1S8DA 3X11A 5BZDA 3LHPH 1Z9SA 4ZYKB 4GKZB 3ALPA 1WCQA 3MRFB 5HJ3B 1WLHA 1S7UB 2MMXA 3ZMRA 4ZOEA 4HIIB 2ZNWA 4PBWD 1AR1C 2BNUB 3IDUA 5DD0L 1ZHKB 2FJGA 5F7NC 4HH8A 2AEWA 4OLUL 4JJ5B 4K23H 2N56A 4R7NA 1HSAA 2BCKB 2FECL 4K3JL 5I71C 1FO0A 4MB4A 3NFSH 2VSDA 4PJIB 4GBXD 4WI6A 4KMTL 2FJHB 1T5XB 3QO0A 3TN0D 1LEIA 4OM1H 5ESAB 3E3QE 1YQVL 3LB6C 4PP2A 1I8MA 3P0VL 5K9JH 3T0EC 5C2UB 3HAEB 4KHTH 2BVPB 3FQNA 2I26N 5JW3H 5KW9L 3SDXF 4X9FA 3L7EB 1RZKL 3ULVE 1OAKH 4NPYB 5L88H 1MRDL 1OVZA 5EWIL 4HMCA 3BJLA 5KTEL 4AL8L 3R06B 4LVNC 4Y89A 3EJZC 2NLJA 4BQ6A 2CRZA 1C5DA 1IC5H 3CFIC 3FFCA 4KC3B 3D3VA 5DUBB 4RAUA 1RI8A 3WDJA 5DSCA 2RBLA 1EMTL 2P46B 1NUFA 3CLFL 1CI5A 1CGTA 1H15B 3FMGL 1EO5A 3KJ4B 2VDPH 3MODL 4D8PB 3DV4B 5DMJB 3FQXA 3A67H 3SE9H 3TYGL 3ZE0E 2D2OA 3DXAB 5DRZB 4KUCD 1JF1A 3TIDA 3EYOA 3A6CH 4OIBA 4MQ7A 1NBYA 4KKBC 1YY8B 3I75A 5I1CL 3IKKA 1R3LB 1A4JA 1P9MA 3Q3GA 3U9PH 1FPTL 1P69B 3N1PC 3QUMA 4OD1H 3N0PB 4X7SH 4Y4KA 1QQDB 4HUVA 1EX0A 4OCMC 5IMKA 4CN6A 2DQHL 4ZS6C 5I74B 2X7LA 3KPSA 3KYAA 4KI5D 4NYLB 3RJQB 4ZODA 2H9GB 3HC0A 4XCNA 1R24A 3MO1B 2YD7A 3MOAL 4YUEH 5CEYB 3M17A 1AGBA 1J8KA 2R23B 1B2WH 4PJCA 4KRLB 4EN3D 2VDML 3V4PH 3O2WL 3WFCL 5IHUH 5LGHL 2JCCA 2X9YA 5F1SA 1QHPA 3RKDD 1QFWM 1FQ9C 3RNKA 4K7FB 4TN9A 4DZBB 4KV5F 4X8JA 5IMOA 3FOLB 1Q9OA 3CD4A 2A2QT 3NIGF 3V52L 5C0AA 4PRBB 4OD2B 1KIRB 5DHVB 3L5WA 1G7PB 3VXPB 5CZKA 4EQ2A 4ZOBA 2NY1D 1CYGA 4JM4L 1D9KA 4F37F 4KJQD 3T0VA 2XA8H 2J5LB 4KK8D 4MSWB 2O5XH 4IOFD 2VXUL 1OT1A 4CKVX 1LO0H 1BQLH 1Y0LB 2WBJD 5I8KL 1BVLA 1MI5A 3FO9B 2AJYL 1HH6B 2OZ4H 4DAGL 1BZ7A 5INCB 4HAGA 1CXIA 3FQWA 4UT6L 3VFNA 3ARDD 1RSFA 4MJID 1U41A 4TUJB 3ZDZF 5IQ9B 3DUUB 3FQUA 3BDYL 5DVKA 3QJFB 2DQUL 2BNRD 4NHUB 3BT2L 1UM4L 4Z0XB 2KKQA 3MYJA 2QADB 5FUCE 1FE8H 5IB4A 5JOPE 2AVGA 4KZEH 2NW2A 1CVSC 4PRNA 5FIEA 5DZLA 3VMPA 2ICWJ 1R5WB 4F8TA 5FYLD 4G6FD 2XN9E 2QR0B 3IJYA 3DV6A 5I18H 1ZHNB 2DBLH 1FNAA 3K1KC 3TA3B 3EZ8A 1WBXA 4DKDC 4NZRH 3NCYP 5IV2B 1DLHA 3D69B 1E27A 2P5EB 1G7HA 1KJ2B 1X44A 1Y6MR 3TZVC 2HFGL 2QJDA 4U6VL 3IFOB 4NP4L 5I30H 3PDOA 4YHKL 2GY5A 3C6LC 4MAYB 4MQSB 1MIEL 4S1DD 1A6VL 4LPYA 4PJHB 3PXHA 4XNMB 1LK3L 1VDGA 3RWEB 2ERJB 1MJ7H 2L7JA 4TULL 5TDPB 2FO4A 12E8L 1FNSH 3P0GB 4QRRB 3HPLB 2GCYA 3F58L 4HUNB 2ORBL 5DD6B 3AM8C 1QP1A 4WV1A 5B4MD 4U1SB 1P7HL 3QUXA 4MA1B 5H2BA 2XZQH 5E1HB 1MHHA 2P24A 2BP3A 1UWEL 5MEQA 4JY4B 1RIHL 2R15A 4JKLA 4YHZH 2ZNXA 4DUXA 1Z5LA 3T2QA 5H35A 1MJUL 1QBBA 3SE8L 2J4WH 3QDGD 1DUYA 1AIFB 2A1WL 3RVXD 4CDHA 5B38B 2AGJH 3MRGA 4GXVH 5CHNA 2WSKA 3PQYA 5JOFA 3RDTB 1EEZA 5ID1A 4KROB 2XZCL 4O51B 1OGAE 3GIVB 3MLVL 2ATKA 3QPQD 4ZUTA 4P2QA 2VZSA 2YRPA 2QSTA 1YMME 3AMLA 4OM0L 4G9FD 5IFHH 3QG6B 1YN7B 3TT3L 4DOHE 4MX7B 4I2XA 3GUTB 1A21A 4IIQC 4M8QA 2QHRH 4ELKB 2JJSA 1J11A 3BP5A 5MEND 1MAMH 4Y2DD 3REVB 1PLGH 4GO6B 4Z7VB 2MSPA 4LK4A 3HHRB 3OXSA 4R8WH 3PL6C 2JJUA 4FQHB 1XGQB 2FD6H 1EFXD 1QEWA 2ZCKH 4ZSOE 4WW2A 1HEZB 2FEDD 1KV3A 4JHAL 4J23A 2UUDH 4X9GA 2Q3AA 2COQA 1YN6B 1OM3H 4XXDA 4LAQL 4OKVB 5KANG 3GMNA 4FQ2H 1JHTB 1KPUA 4L3CB 1FAIL 3B9AA 3G5ZA 4R96A 5EU7E 4Z7UB 3TA3D 2DI9A 2W59A 3C6SB 1A6AB 1FNEA 1YEHH 2D03H 2AQ1A 3B83A 2IBZX 1PJ9A 2R1YB 3WNLA 2YD2A 1OPGH 5A2KH 3MBEC 5HD8D 1WSST 3GSVB 3V5KB 4KUZL 5JHDE 4XNUH 4I8DA 1UVQA 5GJTL 5L2JA 2OTUB 5IW6B 2WLYA 2FEEI 2WP3O 3MV01 4ZD3L 1VEMA 5D7LA 3MA7B 3PWPA 4WUUA 2N7BA 2O5YH 4I77L 5DJXB 3QNZA 1J9CT 1NMAH 2C3HA 1AP2B 1K2DA 3MREB 5FHBL 1KPVA 4XB8A 3UPCA 5EU4A 4R4ND 3DMMA 3MCLL 2UZIL 1LEKB 4QHKI 4NQCB 4L4TB 4L8DA 4ENEC 4AIZA 3BWAB 1N6QL 2EDXA 1RUQH 5IMMA 5I76B 3GMQA 3FN9A 4TVSa 1LP9B 1GOHA 4ORGA 1NC2A 4GW4A 3B9DA 3MR9B 2VIRB 5HGBB 4PLNC 3ALXA 1NGQH 4TUKL 1W8NA 2WUBL 4P2QE 3VA6A 2YA0A 2EDHA 5HYSA 5J6HB 2AK4E 3UTZA 4LEOA 1BX2A 3BUTA 1O7VA 4IDJL 3WLWD 3U46B 4JDVB 2JE8A 4RGOH 4EI6B 3LKQA 4RFEB 3PGCA 1RAMA 3NTCL 3F6LA 2W9EL 1U3ZA 4QTIH 3VH8A 3AB0B 1CK0L 3NCYS 3ZSTA 4GRWH 1RUPL 4OSUH 4YNYB 3KPLA 3OJMB 3QYCA 2AV1B 3QIUA 1U2HA 5IJKA 2IQAB 3P9LA 4P4KB 3BP7B 1NGXA 3D85D 5IB5B 5DJ2A 3TO2B 4Z7WB 4PRHB 1AGEB 2LVEA 1T21B 2XQYK 4JGJA 2J8UB 5D1QD 1YMHB 3QO1B 2QQLH 1CVRA 3W5NA 5DTFB 3GZKA 4X6EB 3FB5B 2UVEA 2NX5A 4LFHD 1FZOB 4LARL 3MV8E 1RZJL 4KRPC 4HGWB 4M1CD 1JYVA 5DMKA 4E9LA 5JLZA 3HCVB 1CGSL 1TETH 4NO3A 1IGMH 1MHCB 4OLXL 4NUGL 5E8OA 5KJRH 4WRLA 2D7MA 3IVKA 3QEHB 1N2RB 4L8BA 3P73A 3IFPB 3HRZA 3O3DB 5CMAB 3ULVF 2YWZA 4TUOA 2HJLB 4YDJA 1AFVL 1EA9C 1WT5A 2OBGA 2HKHH 4BH7A 2EECA 4RZCA 4UNTA 3F7PC 4MD5A 1E28B 3AUVA 3SE4A 1JYNA 1IFHH 1XF1A 1MHPH 3RA7H 4PRIA 2EIEA 5C08D 2HJFB 3EYFB 1PKOA 3MROB 4FQCH 4EIZC 4XH2B 3MZTA 5EORL 4L9LA 4PJBB 3TBTA 4PGJA 5TDOB 4F8QA 3MJGX 2FX8H 5EFIA 2WQ8A 4WFFE 5LAXB 4JFOA 2VLJD 3UTTB 4N5ED 1WZ1H 4K7PL 1NANH 3ZE0F 4JO1L 4M48H 1KCRL 3UJTL 4Z77A 1FBIH 1K5NB 5E6ZA 3SKJL 3DO7B 4M7ZB 1GCFA 5D7KE 3KPOA 4NDMB 2EDEA 3ZTJG 1VKXB 2OQJB 3QDJB 2CD0A 4EN3A 4MWFA 2CIIA 1QRND 3ULVL 5DRXB 3UZQA 2Z4QA 1T0NA 1RJYB 2CLVA 1DSFH 1FLRL 1W0VB 2E7BA 5EO0A 1BOGA 4JVPA 4NQED 4P5TB 3WXVH 1ZS8A 1JGUH 1DBJH 1EDQA 1HXYB 1DLFH 1IC4L 3GM8A 1V5JA 2J8OA 4UILH 1C08A 4ZFOB 3TWCH 2ZUXA 3NZ8A 4QOKA 5LCVH 5FO8A 1S9VA 3L9RB 2BVYA 4XP1L 1UWGL 2BRQA 5IBTH 1BFOA 2WMPA 4P4KD 2YZ1A 4HIHA 3VWKD 3KLHD 3MV7D 3I84A 2NYYD 4LVHB 4TVPL 1JGVL 1WTLA 4H0GA 4P2CG 3AY4A 2NPLX 3UBXA 2A6IB 4JQVC 5E03A 1KEGH 3H7BA 2OZ4A 1HHHB 1FHGA 1XIWD 5F1NB 3UC0H 4E41A 4MVBD 2GITB 3OR7A 1A2YB 3ECBA 3EJYC 5D7IA 3IRZA 3BGMB 2MWCA 3U6RB 3FTGB 3IDMA 3QFJA 5TH2A 1U2CA 1I3RA 2VWEE 4R7DB 4FXKA 5EPMB 1S9KC 5CJ5A 2BOCA 3OZ9H 2VQUA 3PGDB 1UT9A 3GI9L 1D7FA 1JV5A 3TVMB 4OV5A 5FDYA 5IMLA 2LU3A 2G60L 5JW5A 1QSED 4X7TA 5ELIA 2YPLB 2RGSA 4LHQB 4LOUD 1UXSA 3P9WB 2EEDA 2GHWB 3LEXB 3S4SB 3LZFH 4RNRA 1QG3A 4Z9KB 2FZ3A 1OAXH 1BJMA 3VFRA 5KVFH 4PREB 3QQ3B 1FN4A 4LF3B 3HMXL 2JIXB 3O6LH 1ACYL 1O5DT 4HC1L 4PJ7B 4X4ME 3U1SL 3VXSE 3TNMA 1I8IA 4YEFA 4XCEB 3QB7C 3QNXB 5CZXD 4JZNA 4YQXL 2VQ1A 3BPCA 4FQXB 4JDTL 5GGUB 3KXFE 2DQFA 3IDXL 4OZFB 2HLFD 3K46A 4OZGA 4YWGH 1TTGA 3KDMA 3IETB 4KMQA 4QTHB 3B3IA 3ULSA 1LK2A 3HN3A 5C07B 1G9MH 3QDJD 5I75B 4G5ZH 4ELME 2APBA 2ZUSA 1T03H 4AH2A 3MUZ1 1CFTB 4QYOA 1TPXC 3PWLA 4Y4HD 2OTWB 1VFBB 3EYSH 1HNFA 4S1QL 3RY5A 4F15B 3SCMA 1HH9B 2W0KA 3U0WL 2AERT 2OLDA 2DDQL 2VZOA 5D93C 3BXNB 5IESL 1RIVH 5IFJA 2EO9A 1A3RL 2BY0A 4JHBA 2NY0D 1NEZG 2V2TA 3MRNA 3SJVE 1ZT4B 2B2XH 2DQIL 3IDJB 1SEBB 1RUML 3PDGA 3KPRB 4KK9D 3GSWB 3SDAD 5IVXE 2OL3L 3B5GA 2FIRT 3WS3B 2EKJA 3X3GL 2EDTA 1HHIA 4DVRH 2L7UA 1MVUA 2Y7QB 3SDXB 5MENA 4XWGL 3RZCD 3HZYA 5E2WH 3KGRA 1HHJA 4NO0B 2IALB 1KN4L 1MFBL 2BY2A 1MVFA 1MFDL 5EC1B 1C7SA 3AS2A 1EFXA 2W60A 5E9DB 1XF4A 4PRPB 2C3GA 4LLWA 5HHOD 5DK3A 3CZJA 4I13B 1A1NB 4ONGH 5SWZE 3UYRH 5FA4B 4G6ML 3VXUB 5T33H 4XGZA 3LRHA 3ARSA 3EYUH 3LOWA 2Z93A 2F54E 1FFNB 3UTSB 3QRFM 2CIKB 5EZLA 3MXVH 2UV3A 4PJFE 3KYNA 1A5FL 4R4BB 3BW9B 1OP5K 5C09E 2W9DL 4Y19A 3D18B 3ESVF 4Y5VA 4B53A 4YAQB 4UIKL 4FFWD 2IH1A 4JN2A 5JPNB 4AG4H 4P2OC 2A9NL 3C9NA 3S97C 1R5VA 5ADPH 4PGBB 3J8F7 1RPQA 4XP5H 3FQRA 4YHPB 5DFVC 1B0GA 3GMOA 1ZLSL 1HYSC 4DJMA 4YHOL 3RWFB 4R90L 3T04D 5BQ7B 4G9DA 4NRYA 4NO2A 3E2HC 1BGXH 1LQSR 2NR6C 2Q20A 3FO2B 1SBSL 3O81A 1UJTA 5MERB 5FCSH 1JZ2A 4L4VA 3MUGA 3OKYA 3LN5B 4U2ZA 4C83A 5KSBB 4LBEB 3MRCA 4WFGD 5BS0D 4YHIA 4I18A 1RIUH 3U82B 4PJ8B 3BO8A 2PYEE 3ET9F 1OAUH 4BELD 5L9DL 3VXRB 3LIZH 5CILH 3B6SB 4PG2A 3PWNA 3PNWA 3C2SA 2CDGA 4ODUB 1CFQB 2YZ8A 1HQ4A 5I9QC 1YZZA 5GS1C 4JM2D 3C5ZB 2C7UB 3BKCL 1S7WB 1DQDH 3MNWA 1H0DA 3OSKA 4FQIH 1PKQA 3F62A 4RISH 4I9WD 2YC1A 2ICWB 3HE6C 4B41A 1A7QL 1IAIM 4CMHC 3FB7B 2AJSH 4BQBA 4RFOH 3KPTA 4CN1A 5KVGL 5CBEA 3HG1E 4LKCA 5IFAH 2FB4H 5C0FB 4LAJH 3ARFB 3NGBC 5EBLA 4RMTA 3T77A 1GGCH 3D85A 2PO6A 5TE7H 3IAQA 4H1LG 4NO0D 3MUY1 1ZVSA 2DRUA 2PXYD 2PETA 3RWIB 4JPVL 4FP8L 5FK9A 3MXWH 1IT9L 4PGCA 4NN7C 5C0JA 1QSFD 3UMTA 4XNZB 4HLJA 4YHLH 4CN4A 1EVTC 1VSCA 2CO6B 2KZ1B 3O9WC 4K3EL 4Q97A 1HWHB 4HXAL 1EBPA 1QHOA 1DN0B 4WW2F 3GHBL 4G6KL 5JW4R 1WJ3A 1T1YA 2A83A 1TENA 4EUPG 3V7MA 2WANA 1IAOB 4M7KH 3O8XD 4BFIA 2X4NB 4F9PA 4NJ9H 4PG9A 1OB1B 1LE5A 4AEEA 1MLCA 4UT9H 4CGTA 3WEXA 3VD9A 4KDTA 4UINL 5DMGD 3TV3H 2C4FT 5F9JB 2XA3A 5E2UL 1PW3A 5D2NA 2X1WL 3I6LE 4DKEH 1I4FA 1Q94B 3TBYA 4E0RB 5HDLA 1I1AB 3VGGA 3P11H 2W07A 3NBNA 3F6IA 2YD6A 2VH5L 5A16B 3QDMB 4CMMB 2FBJL 2GJ6B 2Y06L 2AABH 4FQPA 2HVJA 4HKXA 4NQVA 4M4PA 5DO2C 1U8HB 1MRFH 3ZHKA 4XRCA 1ES0B 3VFTA 2XRAL 4ZNEE 2FX7L 2JB6A 8FABB 4N9GB 1PKQE 1QRNA 3OKMA 5F9WC 4PD4K 2VLLA 1UENA 4QRSA 4WTXA 4Y4FD 1H5BC 1A6WL 2Q87A 2XNAA 4IRSD 2AAVA 1IC7L 3W9EB 5IBUG 1XFPA 2ILLA 1JGLH 4NQEA 4MA8L 4YK4B 3TCLB 5ICZB 2VC2H 3NA9L 1FVEB 5MHSD 5HYJD 2VN7A 1HQRA 2GFBB 3VU2A 2X1OA 4FNLH 3BH8A 4KQ3H 4YDIL 1I8LA 5JDSB 3KJ6H 4FMKA 4GSDH 2D4DA 3TIEA 3ARFD 4F7CB 3OKDA 2HRPL 3RVVC 1D6EB 2AEQL 4MZ3A 3O0RH 2YUVA 2QKIB 4U1GB 4BM7A 1MRCH 4LRIA 3X14A 1WBYA 1E4KA 1T22A 1L0YA 1SHMA 1T7VA 2ZUQC 4XZUA 1XIWA 25C8L 3SOBL 2ZUTA 1KT2A 3BZ4A 5C0GA 3EDEA 3WNPA 4XCFH 1YUHB 4MQTB 2XTJE 3MGTA 5KS9E 2WZPD 3O3BA 1QOKA 1AD0B 4KKAC 2BNQE 1K4CA 2I07B 3DROA 5AYUH 5D2LE 3BSZH 4FTVB 3OKLA 3D25A 1QSEA 4P46A 5C0BB 2CMRL 1KN2H 1Q9LA 2HVKB 3PV6B 4XNXL 1RHFA 5I1IH 5C0CA 1U8PB 3D0LB 1DUZB 3O2VH 2OMBA 3QZWB 4M9PA 4JVWA 3QIBD 1UCTA 1BEYH 2OJZL 4K9EL 1WZLA 1TVHA 3IYLW 3MLWL 1FZKA 4XCCH 4NM4H 2H6PA 3UDWC 3IDYC 4MHHI 3BDXA 1RK0B 1TJHH 1A1MB 3KLAA 1H3VA 2F5AL 3W9DA 4LCWE 1ZHLA 5J11B 5JPMB 3SN6N 2VABB 3CVHL 1DTUA 3EO1B 4S1RH 5CEZH 1EZVX 3QWOB 1ZGLA 4G8GB 4JFFB 1A7NL 3E6FB 4ZUVB 5IWLA 3V6ZB 1MAKA 4OCSL 1GL4B 2V5MA 3W2DL 4TQEH 2CDFA 2ADJB 1M71B 1XGTB 3VW3H 1AY1H 1R5IA 3L3JA 2F15A 1J1OH 1JMXA 1D5ZA 2XYCA 4DW2H 1NLDH 2DYPB 3NACL 2VO5A 4GXUN 1DANT 2VLRB 4U1JB 1CQKA 3WUWB 2A38A 1SQ2N 1B3JA 3DTXB 4IMKC 3IU3B 3GMLB 1AR1D 4FQJH 4V2CB 2IPUG 3S35L 3SGJA 4J3TA 1NLBL 1F42A 4X0KB 1OW0C 1N59A 4QHUA 4WW1B 4ELMF 5L2KD 2OTPA 3LB6D 2WK2A 2IPTH 3JWOH 1VEOA 5C0NC 3T0ED 2J8HA 4M7JL 3TJHC 3EW3B 4LPUA 3PHQA 4LU5L 3ILPA 3RY4A 4OUUA 2NY7H 3PDDA 3DVGA 3MLTA 4QRPD 5MEOA 4FHBD 4UBDC 5HHOA 4KJYA 4OFIA 4CVXA 2RB8A 2OK0H 1OTUC 4O5LH 2I9LB 5IVXF 1AGFA 3SQOL 1I7UA 4KI1A 4CRPA 6FABH 2AEPL 3KNBB 4I3RH 5GGRB 4FTVD 2XT1B 3I3DA 5DD5L 3IFLL 4HUUA 3QH3B 4H5SA 2FBOJ 1AGDA 5BRZD 5M7QA 1IQWL 4DN4L 1D3CA 5J1AA 3CPLA 5FYJU 5I19H 3EDDA 3WL9B 1MCWW 1A7RH 1N0XH 1RZFH 4QGYA 1EV2E 4KY1H 3UX9B 3FOMB 4IRJB 1NCBL 2OR9L 1HE7A 3NH7H 1XGYH 2F9BT 1P7KA 4PB9H 4KKBD 1I3VA 4BSVA 3IJHB 3Q1SL 4PJFF 3VXOA 2BSSB 5HHVL 1P7QB 3QJHB 2XTLA 3BPNC 1BBDL 3ZSSA 4DCQA 4PJEE 4ZS6D 5IOPB 2BDNL 35C8H 2KQNA 3QULB 4YIQA 1IM3B 1IKNA 2ARJA 3IDGA 3JV6B 1TVBA 5BS0A 5CZVL 1T2JA 3VGAB 5D1XC 1MCSA 4N1HB 3O6FC 4MNHB 2AP2A 5HGGS 4NQSB 1MPAH 2CJUH 1NMBL 1QA9A 1YEEL 2RCSH 2H8PA 2MFNA 1OTSC 3PP3H 2FH6A 3QNYB 4LCYA 5I2IA 4U6XA 5I8OH 3G04A 5GXBB 3G5XB 5GGSB 3EHBC 2BFVH 4Y8DC 4OF5A 4OQTH 3OKOA 1H3GA 3MOBL 4UI2A 2HG5B 4C56B 3ZT5A 1I8KB 2DKMA 1AC0A 2HFFB 2A6KB 4OLWL 4XPHL 5D9SA 4LLYA 2VN4A 5HDBF 2DM7A 2IH3B 2PYFA 5DQJA 3L1OL 5DLMH 3B8SA 4HGMA 1UM5L 1PZ5B 3OKNB 1JPFB 2ZOLA 3FB8A 2PXYA 3GO1H 4POYA 2Y4SA 1J88A 4ZS7L 4AENA 3QEGH 1U8IB 3ZYJA 1JPSH 5C9JA 1NCDH 1Y18B 4PJGE 1QACA 4JFEA 4F7TA 4Y88A 3Q48A 1U3HC 1A7PH 5FYJD 2HKFL 1FZJB 4ZFGH 4NM8L 3WFDH 4ZQKB 1KNOB 2GJJA 2ZG1A 3IF1B 3FT3B 4PJ9C 1T2QL 1XZ0B 5EOCH 5I1LA 1ZEAL 2BK8A 4M6NH 3TBWB 4OKDA 3O8XA 2IBGA 5JW4Q 3KS0H 1JP5A 1ZLWK 3N1GC 3HAEH 4PB0H 3HKFA 2JJWA 3TZVD 3W39A 1I3UA 1D5XA 1JVKA 1BVZA 4EI5B 3LRSA 4AJ0A 4HMEA 5EU6D 3WD5L 1DQLH 3GRWL 3C6LD 5KSAA 2XN9B 1UXWB 5JHLH 5TPWH 1R0AH 1NGPH 1GPOL 4IOIA 2CPCA 1Q9WA 1ERNA 1WWBX 3LKRA 4JGMA 2OL3B 4AEHH 5CLWA 5E2VH 3WN5C 3MUHL 1CIUA 1JPTH 3GBMH 4OBRA 5LXGL 4LDLB 3MLPA 1BOYA 1JGEA 4HIEB 1B0RB 2OJEB 2OP4L 1ED3B 2BY3A 4JFDD 4MJ5B 5HHPB 2CRIA 2Z9TA 2WBKA 2B7DT 3GIZH 3LDBC 5EBGA 4X8XA 3TGXA 2NXYC 1B4RA 2JJTA 3GK8H 1YJDL 2V2XB 1L9NA 2PW1A 4Y4FA 3ULUE 5T5FL 2XPGA 4O58H 1R6VA 5FEBA 1UZ8A 4Y1AA 5DGQA 1XF5B 5IW1B 2IG2H 3SKOA 4GUPA 5DJZA 3SHSA 3HC3H 1S7TB 3GB7B 3BD5A 2W0FA 5IEHA 4K2UL 2ZOKB 3RTQC 3CFBB 4PRDA 1WIUA 4I0PB 4JFHE 5AAMA 4P9HH 3W11C 4YDVA 4LIQH 2AV7A 4G8FB 4AMKL 3AREC 1NFIA 3L3KA 1X6NA 2BMKB 1AXIB 32C2A 4XPGL 5IM7A 1FC2D 2BRRL 1BJ1H 4MS8C 5D6CA 2WM0A 2Z31A 5DDHA 1F3DJ 4IS6B 2AXFA 2HT3C 3EFDH 5GISH 3PL6D 5FO9A 2Q7NA 1DVFB 5HPMB 1XT5A 5IQ7H 1XF3A 1YMMB 5GRUL 5FHAL 3SKMA 1AE6L 3JTSB 2ZCHL 3MRHB 3RWHB 3R0MA 5GGQH 4CU7A 5ILTH 3GSNH 4WO4D 1OLLA 5FFLA 1F4XL 4UUJA 3MRQA 3MLRH 3MJ8A 1YEKL 4QRUB 2O93L 4R0LA 4XBGB 2QV2A 2GTZA 1WAAA 1F11A 4X5WA 3VXNA 3EZJB 4G7VH 4ETQB 3DO3A 3D39B 3SDYL 3MBED 1U8QB 4M1DH 5K9OA 3QIBA 5FUOH 5E24E 4AIOA 5DD1H 2DTML 5KS9F 2BVQB 3I50L 3V6OA 2MCPL 3OQ3B 4IJ3C 1AXSB 4MA3B 1DDHB 4ERSH 2JB5H 4NQDD 3HC4H 1P4IH 3BRFA 2NY3B 1YNKH 2R4SH 5CLTA 1F90H 3DWTA 5D2LF 5EUKA 3W0WA 3SDDC 1LO3H 3U7AA 1UYWH 3SDCA 3TH4T 3DX6A 5TFSL 2OSLA 3B2VH 1X7QB 4GG6E 1XR9A 2EH8H 1MCOL 4HLZG 5DJ6B 1T4KB 3WO4B 1CICA 4KKLC 3HRPA 3C09C 4PJXE 4DWHA 4ZNCD 5JHDB 4ENED 1NFDA 5ACZA 4B0MM 3ZKQD 1SBBA 4P99A 4JR9H 1OD9A 1QFUL 1KJ2H 1S7SA 4OLVH 4YGAB 3FN0L 4X4YA 4HG4K 3LKPB 3NIFE 3CC5B 1NMCC 3ARUA 1WITA 1HCFX 4MGXA 3DUSB 4P3DB 4L3AA 1NGYB 1F4HA 1YNLL 5IVOA 3F5WA 1BF2A 1PFCA 5SWSD 1M7IA 1IRAY 3Q6GL 1KJMB 2F53B 3N50A 5DYOB 4UNVA 3CH1A 3IJSA 1PY9A 4LRNH 4HX1A 5TF1H 1A14H 5F7LB 3QIWA 4HBQA 1UB6A 3BD3A 3T8XA 3SKUD 1KACB 3K4ZA 3VH8G 2H26A 3T3ME 5L2KA 3OHXA 4WGVB 1IGJB 5ANMA 4PY7B 2AXHA 3LPWA 5HY9B 1EAPB 1ITCA 1E6JH 1P9MC 5F96L 4ZFFB 3U0PA 3G6JE 1TJGL 4GW5B 3G9AB 4QRPA 3VDCA 3X12B 4KWUA 3MJ7A 1U91B 4H20H 3JTTA 3S9DB 4M8VA 2XXCB 1KTLB 4ODTH 2VZVA 4U6HB 5DVLA 4XMKL 5JDJA 1A7OH 3DURB 2V9RA 2P8PA 3O4LD 4R3SA 4KRPD 3T2NL 2LTQC 3VXME 4PJ5D 3MLSL 3H9SA 3EO9H 4GKSA 4LLMB 3V2AR 4G42B 3QUYA 1K6QH 1KTDB 3RUGE 3OGCA 1R3IH 5DQDL 1YQ2A 4MAUH 3VE0B 4ZAKB 1D9KC 1LNUB 4JN1L 3MV9A 4PGZA 4O4YH 4APQD 1ZTXL 5T1LA 4OD3L 1QLFA 1NFDE 3MRRB 4KAQL 1JZ3A 2ZZUT 4MNQD 2AJ3A 1QFOA 3OL2A 1NDMA 3IGAA 1WWCA 4ODHH 4K8RH 5FB8A 3R0NA 2WINB 2FYYA 4U1NB 3I6GB 1OD7A 2Q8AH 4JG1H 1KCSH 1LVEA 3JWDH 3TJEH 4RQQB 1DBKL 4P2RA 4QT5B 1U8OB 1KLGA 4LSTH 4U05A 1LGVA 5D5ME 2V7NA 5T1MA 3EOAB 3T4YB 4M62H 3FCTA 4WU7B 1GZPB 1BFVL 3WJJA 2FSEB 4JO4H 5IHZB 1BPVA 1T83C 2VLKB 4DK3A 1JNNL 4OZHB 4PJEF 1AGCA 3V95A 3V9FA 2NZ9C 3U0TA 1B6UA 5LBSL 1KXTB 1OP9A 3BP4B 3ARGB 3I2CH 4OCWH 3KPMB 5DEFA 2W65A 4N68A 4HXBL 4BUGA 3F7VB 4OQTA 1E4XL 3CMOH 5BVPH 1WCBB 1J87A 1GOGA 4UTBH 3TPUA 3FO1A 4MQXC 5C1MB 1HZHH 4YE4L 5SV3A 3RVWC 3VCLA 4HK0A 4KTDL 1PSKH 4WV1C 1MHEB 3D2UD 3QUXC 1WC7A 5I1JH 3S88L 3QP3A 4KJWC 5HGDA 4EXPX 3EJYD 3ARQA 3CCHB 2DQCH 4GKZA 4FQQA 4X6CE 4XCYB 1XAUA 3PJSA 2OI9C 4PJAA 4P57B 5HJ3A 1CLYL 1S7UA 3FQTA 2HWZH 1MLBA 3FAWA 2VMFA 4NIKB 2BNUA 1ZHKA 5E4EB 5LVEA 5F88A 2CGRL 4JJ5A 4UQ2B 4U6YB 4L3EB 5EZOH 5CJQL 4WI4A 1INDH 4FXGB 1T5XA 3B8YA 2ICCA 4V1DB 4HULB 2YD1A 4PJGF 2PTVA 2DF3A 4FFZH 5BV7L 4ODSH 4ZDHA 2JELL 1HKLL 4UDTB 3HAEA 1EHNA 1H3XA 1NAML 1F3JB 1TCRB 2IANE 3L7EA 1FIGH 3RAJH 3O2DH 3VFWB 2JJSC 1O0VA 4NPYA 2EH7H 1F2XK 1XR8B 4LASH 4Z95L 4WTWA 3O3EA 1MUJB 1KCVH 5ICYB 3V7AE 3E2HB 1ZMYA 5FDWB 4WI2A 4WW2C 3RL2B 5DUPL 4KHXH 4XWOC 1JZ8A 5HGAB 4J8RB 1U8LA 1J0JA 3LH2L 1T66C 4XC3H 3P30L 1UH4A 1NFKA 1H15A 1U95B 1UACL 5T1DL 3BD4A 1WIPA 1PEZA 3C8HA 4P3CH 3KWWB 3IDIB 1FSKC 4X7FC 3KXFB 3DXAA 5DRZA 5I9QB 3TT1L 5EG6C 4UTAH 1G9EA 1A8JH 4KI5E 3BZFB 5ITFB 2GTWB 3B5TA 5JQHC 4MYWB 5EOQH 3X3FH 1R3LA 2FL5B 4CMHB 4QWWC 4ELMB 1BD2B 1N6UA 5A2LH 4GAGH 1U3YA 2BSRB 3U36B 1QQDA 1U58B 4FFVC 1FVDB 3N9GL 4WHYG 4JRXD 2H9GA 4MNGB 3RIAF 3FT4B 3DMMC 3MO1A 5FYKH 5IB2B 1LD9B 1N5YH 3JBG7 3LCYA 5AWNH 3PL6A 2VXSH 5CEYA 3DARA 3SJVB 1RJLA 2FJFB 1YPZA 2BC4A 3LN4B 5F6IC 4BSWA 2FNBA 4U3CA 4Q6YA 4NN7B 4WI7A 1SYSB 5D8JL 3V0VB 5IVXB 1PY4A 1ZKAA 4PJIE 4DGIL 5I73C 4K7FA 2YEZA 5ACMA 4DZBA 4BYHA 3VXQA 4WO4A 3FOLA 3H3PL 1C5BH 2ITCA 1AHWB 4JPKH 5E8PB 2XFXA 3WUZA 4TSBL 4PRBA 4OD2A 4Z78B 3BVNB 5I1HH 1G7PA 3VXPA 1M7DB 4GLRH 3BGFB 4GAJH 1JRHH 1CGXA 4MJIE 3GSNA 4HZLA 1TZIB 4QXWA 1X6LA 3ULUL 1Y0LA 1MY7A 3FO9A 1F8TL 4P2OD 1QYGL 3VWJB 3LQMA 5DUMH 5SWZB 1N64L 5HHMB 4MMXC 1MH5A 2VUOA 3QIUC 5ICXB 5IJKC 5DFVD 1OAQL 5E5UB 3FFDB 5IQ9A 1MFAH 2F54B 5CUSH 5FYLE 1HYSD 4PJFB 3PP4L 4OZIE 4NHUA 2DQJH 4Z0XA 4LMQI 1HCVA 4HEME 1V7ML 1L6XA 3QEQD 4CVZB 4K94H 5TE6H 1HINL 2PN5A 3MNVB 2NR6D 1F4YL 1MCQA 1MJJA 3GHEL 3PIQA 5CSGA 3QXVA 3DXAE 1JPGB 2QR0A 5D4QA 3K8MA 1ZHNA 2W0PA 2X4UB 2YWYA 4IMLA 5F9WB 2P5EA 2NXZC 1H5BB 1KJ2A 1MCBA 3LKSB 5KZCB 5SWSA 5DJAB 4K3JH 4GG6F 1CCZA 4KMTH 1GGBL 1NGWA 1WT5C 4PJXF 4PRAB 2FHFA 1YQVH 4MXQC 1VFUA 3SE4C 3HE6D 4NC0B 2ADGA 1F4WL 1FFOB 5EUOA 5F97E 3HUJA 4OZFH 3RWEA 4RFNB 3NIFF 5LQBH 4HUWA 5TDPA 5KW9H 4XP9L 3HPLA 5B39B 3QDGE 3BAEL 1RZKH 1D5BB 3HFML 3OAZK 4L9LC 2Q76B 4U1SA 1IZKA 1WFNA 2FHBA 1MRDH 1KGCD 2E6QA 3P9MB 5DZNA 4E5XA 5KVDL 5EWIH 2YK1L 5KTEH 3MUJA 1Z9MA 1FFPA 4OLZH 2Y36L 3OJDB 4FS0A 2X4OB 2ESVD 1SJXA 2IMNA 2ZUQB 3V0AC 2CR6A 2P47B 1J1PL 2F8OA 4JZOB 3VI4E 4WHDA 1EMTH 2VDNL 1HI6A 4ZOCA 3O4LA 3O9WD 3CLFH 5B38A 3T3MF 1A0QL 4KGJA 1BJ8A 4G9FE 2YD3A 4ESKA 4G80B 2XQBH 4I5BB 1HKFA 1RZGB 1H8SA 1RHHB 4O51A 5M94B 5GPRA 4KPHL 1TITA 3G6JF 3GIVA 4ZXBB 3TYGH 2Z0BA 3BRDA 1X5HA 1U92A 2VLME 1XF2B 4R97C 3VRIA 5GS0H 1JWSB 4QRQB 5T3XL 1I1FB 2P5WB 2YPVL 3C5SB 1RULL 5E2TH 3L7FB 3CXDL 4OGAC 3GMRB 4APQA 2FX9L 1YN7A 1IGIL 5HHMD 2XI9A 5I15L 4PLOB 4MX7A 4P0DA 4WDIA 5HVWA 2B1AL 3BIKA 4LPCA 3O41B 3DIFB 4JDZA 4MNQA 5GSRB 4PV8B 2CK0L 2VTFA 2DQHH 4Z7VA 3RHWF 4B7LA 5KG9A 5FF6B 3AY4C 2IAMC 3KLDA 1XGQA 4FQHA 1DJSA 1HEZA 1JF5A 3RUGF 4R4FL 4WFED 3OAUH 4LLDA 5FOBB 2IPUK 4KH2A 3PXJA 5DO2D 1YN6A 4JB9L 3QQ4A 1KTKE 1YEGL 3MRLB 2Y5TB 1T1ZB 2VDMH 2ZKHL 4L3CA 4XAWH 2BVOB 4M7LH 5L7XL 5EO1B 1NFDF 3Q5OA 2C9AA 3C6SA 4LL9A 1A6AA 4W70A 1GOFA 1JNHB 5IROA 4PJHE 1CU4L 3BN9C 1FL3B 1JZ5A 5E1AB 5F9OH 2CLRB 1ND0B 1YECL 5IKCB 4LCCB 4JM4H 4QRRE 4UU9A 4KFZC 5CBAA 5HSFA 3OB0K 4UAOB 2OTUA 1TNMA 2XWTB 2VXUH 1GRWA 3MFGB 4QKXB 3E6HB 5CEXB 5F44A 3MA7A 4U1KB 4WJ5A 2YR3A 4DAGH 1JI2A 5DJXA 3WIFB 4DK6A 2J88L 4GLRI 2OXHA 3MREA 1VENA 4DGVL 5FXCH 3VFUA 3RVVD 1ZWIB 3CU1A 1LEKA 3BT2H 2V5SA 4NQCA 1MCEA 4L4TA 2IEPA 3F7YA 5I0DA 1OGTB 4JQVA 3D2UA 2H3NA 5AZEL 1CBVL 1LP9A 3ARXA 2VKWA 4NRXB 1JCKA 2VIRA 5HGBA 2IADB 4M6AA 1E6OH 3MLYL 1YYML 4JO3L 5E8NA 5GSVA 4Z0BL 1UJ3B 1P4LB 2EDKA 4JRYD 4OCXL 4HK3J 5F89B 5J6HA 4KKAD 1J86A 1YEJL 3KG5A 1CFNB 5D72H 5MI0C 4OIIL 1AKJD 5GIRB 4LDEB 3QG7L 3SCMC 1SJVA 4DKFL 3EGSB 4EI6A 5H94B 2GI7A 5C3TA 4RFEA 1L7TL 3VD5A 4XPBL 5E8DH 3T1FB 4Q6IB 4NKMB 4YHKH 1QR4A 2MPAH 4F58L 2AV1A 1MIEH 2HFTA 2XTJB 4HDIA 5KS9B 5ISZD 1HK6A 4GKNB 2IQAA 2QQKL 4ZO6A 6CGTA 2BNQB 3ZYIA 2MKWA 3BP7A 1FH5L 3BQUA 3CSYA 4FZ8L 4X6CF 5IB5A 4Z7WA 4PRHA 2FECI 5D2LB 12E8H 3NCEB 1WEJH 2AXGB 4UV4L 1DQJB 1IBGL 5J89A 1M6OB 1VFAB 4E42A 2J8UA 1D5MB 5JORA 4Z7UE 2R4RL 5DZOA 1BQHB 5DTFA 5GZNC 1UWEH 2HN7B 3H9HB 5JW4N 4C54A 4RMVA 1VPOL 3PF2A 1RIHH 4CVUA 5T5NF 4NZUL 3O2DA 3ZT6A 1CLCA 4GQ9L 5E08L 3RGVC 2NY4B 4HGWA 1FL5B 3T0DA 3HCVA 2A77L 4PPTA 3GBLA 4LSSL 2GJZA 3NFPB 4LHUG 2R2BB 2CO7B 5C08E 4OCYL 2VYRE 3FONB 1PX3A 3LHPL 3O6FB 5GHWL 3IFPA 1IEBB 3O3DA 5CMAA 3ZKMC 1QUNA 1I1RA 1QNZL 4LCWB 3VG0H 1KSRA 1IGYB 2UWEA 3C8KB 4Y5VC 2VAAA 43C9B 4QHNB 4L4TE 3RIFF 3OPZL 3F8UB 4JRWA 2VLJE 1G9NL 4OM0H 4ALAH 1DBMH 2HJFA 4OT1L 3MROA 1W0WB 2OR8A 4K23L 1LP9E 3L3DB 1FFQA 1SM3H 5GRZA 1TIUA 1D5IH 5C7XH 4RAVB 4JRXA 5C0ND 3VFGL 5K9JL 2EEBA 3BEVB 4OF7A 3UTTA 5T1KD 1U8MA 3MRMB 1LO5B 5B21A 4KHTL 3TJHD 4EDWL 1MNUL 5JW3L 1J8HA 4KMLB 1E4JA 3ARPA 3A0OA 2KZWA 4S0TD 4NC1E 2B4CC 4KI5F 3SGEH 2Q6WA 3T65B 1CL7H 4NHCH 4UBDD 5C0RL 1FAIH 3BKYL 1P1ZB 4I18C 1OTUD 4LLQA 1G84A 3ZDYE 2LAAA 4JFXB 3QQ9C 1IC5L 5J13B 3ROLA 5DD3L 4LSPH 2MHAB 4PG2C 4P5TA 1A9EA 5GGVY 2YOCA 3HS0B 3MV7E 4PJ9B 3WV0A 3T2PA 3WLWC 4G7YH 4TYUA 1HXYA 4KUZH 5SX5K 5J1SC 4HIXH 3QXAB 2PR4H 4ZFOA 3TBVB 2VDPL 3L9RA 4XNQB 5DA4A 3LAFA 3HLAB 4H1LH 3A67L 3SE9L 2EYRB 4I77H 1S9YB 1X9QA 4PJIF 5A1AA 4M1GL 1AO7D 5EO9B 4MB3A 3U83A 4O00A 2VL5B 3MCLH 4N90D 1HHHA 5DVOA 5F7DA 1PDKA 1BF8A 2PO6C 2VXQH 5F1NA 1N6QH 1MJ8L 4W4OA 2GITA 4GS7C 2WWMC 3QEQA 4J6RH 4OD1L 3U6RA 4X7SL 3FTGA 3HR5B 4R7DA 3PE9A 5T3ZD 3WS6A 5DS8A 3WHXB 3PGDA 5J06A 1ORQA 1AQKH 3H0TB 2K1MA 3TVMA 2CH8A 3V5DB 5D1XD 4HH9B 4LHUB 4WHTB 3O6FD 3H7LA 4NN5C 4NCDA 3HR6A 3LEXA 1J10A 4OZIF 4U7SA 5DXWA 3S4SA 4PJBE 1OTSD 5F1IB 3QQ3A 4LF3A 1CK0H 1RUPH 4PJ7A 1IKFL 3OF6D 2C4FU 1KENL 3RTQB 3UTTE 4KDTC 1SMOA 2H1PL 4TNVK 2ICWI 2YA1A 4XCEA 2AJXH 1JFQH 5D2NC 1WTGT 4WWID 1ZSDA 3JV4B 2XA8L 3QI9B 4X6BB 2O5XL 4MD4B 3QDJE 1BQLL 2DICA 2NY6B 2Z35A 2ZJSL 4MHHG 4FQXA 4H25B 2OZ4L 4O9HL 5BV7B 4P2YA 1N5AB 2EDWA 3NN8B 4OZFA 2UY6A 5SWQB 3BJ91 1NL0H 5FUZH 1NAMB 2V7HB 1LO4H 5I17A 1G7QA 1FG9C 1KUMA 1RZJH 5EBMA 2X4RB 2QSVA 4LSUH 4ZOAA 2NY5L 1N0LA 5FYLL 3IRPX 4OLXH 3U79A 5DC4B 4NUGH 1FE8L 2OTWA 1VFBA 3VG9B 4KZEL 1U3HD 1HH9A 3X11B 5BZDB 3C8DA 3VFVB 3BXNA 3OMZA 2HH0L 1MF2L 3LV3B 15C8L 4PJ9D 5I18L 4YFEA 3BRGC 2DBLL 1AFVH 4EJ1C 2XY1A 5K9KB 3IDJA 1GZQA 4NZRL 2J3SA 1SEBA 1LMKA 1G7MA 3KPRA 2YSSA 3RPIA 1RQ5A 4MJ4A 1PZUB 5FM5M 3WDHA 2R0ZH 4R7NB 1HSAB 3ROOA 3FL7A 1QKZH 3VI4F 2R9HC 3WCYA 5EORH 2BJMH 2Y7QA 3CXHJ 3ESUF 3MA9H 3SDXA 4HSQA 4LEXH 4IJ3B 3P4MA 4PP2B 1IL1A 5F7YC 3U2SB 4LRIC 1E4KC 5FECA 4XMPL 1MJ7L 3W5MA 2YPLE 3L5XL 5E9DA 4PRPA 1FYTD 1KCRH 3UJTH 3WFZA 3WNMA 1DBAL 1Q1JL 5DJCB 1A1NA 1H8NA 4NWTL 5CS7A 2IPKB 5FA4A 2XZQL 1B88A 3VXUA 3ULVH 5IGXL 5GS2H 4Y2OA 2M1KA 3G6AB 1NCNA 1FFNA 3GJEB 4GRLD 2CIKA 2J6EH 5TE4H 1YA5A 3W82A 3LS5L 2E7LC 2NXYD 2DJ4A 4R4BA 1NC4D 2NLJB 4PIRF 3S37X 2D3VA 3BW9A 3D3VB 4RAUB 4HKJA 4NNPH 4P46C 1LDSA 2W0LA 1FCCA 4IRZH 1DE4B 3SGEI 4YAQA 1IC4H 2Z8SA 5JPNA 3VD4A 2RAMA 4YO0A 4GXVL 1RU9H 3T08A 4PGBA 4U1HA 1INEL 1JBJA 5IEKB 4U4BA 3T0BA 1F6AA 3EYVA 5JIHA 3TIDB 3W11D 5C07E 4TVPH 3IAPA 3RWFA 5EN2B 4MQ7B 5FGBA 3S34H 1GGTA 1NBYB 2YBRB 5BQ7A 5KSVA 3I75B 5IFHL 3ARED 4PJHF 2ZUWA 1TQCB 2X09A 3C5JB 3Q3GB 2QHRL 5MERA 4FMFA 4MS8D 1J18A 4Y4KB 1MAML 2DN7A 2DWEB 2HT3D 1ZLVH 1WWAX 4LBEA 4LCUA 1CE1L 2FD6L 3GI9H 4XCNB 2NW3B 3WKML 5IWLC 2WWKT 4U6TA 4I9WE 2R1XA 2G60H 1H9VA 3B6SA 2EYSA 3M17B 1IQDB 4ODUA 2P48B 3BKMH 4ONHA 4PFEA 1U0QA 1OM3L 1CLZL 4FQ2L 5C0DB 2B8OT 1G9MC 3C5ZA 1DANU 2C7UA 1S7WA 4N0UE 1V3LA 5IT2L 5IMOB 4YDLB 1Q9OB 1YEHL 4H8WC 5A3IC 2D03L 2ICWA 4HQQH 4QXUL 3HMXH 1ACYH 2NY0C 1J05A 5C0AB 4M93C 3BUYB 4M6OH 1JK8B 4NQXB 1JTPA 3SGJC 5C0FA 1QSFE 1D9KB 1TZHA 4XNUL 2FATL 3ARYA 4NKDA 4X99B 1NSNH 4QRTB 3QISA 4RMUA 2CUMA 2DI7A 5GRJL 1JZ4A 3OB8A 1BVLB 4LGPB 4KQ4H 1ONQB 2R2CA 3RWIA 3UTSE 3SDDD 1RMFH 1A47A 1CTNA 1T20B 3UZVB 2BHZA 5DEGB 4NT6A 4Z7VF 4XNYL 4KKLD 3C60B 3L3HA 5DURB 4LLUB 3MYJB 1UWXH 4O2EA 1DN0A 5KAQF 1MCDA 1K8IA 2NW2B 5C0IB 2P44B 2IGFH 5JXAL 5HGHA 3HI1B 2D9QB 2VB5A 2DDQH 3FFCD 2X05A 1NGQL 2UYLA 4XX1E 4NGHL 3QQNA 3UTQA 1A3RH 4Z7UF 1FGVL 5EU5A 2Y6SD 4GG6B 2YD5A 1RUMH 4PJXB 4XVTH 5CD5C 1E27B 1ZK9A 1Q94A 3MZGB 1F2QA 4NN6C 2KBGA 3I85A 1IC1A 1KELL 3PDOB 4QTIL 5KSBE 2Y1VA 4OSUL 5IBLC 4J3UA 4XWGH 3FRUA 3QDMA 4JG0L 4GMSH 1IILE 3QXUA 4Z7NE 1MFBH 3L5HA 3BOVA 3VXRE 1A6PA 3U4BL 5FOJA 1U8HA 4FABH 5JO5A 5J7CC 2GCYB 3KPSD 4UIMB 2VQTA 3QEUA 2EDFA 2QQLL 3QUXB 5H2BB 4G6MH 4N9GA 1IKNC 4Y7MA 5MHSE 1MHHB 2P24B 5HYJE 3NCFB 1LP9F 5DC0A 1A64A 5IUSA 2PNDA 1A5FH 2PTTA 3WBDA 1X5KA 3LS4H 5F7MC 3W9EA 1QLRB 3B4NA 1T1XA 2W9DH 3TCLA 5TDNB 1DUYB 1OAYH 5BJTA 5KJRL 4UIKH 1FVEA 5E94B 2E8YA 4MJ2A 3EUUA 5I1KL 3PQYB 5JOFB 1NUDA 2Y07L 5I1EL 2MCG1 1NPUA 4LQFH 1JPST 4KGLA 5BO1L 3S5LG 2HKHL 3CXHK 1T1WA 3SBWA 2WIMA 3GSOA 4ZUTB 1QSVA 1AO7A 2QKIA 1IFHL 1MI5D 3KR3L 3ZDYF 1MHPL 3RA7L 3VXMB 1P84K 1YEFH 4H1LA 2G75A 3PWVB 3CFJB 4I2XB 1KPRA 1BREA 3BP5B 1TQBC 4XPAH 2DQTH 5F7EH 1MCPH 2FX8L 2DMKA 1AD0A 3H9ZA 2JK5B 1V7NL 3GBNL 5C6TL 3GKZA 1QEWB 1WZ1L 3HE7D 4M48L 4XXCA 1FBIL 1Z3GH 5C0BA 3V5HA 4ONOA 4XXDB 2QQQA 5J6GA 3GMNB 2HVKA 1KPUB 1U8PA 1B9ZA 5DI8B 1QLEH 3K2MC 4JE4B 3V7AG 4X98A 2GJ6E 2VDKH 5DMGC 1L9MA 1I1YB 4M5ZL 3WXVL 4KRNA 1RURH 2NZ9D 1JGUL 1DBJL 3IAGC 1DLFL 3SY0B 4UILL 1UVQB 5T3XD 3TWCL 1XCQB 2FDBP 3KYMB 5KSAC 3DBXB 4WWKB 3L5IA 5D5MB 3ARBB 5D7LB 4WUUB 4XVJH 5D6DA 3QNZB 2ICEB 4MQXD 2UUDK 4JPVH 2VABA 3RVWD 1IT9H 3MRBA 4PJBF 1ZLUK 1K2DB 3RVUC 3T1WA 1J7VR 4OGXL 4IDLA 5EU4B 2DL9A 4JFFA 4ZUVA 3E6FA 1CG9B 3BESR 4HFWB 3U7WH 3LEYH 1KEGL 4K3EH 3QUXD 4K71B 3U30B 4HF5L 4LVOC 3UC0L 3G5YB 4RGNC 2QSCH 1M71A 4KJWD 4AYFA 1XGTA 5JA9A 2NY2C 3QXDA 4G6KH 3NPSB 1B4JL 5KOMC 4L29B 1NC2B 2ICES 2JJTC 4GW4B 2DYPA 4X83A 1ZA6B 4Y4FC 1NEUA 3MRJA 5I73B 3OZ9L 4U1JA 5J56B 3IB4A 3WUWA 3V4VL 2KPNA 5A2IH 3IU3A 4NCC1 3GMLA 4YPGA 1C12B 5HYSB 3T0EE 4ZG1A 4BA8A 4UINH 4Y5YB 3PQYD 1BX2B 1T89A 5E2UH 2CLZA 5FGCB 3DGGB 1QSZA 3L95B 2ARJQ 4X0KA 1I9EA 3LZFL 2ZWLT 2ZPKL 4WW1A 1U8KB 4WEBH 4WENB 4P2QD 5KVFL 2ADIB 4HT1H 3O6ML 3ZZ1A 1CDIA 2ZCLH 2AK4D 3RJDA 3LQAH 3TN0B 4U1IA 3HAEG 5AUMB 2C3VB 1EO7A 2Y06H 3UPRB 3NCJH 4FTVE 3EDJA 3EDFA 4KVCL 3UAJC 2Z31C 5E5MA 5TQ2L 3KPPA 4ZPTA 3UEZA 4BFGA 5BRZE 1UG9A 1X5IA 2FX7H 1EEYB 1KJVA 1ZGLM 5JR1H 1NKOA 1SY6A 4XWOD 4YWGL 2NX5B 2LU7A 4GRLA 1DBBH 5LWYH 4M61A 1NC4A 3QBTB 1T66D 1SJHA 5DMKB 4G5ZL 1JYXA 4MA8H 4NO3B 1T03L 4JY6A 4LPXA 5ESVA 3EYSL 1VERA 3WL9A 4U1MB 2AJUH 2J6EA 2E9BA 2EICA 2R8SH 4L8BB 4IRJA 3MV8D 3HRZB 2Z91B 3K1DA 4G3YH 4YDIH 4YDJB 5I6XB 1FNHA 2AI0H 4G8GE 4OI7A 2AEQH 3V6OC 3CFEA 4MD5B 3WSQL 2ATPB 3IJHA 1C7TA 4QWWD 4D0CA 3D48R 3LSOB 3PWPD 4WUUD 2BSSA 1BBJB 3AREA 3NABL 3QJHA 5I16A 1CF8L 2A73B 3SOBH 5GZOC 4FFVD 4HCRL 3SDCC 4DVRL 5IOPA 4BZ2L 1YC8A 2VLRE 4G43B 3DMMD 1IM3A 1CICC 3JV6A 3F12B 3QWRA 1NCAL 4DGYH 2DL2A 4M6ML 4MNHA 4JQXA 1V3KA 1FGNH 4NQSA 1CN4A 1NC2D 5CP3H 1T6WA 3REWB 3U9UB 1L6ZA 2Z8WC 2GSGA 2AQ3A 2P4AB 4POZC 3GSRB 4P9MH 1IGTA 4N0FA 2X1QA 4L1DA 4EN3B 5L6YL 2CIIB 4XNXH 2A0LC 1ADQH 4WFFD 2R0LL 2Z4QB 1ODAA 5DT1L 3G5XA 1GC1C 4JFYB 1TFHA 3MXVL 1S7QB 3BZEB 5EO0B 4K9EH 1JE6A 2HG5A 4JM2F 1UCBH 4DQOL 5D7KD 1I8KA 2DLTA 4PJDE 2QQNH 4PGDA 2NY1B 1MFCH 3QIWC 4AG4L 1KXVC 3GMPB 3NZ8B 3R1GH 3HMXA 1OARL 5FO8B 4WNQB 2IH3A 4NNXA 1OP3H 2WBJB 5EU3A 1PZ5A 4F57H 5F6HJ 3QIUD 5FYJE 4XTRC 5F71A 3QCVL 3SDDA 1N7MH 2BVUA 4L1HA 3ARDB 2Q86B 1U8IA 4MJIB 1U8JA 4LSDA 1Y18A 5E6YA 3UBXB 3JWOC 4WEMB 4WEUD 1HHGB 4U3HA 3ILQC 2BNRB 4WUKH 3W2DH 1BGXL 3F7RA 1Q0YH 3RQ3A 3H42L 3OR7B 2YUZA 3ECBB 4ZQKA 1KNOA 2NX5D 4JZJB 4U3XA 3IF1A 3IDMB 3QFJB 3FT3A 5FA3A 1XZ0A 1NGZB 1I3RB 5F8RC 1OY3B 4FXKB 5IF0B 5EU6E 2BOCB 3K80A 5IHLB 4G6FB 4PS4H 3WJLA 1EEUA 3ABZA 4OZIB 1OAUL 4ZTPL 3H3BC 2NXZD 5CILL 5D7SH 1KB9K 3QUYC 5JW5B 4L4JA 3GDBA 3D9AH 3P77B 4ZUSB 2UY7A 1GGIH 1KCUH 1UXSB 3I02A 1NLBH 4TVPE 1M05A 5FV1L 1EO8H 2XN9A 4WHCA 3SPVB 3HI5H 2FZ3B 1UH2A 1PD6A 4JFDE 3VFRB 2G2RA 4MXQD 1FN4B 3BHBA 4U33A 4EQ3A 1S7VB 4F33B 4HJJH 4PRID 3TNMB 3ZTNL 1I8IB 5FGSA 3WIHL 2VDQL 3VD7A 1VADA 1GGCL 2OJEA 3CH8A 5TQ0H 3BEWA 1EJOH 5I8CA 1R3KB 1BZQK 3BPCB 5EA0L 5CKAA 3VXSD 3SQOH 1Z0MA 3FB6B 2YD9A 2AEPH 3MXWL 3QFDA 4L5FL 4M3KB 4OZGB 4MXWL 4JANA 4C56E 4YHLL 3IFLH 5IW1A 5KSBF 3B3IB 4Z8FL 5CIPB 4R6UA 1QFWL 2VOTA 1S7TA 3GB7A 3QDGB 5BOPA 2ZOKA 5B38G 3KVQA 3PWLB 4Z7NF 5MI0B 3WJJC 3CFBA 3VRLE 3SCMB 3MC0A 4I0PA 4ZFZB 1QVOA 4LGSB 4M7KL 3LQZB 4RDQF 2OR9H 1A4KB 4NJ9L 1IE5A 3FJTA 2IWGA 4G8FA 3S37H 1BECA 4ZUUB 4OGAD 5C6PB 4QOKD 2GW5A 1KC5H 2BMKA 2RFXB 1QBMH 2XY2A 1I75A 4G9FB 1D6VH 1OGAA 1CGUA 1HHIB 3P11L 5CP7B 4JEGB 5BXFA 4CNIA 2IAMD 1OT2A 4AEIL 5MENB 4Y2DB 2PF6A 1DVFA 3K3QA 2H32H 2AJZA 2DLGA 1HHJB 3DSNA 1YMMA 5INDB 4E41D 3VGFA 3JTSA 1EFXB 2V17L 2W60B 3MRHA 3T2OA 3HE7A 3MLXH 4FA8A 1MRFL 1II4E 4DFHA 1XF4B 4Y5XA 3QFJD 4G6JH 3H2WA 3MYZA 2V9TA 1NMBH 4QF1A 1YEEH 2DWDB 1TJIH 4XBGA 4NQDE 4LSVH 3V8CA 4C4KO 3NVQA 1N4XL 4MLIA 4ETQA 3BN9D 4ZSOA 1U8QA 2FIKB 1T83A 1BZ9B 3C08L 1DQQB 1JGLL 3RVTC 4Y19B 1JNLH 2VC2L 3EFFA 4Y5VB 1AXSA 4MA3A 1P4BL 4OLWH 5FV2A 1A1OA 3WIIL 5L0QB 3L1OH 4FNLL 4WGWB 1UM5H 4KQ3L 3VDAA 4TNWF 4PTUA 3RPKA 3ALWA 1B0GB 3KJ6L 3GMOB 4GSDL 3JWNC 5EOTA 5C09D 1TDQA 1X7QA 5HHQA 4ZS7H 2VJXA 4CL7A 5DJ6A 1T4KA 4RWYH 5JHDA 2XOTA 3RX8A 4JHWH 3WE6A 5LGJA 3QUKA 1EXUB 4Z5RB 1B0WA 2A9ML 3LKPA 4KTYA 4NM8H 4XCFL 4X9HA 1T2QH 3NFNA 5BMFH 1ZEAH 4P3DA 3MRCB 2A6DA 9CGTA 3K2UH 1NGYA 4HJ0C 4I18B 2ZP0T 5EH1A 3BO8B 3FO0L 4U0RC 3AC0A 2D9CA 3CZFB 2QBWA 3OAYK 5DK0A 5DMIL 3KHOA 3BSZL 4K3DH 3SCMD 1ZAGA 3PNWB 2WNGA 2CDGB 5DYOA 1KN2L 1MREH 5I1IL 4Z18A 3GRWH 5IB1B 2R2EB 4WHYH 2EYTA 4NWUL 3VXTA 4F7EA 1H0DB 4ISVA 1IGJA 4PY7A 1BEYL 2F58L 1EAPA 5HY9A 2AK4A 4UT7H 4YBLB 5F8QC 5CBEB 4LKCB 2XZAL 4WFHE 3PWUA 4GW5A 4M00A 4P9HC 2BY1A 5LXGH 1NJ9A 4XHQA 5I74C 3X12A 4PJ5E 2DQEH 2P7TA 3T77B 1U91A 3D85B 2OP4H 5GGVH 5CJXA 1I7ZA 1TJHL 4U6HA 5GZND 5HHXH 1ZVSB 3JSSA 5D1QB 3D39E 4XAKD 3HG1D 3HI6H 1YJDH 2D7NA 4PGCB 3RGVD 5CEZL 1CDHA 5C0JB 3OR6B 2GSIB 3IS0X 1ZLUH 3BPOB 4PBVC 1OTTC 5CCKH 1HXMA 2YD8A 5C92A 4WO4C 4FOMA 43CAB 1JYWA 4G42A 4A6YL 1KTDA 2CKBL 1AY1L 2HFEA 5F72S 4HWZB 2ZSWB 4JCLA 1T1YB 4NN5B 4DW2L 3ZKMD 2A83B 1ZVHA 4ZAKA 2QEJA 1LNUA 4Y8AA 2J5LC 4Y19D 3MV8A 1ZE3C 3LN9A 3KYKL 1LE5B 4PUBH 3WEXB 3P0YH 4FQJL 4N8VB 1Y6KR 1V3JA 1U9KA 4W81A 4HIJB 4JO2L 2R0WL 4XPGH 3FHQA 5C08B 1QO3B 3QPXL 1KXQE 5KSUA 2B4CH 2IPTL 2ED7A 3JWOL 3KPNB 4XPFH 4ZUWB 2QADC 2X70A 3I6GA 5F7WC 5CGYC 4RQQA 4QT5A 4W4NA 3BMWA 4HZAA 1UC6A 3I6LD 2KL6A 5FHAH 1U8OA 4HWBH 2VLJB 2NY7L 5E5RB 2F53E 4YXHL 2ZCHH 1T3FB 1FNLA 4CJ0A 4L4VD 3T4YA 1VFOA 2Z8VC 3AROA 4M3JA 3GJFK 2DJSA 4WU7A 1GZPA 2ZUVA 4L8CB 2JB6B 5IHZA 1UH3A 1AI1L 1QRNB 6FABL 4I3RL 3QQ9D 2VLLB 2B5IB 5CP3A 4GXUM 1PQZA 2XNAB 3SDYH 2GY7B 4RSVA 3BPLB 3TYFB 2DQGH 2EKSB 2XACC 3BP4A 3M8OH 5HYIA 3ARGA 4NQEB 1ADQA 1LE9A 5I19L 1S3KH 2NNAB 2OYPA 4NKOA 3F7VA 1MCKA 1RZFL 2DLFH 3G5VB 3VFMB 1JUFB 1WCBA 4KY1L 3JVGA 4NZDA 1KJ3L 2ERJC 3BH8B 5ALCL 4JREC 3FT2A 3NH7L 1XGYL 2GAZB 4FXLA 3KHQA 3VWKB 1MHEA 3MV7B 4ODVL 4ODWB 5JNYA 1TTFA 4MA1C 4CADB 2PO6D 4P48A 4XVUC 4HUXA 5H8DA 4BZ1L 3X14B 1WBYB 1T22B 5HTSA 3RWGB 2WWMD 4OQ1A 2CUIA 4XBEL 1QFUH 2MNUA 1XIWB 3CCHA 4ZPVA 4PJDF 2GKIA 4GG8A 3BZ4B 4XCYA 35C8L 5HDQH 1URLA 2R69H 3O3BB 4XBPA 1CGWA 1JWUB 1NQBA 1YNLH 1CZ8L 1K4CB 3DROB 5HI4C 4KROC 1MPAL 3OKLB 4M03A 3AXLB 4FXGA 4ODBD 1QSEB 4CUCA 3RWDA 1T80A 3OWEA 1JHLH 4GRMA 2NTFA 4J3XA 3S4SG 2EDRA 1Q72H 3DX8A 3EOTH 4DN3L 4UDTA 1FG2A 2B1HL 2V9QA 1ORSA 3PABB 4HUMB 4YXKL 4APQC 2BFVL 4OQTL 1N8ZA 4J3VA 1F3JA 3Q5YA 2M2DA 5F96H 2UZYB 4M7LT 1AH1A 1FZKB 1TJGH 1XR8A 3T0AA 3NPZB 1MUJA 2H6PB 1YEIL 3V6FA 5FDWA 4P49A 2VLKE 3RL2A 3KLAB 2V5YA 2XWBA 2E9WA 3O3UN 4YH6A 1ZT1B 4OZFG 3GO1L 3O3AB 4OZHE 4X4MA 5HGAA 3EO0B 1T0MB 4J8RA 4JPIB 3VXSA 4GKOA 4X9IA 5FYJL 1S5HB 5AEAA 3QEGL 1U6AL 3T2NH 1XGUA 1JPSL 4S1SH 2VE6A 4J1UB 4K8RC 1ZGLB 1U95A 1F02I 2Y5EA 4CW1B 3RHWK 1I1CA 2E3VA 3JWDC 5IROC 4OLYL 3KS0J 1IGFL 3O11B 3KWWA 4Y4HB 3KXFA 5HHNB 3RWCB 3QAZB 4D9RD 1CDJA 1IEAA 4JN1H 5J3HC 1G1YA 5HVHB 3CK0H 5D1ZA 5I8EA 1ZTXH 1I9RL 4OD3H 2FL5A 4ELMA 2E9JA 4PB0L 2NY0B 4YHML 4KAQH 2D7PA 4AQ1B 1EHLH 1U58A 3SDAB 5DJDB 2R9HD 2FLRT 1DQLL 1N59B 1NCTA 2IC2A 2B0SL 5TPWL 3CX5J 5IB2A 1NGPL 2YKLL 1FC1A 4OUOA 5EIQA 1CFBA 2FGWL 2IAMA 1DFBH 3SJVA 3RZCB 4YHYC 3LN4A 3PHQB 1J5OH 1DBKH 3ILPB 1GAFL 2WUCL 5E2VL 4L3EE 1JPTL 4X7CC 3V0VA 5IVXA 2RR3A 3DVGB 4LKXA 2A74B 4DVBB 3MJ9L 4V1DE 5HHOB 5KVEH 2H32A 4CVXB 3LKNA 1VFMA 1AHWA 5E8PA 3GIZL 1BFVH 4Z78A 3BVNA 2H41A 3QCTL 1CD1B 4H5SB 4P46D 1XMWA 8CGTA 2IG2L 1OF2B 4DTGH 5LBSH 1AGDB 3WO3B 4U0QB 3AB0C 4JQIH 5C0CD 5A2FA 5SWZA 2AXJA 2ZSVB 3IXAA 5ICXA 1IEHA 3QCUL 1E4XH 4XC1L 4NN6B 5IR1A 2F54A 1ULVA 4QCIB 4U2YA 1K8DB 1AQDA 3ARVA 3BQUC 4P9HL 4PJFA 5JTWA 4KTDH 1UADC 3DVNB 2APVA 2WLZA 5C09A 2R0KH 1S9WB 1U42A 2EDLA 4CVZA 2OR7A 4BSVB 4TRPH 3VXOB 4MCYA 1UB5A 3U4EA 1YYLH 1HDMB 4DCQB 3EFDL 2X4UA 3G6DH 2EEAA 5GISL 1CLYH 2LVCA 4YIQB 3Q0HA 4KJPC 5B8CB 1NAKH 2CR3A 1TVBB 5BS0B 5IQ7L 1BD2E 1SYVA 4J4PA 2E7CA 2CGRH 4H8WH 2I60L 2ZG3A 5GGQL 3GSNL 2PTUA 5CJQH 4PD4J 4X7EC 4RDQG 1F6FB 4MNGE 2K7PA 1EGJH 1KGCE 4JM2B 4RX4A 4LCYB 5I2IB 5A3ID 4U6XB 3G04B 5BV7H 3B9KA 4G7VL 2P8LB 3UTOA 1HKLH 1FFOA 4F2MA 2ESVE 5ESQB 2PYEA 5DWUH 4P5MA 1NAMH 4BH8B 5DD1L 1NH6A 2Q76A 4FQ1H 4ERSL 2JB5L 3DUHA 3P9MA 1EZVY 4D0DA 4LPVA 3OKKA 3BIBX 5DJYB 4LLYB 1F90L 3B9EA 5J12B 4N0UB 2X4OA 4UDUB 3RIFK 3DRTB 5EC2B 1KEMH 4O2FB 3FB8B 2PXYB 4OFYA 1Q9KA 3B2VL 4M7ZC 1TQBB 2EH8L 3HG1A 4AENB 3LH2H 3RGVA 3L3GB 3P30H 3NZHH 1QSFB 5C9JB 1KLUA 2WIIA 3AS3A 2GEEA 1IARB 3PP3K 5HHME 4I5BA 1GJIA 1RV6X 1RZGA 5BVJB 4JR9L 1KJ2L 1FV1B 1MWAH 4OLVL 4ZXBA 1QFPA 4P5TC 1XF2A 1L7IL 1JWSA 5BZWA 1I1FA 3V6BR 5I1LB 2GUOA 3N1QC 5E6IA 5DK2B 3L7FA 3O8XB 1AJ7H 3A6OA 5FM8A 4WTZG 1JGDA 3CFDB 3K8KA 5CD5D 4WFEE 5DJ0B 3OAYH 3UJJH 3ZLQC 4HV8B 3DIFA 3W39B 4H26A 3DNKA 5GSRA 1K4DA 3V8OA 1FRGH 3LRSB 2IJ0C 5FF6A 1IJ9A 3AGVA 4AQOA 3HB3C 5IBLD 2P43B 3GI8H 3K8LA 5K59E 3BFOA 1KIQA 3K81A 4IOIB 1P53A 1J0IA 1Q9WB 1E6JL 3HZVA 4W4OC 5FOBA 3TO4A 3LKRB 3QHFH 4H88H 5DFWH 1CDGA 3I3EA 3E8UH 4C58B 3MRLA 5D8JH 4YXLH 1T1ZA 5C2BH 2PCPB 3WS6C 2G5BB 4DGIH 1JGEB 5TF0A 4H20L 1RZ7H 2NCMA 4ODTL 3H3PH 3TVMC 1JNHA 4K94C 4X6DE 4C4KT 2V2WA 1FL3A 5FCUL 2Q8BL 4HWBA 4TSBH 2CLRA 5E1AA 5IKCA 4JKPH 4PLKC 1GSMA 5HVGB 4LCCA 1P2CB 1XH3B 2OX5A 1SJEA 2PW1B 4Y4FB 4EIGB 2XPGB 4FZEH 1KIPB 4IRSB 1S9XB 4Y1AB 4LCIH 2R56H 3ULUH 4GUPB 4YR6B 5CEXA 3E6HA 3EO9L 5DJZB 5HBBA 3D6GA 2PW2B 4U1KA 4ZNEA 2W0FB 1QYGH 4TSAH 1G6RH 2R29H 4MA7H 1IAIL 3WIFA 4BUHA 3CFKA 2ENSA 5GQBA 1X4YA 5IIEA 5J0BA 4JFPA 5IG7A 1R3IL 5HYJB 4NKQB 4HWEL 1OAQH 2QL1A 1VA9A 4F3FA 3CX5K 4Y16A 4JRYE 5A40E 2AV7B 4GAFB 1PG7L 1CFVH 1ZV5A 4FQXC 4MXVE 5I1AA 1NFIB 4XP4H 3S6CA 1HINH 3L3KB 4DEPC 3JV0A 4NRXA 4YC2B 2N1KA 1F4YH 5IM7B 4XMLH 1E4XI 2IADA 3NIDE 3PGFH 4JFHD 5D6CB 2C1OA 5F3BB 5DDHB 3L6FA 1RZKC 1TLKA 1UJ3A 2P5WE 5I75C 4P23A 3JUYA 2Q8AL 4JG1L 5F93C 4JFED 1N26A 5EULV 3TJEL 1F5WA 1I3GH 5ISZE 5GIRA 4F15C 1XF3B 4Q7DA 2IF7A 2OM5A 4LSTL 1A3QA 3CSGA 3RGHA 3IT8D 2VERN 1DQTA 1FCGA 3BN3B 4OAWB 5DFTA 1GGBH 3T1FA 4Q6IA 3MJ8B 4Q0XH 4R0LB 2E5EA 3GJFH 4P5KB 5KS9A 2A6JA 4YJZL 3TF7C 4GKNA 3VXNB 3QZWG 1ZT7A 2BNQA 1NCWL 5F3HB 5E56A 1HHKB 5DA0B 4Y0GA 5D70L 3QIBB 5D2LA 2AXGA 5GS0C 1DQJA 1SVCP 3P3YA 3MACH 1VFAA 3BAEH 5MP6L 4OCWL 5KSAD 1RUAL 4D3CH 1BQHA 1RD6A 1KG0A 5KVDH 2BERA 2YK1H 5BVPL 2Y36H 4UTBL 3W0WB 1HZHL 4I3GA 1I7RB 1GVIA 4PP1C 5ADOH 1NBVH 3RVUD 5I0ZA 2F5BH 1C5CL 2BX5A 3C2AL 1NBZB 1YNTB 2VDNH 5I1JL 2XKNB 5E00B 3O4OB 2EE3A 1A0QH 2YD4A 3NFPA 4RGND 2NY2D 1JJUA 3FONA 4OTXH 3A6BL 1I9IH 2HRLA 1IEBA 1S7SB 3MNZB 4LCWA 4X4YB 3O45A 4Y1AD 4W68A 1MQ8A 2HWZL 1IGYA 3C8KA 4JY5L 2YPVH 3WUWG 3D87B 1RULH 5B3JE 4A6YB 4HFUL 3K74B 2CKBB 4OZHF 5I15H 1QPPA 3L3DA 1I7TA 5EZOL 3SQBA 1KB5H 4R26L 3WFHB 1RVFL 4N8CH 2LU4A 3MX0A 3CH1B 4HUKB 2X6MA 5I71B 3V0WH 3MGOA 3QIWB 4X4XA 4FFZL 3RBSA 4S11A 5FGBC 5FAAA 3T8XB 1SEQH 2H26B 3TEUA 1I9JL 5L2KB 5CSZB 5HYQA 3UP1A 5DRWB 4R4FH 3T0EB 5HVFB 2HLAA 1G6VK 3RAJL 3O2DL 5ECJE 4JB9H 2EH7L 3UAJD 2Z31D 1JMZA 1YEGH 4FQLL 2SEBA 3IDNA 1KCVL 3CIQA 4QRPB 5FM5O 1P1ZA 5L7XH 3MJ7B 4JFXA 4POUB 3N06B 3LEVH 4KHXL 1WVZA 1CU4H 1GH7A 4LVNB 1OSPL 3BI9X 2RJMA 3HS0A 2E7LA 1YECH 3MRPA 4XC3L 2P8PB 3OBAA 4IM8A 3QXAA 4PR5B 3TBVA 3C5ZC 5D71L 3BDBA 4C55A 5BRZB 4D94A 3HLAA 4P3CL 3Q6FA 1U3JA 2EYRA 1S9YA 1KIUA 3D0VB 2D7TH 3RL1B 3TCXA 3OGCB 3QXWA 2J88H 1L4IA 4UTAL 3GGWA 3IS1X 5F7UA 3WNKA 2O26U 2I9TA 2DBJA 4DUWA 2VL5A 1H8OA 5T1LB 3X3FL 1RJCA 1BLNB 1FZMA 4X9BA 2VR9A 3IKCB 3WXWH 3W0WD 3HR5A 2AJ3B 2K9UA 5GZOD 1NDMB 3IGAB 4MDIA 4Q58C 3L3IB 3OXRA 3SDCD 3WHXA 4D9QE 4XNZC 4GMTL 2D7OA 3G08A 4EOWL 3H0TA 3U7YL 2IMMA 1G0YR 3I6KB 5FB8B 4Q9BA 1CICD 4OCXH 5AWNL 3TNNB 3V5DA 4EVNB 2VXSL 5C3LD 4HH9A 1JWMA 4LHUA 3GKWL 1GC1H 3EIFA 7FABL 1KLGB 5CEZD 3AU1B 4POZD 1HNGA 2YMXH 4PJEA 5F1IA 3ZL4H 5D7JD 3OV6A 4XPBH 1J0KA 3FCTB 2A0LD 1ETZB 4JPKL 3TM6A 3SEPA 4F58H 1A6TB 5I1HL 1JRHL 3UJIL 3QI9A 5DJ8B 4MD4A 4FZ8H 3KYOB 1I1AC 1B6DA 3OKEA 1PYWB 4ZTOH 1EGJA 1IBGH 3GNMH 3QIWD 5DMYA 2Z92A 4H25A 5JMOC 2LFGA 4ZMAT 2CXKA 1Q8MA 2YPKB 3SE3A 5SWQA 3X13B 4XTRD 1NAMA 3HNVH 1MFAL 3ME0A 4PYGA 5CUSL 3TPUB 4NZUH 3CUPA 2APFA 1IM9A 2X4RA 3VCLB 2DQJL 2A77H 3GSXA 4AT6A 4PJDB 4K94L 3ILQD 1WC7B 5E99L 4OCYH 2X4QA 3VFVA 4NOFA 5GHWH 3LV3A 4HHAA 1G7IB 1QNZH 3CGTA 4FQQB 4BFBD 1JTTA 3WFBH 3PJSB 5DR5H 4PJAB 4YK4C 2YHGA 3FQTB 5K9KA 1MLBB 2D0FA 3H9SD 3VJ6A 5HPOA 3OPZH 2HT4C 4PJGA 1G9NH 1MWAA 2RIKA 3QUYD 3ZE1E 5F88B 4OT1H 4QY8A 4B5EA 1FYTE 3RWJB 3TZVB 1IZJA 1FL6B 3SBWC 2OMNA 3MV9D 1YDPB 5T1LD 3DSFH 1FVCB 4U1GC 3U2SA 4ZDHB 3ZE2E 5EU6B 3VFGH 3C6LB 3FKUS 1DQMH 5GGTL 4EDWH 3S3PA 1MNUH 3MOQA 5IJVB 5LQBL 3JXAA 4PY8J 5DJCA 1MEXL 1GHFH 4QNPE 4XI5C 2IPKA 2F8VA 2E7MA 4F9LA 5C0RH 3O3EB 4BKLA 4EDXA 3HZMA 3BKYH 3G6AA 4OLZL 3GJEA 3RRQA 4JFDB 4HKBA 2EIZA 3TESA 4XXCC 4P2RD 5DD3H 2IAND 5JXEA 4UMGA 4O2CB 4L8SA 3ZYZA 1U8LB 1DE4A 3ES6B 3UTPD 5K59F 3RU8H 5DRNA 4HG4J 1IMHC 4U0RB 4I3SH 4WCYH 2XQBL 2DD8H 5IEKA 5ENWA 4F7MB 2DQDL 3ZO0A 5ID0B 3VGDA 4JAMB 4OJFH 5GS0L 4Q2ZB 4YGVA 1RY7B 4M1GH 1IGCH 5EN2A 2DLEA 2YBRA 3ETBF 5E2TL 5FM4A 1G7LB 4X6DF 1G6RA 1T7XA 4HKZB 2VDOL 1MJ8H 3C5JA 4PGEB 4TPRL 5IK3B 5J11C 5D6DC 5JZ7C 4UZGA 4D0BB 2DWEA 4IIQB 3ARTA 3N85H 4MMZC 2NW3A 2W92A 2VXTH 5EBWB 1CR9H 4RA0C 1HSBA 3OAUL 3PL6B 1NBQA 1DL7L 1IQDA 3MRDA 1RJLB 1YPZB 2BC4B 4BSWB 4ACPA 2MTPA 2VITA 5C0DA 1RZJC 4XAWL 5BOZG 4M7LL 2YEZB 1RFDL 5DEZA 4BFEA 3VXQB 4WO4B 3IFNH 4MXVF 2DAVA 1GIGL 2ITCB 4NRZB 2I5YL 4Q9QH 1IKFH 5AD0B 1KENH 2XFXB 5F9OL 3ELAT 3BUYA 2H1PH 1RK1B 1JK8A 4NQXA 1J1XH 1T89C 3NIDF 4WI5A 1BHGA 4I1NB 2EE9A 4NO5B 3GSNB 4HZLB 4NKIH 4X99A 3RVTD 2YS4A 5I1DB 3MBEB 4RBPH 4QRTA 3QUZA 3ORJA 1MCFA 1T04B 1C1EH 3SKNA 3GJFA 3THMH 4A2LA 2ZJSH 1ONQA 4O9HH 4NQDB 2X4PB 1MH5B 1HOCB 5AZ2L 4YZFE 1T20A 3FFCE 3D3VE 5DEGA 5CD3B 2AK1H 4P59H 3C60A 1N3NB 2FWOA 2NY5H 3KPQA 4LLUA 5FYLH 2HYMA 3QHZH 4BSJA 2E8ZA 3E3QC 4N0YL 5C0IA 3DVFA 2O5ZH 5EZIH 5CAYB 4ZO7A 1W72L 3HI1A 4OFPA 1A6UL 1MJJB 1E6OL 1S5IL 1ZA3A 3PIQB 4GRLC 2HH0H 1IAKA 1MF2H 15C8H 3GMMA 2APTA 4JFQA 4TSCH 5J9PB 1BIHA 3U4AA 4HJ0D 3ULVC 4GG6A 3DX7B 5D72L 1YY9C 2L0DA 4I4WB 4IMLB 4PJXA 2ITDB 3CNKA 5SWSB 2VZ1A 3DXAD 4IRJC 1CT8A 1FNGB 4BQ8A 4EEEA 1Z9OA 4I48A 5CWSB 3CFCH 3KPSE 2GK2A 4FN0A 5E8DL 1NGWB 4JLRB 2MPAL 5LKNA 3EJJX 1RUKH 2Q7YA 2ADGB 1KB5A 4XMPH 5EUOB 3HUJB 4JREB 2I25N 3L5XH 4NUJB 5TGBB 4HUWB 5F1KC 4PJCE 1WEJL 4YDKL 1DBAH 1Q1JH 4LNVA 2JCCE 3VFOB 3CLEL 5CIPH 4NWTH 4UIMA 2QHLA 3ZDXE 1BVKA 3I3BA 3P4NB 5B3JF 4E5XB 5IGXH 3DYOA 3TC9A 1FFPB 3VGAC 2G5RA 5C70A 2EDQA 4N5UA 5C0AE 3LS5H 1TZGL 1LWRA 1XCTB 4JQXC 1QLRA 1P5UA 2G9HA 5DHVH 5TDNA 3VFPA 3WNNA 1EAJA 1KBGH 3G6JA 4UQ3A 4X80H 1HI6B 3TBSB 1OTTD 4PV9A 2EC9T 3O4LB 3OG6B 4KRPB 2GK0A 5MEPB 5E94A 1MI5E 1JHKL 4K7PY 2DMBA 4PJ5B 3MRIB 4RWHA 5GGRY 1Z2KA 2D4FA 1INEH 3ZKXC 1UEYA 3ZHLA 3VG0L 1U92B 3STZA 3DYPA 3VRIB 1KLFA 1EERB 4WY7L 4OF8A 3NMEA 3TLRA 3VXMA 4ALAL 4APQB 1DBML 1DEEB 3PWVA 3CFJA 5IVZB 3NOIA 1SM3L 4WDIB 5E2JA 3BIKB 3JZ7A 5IB3B 4IHOA 4JDZB 4U49A 4MNQB 3RUGA 3S3JA 2VLMD 1D5IL 3HMWL 5C7XL 2MOVA 1FDLL 2JK5A 5KG9B 2QADD 1CE1H 5JW4M 1VGEH 5CJBA 3WKMH 1C8PA 5CGYD 1BWWA 4LSQH 3HNTL 1CXFA 2RHEA 4NZTH 4LLDB 2J7LA 3H9YA 5EZJA 3MGAA 3QQ4B 1CL7L