1ADQL

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
213
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPPGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG4 REA FC
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/autoantigen)
total genus 41
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL01
2IH3B 1FLTX 4HUXA 2IANE 4YDKH 4PRPA 5CJXC 4HUVB 3QHFH 1ORQA 4KRNA 4QOKE 2AQ2A 3GSNB 1OSZB 3KHOA 5KSUB 4LARL 1BQHB 5DMIH 2PTVA 2L7UA 4IRSC 5DDHB 3MV9D 4ODHL 1UM4L 4MNHB 3EOTL 1FVDA 4F57L 2DTML 1FGVL 4HWNA 4KKAC 3D3VA 4ODUB 3U36A 2WUBH 1N3NA 1DQLH 3SKJH 4NQCB 2BHUA 3O4LA 2KUTA 3IS0X 4XMLL 1RZGB 4QWWC 4I48B 3E3QC 4NWUL 2CIKB 1Q72H 2R23A 3PGCB 4PUBH 1Q94B 4PD4J 1NCAL 3QSKB 2P24A 3X3GH 2K3TA 5HPOA 3H8NA 4U33A 3LQAC 2Z91A 32C2B 5ICYA 4IOSD 3GSOA 5EUOA 5TDNA 1QUNA 4GW1A 1KCUL 4JQXA 5DJDA 4EQ2A 4PRPD 4XRCA 2VLRA 3RGVC 1J12A 4PB9L 3C5ZA 5JQ6H 5ACMA 5A2JH 1RHHA 2GSIB 3BISA 5C2BH 4HW6A 2Q8AH 1N6QL 3QCUL 2X4UB 3ZTNL 1QLEL 2QSQA 1E4XH 2JB5H 3LH2H 3G04B 4NO0D 3QXTA 8CGTA 2A74B 2YUXA 2B1HL 2QSVA 4YHOH 5J06A 3OAYK 5T1KA 3D3VD 4QRUA 4ZFFB 5TH2A 3L5IA 2AJVL 4UOW0 2O5XL 3O4LD 4HXBH 1E27B 3PV6A 4NQEB 5JW4R 4YFLI 1T20A 4F9LC 4PGZA 1G7LB 3H9HB 3U6RA 1ZHKB 4G6KH 4LIQL 4ERSL 1RIHH 3TT3H 3O6KL 4F9PA 1JN6B 4UT6L 3GSNL 3KNBB 3H7BA 3HG1E 1H9VA 4XP9H 4G43A 3TIDA 1FYTB 4YGVB 1Z0NA 3GBMH 2DQIL 1V7NL 5ABDE 1F3JA 5EWIL 2Z8WC 3GMOA 2VQTA 5C0AA 4E41B 5EH1A 2LAAA 5I2IA 3V4PL 2HTKC 4I9WD 2VLRD 3S7GA 4FP8H 4OD2B 3C5ZD 3AC0A 1K4DA 1HN1A 1EEYB 3L5HA 4YHNB 3QI9A 1LP9A 3OKOA 1PSKH 5DD5H 3HR5A 1YNTB 1S5IH 1BGXH 3DSFL 3K2MC 1T3FB 1S9XA 3RJDA 1RZJL 1HSBB 3B6SA 3NIGF 1CDJA 2AKRA 3G5YB 1LP9F 1N59A 1FFOA 1F3DH 1Q9LA 4Y4FB 5INDB 1ZGLP 5E24E 3C8DA 4BZ2H 1WSST 4PJ7A 1CL7H 5T1KD 5C08B 2ZJSH 5ALBH 1VEOA 2I07B 5J57B 3F7PC 1F4WH 1QBLL 1JMZA 3MLVH 2P5EA 4PJ7F 1H3TA 5DEZA 4ORGB 1ZA3A 5FO9A 3N85L 4UBDC 1AO7B 4YDKL 4LPXA 3ARRA 4WO4B 4HMEA 5TDOA 3QHFL 5J1TC 5GZOC 2FGWH 4Y2DA 3W0WB 1JWSB 1ZT1A 4N90D 3ZDZE 3BGMA 2J1KA 3N1PC 1CTOA 1AE6H 2XG5A 3GIVB 2FSEA 1FHGA 4TUJB 5FV1L 5C0AD 1I8IB 4Y5YB 2HFFB 1BAFL 1SYSB 1Z2KA 2PW2A 3KPPA 5BZWA 3W9DB 3BP4B 2A9MH 4WV1C 4ETQB 3QI9D 2WUBL 4HIEA 1DQLL 4X4ME 3SKJL 1A7NH 1QSVA 3L3OB 5I30H 5F1NA 5TF1H 4X7EC 1AR2A 3L5WB 3SDDA 1CXFA 3TYFA 1Q72L 1C7TA 2H26A 4PUBL 2WQ8A 3DX8A 1SBSH 4FOMA 1CQYA 4X6BB 2A73B 2NY0C 2EDFA 2PXYA 2WV3A 4HFWA 5F1KC 3LKQB 1NMBH 1BJ1J 4OZHA 3WLWD 4AZ8A 3X3GL 3DWTA 3MTRA 1PKQB 2FJFB 1I1YB 2DB8A 3HZYB 4F2MB 1ZHLB 1MI5E 3EZJB 3MRFB 2DMKA 3HMXA 5CWSB 4DKDC 2OJEA 4OB5H 2P5ED 1KG0A 1KGCD 3DVNB 4OZHF 4OZFA 4JPWH 4NNXA 1GZPA 3BN3B 3WJJA 4YBLB 3RDTB 4H8WL 2YRLA 3SO5A 3LOWA 4Y2DD 2GIYA 4F37K 2D0GA 5A40E 5C2BL 3WJLC 2XTLA 2Q8AL 3GGWB 5EG6C 3FQWB 2Q86B 2E5EA 3BP6B 5JLZB 1CVRA 2JB5L 2ADIB 1A6ZA 3LH2L 1BOYA 4MQSB 3VXNA 3TNMA 5JPMB 1HHJB 2IBGA 4X7DC 5DC9B 1WTLA 5F8QC 2MTPA 1WIPA 4YHOL 4KK9D 2HJLA 1A5FH 4JFFE 2HLAB 4J7RA 3AXLB 1YYLH 4MXVE 4XMPH 4YC2C 3SKNA 3MJ7B 5DTFA 5D5ME 4HXBL 3KPSB 3GSVB 5I15H 1RV6X 3WE6A 3SDDD 3MNZA 2HJFA 3LQMA 3TJEL 2APTA 3QZWB 4EEEA 1L7IH 3TT3L 3P73A 2PXYD 4L4VB 3D69A 4NN7B 3JZ7A 4XP9L 3C08H 1JRHL 1W8OA 4ELME 2NTFA 3GBML 1K4CB 4Y7MA 1A1NB 3IDYB 3HC0B 2OLDA 3WXVH 1QRNE 2E7CA 1AXSB 2XNAA 1QLFA 4FP8L 3RY6A 1MHPH 4PJXB 3L6FA 5DRNA 1L0XA 2W91A 5M94B 1IARB 1HXMB 1DVFB 1NFDE 5CIPA 4OI8A 1PSKL 3ZKMD 3MXVH 4RFEA 5DD5L 1S5IL 3MLSH 1MVUB 1UYWL 3DUSB 1CGYA 5E5MA 4PJEB 5JR1H 3Q1SL 5M95B 3IJYA 4QY8A 4BZ2L 5J11C 2UV3A 1CL7L 1IAOB 4OLVH 5FO7B 1I1CA 4LDEB 3ULUC 3CC5A 2XZQH 2ZJSL 5ALBL 1ZVYA 2G5BA 4PREB 5KSVB 1F45A 5IHUH 3V5HA 3S3SA 3V5KB 1NANI 4EBQH 2CGRH 1F4WL 3SGEH 3MLVL 1UWXK 3B2UC 1EFXB 1WBXA 2DS4A 4X9GA 1QEWA 1ITBB 4NDMB 4YDIH 1P7HL 3WUWB 2F19L 4QHLA 5DXWA 4XBEH 5ID0A 5DC4B 4XNUH 2FGWL 5GGUB 5C7XH 4AQOA 1INEH 1N8ZB 2BFVH 4NQXA 4WWID 3B2VH 4DVRL 3GMNA 4OQTA 2ADJB 5MENB 1AE6L 2DL9A 1M71A 3Q6FA 2VLKA 3FQRB 2P8MB 4XPFH 4WI7A 2YBRA 3PNWB 3T0EC 5JXEA 1KCKA 2MCPH 3PP3K 5TDPB 2A9ML 2BSTA 5BRZB 3OJVC 1T1WB 4ODBD 3SE4A 4LLMA 4RFNC 4P5TA 1EHNA 3HKFA 5I30L 3CFDB 5TF1L 4QTIL 1CD9B 3VE0A 4KMQA 1NPUA 3ULVE 5DLML 3RJQB 4HS8H 1SBSL 3QEUB 5JOEA 4B7IA 1NMBL 2R4RH 1YEDB 2PYFA 4F15B 4XAKD 3HZKB 1JGUL 3IF1A 4CMHC 1HQRA 4FG6D 5HGDB 1L0QA 3FN0H 5LGJB 3ARFA 3FQTB 3SGJC 4P59L 3S3JA 4OB5L 3JV5A 1XIWB 1ZGLB 1P53A 3PWPA 1B6UA 3SHSA 4JPWL 3MRRA 4X7FC 3WO4C 3KYNB 4S2SA 3P77A 2J2ZA 5EUKA 3QPXH 3F58L 5IESH 2JB6B 3QNXB 2G2RA 5C07E 2AJXL 4NRXA 4WHYG 2W9DL 2VLKD 3K46A 5JXED 3IRZA 4LPVA 4DEPC 5HHQB 3BZFB 4TUOA 1QPXA 2YUWA 4CW1A 1U58B 3MRQA 1U8NA 3X17A 4JY4B 2VMFA 4KRLB 1A5FL 3N1GC 1GZQB 5EC1B 3WHXB 3AMLA 2C7UB 4XMPL 4P5TD 1A1OA 3CX5J 2W0KA 3CZJA 4AIOA 4ODXB 5CP7A 5JIPA 3T8XA 4JREB 5KS9B 5DGQA 1YMHA 3ZYJA 2B5IC 2BERA 5SX4H 1OGAA 5I15L 3TP4A 4XBPB 4BSVA 1LDSA 3CVHH 1N6VA 3GMQB 3VRLF 2BHZA 2I27N 1L7IL 1VFMA 1NGXA 2J8UB 5IFHH 1TLKA 1EH9A 1U92B 3H9ZA 4F7CB 5IG7A 3GI8H 4KV5E 3C08L 2Z4QB 3DSNA 3DTXA 1BFTA 5F3BA 1ODAA 1NANH 3ARFD 2NY1D 3C6SA 2I9TA 4AEHH 2NY5L 3PWPD 1RZKC 2NY3B 1GGUA 4U3XA 3WXVL 2WM0A 5F9AC 3R8QA 1BIHA 1XCQB 4FQCH 5HGBB 2V2TA 1JZ7A 2F5BH 5F1OB 5I1GH 1MHPL 3HRZA 1CFTB 3WS6A 2HFGH 3S37H 3BKMH 2R4SH 4PGCB 3QRGH 4OQ1A 5TE4H 1QO3B 3MXVL 4KJWC 1AGCA 5ICZB 2ED7A 3O6FC 4X99A 3WS3B 5JR1L 1QNZL 2NPLX 4P9HH 1U8JA 4HQQL 5L8JB 1BREA 4OLVL 1MJ7H 2JJUA 5H2BA 3TBYA 1JNNH 2AXJA 2VDPH 1J1XL 2XTJB 1JGEB 4HJ0D 4EBQL 4WGVB 2CGRL 1FZMA 4PRAB 1U3JA 3N0PB 1OGAD 2DQUL 1ZVSA 1RUKH 2ICWJ 1A9EA 3HN3A 2N4IA 3G5VB 4LDLB 1KELL 3JWOL 4YDIL 1EEUA 4ZQKA 1S8DB 4XNUL 4I13B 1INEL 2BFVL 4WWKC 3B2VL 2YD6A 4IRJA 1MUJB 3Q5OA 1ONQB 1T6VN 4M7ZC 2UY7A 3J7HA 3NFSH 2L4OA 4X6EB 1P84K 4HWBH 2I9LB 1CFQB 2P5WA 1JNLL 3QDJA 2VLJB 3RTQC 2P49B 5FXCH 2WINA 4HIIB 3VD9A 2UZYB 1U8LB 5BOPA 4M43H 5J8OA 2NXZB 2YUZA 4LLDB 3WXWH 5HDQH 4OI7A 2G5RA 4PJIB 5FM5O 2IQAB 2RFXA 3K1KC 4JO4H 4XVUD 4JFYA 5IB2A 3IKKA 1J8HB 3PHOB 4KI1A 1H5BA 4NKIL 3QUZA 2GITA 1FNFA 4HS8L 2JJSC 5TE7H 3RWJB 4D9RD 2MOVA 2YA2A 3IETB 4M1DH 5D7IB 1CK0H 1FNEB 4XVSH 3RVVC 3UTOA 3WIIH 5JA8B 4GG6A 3FN0L 4F3FA 3UPRB 3CFJA 5FM4A 5I8OH 3V7MA 2ITCA 1WC7B 4H1LB 4K7PH 4XP5H 4PJHB 1KPRA 4ODVH 2NX5A 2OR7A 3DX9B 2IADB 5E08H 1S7XB 3OXRA 4I8DA 1TCRA 4DJMA 3CFIC 2XQYK 5FCUH 1TZIB 3QPXL 5IESL 3GM8A 3IFPB 1N5YH 3HE7B 4IRJD 1EXUA 4R6UA 1M7XA 4KAQH 4P2OB 4RGNB 5KVMC 1G6RH 5CEZD 3NIGE 2P5WD 2JELH 3KPRE 4MVBD 4OF7A 4Y5VA 3QDJD 2VXQH 1K8DB 4EN3A 3LKOA 3MACL 4OI9A 4UIKH 5C0ND 4DVBB 4X4YA 2CQVA 2X1PA 5SWQA 1CLOH 1OW0C 3T09A 1T5XA 3NACL 4N8PA 3MRBB 4FQQA 1I7ZB 1AQKH 1Q9WA 3QO0B 4EUPH 5EBMA 2ITDB 5DYOA 3BIBX 1CLCA 3RP1A 5EOCH 4PRIE 5EFIB 3D9AL 4WFHE 3QUZD 4P0DA 4WUUA 5IFHL 1VFAB 1FH5H 3G5XA 4YHZH 2H9GB 4Y4KA 2P5EE 1HHIA 5FA3A 5EBGA 4F58H 3GI8L 5BV7H 2X4SA 4HDIA 5A2IH 4KJPC 2OL3A 1MH5B 3U79A 2FH8A 4KXZH 3O3AA 3GMRB 1TCMA 3SDXF 3HE6C 4PJFA 4PRDB 5DMKA 4MJ6A 2NX5D 4ZO7A 4FQCL 2UUDH 4G9FB 5DHYB 2RHEA 1D6EB 1I7RB 5I1GL 4HZAA 2HFGL 4RNRB 3PDGA 3QRGL 5TE4L 3RZWA 1UC6A 3CFEB 4GKZA 4JFDB 5EU6B 3P9MB 1S7TA 4GW4A 1G6RB 4HS3A 1I75A 5AD0A 1I7UA 3AB0C 4EN3D 4P9HL 3JV4A 4MJ5A 3MNWA 5FO8A 4GKSA 4HJGB 1MJ7L 1JNNL 3ZKND 1DP0A 2VDPL 2XXCB 1DBAH 1ES0B 3JTSB 4L4TA 3S4SA 2XWTB 2Z9TA 3E6HA 4EUPB 1GCFA 4OZHE 4S0SD 1RUKL 5E6YA 4M7JH 3EDEA 4NM4H 2J6EH 3KXFE 5E2JA 5GSVB 5EZIH 1P7KA 4WUUD 3DRTA 5JW4N 4OAWB 4Y4KD 2ZG1A 5D6DC 3MA9H 4LVEA 3C87A 4UDTA 4ZSOE 1WLHA 3H3BC 5BV7B 4XNZB 5F72S 1F4AA 1JF6A 2DWEA 5E5RB 5HPMA 2BSED 3K8MA 4J12A 1IEBB 4JDVB 3DHMA 3NFSL 5D7JA 1XR8A 3LQAH 3ZT5A 5C1MB 2NY2D 4FQXC 5DK0A 4L1DA 3WSQL 4ZUTA 4FQIH 3BZ4A 1B90A 4KGLA 1RULH 3PDOB 1T7XA 3DXAE 4M43L 2Q3AA 3EYSH 3WXWL 3WEXA 5JZ7C 3KJ6L 5HDQL 1XF5A 5TJWK 3IJSB 2YZ1A 4KJYB 4OZFG 3STZA 3WIHA 4QRSA 4DZ8B 1LEKA 4MYWB 3T2NL 1V3JA 3MRMB 5CGYC 4IMLA 2ESVE 4QEGA 5TE7L 1A6WH 4M61A 4Y16C 4IRSB 1MRFH 3ARGC 1P9MC 2DQHH 3L3GB 2HN7B 4WI5A 4YR6B 1YNKL 1TJGH 1YPZB 2C1OA 1H3XA 4XVSL 1UH3A 3WIIL 3CCHA 2EIZB 3BH8B 4L4TD 2B1AH 4O51A 5I8OL 4R96A 4FXGA 4XP5L 4K7PL 5D2LE 1G9NC 4ODVL 3TPKA 4LRIA 5E08L 5FCUL 3UJIL 5GS0H 2CK0H 1N5YL 2LVCA 1E28B 4YDVA 4CDHA 4PLJC 2EKJA 1QA9A 3ARSA 4P9MH 4KAQL 5D7JD 2VIRA 3B5HA 1G9MC 1OTSC 4XCCH 2NCMA 5D1QC 3V0VB 5IW6A 1G6RL 2JELL 2BNRB 4PJ9A 2F54E 2GTWA 3EOYG 3P11H 4UIKL 4ZS6C 4AH2B 1U8HB 4YX2H 2XKSA 5CKGA 1CLOL 2DQTH 1TJIH 1P4LA 4NO5A 1DLFL 4XP4H 3RGVB 1DBMH 1AQKL 2RJMA 3IXTB 4IJ3C 4FMKA 3IFNH 1HCFX 4RAHA 5IQ9A 5EOCL 4HS6B 5FDWB 1NLDL 3QWRD 3CSYB 1QFWH 1ZLUH 3VXUB 3KLHD 3LMJL 2NY4C 5ENWB 1FH5L 3MREB 3RAJL 1SJXA 3VXMB 2BZDA 4F58L 1EVUA 5BV7L 1GXEA 1S7UA 5C6TH 2X70B 4Z7WE 2WWMD 2BC4B 1LE9A 1HSAB 2A6DB 4GRLC 5HI4D 5I0DA 4JY6B 5CJQH 5ESVB 5HHNA 2F8OA 4UQ3B 1WWWX 1YA5A 1G1CA 4GBXC 5DURD 4ZFOB 3SE8H 2EDLA 2BSSB 5J13C 4OCLC 3FB5A 3AM8A 3TO2A 1TVBB 3RY4A 4PJ9D 4HK0A 4OIIH 5H35A 4OZIE 3QFDA 5T5NF 1CLYH 1Q9KA 4P23B 2E7BA 3OAUH 3RKPA 5JHDE 3T77A 3UTTE 3HNVL 3TCLA 1DBAL 4NKDA 4NQSA 2YPLE 1MCDA 4OV6F 1KJMA 1LEGB 2D2OA 5FKPA 4YHYC 1RIUH 4M7JL 3IDIB 4NM4L 2J6EL 5EZIL 3DV4A 1XGQB 4LCWB 4Y19E 43C9A 3RL1B 3S9DB 4P3DB 1DLHB 2D7OA 5HGAA 1DQJA 2GK2A 2A77H 2ARJA 5BOZG 3L95A 2R2BB 4L8BB 2FO4A 3NGBC 2HFEA 4XP6H 3LQAL 4KQ4H 3DV6A 5HI5C 3UTQB 3VCLB 1MQKH 5EIQA 4JFZH 3HAEH 1CGVA 5CSBA 4S1QL 4FQIL 1HYSD 2W0LA 1RULL 3IGAA 1QVOB 3EYSL 3OJDA 4KK5C 4MJIE 2M8XA 3W2DL 4BK5A 3TO4A 2Y7QB 3LKPA 3UPAA 5MEOA 5D1ZC 1D5BA 1FZOA 3VXPB 3VRLE 4FXKA 5D1XA 5IW1B 4F7PA 4KUZH 5KSAA 4HUKB 1A6WL 5AZEH 4X7CC 5J6GA 2GT9A 4W4OA 5EO1B 3HB3D 1MRFL 2DQHL 5INCA 1BFVL 5I1DB 4WV1B 3GDBA 4HC1A 3WDIA 4C56A 5IKCB 2E27H 2B1AL 2E7LA 2X1OA 1JE6A 3ARYA 2DD8H 5T1MA 2BXYA 2R1XA 2VYRE 3QPQD 2F5AH 1Z6JT 4WIQA 4ZFOL 3QCVH 1XGUA 4HT1H 5GS0L 2YOCA 4XXDA 1WT5A 3DETC 2NY0B 1ZS8B 4MNGE 1AXTL 4P9ML 1MELA 5CGTA 3PWJA 3CVIH 4WHTB 3H0TA 1S7RA 3KVQA 4XCCL 3M8OH 4JQVA 1U36A 1NL0H 2FJHB 3QA3A 1X9QA 4G42A 5JTWA 4LPUA 4L8CB 1T0NA 3HAEB 3P11L 3X12A 2GUOB 4Z7OF 4YX2L 1N3NB 1LO3L 5ESQA 1TJIL 3B9VA 5E8DH 4XP4L 2HG5B 1DBML 4P2YA 1X44A 1FL5A 1TQBC 3TO4D 3TYGL 1U6AH 2W07A 3IFNL 3QEHA 2X41A 3E2HB 2YEZA 4MLIA 4D9RE 3QJHA 1XT5A 5D1XD 1KLUA 5E8NB 3U4EA 4ONHB 1D5XB 1MJ8H 7FABH 3HPJA 3TEUA 5KSAD 4O2EA 5DF0A 5DVOA 4ZMAT 1FZKA 4C56D 5C6TL 3RWCA 5HVFB 3GM0A 5B3NA 3ULUH 1KNOB 2LQRA 4PV9B 1P1ZB 5CJQL 2PNDA 4YC2B 1ZT4A 4JQIH 4XRCB 3MV01 1CLZH 4IS6A 3CXDH 3O45B 3UAJC 4I18A 4GMSH 5J0BA 3SE8L 2FZ3B 5CEZE 2ZNXA 5J1SC 4GXUM 5E2VH 4APQC 2GI7A 5FEBA 1T2JA 1YEEH 5DUBA 1W0YT 4GXVH 1JNJA 2X5PA 4NPYA 4QGYA 4KJQC 1G0XA 4PGEB 4OIIL 3GKWL 1CLYL 1K3ZA 3KPOA 4FRWA 4PJ5A 3OAUL 3ZKSD 1TFHA 4H25B 1U8MB 4J6RH 5AG9A 3RIFF 1U8PA 2BXZA 3EGSA 5JPNA 1FVCB 1V05A 2VDKH 4GH7B 2W59A 1GPOH 1RIUL 1U91A 4OF3A 1WZMA 3TVMA 1RK0A 4PJ8A 3TZVC 3GMMA 3MA7A 3GSRA 2ATPA 1OCWL 4UNVA 1MLBA 4G80B 4L9LA 5LCVL 4LKCA 5ICXA 5C0DB 4WFFD 2X09A 4NHCH 5J11B 1KV3A 2A77L 2N56A 2ID5A 3HLAA 3KPLA 4KQ4L 5I2IB 1WWBX 1QR4A 2GFBB 5IF0A 3HPLB 1MQKL 3EDJA 3LN9A 3MYZA 3ARDA 3F7YB 5K9JH 2VTFA 5FYJU 3OR6A 3QISA 1J11A 1CXLA 3ARBA 1UKSA 4JG1H 4MCYB 4Z9KB 5D2NB 5GGRY 3GHEL 1NBZA 4HUUB 1PBYA 3I6LD 2OX5A 4JZJA 5F7EH 3TNNA 3NCFB 1UZ8A 1NBYA 1Q9LB 1ZHNB 2R8SL 2MHAB 1YUHB 4HPOL 3RWDB 4KUZL 3T0EB 3VH8A 4PJ5D 4KKBD 4ZAKB 5AZEL 1H8NA 4HIJB 4EKXA 1CE6B 1EV2E 5DHVA 4BKLA 4YDLC 4PJDA 3LEXA 4J23A 2K7PA 2H2SD 3BZEA 3H9SE 4JZNB 3SDXE 2A9NL 2IBZY 4RFNB 3TVMD 4PJDF 2DD8L 4PJ8D 3BYYA 2H6PA 4CN6A 1G7IB 5IBUB 2AXFB 4W68A 4D0CA 3QCVL 4HT1L 3C09B 2R29H 5C09E 3U48A 3CVIL 4JHBA 2F53A 4LPTA 4JRXA 3M8OL 3EJZD 1FNAA 3UDWC 4CMHB 4XBGB 2FEEL 3SE3A 2XYCA 1PEZA 1A47A 1OTUC 3RA7L 3X13B 4DKEH 1HXYA 2XN9A 4V1DB 3WO4B 3ARBD 4Z7VA 4XWOC 3O3BA 4G8EB 1ZXQA 1U6AL 2QSCH 1RMFH 3ZO0A 3BUTA 3V52H 4NM8L 3S8WA 3EOAA 4Z7VF 4K3DH 1MJ8L 2VN4A 2BMKB 5EU3A 7FABL 5GGRA 4DEPB 3RVTD 1PFCA 1AHWA 5SWZB 3C8KB 1ZEAH 1CR9H 4HHAB 4D8PB 3ULVC 4L3AA 4LHQB 5FUCE 3TFKD 4IM8A 4G3YH 4P46A 3QUXA 3ULUL 1X5KA 4Q9QH 4UAOC 5IB5A 2OS7A 1SYVB 4JQIL 1YN7A 4HULB 1HCVA 1CLZL 3BIKB 2B5IB 2K9UA 3CXDL 5EO9B 4GMSL 2Z93B 3PF2A 4NKOA 3EYOB 5E2VL 3S4SG 5D7LB 3VDAA 4CBPA 2DI9A 2F53D 4JRXD 5D9SB 4XB8A 5T3ZH 4GXVL 3TNMB 2ZNWA 2CJUH 5KJRH 4J3UA 5F70A 3FONA 3UO1H 2XN9D 4LCCC 4NCDA 1KIPA 4MNQB 3MRDB 3UXFA 1SQ2N 4J6RL 2AGJH 3C60A 1PQZB 2LU4A 4OLWH 4Z77A 4M6OH 2CLVA 1PYWB 3ES6B 5T3XE 5KG9A 4TSBH 3ELAT 2VDKL 1GPOL 5I74B 5BW7A 4XMKH 4Y88A 4I3SH 3FCTB 5DD6A 2NXYC 1QBBA 3D69B 3AY4A 5T1LA 1I1AC 2ZSWA 5IJKA 4RMUA 4Z5RA 1BLNA 3I6GB 2QJDA 2FL5A 4Y4HC 4W81A 4NHCL 3OKDA 4P46D 3QUXD 5FGBA 1J7VR 2R1WA 1Y18B 1WJ3A 1YECH 3RX7A 4AL8H 2QQLH 4WHCA 1IGJB 1W72L 2XNAB 4HAGA 3L6FB 1HI6B 3PL6A 1I4FA 5K9JL 3LAFA 5E2WL 4EDXA 1R0AH 3CSPA 3OB0H 4GKNA 3PG2A 4I2XA 4JG1L 3T0VA 5IFJA 4HLZH 2AV1A 5ALCH 4PLOB 4WWKB 1KB5A 4PJGA 4WU7A 2EZ0D 2I24N 3SCMA 3L3DB 4MD5A 3D39A 4OV5A 3IU3B 5EU4A 4NT6A 1QPPA 3GB7A 3RTQB 3KJ4B 4PJGF 5CZXC 4XPAH 4WY7H 1X4YA 4WW2A 3C60D 3IRPX 1KENH 1J0ZA 2R2CA 3GMPA 3MFFB 4RDQF 4PJBA 1MF2H 5HYSA 2VUOA 5DJZB 5DJ6B 3VA2C 5KSBB 1VGKA 5T1LD 4WW2F 2LFGA 4U3CA 1A1MA 1KN2H 4PJBF 2GTZA 2YPKB 5ERWA 3D25A 4FNLH 3ZL4H 2R56L 4ISVA 4K23H 4OGZA 3RI5K 4U0RC 4J3OC 4QYOA 1EO8H 3BIAX 5ANMA 4ENEC 2R0WH 3S37X 4M7LH 1A2YB 4JJ5B 5FOBB 5FECB 2XFXA 3RZCB 5FYKD 3K3QA 2AABH 3IDNB 4A6YH 3PL6D 2OTWA 3S34L 1I8MA 1RZKL 1NCCH 2Q76A 1TVHA 4DKEL 4JAMA 3BPCB 1A9BB 4LLMB 4U1KB 3RQ3A 2APFA 3HNTH 4OZGB 4RA3A 1Q9OA 3FFCE 1VDGA 2NLJB 2QSCL 1RMFL 3V52L 1XF3B 5K59F 3SCMD 3D39D 4K3DL 5DS8A 1KCSH 2Q87A 1PJ9A 3B8SA 3O2DA 4Z7UA 3MLZH 4OT1H 4LSDA 5DJ0A 1ZEAL 5T5NG 5EULV 3NCMA 2NW3B 1CR9L 3I6KB 4JVPA 1F02I 1PGRB 3ARFB 3NCYP 1LQSR 3LKNB 1R24B 1V5JA 1J0JA 4Z7UF 3L3KB 5C8JB 4Q9QL 5C0RH 4FTVB 4ZUWB 4OUUA 3LZFH 5KW9H 1U0QA 5JUEL 4GOSA 4O02H 5F9OH 3CDGB 1NH6A 1B88A 3P9LA 4F9PC 2XWJB 4LLYB 3QQ4B 3QG6B 3SJVB 4FQ1H 3ZE1F 3U7WH 1G7HB 4MMZC 4AEFA 1IMHC 4NC1E 4Z0XB 4JFQA 3VFMA 4KK8D 4X5LA 4JLRB 5T3ZL 4TUOB 3ESUF 1QSEE 4QTHA 5BZDA 5D7SH 4HKXB 5DJCA 4PV8A 1U41A 2CJUL 1O0VA 3U9UA 5KJRL 4A6YB 1JYXA 3UO1L 5I76A 4X6DA 3O41A 3TM6A 3L7EB 2QADC 3RWIA 3O2WH 2V9TA 5DFVC 2AGJL 5CP7B 3T8XB 1T2QH 2EIEA 5JIIA 2DM2A 4P5KA 4OLWL 2X4TB 4M6OL 1XFPA 4X6DF 3O11A 2WANA 1PZ5A 2GCYA 3UROR 4XMKL 2A38A 4I3SL 3GJEB 2CDEB 4ZXBC 4EI5D 4C56E 3VXSA 3HMWL 5AWNH 1IQDB 1OD7A 3WKMH 2VL5B 5F3BB 3AB0B 2XRAH 4EI6A 3C6SB 3FQXA 2X7LA 1ZWIA 4KUCF 1WISA 3MJ8B 5D6CA 3BEVA 1A3QA 1YECL 4AL8L 2QQLL 3AFLA 2CSPA 5F8RC 4KROC 3SGKC 5F7HA 3PIQA 2EO1A 1BD2E 4XC1H 1X6LA 35C8H 5CEXA 1G9NH 3K8LA 4XCNA 2DWDA 1R0AL 3BRDA 4P57A 2BNQE 4P99A 2YC1A 5ALCL 5AYUH 3OMZA 3HUJA 4BK4A 1IJ9A 3S5LB 5HI3D 1AC6A 2CK2A 1XF2A 1G9MH 3EKCA 2OTUB 3ILPA 4J3TA 5H2BB 5C2UB 4DKAA 1OP9A 1SEBB 3HUJF 4FQXB 4I0PA 3MJ9H 3LQZB 5F7DA 4CKVX 4WY7L 1KPUA 5D93C 1KENL 1BWMA 1I3RB 1MF2L 3ROLA 5JDJA 3P0VL 4QRPE 2GK0B 5E4IA 4XNYH 1PX3A 2ATKA 4F7TA 3QDMA 4EJ1C 3VXSD 4MAUL 1Y6MR 3TBSB 1KN2L 1CGXA 4FNLL 2IF7A 4WU5A 3ZL4L 4K23L 2ZG3A 4NJAH 4Z76A 4BQCA 4JKKA 3MRNB 4Y16B 2R0WL 4M7LL 5IMKA 4XHJD 5GRUH 4ETYA 3ARGB 2P5WB 3D0VB 2OMNA 2EDQA 3HZMA 4G6FD 2AABL 5FKAB 4E42A 4A6YL 3ULSB 1BM3H 3CDFA 5JO5A 1NCCL 5E8OA 2GYSA 3MQIA 3WN5C 1KJVB 2NY6C 2V7HA 3TN0A 3BMVA 3OKEB 2UY6A 3HNTL 1F58H 2BOBA 4XX1E 3KPNA 1NCDH 4UMGA 3L1OH 5E2TH 3UTPD 1JFQL 3OR7B 5DQJB 5JW3H 3HI1B 5AG8A 2IANB 3DYOA 1KCSL 5D1QB 5JA9A 3MLZL 4OT1L 3QXDB 4LVNC 4S1DD 4POUB 4I0PD 2YMXL 4ZOEA 4GG6B 5DC0A 3SKOB 1JYVA 3BDXA 3FOLB 3IAQA 4KRMB 3FZUD 4XX1G 1ZA6A 2R0KH 5C0RL 2QV2A 4WVRA 3U0TB 1II4E 3QDMD 5KW9L 4O02L 5F9OL 4FFZL 4WW1A 2V9QA 5DJYB 5I1HH 4FQ1L 2ARJQ 4BZ1L 3U7WL 3N1MC 5JOFB 2NY4B 1CYGA 4CUCA 1EK3A 5E2UH 5D71H 2Y07H 1TETL 3OGOE 3VWKA 3FFDB 5GRWA 4OCNC 3V79C 5D7SL 3UJJH 5EZJB 4PRBB 3VMPA 1ZTXH 3G08B 4GRLB 4HV8A 4YDJA 3T2PA 1PG7W 3IFLH 3QUYC 4ZPTB 3V4UH 4W6WB 5EU5B 1R3KA 3TN0D 1K85A 1YEKH 3GBNH 3O2WL 3LV3A 3QQ9D 1NGQH 4YIQA 1C5DA 4TOYH 1T2QL 5CS7A 2GSGA 4GBXB 3OTTA 1NC4B 4HUWA 4P3WA 3SPVB 3ZE0E 1J05A 4XXCC 3UBXB 1BBJB 1AFVH 3INUL 4OBSA 4JN1H 5AWNL 4PP2A 3SO3C 1L6ZA 3B9DA 2H8PB 3P4OB 3WKML 2AJZA 1A6UH 3MCLL 2Z8VC 4NZUH 5EOQH 2YN3A 2IPKB 1ZLSH 4P2RE 1KF9B 1UXSA 2VERN 4RIRA 2E7HA 3EYFA 3KPQB 1HKLH 4G8GE 2YA0A 1LO0H 2FD6L 4NJ9H 4R4BA 4YHYB 5IMLB 1G9NL 2BDNH 2K1MA 5FB8B 3RVXD 2FH6A 1W0WB 5AYUL 3VWKD 5C3TA 5DK3A 2FEDD 1URLA 4BZYA 4Z7VE 4CNIA 1Z0MA 3VXOA 1CU4L 1G9ML 3NGBB 3WMSA 4U6HB 4JHAH 3PJSB 4YHPB 3HG1B 4UZGA 3BKCH 1AJ7H 3MJ9L 4X7SH 2D9CA 2W1NA 4WNQB 5IB4B 3ZKXB 2HTLC 3PGDA 3ME0A 2F58H 4PGBA 4YO0A 3VWJC 1VEPA 3TBWB 4XNYL 2HT4C 3EDKA 1IKNA 2ZUQC 4YNYA 2V5TA 5D1ZB 1KTDA 3KYMA 3FT3A 4NJAL 1QACA 5H37G 4DUXA 1D9KC 5BXFB 1F2QA 5B4MD 1Q8MA 5HDOA 4K7FA 4HGWA 4Y89A 1H3WM 3QDAA 2VDQH 3A67L 1DSFH 3F5WB 1L0YA 4YBQD 3ECBA 4LCYA 3DUUB 5IVZB 1J0KA 1UB5B 1EHLH 2J4WH 4X0KA 4C4KO 4U2YA 1VFBA 4AM0B 1F58L 1NCDL 5E2TL 2NY7H 1YNLH 5E6IC 5EOTA 3LN4B 5IEKA 1DE4B 5JW3L 5DEGA 1DFBL 1U93B 3QJFA 5DWUH 4HBQA 4IMLB 4IMKC 3O4OC 4M00A 2AEPH 4CVUA 5EZLB 4L8SC 4X80H 1IGTA 4JVWA 4G6MH 3WL9A 1HK6A 2X4RB 4M1CD 1MY7A 4ODSH 4DWHA 5KBNC 3UCRA 3TBVA 3BDYH 1S9VB 4LNRB 3X3FH 4N9GA 5FM8A 4FXGB 2WWKO 1OTTD 2IH3A 3PWLB 3VFVB 1WBZB 2R0KL 5C0EB 4K8RC 1ND0A 4GRWE 3STLB 3JBG7 1ETZB 1TQBB 1VERA 3REWB 4HUVA 4XZUB 4JPVH 3GSNA 3M17B 1OSZA 4QO1A 4LPYA 5KSUA 5FYKE 1BQHA 2YD1A 5E2UL 5D71L 2Y07L 5I16B 4OFPA 1CVSC 4JRYE 3P2TA 4PJ9B 5DDHA 1IEAB 3UJJL 2YA1A 3AU1B 4MNHA 1VHPA 2FR4B 2GTWB 3TH2T 4AENB 3SEPA 1MCLA 3S6CA 3IFLL 3V4UL 4ODUA 1P4LB 3CK0H 3MRLB 3T0WA 2FO1A 1NGQL 3D39E 1X7QB 3DURB 1ZLVH 1RZGA 4I48A 4K3HA 2BVOB 4APQB 4XVUC 2CIKA 4KDTA 4XNXH 3PGCA 1A7BA 3DVGB 1Q94A 3X11B 4NCC2 4JN1L 4PJBE 3OHXB 1EZVY 1VPOH 5F1IB 4FFWD 2AI0H 32C2A 1A6UL 4MA1C 3TBTA 1R3IH 4LKXB 5T33H 5EOQL 3LEYH 4ZOCA 1TTGA 1A6TA 5HD8D 1AGBB 1ZLSL 4NRYB 5HHNB 4RDQG 3S36X 1BQUA 1T83A 1HKLL 3ROOB 5B8CC 4PLNC 3QH3B 2N7AA 5CBAB 4NJ9L 4JFFB 3V9FA 3UTSE 1QKZH 1K6QH 2QQQA 3HRPA 2GSIA 4OGXH 5DQ9B 3UZVB 2M1KA 1H3GA 1R5VA 1UWGH 3QB7C 2ENYA 3TZVB 5HYSG 4OGAD 4K3JH 5D5MB 2X4UA 3ZE2E 3RUGE 4TNVK 5SWSE 2A74A 5K59E 2EDWA 1JVKA 4YGAB 2XZZA 4JHAL 4ZFFA 5HYIA 2GQHA 5HJ3B 3BKCL 4NQCD 4AJ0A 4ELMB 1F97A 4HBCH 5L2KA 1E27A 4NQEA 5JORB 3CX5K 5FKPB 4Z7UE 3TWCH 1G7LA 3H9HA 1QRNB 1B2WL 3U4BL 3NN8A 1ZHKA 4MZ2A 3SGDI 1OL0A 3FJTA 4WFEE 1FPTH 3QIWA 5BVPH 1JN6A 3DX7B 3KNBA 1LVEA 1NFDB 1FP5A 1T66C 4NOBA 4YGVA 2D4DA 2EXYC 2EDRA 4JN2B 5I1KH 1VESA 3ULVH 3DV6B 2R0ZH 4RBPK 3EYUH 2X4QA 4X8JB 3DO7B 4K3EH 2H32B 3EO0B 4XCFH 3NA9H 4OD2A 1DSFL 4NNPH 4KTEH 1JHTB 1AIFB 1AKJB 1EEYA 4YHNA 1IAMA 2PR4H 1EHLL 2J4WL 4DN3L 3IGAB 3ZYZA 3LKSB 4MA3A 3QXUA 4C55A 4XPGH 4HLJA 2NY7L 3RNKB 1T3FA 2OCFD 1YNLL 5KAQF 1HSBA 3MODH 3G5YA 4MXQC 4Y4FA 5INDA 5D1XB 5MEQB 2C3XA 5DWUL 3AGVA 4JHZA 4HAFA 1TNMA 2AEPL 4HIXH 2GT9B 4X80L 1RVFL 5INCB 2CXGA 2HH0H 2DM4A 4PGJA 3ILQD 4G6ML 2HYMA 2I07A 4ODSL 1S9YB 4DFIA 4NQED 3BDYL 3P4MB 4PG2A 1JNHB 3RRQA 1KEGH 4ORGA 3VRJB 5HYJE 1AO7A 5L8KB 4WO4A 4R7NB 2MMXA 4JPVL 3T04D 1RJYA 4ZNEE 1NDGB 4QF1B 4XCYB 3F12B 1JWSA 4XXDB 1AC0A 2GAZB 3GIVA 4KTYA 3PWJB 1V8HA 4TUJA 2C3WA 1QR1B 4E41D 3ZYIA 2AJ3B 1I8IA 4Y5YA 4OCYH 5BS0E 2HFFA 3VFGH 1E0OB 3GFUA 1SYSA 5ETUB 5BO1L 3W9DA 3BP4A 1ZV5A 4ETQA 3VFTB 2B20A 2DIBA 4Q9CA 3CK0L 1QBMH 4D9LL 5E9DA 1FL5B 4F8QA 3L3OA 1IBGH 5ELIA 2VLLB 3NZ8B 2APVA 3ARZA 3L5WA 4Y4FD 4XNXL 1GOHA 4X6BA 2A73A 3LKQA 2VE6B 3PWUB 1JI1A 3QDGE 1PKQA 2FJFA 4S10A 3HZYA 1ZHLA 5B39B 3QNYB 1EUTA 1VPOL 2P8LB 3MRFA 4HXAH 5C07B 2AI0L 5SV3A 1DUYB 1MJUL 1R3IL 5T33L 3DVNA 4LCCB 2D7MA 4PLKC 5E56A 1ZT4B 2UWEB 1AO7D 2MSPA 5FUCC 4WO4D 5D7KD 5CJ5A 4CMMB 3RDTA 5F7UA 2UVFA 4I18B 4E0RA 2EIBA 5L6YH 4L1HA 1KN4H 3K4AA 4IBLT 3W0WD 1QKZL 2XKUA 3VI3F 1D5IH 5GIRB 4OGXL 4P2QE 2NXYB 1UWGL 3GGWA 1NDMB 3FQWA 4K3JL 2X42A 2Q86A 4FFYH 1I1AB 3BP6A 3GJFH 1W8NA 3B43A 1IGMH 3QBTB 5JPMA 1TZGL 1HHJA 4Y4HB 1V7MH 3KPOB 3K7UA 5DHVH 2FYYB 2HLAA 1OP5K 1U2CA 1IM3B 2KQMA 3AXLA 4E5XB 5E9DD 3MJ7A 4N8VB 3W5NA 4WI9A 3KPSA 4JCMA 3JSSA 4MX7B 4BH7A 1FFRA 5A2KH 5LWYH 3TWCL 3QAZC 2A0LD 2WBJC 4KK6C 5TGBB 3QZWA 3MUHL 3MBEC 4PJ8B 1DQDH 1FPTL 2QEJA 4JKWA 5BVPL 1T7YA 4NGHL 5AEAA 4N0CD 3IDJB 1EJ6A 2XACC 1ADQL 3FRPG 1K4CA 2NZIA 1A1NA 4LSQH 5C3LD 1CBVH 1N4XL 3BWAB 3QUMH 5I1KL 1J1PL 3HC0A 3ULVL 1JGVH 2R0ZL 1BEYH 5C9KA 1AXSA 4K3EL 1BECA 2ZKHL 4XCFL 3NA9L 3RDTD 3ARDB 2PYEB 4NQDA 4KTEL 1HXMA 1WBYB 2O61B 1DVFA 2PR4L 3HI6H 4PR5B 1B9ZA 3MRIB 4PY7B 4XPGL 1NBZB 3GSUB 4PJXF 3DUSA 3TNNB 5J9PB 1UZ8B 4Y2OA 4D94A 1AD0B 3GJFB 4U0RB 3MODL 4PJEA 3HFMH 1IC1A 1NGWB 1UGNA 4NYLB 1FJ1B 2VKWA 2CKBH 4BQ9A 1IAOA 4JKMA 5ISZE 4JDZA 1IAII 4WI6A 5DRXB 5FO7A 3VFWB 1EEZB 1NUGA 4PJEF 2M26A 4PREA 5KSVA 3KPSD 3V5KA 5IMOB 1EFXA 3PP4H 1KEGL 1MFAH 2FBJH 4U49A 4ZNCD 4NDMA 4L4VD 3WUWA 1BVKA 4S1RH 5GGUA 1IC5H 1N8ZA 4G7VH 3DOSA 2ADJA 4TSAH 5MENA 3FQRA 5F7FA 2X1XR 1IZJA 2P8MA 3PNWA 3QUMB 4OCYL 3VFGL 3MPCA 5FGRA 4U1MA 5TDPA 5CEYB 2VQ1B 5IQ7H 2J88H 1T1ZB 5BRZA 1T1WA 4NZTH 1DVFD 1HXYB 3HA0A 3UMTA 2W9EH 3QIUC 4G6AD 3T65B 1HYSC 5DRWA 1QBML 2LVEA 1IBGL 4RAUB 3CFDA 2A6JB 3DMMC 1YN6A 1ZE3C 3EDFA 3T3PF 4X4ZA 1EGJH 3EOAB 5GZNC 3FT4B 3D87B 5GGRB 3QEUA 1AHWB 2CKBB 2IGFH 1YEDA 3HZKA 2J3SA 4WGWB 4X6CE 1EX0A 4F7EB 4HXAL 5LGJA 5DUML 3FQTA 1YJDC 1ZGLA 1EFXD 1XIWA 1WIUA 1IKFH 1ZANH 2QADB 5IB5B 5E7FA 3KPRB 5LQBH 1OD9A 4N5ED 1XCTA 2P46B 4R8WH 1I1FB 3KYNA 2YD2A 4LP4A 1RD6A 4JFHE 3CSBA 5DJ2B 1N7MH 2JB6A 3F6LA 1WCQA 5HHOB 1KN4L 1M7IB 4NKOB 3FQNA 3DARA 2Q7YB 4ZXBB 5MEND 5FYJE 5JOPE 3HTLX 5DT1H 3QO1B 4FFYL 4U1NB 4ZUSB 5HHQA 3BZFA 4X9FA 5FUOH 2XKNB 3FN3A 1V7ML 1U58A 3CH1B 4FFVC 4Z18A 3BEWB 4LGSB 5BRZD 2VN7A 4NC1C 4JY4A 4OFYA 1GZQA 2Z31A 3PQYE 5EC1A 4K94H 4OJFH 3WHXA 4KROB 2C7UA 4URTB 2HAZA 2DQGH 4CRPA 3C60B 1QYGH 1MCIA 4MAYC 1QHOA 4ODXA 5HVGB 1MFNA 5KS9A 2BJMH 1A0QH 2RAMA 4XBPA 3GMQA 3B9KC 4N68A 5E99H 3RWFB 3HI5H 2GJZB 2J8UA 1DQDL 1PAMA 4Z95H 4XCEB 5KS9F 1U92A 4F7CA 2FL5B 2P45B 4TULH 4CVWA 5J6HB 2J8UF 1XIWD 4KKLC 4LSQL 1JZ4A 1CBVL 3QUML 1D5ZB 1BEYL 1XCQA 3RVUD 2O5ZH 5D93B 1JUFB 5HGBA 4BFIB 5I1EH 4OF5A 1CFTA 4EDXB 4PGCA 2DLIA 3HI6L 1SEQH 1T22A 4WTZA 3PGFL 1QO3A 3V4VH 1OT1A 2H3NB 3G9VA 5ICZA 2FB4H 4QT5B 3WS3A 5DVKA 2P44B 2FATH 1IGIH 3KXFB 3HFML 1JGDB 3MUJA 3LRSB 4NQCE 2CKBL 4OFYD 1K2DB 2Z31D 4ZSOB 3GB7B 4GAYB 3RY5A 1BQHG 1P2CB 3MV8B 3CFKB 1JGEA 1FN4B 3FAXA 2WBWB 1FNGA 4PRAA 3WN5B 1OAUH 4L3CB 2NY6B 2IEPA 4XTRC 3PP4L 4GRMB 2NR6C 4M3JA 1MFAL 2AJUL 2FX9H 3LY6A 3G5VA 5CSZB 3BOVA 2XOTA 4ZDHB 1H8OA 2GTZB 4WUKH 4P5MB 1S8DA 4NUJB 4S1RL 2DQCH 5B38B 1IC5L 2F15A 2JLLA 3DXAB 3MLWH 1OM3H 2CDFA 5F9WB 2VABB 4LRNH 1MUJA 1FGNH 1ONQA 4TSAL 1IILE 1O7SA 1I9IH 2NY3D 4X6EA 4AEEA 1LDPH 4MHHI 2I9LA 1CFQA 1FBIH 1JTPA 2VLJA 2AJSH 1OPGL 4P4RB 1MAKA 2ESVB 2W0FB 1A6VH 4GMTH 4HIIA 2J88L 2WW8A 3PHQB 3REVB 1U8LA 4MA8H 4HZLB 4LLDA 3KHQA 4LHUA 1UB6B 4PJIA 2NYYD 1CGWA 4UV7H 3OB8A 4L9DA 2MKLC 1J8HA 1GC1C 25C8L 3PHOA 1EGJL 2X4OB 5D2LB 2KQNA 4GG8B 4PJIF 3RWJA 2ICWI 3O6LH 5GJTH 5JW5B 3OKNB 3VG9B 4K7PY 3IETA 2XTJD 5D7IA 2ZOKB 1FNEA 2XG4A 3FKUS 5E95B 1GVIA 2HT2C 4L29B 2EDYA 3UJTL 3UPRA 3QUYB 1INDH 3MYJB 4RRPG 4B41A 1I8KB 4MA7H 4PRNB 1WC7A 2XQBH 4H1LA 4PJHA 1FYTE 1RZIB 1VCAA 2Y23A 2ADFH 4R8WL 5D7IF 5HDBF 2IADA 1S7XA 3NFPB 2F54B 3TVMC 1TZIA 1U8QB 1N7ML 3IFPA 4E41E 3HE7A 3ARUA 4U7SA 4JFEE 5DT1L 4P2OA 4I3GA 3SO3B 1XH3B 5BZDB 5I1AB 2VLJD 5K93A 5FUOL 1GJIA 4M7KH 4UU9B 1CD8A 1K8DA 3BXNA 4DVBA 2CUHA 2NXZD 1QFPA 1WK0A 3UYOD 3WYRA 4OJFL 1DL7H 3MRBA 1I7ZA 4LHUD 1S78C 2DQGL 3RGHA 3RX5A 4Z7WB 1QYGL 3IS1X 3RKDC 1A3RH 2ITDA 2BJML 1A0QL 3VD5A 1KTRL 4G6JH 5EFIA 1J8HD 3V5DB 3LIZH 5C08E 4PS4H 2X44D 3HI5L 1G9EA 5KAQG 1A7RL 1VFAA 2H9GA 4Z95L 3T0AA 3T4YB 5I1LB 1BVLB 4LLVB 3FTGB 1H3VA 2IBBA 2YD3A 4TULL 2A2QT 1ZWIB 1LO5B 3SOBH 5D7KE 4FXLA 1FL3A 3GMRA 1BMGA 3H2WA 4PRDA 3W0WE 3D5OF 2O5ZL 4G9FA 5DHYA 4OZIB 1D6EA 1I7RA 4NBXB 5I1EL 1HHKB 3PIQB 2GW5A 5JHDB 4K8RH 3HE7D 4RNRA 1SEQL 1BX2B 3UTTB 3ALPA 4M03A 3V4VL 3CFEA 4P2OD 4RGND 4JFDA 2ZUQB 5EU6A 5IVXF 2Y4SA 3MUGB 3QFJE 3P9MA 4IDJL 1M7DB 3N1QC 1MEXH 2YPLB 2FB4L 2VZVA 4A2MA 1G6RA 2CR3A 5IWLC 2FATL 1J86A 1A3LH 5HTSA 1D9KB 3IDXH 4ZTOH 1U8OB 4Y19B 1N2RB 4N0YH 1BBDH 3EDDA 3MOQA 2EE6A 3PXHA 3KAAA 1JIBA 3EO9H 3FL7A 1ES0A 4IIQC 2VDNH 3JTSA 5IUSA 4Y8AA 1OAUL 2XWTA 4J3VA 5C0BE 4EUPA 1MWAH 2D7NA 3JUZA 2FX9L 5GSVA 2W0PA 3CIQA 4FZEL 4HWUA 1CD0A 5E6IB 4OAWA 2DQCL 5JMRA 3MLWL 1OM3L 3RIFK 4M6AA 4LRNL 3C5SA 1FGNL 3O4OB 4WTWA 1IEBA 1FNSH 2BHYA 1I9IL 4JDVA 4L8SB 2VLME 4WFGD 1LDPL 5GRYA 3T0XA 1F2XK 4RQQB 1WAAA 4WRLA 4G9FD 2AJSL 1WIOA 4JO3H 5EOCJ 3L3JB 3QEQE 1GAFH 1A6VL 4GMTL 4KZDH 3PDOA 4M5YH 4CADB 2AP2A 4MA8L 3P9WB 3R0NA 1WAAF 5CJXA 4JFDD 5EU6D 3ESVF 3IJSA 4KJYA 1NCUA 3P0YH 4DZ8A 3MGTB 3FMGH 4EIZC 1JZ8A 1WCBB 3VGAC 4IDLA 3NZHH 4OM0H 3ZHLA 4MZ3A 3RHWK 3MRMA 3JVGC 4FQJH 3DI3B 1UACH 3O6LL 4IRSA 4MS8C 5GJTL 3L3GA 2HN7A 1J1OL 3VGHA 4YR6A 1YPZA 4TNWF 4LBEA 2EIZA 3BH8A 4MNGB 4M4PA 3QXVA 4L4VE 3QNZB 4D9QE 1MWAB 2ADFL 2J6EA 1YPZF 2OP4L 3QQ3B 5BW7C 3GK8L 2CLZA 2ZUSA 2ICWB 5GRVK 3VFUB 4DGIL 3TIEB 3H3KA 4QHKJ 2X9XA 4LARH 5CD5D 3OXSB 4EOWH 1X5JA 4PJXE 5C6WH 3V0VA 2UYLB 3O3DB 1IT9L 3QZWG 1D5MB 2HFTA 4Z7QF 2BNRA 4M7KL 3G6JE 3O8XC 4F57H 3OAZH 1JPFB 1WUNT 4AH2A 1U8HA 2V2XB 2J8OA 3KGRA 3T2QA 1DL7L 4PJEE 3LV3B 3RGVA 2O26U 5B8CB 4AT6B 4Z6AT 1A3RL 3QG7H 4KU1A 4G6JL 5JNYA 4PS4L 5FDWA 3UTZB 1SY6H 3CSYA 3KYKH 5TPWH 5DD3L 3SCMC 3MREA 4IRSD 5DQDH 1G7PB 1GSMA 5FAAA 3VXMA 3HZVB 4J4PA 2AK4E 2X9YA 2X70A 3VRIB 2BC4A 4YPJA 2VDMH 1HSAA 4KKAD 3SOBL 3C9NB 1WFUA 4XP1H 5ESVA 2QHRH 3GEWB 5I0ZA 4UQ3A 4R26H 1QBAA 4F9LA 4K2UL 4G9DA 4K8RL 4ZFOA 3QCUH 5I19H 4LSSH 2BSSA 3OG4B 4ZD3H 5BRZE 3B5TA 9CGTA 5IM7B 1MEXL 2BRQA 1TVBA 3MV7E 1HDMA 2BNRD 5IGXH 1A3LL 2B7DT 3CFBB 3GSQB 5F7LB 1PLGH 4ZTOL 4P23A 1QSFE 3U7YH 1IFHH 4N0YL 4GQPH 1BBDL 1R3LB 5JQHC 2AJVH 3RGVD 3WFCL 3EO9L 3CH8A 4LQFH 3VG0H 2VDNL 5GQBA 2DI8A 2WUCH 3FO1B 1MWAL 1LEGA 1OGTB 1JTOA 1L4IA 1JYNA 5I73C 1OWWA 4OM1H 4PYGA 3IDIA 1XGQA 1IVLA 1PG7X 4LCWA 3TV3L 1EO7A 1OLZA 4UT6H 3GSNH 3RL1A 2XY2A 3WFHA 4P3DA 4ZPVB 3VXMD 4X4XB 4EI5C 1DLHA 4J4PD 2DQIH 1V7NH 5KVFL 1WWCA 3RNQB 2R2BA 4L8BA 1FNSL 2GJ6B 3EYVB 2VZ1A 1MCCA 1X5AA 4XVJH 4HGWB 3NMEA 3BP5B 3UTQA 3VCLA 1UADC 3SDAC 4JO3L 2YPVL 3VGGA 1GAFL 2AAVA 4OSUH 5IHZB 4ZO6A 3TJHC 3VXRE 1SMOA 5GS0D 4CAGA 1QVOA 4FN0A 4POZC 5CJ8A 1SMAA 5DI8B 1SVZA 2YN5A 3H9SB 4ZFZB 2Y7QA 3FMGL 3VXPA 2IAMC 3NZHL 4OM0L 2EKSB 2BCKB 2BSRA 1MHCB 5IW1A 4P23D 4FQJL 5DD0H 4KMTH 1IGTB 1UACL 2Q1EA 5EO1A 4OF0A 1YMMB 5IT2H 2JCCE 1HNFA 4OCRL 5I1DA 4WV1A 5C09B 4HIHB 5IKCA 1I1RA 5GRZA 3N85H 3E8UH 3WNPA 1ND0B 4LCWD 4JM4H 3P0GB 4AEIH 4YH6A 5TQ0L 5IROC 2ZWLT 2H2PC 3S35X 4L8DB 2VWEE 2OJZL 2ICEB 4V2CB 1ZS8A 2X1WL 3G6AB 4EOWL 5T3XH 4WHTA 5HDLA 4N8CL 4DFHA 1BAFH 2FECL 3BN9C 2FJHA 4ZS7L 1KULA 2EECA 3C2SA 4L8CA 3HAEA 1C12B 1TPXB 2GUOA 4UBDD 5F1SA 2IH1B 3BUYB 5B21A 2HG5A 5GZOD 3UZEA 1M4KA 3IFOB 1ZLWK 3LEVL 3QG7L 12E8H 4NWTH 3WJLA 2LAGB 2AW2A 3U82B 1SY6L 5E8NA 1TZHB 4ONHA 1D5XA 3KYKL 2ZUYA 5TPWL 3MRJB 5DQDL 4WTZG 3B3IA 3LS5L 4M62H 3V7AE 4JHWH 3TBTB 3NPSB 2VDML 3MGOA 1KNOA 2GHWB 1A6TB 1I7TB 1G0DA 3BWUC 4PV9A 1P1ZA 4XP1L 5D4QA 3Q5TA 4YPGB 2QHRL 4U05A 1CICC 4H8WH 1U3HC 4R26L 3O45A 5EUOF 2D9QB 4CJ1A 2XPGB 4C59B 3QAZB 2C9AA 4IHOB 2WBJB 2FZ3A 5F44A 1B0RB 3JV6B 1R5VB 3MBEB 5HHME 2NY0D 5I19L 1NGPH 4LSSL 3S96B 5L2JB 4ZD3L 2VAJA 5DMGC 3V7AG 4OFDA 5IGXL 4PGEA 1PLGL 3MCKB 2EE2A 3UYPA 1QRKA 3U7YL 1KJ3H 3PV7A 1IFHL 2XICA 5GRJH 4H25A 1CD1B 1OAYH 1LNUB 1U8MA 4OZ4A 1J8HE 3EAKA 5L2KB 3N50A 3TH3T 4LQFL 3VG0L 4Y5XB 1VA9A 2WUCL 1T4KB 1F00I 1FVCA 1FFQA 3TJEH 3NN8B 2A6KA 4Q9RH 4OM1L 4Z0BH 5HDBE 3QIWB 4LLUB 2CKNA 2QKIB 4HH9B 1JRHH 4M6ML 4YZFF 4G80A 2C5DC 5C0DA 1MHEB 2QBWA 4N1EA 4ZFGH 2R9HC 4XVJL 2X4QB 1QQDB 3MOAH 1OAXH 2PF6A 2GFBA 5D72H 4JZOB 1YJDH 1X4XA 3HPLA 3ZDXF 3F7YA 4OSUL 4K55A 1T03H 4MA3B 4MCYA 5J7CC 1BOGB 5D2NA 1UYWH 4O2CB 4HUUA 1YDPB 4N5UA 1GOGA 3ZTJH 3Q1SH 4NO3B 2CDGB 1ZHNA 4LSTH 2MHAA 1YUHA 3RWDA 3D2UB 3Q2CA 4X98B 5DD0L 3T0EA 4KMTL 4ZAKA 1UG9A 2V6HA 4HIJA 1CE6A 3U7AA 5EORH 3RIAF 5IT2L 2V5RA 2DBJA 1J5OL 3EJYC 3MUZ1 4LMQE 2OI9C 4JZNA 3QIUB 3V0WH 2EICA 5E00B 3E8UL 5E8EB 3CD4A 1HH9A 4LOUC 2F19H 4JM4L 4JG0H 4MSWB 4ORZC 1RJYB 1G7IA 3DMMB 4AEIL 4EQ3A 2AXFA 1A22B 2ILLA 3Q3GB 4DVRH 2JF1A 2RBLA 3V6ZB 4Q7DA 3VFSA 4YBHA 3FFCB 5IVXE 5T3XL 3ULUD 1TIUA 2X10A 8FABA 3HS0B 3NTCH 2MWCA 1W72A 4XBGA 3W82A 1TQCC 1S7QA 1JCKA 3SGJA 2EC8A 3B2UD 3C6LC 5EU6E 2DI7A 3X13A 4JE4B 5E1HB 4RGMC 3F8UB 4V1DA 5E9DB 4MGXA 1QZ1A 1RJLB 4J8RB 4UINH 4G8EA 4QTIH 3V8CA 4IOFC 4UIMB 12E8L 3R0MA 2AXHA 4NWTL 5J89A 4M3KB 4PTUB 2EEDA 5DLMH 3U1SL 2BMKA 4RAVB 3T0ED 1WEJH 4ZAKD 5SWZA 3C8KA 1JGUH 4HHAA 4D8PA 2VZTA 4M62L 4JHWL 4P59H 1MCWM 2VSDA 3SQOL 2IBZX 5ECJE 1QSEB 5IIEB 1SYVA 4MAYB 4R4FH 1OTTC 4Y1AA 2EYSB 3BIKA 2CIIB 3MO1B 3F58H 4E0RB 2RGSA 1PDKA 3B9KB 5EO9A 2Z93A 2AJXH 2W9DH 3EYOA 4AIZB 5D7LA 5E1AB 1NGPL 1P7QA 4M02A 4EUPG 4PYHA 5IJVB 4Q74A 1MNUL 1TENA 1RUMH 5D9SA 4OLZH 1HQ4B 1SJHB 4AK1A 5FHBH 2WBKA 1F4XH 5H94B 5DJAB 3MROB 2JIXB 1C5BH 3CMOL 3IXAB 3OG6B 4WHDA 4GLRI 1KJ3L 1P69B 4V1DD 5GRJL 4MNQA 1OAYL 3MRDA 2EDHA 4LU5H 1KCVH 3V6OE 1PQZA 4BH7B 3KLAB 1DQMH 1PYWA 3ES6A 1RPQA 1EBPA 4G5ZL 4RMRA 4Q9RL 1UQSB 1FSKC 3AAZA 3EFFB 4AMKH 1WZ1H 1YPZE 3FCTA 4Z0BL 1LK3H 1EAJA 5SWZD 1GC1H 1BD2B 1KCRL 4Q2ZB 4S0TD 3I6GA 2NY5H 4JGUA 2BNQB 4ZFGL 1S7VB 1E6OL 4QXUL 1Y18A 4PIRF 2VDOH 2OXHA 1IGJA 4MDIB 4N0UB 3MOAL 1FNLA 1OAXL 5D72L 4Y1AD 1YJDL 3O3UN 4NQDB 1HI6A 4LAQH 1RUQH 1NSNH 2R2EB 1T03L 5D7LD 5C0CB 2N1KA 2MKWA 5LBSH 4QRPB 1YYMH 4WWKA 1QNZH 4GS7C 1F6AB 3L3DA 2JJTC 2D03L 4LSTL 4HQQH 4JDZB 3IU3A 4ELKB 5HGHA 3S97C 4MNQD 2ZZUT 1J1XH 4L3EE 5EORL 3U0PA 1MCWW 3RTQA 5SV4A 3VXUE 4K07A 3MFFA 2DQUH 4TUKH 2IALB 5DJ6A 5DJZA 3V0WL 1AR1D 4HKJB 5A3IC 5KSBA 4ONOA 1XAUA 2EC9T 2XT1B 4KJWD 1KELH 3JWOH 4WJ5B 2YSSB 2HLFC 3OKLB 4JG0L 1BVKB 3D1MC 3QIBC 2YPKA 5IB1B 5FDYA 5KSBF 2JJSA 1JZ6A 2W92A 5SX5H 2QLVB 2PKDA 3CPLB 3DO3A 1A2YA 1YQ2A 4HUNB 3RWEB 4JJ5A 3FHQA 4ZUVA 1JNLH 5FOBA 3NTCL 5FECA 1HKFA 3RZCA 4U1MB 4W6YB 4WEBH 3IDNA 1EO5A 5E8PB 5GS2H 1UFUA 4DKFL 3BPCA 4TTGA 1A9BA 4MXWL 4U1KA 5DRWB 4OZGA 1IL1A 3VD3A 3GKZA 2Y72A 2HJKB 4QHUB 4UINL 1DN0B 2A83A 2NLJA 2OR9H 1H15B 1S5HB 3U4AA 4D3CH 1YN6B 5T3ZD 5MHSE 4WWKD 3WNOA 1XF3A 4NKIH 2YKLH 2DBLH 1VACA 3F7QA 4N0FB 4GUPB 4F8TA 4GLRH 1WEJL 3BT2H 3NIFF 3L3HB 3AREC 2NW3A 3RTQD 3I6KA 1JZ5A 3UX9B 4GSDL 3LKNA 5GGSY 1REIA 1R24A 1BPVA 1OW0A 5DJ8B 3L3KA 4TNVF 5C8JA 1XCTB 1OP3K 2E6JA 4FTVA 4ZUWA 3BAEH 4R4FL 1BQLH 2AEWA 4X8XA 3IAGC 3CDGA 5LGHL 1IC4H 2XWJA 1JMXA 4LLYA 3QQ4A 3QG6A 3SJVA 3FQNB 3VA6A 1NUDA 1DUZA 1G7HA 4OTXH 4Z0XA 3MV9E 3IU4H 4R0LC 3VU2A 2OBGA 1RUML 4JLRA 4OLZL 3RZCD 2I25N 5FHBL 3RVVD 4BUHA 1F4XL 3VFPB 3IAPA 4HKXA 1C5BL 4K9EC 2CRZA 3MACH 4A6YA 5J56B 3P3YA 2Z31B 3FN9A 3HE6A 3NACH 3L7EA 3NIDE 2EDBA 4JFOA 5J4MA 3ALXA 4D0DB 4LU5L 3T08A 1KCVL 3OX8B 2COQA 2XA3A 4OBRA 5EIIB 5EBLB 4GFTB 2X4TA 1DQML 1I3UA 3D9AH 4P2RB 2WK2A 4AMKL 1WZ1L 3GJEA 2CDEA 4G8GB 4Y4FC 1I85C 1LK3L 4U1HB 5KOVC 1G7JA 1GC1L 2AJYH 1IQDA 2VL5A 2YXMA 4M93C 2D7TL 4LEOB 4PRPE 4LQ1A 1K5NB 1BFOB 3MJ8A 5J1AB 2VDOL 1IM9B 4FTVD 1MCBA 1UJTA 1FYHB 4IIQB 3RPIB 1CT8B 4O4YH 3O9WC 4LAQL 1RUQL 1NMAH 3SJVD 3CZFA 1NSNL 4HMDA 5A1AA 1T22B 3E6FB 3QHZH 5HYFA 3KPMB 5JHLH 2OTPA 2ICCA 1P6FA 5GS3A 4X9HA 5D6DA 5LBSL 3D3VE 3S5LA 1YYML 1X5XA 4GRWH 4KJPD 5IBTL 3D0LB 2MQCA 2OTUA 3O3EB 3O4LE 3R06A 3RX8A 3U46B 3HE6D 2X1QA 1SEBA 1JWMB 4FQXA 3LQZA 3TPUB 5F3HB 4C54A 1FNGB 3H3PH 2V5SA 1I3RA 4TUKL 4H1LH 1PW3A 2OYPA 2GK0A 4RZCA 5FF6B 3VXQB 4OD3H 3LS4H 1NGZB 4LCIH 1FORH 4JB9H 3HAEG 1PKOA 2A0LC 1QP1A 4ZYKB 2QTEA 5EUOE 3TBSA 1CF8H 2W60B 2CDFB 5E94B 4I9WE 2FBOJ 2VLRE 1QHPA 3FB8B 3MRNA 2PCPB 4Y16A 1UKTA 5HHPB 1P9MA 3ARGA 3D0VA 3IDGB 1FAIH 3WSQH 5EBWB 5FKAA 4WEBL 1XZ0B 3ULSA 5I71C 2NZ9D 1KJVA 4ODTH 1XR9B 5JW4Q 3OKEA 5A16B 1N0XH 3FT2B 3KJ6H 4LHUB 3AS1A 3AS3A 1NC2B 2OR9L 5E5UB 3OR7A 2OZ4H 5DQJA 3T2NH 4D3CL 3HI1A 3PABB 4FZ8H 4C57C 3SDCC 2IANA 2YKLL 4GRWB 2DBLL 2OQJB 1EERB 5D1QA 3GHBL 3BT2L 3QXDA 4FQXD 1YNKH 4YZFE 3O8XB 3MJ9A 5GS1C 3SKOA 2X89A 4MLSA 4AYFA 2K7QA 3FOLA 2AK1H 1FLRL 2NMSA 5JZ7D 4YEEA 1EVTC 4JRYB 2QSTA 3EHBC 4N90E 3U0TA 4GG6F 3BAEL 3VGDA 1BQLL 1KIRB 3ZDXE 3UJIH 4R3SB 2R39A 4XAWH 5DJYA 1IC4L 4NN7C 5C0AE 3VFNB 2RB8A 2XIDA 5CGYD 1H3UA 4OTXL 3ZT6A 5JOFA 3NCJH 4PB0H 4Y16D 3IU4L 2PO6C 1RZ8B 1L9NA 3ARGD 4CJ0A 1LP9E 4GAJL 3FFDA 4DGVH 5J3HC 5HHXH 4MDJB 5EZJA 3BXNB 4PRBA 4ODWB 5D2NE 4GRLA 3G08A 4GW5B 4I4WB 4UUJB 4P4KB 1U8IA 4ZPTA 3OAYH 4WENB 1XGPB 5EU5A 5IV2A 1DLFH 4PJ7E 4GBXA 3MMEB 1NC4A 3SPVA 1NLDH 4U2ZA 5CINH 3UBXA 4PLJD 4W4NA 2IPTL 2IAND 3A6CL 3LMJH 5DVMA 1BBJA 5F88B 1OTSD 5D1QD 3RAJH 5TFSL 4HKBB 1KGCE 2AJYL 3UTSB 1CTNA 2C3HA 2H8PA 3P4OA 3CNKA 2X89D 4ZS6D 1Z3GH 2DTSA 3X14B 1FL3B 1NUFA 4R2GC 3RUGB 2IPKA 1C08B 4U7KA 3KPQA 3RBSA 1EIBA 2FX7H 4JPKH 1ERNA 3CXHK 5T5FL 4O4YL 3BQUC 4W70A 1XGRB 4O9HH 5EA0H 1T7WA 1NMAL 5IMLA 4LAJH 5FYKU 5I73B 2CUMA 5C0GB 2DJ4A 3NPZB 3QHZL 4PJFF 5IBLC 5JHLL 2NY4D 5FB8A 4NSKB 4TVPH 4DZBB 3RWGB 4D0BB 4H5SB 1W0WA 4NC0B 1PX4A 1LILA 2ZUXA 3IT8D 3KR3H 2ZOLB 4U6XB 3VI4E 5IBUG 5MERB 4GRLD 4U6HA 3PJSA 4YHPA 3KLDA 3HG1A 1UXWB 3A6OA 1BJMA 4V2BA 3HNVH 3SDAB 4WNQA 5IB4A 3BP7B 5HY9B 4GBXD 1HE7A 1NC4D 3H3PL 4TTDC 3BPLC 4UILH 4OD3L 3LS4L 1U8KB 3TBWA 4LCIL 4U6VL 1FORL 4JB9L 4QXWA 2G75B 1Q0YH 1CF8L 5D1ZA 1RUAH 1OT2A 1HHHB 3C5SB 3PWVB 3RL2A 5ESAB 4RWYH 3GUTB 5BXFA 3TA3C 5FYLH 2IMMA 3QCTH 3MOBH 1MIEH 5KTEH 5F9DC 2IFGA 1FAIL 1AD9A 3F5WA 3L7FA 4S1QH 2QL1A 3ZSTA 3DUUA 5IVZA 1UB5A 4ODTL 1N0XL 1UENA 3WBDA 1B0WA 4AM0A 3LB6C 3W2DH 3LN4A 1DE4A 2OZ4L 2P7TB 1U93A 4FZ8L 5CZVL 1V3LA 5HYJB 5IVOA 1HILB 3L9RB 5EZLA 3HG1D 1BFVH 5HI5D 3MLXH 3HC4H 3DIFB 1VADB 5LJYH 2X4RA 4LBEB 4MQ7B 5ID1B 1F4HA 1S9VA 4LNRA 4CN4A 2AK1L 3OBAA 4PP1C 1WTGT 3PWLA 3VFVA 5BS0B 1WBZA 5C0EA 1B4JH 4KK5D 3STLA 3ZDZF 1ETZA 2CLZB 3REWA 1QTYT 3DBXB 4PBWD 2P48B 4QCIB 1RUPH 4XZUA 5K9QG 5D1ZD 4H0IA 4XAWL 3M17A 3V95A 4QRRB 4X4MA 2HVJB 1NGYB 1AXTH 3NCJL 4PB0L 3BW9B 3BPOC 2XZAH 5DFWH 2W65A 3OF6A 2RIKA 5GPRA 5I16A 3VGBA 5DR5H 4DGVL 2EDNA 3WFBH 1IEAA 2VWEC 5HHXL 3AU1A 3DI2B 2B8OT 3IDMB 2BOCB 4AENA 2FR4A 1AH1A 3U30C 3QDGB 1LO3H 1I8LC 4U6YB 3MRLA 1CICB 1FE8H 4PGDB 3CSGA 2VAAB 1MCSA 1U3HB 3TYGH 2Y6SC 1X7QA 3DURA 3ZKQD 1MQ8A 3SKMB 1NCWH 5JNYB 5FUZH 3LSOB 1JK8B 2BVOA 3DETD 5CINL 4XAKE 4APQA 3DVGA 5HGGS 3O6MH 3X11A 2EDJA 3OHXA 3WLBB 5FV2A 1IAIM 3AMKA 4YUEL 2KPNA 2VL4A 5F1IA 4P2QB 1NCNA 3DRQB 3WIFB 5KSBE 4HPYH 5CCKL 2QQNL 2DIAA 1Z3GL 4LKXA 1QFUH 3UPCA 4U4BA 5KN5B 1AGBA 4NRYA 1NBVH 3A0OA 2UZIL 4JFXB 4MJ4A 2MCG1 1S9WB 2FX7L 4JPKL 3ROOA 1X5YA 2VSCA 4EVNB 2VLKE 2QHLA 3QH3A 5CBAA 5FFLA 3CU7A 5EA0L 4O9HL 4NUGL 4JFFA 4G9DB 4I3RH 5C9JB 3K81A 5DQ9A 1FZJB 1YEJH 1LD9B 5LKNA 3TZVA 4TVPL 1E4KC 1JGLH 5D5MA 3OF6D 2YRPA 4XGZB 3CX2A 1BHGA 3KR3L 1HDMB 1X4ZA 3FQUB 1LO4H 2B4CC 2W9LA 3FOMB 3GKWH 4TQEH 1EAPB 2E8YA 5D5MF 2E6QA 3HNSL 3NIFE 1U95B 1OOAA 5HJ3A 1INQA 1DQQB 4ELMA 3LRGA 2EC9U 3LD8C 1RURH 3UAJD 3ZDYF 1F6LL 5JORA 1UWXH 4UILL 4APQD 1QRNA 4RWHA 1B0GB 3JWDC 4KVCH 4ELMF 1A4KB 1Q0YL 3WFHB 4NKQB 1EZVX 5LXGH 3DX7A 1OCWH 1SJEB 3PWPE 1NFDA 1RUAL 4KJQD 5LCVH 5HVWA 2YWYA 4FTVE 4HLZG 1DQTA 1DN2A 4UB0H 4RWYL 4JN2A 5FYLL 4YFDB 1QG3A 3QCTL 1NFDF 3DGGB 3MOBL 1MIEL 4KHTH 2H32A 3EO0A 4X8JA 5KTEL 3DO7A 3Q5YA 3WHE1 3OKKB 4GAFB 3PP3H 5DRZB 3IJHB 2OI9B 1JHTA 1AIFA 1AKJA 3C2AH 3QUKB 4JFFD 5ISZB 2D7QA 3BGFC 3LKSA 1K3IA 3GHEH 3TZVD 3RNKA 2IQ9L 2X2YA 1RFDH 1FFNB 2DKMA 3BO8B 4PG9B 2BSRB 4MD0A 1DBKL 5MEQA 2R8SH 1OARH 3VGEA 4HPOH 5EC2B 2H45A 4U1IB 3UDWA 2DICA 1OGAE 3VXTB 4YE4H 3MLXL 3HC4L 1TQCB 5FYJH 5F7WC 1S9YA 1KFAH 1EEQA 3C6LB 3P4MA 1JNHA 4JDTH 1FG2B 2A9NH 1QRND 3VRJA 1YZZA 1Z9LA 4IOIB 1B4JL 3JTTA 4JM2C 4R7NA 2HT3C 1RUPL 5MP6L 2ICES 1A02N 1NDGA 4QF1A 1MAML 4XCYA 3F12A 1A64A 1FFPB 1BZQK 2GAZA 1ADQA 2RR3A 4QRTB 1A4JB 1EUUA 2XZAL 1JF5A 1CDHA 2JJWA 1QR1A 2AJ3A 5ETUA 3IKCA 5DR5L 2DLGA 4YLQT 3WFBL 3I2CH 1UM6H 5AUMB 5FCSH 1I9RH 1AKJD 3RA7H 4XI5D 3RFZC 3VFTA 5CJBA 1ACYH 1T89C 3ULVF 3KS0H 4X6CB 1FE8L 2DLEA 4RFOH 2VLLA 3KDMB 1UKQA 4QHNB 3NZ8A 1ZHBB 1NCWL 4NM8H 2NNAB 4MB3A 5FUZL 5C0FB 4E9LA 1Q1JL 5AZ2H 3O6ML 4WCYH 2VE6A 3PWUA 1A14L 1FVEB 3B3IB 1UZ6F 2RCSH 3HCVB 2E9JA 3QNYA 4UDUA 1E4XI 3OKMB 2P8LA 5C07A 5B39A 3WD5L 3G5ZB 4HPYL 1LK2B 1DUYA 1OTUD 3MGOB 4NHUB 2GKIA 4R4NC 3S5LG 3W81A 1QFUL 1CG9B 4LCCA 4BJLA 4DUVA 4G7YH 4X7TA 2UWEA 1NBVL 3MRGB 4XWOD 2IJ0C 4CMMA 3PQYB 4OIBA 1FSKB 4I3RL 2P5WE 3K80A 5GIRA 5IHBA 2UWEF 2DKSA 1YEJL 3QDJE 4JGMA 2VR9A 1KB9K 2L0DA 1NDMA 1JGLL 2XXMB 1KBGH 1L6XA 1I1AA 5CMAA 1UJ3C 2ZP0T 3ARQA 3ULVD 4XPHH 1ORSB 5CKAA 4Y4HA 4KPHH 4H88L 1LO4L 1S7SB 4TQEL 4MQXC 1G7QA 5E4EC 1Z9OA 2FYYA 1KCLA 2WAHA 4X5XB 4OZ4B 1IM3A 4E5XA 4N8VA 4OD1H 2VR5A 1RURL 1AP2A 4QNPF 1WFTA 4MX7A 1VENA 1KTLA 4HX1B 1FRGH 4Q6IC 2A6KB 4H0GA 2OK0H 1GGBL 1RJCA 5TGBA 4KV5F 3VJ6B 4GG6E 4KVCL 3TH4T 3V6OC 3W39B 1E4WL 5LXGL 2CPCA 3FB6B 5GGTH 4GS7B 5C07D 3IDJA 1LE5B 4NO0A 2NX5E 4OLXL 1MCEA 1OAZH 3P40A 2C1PB 4UB0L 3BWAA 4LK4A 1MFEH 3WV0A 1W72H 1CL7I 4KHTL 5IMMB 1GIGH 3WUZA 3RHWF 2PYEA 1SHMA 1WBYA 3C2AL 2O61A 5E2WH 2D0HA 4PR5A 2NXYD 5B22A 3MRIA 4NRZB 4PY7A 1J8KA 1I1AD 2G60H 3GSUA 3QIBB 4XB7A 4F7MB 1TMCB 5J9PA 1S7WB 1RFDL 1ZT7B 1AD0A 3GJFA 5F6HJ 4Y4HD 4CVXB 1NGWA 4NYLA 1FJ1A 1OARL 2E8ZA 1CE1H 4DW2H 5I8CB 5DRXA 4YE4L 3VFWA 4K9EH 1EEZA 4N0RA 5FYJL 5FHAH 3SY0B 5IR1A 5C0IB 4HF5L 1KFAL 4WUUE 4EDWL 5IMOA 5J12C 4JDTL 5BJTB 2CMRH 3VFOB 1HH9B 1DR9A 3SBWC 3M1BB 2NW2B 5DO2C 4WEUD 2R56H 2P42B 4PJFE 4U1SB 5E70A 4BYHA 3VFSB 4J4PC 3FB7B 2HKFH 2MPAH 4YHLH 3W9EB 3QXWA 8FABB 3UBXG 5FOJA 3QUMA 3AREB 1T1XB 1AGDB 5CZXD 1W72B 1S7QB 3P4NB 3IVKB 3MLUH 3S34H 1RZKH 3ARDD 3I2CL 1UM6L 2PYED 1OB1B 2VQ1A 5CEYA 3RVWC 1I9RL 1T1ZA 3W11C 4M48H 4M8QA 3B83A 1ACYL 1F11B 3T65A 1R3JB 2V7NB 2KBGA 2VITB 5GS0C 4UT9H 4RAUA 4RFOL 2A6JA 3STBA 4HCRH 4ENED 3FT4A 2V17L 4R0LB 4WDIB 4LDOB 5AZ2L 4WCYL 4L4TE 2CKBA 4PJAB 4TSCH 4QXGH 4DAGH 4IRZL 4U7MA 5ITFB 4P23C 5I17B 5DJXB 1HOCB 2DQFB 1OWRM 2RCSL 2E9BA 4F7EA 1KT2B 2UUDK 2G9HB 3BDBA 4JFEB 2AV7B 4KKCC 4PY8J 3K4DA 4KRPC 3KPRA 2E6PA 4G7YL 4Y1AB 5JUEH 1I1FA 1R3HB 4RMVA 1CWVA 3NCBB 5DJ2A 1I3VA 5HHOA 1XGTB 4TNWK 1M7IA 1U3YA 2YD5A 2Q7YA 4ZXBA 1P7QB 4DOHE 2EH8H 3QO1A 1KBGL 4U1NA 1JPGB 4ZUSA 1YEHH 4NO2A 5IB3A 3T0BA 4XPHL 4PRIA 3ZMRA 5GRXG 5A2FA 4M93B 2EDTA 2XKNA 4KPHL 1J0YA 1K8IB 3CH1A 2X4PB 3BEWA 2O93L 4RSVA 4BSJA 1YEFL 3ZLQC 2VR4A 3SGKA 3O9WB 1QLRB 4OD1L 1FRGL 1NAMH 3AAZB 2OK0L 3V2AR 4HKZB 4Z78A 1JZ2A 3RWFA 1EGJA 2BVQB 2GJZA 3I02B 3UEZA 1NEZB 4M1GH 3DVIA 3HMWH 5DMIL 3O6FB 4XCEA 3MLRH 5GGTL 3D18B 5GXBB 1J9CT 1JYWA 1OAZL 2GJJA 1NEUA 5J6HA 1LEIB 3WFZA 3QFJB 4EXKA 2QADD 1MFEL 3KPRD 3PE9A 1D5ZA 5DFVD 1RIVH 4ZO8A 1JUFA 1GIGL 1HEZB 2MQ0A 4BFIA 4O5LH 3GSWB 5HHOD 1NJ9B 3SGEI 2YRZA 4ZXBD 5IK3B 5F89B 2D31B 1UVQB 5HHVH 5IEHB 43CAB 1IGCH 2G60L 3GRWH 2H3NA 5C0BB 4QT5A 4PRID 4BSWB 4WFHD 1X5FA 2HKHH 2PUQT 3KXFA 4M7ZB 1JGDA 5ACLA 3LRSA 5F7YC 3NCCB 1CE1L 1HH6B 1JV5B 4DW2L 5HGHB 1K2DA 1W2KT 5BVJB 4KROD 3U0PB 4ZSOA 4YAQB 4GAYA 1KXTB 4K9EL 1P2CA 1CXKA 3MV8A 4OKDA 5FHAL 1J87A 3CFKA 5I71B 1FN4A 3WN5A 4L3CA 2YXFA 3P0VH 5TE6H 2CMRL 4GRMA 5JQ6L 1ZKAA 1NAMB 1CFNB 3VMOA 3E2HC 5CSZA 4KHXH 4G8FA 4MAUH 1A6PA 3QEQB 1A7OH 4ZDHA 4P5MA 2P43B 4NUJA 5B38A 4MCZB 3DXAA 1E4XL 1FCGA 3SDCB 4B5EA 2VABA 4NNYB 5F97E 2HKFL 2MPAL 3GMLB 1FIGH 2VISB 1BP3B 4YHLL 4ZUVB 4LFHD 3MRPB 4PBVC 4JQXC 2WMPA 5GS1B 4J3SA 1CFVH 3MLUL 4P4RA 1GH7A 2ESVA 2W0FA 1MCNA 1BIIA 3PHQA 4KI5F 3REVA 3C5ZC 5LAXB 1F5WA 4M48L 3BE1H 4HZLA 1C7SA 4WI4A 1IL1B 1ZLUK 4G6KL 1UB6A 2DMCA 5K9KB 1RIHL 4UT9L 3ZDYE 2A83B 1JFQH 1HHGA 4YJZL 1MCFA 4HCRL 3KXFD 4PRHB 1VACB 2X4OA 5D2LA 1CFBA 2PO6B 4AQ1B 4MMXC 4GG8A 3CAFA 1DDHB 4TSCL 1VFUA 3H7LA 4QXGL 4DAGL 1KJ2H 2YMXH 3MJGX 5JW5A 3OKNA 3MV8D 2ZOKA 5D2LF 4OIAA 4L29A 5DMYA 3QUYA 2NY6D 3MYJA 1I8KA 4PRNA 1ITCA 1RZIA 3MRHB 2GY7B 3G6JB 1UH4A 3NFPA 4FFZH 2F54A 1BGXL 1U8QA 3DXAD 4XXCA 4BZ1H 1DUZB 5SX4I 3QULB 4KMLB 2EH8L 2YHGA 4KI5D 2YD4A 1TETH 4JFPA 3MSPA 1YEHL 3BI9X 1UEYA 1XH3A 4NN6C 2C4FT 5I1AA 4JRWA 1HWGB 2FJGB 1JWUB 1F42A 4UU9A 3T3MF 2ESVD 5F96H 4R2GB 3U2SB 3ARVA 2CLRB 3HE6B 2ZG2A 2V2WB 4JFOB 4Z7NF 5MI0C 3QI9C 1XMWA 2AK4B 4Y8DC 3T4AB 4Z7WA 2Z0BA 3BQUB 3G6DH 4KGJA 5D2NC 4YFEA 3V5DA 1NAML 5F6IC 3QT2A 3INUH 4M1GL 4Z7WF 1QOKA 4K7PX 4R7DB 1G7JB 2FRGP 3T4YA 5I1LA 3MLRL 3WLWC 1KJ2B 1BVLA 4XPBH 4LLVA 4ZAKC 5C92A 3FTGA 5KZCB 3HHRB 3MCLH 4CVZB 1RU9H 3QUYD 1LO5A 1VFOA 4RGOH 3EYQD 1IZKA 5HYQB 4TRPH 3MV7B 1RIVL 1UA6H 3DUHA 4OZIA 2F54D 1A7NL 2FD6H 1HHKA 3BPLB 5GGSB 1QSFB 4O5LL 3MLTB 1R5WB 4Z7OE 3CZFB 1KPVB 5JHDA 4B50A 3VWJA 2YD8A 4Y2DC 1BX2A 3UTTA 5HHVL 3C09C 5CBEB 2DMBA 4OZIF 3CUPB 3MUGA 1IGCL 1M7DA 3GRWL 2KL6A 2YPLA 4KQ3H 1LMKA 1T0MB 2HKHL 1CU4H 3FO9A 1D9KA 1U8OA 3R06B 4Y19A 4NN5C 3TA3B 4BQ8A 3ET9F 4QRQB 1N2RA 4KK9C 3VFRB 3CU1A 1UZ6E 1DEDA 1O7VA 1C5CH 1CXIA 4TN9A 3BESR 5DZOA 2LTQC 5TE6L 4FHBD 4Z8FH 4RZCB 5ACZB 5I1IH 3SDDC 4PJCB 2XZCH 4KHXL 4WFFE 5E6IA 1A7OL 2PXYC 3FO0H 3VXRB 3WCYA 1Y0LB 5CP3H 1IGYA 2UWEE 1B4RA 3LKRB