1ADQL

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
213
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPPGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/autoantigen)
molecule keywords IGG4 REA FC
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
total genus 41
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL01
4NHCH 1KEGH 1U8HB 4X6FB 4N8CH 1FHGA 2ZKHL 2YPKB 3L3OB 1I3RB 3LH2L 1ZA3B 4GMTL 4J6RL 3RNKB 3E8UH 1S9WB 4XP6H 3GI8L 2BSTB 3FMGL 4IRJC 2VE6A 1FO0A 1TIUA 4MNGB 1F8TH 2Y23A 5F8QC 1E4KC 3LV3A 4WVRA 5TQ0L 4EOWL 1E4JA 4HIXL 1BQLL 3PUCA 2O93L 4ZFOB 2H32H 5ITBH 2A9NL 3A6BL 4NUGH 5GSRA 4JFYB 1Z9OA 3VRJA 4M00A 2WBJB 4WW2B 3MBXH 3VFVA 3H9SE 3SQBA 5CSZA 4X7FC 2JB5L 2DLHA 4PGEA 2E9IA 4NJAH 3U46B 3VDAA 4EXKA 5DR5L 3H9SA 5D1ZA 3MXWH 3TZVB 1WT5A 1MHHA 4Q9BA 3WNNA 1NMAL 3OKDA 1F4WL 3BMWA 5DUBA 5D1XB 4JRYB 3FKUS 3LKNA 5JDSA 4KZDL 1MEXH 4S1RH 2X9XA 5FYJE 2A6IA 4DVRH 5K9OA 5TE6L 2VLRD 2H6PA 4HUWA 4KPHL 3DRTB 2EH8H 2VDPL 4KXZH 4OLYL 1YEIL 5T1KD 4XP4L 4P57B 2Y5TB 1JI1A 4X6DF 3BYTA 4WNQA 3MV8A 1IC5H 1DN2A 2ADIA 4QRSB 1PG7H 3S6CA 3VFTA 4E5XB 4MXQC 3BEVA 5T3ZD 5D1QD 1BREA 4PJDF 3OJ2C 5BV7B 2LVCA 1P7HL 1YMMB 1MPAH 1GHFH 1IGIH 3MZTA 5SX4H 1B2WH 1QRND 2NYYC 1NGXA 3ARTA 4LHUB 4NN7C 2LTQC 5IROC 3IJHB 3HCVA 4XNMA 3GSUA 1TZIB 3L7EB 4NBYB 4XXCC 4KTDH 4NRXB 5C1MB 2PR4L 1KCVL 2A74A 4KKLC 1TTGA 1TNNA 1U41A 1CFVL 4MJIB 4Y19B 1KIQB 4KKNA 2P8PA 3S35L 3KHOA 1TZGH 2A0LD 2IPTH 4HIEA 1CR9L 1RJLA 3BMVA 4ODTL 5DHVH 1EAJA 5D70L 4QLRA 4ZQKA 3MJ7A 5LGJB 3QQ9C 1XF4A 2YD9A 5F93C 1ZHKA 2R0LH 3CCHA 4DGVH 1QBLL 2W0FA 1BFSA 3GUTA 1CFTA 4MDIB 1W0VA 3QHZH 1MWAA 1ZSDB 3GSQA 3MRQB 4MD0B 3V6FA 5C0CA 3GNMH 4I0PA 4QRTB 5IESL 5IVNA 5K59E 1IQDB 4YPGB 3I3DA 5JIIA 4NOBA 2Y9RT 3HZYA 3D2UA 2H1PH 4WWKC 4G7VL 5LGHL 4Y2OA 2R1WA 3G6JB 1AGBA 1B4JL 2GAZA 3BDBA 3IXTB 1INEH 5CKAA 5D7IA 4HWBH 4HUUA 4LF3A 2FIKA 5BJTA 1HHHA 3IJSA 4WTZG 3ARDD 4P23D 3D25A 4I4WB 3BP4A 1VFMA 1NEZB 4LPCA 2DM2A 1G9ML 3ARDC 1UZ6F 3OR7A 5DD6B 1V8HA 3UX9B 4EI6B 3MODH 1I8LA 25C8H 2IH3B 3E2HC 1YN7A 3BP6B 2VZ3A 1OAYL 4X98A 2CQVA 3L3KA 3KWWA 2EDBA 3MRLB 5D7KD 3MJGX 2CIKB 3QNXB 4QOKA 1NC2D 3V6OE 4M62H 5IHZA 2F58H 5HHXL 3ZKMD 4OT1L 3I02B 4PPTA 4PJ9A 3O2DA 3AUVA 5I8KH 5FDWA 2EYSA 5K9QI 4PJ8B 3PDOA 2OL3A 3ZE2E 2XTJE 1N6VA 4R9HA 4GFTB 1FNSL 1CDHA 1GGTA 4AM0B 4KROD 1CTOA 1Q1JH 1QPPA 1RJYB 2LFGA 3IFOB 3JSSA 3IDGA 2VISB 2GCYB 3GJFK 4M7LL 5D5ME 4WHDA 3FN3A 5JNYB 5HGAA 1FLRH 3I3EA 4XMLL 1LEIA 2YSSA 4NKDB 3QJFB 4J8RB 4WI3A 3SJVE 1S7VA 3UP1A 3KPMA 1GGIL 5DRZA 1HQRB 2VDML 1C12A 4HXBL 4Y4HC 3GSNA 3SJVA 5BZWB 2CMRL 5KSUA 4ZDHB 3DUSA 4JQVC 1KLGA 2MCPH 3DI3B 4RFOH 2CR6A 4FN0A 1MCBA 5EBWA 4RGNC 3GMQB 3GKWL 4U1HB 1UJ3A 1XCQB 4HS6B 3P11H 4PJDA 4NKMA 5C2BH 1NCNA 4K3DL 5ADPH 5E8PA 1XMWA 3BOVA 3HC0B 4NQDB 5I1IL 3AREC 2IH1A 5B39A 3RZCA 1A4KA 3FO0H 2CUMA 15C8L 4UIKL 1I75A 4UV4H 1KB9J 4F7EA 4JFOB 1PKOA 5EO9B 3BFOA 4YHZH 3IDUA 4LLAA 3SKOB 1DP0A 1UB5B 4G5ZL 1CQKA 1HWGB 1JNNL 1QTYT 2CPCA 3NFNA 3UTTD 3RU8H 3QUXC 2X7LA 2UY7A 4L4VD 4WHTB 5F1IB 1HE7A 1MH5B 5LCVH 3Q2CA 4OFYA 4XMPL 4OKVB 3OGCA 2YC1A 2HFEA 1FSKC 3FT2B 4N8PA 4J3VA 4S0SD 3TPUB 1GSMA 2FR4B 3U30C 4I0PD 3QI9B 1CE6A 4NZJA 4ERSH 1KNOB 4F7CA 1J8HD 1YEGL 1DBAH 2EIBA 4A6YH 3D2UD 1AKJB 3I9GL 1WVZA 2Q86B 1YY9D 4KJWC 2AK4E 2HVKA 5ESQA 3WXVH 3EJYD 4QXGH 2H41A 1YNKL 1Z6JT 2Q87A 4XAKD 2AK4A 3TBWA 1E6JL 3ARWA 4ZFGH 3UO1H 1JJUA 1QFOA 3AY4A 3P2TA 1X4ZA 4GO6B 2NY3D 5IQ9A 4CVXB 1QA9B 2GTZB 3L5WA 4WDIB 4ZUVA 1I9IH 4R0LC 5I71B 2E27H 3ULVF 4CW1A 3RI5F 4UINL 1LVEA 2GJJA 2X2YA 3ARFC 4CVUA 5CAYB 1H8SA 2FL5B 1NCAL 3LKSB 2Q7YB 1R5VA 3MJ6A 4PGCA 4KTYA 4XVUC 3QEUB 5E56A 1Q9WA 2FJGA 1YJDH 4U0RC 3DMMA 2AV7B 2Y7QA 2GIYA 1RZFH 2K9UA 5CS7A 3MBEC 4HFUL 5C86A 1ZAGA 5INCB 3FONA 3D39A 5FDYA 3X13A 4K3EL 1J0YA 5C07D 4X5XA 3NCCB 1UKSA 1KELH 4Q6IB 4M7ZB 4F7TA 1V7ML 3BE1H 4LCWE 5DD3H 4JREC 4F33A 3JVGA 4QT5B 1IGMH 2FATH 1P7QB 3VXME 4LCWA 1WFNA 4KMLB 3JV5A 3SQOL 1HCFX 4ZS6D 5DHYB 1RMFL 4H1LB 3VXMA 4EI5A 4MAUH 3T2PA 1F90L 8FABA 1T66C 3VA2C 5B8CC 2DN7A 2IALA 3FHQA 3QBTB 3ZYZA 4C4KT 1UWGL 4JZNA 5KS9B 5HDLA 3IAGC 3QPXH 2EDXA 3F7QA 1S7SB 5EG6C 5GGUB 3BPOB 4GUPB 4JVUA 1H8OA 4JO2L 1A7RH 5D2NB 5DD0L 3EYFA 4UOW0 4DTGH 3RZCD 3RWFA 2GT9B 5CP3H 3BX7C 3U2SA 3G6AA 1V7NH 1VSCA 5J12C 5DUPH 2AEQL 3H42H 2OTUB 3SCMB 1DLFH 3ULUF 4J23A 3PHQA 2I9LB 5GS2D 2DBLL 4R7DA 4D0BB 4B41A 1XF2A 4ONHA 1T4KA 4OLZH 4RQQB 1KCRL 1JGDA 3VE0A 5J13C 1GZPA 5DRNB 1I7ZB 3QDMD 5IB4B 1EFXA 4MNQA 3T4AB 5IM7A 4YXKH 1BZ9B 1LO0L 2X4OB 3AAZB 4HX1B 1W0WB 5K33A 4OFYD 3ROLB 2X9YA 1GC1H 1CK0L 2XQYG 5SX5K 1OAXH 1NGZB 5HHPA 2XQBH 4R3SA 3BT2L 1Q94B 1S7XB 4YHNA 1I9RL 1MFCH 3C5SA 3V4UH 3RUGE 4E41B 3GK8L 4YAQB 1NBZB 3OKNA 3RUGA 3DETC 1FH5L 3P4NA 5C09E 2MCG1 1CCZA 1Z3GH 4U1IA 4RFEB 5DJ8A 1P69B 3SDDB 2B1HL 4OFKA 4D9RE 2QL1A 1CWVA 3WL9B 3QCUL 2IQAA 3WBDA 2YA1A 3DX9A 3UZVB 3VFSB 3DV6A 2BY3A 4M1CD 3DVIA 4YC2B 4MVBC 4TVPH 1H0DB 1L0QA 2VQ1A 3PE9A 1OP3K 1I9JH 1G6RB 4U1JA 5H2BB 4ZODA 5C0BA 5M95B 4ZFZB 3UAJC 1MJJA 4PY7A 2D7MA 2DQHH 2UV3A 3A67H 3LKRB 3U0TB 3WLBB 3P4MA 4OCXH 3VDBA 1GZQA 4P2RB 3NPSC 2SEBA 3GJFA 2BCKB 2NR6D 2Z8RA 3A6CL 5T1DL 5MENE 3DUUB 4F37K 3I75B 1NDMA 2W65A 5T3XH 4HMEA 4OLWL 4D9LH 5IMOB 3D39D 2EZ0D 5HYSA 4UIMA 1IRAY 3L7FB 1LO5B 1RFDH 5INDB 5MERB 5KJRL 2BERA 3R0MA 1MRDH 4DQOL 1SM3H 2Y06H 1I8KB 2IANB 3PABA 4U6TA 2Q8AL 2VDRH 1FIGH 1WC7B 4P5TA 1PKQB 4PTTB 1RU9L 3REVB 3QFJD 3L9RB 4W4OC 4EI5D 3EGSB 4GSDH 3MLXL 1H3WM 3KPPA 5DGQA 4DZBB 1MCJA 1CGTA 3UTZB 5IB2A 2Z31A 1OTUD 43CAA 1AO7A 4M93C 4LSPL 3FFCA 4QTHA 4P4KB 4F80A 3MLTA 4YQXH 3RL1B 1KGCD 1KCUL 2F53E 1FZJB 2I07A 2BNRB 1ES0A 2DQGH 1KCSH 2HYMA 2NMSA 4FRWA 4MB5A 5JIHA 5JUEL 4QTIH 5I19H 3I50L 4J4PC 1GPOL 5TH2A 3RL2A 5L9DH 3CDFA 4NNYB 1CD0A 3IJYB 4R4FL 3Q6FB 3S9DB 5T5NG 1MVFA 3MLPA 1YQVH 3RGVB 2DMBA 1IAKA 4JG1H 1WZKA 4L3EB 2HVJB 4GKSB 4EIZC 5EORL 4I18A 3O8XA 1EFXD 2BOBA 5C0GA 3TV3H 1D5IL 4I2XB 2RGSA 4WW2C 3C8KA 5FKPA 2PYFB 5SWSE 5EFIB 1LO2L 3HZKA 1FE8H 5FM4A 2BNQA 3TZVC 1FFNB 4GAJL 3RJDA 4JFZL 2X4QB 5HHQA 4MYWB 4NPYA 5IVXF 4YDIL 4FQJH 4MJ5A 5GIRB 1BFTA 4IIQC 5AAMA 3SO5A 3T1FA 5DRXA 1DL7H 1RUAH 1ORSB 3F5WA 2XNAA 5IKCA 3EOTH 2VDOH 3HR5A 3OG4B 5IG7B 1IT9H 2QQKH 1ETZA 1X5ZA 4GKOA 4JO1H 1IGFL 4X7SL 1RULL 5FYLD 4R4BB 5DEZA 5C71A 4ETYA 5F3HA 3MRGA 4K07A 1A7NH 1NCWH 3V0WH 3KS0H 3MNWA 3EYQD 1FPTH 1W72A 1EFQA 3G5VB 4FTVB 5HGDA 4OIBA 1HHJB 2DTML 3TVMC 3GMMB 5DLMH 4ZTPL 5AD0B 3TF7C 4HQQL 3EYQC 5EOQL 4GKZB 2EXYD 2PXYA 4Y1AA 1BOGA 3NCYS 5I9QB 1TCRB 3D3VA 3VGGA 2I27N 4BZ2L 3NMEA 3ULVD 2R2BB 5DUML 2EKJA 3IYLW 2GFBA 3WFDH 4LHUG 3B8YA 2VJXA 2P24B 3VXOB 3C6LA 1OM3H 3ZDXE 4BELD 3B83A 5F7EL 4WV1A 4XNUH 5CILL 4JFXA 4QO1A 3U9PH 1AY1H 4JPVL 2CGRH 5DA4A 5HYQB 4ODUA 1H3PH 3RVWD 3WSQH 4Y4FA 4NM8H 3G6DH 4JFDB 5F9OH 4HKXB 1G7MA 1R3KB 3DO3A 1F45A 3FQNB 4NYLB 5HJ3A 4NZRH 5GGSB 4MSWB 3O0RL 3S3PA 1F4AA 1C5CL 5IMMA 3DHJA 1V3KA 3MRBA 1M1SA 3L3GA 3FN0L 3RVTD 1QD0A 2BDNH 2LQRA 5T5FL 1A2YA 1L0YA 3LY6A 2VQTA 2Z31D 3HZVB 3RRQA 5DJ2B 3FFCD 3BWAB 5F88A 1QYGL 1LE9B 2CDEB 1EJOL 5GS0C 2EIDA 2R15A 4FFWC 1D6VL 3QWQB 1X5KA 4P3WA 4M7KL 1EO8H 5KTEH 5CCKH 1IAOA 1KTDA 1OF2B 4KVNH 4DW2H 1F2QA 4W6XB 1H9VA 2WANA 5FYJU 1P2CA 4U1NB 3B5TA 4YDVB 1JWUB 5KSBB 1XZ0A 4Y5VA 5CWSA 3CDYA 4LAQL 3SY0A 4HSQA 4FQXD 2AJYH 2R69L 4Z77B 1JMZA 4OD1H 5D71L 5LWYH 3QDGE 1NC4A 3SKJH 5IVOA 3RKDD 4JANB 5SWZE 1HOCB 3M1BA 3ZKQD 3Q5TA 4XP9L 5SWZA 2GK0B 3UBXA 1U42A 3WD5L 1A3LH 4ZD3H 3ULUD 4RFNC 3WCYA 1X5FA 5FECA 2A6KA 3Q48A 1QFWL 3ULUC 4P3DA 3INUL 5HGGS 3RVXC 1P84K 4MCYB 1AGFA 1JYXA 4HC1L 2BNQD 1DEEA 3IDYB 2ZCLH 3KNBB 3QUML 2PYEE 3AU1A 3TESA 3MLWL 1WEJH 1L0XA 4MD4A 4MB3A 4OV5A 3FFDB 1BQUA 4M9OA 2PYEA 1CGSL 1EEYB 3MREA 1T1WA 1BZ7B 1VERA 3WJJA 4TPRH 1CXLA 2X4TB 1HSAA 3SOBL 1A14L 5F7MC 1MAML 4M02A 1A1OA 4XPGH 1GCFA 3CLFL 5IGXL 2YRZA 2VZ1A 5IVXA 4QRQB 1P4BH 2EKSB 3VGHA 1W2KT 3T0EB 1PG7W 2FX9L 4LSUL 2CJUH 1TQCC 2R2HA 4YDLC 4O9HH 4H20H 1N0XL 3DECA 4X6EA 4QGYA 2AJSH 3DOSA 1JV5B 4JFQA 1KFAH 5EUKB 5GRXG 3ES6A 3W5NA 4UT7L 1CLZL 3UJIL 3C6LD 4P9HH 2FGWH 3TNNA 4DJMA 5GJSH 4KJYA 1F3JA 4KV5F 1DUYA 1U2HA 4WW1A 1Y18B 1Q9KA 3FQRB 1IC1A 5I17A 2OTWA 5J57B 5BS0B 4J3TA 4IHOA 5C0NC 2UUDK 2A6DA 4XP1H 1F58H 1N2RA 1YEEH 4G9DB 4XWGH 3VFWA 2QKIB 1LDPH 4PJFA 3CFDA 4PJHA 2APBA 1NCUA 4PRHD 2Y6SD 3NZHL 4X80L 3SDCA 4JRXE 1NUFA 2X89A 5F1SA 4F7MB 4LKCA 5JW5A 4HEPG 4JG0L 5C0JA 5FO7A 1EO5A 2IQ9H 2XI9A 4JRXA 5DVLA 3VJ6B 4LRNH 3QI9C 4NQCE 1SMAA 1JWMB 1ONQB 3D87B 4XPHL 1T1XA 4NRZB 4Q58C 3U0WH 2ZUQB 4YR6B 1UWXH 4GMSL 3GHEL 4JZJB 1QBML 3ZT7A 1YPZE 3HI6L 4U49A 4M6AA 3ZHKA 3V7MA 3BZFB 32C2A 4L3AA 3SE9H 1V3MA 3WE6B 4CADA 3GSOB 3BZDA 3QAZC 4LRIA 2D7QA 3M07A 3E1F1 4P2OB 2E7LA 4K7FB 5K9QG 3C6SA 4MA8L 2EH7H 1I1AA 5CEZE 3JV4B 3TBSA 4UTAL 4WO4D 4YFLI 2WIMA 1UZ8B 2C3VB 1IBGH 1CL7H 3STZA 4M48H 2DQCL 5E2JA 2EDDA 5DTFA 4O58H 3CIQA 4XX1E 1IM9B 3EO1A 3NFPA 2JCCF 4HKJB 1NJ9B 2B4CC 2W92A 2C5DC 3PGDA 1FZKA 1UQSB 3QIBA 1J0IA 1S7WA 2EE6A 3OKLA 3MRCB 4MAYA 4G8GD 5E8DL 5J1TC 1FGNL 3KLAA 1VGKA 2EDWA 1CD1A 4TTGA 1OAQL 3QIWA 2WUBH 1EEUA 2VZTA 4XNXH 3ME0A 5LVEA 1UM4L 4JJ5A 1UXWB 4OM1H 3FO9B 3OAUL 2VLLB 2OZ4L 3W2DL 1II4E 4LFHG 4G8IA 4XNZC 5HPMA 2UWEB 4JFFD 1MY7A 2ITCB 4OIAA 2VXQL 2NY1C 2DLGA 4ORGB 3UTQB 3P9MA 1EO7A 1BQHG 43C9A 3LS5L 4H1LG 1U8JA 3NGBC 4GRMB 5J6GB 5ICZB 4M61B 3HKFA 4IOFC 1CU4H 3VD4A 1I9EA 4WU5A 3BKMH 4XH2B 2DS4A 4RMWA 2AJ3A 3MRPA 4OZHB 3M45A 5FGCE 2ID5A 1U3HD 2HJLA 3SPVB 4RA0C 2Y5EA 4OZFB 4OZGB 3BO8B 4L8CB 2BZDA 4R7NA 5E2TL 3LZFL 4ETQA 3ARPA 3HZMA 3L3HA 3RHWK 2NQCA 1QSED 4KY1H 3SCMC 4XWOC 4JFHE 1VKXB 1C5DB 2ZSVB 3FTGB 4DCQA 1NGQH 1OB1A 3DVGA 3JWDL 3ET9F 1OW0C 4M7JL 2DQDL 1TJGL 4WI6A 3WUZA 1JZ5A 4OTXH 3ZTNH 3BP5A 4CL7A 2VWEE 2VSDA 3CSYB 1AJ7L 3U9UA 1D5XB 1ZLSL 4P48A 3HPJA 3OKEB 3C60C 3TJEL 3B9AA 2WINB 5DK0B 1WFOA 3CFBB 4ZTOH 3MLVL 4OIIH 3V52L 3BJLA 1LK3L 4EDXA 3TA3D 4KQ4H 4KRNA 3MLRL 3U36A 5BRZB 3V7AE 3CVIH 1PSKL 5DK3A 3VI3F 2J6EA 1PZ5B 5EU6B 4JN2B 5DQDH 4U6VL 3BH8B 3STLA 3KPRE 5CINL 2DWEA 4PUBL 4TNWK 3SDDC 4KDVA 1ZVSB 4XC3L 1DTUA 3KPRA 1J1OH 4P59L 5DD1H 2J8UA 4G6FB 3CK0L 4PRID 4YC2C 4FQCL 4LSTL 4ZO7A 2YPVH 2DL9A 4WFGD 3MV01 1KPVB 2UVFA 2XN9B 1SEBB 3MO1A 1INDH 2F19L 1ZA6A 3OX8B 5IROA 3KXFB 4G8FA 4XXCA 3F7VA 1X5LA 5ESAA 4ONGH 3W9DA 4Y5YC 1WITA 5DYOA 5T1MA 4FMFA 2Q76A 1DLHA 1I3GH 2H45A 3H9ZA 2NPLX 3VXUD 3T3PF 1A9EA 2DQIH 3TFKD 5E2VH 1RUMH 4APQD 1CFQA 4XZUA 2VOTA 3QUMA 1A7QH 1L6ZA 3O2VL 5F7LB 1QFWM 5KVFL 1E4WL 1ZHNB 5C0EB 4S10A 3HLAB 4OZ4A 1RUPH 1DBKH 1BF2A 2ZJSL 3QIWD 5I8EA 1GIGH 4ZYKA 5HY9A 3GBNH 1LDSA 4L9LC 5FB8A 1AQDA 2R8SH 4YH6A 5MP6L 4PJCB 2CO7B 4W68A 1ODAA 2GJ6D 3HRZB 3KYKL 4QHNA 2QQNH 5EN2A 5F1KC 1MIEL 4X4MA 5HD8C 3VRIA 3D85D 3VWKD 4HS3A 1R0AL 4OZIF 2XG4A 1IM3A 5GXBB 3BPLC 1JTOA 1OGTB 5TDNB 4NQVB 3LN5B 1O0VA 4NFDA 3S88L 4Y4KB 1XIWB 3BQUD 5GRZA 2BHYA 3RIFK 2APWA 4HUVB 1BVLA 1XGYH 5I8OH 4FZ8L 3QISA 2F8OA 3BKCH 5ANMB 1J0HA 3DWTA 4AMKL 3DNKA 1KIPA 5KW9L 2EDOA 3N85L 4X6CB 3QQ4B 1A6AA 5JR1H 4G80B 3P3YA 3RGVC 3E6HB 2FH6A 4FFYL 4WFFE 5D7KE 2ZUTA 4AL8L 4G6MH 1EBAA 1CDGA 1JTTA 1SY6H 3AXLB 5GGVH 2RHEA 5I73B 2P46B 2VXSL 4P0DA 4I3SL 4KRMB 1LWRA 5CBAA 4PB0L 3ZDZF 5DJCA 5J11B 1AE6L 1BGXH 6FABL 1R3HA 5JIPA 4X9IA 3RA7L 1RZGA 3MA7A 5J7CC 1SBSH 2ZCKH 3UYOD 3P73B 2XWTB 3NCFB 4GJTB 2XFXA 1NBVH 3M8OL 5LBSL 1L6XA 2OX5A 3Q0HA 4HJJL 4LDLB 4NZDA 3BPNC 4J3UA 4N9GA 1MFAL 3KPSE 3HTLX 4LVNC 1KPRA 3WN5C 2C7UA 4XI5C 5D2LA 1N5AB 3KPSA 1NGYA 1CXEA 2V7NA 3U79A 4HT1H 4BK4A 5FGBC 1IZKA 3EO0A 1JF5A 4QNPE 1CFNA 1DFBH 4JQVA 3UDWC 2E3VA 2NY2C 4RGNE 5GISH 1G7QB 2W38A 4GAYA 3VXRB 2B0SH 5ADOL 3RWHA 2D0HA 3MV7A 1E6OH 5HPOA 1V3JA 4R4NC 4XVJH 4GRLB 3BD3A 4JGMA 4KUZL 4QWWD 4QCIA 2A73A 1CBVH 5I9QC 4XBPA 3UCRA 1R5WB 4TSCL 4HG4K 1MREH 3S5LG 4Z95H 1OARL 4X9GA 4HK3J 4YHYB 4NGHH 4IS6B 4RAVB 4EDWL 1EAPA 4IDJL 1CLOH 1T83A 1ZHBA 3C2AH 4U1LA 3F12B 3L6FA 7FABH 2AEPH 3KYMA 3MV11 1S7TB 3O3AA 3WIFA 5E99H 3QEGL 4NQXA 1SEQL 5EZJA 2UVEA 3IFPA 3RTQD 2DI9A 3BSZH 4ZNCD 5GS1B 1MF2H 4B5EA 4LNVA 1N5YL 2VUOA 1NLBL 3N9GH 4X6BB 4BZ1L 3QJHA 2WLYA 2NW2A 4C56E 3GMPA 2OZ4A 5CGTA 4OSUH 3DO7A 2EDRA 4OD2B 1NGPL 4C56A 4G8EA 4M43H 1EGJL 2MWCA 3P77A 1J8HE 3GMOA 3DTXA 5HVGB 1YEJH 2YD3A 5DJZA 1JYWA 3U4AA 2COQA 3TIDA 5DD5L 3CMOL 3FOLB 2VC2H 1SBBA 3LSOB 3V4VL 2NNAB 3T2QA 1T0MA 3B5GA 1FC2D 1A6UL 2NTFA 5DJXB 4F2MA 1YN6A 1I8MA 3BDYL 1HEZB 2FJHB 4FQQB 5D7LA 2Z35B 2PTUA 1FVCA 5DMIH 1IKNC 4N8VB 2YXFA 1CF8L 1Z5LA 4P5KA 1NCBL 4BFIA 5BV7L 3LD8B 3MRRA 3PXHA 4F9PC 4XP5L 1T1ZB 5DURB 3OKMB 5JW3L 2XA3A 2R29H 3MBEA 5SWQA 1CIDA 2JF1A 1OPGH 5E9DA 1R3LB 1HIMH 3MFFA 1U3YA 5ISZA 4YGVB 3F7YB 3SN6N 5C07E 1YJDC 3PWNB 3WFHA 5MHSE 1NQBA 1E0OB 4GXVH 5EDXA 1AXIB 3UYRH 3NN8A 2PW2B 3O6FB 5B38B 5KZCD 4K3JL 4PJXE 2YD6A 3SKMA 1L9MA 4Q97A 1MFEH 4C4KO 4UDUA 4PJXA 4LBEA 3SE4C 4K9EC 1T2QL 1AXSA 4XNYH 2G5RA 3KVQA 1S7QB 5B8CA 4X6DE 3HFML 2C3GA 5ACLA 3ILPB 3ZHDA 1G1YA 3AB0B 3LVEA 1S9YB 4ELME 5GS0L 2F5BL 1YY8A 3ISWA 5J6HB 3I6KB 5T5NF 4AIZB 5I30H 1U92A 2GY5A 3HE6D 3MRJA 4ELMA 4WENB 4U7KA 4Q9CA 4YHOL 1SJXA 2APVA 4JJHA 2VR4A 3MCKB 3LHPH 2I9TA 4NN6C 4DGYH 5E1AA 1QSZA 4QXUL 3LKOA 4IJ3C 4TUKH 4UU9A 3B43A 4NKIL 1KACB 1S7UA 1A47A 1QSFE 1BP3B 4TQEH 2LU7A 5MEOA 4QF1A 4YO0A 3PP3K 4U6HB 3VXTB 2N1KA 5FKAA 1EHNA 2JJTC 1K2DB 5JPMB 5ALBH 3RY6C 3DIFB 1QNZH 2OJZL 3O9WD 1YNTA 3EYUL 3QDME 2Z91A 4I48A 4E0RA 5BVPH 3PWUB 4JGJA 2XV6B 3KDMB 2JK5B 4R2GB 5ICYA 4QKXB 1JGVH 4J1UA 4UQ3A 4FXGB 1C7SA 1RK0B 5DEGB 1U95A 4POUB 2N7BA 2Q1EA 2DDQH 1FFOA 4M03A 3MCLH 3LPWA 5I1AA 1PLGH 5DO2D 3EDFA 2E8ZA 3IAQA 3NA9H 3HE7D 2HJKA 3TH4T 1GC1C 4OD3H 4OUUB 5EU5B 1RD6A 1KTKE 4HWEH 1MFDL 5JA9A 5L6YL 5ALCL 4PRDB 4PJ5E 1Q9LA 4G6JL 4JQXC 4U6YA 2P8PB 3EO9H 3TNMA 2V2TA 3V95A 1UM6L 4PJ5A 1MCPH 1EMTL 4P4RA 4PGDA 3LRGA 1G0XA 3V4PL 3PIQB 2FEDC 3U82B 4WUUE 3CX2A 2HA1A 4HFWB 2I24N 5D7LD 4ZXBD 1TFHA 3F58H 4JZJC 4WUUA 3RWGA 3CCHB 2GKIA 1DQLH 4JLRA 2XZZA 5CD3B 2AJXH 3GUTB 5IFAH 1KT2B 2DQJL 1DDHB 2HT2D 4JB9H 1UZ6E 3TO4D 4HEME 2DD8L 4Z9KB 2VKWA 4K23H 1PZUB 3HZYB 5F3BA 5AZ2L 2EIZB 3NIGF 3BKJH 5IVZB 2AJZA 5ISZD 1PG7X 4ZOAA 4ODBD 4JKPL 4JQIL 4CVZB 4BSVA 1G7IA 2IPKB 5AUMB 4Z0XB 2Q8BL 1ACYH 4NO2A 3AC0A 4WWID 3RNQA 3V0VA 5TPWL 4GBXC 3RPIA 1NBYB 1ZEAL 4WJ5B 1U91B 1DQJA 1LNUB 5HI4D 3ETBF 3KYOB 4W4OA 4YHML 3G5YA 4TOYH 2W91A 2A9MH 3B2UD 5K9KB 3Q3GA 35C8L 2HWZH 1CGUA 4OCRH 5IJKC 5LAXB 2R1YA 5DJDB 3CDGA 4QRRD 1FIEA 2FBJH 3RZWA 1DANT 4K71B 1INQA 2VLKD 3TYFA 4JDTL 4PLJD 3RX5A 3KPQA 1JCKA 4MWFA 2ARJQ 1U8HA 4X6FA 1OP5H 2YPKA 3L3OA 1I3RA 3QPQD 3SDXE 2BHUA 3RNKA 5ERWB 1U8PB 3NCYP 2ED7A 4LSDA 4MNGE 3SDXA 3T0AA 5D7SH 4L8SB 2BSTA 2XTJB 4MNGA 4FNLL 1FFRA 1K4CB 4CN4A 3P0VL 5HGAB 4OKDA 4FMKA 1HZHH 2YSSB 2ZCHL 4YWGH 1MQKH 4ZFOA 4TUJB 5HDBE 5D5MB 1IGCL 2E9BA 4JFYA 1GAFH 3B5HA 2FYYB 4CUCA 3GSNB 2WBJA 4WW2A 2VDLH 1UVQB 2A38A 3U46A 1YC8A 2AJVL 2V17H 4HIIB 4S0TD 2DYPD 3TZVA 3LPFA 5KSVB 1OOAA 5GRJL 3QG7H 2B4CL 1KB5B 5LQBL 5HYJE 4LL9A 4HLZH 4JRYA 2HFGH 4KRPC 1KXVC 5HYJA 5I2IB 3IDXH 2OYPA 1P7KB 3VFRB 4D3CL 1OCWL 4CDHA 4OF5A 2G75B 1CLYH 1KJ2B 2CDFB 4YDJB 2MJWA 3DRTA 3SBWC 1A0QL 4OCWL 4P57A 2Y5TA 2F5AL 5FYLE 5AWNH 4EQ2A 1LO4H 4P2QD 5IHUH 5CIPB 5IMKB 3BN9C 2EXWD 4JPIB 4QRSA 4LVHB 1KSRA 3OPZL 3TVMA 4E5XA 2LE9A 5FF6B 4K8RH 4BQ8A 1KBGH 1T1YB 1YMMA 5HYFA 1H5BB 5E2WH 3AM8C 2HFEB 3WKMH 5E03A 5DZNA 1A6PA 4ALAH 5IR1B 3MRHB 3MLYH 3HMWL 4XPTH 4EVNB 3CSPA 5GRUL 4XP1L 3IJHA 4DAGH 1TZIA 3L7EA 1LQSR 1IAIH 4NRXA 4MJIE 4B7IA 2NW3A 2VAAB 3E8UL 3QIUB 1AQKH 1OT2A 4MJIA 4XP6L 4Y19A 1KIQA 2MSPA 5JOPD 1BM3H 3ZE1F 3AGVA 5CKGA 5E7FA 1A7OH 1PAMA 3ARBD 4NZTH 1CICC 2AABH 3ARBC 5ITBL 4Z7VE 4F57L 5LGJA 4LCUB 4CW1B 4KHTH 1VENA 4FZEH 2DL2A 4M8QB 3DURB 3MACL 3MBXL 3BVNB 3RDTC 4FQ1L 3W11C 2HFTA 2VXUH 4KK6C 4MDIA 4AZ8A 4RGOH 1ZSDA 3MRQA 3MXWL 4MD0A 3CFJB 5IW6B 2BRRH 4JR9L 1N7ML 2D0FA 4QRTA 3HR6A 3VI4F 2Y7QB 1OQOA 4HK0B 1IQDA 4YPGA 5I15L 3K2UL 1XR9B 3TN0D 2OP4H 3G6JA 4DVRL 1C8PA 4Z7QF 1EH9A 3IXTA 2EH8L 1AHWC 5EZLB 3OTTA 3HNSH 3MC0A 4Y4KC 4AENB 4QGTA 1A7BA 2B2XL 4LSRH 4I4WA 1NEZA 5DD6A 1JN6B 4EI6A 1PG7L 4CJ1A 1G6RL 2NX5B 2IH3A 5CZVH 8FABB 3ULUE 3BP6A 4GG6F 2Z93B 1SVZA 4QHUB 2WBJD 4M8VA 1GHFL 1IGIL 3E3QC 4U1SB 4E9LA 4PV8B 3WIHH 3NTCH 3MRLA 2D9QB 1S9VB 2UZYB 2CIKA 3QNXA 1QFHA 5I73C 1NCDH 3HC3L 1RZIB 3I02A 3HG1E 4LAJH 4XCFH 5D1XD 3P9LA 1K6QL 2WWMC 3FO2B 3TJHC 4HJ0C 4PJ8A 3U2SB 4ZO6A 1KLUB 2IPTL 3KJ4C 5FHAH 3WO4C 4AM0A 1RJYA 3IFOA 4I1NB 4JFPA 2ILLA 4M6MH 2VISA 2GCYA 2BXZA 2X40A 4NKDA 3QJFA 5CZXD 4PIRF 1NCTA 5DQ9A 2R0LL 5E6IC 3UJJH 1G7LB 4IMKC 1AGDB 1WJ3A 2EC8A 3U83A 3OAZK 1HQRA 3SDAC 4ONFH 2FH8A 1UCBL 2YUXA 3WFBH 1YMMD 4N0CC 5I75B 5FYKD 1HWHB 4IRSC 3GNML 4WCYH 3X3GH 2EYTA 3C5SB 4LHUD 3GMQA 5KSAD 4U1HA 1XCQA 4HS6A 5F9WB 2RCSH 2H1PL 3DARA 4P99A 3HC0A 3RUGB 4NQDA 5KSAC 3O4LE 1VA9A 2B39A 3OL2A 4KVCH 1INEL 4HWBL 5E70A 5FA4B 5C09B 5I18H 3BZ4B 2IQAB 3DV6B 2OQJB 4JFOA 4U6XB 1T5WB 4F8TA 1OTTD 3FOMB 1EX0A 1UENA 3SKOA 1UB5A 1S9XB 5HGHB 3MODL 4HPOH 25C8L 4X9HA 1FVDB 1WIUA 5E2UH 4WHTA 5F1IA 1MH5A 3UTPE 4OKVA 2OSLB 4G6AD 4NSKB 3EHBC 2BVTA 3FT2A 4DFIA 2P5EB 2DMCA 3TPUA 2FR4A 2AK1H 4HZAA 1GGYA 3QI9A 3IF1B 4Z6AT 1U6AH 1KNOA 3V6ZB 5MENB 3AS2A 1AKJA 5I8KL 2Q86A 5C6TL 1PYWB 1JTPA 4Q6YA 2ORBH 2EDTA 1NAMH 3ZKND 2BXYA 4CVXA 1QA9A 2GTZA 5GZND 4ZOEA 4WDIA 1ERNA 3M17A 5FFLA 4PRPD 1IFHH 2VTFA 3KPPB 4LLVB 5JOFB 3PGFH 3ARGD 2NY0D 1OAKH 5IB2B 2FL5A 1IE5A 4KI5C 5B3NA 1N6QH 4D0DB 1JBJA 3LKSA 3GBLA 3QEUA 5JHLH 5EWIL 3LD8C 1KC5H 1CXHA 2VNCA 2W0KA 1FCGA 1GGCH 2E9WA 2AV7A 1PW3A 3P11L 5C2BL 4GQ9H 5EBMB 3SO3B 2F53B 4WHYG 4L29B 3BRFA 5INCA 3FO0L 4PGBA 4N90D 4ZUWB 4UV4L 2DLEA 4IOIB 1BJ1J 4HV8B 4Q6IA 1OL0A 2QTEA 4OGAC 5EU4B 3H7BB 5B38G 4YHZL 2FGZA 2HT4D 2JIXB 3BIKB 1JPFB 5D93B 1T89C 1NKRA 1P7QA 4LPXA 1P84J 4X9BA 2YD1A 2OR9L 5E94B 2Q6WB 4LIQE 1KEMH 3I2CH 5DHYA 1XGUB 4H1LA 4ZO8A 4X4YB 4LKXB 1K85A 2ZPKH 3SGDI 5KS9E 1WAAF 1FAIL 3H3PH 4KKBD 1J18A 5KS9A 1VDGA 4N0YH 4YX2H 1Y6MR 3AB0C 2IGFL 4HGKC 1S7SA 5GGUA 5SWSB 4GUPA 1HKLH 3LRHA 3WYRA 5D2NA 1AGEB 4NPYB 4NQDD 4QXGL 2GT9A 5C70A 1TVHB 2V5SA 2XNAB 3UBXI 4GAFB 4ZFGL 1VFAA 2XZAH 3SCMA 1MHPL 3ZHLA 3B9EA 2I9LA 1ZT1B 2OM5A 3L1OH 5ITFB 4D0BA 3IGAB 4Q0XH 1T21A 1I9IL 5T3ZH 4RQQA 1OW0A 3MRNB 3MNZB 4GG8B 4XCCH 5ETUB 5DRNA 4J2XA 1I7ZA 1NLDH 5IB4A 1R5IB 4HWZB 3T4AA 4EN3D 1BZ9A 3AAZA 2X4OA 2YEZA 4HX1A 1W0WA 3QXTA 2IFFL 3ROLA 1BOGB 5F9JB 1KTRL 1NGZA 3HUJE 5H35A 1S7XA 3NCMA 1NL0H 4E41A 3TCXA 3QEQE 4YAQA 1FNLA 2D7NA 3DGGB 4WV1B 5HBBA 4RFEA 4K9EL 4U1GB 2CXGA 4RWYH 2V9RA 3OZ9H 3SDDA 1UYWL 4XNQB 3PWPB 4JPWL 3WL9A 3MRDB 4Y4FB 4DK6A 5D7JC 3VD7A 5I1DB 2FX7H 1IGML 2FATL 5C0AE 1KN4H 1DR9A 5I0DA 3TM6A 5DRWB 5EBLB 3GMNB 4CKVX 1R24B 3EOAB 1BX2B 1G6RA 5H2BA 3QUZB 3KJ6H 4F58L 2DLFL 5L7XL 4ZFZA 3MRBB 2ARJA 2DKUA 5GGRB 4P2RE 3LKRA 4J3OC 3WLBA 4UBDC 1AI1H 4QYOB 3T0DA 3PWLB 4ZS7H 4P2RA 2ZOLB 2BCKA 1IEAB 1ZVYA 3WMSA 1Y0LB 3DUUA 5LJYH 1KTDB 1I4FB 4KZEH 2BVPB 3QWOA 3I75A 4DTGL 2MPAH 3I85A 5F71A 2GYSA 1FO0H 1NFDF 1XZ0B 3MLZL 3QRGL 5IMOA 5F21B 4Y5VB 5E08L 3L7FA 1LO5A 4JAMB 5INDA 5MERA 1DLFL 3N06B 1IC4H 4LFHD 1I8KA 2IANA 4QRPD 1G9NL 4XBGB 4OLZL 5AYUH 12E8H 1WC7A 3BJ91 2XXCB 3QDGB 1PKQA 4PTTA 3BDXA 3REVA 1J05B 4F9LC 1B0GB 4YXKL 3L9RA 2Y07L 2HRPH 2PW1B 3EGSA 3T3MF 4NP4L 3C2SA 4PTUA 4DZBA 1JZ7A 3UTZA 4Z76B 3I3BA 3HB3C 2XY1A 4LSQL 5FECB 1T0PB 5KN5B 2XQBL 1AGFB 1UH3A 3D6GA 5KSBF 1MFCL 3RL1A 4LSVH 1ITCA 2J4WH 3IRZA 4K71C 2FHCA 3K8KA 1FZJA 1EHLH 2BNRA 4UB0H 2P8LB 5GZOD 4MS8D 2X4NB 3RGHA 5I6XB 1WAAA 4KK9C 4YBLB 3HS0B 4PRNB 5DC9B 5GZOC 2N4IA 2PYEB 4FA8A 4HWBA 5HVHB 1YYMH 2OI9B 2X1QA 4N9OB 1OWWA 4NNYA 2V6HA 3E6FA 4KC3B 1S8DB 3IJYA 4L8SC 3Q6FA 4TVPL 3RGVA 4YBHA 1G9EA 5ID1B 1JZ3A 1CZ8H 4GXUN 1I9JL 3Q1SL 4K94H 4L3EA 5C9KA 4YZFE 4Y2DC 4YHLH 4GKSA 4LPYA 3DSFL 2YKLH 2YA2A 4JM2C 2EDYA 2DQHL 4L8DB 4S1SH 4I2XA 4BUGA 3T4YB 1E4XI 3DV4B 3K74B 4P49A 1R3IL 5EFIA 3S4SB 1WV7T 1CD9B 3OF6A 4FFVD 3O3BB 3WIIH 1M6OB 1FFNA 5F6HJ 4HH9B 4E41D 2X4QA 1FYTB 1A02N 5T3XL 4ODWA 4D9LL 5IP4A 1U3ZA 1X5JA 4KJYB 5B39G 2QHLA 5GIRA 1FCCA 1RFDL 3GFUA 4KJQD 3GI9H 3PL6C 4YXHH 1ORSA 3QDJE 4FG6D 1N3NB 2R39A 4JN1H 5FGBA 5IBTL 5IG7A 2XA8L 1SM3L 4KJQC 2Y06L 3UDWA 1UM5L 2CXKA 3QDJA 3ZKSD 2VDRL 1FIGL 1C5BH 4R4BA 5FCUH 3O41B 2D7OA 1D3CA 4IHOB 1F02I 3ARVA 4KHXH 1IGTB 1N2RB 4FTVA 3X3FH 2B20A 3ARRA 4HS8H 1J5OH 4NC2B 4GSDL 1HHJA 3LRSB 1HILB 1M71B 3GMMA 3WDJA 5AD0A 4EEEA 2JE8A 1RQ5A 2VDQH 1IGJA 2OCFD 4GKZA 1QO3B 1H5BC 3TIEB 4OCNC 1N26A 1J1XH 4YQXL 5IB5A 2R2BA 5EC2B 2HMIC 3NOIA 3SDYH 3S3JA 1FVEB 5LGKA 4X9FA 3VXOA 5ABDE 4QTIL 5KVMC 3RKPA 5DJ0B 4NQCB 3L95B 1ZLWH 5I19L 4LU5H 4Y5XB 2YPLE 5FOBA 2D3VA 5L9DL 2JCCE 1A6ZB 3UTSD 1I3UA 3QIUC 1QKZH 2PF6A 5HYQA 4LGRB 32C2B 3S34H 1HXYA 1YPZB 4JFDA 4HKXA 1R3KA 3P4OB 2IAND 3VGBA 1JK8B 4JG1L 2R2CA 1I1RA 4G6KL 1FZMB 3Q6GL 5GGSA 4Z7WE 4MSWA 5K93A 1I1AB 1FN4B 4PS4L 4G9FE 3TV3L 3BKYL 2BHZA 4I9WE 4Z7WA 2MNUA 4YBQC 3HZVA 4YNYB 5DJ2A 1FE8L 3BWAA 1Q9OB 3OG6B 4P4KD 5ESVA 2CDEA 2WUCL 1Q0XH 3O2DH 3BRGC 3VDCA 3CPLB 3RVVD 2OL3H 3QIBB 1NPUA 4LARH 1OF2A 2O5ZH 4OLXL 4FQJL 2PO6D 3C5ZC 4XC1H 4U1NA 4YDVA 1IKNA 1DL7L 1JWUA 1RUAL 5KSBA 1IZJA 2EDLA 3EOTL 2VDOL 1IT9L 4Z77A 4JO1L 3IDJA 2IAMB 4LCCC 3VFOB 1RIHH 1QFWI 1Z9MA 4JANA 4KKAD 4S1QL 1A7NL 2Y36L 3V0WL 4F9PA 3OGOE 1FPTL 1HINH 2GK0A 1GJIA 43C9B 2QQLH 2JKXA 5CJXC 2FEEL 2H3NB 2NZ9D 1J12A 1SMOA 5JHDD 4MCYA 1Q72H 1UT9A 2R0ZH 3WFDL 3OF6D 4IRJB 3K81A 3KNBA 4IBLT 4X5WB 3QXVA 5DEFB 4LLQB 1W0YT 1OM3L 3BRDA 1P6FA 3FFDA 4XNUL 5FGCB 4Z7OE 1X5IA 1BZ7A 5L2KE 4PJGF 3SGJA 1VEOA 2X4TA 3DUHA 3LB6C 3RBSA 4NM8L 3G6DL 3VI3E 2EKSA 5E4IA 3T0EA 4NO5B 4NZRL 2OXHA 2CRYA 4FTVD 3MOAH 1FRGH 3QUYD 4OZHF 2QHRL 1HH6B 2GTWB 1NFKA 1D5BA 1VACB 3HPJB 4DKEH 4OZGF 2ZKHH 5A2FA 5I75C 5CJOH 4JFEE 5EUKA 1TETL 5F7WC 4LSSL 3UXFA 5F9WC 1FV1B 3C5JB 2JJTA 3RWEB 5T1KB 3FMGH 2GJZB 3RY6A 4OFPA 3D69B 1UGNA 3OB0K 1Y18A 2XKUA 3FQRA 2M8XA 4OD1L 5BS0E 5LWYL 2VLJD 3GSWB 4M1DH 3A6BH 1I7UA 1GYAA 4JFDD 5D1QB 3WNOA 1CGYA 4LHQB 3S37X 5BS0A 1J8KA 4HG4J 4RBPK 4P3CH 5DMGD 1UACL 1S78D 2LTQB 1A3LL 4G9DA 2QKIA 5FM5O 1QRNB 1SJVA 3G5ZB 4LP4A 4YFLF 1LO3H 4OM0L 4UQ2B 3VFUB 3OWEA 4NFCA 4WRLA 3CVHB 3OXRB 4JQXA 4F7MA 5IW1A 4LASH 4Z78B 3VJ6A 3QUMB 1JWMA 1ONQA 1DEDA 5TE6H 3CFIC 4KPHH 2UZIL 1ADQL 2CSPA 4J12A 4OLYH 2YZ8A 3R1GH 4ODXB 4XP4H 4TPRL 4TVPE 4JZJA 3K80A 5BZDA 3EYSH 2M1KA 1QPXA 1UKQA 2BX5A 1RIUL 4PP1D 4XPGL 3BZFA 3WE6A 3GSOA 4P2OA 4K7FA 2CJUL 4MD5B 1CT8B 1UJTA 2XTLA 2DQTL 3CX5K 1G0DA 4H20L 4KRLB 2C3WA 3LEXB 2H2PC 3JV4A 4WWKB 3MCG1 4IEFB 1UZ8A 2C3VA 3BXNB 4H88H 2HTLD 1IM3B 3QEHB 1IM9A 1A6WL 2PR4H 3LQMA 3V8OA 1AP2A 1KCVH 2HTLC 3ZYOA 5T3XE 4HKJA 3AFLA 1CGVA 1NJ9A 4P2YA 5HHOD 1RY7B 2FGWL 3ARDB 3SO3C 4P23B 4GBXA 3MUJA 5IW3A 1RIVH 5KVDL 1CR9H 4M4PA 4PJCF 4NQEE 4ODTH 3N1MC 4IMLB 2HKFH 4YIQB 3GM8A 5C6WH 5EO1B 4LP5A 2FX8L 2YXMA 4G3YH 1UXWA 3TEUA 5IJKA 3FO9A 4WFHE 5F6HI 4QRRE 2QBWA 1QBLH 5A16B 1PVHA 3T0ED 2UWEA 1YEEL 2ITCA 2E7MA 5IT2L 4QHLB 3UTQA 1U8OB 1LDPL 1U93B 1NC2B 3OR6B 5J1SC 4ZSOE 5IESH 2I5YH 5J6GA 2AV1B 3QG6B 5ELIA 1IKFL 2XKNB 2GQHA 5ICZA 3MOBL 4M61A 4OUOA 5AEAA 3ZE0F 4G7VH 4XH2A 4LRNL 4WFED 4X6CF 1G7JA 2HLFD 1B4JH 2F54E 4KROB 2JJWA 3U0WL 2V2WB 3SPVA 2F54A 8CGTA 4OZFA 4RWHA 3P0YL 4GW5B 4OZGA 3BO8A 1A5FH 4L8CA 3VRLF 3OAYH 4IRZH 5JA8B 1G9MH 4Y4HB 4XVTL 2ICWB 3LEYL 3SE9L 2LV4A 3TPKA 1VKXA 3FTGA 2ZSVA 1HYSD 4ISVB 3HNVL 1CDJA 3RWHB 4WI9A 4RGNB 1UADC 1HYSC 3CMGA 3DROA 3RWJB 1H3VA 3STBA 5JW4Q 1UWXK 4TTDC 3ULVH 2OJEB 1IBGL 1CL7L 3AREB 5CD5D 3CSYA 4M48L 4QCIB 1CI5A 2IMNA 3NAAH 1D5XA 4Y16D 5DJ6B 3OKEA 2A73B 2D03L 2DM4A 4O58L 1B88A 4OB5L 4YJZL 2WINA 5DK0A 3VWJD 1JF6A 4Y16C 2EO9A 2I25N 1RZJH 3S3SA 5MEPB 4MLSA 3SBWA 2EYRB 3VWJC 1TVBB 5BRZA 3S36H 1FNSH 3FQWB 4ZUSB 4NO0D 1PZ5A 5EZJB 3QUXB 5EU6A 4JN2A 3BH8A 2WUBL 1FP5A 1ZVSA 4XNXL 4L4VB 4DN4L 3IKCA 3AM8A 3EUUA 5EUOB 1GGIH 1ZTXL 2A83B 1R3JB 1YYLH 4P2OD 2CMRH 1KPVA 3H3BC 2XN9A 1SEBA 3VGAB 3W81A 4HPYL 5C08D 3OX8A 3QUZC 3KXFA 4K8RC 3CFKB 4XB7A 3DTXB 3QWRA 1MCWM 3C08H 1WCQA 2FWOA 1J8HB 4HKZB 1D9KC 4I77L 4K3DH 1CU4L 3S37L 5JOPE 1IM9D 5I1IH 2NTFB 3LMJL 5GGVY 4HKBB 1YN6B 5FYJL 2LAGB 1JGUH 5E4EC 1I8MB 3DVFA 1ZHNA 1DBJH 4R0LB 2NY3B 5C0EA 3O3DB 4E42B 3HLAA 2R9HD 1IC7L 3ARFB 5DMJB 4KY1L 1Z5LB 3IS0X 3B9KD 1T20B 1NGQL 1K8DB 4PJBE 4PJCA 1NCCH 3VD5A 4GW1B 1FQ9C 3HRZA 4OTXL 4EUPB 4P46C 3ZTNL 4PLKD 5ENWB 3UBXG 3HPLB 4PJ7E 3W9EA 1S3KL 1ZANH 2EO1A 3ZSSA 1YEGH 2IG2L 1C1EH 5IB3B 2D0GA 3I9GH 3LQAC 4O2FB 5TDNA 4NQVA 3LN5A 4OCMC 1ZGLM 5C07B 4Y4KA 1XIWA 3CVIL 1YNKH 1HHKB 3A0OA 3SKMB 4NNXB 1BEYH 5GQBA 5ANME 4HUVA 2FJFB 3O81A 4UAOB 5I6XC 1JE6A 4UDUB 4WY7H 4YBLC 4LBEB 5DQDL 1A22B 1GGUA 5ANMA 1DBML 1BPVA 4N5ED 5TFSH 1MY5A 5TDOB 1IEBB 5DS8B 3E3QE 3DVNB 4X6CA 1I1YA 2EE3A 1J1OL 5E8EB 4PJAE 3VGDA 1UWEH 5DD1L 5H94B 3WUWB 3QQ4A 5B8CB 3PNWB 3VXPB 4G80A 1RUQL 2WQ8A 1W72H 3E6HA 4X6DB 1INDL 2EE9A 1JP5A 1CDIA 3AXLA 3AROA 2ZOKB 3WHE1 1DSFL 4ELMB 1XR8B 4EJ1C 4ONGL 2NY4D 1N59B 5DC0A 4JE4B 3R06B 4F7PA 3W39B 5E5UB 3BGFB 2NY4C 3P73A 2DQIL 2XWTA 3BPCB 5E2VL 1RUML 4POYA 4UU9B 4Z7UE 3CSBA 1WCBB 1ZT4B 3CLEH 2FSEB 1BVKB 2BFVH 3EFFB 2NY6C 1ADQA 3ZL4L 1QSFB 4PJEE 5FKAB 5MEQB 1V7MH 5B21A 5J13B 1DBKL 2P49B 1N5AA 1GIGL 2CLVB 3SQOH 1JFQL 3QDMB 1DVFD 3GBNL 2QQQA 1T5XB 1RMFH 2DI7A 5CZKA 4G6FD 1GRWA 4L1HA 5DI8B 1BJ8A 2HG5A 1G7QA 3VXRA 4Z8FL 3MR9B 1AR1C 2QQNL 3KXFD 5E1HB 4GRLA 2OMNA 4YFDB 2MMXA 1K4DA 3EFDH 1H3UA 1EZVX 4JO2H 5IQ7L 1WQVT 5DD0H 2KKQA 1P5UA 1R5WA 3MMEB 3IFNH 3TNMB 1T3FB 4IS6A 5I1GH 1HH9B 1AR2A 3F12A 3NIGE 4QRUB 4JCMA 1P4IH 3PDGA 1XGRB 1S7TA 3BKCL 3GKZA 1RAMA 5TF0A 2DBLH 3CC5B 4Y5XC 5CGYC 2HTKC 5EOCH 2YUVA 4GAGL 4JCLA 5GS1A 3H3KA 5CHNA 1KCRH 3ZYJA 5JR1L 4RX4A 2RQ8A 3BH9B 3NPSB 3PHOB 1CE1L 4OD2A 2V7HB 2WNGA 4G6ML 2JJSC 3FB6B 1SY6L 5GGVL 1CFSB 2O26U 1EZVY 1D6EB 2NXYD 4U31A 4TSAL 3VFPB 3NIFE 3LCYA 1MCDA 4BA8A 3BT2H 1TNMA 1BGXL 1KB5L 1MJUH 1I9RH 1SBSL 1XAUA 5KVGL 3FOLA 1FNGB 3LSOA 1NBVL 2NNAA 4YHPB 4J3WA 3RX8A 3PQYE 1X6LA 2FRGP 5DJXA 3T04D 3W0WE 5IEKB 3OKOB 2B1HH 5CEYB 3X11B 1MI5E 4ESKA 3PQYA 2DQEH 3QCUH 1HEZA 3W0WA 4WEMB 4FQQA 3MV9E 1IGYB 2Z35A 3WJLC 4OF3A 4RMSA 2QADC 1QQDB 1EVTC 4PRPE 4PV9B 4N8VA 3MV9A 1WIOA 5IBLD 3QFJB 2A77H 1DFBL 3S98A 2ZG3A 1I7RB 5K59F 4M93B 1OGAE 3CDGB 2IAMC 5GISL 3BN3B 1VPOL 2CO6B 4NUJB 2B0SL 5HHMD 5D7IF 1T1ZA 4XVJL 5B22A 3KPQB 3OKMA 4NBXB 3GMLB 4NBZB 1KTLA 2OS7A 2FHBA 5KOVC 3A6CH 5DJAB 5T1DH 1R3LA 1QACA 1RUKH 2NXZC 1Z2KA 5LXGH 4YGVA 3F7YA 1MREL 3EDJA 5GHWL 3SDXB 3PWNA 1ZT7B 4NGHL 5HI3D 2PW2A 4D0CB 1CLOL 3O6FA 5B38A 3C2AL 4MJ6A 7FABL 3LOWA 3OKYA 3KHQA 4XGZB 3HAEB 1T89A 1QVOB 4HW6A 5KJRH 5E99L 2ERJC 4Y8DC 4DQOH 3BSZL 1MF2L 5L88L 2PTTB 1FGVL 2AAVA 5LKNA 3EYOB 4LNRB 3N9GL 2C3HA 1S7QA 1HI6A 4R8WH 1J87A 3EW3B 1AXTH 5BMFL 3ILPA 4ZNEE 3MLXH 1DQQB 4G42B 3VXRD 1S9YA 4NKOB 5DWUH 4UT6H 5T1LB 4KFZC 1BMGA 1CXFA 4ZNEA 4LSPH 5J6HA 3I6KA 1GL4B 3ZE2F 2ADGA 4GRLD 4OBRA 4AIZA 5J1AB 2E6JA 3QQ3B 5I0ZA 1LE5A 2KH2B 5TE7H 2EC9T 5HYJB 5E24E 2VC2L 2X1PA 3NACH 5JOEA 4IIQB 3MCKA 2VWEC 3QDAA 1MFBH 1U36A 3WHE0 3O6MH 3EJJX 5GGTH 5A2JH 4U6HA 3VXTA 2J12B 1A4JA 1K2DA 5JPMA 5CJBA 3DIFA 2JLLA 4XPAH 3V7AG 3ZE1E 3TVMB 3PWUA 1D5ZB 3KDMA 2JK5A 5DMYA 5A2KH 5L2JB 5EORH 6CGTA 4FXGA 1BFVL 1RK0A 5D1QC 5DEGA 1HHIB 3T0VA 1D5IH 3V5KB 4KJPD 1SYVB 4O51B 2WV3A 3KLHD 3OMZA 2R29L 2H8PB 1OPGL 3HC4L 1LO2H 4BH7B 1JYVA 2P1YA 1JHLL 1U8LB 2EDFA 4O5LL 4OUUA 5EU5A 1L4IA 4AIOA 2NW3B 4FXKB 4Q74A 4GRWH 4O2EA 4PRDA 4UOJA 3NPZB 4O2CB 4ZAKD 3UYRL 4YDIH 5D7JA 2P42B 3EZJB 1IVLA 2P48B 3O4OB 1MFEL 1TXKA 2A0LC 3PIQA 5B4MD 1KN2H 4QY8B 1YNLL 5I1JL 3FZUD 5J0BA 1FDLH 4HFWA 4DOHB 4X7SH 2NY7H 4ZOCA 1CVRA 4Z7VB 1NGWB 4YUEL 4V1DD 2EDJA 1F3RB 5CD3A 1P9MA 4OLUH 4WUKL 1KT2A 1E27B 1DDHA 4MA1B 3GB7B 4HQQH 1BBDH 2DWDA 4MJ2A 4XHJD 2EDKA 3NABL 4R26L 1RI8A 1K9TA 4GG6E 4XHJC 4PGZA 4FXLA 4JHBA 2EIZA 2AJUH 2YBRA 5IVZA 5IMLB 3LHPL 4DGYL 4KMTL 5EB9A 4CVZA 2A1WL 3N50A 2Z4QB 5F7EH 2IPKA 5AUMA 2QSVA 5CILH 4Z0XA 3O6FD 1ZLVH 5J56B 1KIUA 4FQXB 4QRPE 5ALBL 4PJIE 1C16B 4P23C 1BVZA 2CLZA 1NBYA 1OWRM 5C0RH 4WJ5A 1U91A 1LNUA 4F9LA 5BVPL 1KV3A 3KYOA 1N8ZB 3QH3B 4EZMA 2IBBA 1IL1B 4RFNB 5K9KA 1JGVL 3O0RH 2YWZA 3S96B 5LAXA 3ROOA 5DJDA 4UOW1 5EZIL 2DDQL 3FN0H 3H9SD 5T5FH 3MCLL 5D1ZD 3BZEB 4HCRH 4IDLA 4TRPH 3SKNA 5CEXB 4OI7A 1RZ7H 3VXSE 3ZTJG 3NA9L 5D1ZC 1M7IB 3DYOA 3QXDB 2R23B 3PXJA 3V6OA 2DKMA 3P9LB 4ODSH 3HMXH 3ZKMC 5GGRY 3BD5A 3HG1B 5ERWA 3DHMA 1U8PA 5HSFA 5TGBA 3EO9L 1BJ1H 5EC1B 1MCPL 4L8SA 2J6EH 1NMBH 1A7PL 1FL5B 4JFPB 3ABZA 5EH1A 4LAQH 5FEBA 5JTWA 4KROC 3MZGB 1K4CA 1TTFA 2IEPA 5D71H 2W60B 3MV8D 3F58L 4TUJA 5DQ9B 5D5MA 5JXEA 1TQCB 1DQLL 4YDLB 2B7DT 2XWJA 5A3ID 2FYYA 2D31B 2AJXL 3IFLL 4R2GD 4XP9H 5IFAL 3N1FC 3NVQA 1KB9K 1VHPA 1MCIA 2IWGA 1UVQA 1ND0B 4X7DC 4H26B 4HGWB 1A21A 2EYTB 4HIIA 5JO5B 1F11B 5KSVA 3INUH 1KB5A 3T65B 3ALXA 1XGQB 3BKJL 4XCYA 5I1CL 4XHQA 3ZDYF 2ZP0T 1EVUA 5I2IA 1P4LB 1P7KA 1GOFA 3VFRA 3O4LB 2G75A 3KYNB 1KJ2A 2CDFA 3EIFA 4YDJA 1CGSH 1ACYL 2QV2A 5C3LD 1CN4A 2CK0H 1G84A 3WFCL 1A14H 5CUSL 5CIPA 5IMKA 3JWOH 2P5WE 4JPIA 4TOYL 2A9ML 2ESVE 3RJQB 5FF6A 2HWZL 3ZT6A 4H8WH 4OCRL 1T1YA 3RUGF 1H5BA 5DVNA 1GOGA 2ESVA 4PRHB 3T77A 1WZ1H 1N0XH 2AI0H 5IR1A 3MRHA 3T8XA 5C0CD 4I5BB 1IILE 1YECL 3VGAC 4EVNA 4MQSB 2ED9A 4Y88A 2FBOJ 1MCOL 2O5XH 4CRPA 2FZ3B 4I0PC 4ENED 1J11A 2UUDH 4RISH 4KAQL 4U2YA 2VAAA 4ENEC 3QHFL 1WWCA 1YY9C 3UTSE 3QIUA 3UJIH 2X4UB 1FNEB 3CFCH 2OTPA 3EJYC 4D94A 1OD7A 4RNRA 4AG4L 3FN9A 3GZKA 3QAZB 4GXUM 2ADFL 4YWGL 4HWUA 3B9VA 3M17B 2NY3C 4LCUA 1OP5K 5T33H 4M8QA 3DURA 3BVNA 2VDLL 4LDOB 1OTSD 4WO4B 3SE8H 2BNUB 3AMLA 2Z8WC 5I66B 2V17L 3FT4A 3CFJA 4YHKH 5IW6A 3KPNA 3NZHH 4QOKD 4X80H 2R56H 4PFEA 4HK0A 1MUJB 2FLRT 4EUPG 2BVOB 4KTEL 4PJ9D 4OF0A 4JG0H 2HFGL 1XR9A 3IDXL 1GGBH 5JZ7D 3TH2T 4XPHH 4PGBB 2L4OA 4G8GB 5KVEL 3PWJB 1CLYL 2CH8A 3WXWL 1RURH 5IJVB 1PQZB 5EZLA 3GSVB 2XTJD 4GMSH 4CNIB 3GHEH 4AENA 5AWNL 5KOMC 4LCCA 5IHUL 1B0RB 3GJEB 3HI6H 3K8MA 1BLNB 3N0PB 4NO3B 4XNZB 4UAOC 2NX5E 3OB8A 1JN6A 1QBAA 3MGOA 2NY1B 1XFPA 4JVWA 3I6GB 1TJHH 5JXED 5A1AA 2EEBA 2NX5A 4MCZB 4JFFB 4K8RL 4ZS6C 1KBGL 2CKBB 3GIZL 3RP1A 3NGBB 5CJXA 2BSSB 2Z93A 3SJVD 4QHUA 4NDMB 4ALAL 2MQCA 4U1SA 4PV8A 2VR9A 2G60L 3MLYL 4XPTL 1S9VA 4PYHA 5CMAB 2DQCH 1I1FB 4X8JA 4U3CA 2WBKA 1IAIL 1RZIA 4K7PH 3KYAA 2CLRB 1UJ3C 3J8F7 3FO2A 4YDKH 3ILQD 4WEUD 2FO1A 1RZKH 3BGFC 1BM3L 5DC4B 3RZCC 1KLUA 2NY5H 5E8DH 4U0QB 1FGNH 1VFAB 3ILQC 1NDGA 3ZMRA 1A7OL 2DQFB 1OAQH 2AABL 1QSEB 1WIPA 1T21B 2H32B 1QRKA 4KH2A 3WS6A 1OY3B 4KHTL 3PGCB 2OZ4H 3SEPA 3W2DH 1G7LA 1AGDA 3FQUB 2YEZB 2VXUL 4NWUH 2VXQH 1ZMYA 2VXTL 4KUCF 5BCAA 1JZ2A 3C60B 5BQ7B 4O00A 3LS5H 4HMDA 5H35B 3LQAL 3ZT5A 3HUJB 1A6VH 4LLUB 5SV4A 2OP4L 3QEQB 5IFJB 2C4FU 4BQBA 2X5PA 5FA4A 2AK4D 5C09A 3BZ4A 3MGTB 1BD2E 2VLJE 5JQHC 2OQJA 5E2TH 1YUHB 4U6XA 1T5WA 3EJZD 3FOMA 4M1CC 1K3IA 1NFDE 5DVKA 1S9XA 5C0AB 3MA9L 5HGHA 2YWYA 5TF1H 4X7TB 1FVDA 5CZVL 3O6LL 2ARJB 3JWDH 4M7JH 4CVWA 4Y5YB 2DQDH 2P5EE 2L0DA 3WIHL 2OSLA 4NSKA 2IBGA 4NCC2 2P5EA 1AD9B 2G9HB 2YK1H 1AJ7H 5TE4H 3ZDXF 5LG1A 2ARWA 2N56A 4LCIL 4XMKH 3EZ8A 1NCDL 3VXUB 5CJQH 3DMMD 3TJEH 3IF1A 3T3ME 4HXAL 1K5NB 2NR6C 4APQB 2FECL 3QWOB 3V6ZA 5MENA 4PREB 4MLIA 4QXTA 1PYWA 4LVOB 2YS4A 1A3RL 3GO1L 2BVEA 2EZ0C 1MCKA 1Z9LA 4L9LB 5CINH 5DHVB 1KYOK 3FB8B 4XC3H 1AFVH 2VN4A 4P59H 4LCWD 3JVGC 1MQ8A 2J88H 4FQCH 4LSTH 3TWCL 3VXMD 2R0WL 2GJ6B 3MUGB 4ONFL 4LLVA 4PTUB 5JOFA 3RWIA 4EI5C 1S9KC 1NUNB 3KAAA 4D0DA 3D85B 3BPLB 4WCYL 3VWKB 3GEWB 1OTUC 3HNTL 4X83A 2X70B 1JPST 5HHOE 1TJIL 3BW9A 5EBMA 3VW3L 2F53A 4EBQH 4R6UA 3HI1B 4L29A 1GXEA 4L3CB 5I18L 4ZUWA 3G5XB 5IB1A 4IOIA 3E6FB 4MQXD 5L0QB 4HV8A 3FCTB 5EU4A 2C3XA 4MQ7B 1NKOA 3H7BA 2ZJSH 4CU7A 2JIXA 3BIKA 3VMPA 1JPFA 5E94A 2Q6WA 1XGUA 5E2UL 5EO0B 3BUTA 2YHGA 4MNQD 4LKXA 4X4YA 4POZD 3TT1L 3KS0J 4Z0BL 1B9ZA 2APTA 1U8MB 5CEZL 2OBGA 3KYKH 3VFGL 4XXDB 3LKPB 3IXAB 2DAVA 5TJWK 4JY5H 4LOUD 1U6AL 5SWSA 3RVUD 1T04B 3BPNB 1CYGA 1AGEA 4QHKJ 4ODWB 4LVNB 3RVUC 3WN5B 3JTSB 1E4XL 4F37F 5HI5D 1RK1B 5C0DB 4FZ8H 1TVHA 1EEQA 2EC9U 4Q9QL 5FV2A 5GRWA 5FAAA 4I3RH 1RZ8B 5ITFA 1ZT1A 2NY2B 3QDJB 5KW9H 3VU2A 4D9RD 3IGAA 1LEKB 4NM4L 5C8JB 2OK0L 3KPTA 3TYGL 3MRNA 5IBUB 1G7HA 2ZG2A 3MNZA 4GG8A 4JY6B 4KK8D 4NHUB 5ETUA 3T08A 1IFHL 5C0BD 1XT5A 1R5IA 3QNZB 4HWZA 1C7TA 3PGFL 2YR3A 5FOJA 1OAKL 1JIBA 1IGJB 1EIBA 1N6QL 2VXSH 3GHBL 4I3SH 1DQDH 4BFEA 5F9JA 5IB5B 1KC5L 4BZYA 3RX7A 2WWKT 1AE6H 2EXYC 2HP4A 1GGCL 2R1XB 3LN4B 3ULVC 1CGWA 3FQXA 3SGKC 1L7IL 3M8OH 5LBSH 5MEND 4N0UE 3BIAX 4L4TE 3DGGA 3BGAA 3PWPE 1V05A 1BF8A 5FOBB 1RZJC 2YMXH 4N0UA 4L4TA 4XNQA 3PWPA 4AEIL 2R2EB 2YPLB 3MRDA 4Y89A 3RTQB 2JCCB 1HKFA 5I1DA 2XICA 4PJFF 4PJHF 1HXYB 5J3HD 1XF1A 2RFXB 3O4OC 3RVWC 3PJSB 3I2CL 4P5TD 1QLEL 3QDHA 5DRWA 5EBLA 3GMNA 3V5HB 4PRBB 1R24A 3EOAA 1BX2A 2BMKB 5C08E 3QUZA 4BSJA 3SKUD 3KR3L 1WUNT 5ADOH 4Z7WB 5GGRA 2P47B 3GSXB 3H3PL 2DIAA 4G9FB 4DN3L 1AO7D 4QYOA 2FD6L 3PWLA 3MLSL 4N0YL 4MA1C 4G43B 4YX2L 3RVTC 5ESVB 4HHAB 2ZOLA 1IEAA 2Z31C 1HKLL 4RZCB 3RIAF 4A6YB 1Y0LA 1SJEB 3F8UB 1I4FA 2PKDA 1YPZF 2BVPA 2F53D 2BP3A 1T7XA 2JELH 4IDJH 2IMMA 1KLFA 3CX5J 4JAMA 3QEGH 1IAIM 1SEQH 3IDJB 3L1OL 4OQTL 3QXUA 4Q0XL 4FQXC 1N5YH 4XBGA 5T3ZL 1WISA 4U1KB 5IOPB 3MXVL 4BZ1H 4TNVK 4XCCL 1NEZG 3QDGA 4M5ZL 1BWWA 1MJ7H 1QR4A 3RKDC 1J05A 1NLDL 1B0GA 1WWWX 4XRCB 1FAKT 3O8XD 4GRWF 5CP7B 4JKKA 2PW1A 2Z0BA 4X4XB 1RJZB 3ARYA 3H9YA 4Z76A 4LPWA 5KN5A 3CVHL 5J4MA 1UCTA 1NL0L 5DD5H 3CMOH 4BQ6A 5FO9B 3SGEH 3V4VH 2P8LA 4OI9A 2DTSA 3GGWA 4KUCD 2X4NA 5DK2B 2P45B 3HS0A 4PRNA 3BISA 4NWTH 3WNMA 4WEBH 3OZ9L 1JGEB 1S8DA 5L2KB 1KN4L 2E6PA 5ID1A 3J7HA 4S2SB 1KJMB 5BV7H 2YZ1A 3WNPA 4XCEB 4L8DA 5FYKH 4XP5H 1AI1L 2D7TL 1D5BB 3DX8B 3T4YA 4KU1A 3HE6B 2PXYD 3DV4A 4Y1AD 4LMQE 4RGMC 4NN6B 3D3VD 2BY1A 4IJ3B 4K3GA 1DQMH 3S4SA 2PXYC 1ORQB 1YEFH 3O3BA 1FYTE 1JGLH 1M6OA 1SVCP 4HH9A 3VXNB 1OSPH 1FYTA 4JFEB 1TPXC 2MPAL 4FQIH 4K3JH 5JMRA 1J1PH 3QCVL 3C6LC 5BO1H 3CAFA 3O9WB 1IC4L 1N3NA 4UILH 4Y4FD 3MROB 1I7UB 4HBCL 1T2QH 2Q7NA 3DXAE 3O41A 12E8L 2HAZA 3U0PB 2B5IB 1X4YA 4OGXH 3HFMH 4V2CB 4LGSB 1IGTA 5I1KH 3DXAA 5HVFB 3LRSA 1HILA 1M71A 4BQCA 3ARXA 1JPGB 2X41A 1QO3A 3ZKXC 3HE7B 4FFZL 3TIEA 1T0NB 3U48A 2BVUA 2HT3D 2Y6SC 5IW1B 1Q0YH 3K3QA 4LSVL 2J4WL 4YHOH 3VXQB 4PP2B 5EC2A 1HHGB 1EHLL 4RMTA 2FB4H 1FVEA 4CMMA 4UTBH 1VGEH 2J8UF 1VFUA 2O5YL 2BSRB 5EPMB 1WZLA 5DJ0A 4NQCA 3L95A 4DUXA 3O6KH 3L3IB 4Y5XA 3UTOA 4OZIB 3X14B 3C87A 1A6ZA 3TH3T 2KQNA 5BZDB 4DVBB 4ZXBB 2RAMA 2OJZH 3NIDE 2FCBA 3MNVB 1YPZA 1NC4D 1CZ8L 3P4OA 1JK8A 3VD3A 2JJSA 1CG9B 3CXDL 1FZMA 3QDGD 2VDKL 3TO4B 5SWZD 5IFHH 2BVQB 1D5MB 1FN4A 4L4JA 4LK4A 4S1SL 4C54A 3T1WA 4OCSL 2DB8A 4WO4C 4YNYA 2ZSWA 4H0IA 5JQ6H 5GRYA 1Q9OA 5D6DC 1AP2B 3CPLA 5L6YH 5ALCH 4OF6A 4G6JH 4DEPC 4GBXB 1JNLL 1N4XH 4N5UA 3ZE0E 4K2UL 5I1EL 1TLKA 2PYED 5GRVL 5DA0B 3V4PH 3GI9L 4NQEB 1KXTB 1LP9E 2VLMD 2FEEI 1T7WA 2IAMA 4JHWL 3VFOA 1ZV5A 3OJVC 1LP9A 4QEGA 1F5WA 4RAUB 5DFVD 4QHKI 4QRRB 4YXLL 2DQJH 1J5OL 1NH6A 4W6YB 3LN9A 2DD8H 1LD9B 2VLKB 2GSIB 5GRVK 1EV2E 5F7HA 2H3NA 3BAEL 4MA3B 4ZUTB 5ID0B 4RIRB 4ZSOB 4DK3A 5DHXB 2FLBT 3JTTB 5AZ2H 4LDEB 2VERN 4N0RA 3SDYL 1G7JB 4IRJA 3ORJA 4NC0B 1E4KA 4X5WA 5DEFA 4LLQA 1OHQA 5JXAL 4LU5L 1I8IB 2QSCL 1FBIH 2F54B 4RA3A 4URTB 5I74C 3L3DB 3UYPA 5D6CB 1QKZL 1U3HC 1NFIB 1MLCB 3S34L 4OCYH 3MYJB 4S1DD 3QA3B 4YHMH 1CXIA 3WLWD 5FIEA 3QFDB 4NO5A 4M1GL 1T03H 1MAJA 5FO8B 3FRPG 1ZLWK 3DROB 5D8JL 1U8KB 5HHVH 4KRPB 1HH6A 2GTWA 1VACA 5FUZH 5L8JB 1EA9C 3SDCD 3BIBX 2X89D 5D2LF 2VLRE 1FL3B 1Q0XL 1YQ2A 1UKTA 3DX7B 5E00A 4JRXD 1BAFH 2VLRA 2OL3L 3ZSTA 4LARL 3VH8B 4RMVA 1FV1A 3C5JA 3TA3C 4XC1L 3RWEA 2PCPB 5T1KA 2AKRB 4NQCD 3UPRA 2GJZA 4QNPF 1A3QA 3D69A 4KK5D 1E28B 5EIIB 5T3ZE 4OQTA 3ARSA 2VZSA 3GSWA 1IGCH 3IKCB 5EOTB 3H2WA 2P44B 1RIHL 5D1QA 3VG0H 4RMRA 3BD4A 2JTDA 1BBJB 1YDPA 1A8JH 1HINL 1QRNE 4YEFA 2XACC 3IDNB 2XPGB 3BWUC 4TUOB 1I1AD 4LRIC 2QQLL 2E7LC 5AYQA 1QRNA 2AJVH 3G5ZA 1WGOA 4UQ2A 1DCLA 2FWOB 3VFUA 2B4CH 4WU7B 4ZUUB 2CDGB 3CVHA 1Q72L 3OXRA 4HC1A 3QT2A 4JRWA 4Z78A 4U3XA 1PX3A 4NN5B 5D9SB 5DQJA 1CICB 4D3CH 3TFKC 1OCWH 4APQC 3QIBD 3WHXB 3ARBB 1CIUA 1Z0MA 5DMKB 4MAYD 4HF5H 1A0QH 4ODXA 4LVOC 2XZCH 2VQUA 1HSBB 1U8IB 2DJUA 3RDTB 1UFUA 3QIWC 3MSPA 4ELKB 3RHWF 1QOKA 3OPZH 4H1LH 1JPTL 4MD5A 4V2BA 1CT8A 3S36X 1EEZB 3MOAL 4PJBB 1EBPA 1ZGLB 1MCHA 3LEXA 3W9EB 3F62A 4WWKA 4NQUA 1UA6L 3BXNA 3EBAA 4PJ7B 4DKEL 5L8LB 3QEHA 4LLYA 2C4XA 5SV3A 3VWKC 5CJOL 3TN0B 1AHWB 4IRJD 1C08B 3P0GB 4ODHL 5J06A 3ARDA 4P23A 3BQUC 4KMQA 5CLTA 2ZUWA 2Y4SA 3IVKB 1OD9A 3R4DA 4IMLA 1I1YB 4XAWL 4F57H 3G9VA 4M1DL 5L0QC 4TNWF 1HN1A 4YIQA 2K7QA 5EO1A 4PJAB 3K0WA 2Q3ZA 5E8NB 3UZQA 3MACH 3BYYA 4P3CL 3PF2A 5A16A 4FQ1H 3U1SH 3OBAA 4JFHD 1HQ4B 1WBYB 1BFOB 1F6FB 2AW2A 4QHLA 1U8OA 3FB7B 4HJGB 1U93A 1LO3L 1NC2A 3OKKB 3OR6A 4Z7NE 4JR9H 1N7MH 5ILTL 4EQ3A 1JNHB 2AV1A 1IAMA 1QLFB 3QG6A 4F7PB 5I15H 2XKNA 3K2UH 1F6AB 4PJXF 2UZXB 4LASL 2YN5A 3KJ4B 3WO4B 1I7TB 4WTWA 1BZQK 5FA3B 2EIEA 4LEXL 3DX6B 2WIIA 4Z7UB 1MRCH 5AZEH 1KJ3H 3R1GL 2V2WA 3MV8E 4GW5A 2B2XH 4M4RA 4PJEB 5E6IB 1VB9A 3EYSL 5E8OB 4MXQD 1FG2A 1ULVA 3SDAB 3WNLA 2E5EA 4Y4HA 1CTNA 2ICWA 2YA0A 3KPRD 4ELMF 1CL7I 2KUTA 1G6RH 4CN6A 1U0QA 4ISVA 2HG5B 1NEUA 4IRSB 1FORL 4PR5A 3T2NH 3D0VB 2NYYD 1J0ZA 4FQ2H 5IBUG 5CJ8A 3RWJA 4M6OL 1EXUB 1K4DB 4JKLA 2OJEA 2VL5B 3CU7A 3AREA 5KSAB 4H88L 4P5MA 4Q2ZB 5DJ6A 4KKLD 3HC3H 2DI8A 3PWVA 5I1HL 1EPFA 4QWWC 1YEDB 3FHAA 4FQLH 4ZO9A 4DGIH 1F4YL 1K6QH 4OCLC 3OAZH 5MEPA 1QFUL 2EYRA 2WM0A 3NH7L 1TVBA 3FQWA 2XRAL 4ZUSA 1QP1A 4RRPA 1MSPA 1DQTA 1I85C 3RIFF 1RIVL 1URLA 1R6VA 3QQ9D 3UTTE 3TP4A 2G2RB 5I16B 3QUXA 3QHTC 2HKFL 4L4VE 5CHNB 3O2WL 3UTTA 5EUOE 4JO4H 4BQ9A 3RTQC 4G3YL 4L4VA 4U1MB 3BGMB 4YK4B 1F00I 5EUOA 2GY7B 2JB6B 2A83A 3JWOC 4XB8A 5C0CE 1R3JA 4JEGB 1UCBH 1NAKL 1HDMB 4LCYB 2ZUUA 1F2XK 4H8WC 4XBEH 3CFKA 4PBWD 1M05A 2I5YL 3LIZL 3QO1B 4WWKD 1J8HA 4HKZA 2G5BB 2IPUK 4TVSa 4XAKE 3AS3A 5D7IE 3G9AB 3QO0B 4HKBA 3JWNC 4JZOB 3PQYB 3W0WB 2X4SA 1PX4A 4R0LA 4WI4A 4ZPTB 3O3DA 1A5FL 1MI5B 4E42A 4IRZL 5FYLL 4MZ2A 4FQHB 4UNUA 4Y8AA 3MV9B 3ARFA 2ZZUT 4PRPB 2O61B 1G7PB 3P40A 4ZPVB 1T20A 1K8DA 1RVFH 3ARGB 2NY0B 3L5XH 1RSFA 1MLBB 1FFPB 1OGAB 4NNPH 4QOKE 3QCTH 4GW1A 4AY0A 4Z5RB 4WFFD 4EUPA 4JDVB 1KTLB 5ENWA 4UT9H 3ULVL 3HPLA 3EDEA 4TSBH 4CU6A 3NAAL 3OAYK 2PETA 3GMRB 2X9WA 3TLRA 1VFBB 5FV1L 4I0CC 5IB3A 5BW7C 3KPLA 1RZJL 4UMGA 3WFEH 1ZLUK 4O2FA 5C6TH 5C07A 3S36L 1BJMA 1HHKA 4MJ6B 4NNXA 3LS4H 2FJFA 3CU1A 5IK3B 1QR1B 4L8BB 3RI5K 1HXMA 2A6JA 1N64H 5TDOA 3KPSD 1IEBA 5DS8A 1G6VK 3DVNA 3MQIA 4UUJB 5E8EA 1P5VA 4Y4HD 5H94A 3WUWA 3THMH 1HI6B 3PNWA 1S7RB 3U7AA 3VXPA 1MCWW 2VXVL 4JM4H 4O4YL 1ACZA 1YYLL 2R4RH 4X6DA 4M5YH 3O3UN 5E0QA 3SDXF 3MV7D 3K2MC 4RGND 1SYSB 3GRWL 5FM5M 2ADGB 2ZOKA 4LQFL 4PJDE 5EWIH 1XR8A 1X5HA 3C08L 1LE5B 5C9JB 1N59A 3ARED 4NJ9H 3R06A 3HE6C 1YMHB 2HKHH 3W39A 1OLLA 1VADB 3BPCA 3ULSA 5HHNB 4C58B 1WCBA 1ZT4A 4H25B 1JGUL 5GS3A 5HDBF 2FSEA 1JPSH 3D0LB 4WW2F 1BVKA 1LK2B 3EFFA 1DBJL 1QSFA 3QXAB 1A4JB 5MEQA 1WBZB 1RZKC 1T83C 1JRHL 4CBPA 4MNHB 2YUWA 3QUXD 3U4BL 2NY5C 5F89B 3GDBA 2EEAA 4RSVA 2CLVA 2OR9H 4BH8B 3O9WC 4D8PA 3QDMA 2B1AH 1T5XA 5F6IC 4EN3B 4CGTA 3JXAA 3C09C 3E0GA 3ULUL 2QSTA 5DI8A 4C56D 1NCCL 3LQZB 2DLTA 1FAIH 2B5IC 3MR9A 5J89A 1DBBH 1UG9A 4FOMA 4FS0A 3WS3B 1A64A 1ZANL 2IGFH 4KJWD 4AT6B 5DO2C 1C1EL 4O2EB 1CQYA 3HE7C 2BY0A 2Y25A 4R97C 4JKMA 3MMEA 3C9NB 5D7JB 5IV2B 1QEWB 1T3FA 3AMKA 1XF3B 2GUOB 1BEYL 4LLDB 1HH9A 1YEHH 5EZOH 4QRUA 1XGPB 4NCC1 4WY7L 4BUHA 2IADB 1XGRA 5DJYB 1IQWL 1MHPH 5TFSL 3CC5A 3P30L 5ICXB 1UWEL 1P6AB 1KJVB 3ARFD 4ZXBC 3SE3C 1EERB 1W72L 2Z92A 2LVEA 5JORB 3BH9A 3PHOA 4XVUD 4PRAA 2V7HA 2DWDB 3FB6A 2IFFH 1CFSA 3T0XA 2HT2C 5DSCB 1D6EA 2V2XB 3VFPA 3TO4C 3N1QC 3JWDC 3UC0H 4AQ1B 3MBED 5E9DD 1JL8A 2GSGB 1JI2A 3NZ8B 2YBRB 4GG6B 3D39E 4PB9H 1FNGA 2W0PA 5I76B 4YHPA 1QLRB 4Z7VF 3FB5B 3VD9A 3CLEL 1MJ8H 4K9EH 2BFVL 5IEKA 2C1OB 3CZFB 3GIVB 3OKOA 1UYWH 2QEJA 5MHSD 5CEYA 3X11A 4JPWH 5F96H 5FM8A 2CLZB 2HN7B 4QRPB 4LLWB 1IGYA 5C0IB 3U4EB 2HJFA 3QFJE 4PJIB 1QQDA 4PV9A 1PBYA 5DZLA 1BQHB 1T66D 1XH3B 3QFJA 5HI4C 4F58H 1NBQA 2DLFH 1I7RA 3D5OF 4Y0GA 3PP4H 4QHMB 5L7XH 3ROOB 1S5IL 3B2UC 3G6JF 4M6NH 4NUJA 3BESR 2F15A 1MAKA 1KGCE 1AD0B 3SKNB 1OP9A 3JUYA 3GMLA 1L7TL 3EFDL 3IT8D 4HUKB 1NSNL 5DJAA 5IWLC 2ICES 4PLJC 3VXSB 3O45B 1MHEB 4D9QD 2CIIB 4J4PA 4ORZC 5TGBB 3IFNL 3QPQC 4LPUA 1ZT7A 1DJSA 4D0CA 5I1GL 3QRGH 3MLZH 4Y7MA 5E08H 1P4IL 4XGZA 3HAEA 1P53A 3ZDYE 1QSFD 1QVOA 4Y2DB 3REWB 2WK2A 5EOCL 1MIMH 4OZFG 1G9NH 2PTTA 4HIHB 2WP3T 4JM2B 2VDNH 2XWJB 3EYOA 4LNRA 4MNQE 5C92A 3CUPB 5A40E 2N7AA 5JLZA 5D96C 2Y07H 1EGJA 2YOCA 3NFSL 4NP4H 1DQQA 2P7TB 4HDIB 4AH2B 4G42A 2A2QT 4NKOA 1EK3A 4LSQH 5T1LA 4MDJB 5CSGA 1MJUL 5J1AA 3QQ3A 2W9DH 3DETD 2NTSP 4XCYB 5E5RB 4IIQA 4LEOB 3PL6B 4JVPA 5F44A 1CDCA 4FABH 3UPCA 4PJ5D 4MXWH 2V9QA 4MVBD 4ODVH