1ADQL

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
213
structure length
213
Chain Sequence
YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPPGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/autoantigen)
molecule keywords IGG4 REA FC
total genus 41
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqL01
1MHEB 3OXSB 4KVNH 1GH7A 4DZBA 1CGSH 3RWCA 3U7WH 1NH6A 2M26A 4LIQE 4HZLA 1N0XH 3WO4C 4BQBA 1FC1A 3V6OE 1HQRA 3AXLB 2MCPL 3RGVC 3OB0K 5I1EH 3WIIL 1DL7L 3ROLA 3QI9A 5JIIA 1CFQA 1U8MA 2V2XA 1M7DA 4KGLA 3TH2T 2K9UA 5DVMA 1JL8A 1OP5H 1WWAX 3PWJB 3QQ4B 4M9OA 3GM8A 2DQFB 3HMXA 1PZUB 3DETD 3R8QA 1VFOA 2IAND 4ZUTA 4D9RE 1K3ZA 1DR9A 3IFPB 3D0VB 1HQRB 1LHZA 4DGIL 3GSVB 5D9SA 3WL9A 3FB6B 1Q94B 1AGBB 3U4AA 4O02L 3LVEA 1YEHL 4GW5B 4AY0A 3UXFA 1U8HB 4K2UH 3HI6L 4HIEB 3MV9D 4K3GA 2EYSA 2K7PA 3GIZL 4GRLA 3X14A 2AJYL 3JV0A 5SWSB 2A73B 4JVWA 1BBJA 1BD2E 2F19H 4JFEA 3SHSA 3QT2A 3D87B 3DXAB 4WNQA 1PKQE 3QDME 5IBTH 1YQVH 3EOAB 1Q1JL 5B39B 3L6FA 1UWXK 1CGWA 4QWWD 5GRYA 3WS3B 3V9FA 5DQ9A 5CP3A 3VFUA 1KJ2A 1SMOA 2NY1B 4MDJA 5CJOL 3HG1B 1BX2B 5JZ7C 2D03L 4RGNB 3OZ9H 4PR5A 1EXUB 4BSWA 3RPIA 3S88H 4L9DA 1HQ4A 4QRRE 3LPWA 4NJ9H 4NRZA 1FSKB 2YOCA 5MI0B 1UB5A 1HHGB 4I48B 1F11A 2R23A 1G7QB 1QOKA 1ZEAH 5D96B 4C4KO 1ZVSB 1MI5E 3T1FA 1S3KL 5EN2B 3CX5K 1CXHA 4Y4FB 3O4OB 4S1RL 4AEHL 3DSNA 4TSBH 2FEEI 1HEZB 1YECL 2NLJA 4ZQKB 2VLMD 4PJEA 5I15H 1IMHC 2VDNL 3P4OA 1MFCL 4UB0H 3E2HC 4ZS6C 3BO8A 2HFFB 3WD5H 5I73B 2O5ZL 3ARUA 1IGYA 5L8KB 4P5TA 3WN5C 2ADGB 4HH8A 3CSPA 4GUPB 1RI8A 3IJSB 3NIDE 3BP6A 4O5LL 1JRHH 4ZNEA 1K4DB 3PL6C 3FB7B 4YDVB 1K8DB 3V5DA 5E5MB 3QUYA 1AI1L 3N9GH 1ZMYA 2GJ6B 4XHQA 4OZIB 3HR5B 4ZS6D 2HFEA 3DLQR 4XI5C 2QR0A 1NCAL 3ET9F 2PYEE 5KSAD 3MA7B 4IHOB 5MERB 1GHFH 5SWSD 5CFHA 3GJFA 5I9QC 5DFTA 1AD0A 4K94H 4O9HH 4G42A 1LO0H 3IFLH 3OAUH 3QA3B 3HRZA 2VMFA 3F65A 3MCKA 2DI7A 4K3DL 3HE7B 5MEPA 3JWDC 1KJ2H 5JA8B 4RMQA 3BWAB 4OCNC 1XGUA 4KQ4H 5E56A 1ZT4A 3RWEA 3T2NL 4MJ5A 1C5CL 2R15A 3C08L 3E1F1 2XWTB 1YPZA 3A6BH 4P3DB 5HHVH 1FGVH 2NYYC 3T2PA 4MS8C 2R0KL 3L5WB 3PP3K 5TJWK 2VISA 3WNKA 3NCJL 5EUOF 1IQDA 1RUPL 4Z7WF 3K81A 1PX4A 4JPIA 3SJVD 1R5WA 1F3DJ 1RPQA 4LSTL 4HK0A 5DK2B 1Q9LB 3MCG1 4NN5B 4OZHB 2MHAB 1BQHA 1CI5A 1SY6A 1T1WB 4GAJH 1LP9F 2AJZB 2NW2A 5DS8B 2WLYA 4XH2A 4E5XB 2XXMB 5BMFH 3LEVL 3PXHA 4KJQC 3P0VH 1FGVL 3C8HA 2EZ0C 4OCSL 4LU5L 4TQEH 5DTFA 5HI4D 3VFPA 2VQTA 4HX1B 3GKZA 3BPNC 5CD3A 2CIIB 3RKPA 4XNMB 2M8XA 3DTXA 4FTVA 5JUEL 4MNQA 4XMKL 4ZTOH 3IFLL 3CZFB 3IDGA 2XTJB 1JWSA 4GRMA 3AVEA 3GGWB 5EO0A 4GKNA 5EOTB 4XPBL 5E5RB 1MRDL 1A21A 4OLUL 1D6EA 3DIFB 3OKOB 4FQHA 5D7IA 1E6OL 1FL3B 4AMKH 5ACZA 4YPJA 3HE6B 4N0UA 2EDBA 1A6PA 5IFAH 5C0BD 4ODVL 2VZ1A 5KS9A 4ALAL 2ESVB 3EAKA 3RPIB 5TE6L 3U2SB 2GHWB 1AXSB 5SWQB 4LLMA 3IDNB 3VFRB 4ORGB 1LGVA 2EE6A 1YPZE 1V8HA 2W60A 5CILL 1J0KA 3HFML 3O11A 4UB0L 5EBLA 4K55A 4AIZA 2HAZA 1BIIA 5I15L 4E42B 4R7DA 1WITA 2XTJD 1IKFH 3DXAA 2GW5A 3AAZB 2XNAA 2IPUK 1BD2D 5DZLA 4GAGL 1KGCE 1JPFB 2CJUL 4XPGH 3T2OA 1NMBH 4G42B 4ZOAA 4RNRA 2BDNH 4NJ9L 2IGFL 4JRXA 2GK2A 3JV6B 1JNHB 4JQXA 4WGWB 3GSOA 3NCMA 4JY4B 1H0DA 2Y06H 3G5VA 1JGDB 3GSNH 3RGHA 1KYOJ 5E94A 5ISZD 5LQBH 5CIPA 3T4AA 3BWAA 4N0CD 3S37H 1KIQB 5C0IB 1JZ8A 4AH2A 2I5YL 1HN1A 4HUXB 4P9HH 3S96A 5F7EH 1ORSA 1WAAE 2ATKB 4WVRA 1U8NA 3MRMA 1LE5A 1KENL 1RK1B 4M5YH 1IGCL 3LKQA 3ULVH 5ICYA 3UTSB 1T20A 4M7LL 1KT2B 3BUTA 1ROWA 3MRQB 4QRPE 3NN8A 1M71A 2DDQL 4RAHA 4AEFA 4U1SA 4ZFFA 3UTQA 4MDJB 2BY2A 4ZNEE 4TNWF 4LIQL 2VRAA 2IEPA 1W0VB 2WQRA 3VG9B 4UNVA 2DBLL 2WV3A 3G04B 4JKKA 4PJIE 3V4PL 3OR6B 3L3KB 1JGVH 3VXMA 4EI5A 4X9IA 3RZCA 5L6YL 2XQBL 2Y6SC 4M62H 4WI5A 1PZ5A 4JHBA 1IAOA 3EHBD 1OAYL 3LZFL 4PFEA 3RVUC 1NGXB 4I13B 4M48H 1PX3A 3OKKA 4WWKB 3DI3B 4UILL 2WWMD 1OAZL 4DKDC 4E5XA 1OT1A 4IRJD 4P46A 4KVNL 1F02I 4O2CA 5GRUL 1G6VK 3MREB 4DGYL 2DAVA 2G60H 4JR9H 3TN0C 1AC6A 5BVPL 4GSDL 4ODUA 4FQXD 1TPXC 4NRZB 3JUZA 3ARFA 3BRDA 4XNZC 1S5HA 5KVFH 3ARGC 5EO9A 2F74A 4XX1E 4OZIE 3OKKB 1AGEA 4L4TD 1YNTB 4UZGA 4S2SA 3QDGB 3QDMA 5JA9A 3C60A 2HP4A 1ZWIA 4PJFA 4XP5H 1BD2A 2GSIB 2P47B 2XRAH 1GZQA 4TSCL 1WBXA 4KK8D 3WE6B 3RVVD 5CIPH 1J8HE 3LQZB 1WCBA 4HUXA 4CUCA 1YEJH 4PGEA 1A9EA 2WP3T 3STBA 4DKEH 2KZ1B 4N0RA 5KG9A 1MLBB 4HJ0C 5KVGH 3M45A 3ZKMC 4Z7NF 3TJEH 5IG7B 5DUBA 4AL8L 4K07A 3P40A 2W65A 5HDBF 2NQCA 2W59A 5HD8D 5ID1B 3WLBB 3HMXL 3IU3A 2WUCL 3O3BB 3IDNA 3WLWD 4PJCF 5I66B 3ROOA 1NBYB 3V5HB 5L2JA 1P4IH 3VGDA 1Y18B 4YDVA 3S3PA 3ULUH 3IDGB 2XPGB 4RGNE 3QUYC 3I6GA 5IK3A 4WW2C 1NLDH 1WBYB 5IGXH 1UH4A 3O6MH 3TBYB 1P84J 4EDXB 3MV8A 4F7TA 3AUVA 4ZXBD 1TITA 2DYPB 3UO1H 3VFTA 4PB9H 3JWDL 2PXYC 1NBYA 4G9DA 4N8CH 3RWFA 2ATPA 1FNSH 5C0GA 3CLFH 4JN1L 3MYZA 3D85A 1INQA 2VXVL 1DANU 2H8PA 2Y7QA 2Q76B 1CVSC 4YX2L 1A5FL 4NNXB 2CLRB 5H35A 4ZD3L 4HX1A 3GSNA 1BFTA 4XAWL 5F1IA 4P5MA 5IW1A 3S37X 1J1XH 1B6DA 2OTPA 1BIIB 1V7NL 1ES0A 3PV6A 3SKNB 2UY7A 3BEVB 3D3VE 3ARZA 1T2QH 4KMLB 1UJTA 1JYXA 2GITB 1VCAA 4LLUA 5AAWA 3QEGH 5IMKB 3E3QC 5DFVD 3KPMB 3UCRA 1RZFH 2W38A 4JVPA 3UTPE 1EFXD 5CUSH 3SDDA 5DK2A 1R3IL 4JPKL 1REIA 3V6FA 4JRXD 2IH3B 4G3YH 3KXFD 1U3HD 1FC2D 5I74C 4CVXB 1VGEH 1TQBC 4Y5XC 4JJ5A 4NP4H 3VRJA 2XWJA 4WJ5B 4KTDH 5D2LF 4LCCA 4KKLC 4KVCH 2IAMD 1G7LB 3EYSH 3QJHB 2DIJA 1HZHH 3I9GH 3O41A 4XP6L 5I18H 2Q8AL 4U6YA 4MD4A 4EZMA 4TUKL 4NWTH 1EHLH 2BMKA 3IU3B 5E2UL 4YIQA 5AD0A 3I75B 1DBML 1A6UL 4JGMA 1QKZL 2ZUQB 3KYKL 1OM3L 1C5BL 1RZGA 3RIFK 2ZOKB 3F5WB 2J1KA 5T1DL 4PJ9A 1KTKE 4CDHA 4EUPA 3DBXB 3QXAB 4KJPC 1K2DB 1G7PA 3QIWA 3B2VH 1IGJB 4YHIB 5J9PB 4HUVB 5AEAA 2O26U 5IMLB 4EUPG 1W0VA 4JRYE 2V2WA 1QYGH 4JO4H 1FH5L 2W60B 2VLKE 2MWCA 2VXUL 1F5WA 3ZDYF 1HHJA 5F7KC 5E2JA 3GJFH 3WFHA 4RZCB 3TPUB 1AO7A 5HHMB 3O3EB 4NO3A 5D1QD 1A1OA 4PJHE 4ZUUA 3LEYH 2OBGA 1GGCH 5FYJU 4ODTL 1R0AH 3CFCH 1FJ1B 2CO6B 5KN5B 4IMKA 1QSFA 1NC2D 3HZVA 1VB9A 1MJUH 3EYOA 4P4KC 4PGDB 2PTTA 4XVSH 4ZAKC 4ZAKA 2JJSA 3RKDD 1D9KC 4ONOA 1A6WL 5B38A 5LG1A 1NANH 4F7PA 3CFDA 5D5MF 4YXLL 5ITBH 3WHXA 4H0GA 4HUMB 4N9OB 4BFGA 4G8FA 5DSCA 5MEQA 4X98B 2IH3A 1HI6A 3BT2H 4X9BA 5DD0H 5HXMA 2XQYK 1CLZH 1RUKL 2GTWB 5HI5C 2FO4B 4E0RB 4UUJB 2HTKC 1BAFL 3UTTE 5L2JB 2ITCB 4M6NL 4EN3C 3T0XA 1KPVA 2PTVA 4ONHA 3VWKB 3MOBL 3QFJE 1ZK9A 1N0LA 4OLWH 1B88A 1IAOB 4K71B 4XNYL 2FZ3A 1NDGB 15C8H 2PCPA 1U3ZA 2NY1D 4ZSOA 3CJJA 3IAPA 4CNIA 3BEVA 3O9WC 3EYFA 3H9ZA 5GGSY 3P0YH 3QDJD 4OGXH 4RQQA 1UCBH 3J8F7 5TE7L 1CFVH 3IF1A 3QIUC 4JHAL 4HK0B 1LEIB 1HWHB 3HZKB 4JPVL 3AS0A 1JGUH 2RFXB 1EO8L 4RX4A 3VH8A 3VFUB 4BQ8A 5I66A 1T1YA 4GKSB 1UJ3A 2IPTL 4M6OH 2QQQA 2HFTA 5DDHB 1JPTH 1LE9A 3L95B 5IBUB 5D1XB 3Q6FB 3LDBB 4HHAB 5SWSA 4EBQH 4K9EL 2ZJSL 4HBCH 3IT8D 4Y19D 2OMNA 1YEEH 3MLWH 4GG6B 4PJFF 1MIEL 2I07A 3ARWA 1W2KT 4XP4H 1TVBB 3GMPB 4ZOBA 2LTQB 3ALXA 5JDSB 1KIRB 3RWDB 3MV9E 3O2VH 3TBSA 3EUUA 4S1SL 1X5HA 1UQSA 3OMZA 3HUJB 5HVHC 2V9RA 2YC1A 3IXAB 5J06A 3BKMH 3QG7H 2Y5TA 3MZTA 2NW3A 1SYSB 3ARYA 2YMXL 1MCOL 4LGPB 1U3HB 1GJIA 1J05A 4DTGL 1QFWL 4HIEA 2NY3C 4I77L 2NPLX 1HI6B 3W5MA 1YEFL 3TO4D 5DVLA 1KC5H 3QO1B 3WN5A 3LQMA 4XP9L 1ZLWH 1BVLB 4M4PA 4JO2H 2Y9RT 3AU1A 4X6CB 1ZT1B 1WZKA 4OJFL 1EZVX 4YFLF 1BECA 3G5XA 1DFBH 1D6EB 2DLFL 2IWGA 3EJZD 3QWRA 4G6FD 4DW2L 2NXYB 3B5HA 3L3OA 1MWAH 5K9OA 1SBSL 5HYFA 2VAJA 5EIQA 1ZLVK 4FQLL 4NYLB 3RTQA 3FQXB 3OG6B 5E6IC 3IKKA 3BGMA 1NC2A 4L29B 3K0WA 2QKIB 5L0QB 1S7QA 4JHWL 1S7UA 2CRYA 2A1WH 4WFGD 3TA3C 4RDQG 4ZTPL 3VRIB 4IJ3C 1HH9B 4JZNB 4AQOA 2X1PA 1X5KA 1T5WB 5FHBH 2GUOA 1CXEA 5TF1H 4Z78A 4JQIH 1F4HA 5DHVH 3NIDF 2YD4A 4E41E 5AYQA 3N1MC 5FGCB 1TCRA 4UV4L 5IESL 2DKMA 1I85A 4IEFB 4M7ZB 5IMMA 4PTUB 1AR1D 3FQNB 2HJFA 3SO3B 3T1WA 3PGDB 3QIBD 1BFVL 4I3SH 4NM8H 4BZ2L 3SPVA 3VD4A 4IRSA 1U8IA 4ZSOE 1NAKL 3AB0C 3RL2B 4XVJH 3OHXA 3DO7A 5C0JA 3OGCB 2KZWA 1OF2A 3NPSC 5GJSL 1QBLL 1FPTH 5IBUG 2KQNA 2ATKA 1ZLUH 3HTLX 1KXTB 1QVOA 2YN5A 1FCCA 4ZPTB 2EE2A 1DQQA 3NIFF 2J8UE 3T0WA 3BUYB 1NL0H 1JN6A 4EIZC 5K9JL 1OAKH 3BMVA 3QDGD 4P5MB 1ZA3A 5KOMC 1DE4A 3QH3B 3WFZA 3LD8C 5D2NC 5EZJB 5GS0D 4OGAD 2CMRL 4YFDB 4KK9D 3KPNB 1ITBB 4OB5L 2FIKA 3RDTB 5ID0B 2K3TA 2P4AB 1I9IL 1BHGA 1GSMA 1FFQA 4D9RD 2FX7H 3IJHA 4LLWA 5F6IC 3RA7L 4LGSB 1JE6A 5GRJH 4HD9A 5E9DE 4BQ6A 5E2VL 1D6VH 2KKQA 4Q0XH 1QA9A 2AJ3A 5E8DL 2WBJD 3NCEB 1MJ7H 7FABL 3L3HB 5D72H 3BHBB 4X8JA 4ZS7L 2AK4B 1S9VA 3HE7D 3TN0D 1ZT7B 5KSUA 5JLZB 1FSKC 1FYHB 1UXSA 4EI6A 2CXGA 3BH9A 1ZT1A 3ZHKA 5B4MC 4R97C 3I6LE 3MODH 2WBJB 2R9HC 4YE4L 5CD3B 4JFEE 1PYWB 1YC8A 4LMQE 3UTTD 5I8CB 3FN0L 4DK6A 1SHMA 5GIRB 1XGQB 4M1DL 5EU4B 2FIRT 1ZA6B 5IVNA 1MEXH 4DAGL 2I25N 4NO2A 4NQVB 1IM3A 3U4BH 2DQTL 2VLRE 3GI9H 3UJTL 4JRYA 1OARH 3KLHD 5IEKA 4R8WL 1A7NL 3TC9A 5B3JF 1E4XL 4NQCE 1BM3H 4P3CL 5IV2A 2GJJA 4WHDA 1PEZA 4KMTH 1N2RB 4MXVF 1OWWA 4D9LL 3EGSA 4LEXL 3V4VL 5C0BA 4GRWH 5DRXA 1OD7A 2FO4A 5D7IF 1NCDL 4E0RA 4X83A 1F3JA 4QF1A 5DD3L 1ZVYA 1DBBH 1X6LA 2W0KA 3O8XC 1DUYA 5HYIA 3G08B 4BSVB 1UYWH 2ICES 4K7PY 1AY1H 2EDJA 3L3DA 2DQGL 3ABZA 3LIZH 3BN9D 4JFFD 1SYVA 5J89A 4KDWA 2I9TA 1MAML 5AAMA 3DRTB 1I1FB 2W9DH 3BPCA 1TVHA 3OB8A 1DBBL 5C0FB 3U6RA 4Y2OA 4I4WB 1GGTA 5DEFB 3HZKA 4X6BB 5E99H 2GAZB 5I1HL 1F3DH 5TE4H 4OCRH 3MV11 2IG2L 1G84A 1RY7B 3L9RB 1XT5A 4LL9A 4OLXH 4RWHA 2Y36L 3FRUA 3N50A 2XIDA 4FZEL 4M1GL 4GW4A 5DJ8B 2ESVD 2HJFB 4AT6B 3GI9L 1S5HB 4P46D 1LEIA 4HCRL 2F9BT 3L5XH 3IETA 5BRZA 4Y2DD 4DAGH 1J0IA 4FQCL 4LRIC 4FFVC 3ISWA 1D5XB 4OD2B 1I9JH 5F7WC 3GK8L 5A3ID 1DQLH 1NLBH 3S7GA 1S9WB 2FH8A 3TNMA 4YE4H 1U8OA 2BNQA 3SKOA 2FYYB 2DLIA 5I17A 2OZ4H 2ZPKL 4HBQA 5CGYD 4UIMB 4ZS7H 1R24A 3W0WE 3G5ZB 4YH6A 2VL5B 1IGTA 4QXGH 3ZL4H 4NJAH 1MIML 3VGGA 3K2UL 1S9YA 3KWWB 3QRGL 3NCCB 4XXDB 5J8OA 4E41D 3BGMB 1EUUA 3LQAC 4H25B 4OBRA 5C09E 1NAMA 4U7KA 5FYKD 1J8HA 3SOBH 2FX8L 5CGTA 5J13C 4V1DD 1WT5A 1AD9B 3QQ9C 5EU3A 3MJ7A 1DBJH 3P73A 3ZE2F 5FYJL 4DK3A 2VH5L 1SJEB 4BK5A 2CMRH 5JR1L 3QEHB 1NEZB 1JNNH 4KDTC 2NY2B 4K7FB 4XGZA 3RI5K 4PJCE 1AFVL 4XCNA 1HQ4B 1LEGB 1FHGA 3VFRA 3VWJD 3WIFA 5KSVA 1G7IB 1OWRM 1CDUA 1FV1B 2EE9A 3PQYA 3PGCB 3MLPA 5K33A 4Q9QH 3MRDA 4PY8J 3FO0L 1KJVB 3MRBA 4W4OA 4Z7OE 3Q5TA 4OTXH 5DZNA 4PGCA 1LO5B 3D48R 4NQEE 2AJSL 4PJFB 2F5AL 1XGYL 2P7TB 4E9LA 1NC4B 4LLMB 3T0AA 4F37F 1LO3H 3QCTL 4F7MA 3DARA 4MZ2A 3PWNB 5J4MA 4ODXA 4HKBA 3V6ZA 3V6BR 5AZEL 4QRRB 1KN2L 1OW0A 1ZLSL 4XPHH 1BGXH 1ORQB 1I4FA 1QFUL 2CLZB 5E94B 1B6UA 2R1WB 8FABB 4KI5F 4L4TE 3LKSA 3QEQE 2PCPB 5I1AA 5IIEA 3QUMH 1HXMB 1S78D 4XNXL 4M93C 2VO5A 5DFWH 4APQD 4ODHH 4DGVL 3M8OL 1XIWD 4J1UB 2ZSWB 3TVMA 4BKLA 4CRPA 3CX2A 1QSEB 2GTWA 3UBXI 4JHWH 4FXKB 3MA9L 4GG8B 3S4SA 2VL4A 4Z5RA 3BUYA 4PJ5D 1GZPA 4PRDB 2M1KA 2KDGA 2YD8A 4LVNC 5CINL 3IFOB 4OGYL 1INDH 1MHEA 2BOBA 1J11A 4U2ZA 4WHYG 2RQ8A 3EOTL 4R90H 2CR3A 1NAML 2DLFH 3GKWL 4NBYB 4ZO8A 4PJIA 3TJHC 5BS0D 1H3GA 5I76A 3LMJH 5GS1B 2Z31D 4S10A 3HG1D 4EEEA 3V0VA 3AGVA 4J8RA 4O2FB 4KRMB 1YEFH 2CKBH 2BSSA 2JIXD 4DKFL 2SEBA 2LAAA 1KJ3L 4LVHB 2W92A 5ADOH 3OAZK 5ITFB 4JAMB 3MMEB 1MCOH 2V2TA 1CFSA 5SX5H 4NO0D 3DMMA 1E27B 2ZUSA 3QG7L 1B0RB 3MJGX 1FLRL 2X70B 2EIEA 2F58H 1ZANL 1WFNA 1T0PB 3V8OA 3KPQA 1GXEA 2Z31A 3S5LB 4X6DF 3FO1A 3WYRA 2ERJC 3GSUB 3T3PE 2DOCA 1YEEL 3NIFE 3H9HB 1WBXB 1FO0B 1HIML 4AM0A 3BI9X 1EA9C 1VACA 5FM5O 4GOSA 4LSVH 4ELME 2UWEE 5E2WH 3U4EB 2PF6A 1H3PH 5FUCE 2NLJB 5D5ME 2ZCHL 4LGRB 4WHCA 4QRQA 1K4DA 4KPHH 1FCGA 3G6JA 1VHPA 1RZJH 4F2MA 4HJGB 1RIHH 1SJEA 2ADGA 4OCYH 3HNSH 5F89B 1UA6L 4LLYB 1GPOH 4PRNB 1CD8A 1IQWH 1UCBL 3OKMA 2FR4A 2P24A 4PP1D 3P0YL 1EMTH 3EO1B 4FFWC 5CHNB 4OZIA 2R0WH 3HG1A 4JCMA 4AEEA 5FUCC 3LRSB 3DI2B 2X4RB 4RGMB 1RZ8A 3WFEL 3T09A 1F8TH 3I3EA 5CZKA 2O5YL 3VXSE 2VDMH 1MNUL 2VR5A 3CSYA 4POZD 1G9NH 5I76B 1P6FA 3UYPA 4YHMH 4HIHA 2FHBA 3O8XA 1PY9A 1CXIA 4H1LG 4QNPF 3TVMB 4NZTH 4BZYA 3EFDL 4RFOL 3FAXA 3VRIA 3D39D 1F2QA 1HDMB 1CXFA 3QIBB 3SDCC 5ERWB 3ARDD 2HRPL 5TDNB 2VLRB 4PP2B 3CVIH 3H8NA 2CIKB 4LDLB 4GXVH 3V0AC 5FHAL 2B5IB 3TLRA 3RNQA 2MHAA 3EJZC 4MA8H 3VWJA 4ZXBB 3KHOA 4HS6B 1BBDH 3WCYA 4GT7A 3LEYL 2NY4B 1IFHH 1U8NB 3WFBL 3B8SA 3K74B 2JJTA 1OP9A 1CLYL 4NKMB 2VC2L 1U8KB 4U1KA 5CD5C 4C56D 4NT6B 2RCSH 5FA3A 3Q6GL 5EU3B 1FBIL 1V7MH 3HNVL 1FIGH 4RWYL 3D1MC 4Z7WE 1TVBA 1I4FB 3GMPA 5C0AA 1F58H 3DYMA 1TQBB 3C5ZD 4Y5XB 1N8ZA 4PJCB 5C08B 2D7QA 1N6UA 3WFCL 1C16A 5GGTH 5TH2B 5AWNH 4M3KB 1TXKA 3BPLB 2P49B 2VZTA 3BE1L 4Y4KD 5H37H 3C60D 2AEPL 1J0JA 5TQ2H 1ZSDA 2J6EA 1KB5H 5BVJA 4IDLA 1I7TB 5ALCH 4HF5H 4NQEB 5T1DH 32C2B 3A6CL 3KPOA 3BZ4B 3LV3B 2A74A 2C3GA 2JK5B 4MJIE 12E8H 1HCVA 4M7LT 2ILLA 4MLSA 3UDWA 1S7TA 4NWTL 2XOTA 4XWOC 1U8JB 5SX4I 1W8OA 4ZUWA 1IGMH 1HZHL 4XP6H 3QI9B 3EYSL 3FMGL 5IF0B 1DEDA 2DRUA 4OKVB 2PR4H 1RSFA 4U1GC 1IL1A 1ED3A 5HTSA 3MRCA 1AGFB 1VGEL 1S9YB 5E6ZA 1LNUA 5HI4C 5INCB 5E6IA 4V1DA 3MRGB 4NGHH 4R0LC 1DQML 2R4RH 1RU9L 3L3GA 4B7LA 5SWQA 1G7HB 1RZIA 4KH2A 1NMAH 1IC4H 3OAYK 4X80L 2AV1B 3QDAA 3DROA 3MLXL 1W72B 4PJDF 5CBEB 4PLNC 1W0WB 3QHFL 4YBHA 3OKNA 3F7YB 3G6DH 1P53A 5E2TL 2V7HA 3MRGA 3HMWL 1F6AA 4XRCB 4P4RA 5E4EB 3RNQB 2DM3A 3DTXB 2NR6C 1XF5B 1V7NH 3QO1A 4KKBC 4JM4L 5HHOB 1EHNA 1JYVA 1U2CA 4PRIA 2X1WL 4HF5L 2GQHA 5ALCL 5JORB 4U33A 4P4KB 4PGDA 2I26N 1JWSB 5LWYH 1M7IA 2DQJL 4PJXE 3X13A 3ZO0A 5A2JH 1AJ7H 1QRNA 4FQIH 3BIKA 5TQ2L 4R4ND 5AYUL 4Z76B 5DI8A 4C57C 3GSRA 5FOBB 2DWDA 5F6HJ 1FIEA 2BXZA 1YYLH 5IWLC 4QRUB 1MCDA 3LHPL 5D7KD 2QHLA 3WFCH 1CR9L 2FEDD 1JNLL 4MJ2A 5MHSD 3HB3C 5ESVA 3S36L 1OP3K 3NFSH 2B2XL 2CD0A 1SVCP 2X6MA 1FFPA 4F7PB 5IGXL 1NLDL 2YPLD 1ZGLM 4XC3L 4PUBH 4OZFB 1M71B 4LMQI 3RY6C 1CLYH 3O9WB 3ECBB 2XFXA 4I8DA 2YUZA 2VDOL 3MYJA 5I1KL 4NC0B 3TWCH 1NGYB 2WUCH 5CJXC 4U49A 4G8IA 4JG1L 1JPSL 5ISZB 3HN3A 1CDJA 3HRPA 1KULA 3AREC 3IFNH 1JPFA 1CDIA 4JFPB 2UV3A 4NQSA 1BOGA 5I75C 3W9EA 1NUGA 5KVGL 5JW3L 3TIDA 2J4WL 2VLKD 1U92A 3U9PL 3T0VA 5D6DC 4GG8A 1MCWW 5GGUB 3G5YA 2HFGL 2H2SC 3RTQD 1SBBA 2PW1A 4DFHA 5ITFA 5ILTL 3HS0B 3QEQB 4YHML 2AQ1A 2UWEB 1YEIH 2IF7A 1JVKA 1MCKA 2GTZB 4N0FB 3UJJH 2V17L 3FB5A 4PJ8D 5GZND 3ULSA 2V7NA 1A14H 3VGHA 2UUDH 5ETUB 4PRID 5HVHB 4RA0C 4OD3H 3KPMA 3IJHB 3K46A 3LB6D 3MLVL 4OFDA 2E8ZA 5C2BH 1TJGH 1UH3A 3ESUF 4UDTB 4N0FA 2AKRB 5DJ0B 3ZYIA 5KVDL 2W0FA 5GRUH 3HNSL 3KPNA 1JNLH 2NY3B 1OAZH 4X99A 3VXRD 2MTPA 2MMXA 4KPHL 5KSBF 2C4XA 2ZCHH 3PWLB 1KGCD 4L5FL 4L8BA 3D6GA 2COQA 5AYUH 5IOPB 3QXWA 3EZJB 2HFFA 3LAFA 4UT6H 3PF2A 4P23B 2WBJA 1JGVL 1TCMA 2IQAB 1MUJB 3MJ9L 3NIGE 1U8PA 4F3FA 1ZOXA 2OI9B 2BNUB 3C6LB 3U4EA 1MCEA 5DEGA 3T0EE 2VLLB 1HOCB 5D6CB 2Z91A 4N5EC 3WXVL 2YXFA 2WBKA 1MCBA 1VPOL 3BAEH 3C5ZC 1YA5A 1G1YA 1KEMH 2ITDB 1ZANH 5BJTA 1CD1B 4F7EA 4FFWD 2EDTA 4A6YH 3GDBA 3ULVL 5FFLA 1VA9A 5ESQA 5GRXG 3IU4H 4LCIH 4LPXA 5L88H 1N6VA 1HHIB 1U58B 2C5DC 5FO9A 4CJ0A 1QNZL 2Z4QA 5ESVB 5ADOL 1E4XI 3BP5A 2VSCA 2OJEB 3O45B 4OZHF 3FMGH 1HILA 4RFNC 3K4AA 1BZ7B 5DC4B 5GHWH 4Z7WB 3TH3T 1ZT4B 2BNRB 3RWEB 1A6ZB 4BZ1L 4B5EA 5EUOB 3BQUB 4HV8B 1QLFA 1BZQK 5EFIA 1NAMH 1T66C 4HCRA 1UXWB 5EU7E 5JIHA 2YZ1A 1MCPL 1NMBL 5F7DA 2IBZY 4LNRB 2H32A 1QR1B 3OJDA 3BESR 4OGYH 3AB0B 3W0WA 4L3AA 5CMAA 5CINH 2X89D 5IHUH 5JXAH 1N6QL 1A7RL 2D7NA 3BN9C 3VGFA 4PG9A 1FLTX 5GGTL 1F6LL 2DYPD 3VXQB 1IKFL 4WI8A 5IBLC 4MJIB 2WAHA 4PJAB 4G9FE 3CAFA 4HWBA 1AGCB 3EYVA 5I8EB 3VDCA 2VR4A 4LLDB 5M95B 4ODHL 3QEUA 4NM4H 3FCTA 4MNQD 3MRFB 4KI5D 3UP1A 2G75A 1NGWB 5I1JL 1CDGA 5I30L 4OGZA 4ZFFB 4JHZA 1BQSA 1NCTA 4IIQA 1L4IA 3GO1L 4U6XA 1RULH 1BBDL 4HKXA 4YAQB 4FQPA 3DVFA 2FX9H 2W0PA 5GGRY 1E6OH 5KSAC 2VB5A 2GFBA 4JLRA 1S9WA 1EEYB 5AZEH 3UBXA 5CEXB 4KTEH 4WU7B 5FKAB 3KDMB 3DURB 4R96A 1D5XA 5L2KD 1MHHB 2ICEA 4XMKH 4QTHA 4RFOH 3MACH 2VL5A 3QWRD 4MNGE 5FO8B 5HD8C 1TJHH 3W0WD 2EDLA 3WJJA 5EULV 1R5IA 2AXGB 2CDGB 1HSAB 4JFED 2VIRA 3GIVA 1A6VH 1S9KC 4OV6F 3S35L 3D9AH 4Z7OF 4XCEB 3TNNA 3THMH 1OVZA 5EN2A 5J1AA 1LD9B 4APQC 5DO2C 5HYJD 2R0WL 1EEUA 3MRNA 4ETQA 1MSPA 3MRCB 3MRDB 1T1XB 2VH5H 5C0BE 1UXWA 5IB5B 4RMTA 4LFHD 3U0WL 4XCNB 2YD2A 2YPVH 5FO7B 4LSUL 2OTUB 4WWKD 4JKPL 1FO0A 1X5YA 2ZCLH 1XEDA 4X9GA 3SDAC 3U1SH 4O00A 3HUJE 3PQYD 3NZHL 3P73B 5IVZA 2Y25A 5CEYB 1H3PL 3AY4A 5JHDA 5C0CB 1BBJB 5E2WL 5ISZE 1H3UA 4BFEA 4GRLC 4JFDB 4S1QL 3T2NH 1SEBB 5F70A 1HIMH 5DZOA 5JW4Q 3QIWC 4IBLT 1IC1A 3DUHA 3B4NA 3V52H 3BVNA 3QISA 2OZ4L 4WTWA 2E7LC 4AH2B 5T1MB 3QFDB 2ITDA 4OFYA 3DYPA 4RMVA 5C0DA 5IB1B 3O11B 4FQHB 2XV6B 4HT1L 3OAUL 2NY6B 4LCWE 4JREC 4RX4D 5CJQH 1J8HD 3CFKB 3EJJX 3OXSA 3UBXB 3OJMB 4M8QB 3VXRA 2JE8A 3WMSA 3WNNA 5E8NB 4R3SA 2WM0A 1QFWM 1WIOA 2CDFA 5IEKB 1KG0B 4BH7B 3RX5A 3H9SA 2DI8A 4NKMA 3UZVB 1YC7A 3PDOA 3EYVB 2A6DB 1HKFA 1B0GB 1TZHA 3KYMB 4PRHE 1NDGA 2X9WA 5I1HH 3RHWK 3ZHDA 3FB8A 2H45A 5A2IH 2H6PA 4MX7A 5JMRA 2VDNH 2PYEB 1Z0NA 5DS8A 4R90L 4UINH 4ZO7A 4LLVA 3QCUL 2EDNA 1OHQA 3LN5B 5D6DA 5FEBA 2FDBP 4Y4KC 4KROB 1OTUD 1INDL 3ULSB 4PV8B 5IFJA 5D70H 2P8PB 3EBAA 1OF2B 4GS7B 2BXYA 1EGJH 5DJZA 3GHBL 4YDIL 5EFIB 3QAZB 3VFTB 3S88L 3QUXB 1E6JL 1DUZA 2HT4D 3BMWA 3QH3A 3FFDA 1DN2A 3Q1SH 1I7RB 3DVGB 1KPUB 3H9YA 1KIPA 4TVPD 4TOYH 3MUHL 2HWZL 1LO4L 3M8OH 4KV5F 4P46C 3Q3GB 2APTA 4OCWL 1CGXA 4B7IA 3GSUA 4XNXH 4HUWB 2KBGA 4H8WH 4D9QE 3H7BB 2F19L 3KXFA 5J13B 5IR1B 3NFNB 2JLLA 3MO1B 4LCYA 4IS6A 3TZVD 2CK0L 4JM2F 5DQDL 5KVEH 1YEHH 4LLUB 1EUTA 1UFUA 5EBWA 4FABH 4OQTL 4S11A 2Z91B 3GBML 1BQHB 3NIGF 2EECA 5TFSH 3VJ6B 3MRHA 2XZQH 5M7QA 4I0PA 5KBNC 1A4KA 5J3HD 4MQ7A 4OTXL 1Z9MA 4WDIB 5CSGA 4GXUN 3CD4A 4X6FA 5F3HB 1ZWIB 2EYRB 4PLKC 5L8LB 1F11B 2R23B 5EU6D 3MXWL 5FDWB 5TQ0H 1B90A 1DL7H 4XXCA 4P2OB 1I7UA 4MD4B 4L8SC 3V95A 5HYEA 1A1NA 2K1MA 2DQDH 4PJHF 4I18C 4HWEL 1U3HA 5JR1H 3U7WL 1S7SA 4Z7VF 25C8H 3MLYL 1T83A 1DBJL 3CC5A 1FRGL 3SDDD 5C9KA 5F9JB 1I8IB 3KPRA 5EU5B 3RNKB 5LVEA 25C8L 3MLYH 2Y1VA 1WC7B 2BERA 5KW9H 1JHLH 2DQDL 5EUKA 2ENSA 3HNTH 1ERNA 3FO2B 1HSBA 3TM6A 4NSKB 4NWUH 3EFFA 3HHRB 4H26A 5JTWA 4QHMB 1G0YR 4L4VE 4LVEA 3ZL4L 3B9EA 4KKAD 4JKMA 5FA4A 2NTFB 1BJ1J 3F6IA 1IBGH 3PHQB 5L9DH 1XR8A 2XYCA 3F7VB 1QBLH 5DUBB 3MLZH 2VXSL 3TBYA 4YBQD 5HI5D 2XZQL 2DI9A 4JFXB 1CE6A 3ZKXB 1U8QA 1G7MB 4QNPE 1V3MA 4OQTH 5L2KB 2WINA 1CIDA 5HYJE 1UKQA 2HT3D 1I9JL 3OJVC 2RR3A 3ARSA 3ZSSA 1KG0A 1P5UA 1PFCA 1WK0A 3JTTA 4IRSC 4L4TA 3FHQA 4TPRL 5I1CH 1AHWB 1MVFA 1VENA 2BNRE 1AGFA 1KCVH 2R39A 3GSQB 4MWFA 4I0PC 2JCCA 4OCWH 3P4NA 4NQDA 1CICA 3N85H 4C56A 3ARBB 3R0NA 1MRFH 1R3KB 3O6FB 3T08A 3S97C 3VXSD 1DBKL 5BQ7A 4NBZB 3Q1SL 5D7JA 3X12A 4Q6IA 1EX0A 3W5NA 5SWZA 3VI3E 3EKCA 4OFVA 3BWUC 3F12A 5LGKA 2VDKL 1TENA 5I9QB 4KKAC 3PL6D 5CJ8A 5LXGH 1FYTB 5LAXB 2W9DL 1WWCA 2H1PL 3C09B 1I3RA 4PJAE 4ELMF 2IPKA 3GMOB 2OMBA 3TFKC 4FQLH 3O6FA 1MJ8H 3WEXB 3QCUH 1SBSH 3D39A 5C3LD 2FHFA 5DHVA 3L7FB 5D1ZB 1NCCL 1T4KB 2HVJB 1FQ9C 5FO7A 4ZOCA 1NCUA 1X4YA 3C6LA 1NFDF 3P4OB 1N26A 1XGPA 2CUIA 3JWOC 4R8WH 1HSAA 1MCWM 4PJ7B 4QXTA 4QHKJ 3UJTH 1YMMD 5HHME 4LLYA 4K8RH 3SBWC 4PJHB 4PPTA 4A2MA 1OOAA 4KK9C 1UM4H 1MEXL 2ARJQ 2J3SA 3QUKB 2GSGA 1Z9OA 4S1DD 1N5AB 1A1MB 1FNGB 3BEWB 4MNGB 3VXTA 1XGPB 5IW3A 2EH7L 4YBLC 4OIAA 1I85C 1T0MB 4RGMC 2NTSP 4XBGB 2I9TB 4G6AD 3DBXA 4QRSA 3L6FB 1GGIL 4F7CA 4M6AA 3MRRA 4K9EH 3O6KL 1GOFA 5E8PA 5IWLA 2A6IA 2VITB 3EYUL 1HHIA 1U58A 1TZIA 5EU6A 3WUWG 4ZODA 5D7LD 3JUYA 5E2VH 5C0FA 5ICXA 4Q9RH 4BH8B 4QGTA 4M7KH 4L8CA 1OTSC 3DHJA 1SJVA 5I1IH 1AIFA 5IP4A 4JDVA 4P9MH 4XMPH 3MRKB 3UJIH 1P2CA 2DD8H 4PRNA 3E8UH 2CH8A 1CFVL 4I2XB 1HINL 4CW1A 2ZUUA 1FAIL 4NO0A 2W9LA 4LKCB 4KUCF 3JXAA 5F7DB 4LVOB 5LCVL 15C8L 4MCYA 4PV8A 3UAJD 4M6ML 1AHWA 1A7QL 2VN7A 3DO7B 4JANB 4BQCA 4WV1B 1FG9C 3SDXA 1FORL 43CAA 1T1ZA 1P2CB 4R0LA 5HGBA 1FGNL 1UACL 3RUGE 2XFXB 4GMTL 1XGTB 1DUZB 1X5XA 3SCMB 4B0MM 2IFGA 4XVTH 1I1AC 3BT2L 2HLAB 3V5KA 3F58H 4Y1AB 4PLOB 1TVHB 4MLIA 4PREB 5FIEA 3MNVB 3M17A 4NNYB 3FQWA 2AXJA 3HZYB 2XA3A 2V9TA 2VLJD 2HN7B 2QQNL 1XF3A 3TCLB 2R1YB 5I0ZA 4LF3A 4F33B 4BQ9A 2G9HA 2V7NB 3L7EA 4NN7B 4MNHA 1T2XA 1Q9WB 3DMMD 4XBGA 2APXA 5I30H 3QO0B 1MCCA 2FHCA 3ORJA 3ULVE 4YZFE 3CFJA 4J3TA 2X40A 1OPGH 3VI3F 1R5VB 4ZTPH 1U9KA 1PG7L 1JYNA 2X4SB 3OGOE 3X17A 5EORH 2WUBH 5IJVA 4GRLD 2X2YA 4Q74A 2NYYD 1ZGLP 3U30C 5IHUL 1N6QH 3T2QA 3QUZC 2EDYA 2JJWA 2VTFA 5L8JB 2XKUA 3B3IB 1S5IL 4KXZH 2FJGB 5J6GB 1X5FA 3VG9C 1P4BL 4J23A 4P49A 3BVNB 5DK0B 3KYKH 1OM3H 3SDCA 3O6LH 5C0CD 1H3TA 3CXHK 5HHOD 4BZ1H 2AJXL 3WIHA 4MCYB 5MENE 3SE8L 4Q9BA 3I6LD 4ISVB 4X7SL 1OQOA 2J6EH 3PWPA 1XIWC 3PG2A 1ACYL 4RCAA 4APQA 5HPOA 2BJML 4ZO6A 2BVQA 5ALBL 4ACPA 4I77H 4DFIA 3SCMA 2YPLE 1NBVH 1VDGA 3P4LA 3SPVB 4XBEH 3IU4L 4XWOD 5DT1L 2MPAH 3RNKA 1B2WH 3M17B 4P2QB 3WIFB 2BK8A 3ZDZF 5DJ6A 4G7VH 3GSQA 4MWFB 3QWOA 3KHQA 1NJ9B 3BAEL 2XA8H 3CDGB 1FZMA 2CKBB 1WWBX 4X4YB 3WFDL 4H88L 1T2QL 3WDJA 1IAIL 4XZUB 3E3QE 1FG2B 4Q7DA 3ZE1F 1C12A 3MJ9H 1B9ZA 1QPXA 2AP2A 3C5JA 1Y0LA 5FUZH 1A3LL 4QOKB 2RB8A 1VESA 4L8CB 2D0GA 2WZPD 1QRNB 5CP3H 4PJXA 4KQ3H 3V8CA 1A9BA 4CVZA 1D5MB 1OCWH 1JRHI 3L5IA 3SDXF 3K1KC 1GGYA 3JWDH 5I8EA 3ZT6A 2EO9A 4HDIA 3UO1L 3FOLB 4TVPH 4JFOB 4JPVH 1OSPL 3JSSA 2HJLB 1CDYA 4RRPG 1JGEB 2DTSA 1P1ZB 1B3JA 3BD4A 1WV7T 3RWFB 4EN3A 5T1LA 1ZGLA 2H2PC 2WWKT 1OQXA 5KTEH 2DF3A 4GH7B 2A6JB 3Q2CA 1OD9A 4GW1A 3S96B 4JFZL 1RFDH 1J18A 1RJYA 1RUKH 1CLZL 5F9AC 2HFGH 1N8ZB 2ICCA 4R4FH 3KPSE 4WHTA 1YNKL 4OD1H 1RK0B 3R1GL 1K3IA 2HG5A 1DQJA 3ARDB 4JEGB 3UTSA 3BZ4A 4HWUA 4N0YH 4DKEL 2FL5B 1I1RA 5T5NG 3DETC 1A6WH 3HUJA 3BPOB 3QFDA 5C1MB 1OSZB 1UJ3B 5E5UB 3MSPA 1BMGA 2WIMA 3QQ4A 1XCQA 1XIWA 2BNRD 4JG1H 1R0AL 4OM1L 4OZ4B 4QCIB 3TWCL 1YN7B 5EG6C 2OXHA 1S8DA 3QG6B 4JM2A 4GJTB 2EIZA 3ZYOA 5C0AE 4PUBL 1K4CB 3WHE1 1GZQB 3RGVB 2EEDA 5CSZB 2HVKA 5T1KD 1MH5A 4BK4A 2V6HA 4ZMAT 3MV9A 2G60L 4JR9L 4DGYH 3VA6A 3ZYJA 2IBGA 1JUFA 4GAYA 4LQ1A 4Z7UA 4HMCA 4DZ8B 4JGUA 1WC7A 5D2LE 4HKZA 2X4NA 3B6SB 3T4AB 1T3FB 5DUMH 4RMSA 5EC2B 4ODSL 2EKSA 4AEIH 4EI6B 3B2VL 5EZLB 2F8XC 1AJ7L 4POUB 3SGKC 2DQJH 4P5TC 4S1DC 4I5BB 5LWYL 2ZUQC 5JW5A 1S7SB 3QQ3B 4PRHA 1Y6NR 1YZZA 4QOKD 1IE5A 3RVVC 4XCYA 3RVTC 2I60H 5I8CA 5IFJB 4R6UA 2FBOJ 3UPRB 1R3HA 4MXWL 1J0HA 4H1LB 4XPTH 3G6DL 1CE6B 3QHFH 3IF1B 3F6LA 3SDAA 2FBJH 4NT6A 3UTSE 1NMAL 3T77A 3GFUA 5DWUL 4P48A 1RU9H 5BW7A 4P2RB 1IC7H 1YYMH 3TT3L 4OZGA 1IQDB 4WCYH 2D9CA 1QSFB 4G8GB 1HXYA 1I3UA 1XGRA 2Z0BA 4NNPH 3TBVA 2I5YH 1BVKB 3UC0L 1UADC 5H35B 4OCXH 4JG0H 1G9ML 1MCLA 1NGQL 2G2RA 3CVHB 3LKRB 3VFSB 3FFCD 4X98A 4NQSB 1RK1A 4MD5B 1RIUH 1W0YT 4CMMB 2IANE 5B4MD 3Q5YA 1CFNB 3FZUC 1J1XL 1YPZF 4GAFB 2IGFH 2BDNL 5D5MA 5JHDE 4BUGA 2C3VB 3VJ6A 3PV7A 3Q5OA 1D9KB 2PW1B 5DLML 3QULA 1KACB 1IGIL 4GAGH 3W0WB 3NGBB 3QNXB 4I0PD 5FCSH 3BE1H 2JJVA 4KGJA 3PL6B 4KK8C 5AWNL 1Z3GH 2VLME 3RVXD 3D25B 4X6FB 2SEBB 3MQIA 5F3HA 5JXEA 2X4TB 5BZDB 4IRSD 4PB9L 4QRTB 5C0RL 3VRJB 5MENB 4ORZC 4EN3B 1YMMA 5CILH 1FIGL 4RWYH 2A0LC 2HT3C 3O6ML 3ARBD 4K23L 5BO1H 1MJJA 2XG5A 1I7ZB 4DN4L 3DVNA 4EQ3A 2WW8A 1CF8L 3T65B 3MBEB 3ARGD 3DGCR 3WS6A 1XZ0B 4P59H 2YPLB 4ALAH 4APQB 1J1PL 1ZXQA 3SKUD 4B50A 2PTUA 1TFHA 3X3FH 4LLQB 4Y1AE 4NO2B 1R3LB 5HGAB 1UEYA 3C5SA 2D7TH 2WWMC 1ONQB 4MVBD 2ICWI 1YMHA 2NX5A 3CVIL 2QHRH 4HIXL 4ZUVA 4X4MA 3ZDZE 4P23A 3TT1H 2YPLA 4LFHG 3ARFD 3T1FB 5FYJE 4HXAL 4YR6B 4Z8FH 3CXDL 2DWDB 1MREH 1FL3A 4Z7VB 5ACZB 2D7OA 2YWZA 1FVEB 1WIPA 1F2XK 2VZSA 4UAOB 3VFMA 5CWSA 2J8UF 3KYNA 4QHKI 1T22A 1H15B 3FFCB 1AR1C 1G9NL 4XP5L 1FFPB 5IQ9B 4P2QA 1DDHB 5D1QC 3DYOA 3MLUH 4YHOL 4YWGH 3IJSA 4HSQA 4URTB 1KB5A 3P0VL 1L7TL 3VFSA 2WIIB 2BSRA 1CDBA 4L3EB 2J8HA 5KVFL 2H8PB 3H9SD 3SGEH 2E9BA 4KMQA 3I2CL 3O3BA 1KXQE 4F8TA 2DJUA 4NCC1 3UTTA 4U1MA 3AFLA 1YUHA 3C6SA 3D3VA 1OT2A 1UWXH 1RZJL 3PV6B 4I5BA 5EC1A 4PJGA 4X7FC 5JQ6L 1XF5A 1FZKA 1RURH 1KB9K 4Y8DC 4YHPB 1OAYH 2HKHH 1U92B 3DGGA 3A6BL 3WV0A 1RJZA 5EPMA 5L6YH 4D0CB 4I18A 2R0ZH 3KPSB 1BPVA 2HLFD 3BDXA 3IDXL 1QBMH 5EA0L 3PWNA 5I8KH 3LKOB 4NFCA 2FSEB 4K3DH 3BP7B 4JCLA 43C9A 2HG5B 2IAMC 3HKFA 3AROA 1CL7H 1IKNC 2EKSB 3BZDA 5BQ7B 5K9QG 1CIUA 2VE6B 5T5NF 4GG6A 3TO4C 5L0QC 4K94L 3VXRB 3BGAA 1NGPH 1TLKA 5I1AB 5IIEB 2IH1A 4O4YH 3D0LA 3TA3B 4PLJD 5B38G 1Q0YH 3HLAB 3U0PA 1ZKAA 2P46B 4PV9A 5D1XA 3VFVA 4P46B 1VFMA 4IOSD 4OLVL 1NFDE 3OAZH 4ZOEA 3W9DA 5ERWA 2C7UB 5F96H 1JRHL 1XR9A 4FNLH 4JLRB 3DX9B 4UT9L 3QDHA 3U7AA 1ZSDB 1JV5B 2V5TA 2GK0A 1PZ5B 2O5ZH 4HWZB 5E00B 5BW7C 1JF1B 4P0DA 3U36A 1C1EH 4NKDA 5GRVL 3EOTH 1C5DB 2ICWJ 2BSTA 4JM2D 4XPGL 5B8CB 2GSIA 1S3KH 1CL7I 5JW4M 1J8KA 5A3IC 3F62A 3BJLA 4CADB 2C4FU 3HI5H 1AP2B 4U4BA 3BX7C 1CFNA 2BNQE 5KSBA 3TNMB 3OF6D 1MQKH 3FO9B 5CJXA 2CPCA 5HJ3B 4X4ME 5B22A 2N1KA 5LJYH 4S2SB 4UT9H 1JIBA 4P2OC 3RRQA 3L7FA 6FABL 5TE6H 3EO9H 3LRHA 4ENED 5B38B 2YA1A 3KPLA 3GMQA 3LD8B 2YSSB 5D2NB 2P48B 4CVWA 5KS9F 1BFOA 1A8JH 1FZJB 3REVB 1AO7D 3MBED 4Y4HC 1Q0YL 3VXUD 1FZOB 2C3XA 3EIFA 3VMNA 4RBPH 1NGPL 5FDWA 3NBNA 3RP1A 4DN3L 4OLUH 2W0LA 1KJMA 4EN3D 2AQ2A 2NXZC 5GZOD 4ZYKB 3HAEG 3QB7C 3UTTB 2CKBA 4I4WA 3IVKB 3EFFB 3DPBA 4HWBH 5HHPB 4LPVA 3D0LB 4UOW0 5JUEH 2EDDA 4WWKC 3X3GH 3MNZB 1I75A 3AAZA 4NQCD 1B4JL 5EA0H 5CBAA 2HT2D 5FGBA 2UYLA 5DJYB 3PWUB 2R0ZL 1CWVA 2P45B 4PJ9D 3GMMB 2B20A 4PG9B 5HI3C 3QULB 3J7HA 5AG9A 4UMGA 3ZKXC 2OSLA 3MLTA 1Z0MA 1TZGL 2X4PB 1JNNL 3CMOH 1Q9OA 2ADJB 3MUJA 4X7DC 1FNEB 3FL7A 5BMFL 4JFQA 4QRTA 4NO0B 5SV4A 4HQQL 2AGJL 5FYKH 2R1XA 1NGYA 3ZYZA 5C0IA 1HK6A 4IRJC 4OUOA 1OP5K 5IJKC 3JTTB 4LSTH 1E28A 2QSCH 1CT8A 5MHSE 4G6MH 4BSVA 4PJBE 4OZGE 1PG7X 4GBXB 5DJ2A 1OAXH 1RUAL 2AAVA 3TCXA 3MNWB 4JO1H 1WVZA 4RISL 4JJ5B 3QI9D 3SKNA 3O2WH 1KSRA 4NJAL 1KV3A 3VCLB 3L7EB 1YMME 5E9DD 4ZFOA 3VW3L 1U95B 3JTSB 3BOVA 2LV4A 4WFFD 2IADB 4J1UA 3I75A 1HHKB 2RJMA 4OF8A 3D69A 3QNXA 2VXTL 4OFKA 1MF2L 5HI3D 3CXDH 4KI1A 5I1GH 4Z8FL 4HFUL 4PJAF 1G1CA 3STZB 3GSWA 4NDMA 5DHXB 2CUMA 3TT1L 5ANME 4JFHE 1IAIM 1GZPB 4FS0A 2FATL 2XWJB 4WJ5A 3GMRB 1D5BA 3DRQB 3ZTNL 5HY9A 3INUH 2D7TL 1RUML 1PBYA 4M03A 1T6VN 3L5XL 4OZHA 4R2GC 3X3FL 2V5YA 5J6HA 4XWGH 3F7YA 4N0UB 5CJ5A 4LF3B 3T3ME 5GGQH 1EFXA 4X0KB 3EYQC 3GSWB 4NDMB 4RSVA 4OLXL 5EOCL 2AK4A 5JHDB 5KJRH 5IJVB 2IG2H 1QLEL 3QO0A 2UWEA 3QIUA 3BH8A 3CIQA 5E99L 2DQCH 1T66D 3UMTA 4X4ZA 4CKVX 1T03L 1EO5A 4LPWA 2X4QB 4W4OC 3BXNA 3O4LB 4TSBL 3BN3B 5E7BA 2AS5M 3HI1B 1NC4D 5HHXH 5HGAA 3O3AA 5GS3A 2GIYA 1U6AH 2BVPB 4GKZB 3NH7H 1DN0B 1IGIH 4F9PC 1UYWL 1KLFA 1P7QA 2HVKB 3IDYB 2E7HA 1E4JA 3T0EC 3WDIA 5DD3H 1ITCA 3TESA 4PG2A 3C9NB 1YN6B 2D03H 2YUVA 4ZDHA 3MRJB 4PP1C 3MV7D 2PYED 4UDUB 5D1QA 3M1BA 1I9RL 4OUUA 5I74B 1T0MA 1HYSD 2NY2D 2ZP0T 4Q6YA 5GGSB 5FUOL 4OLEA 4JG0L 4FQ1H 1GC1H 4CU6A 2YWYA 4UU9A 4P4KA 1A7NH 1Q1JH 3UC0H 1M7XA 4JFFA 4PIRF 5D7KE 4MXQD 1KTDB 4ESKA 4MA3A 4WCYL 2DQTH 4YUEH 4L1DA 5ADPH 2EXYC 1IC7L 35C8H 2FWOB 2LVEA 5D4QA 2XKNB 4I2XA 1N64L 1H8NA 4YHKL 3TIDB 1E4KA 3HI6H 2LU3A 4U1LB 5HPMB 5IT2L 2BVOA 3FN0H 4LOUD 1JWUA 1HXYB 1XGRB 5D7LB 1T21A 4LVOC 4PY7A 3NCYS 4TUOA 4BFIB 1FAKT 3IXTB 2YKLL 3KJ6L 1S7RB 3S9DB 1BFOB 3ES6A 2GJZA 3UYRH 3VFOB 2G2RB 4WV1C 2APVA 2N4IA 1VFUA 1QRND 1F4YL 2A6KA 4LEOA 4AENA 4CVZB 1A4JB 5E8DH 5HDQL 3BJ91 3NABL 3GUTA 3MA7A 5I1EL 1D6VL 5LBSH 3IVKA 5D1XD 2XI9A 2PXYA 2YPKB 2CLVB 4HC1A 5HGDB 4N90E 5T3XE 3VGEA 2DQUH 5E08H 1T04B 5GS0H 1EEZA 1XMWA 2IALA 1QHPA 2R56L 4NN7C 1WFOA 1RK0A 1R3KA 4L3ED 1JF6A 4R26L 2HFEB 2XQYG 1CLCA 3QUXA 2EIBA 4NUJA 3GMQB 1TETH 5HYJB 1OAKL 4PJEF 5HYSG 1VGKA 1FDLL 5B39G 1Z9SA 2IALB 1NCWH 4YO0A 1LILA 4NQEA 1MWAB 3S5LG 4JQXC 4P5KA 4U1KB 4WDIA 1CTOA 5D8JH 4JFEB 1CE1H 2BSTB 3VH8B 1QRKA 5GJSH 4PGBA 3AS2A 4JFFB 5F93C 3QWQB 1G7JB 4TTDD 1X4ZA 3RVXC 2B1HL 1RJLB 1TNNA 4Z0BL 3B9KA 3KLHC 4PJBA 1FYTD 5C08A 2ED9A 3OXRB 2AI0L 1LNUB 1UB6A 4U1LA 2P5WB 2B0SH 4D8PA 2OJEA 4KRPC 5HYQA 3O6FD 1PG7W 4UV4H 5IESH 4XHJC 5HJ3A 1EV2E 1BVZA 2DQIH 3QHTC 1AXSA 1G7JA 1LVEA 3O2DL 1FFOA 2OL3B 2VDLH 4M43L 4XC1L 5TF0A 4D0DA 1XIWB 1UM5L 3STLA 4JQIL 2A77L 4R4NC 1QLFB 3QQ3A 3BXNB 3O4LA 4R7DB 1KFAH 3MOAL 4XXDA 1OGAA 2R2BB 2P5EE 4HAGA 5DRZB 5MEND 4PJDB 5IROC 4TVPL 2D7PA 8CGTA 5EC2A 1KTDA 5DJYA 2P44B 5HYSB 1T22B 1YUHB 3C6SB 3IKCA 3FAWA 4QRRD 5CHNA 3P3YA 4QHMA 2EXWC 3RAJL 4KZDH 1BP3B 1NCBH 4MGXA 4NCC2 2Q7YB 2X41A 2YR3A 3AY4C 1W72L 4P4KD 3MRIB 5C0EB 2ERJB 3TBTB 4Y4KA 1A3LH 4YFEA 4KY1L 5I6XC 2EDEA 1ZTXL 2WLZA 3QDMD 4UIKL 3HCVB 2DQEL 3K3QA 2R29H 4LCWD 3WHXB 3SN6N 2X05A 5CSBA 4KJWC 4CL7A 5GS0C 1AGDB 4QWWC 4PJXB 1ND0A 4PBWD 3P0GB 4WY7L 3W2DL 4MDIB 3HAEA 2VDQL 1A4JA 2JELH 5IVXF 5GGUA 4JPWL 4YFLI 3EYFB 4YK4C 1T89A 5HPMA 2QEJA 1JN6B 5F9OH 2F5BH 5GGTA 4DTGH 1YY9C 5CMAB 1B4RA 3SBWA 2HKFH 4IRJA 3WIHH 2YMXH 4XBEL 2GCYA 3NMEA 3KPPB 5FAAA 1FNEA 1J12A 2VWEC 5HHNA 4ENEC 1LDSA 3NCFB 1IC5H 5KVMC 1EFXB 4X0KA 2RIKA 5DJ2B 4UU9B 5IB3B 3CFKA 4HV8A 4UI2A 2JELL 1XGTA 2J6EL 3KLDA 3OTTA 2H9GA 4MAYA 4X7SH 3P9LB 5F7LB 1LO2H 3LQAH 4XP4L 1VEPA 1MFBL 3K8KA 4EDWL 1X7QA 4LNRA 43CAB 5C6WH 3O6LL 3PQYE 4WFFE 3GMRA 3HAEH 3SDXE 3U36B 4KY1H 2OM5A 2PXYD 4PTTA 4O2FA 2X44D 5DMYA 3DX8B 2YPKA 5KSBE 3MOQA 3GMNB 5FM5M 3N06B 3FB5B 1QBBA 4ERSL 1MLCB 4IJ3B 1W72H 3O3AB 3JVGC 3RUGF 1JPTL 5DUPL 3QCVL 3RVTD 3WUWA 1YNLL 1Q38A 5C71A 1I7ZA 4M5ZH 5DD5L 1EO8H 1O0VA 3CLEH 4LEOB 4PJBB 1TTGA 4H20L 1JPGB 4Z7UF 2LE9A 4H5SA 3MV7E 3SO3C 3HS0A 3HC3H 5EZOL 1YMMB 5CP7B 1A3QA 1U93A 4P5KB 1OSZA 2NY4D 1A3RL 5GS1A 1CU4H 5JW4R 4YHLL 5KAQF 1A7OH 5IOPA 3U0TA 4PRHD 3VXPB 3G6JF 3TV3H 5A43C 1KPUA 4CMHB 2VR9A 1BAFH 4F3FB 1T83C 1R6VA 4LSSH 4U1JA 3QHZH 2QQNH 3WBDA 1MCFA 2NNAA 2R2HA 4BUHA 2GT9B 4HUWA 5JW4N 4AJ0A 3JBG7 4P2YA 1U3YA 5I8OH 4TUJB 3WSQL 3QUKA 2YUWA 3VGAB 5D1ZA 2E9WA 3BH9B 2NY0D 1WZ1H 4P5TB 4OKVA 5E8PB 1XCTB 1N59A 4Z0XB 3BGFC 2YD6A 3T0EA 4LSSL 1RD6A 4AIXA 1BEYH 2ZG1A 3RDTC 4ZQKA 2ZSWA 3VD9A 5T1KA 3CFCL 3SGEI 4ODTH 2YA0A 4YXKL 5KSAA 1P7QB 1FDLH 2YN3A 2OR7A 4UT7H 1L6ZA 4NRYB 1IAII 1CU4L 1EDQA 1B0GA 1TZHB 2EEAA 5LCVH 2LVCA 1NUDA 4KUZH 5EZOH 5SWZE 4UTBH 3W39B 3HLAA 3O3DB 3JV4A 5EZIL 1FAIH 1OGAE 1UVQA 4X6DB 1UGNA 4OZFG 4YDKL 2R1XB 1BX2A 2R56H 4NQDE 3V7AG 5BS0A 3FT4A 3TO4A 2A9NH 5JORA 4OLZL 1JWUB 5A2LH 4L8SA 4GG6F 1MHPL 3O81A 1YNLH 2R4SH 1OGTB 3RL1A 3PP3H 1FL5B 3AS1A 4A6YA 1XH3A 5DUPH 2XKNA 3JWOH 1OAQL 4TRPH 4BM7A 3MYJB 3OKYA 1LE5B 4MJ5B 4O2EB 4TTDC 4XPFH 5IB1A 5C0DB 4JFQB 4Y0GA 3FT4B 4P2QE 4G8GA 4LCCC 4N8VB 5CEZE 4OM0H 4NZUH 3OGCA 3N1QC 4EDWH 1DLFL 1J0ZA 4PRAB 4F7TB 4JZOB 3MUY1 2YKLH 1C08A 5I18L 1JHTB 3KPOB 1SEQL 2XWBB 4CNIB 4OSUL 2P5WE 5HGDA 4QHLB 2NTFA 1UQSB 5F8RC 1IC5L 1TIUA 1H5BA 2YRLA 3MJ8A 3QIWD 1UB6B 3VFVB 5IHZA 4DJMA 1WLHA 1CZ8H 4ONFH 5D7LE 5D7JB 2YK1H 3X12B 1WFUA 3DV4A 2HTKD 3H42L 3QDJB 5I71B 2QADD 4YUEL 1R3IH 4NKIL 2JIXB 5F9OL 3ROLB 5LAXA 3RDTA 2BFVH 4Z0XA 3QEGL 1WSST 2VDQH 4QYOA 4NQUA 4IOIB 2APBA 4MAYC 2D4FA 4O2CB 1ZVHA 2R2BA 5DRZA 3FO9A 3E6FB 4KXZI 2E9JA 2W9EH 4C83A 5F3BB 1NCCH 5I16A 5CBEA 1BOYA 5D5MB 2IANA 1ZTXH 5HYJA 4OAWB 2FYYA 3IS0X 1A5FH 1NAMB 2F74B 3GB7B 5A16A 2XZZA 2X4SA 3NH7L 3T0DA 1P4LA 1S78C 3FQXA 4X6DA 4NN6C 2CDEB 3AS3A 4JN1H 2H1PH 3KPRB 2BNQD 4GQ9H 1FNSL 3P77B 2C9AA 3FZUD 3GMMA 4N8CL 4PJ7A 5LXGL 2AABL 3IRPX 5DJDB 4QHNA 4LOUC 2VDKH 4G6KH 4LKXA 1G9NC 3B9KB 4J4PC 4JKWA 4X6CA 4UDTA 2DQCL 4AM0B 2ED8A 5FO8A 3TZVB 5EU7C 5D1QB 5HHMD 1IAKA 3KNBA 3P11H 5J1SC 5JIKA 3DX6A 4R7NB 4Q2ZA 1UM5H 1WWWX 4F2MB 4NIKB 1P9MA 4NRYA 3MRIA 5C0BB 2E9IA 3EOBA 2YBRB 4QEGA 5E8NA 1X5IA 1JHKL 3C5SB 3LN9A 3PDDA 5IM7B 4X5XA 4I0CC 4UNUA 1XF2A 1KLUB 3GI8H 5GJTH 3DECA 5H2BA 2AI0H 4HK3J 1F45A 3NACL 3DMMC 2VLRD 4Y1AD 5I1GL 2RBLA 1EVUA 1D5MA 1VFBA 3U46B 3FT2B 1YEJL 1T0NB 3KYOA 4XVUC 2GJZB 2E7LA 5C86A 1OGTA 1IGJA 3MLZL 3WKNA 3O3EA 1FNHA 1CE1L 3PXJA 4M1CD 5D8JL 3TVMD 3IJYA 1IEAB 1AQDB 5IVXE 2XRAL 5DD1H 2NXYD 5I2IB 3VW3H 2Z8SA 3OAYH 4O2EA 1S7VA 5D2LB 2IMNA 1YEKH 3C6LC 2O5XH 3DX7A 4LSPL 2MOVA 4RISH 2D9QB 1RQ5A 1ZHBA 4JO1L 3DRQA 3F7VA 3HNTL 4G6ML 5TGBB 1MFNA 3TO4B 3KPSA 4JZOA 1JZ7A 2QSCL 3KYMA 5DJ6B 1A9BB 1UENA 3U48A 2ZNWA 5IVXA 3UAJC 1LWRA 4NSKA 2AGJH 4KV5E 1LEKA 3SE9H 3LKRA 4IIQC 2F54D 4PTTB 1O7VA 4UILH 4G43A 1SY6H 4XP1H 3RU8L 1HYSC 3PHQA 1U95A 2XTLA 3CPLA 3RFZC 1IZJA 4NNYA 5HY9B 5TQ0L 1X5ZA 3GIVB 3ZE0F 1UWGL 4MYWB 5HDQH 1HH6B 1X5JA 4WHTB 4PRPD 3H6JA 5IB3A 5FGSA 1CTNA 5E5MA 2MNUA 1F4YH 5JPNA 1QSFE 4U1JB 2HJKA 5E1HB 3PL6A 3S4SB 3WO4B 5TDPB 1RVFL 4N5ED 4HG4K 4FQXA 1X7QB 4FTVE 4LIQH 5L7XH 3UYRL 2ADIB 5JXED 3MGTB 4TUJA 1D5BB 2EDQA 3DURA 2C1PB 1QLRB 3GBMH 3MMEA 4WEBH 5INDA 1NPUA 3DROB 1LP9E 2BY3A 2MKLC 3WLWC 1HH6A 2X4OB 3PNWA 5JPNB 4X99B 1N64H 4MVBC 1WZMA 2Y07L 5HYQB 4M5YL 2UZIL 5ADPL 2QADC 1K4CA 1WCQA 4EI5D 3RZCD 1U41A 2PUQT 3IDMB 2FH6A 1XGUB 1EGJA 2GJ6D 4PJ8B 5D7IB 5GS2H 4X6DE 3W39A 3MC0A 2EDFA 5FUOH 1RJLA 5E95B 1LO4H 3MRHB 5F71A 3B3IA 4GAYB 1GAFH 4Y4FC 4DEPB 1XF4B 1WCBB 4HUNB 3R4DA 2Z31B 1H3WM 2VISB 4OI9A 3UDWC 4PY7B 2BVTA 4TUOB 5DMIL 2YC1B 3IXAA 3ZLQC 2Y4SA 5GZNC 1DCLA 3U0TB 5D70L 1CGYA 2DB8A 3HA0A 1FE8H 2PW2B 1U6AL 3UROR 2AJZA 2EH8L 2I24N 2NW2B 5HHQA 4Y4FD 3ALWA 2IJ0C 2R8SL 4OZFA 3EO0B 6CGTA 2HMIC 3VGBA 3MNZA 1KELH 4LVHC 3WJJC 4OT1L 2KH2B 4ELMA 3ZZ1A 3VDBA 3HFMH 1FVDB 5JOPE 5SWSE 1NC2B 3CFEA 4NQXB 5LKNA 8FABA 5ISZA 5D96C 2D0FA 1F4WH 1CGUA 1QLEH 5J57B 1JJUA 4RMUA 3I02B 5JIPA 4FG6D 4I1NB 3O4OC 3VFGH 2X5PA 1A1OB 3BYYA 3PWJA 4MHHI 1JUFB 2WANA 2EDWA 2KUTA 4LAJH 1KF9B 5BS0E 3HE7C 4IRJB 1AXTH 3VH8G 1GVIA 1RUMH 1F4AA 3WN5B 2QKIA 4OD2A 3WE6A 4RA3A 2W07A 4Q97A 4K7PL 4NNXA 1M6OA 5CJQL 4GBXC 4WEMB 5EBMB 1BQLL 2NY0C 2YA2A 4ZFGL 4ZTOL 1MF2H 2AJUH 4JZNA 1NMCC 4HPOH 2HT2C 4FN0A 5BV7L 4PGBB 3MJ8B 3PJSA 3ZMRA 2B1AL 4XCCL 1U42A 1BREA 5DYOB 1QBML 5MENA 3IDXH 3JWNC 5F1IB 3MFFB 5IB2B 3EDJA 4HIHB 2BOCB 2F8OA 4LU5H 2GAZA 3CDGA 2YD9A 3QUMA 1INQB 4JRYD 4N0CC 5JQ6H 5JQHC 4NQDB 4X5LA 4F57H 4P57B 3UTSD 1D9KA 2XTJE 2Q3ZA 3PJSB 1EEYA 1F00I 4U6HB 2O93L 4DQOH 1H9VA 4RIRA 3U0WH 3I2CH 4R2GB 4FQQB 1HHKA 3KDMA 4Z95H 3IS1X 2OX5A 4JRXB 3BPNB 1R24B 4V1DB 5HDOA 4JQVA 5BVJB 3RWDA 3CMOL 3T04D 4F57L 5E00A 2A73A 4DWHA 3GMOA 1L7IH 4IOFD 1AGCA 5HHVL 4TVPE 4QTIL 3MROA 1RZIB 3EW3B 3D9AL 2B39A 3LY6A 3SDCB 1A6VL 1RZ7L 4S0TD 2QLVB 4DUVA 4NQED 1VADB 4WFGE 1MQ8A 1I8MB 4IOIA 3FB6A 1B4JH 2B1AH 3MRBB 4WI6A 1KJ2L 4XCCH 5HGHA 5J1AB 3RWCB 3GJFK 2DIAA 5F1NA 2R69L 1TJHL 3X3GL 1FYTE 4Y19A 4HPOL 3C60B 3ARRA 4HWBL 4Y4KB 2AJUL 1QQDB 5J9PA 2VDPL 3DV6A 1LO0L 1KPRB 4NC1E 3Q48A 4K7PH 3QZWA 4HIXH 5B21A 1X6NA 4GS7C 3BZEB 3GEWB 3IDYC 3QAZC 1JGLH 2IPUG 3IKCB 2V5MA 3MUZ1 3VE0B 3GHEL 3SGKA 2FX9L 1EJOL 4KJYA 5CGYC 1LQSR 1OP3H 1L9MA 1YNTA 1HOCA 3N9GL 1S9VB 1AI1H 5CKGA 3K8LA 3TPKA 3PHOB 2X4NB 4O5LH 4X6CF 4M9PA 1CF8H 2DLTA 1OAUH 4DN4H 4N9GA 4NC1C 4ZFOL 3V7AE 1F4WL 2YBRA 5F72S 3VRLE 4K23H 5BO1L 4D0DB 3AMLA 1MQKL 4NKOA 3B8YA 3HE6C 4PJ5E 2H26B 5BZWA 4G8EB 5IQ7L 4L9LA 5F7YC 1LK2B 1LO5A 3BP5B 2MQCA 1A7RH 3ARQA 4X8JB 5D2NE 4ELKB 3BZFB 2AEQL 5D93C 2EH8H 4JB9H 1KN4H 1S7RA 3QIBA 4Y16C 1HHHB 1CFQB 3AC0A 4NFDA 3HUJF 2BVYA 5FK9B 3REWB 4QRPA 4ZFZB 1NGWA 2RAMA 1L0YA 1KB5B 1IILE 5DMIH 4PRPE 3OZ9L 4UUJA 2AV7B 2OYPA 3SDCD 4G6AC 1OL0A 5C0EA 1CXLA 4Z7NE 4WGVB 4HUUB 4YGVB 4Y88A 1DQTA 5GHWL 1QR1A 2JTDA 1LP9B 3KJ4B 1CFBA 2OP4L 4RZCA 4LPYA 5FM8A 5F96L 5IBTL 2PO6B 4NNPL 4OLVH 1XAUA 5K93A 4J4PD 4XTRD 5AD0B 1EVTC 5E4EC 5L88L 2AJYH 1W8NA 2D4DA 4J3UA 4Z9KB 5DWUH 1U93B 4MQSB 4YHPA 2E6QA 4KRPD 4K2UL 4G43B 2NY6D 5DMKA 2FBJL 1KEML 3SKMA 3SEPA 1EPFA 2ZG2A 1QZ1A 5IR1A 4KHTL 4HUVA 5C09B 3KPPA 3FQWB 5F1OB 3S5LA 1NGXA 1J1OH 5L7XL 1MFDL 2XWTA 3VDAA 2AK1L 2PNDA 3PABA 1XR9B 32C2A 3QIUD 4IHOA 5IKCA 3JTSA 4M00A 2AK4D 3TN0B 1UWGH 1KBGL 4M4RA 2FEDC 3QJFA 1TPXB 2XN9B 5BXFB 4J3XA 3DVNB 4ODSH 2VLJA 2BZDA 4XTRC 3KVQA 3UTQB 3QA3A 1A0QL 5IMOA 2QV2A 3P4NB 3GMNA 2GSGB 1NGZA 2OQJA 4OZIF 5DRWB 2O61B 5IKCB 5KVDH 1QLRA 3BO8B 3KPTA 5GGVY 1BJMA 1TJGL 2OR9H 2FGZA 5FECA 3PHSA 5K59F 5DJZB 2Q1EA 3CFBA 3LSOB 5DQJB 3AREB 4JFDE 4DVBB 2NX5B 3I84A 3RDTD 4FQ2H 5JW5B 1HCFX 1A14L 3L3GB 1L7TH 2X4TA 5BS0B 2AJ3B 4FFYH 4FTVB 5H37G 3OWEA 1YEIL 2F8VA 1N5YL 5GISL 4YHNA 2VUOA 4CU8A 2OTWA 1JZ3A 4KK5D 1QFPA 1KLUA 4Y8AA 3PUCA 4U3CA 4Y5VB 3PWPD 5IBLD 1FNAA 1FVCB 1JZ2A 2J4WH 4P5TD 5DRNA 1V3KA 5BOZG 3P30H 4GKZA 1BVLA 3QUYB 1QSEE 4ZYKA 4R4FL 3IFNL 4PRIE 5ACMA 1DVFC 5HBBA 5F9WC 1F4XH 1T5WA 5DJXA 4JFZH 1JPSH 4EOWL 3GSRB 1ACZA 2VXQL 3QUZA 1S7VB 5D2LA 1RIVH 1A9EB 5KTEL 1S9XA 4O51A 4PRHB 5D7SL 3STLB 2A83B 1J1PH 3QXTA 3DV6B 4MXQC 4ODBD 4YDLC 2EYTA 3Q6FA 4FXKA 1LP9A 2AJVH 3FT2A 3OSKA 2E5EA 4N1HB 3WLBA 3FQRA 4JRXE 3VE0A 4N1EA 4WRLA 2B2XH 3RL1B 3NFSL 3KR3L 1OSPH 4V1DE 3D2UA 4LHUA 4R3SB 3S36H 3ECBA 1IEAA 4U1IA 1CYGA 3FQNA 2E3VA 4DVRH 1Z3GL 3VCLA 1YYLL 3BQUA 2XPGA 4MQXC 2OJZL 4K7PX 3E6FA 4C83B 1SYVB 3HRZB 3LKSB 2YXMA 4FQIL 3H3BC 3MREA 3BD5A 1UKSA 1K8IA 4OI7A 3TIEB 1Z5LB 4YPGB 5FUZL 3MLSH 1A47A 4ZG1A 3MBEA 3PP4L 2CIIA 1NQBA 2PXYB 3W11D 1TTUA 2W9EL 3K8MA 3QYCA 5SX5K 4ODXB 3MO1A 3VI4F 1RIUL 2F53E 5C0ND 3DJ9A 3WFDH 1R5IB 3MRLB 3MNVA 4N8VA 4OCXL 2BRRL 2H2PD 3E6HB 4J3WA 1MCQA 4G7VL 2NY5C 4KKCC 1Z5LA 5EZJA 4XCEA 3EYQD 5I0DA 1C08B 3IETB 3G5ZA 2R4RL 2FJHA 1T1WA 1DQMH 3LS4L 4H0IA 5A16B 5DDHA 4R2GD 1UC6A 1VGKB 5J11C 5ALBH 1KPVB 2PR4L 4WFEE 1EAPB 3P77A 3S34L 1IGML 3CU1A 4FFZH 4MQXD 2DQHL 4NQDD 4XXCC 2C1PA 5J6HB 1DLFH 2HT4C 3VXUE 2LU7A 3KS0J 3MRMB 4NZUL 2I60L 5FYLD 4QYOB 1J9CT 4P23D 1GOHA 1T7WA 3AMKA 4LLQA 1I1AB 3LPGA 3ULUD 3P9MB 3JWOL 4QHNB 4WW1B 4HPYH 2DWEA 3C9NA 4AG4H 4Y5VA 5KS9E 5T5FH 4MB5A 1YDPA 4Y2DB 2WUBL 1CG9B 3G9VA 4W6WB 3SGDI 2QSQA 1DN0A 1V7ML 3HNVH 1FZMB 1Q72L 4IM8A 4HZAA 3T8XB 5BV7B 5KSAB 2XY1A 3QFJB 2UUDK 3G6JE 1UM6H 2PTTB 2VKWA 4UTBL 4ZAKB 3KGRA 4UQ3B 1I3GH 3PHOA 2Q86B 1Q8MA 1ZHKB 3TIEA 4ETYA 2FWOA 3FB7A 4K3EL 1GIGL 1NANI 2A38A 5BRZD 5FDYA 4WI2A 5JO5A 1KIRA 3C2SA 3VXPA 1CBVL 4MCZA 2IFFL 5F9JA 4OM1H 2FGWH 1MCRA 3RTQB 2EYTB 3HC4H 3KPRD 3WFHB 2P5WD 3AREA 3MRQA 1NUFA 4OFPA 2OLDA 3U30B 4KRLB 5JZ7D 3D2UB 1NSNH 3H3PL 3ARFC 1F97A 1KIQA 4MZ3A 3GRWA 3VD7A 1UVQB 3MRKA 4LLVB 3V4UH 4LCWA 2FJHB 4OD1L 1YNKH 4XZUA 3V6OA 4JDZA 1H8SA 1IAMA 1RJCA 3GSOB 1I1CA 4GMTH 5FGBC 1RFDL 2NY5H 4LCCB 4NQVA 2ADFL 4PRDA 2DJSA 2GY5A 4LAQL 5BXFA 1GL4B 4WUUE 5IW1B 1A3RH 4LK4A 2G9HB 4M7JH 3EHBC 3RVUD 3TEUA 5C7XL 2BCKA 3MLRL 4MD0B 3D25A 1RZGB 5ACLA 43C9B 4XAKE 1CLOH 3JZ7A 5D1XC 3SY0A 4HMEA 2MCG1 2R0LL 5TDPA 5D7JC 1X5LA 3E8UL 2DD8L 5DRXB 3QIWB 4HH9A 3UJIL 5I71C 1RZ8B 3UEZA 3H7BA 4P9ML 5C07D 1IGFL 4TNWK 3QEQA 2C3VA 2EICA 3ILQC 5IB4B 3SKMB 3UPAA 1S9XB 3QP3A 4O51B 3WJLC 4G8GE 1MAJA 3L3IA 2C3HA 4GW5A 3D69B 1KOAA 1FL6A 3NFPB 3OKLA 4JFYA 1LMKA 4KQ3L 4ERSH 2NY6C 2FECL 3FQRB 3IFPA 4PLKD 5DRWA 4MJ4A 2IANB 2JJTC 2PYEA 2P42B 3T0BA 4O58L 1I1YA 1JGEA 1MFBH 3LQAL 1RHHA 1LO2L 4JN2B 3VU2A 3IAGC 1DBAH 3VWJB 4YEFA 5IG7A 4EVNA 2CLRA 1PD6A 3I85A 3WNMA 2NMSA 3B9KC 4G9FA 4L8DA 1JPGA 3TZVC 4PJEE 1NBVL 3HPLB 3L3JB 3KXFB 5DQ9B 2LTQC 4OQTA 2NXYC 4DVBA 2ARWA 1GYAA 2YZ8A 4JPWH 5F7HA 1EBAA 2DLGA 4L3EA 5F7MC 5F7UA 3W2DH 4LARL 5CLTA 1DQJB 3ARDA 1NFDA 4WY7H 3L5JA 3SE8H 4E41B 4Q6IC 1G7PB 4HS8L 2XN9E 4LSRH 3R06B 2R29L 1U3HC 4JE4B 3BZEA 4X5XB 2CGRH 3MV7B 2Z35A 3FFCA 2QQLH 3MLTB 1A1MA 1FNGA 2X1OA 3S3JA 4NOBA 1KCSL 5E7FA 4HUKB 4WIQA 1MAKA 2Q7NA 4XNUL 1S5IH 4OUUB 1FJ1A 2J88L 1BD2B 2FD6H 2P7TA 3FJTA 3DOSA 3MFFA 3NOIA 5IB2A 5T33H 5T1MA 2ZG3A 1D5IL 5IW6B 5MERA 3EZ8A 5IM7A 3SE4A 2CSPA 5EORL 5F1KC 3TPUA 2GCYB 4V2BA 5A1AA 3FFCE 3S36X 3MOAH 4M7ZC 5HVGB 5E6IB 4DGVH 4MCZB 3SDYH 3N85L 3A67L 1NEZA 5JHDD 3QUML 5IMKA 4PP2A 1KCVL 1MI5B 3GBNL 1AIFB 3ZE1E 4M43H 2VDLL 4L3EE 4WTZG 3O2DH 2FZ3B 4TPRH 5I1CL 5E8OA 3D5OF 5FOBA 1QFUH 3OG4B 1W72A 1RUQL 2WK2A 1A22B 4LSQH 1X9QA 2B0SL 5B3JE 2D0HA 4Y89A 1IVLA 5GIRA 1T20B 3LKNB 5FV1L 4J6RL 3SQOL 2EDOA 1NBZB 4RGOH 5BZDA 3CVHL 5LGHL 5SWZB 3OJDB 1LO3L 3QCTH 1VFBB 3FN3A 3QEUB 4R96B 1AQKL 4R4BB 4RIRB 5JO5B 3SGJA 3F58L 4PJGE 5E70A 2RHEA 1DEEB 3FQUB 5C0GB 2KL6A 1JF1A 3VMOA 3CK0L 2EC8A 1DTUA 3FO0H 3ZTJG 4Y5XA 3WNLA 1IBGL 1UACH 5L9DL 4MA1C 1FGNH 2C3WA 2DLEA 4CVXA 3BW9B 1NEUA 1PSKL 3D0VA 1F42A 2H41A 2E27L 2CK2A 3MRFA 5CZVL 4CN4A 2JIXA 1OTTD 2WINB 3NA9L 4NHCH 1AP2A 1QG3A 1JV5A 3LEXA 3EDKA 1HINH 1S8DB 3U79A 3I6KA 4YDJB 4YAQA 2GITA 1MFAH 3SJVB 3GUTB 1FRGH 4XMPL 2DS4A 5FCUL 2G5BB 2MSPA 4PGCB 3IDMA 5I1IL 4M7KL 5B8CA 2R2EA 4PJ8C 4ZSOB 1J87A 1YEDB 2VERN 1VADA 4L1HA 3O4LE 1LK3H 2J5LC 4NOFA 4OF5A 5DO2D 3DSFL 2H26A 4YXHL 5BZWB 3K2UH 1ZE3C 3QRGH 3FO1B 4HJJH 4F9LC 5KAQG 3GB7A 1EJ6A 1TDQA 4XAKD 1T1XA 4OF3A 4PJ9B 4WU5A 4WFED 3NCYP 3LV3A 3TFKD 5J7CC 4YIQB 5TFSL 1JPST 4ZPVA 5HGHB 1T4KA 3DUUB 3C2AH 1B0WA 5EUOE 1ZHKA 1CXKA 5EOCJ 3GK8H 3PIQB 3OPZH 3VFMB 2CRMA 2Z4QB 3ZKQD 4X4XB 2JCCE 5DQDH 3BDBA 1DSFH 4NUGH 3OR7A 35C8L 4JY5H 4R97B 4HS3B 3UTZA 3KAAA 2HMID 3VXUB 3SDDC 4ZUVB 1AO7B 1CD9B 4FZEH 4WO4A 3RIAF 3C09C 4F7CB 2PO6D 1GC1L 5DRNB 3MBXL 4WFHE 4U1NA 1L0QA 5D6CA 1PQZB 4QHUB 5KN5A 2YSSA 1N4XH 3HCVA 1HSBB 1CT8B 1EGJL 4JRWA 4U1IB 4K8RD 3BRGC 2P1YA 1MAMH 1HWGB 5IQ9A 1SVZA 4NZJA 4DOHE 4HGWB 3LIZL 2NY0B 3TJHD 5DSCB 2NXZD 1NMCB 3T3PF 5DVNA 3ZDXF 2VWEE 4UINL 1DANT 1D3CA 1P7HL 2K7QA 5HYSA 1T03H 1A2YB 4Y4HD 3O8XB 5F7NC 1G7MA 4HH9B 1BQHG 4NZRH 5AUMB 5F8QC 1DBKH 2FECI 3QXVA 3MBXH 3QUMB 4YQXH 4AENB 1SJXA 5EOCH 4ZAKD 1BM3L 4Y16D 2Z92A 5GSRB 2BCKB 1DQQB 4MD0A 5ICXB 4Z77B 1KEGH 4YBLB 3L3HA 5TDNA 5GGQL 1MPAH