1EANA

The runx1 runt domain at 1.70a resolution: a structural switch and specifically bound chloride ions modulate dna binding
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
b'GELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title The Runx1 Runt Domain at 1.25 A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eanA00
1KZYA 2MEJB 2OCJA 4L0ZA 1GZHA 2BINA 2J1ZA 4IBYA 3IGLA 3US1A 3VD0A 4IBVA 3WTWA 5AOKA 3Q05A 4QO1B 4IJTA 4MZIA 2J6WA 1IO4C 5AOJA 2J1WA 3EXLA 4AGQA 2PCXA 5LAPA 4L18A 1CO1A 3EXJA 1T4WA 2X0WA 5ABAA 3KZ8A 4IBUA 3D06A 3Q01A 2XWCA 2GEQA 1CMOA 5AOLA 5BUAA 2IOIA 2H1LM 5ECGA 3WTUA 4G82A 2X0VA 3VD1A 3TS8A 2J20A 3US0A 2IOOA 4XR8C 3D0AA 4AGLA 4G83A 4IBTA 5A7BA 1E50A 2P52A 4L0YA 5G4NA 4GUQA 4AGPA 1YCSA 2J1YA 1HU8A 4IBWA 3WTYA 3D09A 4IBSA 3WTTA 4MZRA 2X0UA 2ADYA 2RMNA 1LJMA 1HJBC 4HJEA 1GZHC 5LGYA 4IBZA 3D07A 2XWRA 4IBQA 3IGKA 2BIOA 2YBGA 3QYNA 4AGNA 3VD2A 2WGXA 1EANA 1UOLA 3D08A 1EAOA 3WTSA 2FEJA 1H9DA 2BIMA 3QYMA 1EAQA 3Q06A 4LOFA 2J21A 5G4MA 2VUKA 2ATAA 2J1XA 5G4OA 3KMDA 2BIQA 5AB9A 2AHIA 4GUOA 3WTVA 4KVPA 4LO9A 3WU1A 2AC0A 2BIPA 4AGMA 5AOIA 5KBDA 5AOMA 1HJCA 3ZMEA 1TSRA 2IOMA 3WTXA 4A63A 3D05A 1TUPA 4LOEA 4AGOA
chains in the Genus database with same CATH superfamily
3H56A 3FQTB 3G6JE 3KPSD 1AGBB 5SWSE 5LQBH 3DUUA 4APQD 1IKOP 5JPNA 4PRAB 1SHXA 4U2YA 5I6NA 3QDGA 5AL0A 5GGRB 1U3JA 1CFVH 1UXSA 2NNAA 2HLAA 5DZOA 3VFVB 2LLNA 3TJHC 4H20L 4LLAA 4WI0B 4JKPL 1FL3A 3VFRB 2SODB 2X40A 2WLZA 4EN3B 3E3QC 1JYXA 2NYYC 3KBEA 4EBQH 4YAQB 5CGYC 4XWGL 4L48A 4WWKD 5I6KA 5F9OL 3M46A 1KBGL 1XWVA 1MW1A 4NZRL 3TURA 4U3XA 1YMMB 5KVFE 2NY4C 3WHXB 1WBXA 2BVOB 3FN3A 5B8CB 4GAFB 3TV3L 2EE2A 3K6SB 1QR1A 3NIDF 3NZUA 1XTLA 4RMRA 1DDHB 5AOLA 1URIA 1BZ9A 3HLAB 5J1AA 4ALAL 5IG7A 4QRTA 4F8TA 4YHYC 4KTDL 1LE9B 2WYHA 1NFDF 1BLNA 2KZBA 4FABH 4G82A 4N8PA 3PHSA 2F54A 5FFLA 5I15H 5DHXB 4JB9L 3ATBA 1C12A 2I5YH 3AUWB 3BP4B 1W72L 5BVJA 3CFTA 3MBEA 4NI3A 2E47A 4YDNA 3QIUB 3BSZL 3O6LL 4PJDB 4X4ZA 3LH9A 2B2XH 3EG9B 1C08B 5IEKA 3TC9A 2DLGA 1Z9LA 4PS4L 4Q6IB 4KMQA 3L81A 2G3XA 5DTFB 5DYOB 4LMQE 2BP0B 4HGMA 2IANB 3PP3K 1CFTB 4NQCE 3X3GH 5DJYA 1VFMA 5INDA 4AUUA 4HV8B 2G9KA 5EN2B 1RSYA 3PF2A 3CK0H 4QJ5B 4KUZH 4KITB 5HHPB 4IYKA 5EZJA 1AH1A 1RPKA 4A2LA 5HJ3B 2G4GA 4PGEA 5CN1A 2NDFA 3WG7B 5BS0B 1JNLL 3EYOB 1G5GA 4J8QA 4NQSB 3PDOA 1MCJA 2NW2B 1F4HA 4TUJA 4WU7A 2XJKA 1KJ2L 3WLBA 3HZYA 3UTTE 3O8XB 3WIFB 2EEAA 2NXYD 4P5MB 3UTPE 5CZRA 4GI6A 3FCSA 4XX1G 1CL7L 3IF1A 4QRRD 1EXGA 3S3JA 3ABKB 5F6IB 1CLYL 2IQ9L 3BN9C 1W0WA 3MLUH 4ZMXA 1O9ZA 4Q7DA 1BAGA 1V7ML 3MUUA 1B4JH 1WC7B 2QGEA 5HHXH 3HJEA 5BJTA 2EDOA 1E2WA 3M88A 1ZPLA 1EEQA 3RVUD 1SMDA 5FYLE 4TULH 2PCYA 3WS6A 2WQSA 2XJLA 3CMOL 3CSFA 5TK4A 4OKVB 1KCLA 2WCSA 3EF7A 1UTDA 2BMKA 1RFDH 3M1OA 5GRJH 4JNXA 1I1FA 4Z7WA 3WDHA 3ISWA 5ACZB 2UUDH 3VFNB 4F7CA 2X70B 1X5XA 2PCXA 3LPOA 4OSUL 2X2JA 3HG2A 3CN1A 2DH2A 5C9JA 5I0VA 4G7YH 3V5DB 3G6JF 1HCVA 2E27H 4NDMA 3B2UD 3CVHB 4L4TA 5JR1L 3KPNA 1LEKB 5C09B 3HC0A 1WVZA 1ZV2A 1ET7A 1PD0A 4CADA 1XZ0B 3QQDB 3VX1A 1F42A 4XAKE 3SBRA 4JFXB 4FS0A 3JZYA 1NJ9A 4YXKL 15C8H 4P2YA 5I16A 3KPSA 5EUOB 4AT6B 1MAMH 1X5YA 4JRYD 4APQA 4M56A 4XPHL 3UPRA 1IAII 1H3PH 4JQIH 1PG7W 3HS0A 4U1HB 3MMEA 4HQQL 5GRVL 1ET8A 1MJ8L 4HCGA 5E8DL 5EPMA 4A7SA 2C7UA 1GGYA 5C08D 5J12B 2AXFA 4DAGH 5F7AA 1KIUB 3HE7B 2Y06L 4WWKA 5FIEA 1DQDL 1YN6A 3F7RA 1MRCL 4NSKB 5GZOD 1GJIA 1DQIA 5B39A 4MB3A 2NW3B 1QABA 3TO2A 3Q2LA 1JF6A 4Z7AA 5HPMB 1PZDA 1B2YA 5EZLA 5KVGL 2JNZA 3JUYA 2WBJD 4NOFA 4BELD 4X8JB 3QYNA 1Q0EA 3TH2T 4ZW7A 4ODTL 1E28A 3MTXA 1BJ1H 4RCAA 3QORA 5AW1B 2X4TB 4BWUA 1VJSA 5KS9A 1KFAH 5B7EA 3IFOB 3GO1H 5K39A 2CQVA 1T2XA 3OX8B 2ZOUA 1EDHA 3GB7B 1HYRC 3L1OH 1JPTL 3NUKA 4M7ZC 3NZ8A 2V9RA 4EN3D 3D33A 1OM3H 1CYXA 2XDHA 4UZGA 5ICUA 3OVUB 2R56H 4JFQA 3AT9A 3VFSA 1YY8A 4JVWA 1DBKH 2GBUA 4BZ1H 1H8LA 2AXJA 4Z3TA 1EBAA 4KX9A 3R8BB 4U6VL 2P7TA 2OCJA 2YMXH 1DQJB 3VCLB 1PCXA 1YPZE 1DBMH 4P04A 1P4BL 3IDMA 4MXVE 5EBWB 2VXVL 4AC2A 1XGYL 5B1JC 5C2UB 4FN0A 4LVEA 5FUCC 3B6SA 4LAQH 1E4JA 4LGPB 4S1QL 3D3VB 4KXCA 1SM3H 1QUNA 3E8UL 2UZYA 3CXHJ 5AZEL 5LGKA 2WLYA 4F58H 4G1MA 2A6KB 5LWYL 4XPBL 3PGFL 4UQEA 4XP5L 3EOTH 3VJ6B 4IW4C 4M6MH 5CLTA 4QRRA 4QHNB 4ADJA 3MZGB 2ITFA 5LGHH 1L7TL 5E8NB 5CHNB 1YY9C 3T3PB 5CBAB 2EXWC 5HI5D 3TIEA 4KDVA 1ZGLA 2IAND 1EHKB 1W16A 3C6LB 1XCWA 4XMLL 1L9TA 2BZDA 2RQ8A 4LHUG 4QRAA 4UV7L 5KN5B 4PI0A 4WU5A 3WAKA 4A67A 3LNHA 3QEHB 2UY6B 4HKBA 4KQ0A 4UI2A 3GJEB 1IC7H 4Y2NA 1HS6A 1XIWB 3ZDZE 3C2AH 5BS0D 2HG0A 4HCIA 5GHWH 2VB5A 2A9DA 3ESPA 5IEHB 5DZVA 3T0VA 4AZUA 2HVBA 1JAEA 5AVUB 2DTML 1O6SB 3VQLA 1T5WB 4ZUWA 3BCDA 4LZKA 2R1WB 2CKBA 3L48A 3KEHA 1BG9A 4PTUA 2ED8A 4KMTL 4R7NA 4Y1TA 1G0YR 1ECYA 1S9WA 5BPPA 4DEPB 1G9MH 1T7WA 3ECUA 4OF8A 2N3JA 1BYOA 4ERSH 1MNNA 4X6CE 5DLMH 1EGJA 4RA3A 4XWOC 2A74C 2HT3C 4Z18A 5C07E 2J8UA 1UXMA 1NSNL 4DW2H 2ENYA 3OZLA 3D07A 1V3MA 4Y2OA 5DDHA 5B3SB 2JSFA 4W6YB 3VH8A 3VNYA 1ZTMA 2EXYD 1EO7A 4DNLA 2V5RA 3NCJL 3QZNA 1A6WH 2WNGA 5I6XC 1T4KA 1S9XB 2DQJL 2H6PA 4MNGE 3KL3A 3UABA 1RVFH 1RHHB 5D1XD 4TUUA 5IF0B 3G6DL 2D7NA 1JFQL 5CSZB 2AGJH 3P3UA 5JQHC 4HU8A 1P4IH 3W5NA 4H8WH 3CHPA 1GOFA 4PBXA 5ESQB 5D7HA 4NQXB 1Q9LB 3CHSA 3I75A 5IOKA 4CMMB 4AVIA 5B3NA 2ID5A 4WI6A 4L9DA 3VXSB 4P3CL 4KVPA 4WWOA 4HK0B 1X5IA 3H3KA 3P0GB 4XMPH 4ODUA 4P5RA 1CWVA 4PVBA 1H5BC 1R3IL 2WXJA 4I5BA 3V4VH 1OWWA 4ZS7H 4P06A 1GGTA 4JHWH 1F6AB 5H8DA 4IBYA 5C09D 3N41F 1EO8L 2YMTA 5HGDB 2J1ZA 1FFNA 3V4PB 4LKXB 3IGLA 3DJRA 2WBJA 2LABA 2R2HA 5CEXA 3EOAA 4GNKB 1FN4B 1OE3A 3FONA 4YNYA 1ZLWK 1X9LA 3B2MA 1Y7VA 3BHBA 3MJ8B 1U3YA 1C1EH 3U4KA 3FQTA 4WY7H 2DWYA 3WLWD 4JY5H 5K1VA 5AG9A 1AYOA 5KBNC 4PRAA 4UAHA 1INDH 2BNQE 3L08A 4Y4FC 5GGRA 1KF9B 3VFVA 5JYMA 3JQOB 1W91A 4WI0A 5GRWA 3OAUH 1L7IL 2BZ7A 3VFRA 2OMYA 3CFNA 3KYKL 4EN3A 1T22B 1YPZF 1HT6A 4YAQA 5KOVC 4KK6C 4MXVF 2I24N 4IBUA 3HE7D 1UFGA 2QQNL 1QFWL 3BVWA 3CZLA 3M45A 4XT1C 3QDMB 1NAKL 1XSKA 3GM8A 3VB9A 1YMMA 3VA2C 3WHXA 2BVOA 3E8VA 1AVAA 4FGMA 2ZUTA 5B8CA 4KK9D 2X4OB 4GKZB 3UERA 3K6SA 2Y1AA 1DDHA 2ESVE 3VD1A 3EYSL 1B0GB 1I1AC 4O4YH 3HLAA 3T0EC 3GHPA 1LE9A 1KBGH 4CDHA 3VB8A 5CINL 4HU2A 1AQMA 4Z5RB 3QCTL 4TMPA 4XO8A 2O5NA 1YCSA 1DJXA 2NCMA 2WQXA 4QOKB 3BP4A 4PJBB 1UZ6E 3ALWA 4RISH 3QIUA 5T33L 4PJDA 3NIFE 2MFNA 4NZTL 3ZDZF 3EG9A 5GS1B 5D7LB 4FG6C 2J88H 1C08A 3CZFB 4ZTPH 3P9WB 4HWNA 1RJLB 3F01A 4Q6IA 5E5RB 3IDYC 4KTDH 5B1BB 3HCVB 4DTGH 3T3MF 5DTFA 5DYOA 5E6SB 3L1GA 2IANA 1CFTA 1PX8A 1QPPA 4HV8A 3WUWB 5KVFL 4ES9A 4KGJA 1DBJH 4NC2B 4PWEA 5D1ZC 3GBLA 4HG4J 2VLRB 5HHPA 4QKTA 1BIHA 2ZSWB 3GHBH 4JAMB 4X6CF 5HJ3A 3SQOL 5BS0A 5IGXH 1BOGB 4EO5A 3EYOA 4F33B 4NQSA 3KMDA 3D3VD 2UX7A 1CDHA 2NW2A 2GITB 4I2XB 4S2SB 4BXSV 3WIFA 1DFXA 1NGPH 3LJ3A 4P5MA 4TN9A 3T0AA 4FZ8L 1BIIB 4U6TA 5BZXA 3VXME 1OCZB 3MJGX 1XHHA 2BIPA 5EF2A 1ZTXE 4FXKC 5D7JB 5IHBA 3WJLC 4LP5A 3FT2B 4KY1L 6PAZA 5FM4A 2J5WA 4B3VA 1OAQH 1CLVA 4L0ZA 3C6LD 1WC7A 3OC5A 3FTUA 1B9ZA 3ZYOA 2D7MA 2F19L 2O93L 5EOCL 2GJ6D 4ELME 1HAUA 4FLOA 4IGBC 3S88H 5HDBB 2Z93B 5D1XA 4OKVA 1SYSB 2K1MA 2B16A 1HXKA 1WA0X 3NCBB 4KRPD 1RIVH 1BZOA 1MHHB 1TQVA 4OH2A 2B1OA 4X83A 4OQTL 1V7MH 4XOEA 3MLZL 2X70A 3TCLB 4ODHL 1X5JA 1T6BX 3QCVH 1K8DB 4I48B 4JPKH 3SGEI 3B43A 1EDQA 2HT4D 1BZ8A 5E8EB 2XPZA 1MELA 5GS2D 3D0LB 1I3GH 3WFBL 4KKCD 3S96B 5D4IA 3BD5A 2YN3A 3CVHA 3BUPA 3GHEH 3Q2CA 1T89A 2F15A 2G5UA 4LSRL 5C09A 1LEKA 2X42A 2H32B 4F8LA 4ZFOB 3UYOD 3NP3A 4QUOA 1A5FH 4LRIC 4XOBA 4DETA 2IOOA 4LSDA 3IJHB 2EDXA 1T3FB 1XD0A 1XZ0A 1F45A 4LIQH 3D0VB 3QQDA 3I2CH 4IKNA 4HF5H 2E8YA 3L5IA 2ZX9A 4JFXA 4R5XA 1ZV5A 4W9EC 5J56B 4DPAX 1BVNT 4N24A 4ZSOB 5KW9H 5EUOA 4ZW3A 5CZXC 2AJVL 4AT6A 5AG8A 1VZHA 5FYLL 4MTMA 5J11B 1RUAH 2FE0A 1ZLSH 1DP0A 4U6YB 2F7PA 4I0PB 4DF9A 4U1HA 1BVZA 4LOUC 1D9KC 4ZMLA 3CVDA 1GW6A 5BRQA 1A4BA 4BCXA 2BP8B 3PHOB 1J1XH 1GZHC 5AW3B 4JMNA 2FEDC 1KIUA 5K9QI 1RZJC 2I07B 3HE7A 3DX1A 3VXTB 1UA3A 5JIHA 5KOMC 5GS0D 4NSKA 2NW3A 1UT1A 1NCCH 3U82B 5HPMA 5LBSL 2FO1A 4HOXA 1GPOH 4QRQB 5T5NG 1UZ6F 2C9QA 1UM6L 1XF5B 3NIFF 2HTLD 5AYUL 1G7JA 2EABA 4WFHD 4AI7A 1N8ZB 2X4TA 4OM1H 2BOLA 4WEBH 3S5ZA 4B5EA 4UQ3B 3INUL 3IFOA 1IIIA 1Q4NX 4GQQA 1SQ2N 3IVKB 4FQXD 2YOCA 3OX8A 1HKFA 3GB7A 3KPRE 3MJ9H 2Z35B 5JQ6H 3JSSA 1BZEA 1KGIA 4G7QB 4XX1E 3BSGA 5E03A 1XVSA 3HBQA 4Y5VC 3UTSB 1U3HC 5EDSA 3UTOA 3QDMD 3GZKA 4XHJD 3VXQB 3S3BB 4CL7A 2ODIA 2YRPA 5EZOH 4MB4A 2QHRL 4MNQB 1BYPA 1E4WL 2FIKB 1D6VL 2QPSA 4WF7A 5DUPL 4IOFD 1DQJA 3DPBB 3VCLA 4FA6A 4DKFH 3FQXB 5EBWA 2VZOA 4N90E 3SDAB 4WHCA 2D0FA 1K85A 3P0VH 2YA2A 3ARFB 3RGVC 4YSEA 4X4ME 3D3VA 5FPIA 4YBQD 1OP5K 4QOKD 4QRPE 4ELMF 2E74C 2A6KA 4D9QE 4U6VH 1CFSB 4G8AC 2EDFA 4RQQB 4GQZA 3VJ6A 1UD2A 4RWHA 3ZGIA 1KENH 1AS6A 2VMEA 3PCYA 5ABZA 1XGYH 5E8NA 4ZW5A 4CRPA 4Y5YB 2F53B 3IMVA 5CHNA 3EZJB 5CBAA 4JFDB 2CNYA 2Z1PA 4K94C 3C6LA 4WTZA 5DFWH 5KN5A 5B7MA 4LPVA 4DESA 2WB1A 3F6IA 4FFTA 3QEHA 1FORH 2UY6A 2XACC 4DGYH 4Z7NE 5LWYH 2VLRD 3GJEA 5IB1B 1JF1A 1XIWA 3H9YA 4X42A 2BZCA 4ABVA 3JV5A 5E2JA 2WC7A 5IEHA 4YZFE 3X3FH 4MX7A 1KCKA 4PU2A 1L7TH 1O6SA 1U42A 3P9LB 4BSVB 1T5WA 5A2BA 2V8LA 2VWEE 2X41A 3BZ5A 2RMNA 5I8CB 1IT9H 3NIDB 3GIZL 3CSTA 3OJDB 3QJXA 1KMGA 1QOKA 3N9GL 4HIPA 4MMYB 1JMZA 3N85L 2QSVA 3U36B 2HG5B 1X5ZA 1ZT7B 4FJZA 3VI4E 4N1CA 1E5ZA 3OB8A 1TTGA 3HC4L 2X2YA 1ACYL 1YEEH 2DTMH 2FTAA 2EDNA 2UVEA 3UJJH 3REVB 4AV4A 1K2DB 1HNYA 4KMTH 1OEZW 2QPDB 4UTAA 1RHHA 4G6JH 5IF0A 4AEEA 2J43A 2YD7A 4Y4HB 5CSZA 2IXQB 5CZKA 3DC0A 2CM6A 2NT0A 4H1LB 4JO4L 5CEZD 2ZAIA 5EULV 4ZX5A 3P11L 4CSZA 3BKCL 3DI2B 1YG9A 4A2MA 3ZK0A 1Q9LA 3GGWB 4ETQB 1FGNH 4CMMA 1FFPB 1V10A 3VXSA 4OM0H 4L8CB 3WKNA 3PHAA 1PU0A 4HK0A 2Q87A 1AO7E 1FYTE 1LWHA 4AJWA 4TVPD 2YSSB 2BY2A 4JQVA 1ODUA 1F6AA 4XN5A 4RFEB 3BE1H 4M5ZL 2Y5EA 5I19L 3HRZC 4JM0A 4X98B 3QUZB 4KO7A 4U1GB 3V4PA 5AAPA 5GGTA 4H25A 3CIAA 1ASQA 1FN4A 1U4FA 4KKRA 5AVWB 3MJ8A 4PJ9C 3I9IA 5KBMA 4JR9L 4YXHH 1J0ZA 2XQBH 3BDYL 4AV5A 5CFHA 1IKFL 4I0PD 2B3RA 2VAJA 3JYBA 5ID0B 5EEVA 4FQXA 2DF3A 5LXVA 2YAOA 4UB0L 1MHCB 1WAAE 3SE4C 1X5HA 3P1VA 5K9QG 1T22A 5C8JB 4XP6H 3F58H 2DLEA 5DYFA 3HZMB 2R23B 2IMMA 3QAZB 2Y72A 4M6AA 3VXPB 3QDMA 2X6MA 4F8OA 4XCEB 3L7EB 4QMEA 4BA8A 4PP1D 5EH1A 5KAQF 2N01B 3VYOA 2DAVA 1HEHC 4IBTA 3IDUA 2ZIDA 4GKZA 3I50L 4PUBL 3B1UA 3PQYB 2ZONA 2D9QB 3RPKA 4A6YL 3Q6GL 1E8YA 1B0GA 1G9HA 1R34A 4K71C 4ODSL 2BSBA 4LASH 2ZSVB 1W72A 3S3SA 1CE1H 5SWSB 4OGAC 2JCWA 2DQ6A 4Z5RA 4HEPG 1UCBL 2WWMC 3NCXA 3ASOB 3QGVA 3O2DA 4UOW1 4MMZB 4QOKA 3FQRA 1FC1A 1WT5A 1F3DH 3N1MC 1LWJA 1R0AH 2YBGA 4Z7NF 3UTSD 4JFHE 1WGOA 3U25A 1NOLA 1SBBA 5D7LA 4DN3L 2OP4H 1MHEB 2WMPB 2C1PB 1LO5A 3CZFA 4YZFF 1O5DT 3IKKA 3CG8A 1E5YA 3HCVA 4DVRH 1U8LB 4MNQD 4WI4A 1JXKA 3DI3B 1SFDA 1J11A 4BWWA 2VDQB 2L3BA 4M8UA 5D4HA 1OXYA 2C4XA 3V9CA 2P4AB 3WUWA 4Q97A 2H47C 1JZ3A 5D70H 1DVSA 2V9QA 2YXMA 3AS1A 1L9QA 1OOAA 1WQVT 2VLRA 3EADA 2Z91A 1Q0XL 2ZSWA 3SDAD 4JAMA 3T04D 3R4RA 1JRHI 1H19A 3VI4F 4M8RA 5FM5O 1BOGA 3NRFA 3R18A 4TTGA 1J87A 3O6FC 3AREB 3ARFD 1E7UA 3H42L 1NEPA 4UMSA 3QEGL 5CD5D 2AQQA 2GITA 4A68A 1QI5A 3FBKA 4S2SA 2GC4C 1NL0L 1XF4B 3QDHA 3EKCA 4LOEA 3PUCA 1BIIA 1F18A 4LXFA 5AL8A 4FEMA 1A3RH 5DGQA 5D7JA 2MCG1 1JK9B 1WCQA 2J72A 3KJ6L 1CE6B 4KKBD 2MOQA 3FT2A 3RUGE 3W81A 2JB5H 3VM7A 2E7LC 1BF2A 3ASNB 3H7LA 1UJTA 3WFZA 4NQCB 3MI6A 4WCYL 4WEMB 4RFOL 2EAEA 3P2DA 3UL4A 4FQCL 3KPLB 2C9VA 1ASPA 1IQWH 2XRAL 2Z93A 3V7AG 3SKNB 2K7PA 3OM3B 5HYJE 2Y1ZA 3VXRE 1SYSA 4YSRA 2J5LB 4IQHA 1CGSL 4XB3A 3NSCA 4IJ3C 5DT1L 1MHHA 4G6ML 2WNKA 5I1LB 5AZ2L 3AXHA 2WNWA 2IDCA 3UTTB 5ANHA 4Y5XC 1DQTA 3EJPA 3TCLA 1CDGA 1BQ5A 3MJ6A 5DWPA 3BAKA 4I48A 1K8DA 3AS0A 2R4RL 1CLZH 2APTA 3U4EB 3DSNB 1U8MB 2IG2H 4MCYB 4IMKC 5E8EA 4WNQB 1OE1A 2F9BT 3D0LA 5DA4A 3KDPB 3ZBMA 2MNJB 3S96A 1ZTXL 3V0JA 5FUOH 4P23D 1U8IA 2NY1B 2NNCA 2H32A 4ZFOA 5LLIC 1EXUB 1WAAF 2LU5A 2Y25A 1NC2B 3MPCA 3VG9C 4IOIB 3IJHA 1U2HA 1T3FA 5E1HB 3D0VA 4FP8H 3BYYA 2RALA 5EZIH 3TBBA 1HKLL 3KM1A 3DX7B 1TVDA 1HJBC 3GJFH 5EWIH 1Q9OB 1QATA 4ZSOA 5HGBB 1N6QL 1ZS8B 4HEMA 3LIUA 4U6YA 1MQKH 4I0PA 4H0HB 1CI5A 1WFOA 2BDNH 4B9IA 4LLVB 4F9LC 2BP8A 3PHOA 4RSVA 1EJOL 3VI3F 1EO5A 3K6OA 1UWGL 2VC2B 4L3CA 3VXTA 3LIZL 4CC1A 2VR9A 3UBFA 1VLXA 1N59B 4PGCB 3HNVH 2FGWL 3HR5B 4LCVA 5I74C 5E99H 4XHQA 4XBMA 3A6BL 4I87A 1P5VB 3QUZD 5E4AA 4JBSA 1KYUA 4QRQA 2HKFL 4XCCH 1NFIB 4YSCA 3TVMB 5EOQH 4AQEB 1ADWA 3CFCL 4HPOL 3GMRB 1NCNA 3EFDH 3RKDD 1XF5A 3VGBA 2WUCL 1EA9C 4GXUM 4R4ND 2F7IA 2VLKE 2PTUA 1N8ZA 2XT1B 1T1ZB 4UQ3A 3CHRA 1CI3M 5F7NC 4I85A 3WTXA 4GLRI 1JI2A 4DK6A 5DMGD 2J57A 1JG9A 5FHAH 3IVKA 4AIXA 3MTRA 2Z35A 4AL8H 4OJEH 4K8RC 1KIQA 4EIZC 3AWEA 2EACA 2QSQA 3OKKB 2VRAA 1CFQB 1F56A 3UTSA 5DEZA 1UEYA 4M62L 1HINL 1RIHH 2A38A 3VXQA 2AK1H 5BV7C 4G43B 4RGOH 4V2BA 1B90A 2WLNA 2IPTL 1HESA 4MNQA 3FUNA 4XX5A 1QI3A 4Y8AA 2FK9A 2FIKA 3B5GA 4N9GA 1MG2C 3GK8H 3DJZA 2DL9A 1HHIB 5KVDL 4AMKH 3ESNA 1HN1A 4K9EH 3RUGF 3SDAA 4ZNCD 5SWSD 4JFSA 3ARFA 3D69B 3ZO9A 3QUMH 3TASA 3CZSA 3N41B 4M4RB 3Q8BA 4AYDC 2ZXBA 2VITB 3RA7L 1CFSA 1KJ3L 1NBCA 4FQLH 4RQQA 5DRXB 5E94B 4NIYE 4MBRA 3TNNB 3AXIA 4MS6A 4Y5YA 2IGFH 1LQBC 4FF9A 1KYFA 4JFDA 4OT1L 3EYVB 3HNSL 4Z7VE 1QW8A 4UT6H 2YXVA 1A7PL 2VW6A 1LO2L 2X9XA 3GMNA 2CDFA 1YPZB 4L8BB 1IC5H 1ZMYA 4HUMB 4JFOB 5IB1A 1KIPA 3QI9B 5BOZG 5C0RH 5JHMA 4HT1H 3ARED 3ZXAC 4BE5A 2IPUK 2VXSL 4IBQA 2B08A 4ZXBC 4ZYKB 4BSVA 1RZJL 3UH8A 4HDIB 1JPST 4FQPA 1U95A 4N3TA 5I8CA 5FA4B 5FGBA 3MOQA 4R5VA 4AYEC 1AE6L 2YRBA 3IM1A 4MMYA 1EJ8A 2BNRE 2O61B 3U0WH 2KKQA 4FL4C 5AW9B 3U36A 4YO0B 2HG5A 1ZT7A 2WKGA 4FFZL 4JFYB 4S1DC 2CG9X 2X4QA 2Z8WC 5CKAA 1NFDA 5T5FH 4AEIH 2J2ZB 4ZOBA 4M9OA 5D6DA 2OMXB 3TJHD 4NQCD 3WFEH 5DC2A 4M7ZB 2PPFA 4BRVA 3SE3A 1TVBB 3REVA 4D2NA 1K2DA 3AXLB 3FYIB 3GIZH 5E70A 5BNXD 4FD0A 3I9PA 5I1DA 2JJTA 3ZDZB 3MYJB 2IXQA 4UTBA 1PNCA 2QPFA 5C2BH 4TOYH 3MXWH 4H1LA 5DEFB 7PAZA 3LY6A 3UTTD 4LDLB 3NYKA 2HFGH 2V0AA 3GGWA 1WA2X 3MRDB 2IADB 4ETQA 1FFPA 3LZPA 4IBVA 5FR3A 4L8CA 2OMNA 5J89A 4X6CB 4HOZA 3BT0A 2DIEA 5I0XA 2CGZA 2CGYA 2I60L 5C07B 1XL4A 2YSSA 3N44B 4LP8A 4P46C 1CG9B 2IFFL 3E9TA 1JGUL 4RFEA 4ORGB 4JO4H 2NY1D 3S35L 3ZKND 1KNOB 2XVKA 4R84A 3KEDA 2X4NB 3BKCH 3QUZA 1NC2D 3P3TA 4XI5C 4EVNB 2FWOB 5FYLD 1YEGH 1HYSC 2A6DA 2WXHA 3BWUF 3TPKA 2WO3B 4AWJC 3BVXA 4Y0GA 3OJ2C 4PBDA 1K3ZA 3E1F1 1CICB 2A4CA 4S0SD 1MFBL 1JZ6A 3VDCA 2ROYA 2ADJB 3BX7C 4TQPA 5ID0A 4N5UA 1YYMH 2DICA 5L6YH 2Z8RA 3BPOB 2QSCH 3JZ7A 4K94L 4RA0C 5C8JA 4IKJA 3RRQA 3KPOB 2ZG1A 4RMTA 1N67A 2JJVA 2F0CA 1NCIA 3SGJC 2VZ1A 3HZMA 1WFUA 2R23A 3OZ9H 3T4AC 3VXPA 1UVQA 2JJWA 4U1NB 2IEPA 3FMGL 4XCEA 3SE8H 3L7EA 4A6YB 2F7QA 4HMDA 4D0BB 4DP8X 1WUNT 4TNFA 1USQA 3ILEA 3OXSB 3OGCA 5GQBA 3FU8A 5A7EA 3OGOE 1OSEA 2K3HA 2NZ1A 1NGYB 2VJXA 3PQYA 1AQKL 1BEYH 4M02A 3RLSA 2RR3A 2WAHA 4H0IA 4XAKD 3WELA 1OT2A 2A74B 3BN9D 2ZP8A 5CFAA 1UACL 2JH2A 3G6JA 4JFUA 2ZSVA 3CXFA 3UOAB 3BJLA 5SWSA 4QHMB 3RILA 4PVNA 2H26B 2WLMA 1PAZA 2BNQB 4X6EB 3CJJA 2HYMA 3DJSA 1BEXA 4PS8A 4YHKH 1F90L 4PUBH 5JZ7D 5G4MA 3NA4A 4WVRA 3GZQA 5ILTH 1CXFA 1P4UA 2P80D 3Q6GH 4QNPE 5A2IH 2A9ML 1A7BA 1ADQL 2C1PA 3RZCC 5JORB 2A9AA 2WXQA 5HGHB 5IOPB 1U8LA 4KKPA 3L2NA 3T1WA 5IB4B 1LDSA 1OCWH 8CGTA 3KW7A 5DO2C 1J5IA 2ESVB 1QEWB 2DMKA 2CHNA 4U2ZA 4TUKL 1TSRA 1T83A 1IB5A 2MTPA 2Z4TA 2HJKA 3NJMA 3WMQA 4Q9RH 4ZI8A 4H8UA 3OG6B 4R83A 3AREA 4OB5L 1KPRB 2J8OA 2CO7B 3ARGC 3LRHA 5IHZB 5L2JB 4ZT1A 3MRPB 1CUOA 3QFJE 5SWQB 1XF4A 3MXVL 2C9SA 4N26A 1OM9A 1R46A 3Q2WA 4MD4B 3ZYJA 5FDYA 3NIFB 2VRKA 3E9UA 3SD2A 2L7JA 3IAPA 2IDFA 1JK9A 2OLDA 1B9KA 3OR7B 1AZUA 1CE6A 1FG9C 3GPEA 4ZX6A 1Q0XH 3OJMB 5CUSL 3U9WA 3B8SA 5F7LB 1JGDB 4YDKL 7TAAA 5GZND 1PZBA 3ZSSA 1LEIA 3IBEA 4N5ED 4ECNA 4NQCA 2MQ3A 1N64H 3WKPA 4KMLB 4OCLC 3P77B 5I1GL 4HK3J 5ADOH 3KPLA 1JWSB 2DQUH 1ZGLM 1Z9NA 4U0QB 4WK0B 4MJIE 4AX3A 3QI9D 4KHTL 4FMFA 5GGVH 2Y0SA 3GUTA 1SGKA 3NH7L 2LGNA 3O9WB 1S46A 1ZJAA 5I1LA 3OF6D 3UTTA 3KXFE 4JRWA 2YGPA 3FU0A 5LJYH 2PLTA 3AS3A 1MRDH 3MLYL 4HFWB 4JHAL 3VXMB 4BFKA 5I66A 1FG2B 5I5MA 2DY2A 2LT9A 1I1AB 3M1BB 1SBSH 3U4EA 3DSNA 1U8MA 3D4CA 2VABA 4MCYA 4P5KB 1AJ7L 3ZQXA 5FA3B 4FAAB 1T1XB 2HN7B 4W9GC 1N2RB 4G6MH 1EFXB 3SBWA 3CN2A 4X5XB 2DWXA 1WCBB 2IWKA 2J44A 3O6KL 4ELMB 1EXUA 1I9RL 1NC2A 2DQIH 2X4RB 3POHA 1MJUL 2Y2TA 3V0GA 4CKQA 3JXAA 2CK0L 3QNZB 1Z9MA 3KR3L 2XXFA 1RU9L 2EDMA 4AGNA 1EDYA 2FO4B 3DX7A 3IDYB 1Q9OA 3L13A 2ISDA 3UO8B 5E5LA 3VFOB 4YJZL 1OW0A 5HGBA 3HS9A 3BAXA 1ZS8A 3SYAA 5IMLB 3MRBB 1FNLA 4LCIH 4EPSA 2GPZA 3FN0L 4TF4A 4NN6C 4E9VA 3QRLA 1PBYA 1IAIL 1EK3A 5KUKA 4J6RL 4UNIA 5LBSA 3S0PA 1VGEL 4DGWC 5C07D 1HSBB 2NTSP 5HHME 1N59A 2L7UA 1HKLH 1LYQA 1ZDQA 4PGCA 5JLZB 4JCLA 2DQEH 2DD8L 3HR5A 1M7XA 1EHLH 1J1OL 1H3GA 4LVNC 4HJ1A 2BIHA 4A37A 3VTTA 5TTRA 4DKTA 3GYRA 1NFIA 3ZMEA 2Q8BH 3TVMA 3VGAC 4AQEA 3ARBC 4MA7H 3PL6B 5DUML 3ZDXE 4WI8A 3GSNL 5GPRA 4QNPF 4BK5C 1YY9D 3FT3B 3T2NL 3VXUE 1CICD 3LDBC 1QSFE 4K3JH 1T1ZA 4NP4L 3ZUNC 1A6TB 4U3SA 4AM0Q 3K91A 2QT6A 4P2CG 1NCGA 2WTOA 1QBAA 2P1YA 3AZUA 2GQHA 3OKKA 4QHUB 2K9UA 1CFQA 4Y1AE 1KWKA 1BQHB 2P80A 1OANA 2VDPL 3VE0B 1KEGL 4G43A 2K45A 1KEML 3G5VB 2OMUB 4S0TD 5ANME 1DJYA 5D72L 3Q01A 5F88B 5I66B 2GCYB 1DFBL 2E8ZA 4DGUA 1HHIA 1ZLVH 4ENZA 1F6LL 5BOPA 3V7AE 2HT3D 2PETA 3WMPA 3NTCL 4HW6A 5GGSB 3U9PL 1GC1H 1KIRB 4FYSA 4AVKA 2V9UA 3D69A 4OZGB 2BNQD 4OCXL 4HD5A 3KPRB 2QADC 2XN2A 1MCPL 5FHBL 2VITA 1YEHL 2WLHA 2QSTA 2F7OA 5DRXA 2J1YA 2VDML 3S5YA 5I18H 5E94A 2XI9A 4ZK8A 2QKIC 3TNNA 1CU4L 3CFUA 2QVTA 5C0CE 3EYVA 2J25A 2ALAA 1CGVA 5GZNA 2IFGA 1E9QB 2W95A 4BFFA 4UDUB 3RHWF 4UT9H 2IMNA 1AHMA 2KHAA 2ESVD 4XNXL 4QRUB 1YPZA 2VCOA 4L8BA 3MLSL 4JFOA 1C5DB 1OVZA 5FFGA 3QI9A 3MV11 4PJAE 4TSCL 4ZOCA 3ULSB 3SO5A 4DERA 3T77B 4JZJB 1YAZA 3CH1B 3HHMA 5B1CA 1VSCA 4YDZA 4ZYKA 2W92A 3K72A 4GSDL 2X44D 3RWJB 4HDIA 2I9TB 2V5YA 1TOXA 2H9GB 3HNSH 3OF6A 4ZDHB 5FA4A 3NJIA 2HA1A 4QRPB 4WDIB 1FNGB 4ONGH 12E8L 2LU7A 1LO2H 1JHLL 2O61A 1LWRA 4YO0A 3KL5A 4JFYA 4OCYL 5KVEH 1I7ZB 5TQ2L 2OAAA 2J2ZA 4N3UA 2WXPA 1TO4A 2OMXA 1SOSA 1GTNA 2XKNB 1RZJH 4JO1H 3VGHA 3WNMA 1TVBA 3PHQB 3SDCC 4W81A 3AXLA 1ZLEA 4Z7NB 4Y5VB 1AE6H 1U3HB 4KVCL 1BLIA 2HH0L 3MYJA 3US1A 4FFWC 1X7SA 4K8RL 3S35X 1NGQL 1XR8B 2RCSL 4Y16C 2XPYA 4DHLA 5BXFA 5LVEA 3ALPA 2H41A 1E8XA 2E9BA 2FQGA 2IADA 3MRDA 5BV7L 1SVBA 1WJ3A 4JFFD 4KPHL 4RAHA 3OR6B 5KANI 1I1AD 2Z92B 5T3ZL 2JF1A 3A4EA 3ZDXF 3I9GL 4HHGA 4X6CA 4KNUA 3UO1H 3ALXA 2BVQB 4FNLH 1JK8A 1HCYA 1B3JA 3DGCR 5C07A 1LP9E 3VI4B 3K1DA 1MDAA 3RPBA 4EZJA 3D06A 3RGVB 5F70A 1IBFA 4P49A 1SY6H 3HMXH 1CG9A 4OAWB 4ORGA 1I9JL 1EFXD 1K5NB 1KNOA 1UM5H 4J23A 2WVUA 2PW1B 1RV6X 4FLSA 2DQDH 4EVNA 2FWOA 4MNGA 5F1OB 3R0MA 3VNZA 4G70B 2XG4B 1E6OL 3Q5TA 4JCMA 2YD1A 1O6TA 4FG6D 3LZFL 4P2AA 4HX1B 1VPOL 3GZPA 4WW2C 1CICA 4LLMB 2H0FA 3QRGL 3SPGA 3HI6H 3TT1L 2ADJA 3BUDA 4KO5A 1JCKA 4OD3L 3LEVH 4GB9A 3RWCB 4D94A 3EUDA 5BZDB 1I8LC 1A6UH 4F7PB 3HB3B 1AO7B 3Q0HA 5I8OH 1FYTB 2DM2A 4N0CC 2E46A 2PYEE 2YGOA 2XIBA 4LSPH 4U1NA 5E51A 4A6YA 2VT0A 2AV1B 3MRMB 1INEL 4JFPB 4BZ2A 4OJFL 1ND0B 4Q8BA 2ZOWA 1NLBL 1E3XA 1A0QH 3H55A 3JYCA 3K5SA 3NSYA 3OXSA 3NFSL 1LO4L 2AERT 4GKNB 5ISZE 4OJCA 2BXYA 5DFTA 1MWAH 3N91A 4K94H 4LP4A 2A74A 2M26A 5K93A 2YD4A 3EJYC 4GW5B 4QHMA 1BGXL 5HJGA 2NXZB 1IBDA 3QPQD 4FADA 2BNQA 2W0KA 4PY8I 4X6EA 2IWGA 1EWHA 3NSDA 3BT2L 2ZT9C 3BP7A 1CDJA 1LEGB 2HMIC 4EOWH 2FQDA 4A55A 3WNJA 4PJAF 4KJWC 4XPGH 5JORA 2HFFA 4XVSL 3T8VA 5HGHA 4MAYC 5IOPA 3F83A 2UXGA 3D05A 2W60B 3ZX1A 5G5DB 4LHUB 3A67L 5IB4A 5K9KB 1LO0H 4AIEA 1V7NH 2ESVA 1QEWA 2ZUSA 3GBNL 4JFZH 4KKQA 2HRPH 5DD1H 1U6AH 4DN4L 2Q7AA 3Q05A 1E90A 2W94A 3N0PB 2C8NA 2EYTB 1KPRA 4K3DH 5AEAA 2CO7A 4BRJA 5L88H 5IHZA 5L2JA 3J27A 3KPRD 3L1EA 3MRPA 2DRUA 5SWQA 4OLXH 3RY6C 1XR9B 4MD4A 1OAKL 1MQ8A 4UILH 3GLEA 1SVZA 4KAQL 4GSXA 1QBBA 1RUPL 5F7EL 2F7RA 2FATL 3LXCA 4FQJL 2F08A 3VACA 1A21A 4I7ZC 4PJ9B 3L95A 3OR7A 2EVFA 5CZXD 3WKMH 1AOHA 1RUML 5FO8B 1FLRL 5AW7B 1JGDA 1DJHA 2N0KA 3OLIA 1AS8A 3ZL2A 3ZMNA 3I9AA 3OHMB 5IHUL 4FHKA 4JX0A 2K70A 1UFUA 3HOGA 1RUQH 1UJ3C 1JWSA 4JZOB 4PWIA 5ITBL 2Y22A 3SCMC 4U4IA 3S34L 4N90D 1V3JA 1Z66A 4PJXB 3NQKA 5J6SA 5I71C 2B77A 4XP4L 5EUKB 1FFTB 2TAAA 1LP9F 1EPFA 2L7EA 3LS4L 2Y36H 3CLEH 5IWLC 4YHZH 4MJ5B 4LSTL 4QRPD 4D9QD 2H3KA 4HFWA 4NENB 3VXMA 2YUWA 1FG2A 4JRFA 3CE1A 3PU7A 1I1AA 5C0IB 2K6WA 3L5XH 2GJPA 1S7RB 2X0UA 3M1BA 4MD5B 4MJ4A 4R90L 4MZRA 5HYIA 4MJHA 4XP1L 4OI8A 5IQOA 3IRPX 4WUKL 2Q8AH 1KXVC 4TRPL 4H8VA 4WO0A 5FA3A 3EO9L 1JZ4A 2HN7A 3CDZB 4QD2E 4F80A 1N2RA 1TTCA 2VDOL 4AZ8B 3GSQB 5BMFH 1EFXA 3K8LA 3BIBX 4DPRA 1ZDSA 2HKHH 4X5XA 1WCBA 5CGTA 5EBMB 4ELMA 1QKZL 4YSSA 1N4XL 2X4RA 1JWUB 3O3BB 1KY7A 1U3HD 1T80A 4W1TA 3WFCH 3CH8A 2RTTA 3QNZA 3VXRB 3QYMA 1QG3A 3T2QA 1R5VB 4QYAA 1AS7A 2ZX6A 3BO8B 4PCKA 2FO4A 4TUOB 5SV4A 3VFOA 1KCBA 3LPGA 5IMLA 3MRBA 5LNGA 2FDBP 5IVNA 2OV0A 5DHVB 1ZE3C 3GLDA 3ILQD 4F7MB 1BQKA 3NJNA 5DGRA 2NCEA 5JW3H 1A7NH 5AOMA 4WRLA 1KTRL 1RP9A 3WIIH 2CPCA 1HSBA 1TF4A 3RGVD 3ETBF 4KOBA 1L9RA 4LSSL 3J7HA 4OY9A 5JLZA 1J5CA 3CFDB 3WDIA 3E2HB 4PGZA 4YQXH 3B2XA 2BJML 2AAAA 4N2EA 3BVDB 2E7DA 4BUHA 4HETA 1X9QA 4YSPA 4E9XA 1HHGB 3I84A 1YECH 4OTXL 4H2AA 8PAZA 1GTFA 4KJQC 1CF8H 2ZWLT 5EORL 1ROCA 2E9WA 3TJEH 4ETYA 1IX2A 1HIML 4X0KB 5E2TL 3B9KB 4LCWE 5L4MA 1XGUB 4WW2F 5IJBC 4UV4H 3II1A 1OTTD 1E9PB 3NA9L 4NN5B 4XB8A 3DVGA 4QXGL 4FYRA 4GEJA 2DD8H 1A6TA 2VR6A 2FH8A 2F5AH 2VDPB 3RB7A 4AIZA 4F8PA 1Q72L 1F3DJ 3HB3D 1AO7D 1AFVL 2GJZB 3NIGF 1FYTD 4QHUA 3L9BA 3UIYA 2KQMA 3IMTA 1BQHA 4Q9BA 4B9CA 3S4SG 1CBVL 3FT9A 3GSNH 5FKAB 3V4UH 5KYWB 5IJVB 2X2IA 3HIZA 3CHXA 3G5VA 2OMUA 4AYFB 1JZDC 5DEGB 2E9JA 3QZWA 2UZIL 4Y5XB 3S2AA 1G9NC 1E4HA 2EDLA 5F88A 5FW8A 4N1EA 1JTOA 3FXIC 5HI4C 1OPGL 2GCYA 3MOBL 1MVYA 1OK0A 2EEXA 3NPSC 2CXGA 5LKNA 3BI9X 3DX0A 3K46A 1C5CL 3MFFB 2VLKB 3ROLB 4E9WA 1WFMA 2OJZH 3KPMB 5DD0L 5GGSA 4PGJA 3ZPDA 2XZCH 5HI3C 3MRLB 2QHLA 1XSJA 2Y23A 3OKDB 3KPRA 4D0DB 1OHZA 4LRIA 4PIBA 1AGCB 2F2HA 1AMYA 5IUCA 2Z8SA 5E95B 3ZSTA 3STZB 1OO2A 2VDKB 1KCUH 1WEJL 3GBML 3BLBA 5DO8A 4XN4A 3KYOB 2D2CC 3NTCH 1RY7B 4J3XA 2C3WA 1OP9A 4AW4A 4LHUD 1E9QA 3DTXB 3IU4L 4HKXB 1KWGA 1UOLA 4K5NA 4UDUA 3MV9E 4QRUA 5FHBH 5BVPH 3CD4A 1V27A 5BO0D 2XTSA 3RTQB 1C5DA 1YEDB 2NT1A 2EDEA 1GS6X 3MV7E 2JB6B 3V95A 1IGIH 3ULSA 3MLVH 1P9MC 3LD8B 3T77A 3CH1A 4X4MA 3NJLA 5I74B 1CU4H 2G60L 2ICWJ 3BPNC 3OBAA 3WS3B 5C0GB 3QUXC 3RWJA 4M6OL 1ICTA 2H9GA 4NWTL 1WBZA 3IE4A 4FFZA 5F0PB 1B0IA 3OLEA 4QRPA 5DI8B 4WDIA 1FNGA 3BWSA 5EOCJ 1UOVA 5L9DL 4Z6AT 1DJWA 4MWFB 4A2DA 4M3KB 3WFHB 4JFHD 3ZHLA 2VQ1B 4PJ9D 3V6ZB 3RY4A 5I1IH 3IFLH 1I7ZA 1U8CB 3STBA 5HHQB 35C8L 1TLMA 1TU2B 1N6UA 2ZXAA 4Z7VB 2D03L 3EJCA 5F7HA 3DUSB 3EGXA 2O5XH 2XKNA 1H0DB 3AFLA 2AJZA 1RJYB 2O72A 1YEKL 4TSBL 4Y5VA 4G6AC 1U3HA 3B3BA 2CM5A 3SYOA 4DEUA 5I28A 3GS7A 2BCKB 4F8NA 2I26N 3VFMB 4L18A 4X7TA 4FLQA 1AGEB 5CP3H 3RG1C 1WDAA 1ZXKA 1ACXA 4JRLA 4OCYH 2BX5A 2IBZY 4OVUA 3O0RL 3MVSA 4QIRA 5ABAA 1YJDH 4Z7IA 5A2JH 3OR6A 3E6FA 4BZ1A 3FUDA 2BNRB 2F18A 2Z92A 3U1QA 3UGXA 2BVQA 3VI4A 3FZUC 3SSGA 4AMWA 4M6NH 4KQ3H 4OGAD 1S7XB 1BQRA 3OJVC 3RGVA 3FUIA 2WWMD 4NO2B 2E3VA 4OAWA 5CLZA 1K5NA 2EE0A 4F27A 2PW1A 1J0HA 1FVEB 5A7BA 1UWXH 4ZQKB 2XG4A 3LS5H 2Q3XA 5HYJD 3DGDA 1G1OA 4PHXA 3VXRD 2R69L 4HX1A 3BUTA 1QBMH 4NO5B 5T3ZH 3LHAA 4AGPA 4DUWA 5J1TC 2JJSA 1EEUA 4JY4B 4NFBA 3QYCA 4CGTA 4LLMA 2VN5A 2IV8A 3UYRL 3NAAH 4OFKA 1GGUA 4G8GE 2JCCE 3DDGA 1RP8A 3RWCA 4LK4A 2ZCKL 1AZCA 1LJMA 5L7XH 5BZDA 5DHEA 5E00A 1SXZA 4F7PA 1OGTB 1AO7A 1EV2E 32C2B 4YHOH 4Q56A 4XP9L 1FYTA 1QZNA 4PSRA 1PEZA 3WDJA 4BFJA 3WI9A 2ODHA 3QNYB 3NJJA 4FCHA 4QEGA 4F2EA 2AV1A 4AYMC 4JFPA 1ND0A 2D3NA 5TD4A 4G6KL 2CDEB 3ZHKA 2NZ9C 1ORSB 4Z76B 3GLAA 1T1YB 3FK3A 3HN3A 2BS8A 4GKNA 2CMRL 6FABH 4FDWA 2HLFD 3K81A 1NDMA 5F3HB 4AQZA 4LLWA 3NK4A 4RMQA 4TL5A 5INCB 3Q9QA 5FM5M 1O75A 2X53A 3ZTNL 3CLFH 4OI7A 3ECBB 1QHQA 4XXWC 5HJBA 4F37F 3WTVA 4GW5A 1NFKA 1FL5B 4YXLL 2G2RA 3D2UB 4H5SB 3TIDB 1EAJA 5FO7B 2W9EH 1INEH 2VE6B 4PCTA 4QAWA 4N2NA 1BAFL 1F58H 1WAAA 4X6FB 2ZKHH 5H94B 1LEGA 5IROD 4RGMC 3FAWA 1MHPH 3B7TA 3GNMH 2XZQH 5LCVH 4XN8A 4XN9A 3X17A 3WE6B 3GXUB 2OS7A 1CK0L 3AQYA 3K3QA 2W60A 3RVTC 3TL5A 5G5DA 4LHUA 3QCUH 4NQQA 4ANVA 1JF5A 3UJTL 1CDCA 2OTUB 5K9KA 2LAAA 4NCC1 2G3NA 3ATAA 2NQCA 1FHGA 3GRWH 4K0OA 1G87A 2VLKD 4AYSA 4HOWA 5T1JA 4EE2A 2EYTA 4P46B 5DF0A 4YHML 2NY3C 3TJPA 3VFTB 3MLTB 2BS71 2VSCA 3IDXH 2VW4A 4ZODA 4YIQB 4ZS6D 5EOTB 5L8LB 4IRZL 1SLUA 1XR9A 1X6LA 2O26U 4ZMQA 5I30L 3CV5A 4QTHB 4W4OA 4DEWA 1TZGH 2XWJB 3H85A 4PJ9A 3SDYH 5J9PB 1TSHA 2JELH 3OMIB 5FO8A 1XGQB 2TRYA 1BD2E 1KZQA 2A3TA 3TA4D 3QDAA 4HYTB 1LTXA 4FQ2L 3J07A 4XRCB 3NJKA 1NCTA 2QZ5A 3QNXB 2DEXX 4JZOA 3V0VB 2NY6B 4PB0L 4BK4A 1OAKH 4RZKA 1ZD6A 3T4AB 3L3GA 4POZD 1CYGA 3BIAX 3TF4A 5EUKA 3P73B 5L4IA 1JVOA 1ZHNB 2EEBA 2DQMA 5F21B 5T3XE 1K8IB 1A4CA 3ZKXB 1TG8A 4MJ5A 5JPNC 2FB4H 3B2VL 4NENA 5DURB 1IFRA 2XYCA 2AF2A 4NCDA 1O9VA 4NBZB 1PD1A 3L54A 4KJPD 5C0IA 1S7RA 3F7PC 5C0NC 3DVNB 4G8FB 3RUGA 5EBLB 3H54A 1S7WB 2QQLL 3BPLC 3Q2NA 1FQ9C 3D52A 3MGAA 2OMTB 1NM4A 3CDZA 4MXWL 2DQFB 3LS4H 1KGXA 4AZ8A 3GSQA 3AW5A 2JCCF 4K8RD 5EBMA 3V5HB 3S37X 1QUPA 1FNSL 2GTZB 1TETH 1JWUA 2WXLA 3O3BA 4IDJH 5E8OB 1KN2H 4BHUI 5HYJA 2VJ0A 3VXRA 1R5VA 1HHJB 3BO8A 4ICWA 4TUOA 1AKJB 1L4IA 2ZJSH 5MP6H 4TRPH 4W9CC 3FTSA 5TE7L 5H35B 4Y9GA 3KXFB 3C87A 2OMWA 3NGBC 2XIDA 5DHVA 2G0LA 4W9LC 3Q1EA 3US9A 4F7MA 2BNRD 1BHGA 5D8JH 3GWJA 1XF1A 3UC0L 1LO3L 3MBEC 2VDNL 5IFJB 3U46B 4M93B 3U7YL 2BSDA 3CFDA 3WNPA 2ZUQC 4O2FB 3UG3A 5DUJA 3GQFA 2HUHA 1QRNE 3CUPB 1JPFB 2AQ1A 3HPJB 2MCPL 3IS0X 1HHGA 3LEXB 4PWGA 4FI6A 1THAA 3BWZA 3L3KB 4MJ2A 1S5HB 2BLFA 4LVHB 4ZUUB 2ZX8A 4X0KA 1U8JB 2E7LA 5FYJH 1DVFB 5SX4I 4X5QA 2ENQA 1OAXL 3X1GA 1D2OA 1E9PA 4N1HB 1NTDA 1MCDA 2MHAB 5E6YA 4BQ8A 3M7FB 1IGFH 4QGTA 4XMUA 4HCRL 3U48A 4CJ0A 2H6UA 2GJZA 2V8MA 1SOKA 2YK1L 4HIQA 5IROA 5FWRA 3CU7A 5HHMB 4ZXBD 5FKAA 4P05A 3FO2B 4ANWA 5KYWA 1QP1A 2P3YA 3ZYZA 1XMEB 4AYFA 5DEGA 4X7FC 1F6FB 3PYCA 2OR7A 4Y5XA 5CJ8A 4EIUA 2OR9L 5DJDA 3U9UB 1OTSD 4L4VD 4NZUL 1NMBL 4NOBA 1DQQA 3ZDXB 5DQDH 2ICEC 3FFCE 4S1DD 4IMKA 3MFFA 2VLKA 3ROLA 3VXUB 2L8AA 3WS6C 1SDDA 1OARH 4Y2DB 1PG7L 4KDWA 3OPZH 3D2UD 1BFVL 4CU7A 1RZKC 1GYCA 1IBBA 2EKSA 2FJHA 3C5ZB 3OKDA 2VJ8A 4ZFQA 3V52L 1KGWA 4D0DA 1WWBX 2OI9C 2XLLA 4W9JC 1R24B 5GJSL 3A24A 5C0BE 3SZ6A 1XCTB 5T1KB 3MLRL 1Q1PA 1TZIB 3MOBH 5DJZB 5C71A 2ZCLH 4OLEA 1EANA 4HJIA 4Y1AB 2CCWA 4YHLH 3X1BA 5JDJA 3T1FA 1TO5A 3WTSA 4IKIA 3ELQA 2PR4H 1H9DA 2P9RA 1RUKH 3P30L 5DD0H 3KYOA 3GXDA 4JY6B 3AAZB 3OXRB 3DTXA 1C8QA 4HKXA 1GY1A 1ZHBB 2JI2A 3GSOB 2K4AA 3WXVL 4F9LA 1NANH 2EC9T 1BM7A 3APFA 3DETC 2VZUA 3MO1B 3S9DB 2APVA 5IT2L 1YEDA 3BZEA 2JB6A 4AGMA 4MD0B 4P46D 2E6PA 1OPOA 4OLZH 4UNTA 1WZMA 5C0GA 1ZOXA 4LVNB 1C7TA 2JLLA 1IGML 2DTSA 4XI5D 4APQC 2XZAL 3EGSB 5DI8A 1HYSD 3KGUA 4PJ7E 1JNNH 3HS0C 4MWFA 4FFYL 3WFHA 1ODAA 2VQ1A 3GS4A 3W38A 1EZVX 3V6ZA 2XCMC 4K7PH 5FB8B 4KH2A 1U8CA 4KY2A 2QL1A 3AACA 1TU2A 5HHQA 3N55A 4I77H 4WWKC 4Z7VA 2JMRA 3DUSA 2XV0A 1C5BH 2OPCA 4AXWB 3W5MA 1WH0A 2YSTA 1H0DA 2AQNA 2CU9A 5AKSA 4NT6B 4RWYH 1RJYA 4BUQA 2NY6D 1JPEA 4UAOB 3F5WB 5L9DH 1JVKA 3MROB 3AQXA 3MJ9A 2BCKA 4PJAB 3VFMA 1AGEA 4O2EB 1KBBA 2MCAA 3V6FB 1M1SA 3QORC 1KTDB 2HTKD 1K6QL 3QFJD 1TKWB 3ILPB 3PRZA 1EMTL 1W15A 1O5PA 3OAYH 5DURD 3ZMRA 5DMKB 4X80L 3L3IB 3A21A 3ORJA 3VUAA 2BNRA 1WWAX 1G9NL 1OZTG 5FWQA 1KGCE 2XV3A 4P9MH 3BGFB 3ROOA 2G0KA 4PW3A 3V0WL 1S7XA 5DJCB 2DI7A 2XYBA 1TCMA 1U8QB 4XC3L 4NO2A 3AC0A 4Z9KB 1J1PL 3BISA 3EDDA 4YC2C 5F93C 1URZA 4PVLA 4ELDA 2ITDB 5PAZA 5EB9A 1FVEA 3ISYA 1BMWA 4XC1H 3JV6A 5HVWA 3QUMB 4GKSB 4IBSA 4JVUA 2C9PA 4MJID 4MKTA 4ZQKA 4YFEA 1KCSL 4H44C 4JS7A 4N8CH 5B3JE 2OK0L 3O4LD 4NO5A 4IHOB 4XTRC 3RZCD 1KELL 3NCYP 1AKJD 1H3UA 4JY4A 3N3EA 2A4EA 1MREL 5FW7A 1S9YB 3KXFD 2LOEA 3KM2A 1MCWM 5JHAA 3NEXA 1PY9A 3P3RA 1KB5H 1ZVNA 5AVVB 1A1MA 1KB9J 2MWCA 1YEIH 2BSSB 1OGTA 3G6AA 3MRQB 1Y18B 2NXYC 32C2A 2MQGA 2EVIA 3DK2A 3K8KA 2WB7A 2MQ0A 1MCFA 2R2CA 1EEYB 3QNYA 1LP9B 4LSUH 3LN5B 3H6AA 5I73C 4O02L 3ARGD 4ZXBA 2VXQL 2YLKA 2LW3A 1AG6A 3WIHA 3VMNA 2DZEA 1U2YA 1V55B 1CJYA 3K6FA 4GRMB 3FL7A 2CDEA 1BA9A 1ORSA 2VLME 4Z76A 1T1YA 1FSKB 3MRKB 3VYNA 1CGWA 1UZGA 4OLUH 3IN0A 3MAWA 3KH4A 5F3HA 3WU1A 2KL6A 5INCA 3H8NA 3GMLB 2H1PH 2W65B 3ECBA 3G04B 4A63A 1FL5A 1QTYT 1JI1A 4JPSA 3DOHA 3D2UA 3PJNA 2AQPA 2YARA 4H5SA 4N8VG 5FO7A 3TIDA 3B2DC 2VE6A 4YDIL 3ERXA 3UZVB 3TBSB 4X6FA 1NLDH 3N1GC 5FV1L 1JJUA 4HISA 5H94A 1YEJH 1DVUA 2WZ5A 4OCRH 2PYEB 2GC7C 3QQXA 2M1KA 1YYCA 2BVEA 2E7HA 2MPAH 4Y16B 1NCUA 5ESAB 1MFAL 3WE6A 4XH2B 5JW4N 5DS2A 4TNVK 1Q9KB 1JWMB 4TQIA 4XXDB 1CO1A 2R4SL 3N40F 3RAJH 3W39B 2H2PD 1B2WL 4KK5C 4JFEE 1I82A 3EDEA 4NO0D 3DSFH 1CR9L 2OTUA 4HZLB 5FOJA 5ISZB 4XCFL 4PJ7F 3ASWA 1JHKH 2QV2A 5DVKA 1RD6A 3QR0A 3VXUD 3L4YA 5C3LD 1QSFD 4YBLB 1OY3B 2B4CC 5LG6A 1X4ZA 4P46A 3VFTA 5MI0C 2ZX7A 3A5VA 2ZICA 3MLTA 3OD3A 3C5ZD 4L5FH 4YIQA 3WTUA 2BRRH 3D50A 4KKNA 3LMJL 4QTHA 4Y1AD 1JTPA 2XWJA 4AKQA 2WJ5A 5K5YA 2GFBB 3QJVB 4WW2B 5J9PA 4E9SA 1XGQA 3AITA 4JM2C 1J8KA 4JZNB 1XQ4A 2QLYA 2OMBA 5I1KH 1ZK9A 1LXMA 2G30A 2H2SD 4NNXA 1IM3B 4GRWH 2ZYSA 4Z1PA 5DEJA 5KZCB 8FABB 4E42B 3LNGA 3QNXA 3V0VA 5D71L 1I8IB 2N7BA 3MRNB 2M2DA 4KTEL 3T4AA 2WBJC 4PWHA 3L4WA 3P73A 3L4VA 1ZHNA 1A4AA 1A65A 3MRRB 4Q89A 1K8IA 2YKLL 1AZBA 3QFJA 3G3LA 4MQXC 3ARBD 4F7KA 2YAQA 2B39A 3RL2B 4B95C 4PHZA 1MCOL 5JW4R 5B3JF 1M6OB 4B9GA 3DVNA 5EIVA 4EN3C 4GIOA 3JWOC 4TVSa 1S7WA 1R5IB 2YHGA 1PZ2A 4JEGB 5CNHA 5C0CD 4JL2A 2OMTA 4CGUB 2LHAA 3VRJB 2A0LD 4RBPH 1AD9B 1SXNA 5KYUB 2DM4A 4HIXL 3V5HA 3CX5K 4LCYB 5B8CC 1NUDA 2GTZA 4APXA 3QNFA 4BYHA 5E8OA 1PZUB 1NC4D 4MJIA 3KGRA 3UYPB 3RZCA 2GI0A 1HHJA 1J48A 2FBJH 2NSMA 1GGIH 1AKJA 3CFBB 4MAYB 4XBEL 4HGWB 5TE6L 3R1GH 5CP7B 4AQOA 3RNKB 5H35A 3DJ9A 3VFWB 3KXFA 1YHPA 1G7HB 2DDQH 2VDNB 3PJSB 4BK8A 4LARL 3EDKA 4MRCA 5AW8B 2EDJA 1T03H 2VR8A 3MQIA 1S3KH 1WYJA 2FX7H 4FYQA 4MMXB 1BWMA 1IC1A 2JLPA 1VFUA 4HP5A 3BKJL 3V10A 2B1HH 1RERA 5FOBB 2ZTBA 3L3OB 2ATKB 3GXTA 2HPOA 3QIUC 5F96L 2WQVA 4KDTC 1TT6A 5C0EB 5IFJA 3U46A 1H3TA 2CBOA 4BV1A 4RGNB 2DQTL 4O2FA 1MLCB 1UH4A 3T0DA 2R0ZH 4Q6IC 3CUPA 1H6UA 1JPFA 3DX8B 2WGNB 5HI5C 3HPJA 5LXGH 7FABH 3HUJE 3L3KA 4J3OG 4MB1A 1MIEH 3ZRSA 1S5HA 4JG0L 4P2QE 2OR8A 5DSCB 4B0MB 4CC4A 1S7UB 3OWEA 3MLWH 3QUYB 1U8JA 5A6LA 4V11A 2WXFA 3QWNA 4HSQA 2VISB 1WZKA 5I0YA 3GSVB 4HEPA 4DZ8B 3O4OB 3P9MB 2MHAA 4NRZB 5I6PA 1JNJA 1JPSL 3PFQA 2Q86B 1NCDL 1VCAA 4JO5A 2QZQA 3O8XC 3CFKB 5DJ8A 2VW7A 5BOJA 1XH2A 1BVLB 1PG7X 2UUDK 4UUJB 1AHWB 2FSEB 2ENSA 4KX7A 4HUUB 1CPUA 1F4YL 2R0KH 5FF6B 3FO2A 5F6IC 4FQIL 3W9EA 1QPKA 1PYWB 3DOSA 5D2NE 4B6ZA 4PPTA 4M5YL 3IFNL 2WSKA 4NO0A 2ZWSA 1KJMB 3U9UA 3U4AA 2ERJB 2EXYC 3AU1B 3BFOA 2XNAB 4P59H 3VU1A 3WNOA 3CSPA 1IAKB 2Y7LA 4LCWB 4NKIH 2K8QA 1IC4L 3VXUA 1L9PA 1QSFA 4NGHH 1AMXA 2ZKWA 5GSRB 1INQB 4KHXH 1UYWL 1PPIA 3C5ZA 3BUYB 4J3OH 5E2UH 3SDCD 1TNMA 1R24A 2H4EA 1XCTA 2EILB 2YD3A 5T1KA 2IPKB 1X5MA 4KVNH 2GK0B 1TZIA 1NUGA 4XOCA 5DJZA 1CXKA 1G0DA 4FFWD 2PYED 4Y1AA 4BINA 1NGWB 4FMKA 2CBPA 3WKQA 1TQUA 4Y16D 1WZLA 2APSA 2QVKA 3LN9A 4BFIB 1VESA 3V0EA 1B3IA 3DURB 1QBLH 4KZ0A 2J8UF 5ANMA 1M9WA 2XA8H 2AEQH 4JY6A 4PBVC 1MF2H 2CWRA 3AAZA 5D7SL 1ZHBA 3GSOA 1T04B 3V52H 5ISZD 1T89C 3HEIB 3MCKB 3MO1A 3WJMB 2F5BH 3EH4B 4MD0A 1DLFH 4LLUB 4LEEA 4A7GA 4CSSA 2BFVL 2CSPA 2EDKA 1COBA 3AG4B 2BWQA 3LRKA 3QB7C 4MDJB 3WLWC 4TNWK 3CSBA 4JDTH 4NPKA 3EGSA 3ARBA 3PPEA 1NZRA 1YNLL 2WVTA 4AQAB 5E5UB 4BK5A 5IBLD 5E4OA 2X3CA 4YL4A 3QZPA 4JM2F 4ZD3H 4I1RA 4HBCH 5C0CA 3O3UN 3KZ8A 4AXWA 3MODH 4KZEL 2V17L 1QW9A 4U1KB 5KZCD 4NT6A 4LNVA 3MV9B 2W9DL 2G2PA 1WISA 4KK9C 1DZBA 1TYEB 3MROA 1XMWA 2XVLA 2EUXA 3MV7B 1MCLA 4PJAA 4ZO7A 2ZWZA 5C6TL 2H3XC 4HXBL 2QFPA 3V0AC 3V6FA 2CHZA 1MRFH 4R7VA 4DGIH 5MEQB 1KTDA 4LQFL 1TKWA 4FNSA 3ILPA 1EUTA 5SWZE 4N2OA 3SGDI 4BUGA 3S8FB 5DMKA 4JANB 3L3IA 4PW4A 1E5UI 3HUJF 3TESA 4KXZH 1OHQA 3BFQG 3GDBA 2R2BA 1A9BB 3FSOA 4YSOA 5DJCA 1AXTH 1U8QA 1IMHC 1H3XA 2VTFA 3BD4A 4NRXB 1MEXH 1KCRL 25C8L 2EZ0D 5DZJA 1WE5A 3V79C 1IBGL 3E38A 2ITDA 2HMID 2BSCA 4L4JA 1DTUA 3QUMA 4GKSA 1RZKL 3ZL4L 2YEZA 2UZXB 4UT7L 4XPFL 1R33A 4DQAA 3BP6B 3NJHA 3BEWB 4IHOA 1G9NH 1UKSA 4NJAL 1RSFA 5FYKE 4MAYD 4BE6A 4PBWD 1G0XA 1S9YA 4NM8L 3AJ7A 4HAGA 2B59B 2X3BA 4O02B 3PDGA 2D3JA 1N10A 2XN9D 1A3ZA 4FMVA 5AB9A 2BSSA 3MRQA 1FVDB 1BPVA 3P4LA 2VN3A 4L23A 3IDGB 4DKEL 4QTFA 4MCMA 3OL2A 1EEYA 4ZRGA 1LP9A 2YPVL 1I4FB 3LN5A 4LPCA 1WS7A 2CLVB 3LHPH 1B4TA 3BPNB 2B0SH 2VXUH 3M17A 4I3GA 2P5EE 1OD9A 4CVZB 2JK5A 4RFNB 1J9TA 2QR0B 1XBDA 1B4LA 3TBYB 3A6CL 3C6LC 5IBTL 4P3DB 3MRKA 3ARZA 1CS6A 2DKSA 1BVOA 3PXHA 2HLEB 5AWNH 2GT9B 3GMLA 2Z4QB 3QUYD 2W65A 4LT7A 4UQ2A 4PY7B 2MTAA 3FB5B 2ZCHL 1XIWC 3G04A 5I1HL 5E08H 2D31B 3MFGB 3GRGA 3TBVB 4OV5A 3O6MH 4G8GB 4M48H 1XH0A 2JCCB 1RULH 1DVZA 1M2VB 2UV3A 3TBSA 3UTQB 4X9IA 4BEIA 1FAIH 3HFFA 1Z9OA 3GMPB 3BQUB 3CNKA 2PYEA 4DEPC 2BP3A 4Y16A 4ZTOL 5ESAA 3HG5A 4GP8B 4XVJL 1Q9KA 1JWMA 2HT4C 4H0LC 4K07A 4N0YL 4PIRF 4XXDA 5FCUH 1E7VA 3VA6A 3O0LA 3W39A 4GG8B 3N0AA 3QXVA 2MRYA 4HZLA 5ISZA 3ATFA 4YDIH 4NI6A 3P2TA 2R8SL 1J0IA 4IRZA 3BVTA 2EUWA 1QFUH 1DN0B 1MCQA 4AGLA 3FO0H 1WIUA 3G9VA 3EH3B 4EEEA 5DUBB 3QRFM 2X4SB 3IMWA 3VWKB 1HU8A 3O2VH 4HS6A 2EECA 5ALBH 4Z7OE 2AJSL 1L0PA 1MCRA 3SO3B 3L7FB 1SJXA 2GFBA 3X1NA 4AW7A 4WW2A 1ZANL 1W6LA 3TWCL 2DQCL 4LFHD 2A1WL 4OVVA 5MEOB 4P9HH 3TU6A 4JZNA 3ZE1E 5ADPL 4XPAL 4CKVX 1X5AA 3CTTA 4JQVC 2P5WE 1IM3A 1I8LA 1MPAL 1PZ5B 3B7YA 2GHZA 2QGDA 3PP4H 4IIQB 4DGVL 1CLCA 8FABA 4E42A 4XPTL 4G2AA 1I8IA 4Q14A 4YX2H 4KQ4L 3FCBA 3MRNA 1NMCB 3ZVVA 1E6JL 1K5WA 1OB0A 3QG7H 1NFAA 1R1CA 3CFMA 1MZYA 1JUFB 3MRRA 2HTLC 1OWRM 4M1GL 5T1LD 4WW1B 4X50A 1XFPA 3Q6FB 1QLEL 2JQAA 4KJQD 3RL2A 3RX9A 4FLRA 1Z5HA 1GSKA 4XBPB 5L2KD 4NJ9L 2CUAA 3VG0H 1NIBA 2VXTL 1ZWIB 4K3EH 4LO9A 1M6OA 4TQEL 1OSPL 4RMWA 1R5IA 2FO8A 3UG4A 4A04A 2DN7A 3BVVA 1BD2B 1MWAB 1S6NA 3ULVC 1DR9A 2IDSA 3VRJA 3CDYA 4FNPA 3CZGA 3TTYA 1AD9A 1FJ1A 4LHQB 2YN5A 3D30A 4DIXA 5CILH 2FEEI 2O6DA 3MV9D 1HAWA 2J4WL 2YD6A 3GT6A 4L5FE 2XN1A 3OB0H 2GBAA 3MV7D 2X6VA 3UYPA 1P7HL 4LOVA 1A8ZA 3CFBA 4PW9A 4MAYA 2OZ4L 4HGWA 3IWVA 5CP7A 3FOLB 4X5RA 5IREA 1A14H 1TMQA 3RNKA 3VFWA 4JN1H 1G7HA 1IAMA 3QISA 3PJSA 3K6DA 4EXKA 3MBXL 3SYQA 4DPBX 1N26A 4L3EE 4MMXA 3UP6A 4HVBA 4PG9B 4OIIL 3U30B 5FOBA 5D5ME 5C0EA 1A7QL 2MKLC 2YMOA 5TF1L 1QFOA 5DD3L 5GS1C 1CMOA 4GMTH 4XBEH 5TE6H 1MLCA 3RY6A 5JXAL 4QXVA 4F3FA 1FGVL 2B4CL 4Z7UE 1L6XA 3DX8A 3WFDL 1JD7A 3HPLB 4Z3GA 1UZ8B 3DX9B 3GKWL 5IBUG 1S7UA 3PAYA 3QUYA 2BVTA 4PJ8B 4HCRA 4L0YA 2VISA 1A6AB 4PJCE 3P9MA 4QJ3B 4C55A 3H3PL 2CJUL 1D5MB 3SZKC 2Q86A 2F8VA 4QT5B 4NX0A 3O41B 4PRHE 2JVUA 3SKUD 4E9TA 3CFKA 4ZMTA 5DWUL 1BVLA 1GYVA 3AT8A 3HI5L 4UUJA 1AHWA 2FSEA 3FTYA 4HUUA 1PLGH 3F2LA 5FF6A 3WO3B 2Y5QA 5D7JC 2IAMC 3X13B 3EH2A 5IWLA 4O58L 4Q0XH 1IFGA 4AV0A 5JHLH 1ZLDA 2ZOLB 3B5TA 3CVIL 1L9MA 1FO0L 1QRNB 1P6WA 4OCSH 4OLVH 1JGLL 4LDCA 1KJMA 1WZ1L 4H8HA 3AU1A 4PJBE 2XVGA 2XNAA 2NRDA 3BUBA 1WA1X 3ZZ1A 4Z7OF 3AGVA 3ARVA 1CLOL 1IAKA 4LCWA 4LLYB 5TE4L 4G5ZH 4R4FH 1I8MA 1WGVA 3O45B 1E27B 3QO1B 5I1JH 1MN4A 1INQA 4G8GD 5GSRA 3ZE1F 2WO2B 3BUYA 5ACMA 1J10A 2D7TL 3JWOL 4HWUA 5E7BA 3TH3T 2EDBA 5EHFA 3DTUB 4AY0A 1AI1H 4I3RL 2WO4A 2GK0A 1N3NB 3KYNA 3BQUD 4PP2B 4MDIB 5KYNA 1NGWA 2EH8H 2ADFL 4XNMB 4M7JL 4BFIA 1IC4H 1YA5A 1KDJA 5GRUL 3DURA 5IW1B 2YPKB 3ARRA 2Q7NA 3GRBA 4Z77B 5CN3A 1MCIA 4I2XE 1R3LB 4HUKB 5MHSD 1DBAL 1NINA 1OB1B 2X05A 1BOYA 2WLKA 2COVD 4WO4B 3MCKA 3FFCB 1QR4A 3WJMA 2GBVA 3FUKA 1YMHB 1VACB 3IJSB 4LLUA 4P4KB 2HT2C 3QJRB 5ICYB 1L3NA 1SF5A 1MY5A 3DECA 4L3AA 4MDJA 5T1LA 5J11C 5C0BB 3MREB 1DUZB 1FPTL 5A2LH 4I0PC 2PWDA 3SGKC 3BZDA 4AQAA 4J2XA 2BVUA 2VOTA 1OP3H 3K2IA 5IHHA 2WXOA 2OQJA 2PO6B 2XC8A 1SEBB 1U58B 3VD3A 1IARB 2B9BA 3KCWA 4U1KA 3G5YA 5FYJU 1HL9A 3MV9A 3CVCA 1SOQA 2ATPB 2PP8A 3QIBB 3SD5A 3TN0B 4F15B 5D5MF 3MV7A 3RE0A 3JBG7 4Q9QL 1CTMA 4R2GB 1LHZA 4CSTA 5MEQA 3RVVD 2DJSA 3MSPA 1TQTA 4LSVL 1ERNA 2NZ9D 2X4UB 5DRZB 4XXCC 4U6HB 1MH5B 4Z7UF 4KZEH 1L6ZA 2AITA 1XAUA 3JTSB 4K73A 1GAFL 4JANA 4PJ7B 4S1SL 5GISH 1DQVA 3QEQB 2BERA 1CN4A 4JO2L 1A9BA 2QPUA 2EUVA 4NQVB 2R39A 3ULUH 4J3TA 1BD2D 2AABH 3IFPB 4OJAA 3ULVF 4NZFA 5HPOA 4NRXA 3WXWL 1KGUA 1MFEH 3MLXH 3UTZB 3MRIB 1BQLL 3REWB 4Z23A 4QHKJ 4F57L 1LNUB 1ES0B 1KPUB 3AM8A 1RCYA 4HJJL 4DJMA 4FE9A 1BFTA 1PSKL 2D7PA 2UZXA 3LH2L 3NT0A 5LBVA 3BP6A 4Z0BL 4CBZA 3M8OL 4HIEB 2V5MA 4W9IC 2ORBH 1I7UB 5T3XD 3SDAC 4J5VA 4F20A 1OGPA 1E42A 3QR2A 5ENWB 4JLRB 3ARFC 2A9NL 4LRNL 4GXVH 1OAZL 2B59A 4O02A 4GKLA 2VXQA 3T4YB 1NH6A 1IAIM 4LCUB 1TQWA 2NY5C 5EU7C 4PJBF 3U6XA 3IPFA 3ZL4H 3IDGA 3VGDA 4GS7C 3BAEL 4PS7A 1YYLL 5D7IE 4G8IB 1U0QA 3CVHL 1P9MA 1I4FA 3ARDB 3S4SB 1J0JA 4RSYA 5CCKH 3IXAB 3NVQA 2CLVA 3ZW3A 3THMH 1RZ7H 3EJZD 1RZFH 3N1FC 3UAFA 4EQ2A 1TTFA 4Y5YC 4CVZA 5B39G 2QR0A 1Y6MR 4X99B 2IH1B 4QXUL 3TBYA 4P3DA 4ODWB 4IIZA 4POYA 4NHCH 5DJ0B 5PCYA 4BQCA 3KJ4C 4XAWH 1UD8A 2O5ZH 3N1QC 5BQDA 2JXMB 2GT9A 2HB0A 2Z4QA 3KBPA 4PJ8D 4PY7A 2IDUA 1I85C 1CBJA 5IKCB 1TQBB 3FB5A 1IEHA 2D31A 1D2PA 3TBVA 2GTQA 4OU3A 2Q1EA 4G8GA 3NCWA 2JCCA 4NO3B 1M2VA 1BV8A 3OHXB 4K2UH 4P2OB 5FYKL 4ZMVA 4NFDA 4KZDL 4KH9A 2Z65C 5JPMB 4ZMWA 5FGBC 1Z3RA 2CRYA 3ET9F 3GMPA 3BQUA 3S36H 1KYDA 1HK6A 1BM3L 2YAMA 2Q7YB 4B27A 4BSJA 3U7WL 3EAKA 1ACZA 5D7KE 1VHPA 1NKGA 4GAJH 3KWWB 2ZCHH 4H0GA 5HYQB 2BO0A 1QRND 1QSVA 2AI0H 2OA9A 4GG8A 4JPVH 4P57B 4X4KA 4TXVB 1FE8H 2LU3A 3D25B 3D4ZA 3G5ZB 4XR8C 5D6DC 2RFXB 2WXRA 4LPYA 5HVGB 2VDLL 1P69B 5C0ND 2A77L 1D6EB 1T2QH 2KZWA 3P0YH 3GFUA 2VM3A 1DN0A 2JJTC 4Y4HC 1YO4A 1ITBB 3D4GA 5CJQL 4DKAA 2IALB 2F53E 3QWQB 1WAEA 1DANU 5DUBA 4XMKH 2UVFA 2Y7MA 2X4SA 2O4EA 1SY6A 4RRPG 4FKKA 2APWA 4EJ1C 4J3OF 3BRDA 3L7FA 5E6ZA 1EAPA 1UD3A 1UKQA 3QJZA 5DR5H 2OX5B 4QTIL 3RFZC 4YH6A 3VW3H 3RJOA 3DARA 5MEOA 3APCA 1H15B 4JFEB 3U4BH 1TZ8A 1DBBL 1PZ5A 1T20B 4IIQA 1QYGL 4WO4D 2XICA 3F7QA 3FFCD 4A7UA 3OAZH 1IBYA 3WCYA 1NCWL 5I73B 4P4KD 1A4JB 5HHVL 3CX2A 2GIYA 1T7ZA 1ZANH 1CURA 4NNPH 3QARA 5E2VH 4NC1C 2CHXA 4WW1A 2A1WH 4BFEA 3QHZL 3K4AA 2V7NB 5C0BD 2D7OA 3Q6FA 4C83B 1CGUA 4EI6B 1NBQA 3LB6C 4EI5B 3TYGL 5DMGC 1CXEA 1T5KA 2WXKA 1ZWIA 4HWEL 4NUMA 4GJTB 4QYOB 4ESKA 1BBDL 2PO6D 5HYFA 3ATEA 5MEPA 1BD2A 3QPXL 5IMKA 1MWAA 2VUOA 4IMLB 5A6MA 1PVHA 4HWBL 2JI1A 4YDMA 4DQOL 4OCWL 5IESH 4XVOA 1HI6B 3VM5A 1HWGB 1FZKB 3PWNB 4HZ1A 1DUYB 2IWEA 3UCRA 1GJWA 4XMWA 4IEFB 4R2GD 4OFQA 2IO5A 4GH7B 1ORQB 3FOLA 1NAMH 1UA6L 1XDTT 1OT1A 1HNGA 1UB6B 4X5LA 4BKTC 1PIGA 4GIAA 3FSZA 4U7KA 3HNTL 3RVXD 5BUAA 4MMZC 4PG9A 3DGGA 3DHJA 2AJ3B 3LKOB 4IRJB 3SOTA 2H1LM 3JWDC 3WEAA 5EEWA 5IFHH 5DD5L 2R0WL 2CKBH 3PGCB 2ADGA 1M3IA 1UM4H 2Y9RT 5AKVA 4B5ZA 5DJ6B 4UTAL 3I6GA 1W2KT 2W9LA 4E5XG 5I1EL 3NJGA 4B9FA 1VZGA 2WOBA 3KGSA 3HPLA 1EGJH 4ODBD 2EO9A 1UZ8A 2NMSA 3FUFA 4JFTA 4PREB 2DQGL 5EEYA 1E5CA 1XH3B 4FQ1H 1AHKA 2BSRB 4PJ8A 2QPEB 3L5HA 4JM2B 1T83C 3PFUA 4EN2A 2IH8A 2AANA 2EYRB 5B21A 2XQYG 4Q52A 1M1XB 3AREC 3N40P 3TCXA 4L4TD 1X4YA 1D5MA 3MRGB 4GMSL 1IV8A 4UIKH 4MQ7B 4HUCA 4ODVH 4QT5A 3O41A 3NOIA 2AXHA 2QLVB 2D4FA 4EQ3A 3DIDA 3T2OA 1KGCD 1UENA 3HMWH 1FO0B 4S1RH 3HFML 3ARDD 2LLGA 4I1PA 3X13A 1PAMA 2ZOLA 3V4PL 3DRQB 5GGTL 1KB3A 5D96B 4AKOA 4DWHA 4NWUL 1QRNA 1YUHA 3SIKA 2YWYA 5C3IA 3SB3A 3HUJB 2BS9A 4AK2A 5HSFA 1RIUL 2NUPB 4I3SL 4MCZB 4P2QB 4LLYA 3FSVA 2X9YA 1CZ8H 3AWGA 4TSAH 5HDQH 3O45A 1E27A 4MQSB 3QO1A 1I75A 1J18A 2FYYB 1P1ZB 2J5LC 3GJFK 4O58H 1A7RH 4XZ4A 3FF7A 4P2OD 4OF5A 2XN0A 2GG1A 4OZFG 2XPGB 3ULVL 1N3NA 2MEJB 1EIBA 4PP2A 3ML9A 4MDIA 2Z3FA 4M3HA 2OXGB 2QJDA 1LDPL 5TE4H 4ZO9A 1HWWA 4XNMA 3QORD 2FX9L 2LV4A 4YUEL 4WEUD 1UEMA 2J6EH 4BFOA 5KJRL 5IW1A 4Y19E 3V0FA 5AOJA 3U2SB 1G7PB 5D2NB 1HTYA 1IFHL 5C7XH 2VLMD 1YSOA 4Z77A 3DPDA 1R3LA 3R06B 3JWOH 4NXKA 3SPVB 1PY0A 1OB1A 3SBWC 2NY1C 3ZKNC 1DCEA 5CZVL 4WO4A 3FFCA 1YMHA 4FG4A 1VACA 3BH8B 4B9YA 1ZEAL 3LQAH 3IJSA 4XNQA 1FI8C 4P4KA 3O2DL 1KN4H 2ADFH 5ICYA 3K0WA 5J6GB 3MU3A 2ZXCA 2GBTA 2GEQA 3ATDA 5F7BA 1OW0C 2N59A 5C0BA 3BKYL 1F1AA 1P7KB 4WI2A 5DJAB 5E23A 4OLWH 5TQ0H 4XTRD 1EZUA 3BOVA 1G6RL 1CT8B 4R26L 5BZWB 3CZJA 2JWYA 5I82A 1T0NB 2P24B 1YC8A 1GOGA 2PO6A 2ADIB 4JDVB 4OZFH 4JRXE 4NKMB 1U58A 4JFED 2PWFA 5T1DH 4JO3L 4M1DL 3MACH 2R0LH 1EXHA 4OGYH 1RL1A 1R3HA 4Y9BA 1ACCA 4XO5A 1N7MH 1FPTH 3QIBA 5AOZA 5JA9A 3UBHA 3T6VA 3TVMC 3TN0A 4UANA 4XVTH 4JL1A 4I18B 1IGYB 2NQ3A 1CTNA 3RU8H 1A2YB 2YQ2A 3N06B 2DIAA 2IC2A 2IDQA 1SXBA 4M43L 1UCTA 1TCRB 4G3YL 3B7RL 2WYZA 1MH5A 4D8OA 2DKUA 1FUNA 2KLRA 3JTSA 4PJ7A 4LPXA 4P48A 2ICEA 3BDXA 2CGRL 2FJFB 1OAUL 3L5WA 2FX8H 4IRSB 4H88H 4POUB 5JZ7C 4NQVA 3F62A 5CGBA 1M9SA 4H26B 1NCAH 1XL6A 5GRYA 5F71A 5TPWH 5BRPA 3UTZA 3FCUB 1HEJC 3MRIA 4LBEB 3REWA 5EDXA 2ZWKA 2AJUL 3OKYA 1ES0A 1I9IL 1KPUA 5IUSA 1MIML 1RURL 4YEFA 3OQRA 3TT3L 2EDTA 5EA0L 1NBVH 5CEZL 2BY1A 2GI7A 2P8MB 2KS0A 5I1AB 1I7UA 1F4WH 4KK5D 5IFAL 1J5OL 2WPGA 1OIOA 3EOYG 3NABL 5SWZB 4JJ5B 5AKTA 5ENWA