1EANA

The runx1 runt domain at 1.70a resolution: a structural switch and specifically bound chloride ions modulate dna binding
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title The Runx1 Runt Domain at 1.25 A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eanA00
2XWCA 2X0UA 5AOKA 4IBTA 3Q01A 2OCJA 3WTYA 5LAPA 1UOLA 2GEQA 4IJTA 2H1LM 3ZMEA 5AOLA 2J20A 4AGOA 4L0ZA 1TUPA 2J6WA 5ECGA 2MEJB 3EXJA 2IOMA 4GUQA 2J1ZA 2VUKA 3US0A 2BIMA 1CMOA 3D07A 2J1XA 2AC0A 2AHIA 4A63A 5LGYA 2BIPA 1HJBC 1IO4C 2P52A 3D08A 5G4NA 5AOJA 3VD1A 1LJMA 3D06A 3WTXA 4IBZA 4IBYA 1GZHA 2J1WA 1CO1A 1H9DA 2YBGA 2FEJA 4G82A 2J1YA 5G4OA 1EAOA 4MZRA 1HJCA 4AGNA 1T4WA 3US1A 3WTTA 3WU1A 4HJEA 2IOIA 3D0AA 3D09A 4QO1B 3EXLA 3WTWA 4G83A 3Q06A 2X0WA 1EAQA 4IBQA 2BINA 3VD2A 2PCXA 3QYNA 3KMDA 1TSRA 4L18A 4AGLA 5A7BA 4AGPA 2BIQA 2BIOA 4IBWA 2X0VA 5ABAA 1GZHC 5KBDA 2WGXA 4L0YA 5BUAA 1EANA 2XWRA 4LOEA 3IGKA 5AB9A 3KZ8A 3QYMA 5AOMA 1KZYA 4KVPA 4XR8C 4AGQA 3WTSA 2ADYA 1YCSA 4AGMA 3WTVA 5G4MA 4MZIA 5AOIA 3Q05A 2J21A 3WTUA 3IGLA 4GUOA 4LOFA 2IOOA 4LO9A 2ATAA 1HU8A 3VD0A 4IBVA 3TS8A 3D05A 4IBUA 1E50A 4IBSA 2RMNA
chains in the Genus database with same CATH superfamily
2OTUB 4Y5XB 3TT3L 2NQDA 1GIGH 3U0PA 4M03A 2QZ5A 1NOLA 1EEQA 2CO2A 2DDQH 2QR0A 5FLVA 4FEIA 5I1KL 4UAHA 1T22A 3IU3B 1SLVA 2YLKA 3QUYD 1FFRA 1XF3B 3PJNA 1TG8A 5EMYA 3FHQA 4C4BA 2DQMA 4C56A 5CD3A 1HE8A 4AV5A 3GMPB 2X4OA 1FO0A 5DC2A 5C9JA 1XIWD 5IEKB 1CJYA 2O93L 1RZKH 5H2BA 1RUKH 2FLMA 1QNIA 4RZCB 4DN3H 1JTOA 4HIEA 1QI3A 1MRCH 2DICA 4KJPD 4LNVA 1CG9A 3O6FD 5FYLD 5MERB 1XEUA 3KWWA 3VG9B 1PMYA 4E2OA 3HZVA 2DMHA 4P3CL 5JTWA 1I85C 2C8NA 1WD8A 1DQVA 1SMDA 1ZDSA 3CMOH 4AEHH 4AZ8A 4KJYA 3RA7L 3GKWL 5TTRA 1C08B 4EDXA 4P2QD 4PGZA 3VXNB 2VLJD 4C83B 1AGCA 4MBRA 4QXVA 5KYYA 3FT2B 1Q9LB 4Z7QB 2BY0A 3DX4A 3ZLQC 1XR8A 3FO0L 3FO1A 1CE1H 4MNHB 2DYSB 2YQGA 1D7FA 1QSEE 1SOXA 4FMVA 4PHZA 5IMOA 3WO3B 3DHUA 4RQQB 3MLXL 1S5IL 1S8DA 3T3PF 5GRXG 4GLRI 1ZTMA 4GXVL 3O3AB 5ITFB 4QO1A 3ES6B 4IIQB 3OHMB 3CXDH 1XQ4A 5J3HD 1L3WA 4KI5C 3RAJH 2GBAA 1Q90A 5MENB 3L9RB 1VSCA 1KYUA 3O2WL 4TSCH 5HPMB 2VC2H 4S0TD 2X10A 4L8SA 1MZYA 4GW5B 2FO4B 4OZFH 2X0VA 2Q6WA 4XWGH 1NAKH 4BFRA 2AXWA 4G7YL 3WY4A 4YQXL 4UTAL 3WDHA 3GHBH 1QFUH 2LOEA 2YGQA 3FTGB 2B20A 3MROB 4QHLA 1KLUA 1SHMA 1W0VA 4QGTA 5IBUB 1BVKA 5ADOL 5C3LD 5I73B 1J5CA 2HN7A 4S10A 3OXRA 5KTEH 2ZX6A 3BKJL 1FNLA 2OXGB 4HOMA 2ZCLL 1K6QL 4ZFZA 4MNGA 4ZS6C 1R46A 3OJDB 5TGBB 1EGJA 1FO0H 4YHIA 3LIUA 5J13C 3RY4A 4X8XA 3ULUH 1DQTA 2ZJSH 3U0WH 1PG7L 4NZRL 2NNAA 4IBTA 1R6VA 2ICWB 4WEBH 1TYRA 2DB8A 2GJZA 4Z7IA 1A9EB 1BZ9B 1Q8MA 3OR7A 3ZMNA 3RWHA 5EF0A 4OUUB 3VXMA 4JFFB 3SPJA 3DO3A 1M2OA 4N0UB 3NCCB 2EDTA 3QFJE 2DS4A 1M1XA 3WFCL 1J1OH 2LW3A 3KH3A 5BS0E 3T6QC 1MFBL 1IAKB 2J88L 3LQZB 4O9HL 2H6OA 1L9TA 2ZOTA 4QXUH 4RVBA 1IVTA 1NFDE 1H8OA 5CGYC 3W9DB 4CN1A 1IBFA 1N26A 2AJVL 2BIMA 2K4WA 2R29L 3MA7B 5JUEH 2J1XA 3ARYA 5AKSA 2ENQA 2I69A 3KBHE 3QEQD 4N20A 4XI5C 2GTZB 3FTXA 4MRCA 4UF7C 2B5IC 2ZG1A 4K8RL 3DTUB 3BOVA 4B9PA 5FFGA 4XC1L 5G4NA 5FB8A 4U6XB 3KYNA 2B0SL 4YDKL 5F9JA 5LGJA 2EYSA 4M7JL 4P99A 4BHUA 1R3LB 3PAVA 3C5SB 3AREA 1U8MA 1E9QB 3W0WD 2FT7A 3WY1A 4M3KB 1HQ4B 4JR9H 3UBHA 5C08D 2PO6C 3BKCH 1LK2B 5CD5C 2OQJB 4P9HL 3RTQC 1IZJA 2MNWA 3NZHH 5CJOL 4DHLA 4RAVA 1UXSA 1AANA 5DQ9B 1BSIA 4XOCA 3RX7A 2YD4A 2QVTA 3S2AA 2EJ1A 5EU5A 2ZXBA 4DAGL 4Y9BA 4GP8B 4CVZB 4M8QB 4OCWL 2C1OB 4RX4D 1EAQA 4MAYC 3JV6B 3MRFA 4D7PA 4ENZA 1F1GA 3GSQB 4UILL 4NHCL 2AEQL 3HNVH 3MOBL 1U3HC 1NLBH 1KJ2H 4JLRA 3CUPA 3DV6A 4FXKA 3UJJL 3V0JA 2CM5A 3MX0A 2F58H 3FT3B 1XGZA 4GLRH 4AJYV 1IBGL 5AW3B 1U2HA 2J4WH 1UXLA 3WDIA 1SMAA 1WG3A 1NCJA 3JT0A 4HJIA 3RVWC 1NIEA 3PWVA 1KCLA 1DJIA 2MQ3A 2V5SA 2AZAA 2E27L 3REVB 3AS2A 4H1LB 4AJ0A 1AJ7L 3VWKD 2Y5TA 3IDIB 5C09B 4HCGA 5BMFL 4AEEA 4HOXA 1M6UA 2YPLB 4UIKL 5CJXC 1UB5B 3DO7A 3DX9A 1OW0A 3SCMD 5LWYL 3RFZA 2B5IB 4O02H 4DK6A 4U1SA 4BSVA 4KZDH 2DLTA 1NGXA 2YAQA 1S7SA 1MCEA 1TZIA 4QYAA 4U1HA 4JN1L 3O9WA 4A6YL 3D9AH 1OANA 2ZAIA 3VGGA 4Q74A 2XWJB 1UXMA 1JGIA 2PO6B 5T5NF 4F27A 3QRFM 2QQLH 3FOLA 2EIZB 4DKEL 2X9XA 4PJHA 4M43L 5E7BA 3IE4A 2GJJA 4P5RA 2BFGA 4Z18A 1P7QD 2WO2B 2VMJA 4LP4A 2IDQA 5F89A 5K1NA 1EBAA 4KJQC 2J1ZA 3O3BB 2EDHA 4MAYB 4KXAA 2N7AA 1JZ4A 2ZKYA 1NMBH 1DCEA 3MRLB 3HUJA 2V9UA 3QGVA 1U3HB 4L4VD 4GI6A 4X6BB 1E6OH 2B15A 2DQHL 5F9OH 4D0BB 1XCTB 4AYFB 4G8GA 1M7XA 4P5TA 1S2EA 3L4ZA 1ITBB 1E5AA 1N5YL 4Q6KA 1CTMA 4R9HA 1XH3A 2BHFA 4PW4A 1AOHA 1LE5A 2PCFB 1NPJA 4L8CB 4KX8A 3WJMB 2Y23A 5CLWA 3DX3A 2EE6A 1Z3GH 3UZQA 5HDQL 3WDJA 1T3FA 2WO3B 1F45A 2XV6B 4R3SA 2XXFA 4JFOA 2D2OA 2YZ8A 2VDML 5F0JB 2AVFA 5IQ7L 3RJOA 4AX3A 3MUJA 3QUXC 4FQLL 3RJDA 1S7XA 2VW4A 4L29A 5LCVL 5IB1B 5E5LA 2W0FB 3PV6B 2D31A 3DHJA 4UM8A 1GYCA 1NGPL 1RJZA 3BD5A 1DQLL 1MRFL 3SPVB 5FYLL 3K6DA 2BK8A 5EDXA 4YXKL 1UB6A 3TPKA 3TT1L 3GMRA 4NKMB 3U9PL 2FCBA 5IJDC 5M7QA 2BSBA 3FO2B 3Q2WA 4JE0A 4QRPE 4XNZB 3UTTA 1NL0L 5DO2D 3BFQG 4WGVB 5HXMA 1PF3A 1BZ7B 3IGFA 2ARJA 3FB7A 5FV2A 3L81A 4J5VA 5C07B 4GSDL 2ICES 3S5LG 5F3HA 4DCQA 4YZFF 5FW8A 5J1TC 2DQIL 3AJ7A 4PB9L 3PNWB 3GEFA 4LPVA 2CIKA 3QQ9D 2FEDD 3CGTA 5GQBA 3K7UA 4E9XA 2WUCL 3B1UA 3D50A 4LCVA 3VFTB 5HJ3B 2YUVA 1SDYA 1EJ6A 2WK2A 4U2ZA 2KI6A 1HVXA 4Y2DC 1QLFB 2WGNB 3CSTA 4HHAB 1MWAL 4JDZA 5I82A 1B0GA 3UBFA 3ZDYE 3CWGA 4KQ0A 2UZXB 4P49A 4RBPK 2FGWL 4IBUA 4J3XA 1KEML 3CZGA 1R5IB 2UX6A 1MNUH 4IBSA 4M5SA 4RIRA 3QUHA 4CGUB 3U4EA 1CGYA 3MACH 1AQDA 4U4BA 1H5BA 4WQOA 3I9IA 3OKNB 5AW5B 2VDPH 5ETUB 5EF3A 4HWZA 4UOW0 1RK0B 3DJTA 1MXGA 2N1TE 3OKKB 3BAEH 1TTFA 2HTKD 2C9QA 2ID5A 2Z4QA 3JV0A 3MRGA 2X6CA 3G6JF 5DD3L 4YPJA 4DO5A 4HXAH 1L3NA 3IMSA 1NEZG 2ODHA 1MSPA 3QUXB 4P5MB 1QEWA 4LP5A 5IVZB 4N2LA 2H41A 3J2PA 1TFHA 3AT0A 5FK9A 1MREH 1BPVA 1OP5K 1G1YA 4MJ5B 4N85A 3PWNB 4BSWB 4PJFF 1U8CA 4F33B 4Z3FA 1UWEH 1WEJH 3LQAH 3V10A 5DJZB 4YSRA 4Q0XH 4ONFH 2IFGA 5T1JA 1K4DA 4U1GC 3GXTA 3HG1A 3BJLA 4O2CA 1OARH 2XZQH 3HVDA 2NUPA 1AD0B 4G6JL 4UT7H 2VDQL 4ACTA 2YSTA 3UBXB 4L3AA 3L7EA 1X5AA 4YHZL 2QQKH 2Z8VC 4BQ6A 1BFTA 4DPCX 9CGTA 1K8DA 1TEFA 1EO8L 2NPLX 1JGUL 5I30H 1RJCA 1C16B 1CE6A 3F5WB 4LSPH 1K2DB 4YBQD 1U6AH 5F7DA 3PJSB 4TQ8A 5FGBA 2R0LH 3VUAA 4P2QE 4Y2DB 1CI3M 2EDXA 4IBLT 3SDCC 1FWXA 5TPWH 3J27A 5I66A 3TFKC 1PG7W 2FSDA 3RWIA 4ODWB 4AQAB 2X89A 3IGAA 4QOKA 4X6CF 3ZKMD 3FUMA 4JCMA 4N8CH 1BZEA 2LT9A 3L1OL 1UA3A 4X0KA 4H26A 5IHUL 3K8LA 1VIWA 5D5MA 3QQDA 3ARBA 2V7HA 4FP8H 5EZPA 1EZLA 4Z7UF 4A7TA 1L6ZA 4M9OA 2E59A 2XZZA 2YMXL 4WFHD 4Y89A 1QTYT 4YHOL 2QQNH 5D4JA 2Y36H 3SKJH 3SGJA 1DVXA 5DFVD 5I17A 1K85A 3FYEB 4LHUA 5D1QD 1N4XL 2C4FT 5B39A 3OR6B 4N0CC 1N6VA 1O7VA 2QHRL 2OL3A 1AH1A 1OTSD 1VENA 4CW1A 4IK7A 4PGEA 4PJEB 3V6OA 4PD4J 4U1GB 3ZL4H 4ZTOL 3LN5A 4O2FA 4F57L 3CQQA 4ODUB 4OCSL 5CM1A 2DTML 3H54A 1LQSR 3A24A 1T1XB 2QKSA 5GJSL 3RVXC 4E9RA 1MG3C 2BY1A 3HZMA 2YPVA 4PJAE 1FZOB 3PGCA 3BAYA 3CFBB 4UBDD 3VD3A 2AK1H 2ESVE 3Q1SH 2ZCKL 2KT6A 2Y1YA 5FM5M 2AXJA 1U8IA 3SDCB 1LO0L 4J4PA 4YJZL 4F8TA 3LNIA 1JFHA 3TBBA 4HU8A 3KG5A 3HTLX 1RJYA 4O4YL 4KOCA 4O51B 4XPGH 1AXTH 1BZDA 2CXKA 5I8KL 4ELMB 1IAMA 4KZEL 2QPEB 1YHPA 4PVBA 3GI8H 2XQBL 1OP3H 3SDDA 3FQ4A 3OHXC 3OJVC 4OLVH 1TJHL 1H3XA 2A5UA 2Q76B 2WTPA 3DVGA 1F58H 2JIXB 5BNXD 3VFNA 2W65B 3MRMB 4NGHH 2VM3A 1K9TA 3FL7A 4K7FB 2VXQA 4NUQA 5GIRA 1A65A 5CJBA 4ZAKD 2QSCH 1AG6A 2WXRA 4F5CE 1KGYE 2CNYA 2VDNL 3QEQE 2JKNA 2X6BA 2VR8A 4S1SL 4MVBD 3VB9A 5JPMA 1AGBA 1CO1A 2HUHA 4M5YL 3LEXA 3CVHL 3DUHA 1ID5I 3MI6A 3Q44A 5E03A 2VDRL 1P5UC 1BQRA 3FT9A 4KH2A 4MZRA 2OXHA 5D2LB 5E4EC 1SDAB 4JK0D 3QXDB 4PJ5B 5FYJU 3IB4A 2C9SA 1NBZB 3HMXA 3JWDL 7PCYA 4DN4L 1TQTA 4LZKA 2NW2B 3QS2A 3E6HB 3GGWA 3P73B 4FFZA 4P07A 4PP2A 3JTSA 2CRZA 3DYMA 1L6PA 5AKTA 4M5TA 3CVCA 4QCIB 1ES0A 1C7TA 5EU4A 4RFOH 1A6UH 1YPZF 2OL3H 4OGYH 4ZMAT 1MI5B 1TLMA 1ACXA 1T04B 2HKFL 4HG4J 1J86A 1CGVA 1ZY9A 1DLHB 4G9DB 2TSBA 3VFGL 3VNYA 1M7UA 4NLHA 1SGKA 3C6LC 3NSYA 3PQYA 2XCMC 3MV7D 3S4SB 3ZE1B 4DO6A 5KYXB 1XGRA 3BWZA 4TLKA 2BS71 2FYYA 4TUKL 3CPLA 4YPGA 4A7GA 5IQ9A 4OKDA 2UWEE 5E8PB 1Q9WA 3EJCA 3ET9F 4OJEH 1H3UA 3W82A 5KVGL 1OZTG 1WT5A 4TPRH 2AQ1A 1IQWL 4M8UA 3OHXB 1E9PA 2Q8BH 2ADYA 4WI5A 3QHFH 1OAYL 3GBLA 4QF1A 1I9RH 4NAMA 8FABB 5EWIH 3MODH 3N43F 2ITCA 4FQXA 2OS7A 4Z7WE 3F2LA 4WCYH 1F00I 3TBTA 4G43B 2WSKA 4IBVA 2VLLB 2AABH 1KZQA 3NUKA 3W1ZA 2QPFA 3F04A 5CZVL 4FQPA 4NKIL 4LF3B 5C8JA 3NABH 4NDMA 5T33H 5J8OA 5ILTL 4RA3A 1R24B 3GSWA 3WE6B 3HNSH 3GHPA 1FVDA 2A99A 5BQ7A 1KTBA 2SEBA 2X3CA 1ZHNB 2FQFA 1DQDL 3O3EA 5E4EB 3L6FB 3NEOA 5FX3A 5BQDA 4QWWD 3G5ZB 3ZL1A 1BVNP 2CJ3A 4BFFA 1CFNA 3DTXB 2EDMA 4GEIA 3ML8A 1JHKH 5DUML 3UMNA 1OKEA 4YDZA 1A6PA 4NO2A 1KELH 2E6PA 2EDOA 4PJBA 1A7BA 3MFFA 4LKCB 1MRDL 3BAWA 4YOKA 3SKOA 1TZ8A 2CBOA 3KVDD 4NQVA 3C6LB 3MLVH 1KBPA 5JQ6L 3VU2A 5HHOD 2I7SA 1A6TA 2LU3A 2WVVA 2UUDK 4L4VE 1OB1B 1W72B 3CX5K 4WK4B 2W81C 3UZVA 5C6TH 2EIMB 4OF3A 1EEUA 1FNAA 3MCG1 4N3UA 5HHXL 1BBJA 2AI0L 3QDMA 2Y1VA 3QZWG 2R23A 4OR1A 1LL1A 3WIFB 2YKKA 2WXIA 5HJDA 5DHYB 1JNJA 3TJHD 3M1BA 1SNRA 4RGNC 5KVGE 1J18A 3P77A 4LLYB 3QNXB 4LCIL 5E70A 1JPFB 5EPMA 1WYJA 2WINA 4HZLB 1C5BH 25C8H 5J7CC 3HZYB 5MEND 1Y18B 3OAUL 2HLFC 4KUCF 3A23A 3ASWA 5DS2A 4UIMB 5IB3B 3GBML 4RH4A 5KS9A 5CINL 2L7JA 2V4LA 5ELIA 4DFHA 3PAZA 4PRPB 3CXHK 3WEXB 1OHQA 3C87A 5DJ6A 5AZEL 4ZXBC 3GF8A 1AFVH 3SDAA 3DETC 5LBSA 3EFDL 4CSTA 1XF2A 5EZIH 4KO7A 4NUMA 1NJ9A 3FUHA 2NCMA 4NBXB 2BY3A 3U25A 1DJZA 5HGAA 5BUGA 2H2PC 3COOA 3LKRB 1CXKA 3T4YB 4KVCL 2DKMA 4JW3A 3HC0A 5KYWB 2X88A 4ZOCA 1E28B 3N50A 2ROXA 3BP7A 4J1UA 5KW9H 4IRZL 4QY8A 3TX4A 2BNRB 5A2CA 2R2BA 3EOBB 1V7NH 3RLSA 3EYSH 5KSVA 3K72A 3ZZSA 2ALAA 1MELA 3DI2B 4YSDA 4RDQG 1BV8A 3GIZL 1D9KC 5DCCA 3HI5L 2WVTA 3AQYA 4JFFD 2DQCH 1D5BA 4H4NA 1ZIAA 1KCKA 4HISA 3VSQA 1S3KL 4XGZB 1KULA 5EOCJ 3D69B 2PWEA 3HBZA 1ZRUA 5GZNC 1HAWA 4RGNB 3AFLA 1PD1A 1EK3A 1DBJL 3BP6A 1DLFL 3BH9A 3P0VL 2YRBA 1EDYA 1AGFA 5GGQL 2GFBA 2VXUH 3P9WB 2MCMA 5JLZB 2K3TA 3A67L 5K9QG 5B8CA 2Z31A 1CK0L 3ESOA 1WE5A 4ONHA 2H8PA 2PKDA 2FX7H 5FHAL 3ZYIA 1T1WA 1J0ZA 1FDLL 3QH3B 1HNFA 3BZFA 3TA3C 1WSST 5IKCA 4WHDA 4G5AA 4CJ1A 3KVPA 3O6LH 5F1NB 5ICYA 2YEZA 2WZAA 2N0KA 4ZXBB 4ETQA 1FGVH 2X6MA 5DRNA 3I3EA 1QD0A 3U7YH 4YAQA 3VW3L 3NDZE 1NFDF 6PCYA 4ZS6D 3D39B 3T0EA 3WOVA 3K2UH 3EFFB 1PYWA 5MEPA 4P4KA 4M1CC 3FN0L 5LBSH 1NGQH 1OTTC 5INCB 3D0AA 4QHUA 5C0AA 4BELD 1F4WL 3B3IA 3TJEL 3W5MA 4D2NA 1RULL 4JL2A 1QWNA 1N68A 1P4LB 1A2YB 3TEXA 1O6SA 1BD2D 4L9LB 3N1FC 3L95B 3HE6C 2COQA 3BX7C 1F4XL 4DPRA 1BVZA 1X9RA 1D9KB 3CNKA 3GPSA 3QYNA 2IH3B 3ARDC 3T3ME 3DJRA 1EHKB 3I2CL 2AJUH 4FE9A 1GGBH 3IVKB 2PYEE 4NNXA 5ABAA 4YVUA 5D1ZI 4N0FA 1EFXA 3UADA 1UQSB 3H9SA 3MREB 4JKKA 1G7QB 1ULVA 3P30H 1KBVA 1T66C 1UEMA 3NFSL 1ITCA 5CGYD 4HJUA 1A4AA 3P4NB 4GQRA 5C09D 3GRWL 4GJTB 4WUKH 4JVWA 1FHGA 4YSSA 4LSSH 3ARFB 2E6QA 1S7UB 2AJXH 4XZUA 4BFKA 5FYJD 2B3RA 4Q2ZB 5DF0A 5D1QE 1W8OA 2HTLC 4X7SL 1SOQA 3GSNL 2Y7SA 4MJJA 2VXVL 3HA0A 4LFHD 4WNSA 3CVIL 3TA3B 5MP6H 1RUPH 3HMWL 2XZAL 4IU2B 2AEPH 3MV9E 4JG1H 4L8BB 4HKBA 3P0GB 2XN9B 4PRNA 1HZHL 4PY7A 1Q0YH 5C0RL 4HBCH 1BAWA 5D1XE 1RZIA 1E4XH 1Q1JH 4I88A 2YOCA 3AG3B 5I1HH 1TOXA 2AXGA 2BP0B 2F8IA 1E4JA 2KMWA 4OFKA 3WFEL 3FQTA 1BX2B 5FO7A 3BMVA 4MDIA 3K6SA 3QCTL 1BFOB 3LEVL 1F4HA 3RI5K 1KUMA 1ZT7B 2DAVA 3TA4D 4L1LA 4MAYD 2K6YA 1NBVH 4J3UA 1B2WH 4X99B 3Q8CA 4Z7NE 2OMTB 3HE6B 1U3HD 3QQXA 4UDUA 5CZKA 1W6WA 5F1KC 3QDAA 3QWOA 1HILB 2JK5B 2IV9A 2PP7A 3U6XA 3L5XL 5I1KH 4DKTA 4R97C 3QDJE 1XZ0B 1J48A 1YAIA 4MDJA 4RMRA 3VQ1C 1JE6A 1ESOA 1B6UA 4GW4B 5JR1L 2JCCE 1MIEL 3QG6A 3FUKA 1CU4L 4WV1A 2F1AA 1MJ8L 3FRPA 2FHCA 3LX9A 1MLBA 1IJ9A 2Z7YA 4RAUB 3RVWD 1FORH 5EU6E 1CR9L 2WLJA 2PWFA 4Y4FC 3WY3A 3SPGA 5FKPB 1T20B 5HVFB 1HHKB 1IC1A 2W9LA 5PCYA 3L3GB 2MKLC 2DWSA 3SKUD 5BJTB 5IHWA 5I16A 2EECA 5A6LA 1H3PL 1VKXA 2XV0A 4ZSOE 1ZS8B 3NJNA 5I15L 4P3CH 1CF8L 3CN2A 1AZCA 2CKBB 4L0PB 4AJWA 4PY8J 2X42A 1HSAA 1D2PA 3SZ6A 2NYZA 2V6HA 1DVFA 2VN7A 4BFGA 2FR4B 4PCTA 5DZPA 3TV8A 4A38A 4OZFG 3Q06A 2CBMA 4P57A 2YAFA 5IF0B 4RSVA 1MNNA 3K46A 3PDOA 3U6XS 1FH5L 2BO0A 1GTFA 1A4KB 1IB5A 4IOSA 1G84A 5D4QA 3FO0H 4MX7B 5C07D 2ZUVA 3RE0A 3BEVB 1BMZA 4B9ZA 2NLJB 4LLDA 3CFJA 2FZ3B 2OYKA 3NJXA 1LTXA 3F7YB 3AZUA 1G1CA 1GAFL 5CEYA 3RGVC 1NFAA 4JM4L 2KZBA 3MU3A 4NCDA 5CP7A 5IB5A 4L3CA 3T2LA 1PZ5A 3EZJB 2Y4SA 3WSQL 1NCGA 2DMCA 4KKAC 4DGIL 5JDSB 4MCZA 3BVWA 3QA3B 2XXCB 1JRHH 4L1SA 1DANU 5JDJA 2A9ML 3O2WH 1M05B 4OFVA 4U1IB 2BJMH 4R97B 3C2SA 1JZ8A 4G7YH 3WMSA 1E2VA 1VZHA 1KLFA 4YQXH 1F4AA 3MR9A 1IC4L 4Q89A 4BQCA 15C8H 4HUXB 1Y6MR 4NBYB 3O3DB 5IJKA 4AG4H 4XODA 4X5XA 5ADOH 3HG2A 3CDCA 4OV6F 1HIML 2CBQA 4Y4FB 5D8JL 3ZKXC 2H1XA 2H6PA 4ODSL 2VITA 2ZCLH 1K6QH 5E94A 3V5HA 2KYIA 4GT0A 4LSDA 4ZMLA 3PWLB 4NQTA 2X4UA 3QUXD 3ZDYF 4L37A 3GZKA 1ZV2A 2PLTA 5E23A 3KJ4C 4K73A 5CSBA 1KNOA 3RGBA 5ANMB 1DSYA 3EDKA 3DGCR 1INDL 1PG7H 4NZRH 1KN2L 1PLCA 3BGMB 5L4JA 1FYTA 2CGRL 4XRCB 2VR7A 3WJJC 5T3ZE 1F0LA 5HD8C 1NDGB 3LXBA 4ZYKA 3BPCB 3RUGA 5JXAL 3ARWA 4C57C 2EO1A 1MAKA 4MD5B 2AV7A 3TO4A 3V0VA 2BW5A 3KPOA 3WFCH 1P84J 1KCSL 1BWWA 1IAIM 3BW9A 3Q3GA 4JY5H 1GRWA 3X2QB 1FP5A 1MFBH 1YN7A 2J88H 1PZ2A 4O9HH 3RGVB 4HJ1A 2FECI 2ITEA 4W6YB 3X1GA 5EG6C 1G4RA 2CZNA 5HHOE 2AJVH 4MB5A 4YE4L 2AQ2A 2EIDA 4MS6A 5ABDE 4ZT1A 5ESVB 2Q7YA 3DRQB 1S9WA 3AGWA 4ZFGH 3S34L 4YS4A 1ZGLA 2L7QA 1W80A 1D5ZB 4JFYA 4QPEA 5IFAL 5DSCB 4NNYA 4W6XB 2B0SH 4M7JH 5L9DL 3ZX1A 3HEIB 2DLGA 4JPIB 2NSQA 5F21B 3C09B 4MA3B 1LP9B 3ZKXB 4X9HA 5TE4L 2IWEA 4NRZA 5MENE 3HN3A 4HIPA 3R18A 3VXTA 3SD5A 1VB9A 4Z23A 4HLEA 1N59B 5CAYB 1CL7L 4HUKB 5CJOH 5I6KA 1KFGA 5D2NE 3IJHB 2WGXA 3KPPB 3TGXA 1S7TB 4UQ3A 5DK2A 1LWRA 4APXA 2KZ1B 3KJ4B 3RKDC 3TIEB 4DAGH 1J11A 2NZ9C 3HNTL 4OCWH 2OMZB 3AWGA 4G6KL 2I9TA 3KPSA 3F05A 4D8PA 4NHCH 1QR4A 4NQSA 2AEQH 3L17A 3MOBH 1WZAA 3M86A 1JZJA 5CJQL 4JFVA 1Z5YD 3UJJH 3L3IA 1BCIA 2XSKA 5D6CA 3RWEB 1IBGH 2HX9A 4JFHD 2NYYC 5AAWC 3ESNA 4MAUL 1LQBC 2VKXA 4NEHB 4TNWF 3RX8A 3UIYA 4MAZA 5HDLA 2ZG2A 1AJ7H 4O58L 2IAMA 3UTPD 4X8GA 3SDCD 4NO3A 1FBIL 5BMFH 4OU3A 4D9QD 1NSNL 1KV7A 4UIKH 3TFKD 1C1EL 4AXWA 3HG4A 1O7SA 2QKIA 4JDTH 4PI0A 5LWYH 5IJVB 2Y3AA 3FQWB 4KNQA 1ORQB 4PH8A 4ZO6A 3ZTJH 1R3IL 5I28A 3OAWA 3KYMB 1R5VB 3DMMC 1WBXB 4JN1H 3VH8B 3HPJB 4HV8A 4PJAF 4RNRB 5FYJL 1GGIH 1U36A 3MUGB 1PLBA 4CRPA 3O11A 4Y2LA 3NJFA 1ZA3B 5CZXC 4FDWA 1FG2B 4M43H 3D1MC 5EIIB 1NDMA 5FGCB 1QWUA 1Z5LB 1LJMA 1ZLWK 4HALA 4R4BB 1N18A 4FC3E 4WHCA 1TZAA 2O5YL 4PJ5D 2LU4A 3M07A 3S37L 1PW3A 2R0KL 2Y07L 4G9FB 4AL8C 2DQHH 2RD0A 2JMRA 2FBJH 4JZNA 2V9RA 3ZTEA 1ZPLA 1WFTA 2YAEA 3ARSA 3H2PA 4X4MA 5FIEA 4F2EA 1YNKL 1MI5D 1S5HB 2YD8A 1VF5C 4JZJC 3RVXD 2WPGA 3ZKNC 5C0DA 4GH7B 2ZTBA 3VFPB 1FFTB 3BWAB 4XNBA 5SWSD 2CUHA 3MOAH 5H35A 3ZHLA 2VZOA 1OAKL 1QABA 1WA2X 2OMVA 1BD2E 3LKNB 4UYQA 4AUYA 2ZWZA 4JFTA 1UZ8B 43CAA 4GXFA 4LL1A 2PPFA 2VDMH 4FQJL 1SJEB 5IQ7H 4P2RE 2YQBA 3G6DH 1RZ7L 4NX0A 4OJFL 2R1WA 1F6AA 3FMGL 3JWNC 1ZK5A 4LOEA 1TJXA 1A1MA 2JXMA 4K5PA 5I75B 3UTZB 3CZSA 3ALPA 5HYSA 5J1AB 5GGSA 1NGPH 5F88B 4QRQA 1VZIA 1MRFH 3NP3A 4Y4KD 5FYLH 3ABLB 3ILPA 4Y19B 4CN4A 4MSWA 3LRGA 2K6WA 4YXKH 3TT1H 4HD5A 1ZLSL 4EF3A 1RJLA 1I1CA 1CCZA 1NL0H 4RETB 2BLFA 2W0KA 2Y1AA 5LUMA 3SY0B 4RFEA 1YYCA 1RAMA 2W0PA 1JMZA 2X38A 1SLWA 2CUIA 4OLXL 4KXZH 3FT0A 3AU1A 2UWEF 4PB9H 3CN3A 4NP4L 1L7IH 1A14L 3CSGA 1QRKA 1T0MA 3SJVB 3CH8A 1LWHA 1UZGA 2WUCH 4CUCA 4CC4C 2D9CA 5C86A 3EOAB 3ZSTA 4YHML 4CVWA 1M7DB 1IGYA 4Z7WF 2G0LA 4QRSB 4GKNB 5JHBA 3OAYH 3HI1A 4FNQA 5B1BB 1O7DE 4ZX3A 2CNZA 1KEMH 4NQQA 4EEEA 4WEUD 5A6IA 1CDHA 2LLLA 4JRFA 2KC0A 3GDCA 5FW7A 4EDWH 3EGXB 2AGJL 4IOIA 1G6RB 4I0PC 1YY8A 4LOUC 1ACZA 4RRPM 4KMQA 1VZGA 4XPTH 1I1FA 5KG9A 2OV0A 4JANA 4EE2A 2WCSA 4HIJB 1RHFA 4ZTPL 2NY5C 2W07A 1AKPA 5A16A 1JD7A 1HWWA 5DD3H 5C08A 1KIPA 1RUML 3QI9A 4UUJA 1JN6B 2V9TA 1MKFA 3GZPA 2ZWYA 1IAOB 3WD5L 1OB0A 3PABA 1M9WA 3HN8A 1J12A 1UXWB 5AOJA 3ZQ9A 2OSLA 1FVCA 3SQOL 2GBTA 3MLSL 3LSOA 2XBZA 4F7EB 3B9KB 3ELQA 4OFYD 1HJCA 1IAIL 4HKXA 1LDSA 3GMOB 4QT5B 3L3KB 3BEWA 4KRPC 1GYAA 2VDQH 5T1DH 4POUB 2A9BA 1HHJA 1AIFB 3SHSA 4GSUA 3P9LB 4W9KC 3VQ2C 1SHXA 1EO8H 1WFIA 1JGUH 3CK0L 3B7SA 2FIRT 2J8HA 1T5WB 4AM0A 2YXVA 1S7VB 1IKFL 1DCLA 5IROC 4H7VA 4PRPD 3ZHKA 4U6VL 1U8PB 3X12A 3BP4A 3G5WA 2NY7H 3N41F 5D7LA 2BOBB 4MNQE 4X7DC 1NGYA 1U4FA 4JJ5A 2UXTA 5SWQA 4D9RD 2ZD0A 1MFUA 3ARZA 4HUCA 4CADB 1AAJA 5CGTA 3T6WA 3HHSA 4XMLH 5C07E 5ESQA 3WUWA 3PWPB 1JK9A 3O2VL 3CTTA 2WLYA 2N0MA 1RHHB 3L1OH 1WHPA 4I0PB 3KCPA 3N1GC 1SXCA 5IHUH 2BNRD 1Z9PA 1KN4L 1UUNA 5EEYA 4A66A 2DQ6A 1XCQA 3BP5B 4LNRB 2F08A 1NA8A 2GAZA 4G2AA 1ZT1B 4UDTA 2YMXH 3K8MA 3HJEA 2X7LA 1QACA 2CDGA 5EC2A 1LGVA 4URKA 4YHOH 1ODUA 2AQTA 4YLBA 3QUZD 1IGTA 1N4XH 1S9XB 3TCLB 3ZR6A 3B4NA 2H3KA 1PZSA 3MRPB 4J3OC 3RZCC 3PPSA 3VI3B 2ZYRA 5C1MB 5IK3A 4YHPB 2R2EB 3DX8B 2QHRH 1FQ9C 1RKRA 4GPVA 5TDOA 4U1NA 1KXQA 5T1MB 5EOTB 1LO2L 3F65A 4XXWA 1YEIL 4ZTOH 4F57H 3HR5B 4DO4A 3BIKA 4KRPB 3SDXE 4XCCH 4L05A 3ZE2B 2DTMH 2VRQA 5E7FA 5D7IA 4AOFA 2Q3AA 3BKML 4PGJA 4KHXL 4FZ8L 3GB7A 5E0FA 3FU3A 4ZOAA 4PV8A 4PJ9C 1X5YA 1YEGL 3D85B 1JFQH 4PJXA 2I25N 4K55A 2ZCKH 4NENB 4A68A 3IN0A 4LLVB 5IOPB 1CLCA 1VDGA 3VM7A 2HLEB 1F3DJ 5FGRA 1S7RA 4PTUA 3ULVE 2E9WA 3GTVA 4XBMA 1OAZL 2H2PD 3RJQB 2OM5A 4HS3A 5I1EL 3D39D 4KZEH 5JMOC 2XQBH 5EUOB 4GS7B 4WSGA 4LRIC 4L4TD 1MF2L 3TPUB 5MI0C 1SJHA 3MRDB 5J11C 2VWEC 5DS8A 1T2QH 2BNUB 3BESR 2DIEA 1X5JA 4F7CA 2VDKL 2XVGA 2KDGA 4EI5C 1WJ3A 4AV4A 1D9KD 4PQXA 2UXVA 1BOYA 1NBYA 4NN7C 4BXVA 1JI2A 1VFAA 4G80A 1WC7A 2VDRH 3RZCB 3LRSB 1HINL 3GS0A 2VXSL 5GZND 1J05B 1U8NB 1C8QA 2JELH 3EOTL 5E1AB 1S46A 3LKSB 4PW3A 4OCLC 2EC9U 2PETA 4G1MA 3ABKB 2NY4C 3JWDH 4HQQL 1VFUA 4HFWA 1PIGA 3WL9A 4DN4H 1DUZB 3UMTA 3PWJB 1MHPL 4XCFH 2WAQA 3JSSA 3I85A 4I18C 3ARFD 1TVDA 3MV8A 5T1KA 3UYPB 2HYMA 3KDMA 2DWYA 5F7HA 5HDBB 4PJ7B 2HKFH 1NMAL 1XF4B 3T3MF 1FLRH 3VFGH 1JERA 4QUOA 4LGSB 3ROLA 3WS3B 4PJ9B 3ALWA 3C60D 4BIKA 4N2MA 3BJ91 3NJIA 3STLA 2ZWSA 4U1KA 1GYVA 3QNZB 1JAEA 1I7UA 3H4FA 2E7DA 2HFFB 3KBEA 1E5YA 3M6DA 4PCKA 4R2GD 4TUKH 3IDNB 5IT2L 5JHDB 4PJEE 1F3DH 3ATEA 3QJZA 5IW6B 1V8HA 1WTGT 3GBNL 1ETA1 4MMYB 2FO8A 1OCWL 4PB0H 2HFEB 5CLXA 1NC4A 4I3SH 3VXUE 3IMBA 5DJCA 1IQWH 1ETZA 5T3XD 3CSBA 3O45B 1OAYH 5IBLD 1OTTD 5MI0B 5T1LB 1GW0A 1QA9B 1N8ZB 1T0PB 3I6SA 1A9VA 3K80A 3UTPE 3RY5A 4JMXA 4MA7H 5CZVH 3HE6D 4GRMA 4NN6C 4NKIH 4TULH 4OD3L 2J73A 1WK0A 1ET5A 1RZ8B 4YDIL 3RX9A 5ILTH 1SFHA 1MFVA 2AJ3A 4FQQA 1QASA 2B2XL 2MEJB 4D7BA 3S35X 3ZBMA 4S11A 1T03L 4GUQA 1RIHL 1OE3A 3U83A 4OLWL 4QNPF 3S37X 1ZMYA 3L8QA 1DQDH 2D0HA 4PJIB 4L1BA 4EQ3A 4LESA 2AXFA 3L5WB 1MUJA 1KXTA 2EO7A 3TN0C 2HFTA 4MJIE 4EIZC 2W60B 4KKQA 2CLRB 2NY4B 3GZOA 4OD2B 5E00B 4F7TA 4LVNC 1FNEB 3L3OA 3OG6B 4I18B 3QUMA 4A7QA 5DUMH 2EUWA 5L8JB 4GO6B 4ZBJA 4Z7NF 2V7NA 3CVBA 3NJKA 5F1OB 3V4PB 3FTVA 3UGEA 3WGVB 3ABZA 1EVUA 3JUYA 3FT4A 4X7TB 5DJAA 2HTLD 4KVNL 1CWVA 4X9GA 1TMCB 1QVOA 1H8LA 3D3VA 4M4PA 4WI0A 3V52L 4NJAL 1J9TA 3PE9A 3DXAB 3KEHA 1UM4H 5GGTA 2JCCF 1XGYH 2EP6A 3FSAA 3ME0B 4DNLA 5JQ6H 2HG5B 1D5IL 2H47C 2Z93B 1TCMA 2NNCA 1A7RL 4L4JA 2PW1B 1NANH 4EIBA 1URIA 4XBGB 3UO1L 5BO0D 2X0WA 2EXYD 1T4KA 1XDTT 5ISZA 5L6YL 3OXSB 4HUMB 2NNXA 2VR9A 2XU9A 1MI5E 2YK1H 1VFBA 1CZ8L 1MHHB 2GSIA 3B2UD 1I8AA 2GB2A 4OAWA 2P5EE 1AQ8A 5SWSE 3CXFA 1NC2B 3DHMA 5DVOA 2WB1A 1KYOJ 2DYPB 3EJYC 1U33A 1A6AA 2FT8A 4JGMA 4FFYL 1NLDL 4NN6B 3IGKA 1BAGA 3OAUH 2FJGA 4MCYA 4PRIA 4HIIA 4KXDA 1CFVL 4QRUB 1OAUL 1JZFA 2RR3A 4Y8AA 3L4VA 1Z2KA 5AUMB 1HEZA 2R59A 4N2BA 4PJCA 4HYTB 3O4LA 4PEEA 5CINH 5GGVL 3SBWA 3POCA 4I2XA 3TN0B 2XN2A 2CHDA 5AZEH 4Z3HA 5I2IB 3WV0A 4FQIL 3EFDH 1KJVA 1O0VA 1XD1A 4JFEE 3U0PB 2VISA 4KMLB 3CHQA 5AVSB 2QR0B 4GRLC 5TD4A 1DP0A 3QPQC 3IETB 1OF2B 4IRSD 4KVCH 3U1PA 3IGUA 1R19A 2YKLL 5F3BA 2GJ6A 4G8EA 1KPVA 4J3SA 4S2SA 5HHPA 2GY5A 4DQAA 2ZOKB 4Y5YC 1XTMA 4MJ4A 2X4OB 3CFTA 1JGLH 5C9JB 4XNUL 3GK8L 4AKPA 4PLNC 5IY5B 5H2BB 1S6NA 5IEHB 1J8HA 1TUPA 2NT1A 2DL9A 3FTWA 3VD7A 3GIZH 3V9FA 3H7BB 3HI5H 4M7ZC 2QLVB 2XTJC 2WBJD 4LB8A 4ETYA 2NX5A 3FU5A 2IG2L 3HZVB 1S3KH 4PS8A 4WKZA 1YJDH 3FSOA 2HRHA 1FPTL 3HE7A 3K3QA 5CJ5A 4OSUL 1PY0A 4KJYB 4AZ8B 2G75B 1DBJH 3RGVD 4HFUH 3REWA 1DLFH 3RU8L 1UOVA 3P0VH 5GGQH 3VAEA 4EDXB 4RMSA 4H25A 4CVUA 3GSNA 4KKAD 4I3RL 1AGDB 4OGQC 1MFAL 2XFXA 5KYYB 5SWZB 5F1IA 1EEYB 1CK0H 5CN3A 2VL4A 2QMKA 3FO1B 2I26N 3IJSB 5FHAH 5IMOB 1NCOA 1ZJAA 4YEEA 2AK4E 3V0WH 1T4WA 4Y7OC 1T89A 1GGTA 1EEZA 2BNQA 5B7MA 3TU6A 5I8OH 2P43B 4QO1B 5HHMB 2H32A 3AAZA 2MMXA 1JDDA 2EUVA 4NM4L 4ELKA 3MRJA 3PHOA 3VW3H 3MOQA 4HJ0C 1MVYA 4GRLB 1E4KC 1RURL 3M1CA 2ZF9A 3NCMA 5JW4Q 2Q6WB 5I26A 4GY4A 2A73A 3RY6C 4F2MA 3FN0H 4BRJA 1ZHBB 3GBEA 4DTGL 3WCYA 3WNMA 1LWJA 2UY7A 4QHLB 4Y5YB 3B5TA 2C9VA 3AREC 1YMME 4NRYA 1F4WH 2QVFB 3TJEH 4DFIA 3QJRB 2HN7B 4TUOA 1NCIA 3LMJH 1P9MC 5F7NC 3S3BB 5MEOA 4N0RA 4MMXC 5JQIB 4QDGA 1F4XH 2ZUTA 4ZFZB 5IIEA 1YEKL 3ULSA 2XTJB 5D7KD 3LZRA 4KNSA 5LDSA 4YHIB 4XNYL 3I2CH 1XGQB 2LLGA 2DM3A 1BXVA 4YIQA 4NKQB 3MLZH 4G1EB 2VLRE 2DBJA 1XF3A 5E8NA 2GHWB 1G9NC 3WN5A 1IFHL 5CBAA 3L7FA 4UQDA 3MXVH 4OCYL 2GJZB 3OR7B 3II2A 3L45A 5TF1L 2P5WA 3NN8A 4RZCA 3BVXA 3IMTA 1KCVH 4UNUA 1UCBH 3T04D 1A7OL 5HGGS 5MERA 1M1XB 4QI3A 4FFVD 4X7SH 3SPCA 3UXFA 3GSNH 1UHVA 1UD8A 1WITA 2VXVH 3V79C 4FKHA 1ZE3C 4F1ZA 3HMWH 2XZAH 3Q2NA 2CJSA 4HGWB 4CSSA 3IYLW 1HZHH 2CO4A 3ZKSD 3FCGA 1CVSC 1IEAA 4QYOA 1ZVYA 3B37A 3HG0A 1A8ZA 1MCDA 2WYTA 1VPOH 4BUQA 5BRZB 5KVDE 1I7TA 1OW0C 3EYOB 4D3CH 5B22A 5I0WA 1WZKA 3WFEH 2H32H 3LZOA 5E8EA 2FX9L 3AG1B 3GJEA 4IRJC 5FB8B 5EZOL 5F9JB 2Z0BA 4OZHA 4OBSA 2EYSB 5LGJB 1CURA 4AWJC 1DQML 3RKDD 4ZMNA 1TR7A 1INQB 4GI8A 4WW1B 3AREB 1F97A 1U8MB 2NZ9D 3O9WC 4GT7A 5EULV 4PJFA 2A6DB 3L5IA 2IMNA 2A0LC 3ES6A 4ZUTB 2J1WA 4MMXB 3F7QA 4G9FD 4OF0A 3ML9A 4R4FL 1ID2A 5T3XL 4Z7AA 1MZZA 2QDVA 5HPMA 4YSOA 4WI3A 5FHBL 2AITA 3AUWB 3MCYA 4B9GA 5A1AA 4GW5A 2FO4A 2R0WH 4ZNCD 4L4TE 4EBQL 1MIEH 1CU4H 3BXNA 1MJ8H 2WYIA 4MXVE 2BIHA 3FTGA 1BYNA 3MROA 2XJKA 3IKKA 3CZLA 3F58L 3B7RL 3QAQA 3NTCL 2YD3A 2B14A 4BE5A 1ZHLA 4JLRB 4DGYL 3OAZK 4FXKB 3RQ3A 2A6KB 2X1XR 5JIMA 3MX0B 2FD6L 3QG7H 4S0HA 5DJXA 4M62H 1QKZL 3EGSB 4BQ9A 2ARWA 3MMEB 3AWEA 3OJDA 5I15H 1CF8H 3NJHA 4F8OA 1WS7A 1I85A 5LBVA 4YDJB 3TYGH 2QGEA 3PWVB 1CL7I 4MLSA 3SBQA 4MASA 2Y5TB 4YH6A 3VDAA 4Y19D 1MCSA 1QHOA 2ICWA 2ADGB 3NACL 4YSPA 4FLRA 4RMBA 3RWFB 4HULB 2CKBL 3AB0C 3KJ6L 3MRRB 3DO7B 5EFIB 4OUUA 5CZXD 4BZ2L 4Z0XA 4N0UA 1HT6A 2XWZA 4EVNA 1NGXB 1QRNA 1E6JL 1PFOA 2JKSA 2RCSL 3KR3L 2FE0A 2ICWJ 3FHAA 4ZX4A 3NCFB 3SJVD 1GAFH 1OGAA 2NRDA 3O9WB 5IHLB 1Z6JT 4JM4H 3LQZA 3BKYL 5IW3A 2OYPA 3WSQH 4DGIH 4FYQA 1VGKB 4RESB 1P5VB 3ZIYA 1OOAA 3W9DA 1NAML 3GD1C 1PKQB 2A9MH 3CFIC 2P8MB 4L23A 3W57A 3ZK0A 4JHAL 1U3JA 5FUOL 1A4BA 2GTZA 3TONA 2ITDB 1W91A 1KBBA 3IU4L 5F89B 2IBZY 4NZJA 1IC4H 3DJSA 1MCNA 4U6XA 4HEPA 4HCRA 4Q6YA 1I53A 4N1CA 3FU6A 4EN3A 2MQGA 3KPNB 3N1MC 5DQDL 2P28B 3HUJB 4J3BA 1HIMH 5D8JH 3D07A 1HQ4A 4M7LT 4AEFA 2VDPB 4BM7A 2OQJA 3X1BA 4NNPH 1W8NA 3NCWA 1XH3B 2XETA 4GQPH 1LE5B 4ZMTA 2EIEA 4MB3A 5DQ9A 5HGBA 1AS8A 5D7JC 3VXSE 1INDH 3B9KD 3LTVA 1OP4A 5F7KC 3QC6X 3FQNA 3ZE2F 4CVZA 1QUNA 1VEOA 3JV6A 3GSQA 2MWCA 3T71A 4CKVX 3RBSA 3HN5A 2BWDA 3AB0B 5AQ0A 5I23A 4S1QL 4LPUA 5JXAH 2WQUA 4PLJC 5EORL 4NERA 3BWUF 1S7XB 2IOIA 2Y69B 1B88A 4ZS7L 3ZT6A 1QLRA 1JF5A 4RWHA 3U4BL 2D31B 5J57B 4UM8B 1E30A 1RJZB 2IGFL 4R96A 4KKBC 1GH7A 3J07A 4M6MH 3REVA 2X6VA 1HQRB 1UB6B 4H1LA 4O5LH 3WNIA 4XNDA 3IDIA 3GHEH 1UC6A 3LXCA 1TZHB 3DOSA 4X6DB 5GPRA 2JJTA 5C09A 3V7AE 3WO4C 4BYHA 1FC1A 3TBWA 2YPLA 1UB5A 3S34H 5F3HB 4DCQB 2BDNL 5IFAH 3FF8A 4JM2D 2EIKB 3PWPD 1JP5A 4W9EC 3APMA 4U3XA 2WSDA 5LGHH 4I0PD 3DX6B 4TLSA 1HYSC 1XFPA 2IH8A 4PJGB 1X7SA 5FGBC 4DW2L 1FV1A 1MCJA 2WLLA 3KW7A 4TNFA 5E2VH 4N86A 1WFOA 3O81A 3TTSA 2PO6A 1DE4B 2F2HA 4HCRH 3IFPB 5GS0C 2Y7OA 2EIZA 4OCRL 1CL7H 2F53E 3RTQA 3EJTA 1HU8A 3U4EB 1P2CA 2EDYA 2VLKB 3BFWA 4YWGL 3X1FA 1T1ZA 4GKOA 1NCUA 4N9OB 1KGCD 2IANE 3NEEA 3WMQA 2XN0A 3ARBC 1U95A 4OCNC 3SE3C 4I4WB 1CFQA 5E1IA 5FC9A 3WTYA 3MRLA 3GUFA 3ZTJG 3NIGB 1REIA 3GXIA 2Z4QB 3MRGB 2WXFA 1SXNA 5CJQH 4D0BA 4KRPD 5KZCB 2JNZA 2DIBA 1QEWB 1DUYA 1UACH 3MUUA 4PRHD 2MNJB 4IYKA 4DP0X 1UD4A 3BCFA 4LCYA 1GGUA 4XHJC 2Y2YA 3KHOA 1CTOA 4MAUH 1MDTA 4E41A 4GKLA 4E9TA 4OFIA 1G94A 5IROD 3D85D 4PVNA 5DVLA 4Q97A 4L8CA 4O58H 2BVTA 2CDFB 5HP5A 1AKJA 5FM8A 5I6OA 3UPAA 1K4DB 2FYVA 2R83A 3EJPA 3WO4B 1NSNH 2NUPB 4YX2L 4R6UA 2EDNA 3E3QE 3IFNL 1E8WA 1Y1UA 3ILEA 4FOMA 4DP4X 4F24A 1K8DB 4Z7OB 4RCAA 2GIXA 4H1LH 5DA0B 3SDXF 3BRGC 3VD1A 5KBMA 1R3IH 1QSFA 1UT1A 3ROOA 4BWUA 4QHKJ 4HWEH 3CFKB 1R3JB 4FKEA 1B0RA 2FEJA 5JOPD 5FYJH 2J8UE 2WKOA 4D0CB 2ATPB 5I66B 4NKMA 3FO2A 1HXMA 3FUNA 2EDRA 5B7FA 3IGAB 4LPXA 3BAXA 3T2QA 4QOKB 2D4DA 1BZ7A 4XMXA 2VZ3A 1WBZA 3Q8BA 3ULVF 4X4XA 3VFOB 3BAJA 1MIML 3BDBA 1UKSA 3MFGB 4FXTA 3RZCD 2J7LA 4X0KB 3QISA 5E99L 3TNNA 5FPIA 2ZUSA 3VO0A 1I1AC 2O5YH 3ARBB 2V7HB 3WS6C 1OSPL 1M71A 1UD3A 2R0KH 3S37H 3VFTA 2Y07H 1LP9E 4HIHA 5DC9B 5D96C 5E56A 1QLFA 3S36L 1X7QA 4R8WL 4AW4A 5DHXB 1YNKH 5B7EA 5I17B 4LHUB 3DV4A 5B39B 1R5IA 1XSOA 3CZUB 4OF5A 3UPRB 2B1AL 4PJ9D 1QSEA 1TT6A 2H9GB 5EF2A 1OAKH 1T1YB 2CMRL 5ETUA 4W9CC 2WAHA 5GSRA 2R4RL 3H85A 4GFTB 3ZGIA 5JXEA 1MFDL 2IXQA 2RBLA 3LN5B 4O2FB 4R7XA 4XVOA 5DJYA 1VGEH 2OTPA 1WIOA 1G87A 1II4E 7CGTA 1RZ7H 1OGSA 1GR7A 3EF7A 3FMGH 1RERA 2UY6A 3QUXA 4P5MA 5CU9A 2XWCA 3HZMB 5IVZA 4BINA 2WXMA 1EV2E 3PWUA 1ET7A 3WIHL 4ADIA 5T1LD 1DL7L 2AV1A 4K9JA 2OCJA 1M3IA 4MJ5A 3HBPA 4NQEE 4F33A 2BZ7A 2JI2A 3W39B 4U7KA 4BKTC 2DWEB 2GG1A 2YWZA 5EN3A 5TDPB 1SXAA 5IQMA 4PJEF 1WT5C 4OLXH 2GIYA 3UBXA 4IDLA 5IHBA 1OGTA 4EJ1C 3DVGB 1BVLB 5DVNA 2FQGA 2G3XA 4E5XA 1A14H 2EDEA 5DJ8A 4CU7A 5DK0A 1UA7A 4UNVA 1YO4A 1DBKH 4FQXC 4XCNA 5GIRB 5GS2H 1C16A 1I1AB 3AMLA 1CMOA 3WXWL 4YGVA 3DIFA 2F61A 3PJSA 3LPWA 4YC2C 2NY4D 4YHMH 4Y2DA 5D96B 4RBPH 4DT2A 5BOJA 1IO4C 5DRZA 3TXAA 2BMKB 3I9AA 2D7NA 4YBLC 3X11A 5JPMB 4ODWA 4AQAA 2O5ZL 1TJIL 1YNTA 2AGJH 4YMPA 1G7MA 2BP5M 2OXHB 1UTDA 2FWOB 4XN9A 1AO7D 3DXAD 5AVQB 4AL8L 4JPVH 3T77A 2DMKA 4GSQA 2XG5B 1T21A 3IPFA 2F8VA 3QJFA 4JO2H 4ZTPH 5ABZA 3GGWB 5IP4A 1MXDA 3N3EA 3OG4B 1RUMH 3GWJA 4HS6A 3WD5H 1ES0B 1G6RL 4N2OA 5EU4B 1PEZA 5BZZA 4XP1H 3SQOH 1OP5H 1Q4NX 4U7SA 3OR6A 2YD1A 5LN4A 3WKYA 1J5HA 1SVBA 2B4CC 2ZOOA 3TCTA 3V4VA 3QIUC 1XGRB 3F8UB 5C6WH 2A77H 1OK0A 4YNYA 3IMRA 1IAIH 2FYYB 5DMGC 2DYPD 2IJ0C 4YPGB 4AMXA 1BJ1J 2DQGH 5IQ9B 1X5XA 4TXVB 1V54B 1Q9WB 2FRGP 1UM5L 4I77L 5TH2A 2J44A 3CFCL 2MOQA 4HX1B 2ED7A 5CCJA 4ODUA 1DVZA 3AADB 4HZ1A 3CK0H 1T1XA 2XIBA 5B3SB 4XC3H 1FFOB 2ITCB 4KVPA 3N2JA 1IKFH 1FZOA 2KLTA 4FQXB 5F96L 4P2OD 5CR1A 2ZT9C 4U6VH 3TN0D 2HPOA 2ZUUA 2FH8A 4Y19E 3AWFA 4LGRB 4U6HA 2MPVA 4YC2B 2B3IA 1N6QL 5C8JB 2DLHA 2Z92A 3WKPA 4E9QA 5DXWA 4HA1A 4NDMB 2VT0A 5AVXB 4YBLB 5J9PA 4DESA 3RPBA 4ELMA 1FVDB 5DD6A 1F02I 2KKQA 1GPOL 4Y4HC 2D7OA 5AWNH 4H0HB 2SEBB 5KOMC 4GKZA 3SJVE 3SE6A 2JIXA 3O3EB 1TJGL 5DVKA 2YOAA 3FB8B 3UEZA 2X1QA 2W65A 1KN4H 3PS6A 3S3CB 1XXDC 3SDAC 3T6ZA 2XRAL 4MJ6B 4EXPX 1V3JA 4JN2B 4P3DB 1CFNB 5FS5A 3SDYL 5FR3A 4YL4A 5ICXA 3W11C 3FUDA 1PJ9A 4NO2B 4JQXC 4FL4C 3G9VA 5FA3B 2FEEL 2YN5A 4PJBB 4XPFH 1BXXA 3U46B 3MFFB 2HT3D 2VZSA 3SKOB 3TM6A 4HDIA 3TESA 2XUWA 4NQVB 5LNEA 3B2MA 1LEKA 5FDWA 4Q9QL 3QIUB 4NKDB 4UQ2B 3RB7A 4PJ5A 3K4AA 2WVVB 2J5WA 1HEJC 3EJYD 3ZZLA 3ZO0A 2NW2A 3E6HA 1SF5A 4N26A 3HS0C 4UT9L 3PAYA 1BBJB 1LDPL 1CLVA 4AK2A 5E2TL 2C5DC 4FZ8H 1T04A 4NS0A 4GRWE 4GP4B 3M1BB 3UH8A 3Q6GH 3P77B 4FNTA 1HHGB 1JNLL 5HHMD 1I8MB 5BO1L 5KYXA 2HJLB 2JQAA 4LAQH 3ZY7A 5A3IC 1A7PL 1DBML 3L1EA 5B8CC 5KWYC 4FFTA 1HL8A 4Z77A 2Z31C 3QPQD 1F90L 3G04B 1OAZH 3MDJA 3TOPA 3WNLA 5I1EH 3L1FA 2ZUQC 1WAAE 1YRKA 4Y4HB 1MF2H 5KSBB 1WA1X 2EH7L 1JVLA 4GFXA 3VI4B 2VDLB 3B2VH 3S5LB 5KS9B 3LPFA 1OTUC 1XX9C 4LCUA 4WTXA 5DJ6B 3MTRA 1DANT 3SDAB 1KB3A 4K3EL 1XF2B 4JNXA 4G43A 4FG0A 3MCKB 3VG0L 1HSBA 1RZFH 1U8OB 2XTJD 4FI7A 2NDFA 5F7UA 1R24A 4N6RA 2AQNA 4FL4B 5K1VA 3HC0B 3MNWA 2FLBT 3A4DA 3CV5A 2DEWX 3BP7B 1HINH 3B7TA 4OFPA 4ATWA 2R2BB 1P5UA 2WANA 3EOTH 4NZUH 1NICA 3JZYA 1H3VA 4G6ML 5IVXE 3EKCA 4HQQH 3JTTB 2B7DT 1MHPH 3M46A 1IRAY 3E80A 1JG9A 4ZD3H 4PGBA 1AS7A 3DTXA 4KHTL 2P4AB 1XZWA 3UJTH 4ADJA 1VEPA 4QRPA 5GZOC 2HKHL 1YECL 2NTSP 2QSVA 4IMKC 4NRXB 1NMAH 3U9WA 1V05A 1JF1A 4LKCA 1KGCE 4H8WL 4R90L 5EZLA 3BI9X 3BP6B 3MLTB 4WU7B 3RZWA 4XP6L 1AGFB 3C6LA 4CN6A 5A2KH 3CX5J 2Y24A 4PP1C 5JPNC 3GBNH 4HJ0D 5B8CB 1OCWH 2X4TA 1W72A 5ICZB 3F62A 3GFUA 2Z31B 2PCYA 5BRZD 2XA8L 3H2QA 1VFOA 2GVYA 3GLDA 4RMVA 4PRHE 4KUZL 1Q94A 4AKQA 5AG8A 5DHYA 5LLIC 3ARED 5EC1B 2Y2WA 3WKNA 5L2JB 1BYPA 1G7JB 4ETQB 5DRNB 1IM9A 3MZGB 5LGKA 2ZYHA 2WW8A 4YAQB 2RALA 3UJIH 4HK3J 1JPFA 2EZ0D 4OD3H 4YDIH 4GB9A 3HZYA 1Y18A 1Y0LA 2B2XH 1FSKB 2GI7A 4M29A 1PYWB 5GRUL 4R5VA 3EH3B 5MEPB 1U8LA 2WIMA 1RIHH 3L2NA 5CIPA 4UIMA 3KCWA 4OLWH 3EH2A 2CJUL 3CXHJ 4ZDHB 2BY2A 3IJEB 2YN3A 4PMEA 3B3IB 1ZOXA 3S36X 3N9GL 1UATA 2EDLA 4PRPA 4HETA 3HB3C 5JOPE 2YRPA 2ENJA 3R1GL 2WWKO 4FTVB 3EHBC 1OE1A 4WDIA 3LH8A 2MTAA 4RISL 2WTRB 2DQFA 2O6DA 2OYMA 2WJ5A 3LKRA 5IFJB 3Q48A 3OKOA 3BRDA 1MQKL 3D18A 3SGEI 4NNXB 3TURA 3GO1L 4N0FB 3V52H 4AGLA 1B9ZA 4AGPA 4F15C 5LHDA 2C4FU 2UUDH 3LRMA 3AGVA 1OIOA 4Z8FL 3Q2VA 4MXVF 1A7RH 1N67A 3UEQA 3V4PL 3IMWA 1RUKL 2IPUG 5K33A 5JW5B 4DN3L 43C9B 3EYQC 2QQQA 5IBTL 3DURA 4XZUB 1MRCL 1T7WA 1TQWA 2GI0A 3NT0A 4TF4A 5F6HI 4XX1G 5HDBE 4HUNB 1WGVA 1ODAA 1CZ8H 1WUZA 4LPCA 3RNKB 1W72H 3O9WD 1XL6A 4HKBB 4ANWA 2IDCA 4PRNB 4Y1AB 4PY7B 4KKCC 3QRLA 5DT1H 3SGKA 1NLDH 2LU5A 5JLZA 3ZPDA 4TVPH 2WNXA 4XAKE 3FUIA 2J3SA 5ACZB 1CYGA 4G3YL 3N06B 5C0IA 3AG4B 2Y6SC 4WZ9A 4KQ4L 5ACMA 3FQTB 2VW6A 3K6SB 4MDIB 2HFGH 4UYPA 4MHHG 3QH3A 1QFOA 5GGVH 2PYFB 2XY1A 4NCC2 5J5EA 1FCGA 1NIBA 2LGNA 5FLUA 3V0AC 3HB3B 4L2LA 4FQIH 1V3MA 1TCRA 1ZHKB 4ZXBA 1H15B 2FB4L 2QFPA 3GMQA 3EHBB 2IBZX 4MLIA 3M1OA 1IC7L 4GAGH 3BZ5A 4MDJB 4P5TD 2WLNA 1RZJC 4QRTA 1M6OA 1SXBA 1U2YA 3QG6B 4M61B 3CCHB 3SB3A 2QADB 3FRPB 2B9AA 4LASL 4XPBL 1MW3A 2YQ3A 1PBYA 4PJIE 5INCA 4F15B 2ZXQA 4EKJA 1NGWB 4XNUH 1WAEA 2EDBA 4PJAA 3VWJC 5B38G 4BGDA 1A2YA 1EXUA 5KTEL 2ESVA 3L95A 3D2UA 1XBRA 1XV8A 2IH3A 2IG2H 3MLPA 3FU9A 4XMWA 1WPCA 5FYKU 3C6SA 2MNUA 1FPTH 3BAIA 4OSUH 3QIWA 3US1A 2R56L 2ZJSL 3MUZ1 3U0WL 1AO7E 3RU8H 5GZNA 4P57B 1UQSA 1Y07A 4NM8H 3U79A 3LS5H 3MREA 1G7QA 1D6EA 4PG9B 3ZDWA 2E4TA 4WEBL 2VZUA 3N91A 2WC7A 1MFAH 1G9MC 3DX0A 3P4NA 4LLQA 3UTTD 3X1NA 4KK9C 2DM4A 4L1TA 1BIIB 3TO4C 5DZOA 5B4MD 4LCWB 3ZZ1A 5JW4M 3LVEA 1EXGA 2D8KA 4S1DC 1DO5A 4LLDB 3CFJB 3R0NA 2XFGB 1J1OL 4BFNA 4IBWA 4JFQA 1P4BL 1V7ML 2FBRA 3IFOA 4GAFB 5DURB 3TA3A 1JZGA 3F6IA 5CP7B 2A6IB 4L3CB 4UWQB 4IU2A 2A83B 4YSEA 1IBHA 3P54A 1Q9OA 1A22B 1NUGA 1X5MA 2XN9A 2YD6A 2ZUYA 4MCZB 4NM4H 4PV9A 3SE8L 1ECZA 2XWTA 1UWGH 1LO3H 4BFIA 5JA8B 1J88A 3J8F7 4IOFD 4DSYA 1S78C 2VLKD 3MR9B 3KE0A 4DTGH 5LXVA 1BX2A 3IGLA 4X4YA 4LO9A 1ZT7A 1I8KB 4F9LA 1PQZB 4X5XB 1BZOA 5L4MA 2OMWA 5EHFA 1ET8A 2BVQB 2RMNA 3VWJB 1A3QA 1IT9H 4N5EC 4DPBX 5HI3C 2VITB 4HC1A 4JR9L 5E94B 3HE6A 1JV5B 3BKCL 1YEKH 1CDBA 4PLJD 1HILA 2JK5A 4DVBB 4XNYH 1XZ0A 3ARDA 1ETJA 3NZHL 4HD9A 4YL9A 1G5GA 3L5HA 4UOW1 3T0BA 1HWGB 5C0FB 1KNOB 3CHRA 2UVEA 4G72B 4C56E 4ZMPA 3TEWA 4L3EB 4KKBD 4K3GA 4LSUH 3QULB 2JI3A 3AY2A 3BAKA 1BEYL 1EGJL 4M4RB 5AFAA 3ULUE 4OCYH 2L0DA 1DJYA 1IZKA 3HNVL 1H6EA 5TF1H 3HG1D 3RUGB 1NLBL 5FKPA 1T20A 3AQDA 1YY9C 3OLDA 3N42B 2AV7B 3TO4B 1A7OH 3L3GA 2C9XA 2XV2A 3KPOB 2CGZA 4JQIA 1KB5A 3GM8A 4GKSB 3Q3GB 3QZWB 2J4WL 3BVDB 1JTTA 5DEFB 3DYOA 3OZ9H 1HYSD 2Q20A 4IEFA 3PPEA 4GO9A 3ECBA 1MCOL 4OZGE 2IAMC 2M83A 5IM7B 5I1CL 1OOWA 1Z66A 2H2SC 4DZBA 1EERB 1TVBA 5IF0A 2IV8A 3D30A 1Z5HA 2F74A 4F7KA 5BVJB 1Y6NR 2Q7YB 1A4KA 1S9WB 3Q6FA 2X89D 5GS0D 3VRJA 1GGCH 4QOKD 3ZW3A 1JOIA 4MX7A 4OVVA 3HRZC 5DZVA 2CA4A 3BEVA 3OMNB 2DBLH 2Y06L 1DQMH 1XGPA 1KCBA 1SZNA 1R3KB 3WTWA 4X5QA 5HHME 3ARBD 5IVNA 4WY7L 2XXMB 4GQ9H 2OMUA 5JDSA 1SY6L 4R4FH 5CS7A 5T3XH 2PPCA 3VXTB 3FB6A 2J8UF 1ZT4B 5FHBH 1M05A 4U1IA 4FG6C 4P2CG 1EX0A 4LHUD 4UQ3B 1CPUA 5I74C 4APXB 2QGBA 4HJJH 4MYPA 4XHJD 2BOLA 2DEXX 4DERA 1V3LA 3KD4A 1RY7B 4J28A 2XWRA 1XD0A 3F58H 1MHCB 3FFCB 3S48A 4NQSB 1IQDA 1NMBL 3FW6A 3KPQA 2VR5A 3CDYA 2X4PB 2H0PA 4JAMA 4Y4FA 1E6OL 4MNGE 1AXSA 3L3IB 2FD6H 3HI6L 1LP9F 1QKZH 4YDLC 5D6CB 5F2FA 2J21A 3IMVA 3UGXA 2NMSA 4NC2B 3KGUA 3TBYA 1F11A 5JZ7C 5ANMA 4HK0A 4B5ZA 2OMYB 3B34A 4AVJA 2IAMB 4E9SA 1Z3GL 4J4PD 4NO3B 3VB8A 1AOZA 1NDGA 3UIZA 1AXIB 3BPCA 4GUPB 3VXME 2VH5H 3HS8A 2P80A 3H3BC 3UTSB 4JRYA 2CHWA 5EN2A 3S6CA 3ZMEA 4BZ2H 2C34A 4H13C 5EF1A 1E6JH 1MPAL 3UAEA 2RCSH 1UFGA 3KR3H 5JIDA 4PJ8C 2EXSA 2OSWA 2JTDA 3ESVF 1Q0XH 5IZ7A 3PREA 5JHMA 3ELAT 4HV8B 3BKYH 4PS7A 4UM9B 1FRGL 2WM0A 2NUTA 2ZXWB 4LVHC 2VIRB 5L7XH 3Q2CA 4BDVA 2CALA 4JHAH 5ESVA 5CF3A 5E9DB 3NRFA 5HPOA 3PGDB 5FFOA 3K6NA 1ZS2A 3IU4H 2GBVA 1D5ZA 3Q8FA 5I74B 3U6RA 5DSCA 2JB6B 3D2TA 1JWMA 4KQ3L 4CDGC 4NQXB 1FAIL 4GMTL 3V0DA 3JT2A 4YXHL 2F1EA 5DQDH 1EIBA 1V5JA 5BOPA 3K6OA 2K9UA 4QRRE 3FS9A 1ANUA 2YD7A 4YDLB 3N6YA 2VR6A 4G7RB 4ZFFA 3LQMA 1PS3A 5BCAA 3D09A 2EC9T 2GJRA 5H35B 4YDNA 2VDPL 1G7PA 4MQ7B 2QDWA 5L8LB 1TEYA 3NJLA 3IPEA 3ZIMA 43CAB 4L9DA 1A21A 2D03H 3ZE0B 3L13A 5EORH 5J06A 2BIQA 3PV7A 3QO1B 2R1WB 3JYBA 3GSRA 4LIQH 2RGSA 3IS1X 4LPWA 3E1F1 4ZS7H 1A1MB 5KYUB 4GW1B 3MXWH 2DI9A 5HYSB 3H1ZA 4HEPG 4URTB 5GGSB 1A64A 1BJMA 4QRQB 1MREL 4FQXD 5LBGA 3CLWA 3BSGA 3HZ3A 1TFPA 2BH0A 2OP4H 2BWIA 3FT1A 5AOMA 3LQAL 2O30A 2PTVA 3DUSA 4H8UA 3TTYA 4HIXL 5CEXB 3T6VA 4J27A 1BQHA 2FJHA 4UT7L 3FOMB 3PP4L 2BDNH 3SYAA 1JVOA 3OB0K 3GPEA 1NH6A 1ORQA 1B3IA 2VW7A 4JFUA 4N6QA 3D0VB 4LSPL 3SO5A 4A1RA 4G8FB 1WBXA 2DQTH 1U6AL 4DW2H 3VH8A 2ZUXA 2G30A 2F5AL 2R0LL 1IGYB 4DK3A 2X2IA 4I1RA 2H1LM 3FSWA 3MUGA 3H0TB 4PJHE 1DFBL 4OCRH 1ZA3A 5EIIA 4YWGH 4W9LC 5DJDA 3STZB 4N8CL 4TNVF 4LAJH 4R7LA 1Z5LA 1YY8B 3GEWB 2E9IA 1Z0MA 4DOHB 4R4BA 1I1FB 3IRZA 3CN4A 3TEUA 1S9KC 4H1LG 3HUJE 4A67A 1U8KA 2KZKA 4XNAA 5DMGD 2W59A 2X41A 2K0RA 3RVUD 3QZPA 3MLYH 1KIPB 4G8GE 4UUJB 2F9BT 2ZKWA 2I32A 1LVEA 2R15A 4X98B 1XR9A 4JHBA 2Z8WC 1FVCB 2Y36L 1BBDL 2D73A 4N2KA 5IR1A 2HVBA 4LFHG 3FQUB 5H8DA 3VFPA 4F37F 1AQMA 1PIFA 2CSPA 4HKXB 2JFCA 4AGNA 3KL3A 4YX2H 3APCA 1UZ8A 3IFNH 1HHJB 3M8OH 3VD4A 2FGZA 2YAPA 5G2NA 4Y4HD 3QDJA 2JE8A 4PI2A 4E9YA 5HVGB 1RPQA 4CBPA 1NFIA 5FCUL 3WNPA 3DMMA 4W81A 2WXPA 3GJFB 5F88A 2YEVB 4GRWF 3SDAD 3Q1SL 1IGCL 1HHIA 3Q1EA 2QJDA 4XVJH 3MNDA 1NGYB 4ISVA 3UTTE 4PRDB 5EU6A 5SWQB 2F7QA 5C0BB 3ECUA 3D52A 1E5ZA 1XB8A 3N40P 3T2OA 3W11D 1AXTL 4KPHL 3SY0A 5AKVA 5ESQB 4YR6A 3O8XC 4M93C 1JK9B 1D6VL 1MIMH 2VJXA 4I13B 3GJFK 5ID1B 1DJGA 1WAAF 3JTBA 4J6RH 5B1CA 5GS0L 5DGQA 3EOAA 1TQSA 2OI9B 1X6NA 4XO5A 1M7DA 2IH1A 2RTTA 5EC2B 2CDGB 1JNHB 1XMEB 1GSMA 4R8WH 3UERA 1PLGH 4GKNA 2D3NA 4PBWD 5F7YC 4A7UA 1IGTB 1KLGA 4XBPA 5IFHL 4CGTA 5CCGE 4JZJA 3EGXA 4FYTA 5IK3B 1FHNA 1EH9A 2B1AH 2RQEA 4JM2F 4JS7A 3F6LA 3H42L 5TDOB 2CMRH 4U1NB 5DMIH 5I18L 1KV3A 3CSYB 4P4RB 2PWHA 2X4RA 3I6LE 1MFDH 2I85A 4HIJA 5E6ZA 5A3ID 4UQAA 3N44B 1J7VR 1MJJB 1G7IA 1N70A 1U93B 3BIKB 2Z31D 1WFUA 4HPYH 5IVXF 5D55A 3RL2A 1IAOA 3MJ9L 2VERA 4RFOL 1UXWA 4TSBL 3TLRA 3GB7B 1OTUD 5IG7B 3J7HA 3BT0A 4F7EA 4PJXB 2FEEI 3QIBC 2W94A 1PEWA 1USZA 1S7RB 3HG1E 1S9VB 3M17A 4H44C 3GMOA 4QT5A 1DO6A 2YPVL 3L3KA 2Q3XA 3BDYL 4JBSA 4HS3B 4OLUL 3T0ED 1LE9A 4M93B 1AIFA 4Z7OE 2AW2A 5DJ2B 1SJHB 3MJ7B 1RVFH 4JGJA 5DS8B 4A2FA 4N90D 1T5WA 5EWIL 3WXWH 4FQ1L 1S7VA 1Y1DA 2ROYA 1MG2C 1U8PA 3AW5A 3K4DA 1P6FA 2G5RA 2MKWA 4LL4A 2PR4L 2AABL 1WWWX 4FNPA 2E9JA 2F7IA 2VAJA 4U05A 2BOBA 3NABL 4HT1L 4W4NA 3GM0A 1JUFA 1NBYB 2EEAA 2O5ZH 3HNSL 2HB0A 4FD0A 2VXQL 1A1NB 4RDQF 4NBZB 5CEZD 1D3CA 1WC7B 1J9RA 3WLWD 2BSRA 1B0WA 4XNQA 3PWPA 3MLWH 2ZQKA 3T3PB 4G6FD 4ZW6A 4WU5A 5D5ME 4AL8H 4JO4L 3ZDZE 1JF6A 5C7XL 4P5KA 3GSXB 4G1MB 4ZQTA 4IKIA 4N8PA 4HFWB 4BE6A 3WL9B 1RI8A 3EO0B 5CN1A 2BCKA 3BP5A 4LNRA 4PP1D 2ZG3A 4D8OA 3L3OC 1YEFH 4DH2A 3MV8B 3G08B 4JY4A 5T1KB 4MMZA 1VADA 3KDMB 4ZMQA 1E9OA 1G6RH 5KBDA 3UBXG 2C9RA 2QPSA 1S9XA 3HMXL 1JTPA 1UD2A 3KLHC 3MRPA 3IDJA 4FFZL 5DD0H 4LL9A 3VI3A 1A3LL 3P3UA 3BPLC 4JCWA 4KKLC 4U1KB 3RHWF 3STLB 3UC0H 2R2EA 3DX8A 1I7UB 2AJYL 4Y1AD 5EIVA 4R7VA 2EEFA 4V2BA 3V6OE 5T1MA 4MBOA 5EOTA 2BVOA 3JWNH 1GYUA 2NY0C 5K9QI 1NC4B 2YAOA 4I77H 4X5WA 3ZHNA 1XGUA 5G55A 2F7PA 3HR5A 3CFCH 4MXWL 4ZW8A 2VZ1A 2CRYA 1D7CA 2C9UA 2FAUA 2P8PB 3PL6C 4KO5A 4NQUA 2X1OA 4WWNA 3CLEL 5DHMC 4BCZA 4C4KO 5HDBF 3EGDB 2X4NA 3MAWA 4GAYB 4YLQT 5IROA 3MJGX 2DWXA 1ZVNA 2HLAB 3HB3D 4WWPA 2CE6A 2GEEA 5I5MA 4LLVA 5IOPA 3DROA 3TBCA 1IE4A 4MD4A 1VHPA 4OJYA 1MH5B 2AEOA 2AJ3B 4FQQB 2APXA 3CDZA 5GRJL 2XA3A 1P1ZA 2CU9A 4F93B 4XO9A 2QPUA 1E7UA 5HVHC 2QADD 1UURA 1C9SA 2W38A 3TPUA 2AXFB 3GMMA 1TJGH 4PBDA 1MUJB 3GC3A 1KXTB 3EUDA 2DWTA 1U8QA 5HTSA 3BUBA 4PWJA 1QI4A 3BZEB 2XRAH 2BNUA 4F7TB 1IARB 3S8GB 3PAUA 5CZRA 5EZIL 3L3OB 2F6AA 4WNJA 3QUMB 1H6FA 3EYQD 5D72L 1FF5A 4UANA 5DJAB 1Q72H 3EO9H 5K59E 1FNGB 1NMCC 2ZF8A 2QZQA 3D3VB 5LXGL 2C1PA 1OZUA 1DVFD 2DWDB 5AVRB 3SKMA 5A2IH 2NY5H 1JZEA 4Q9QH 1KDIA 3BPLB 1J05A 3QR1A 3NFPB 1FNHA 1RZPA 3V0HA 2EINB 3LKSA 1KFAH 4PJIF 1G7LA 1WIUA 3MRCA 1DUZA 3LDBC 4IOSD 2VR4A 5ISZB 2BCMA 5BV7C 1EZUA 1LDPH 4LCWD 4GEJA 2Y6SD 2Q2EB 1AD9B 2B4CL 5E2TH 5TQ0L 1D5RA 1R5WB 2DQEL 1VFBB 3PL6B 2DEYX 3HE7C 4PJ7A 2AJZB 2E6JA 2UV3A 1W16A 2GSIB 3QXTA 4OAWB 1XF4A 2OZ4A 4XCEB 5DURD 2CHZA 1JNLH 3R06A 3PQYE 4P46C 4RGMB 2V8MA 1ND0B 2DIJA 4PJ9A 4YHLH 3WS3A 5BO1H 3V6FB 4DIXA 3DVIA 3LHPH 2VXUL 3VVWA 5JHDA 1A7PH 5EOQL 3IDNA 2FJGB 2HKAA 4MCYB 4JFZL 2EYTA 5DTFA 2XWDA 4HIIB 5IW6A 4MMYA 3HLAA 2I27N 1NCTA 3UGUA 1KY7A 2YJQA 1BGXH 2XZCL 4PM1A 2FX7L 2HA1A 3KS0J 4PJCB 2EH7H 4LRIA 5HVHB 3OKMA 3ILDA 3O45A 4I2XB 4XMKL 3LZPA 1QA9A 2W9EL 5CJ8A 3T6XA 5C71A 3NA9L 4K3EH 1KJVB 3DX1A 4HUWA 3VWJD 2WQXA 1L4IA 5T5FL 4EI5A 3VG0H 2WB7A 1RFDL 2IGLA 4HH8A 4OJDH 2I7OA 1C12B 1UKQA 4YVNA 1MAML 1XCXA 1NMCB 3K2UL 4FYRA 2GJ6B 4G8EB 5AAMC 2JLPA 5F3BB 1KPVB 4S2SB 5HHPB 4OT1L 5IQLA 5LBSL 4R0LC 1NGQL 3RWGA 4AQ8C 3AXIA 3GMNB 3TF4A 3AM8C 4L3ED 4ORZC 3L5WA 3S4SG 4G6MH 1VACB 2W60A 1XSJA 2FHFA 2CLRA 1J8HB 3DSNB 4YN3A 5E00A 4CA4A 3OKEA 2ZXCA 5D9SA 3LDBB 5E9AA 1OAQH 5BV7B 4J3OH 4KHTH 2NX5B 3TO4D 1GOGA 3C5ZC 2HKHH 4PJBE 1G6VK 1YECH 4S1DD 4WKZB 3V4PA 4FXGC 2AZUA 4OZIA 4X7TA 3HE7B 4BQBA 1DJSA 3LS4L 4I89A 4P23C 3MJ8A 1ZA6B 3REWB 4P46B 3CHXA 3DXAA 5A40E 3ME0A 2XKUA 2DQUL 5CBEB 1OWRM 3QNFA 4CL7A 4HMEA 3OC8A 2PW1A 2OZ4H 3FTSA 4IKLA 4XBGA 5AYTA 3ULUF 1SVZA 3QDME 2XA8H 3P3YA 4JEGB 3OXSA 4KH9A 4GQQA 1S78D 3KS0H 4KUZH 4NFCA 3SE9L 4AKOA 2KQMA 4RRPG 1EEZB 2YIHA 2YSSB 2HVKB 2H32B 3AAZB 4NN5C 4OGXH 4Z1PA 2GPZA 1NC2A 2AEPL 4JG1L 3PHOB 5DFWH 4N5ED 1A0QL 1Q0YL 3E2HC 5HI3D 1KDJA 1YEDB 3MRIB 2JKWA 1X3DA 5I1HL 2B16A 4XP5H 3GSOB 2A73B 5GRUH 3QWRA 4N5UA 4QRUA 1GC1C 2ZP8A 4F2MB 3VFVB 1J0JA 2UY7B 1L7TH 4R0LB 4BK5C 2CJUH 5GGRY 1ZGLM 4G42A 4NRYB 1A7NL 3U2JA 2Y25A 4ZOBA 1SUHA 3FFCD 3KPSD 3KPRB 5EUKA 3TN0A 5MEOB 5EU7E 4U6YA 1NBVL 4XVUC 5I2IA 1B2WL 2XKSA 3R1GH 3QJTB 4KXBA 1HDMB 5IIEB 3AG2B 3IETA 1A7QH 4RISH 1OF2A 4YGAB 5E6IC 2QPDB 3C5ZB 3HW7A 2CHNA 4WVRA 4YIQB 1MQKH 4FXGB 5J6GB 3I50L 4GMSH 3GO1H 4LMQE 4XN1A 5E8NB 3RWCA 3T1FA 1YQVL 5AW2B 3RTLA 4XE0A 2ZOKA 4K7PL 4I1PA 2R9HD 3WN5B 2YA0A 5CBAB 3L7FB 3BO8B 4LOFA 4HJGB 1FORL 2IAMD 4Z8FH 2HMIC 3ZHFA 2JSFA 3V4PH 2P5WB 3NN8B 2CO6B 5CEZL 3RDTC 5IEHA 5IBTH 2P24A 2JKRM 2R1XB 3ARGC 3H7BA 5IVOA 3UTSD 2JB5L 4MNQA 3T9WA 4YFEA 1AG0A 4MS8C 4ENED 3QHZH 4XPHL 1F13A 2C4XA 3BUYB 3SYCA 3O2DA 4JRLA 4IHOA 2G75A 4NN5B 4U1MB 1KB9K 1SYVB 4AK1A 5EEZA 5GJTL 3E2HB 1AGDA 1IEAB 3G6JB 4QYOB 5E8OB 3MGAA 5HDOA 5SWZA 1CGUA 1I7TB 3U9UA 4G3YH 3EXJA 1EEYA 4KQ4H 5E8EB 3GJEB 3EF4A 3IJSA 4NPYA 3TBVA 1GKOA 2BW4A 1E4HA 4OZHB 2AC0A 2KBGA 1FVEA 3NIFE 4CAGA 4KKPA 1HJBC 4PJFB 1E5UI 4OKVA 1JDCA 2G9HA 5I1DA 2R27A 3NCEB 4WFEE 2FB4H 2VSKB 3KXFB 1JRHL 4G71B 2IGTA 2V2WB 5K5YA 1IC7H 4GRLA 4JZOB 2VQTA 3T0EE 1XSKA 2BJML 2MH4A 4DUWA 3MBEC 5E6IB 3T4AC 4I5BB 2AQQA 3OQ3B 4BWWA 2XWXA 3BXNB 1ZHBA 4LASH 4XPBH 1UGNA 4NXKA 5C0AE 4ORGA 3WYRA 15C8L 4Y5YA 3GXFA 3CAFA 4EN3C 5JZ7D 1USQA 4NQDB 4AG4L 1CFBA 1PX3A 4YUEL 2WVUA 3O41B 3OJ2C 1ZHLB 3LIZA 3QFDB 3RDTB 5DJXB 4Z3JA 3ARGB 4X6CB 3RIAK 3H3KA 2BZDA 5FO9A 4LSVL 4ILDA 3WNJA 4JKMA 1K3ZA 3AS1A 2GK0A 1XGQA 4ANXA 3PF2A 1BLNB 4KWUA 4LSRL 4BHUI 2R56H 1ZIBA 4G1EA 3RIFF 3H9SE 2XWEA 1W2KT 2JKLA 3NK4A 1J0IA 1BZ8A 4Z7UB 4JFXA 1ZLDA 4HVBA 4RFNC 3KBPA 4ZMOA 4Z0XB 3DVNB 4EVNB 1QRNB 1OGAB 1DBAL 1P4BH 1V7MH 5ICUA 4JY5L 1BVOA 1IUZA 1KY6A 4HGWA 1M2VA 1KTKE 2BS8A 2VL5A 3SE8H 3TP4A 3FFDB 1B90A 1UA6H 2JJTC 2FWSA 2WWNA 5C0GB 2BVEA 2EQDA 1E4KA 2X9YA 5BRZA 3EYOA 2JJSA 1LXMA 3MBEB 4GAAA 3T4AB 3W81A 4ZFGL 3CD4A 1U58B 4QTIL 3RY6A 4BH8B 1SY6A 2F5BH 1EAPA 5H37A 1JXFA 1I31A 3NP4A 4ODHL 2YD0A 1IE5A 1YUKB 1T0OA 1INQA 4WW1A 4EN3B 4AIZA