2VW4A

Nitrite reductase from alcaligenes xylosoxidans - 2 of 3
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
b'ADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title On-Line Optical and X-Ray Spectroscopies with Crystallography: An Integrated Approach for Determining Metalloprotein Structures in Functionally Well Defined States.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw4A02
4E9WA 1V10A 5PAZA 2AANA 4HZ1A 3ASNB 1NWPA 3OM3B 6PCYA 2VSKB 2H5UA 2PPFA 4QLWA 1PLCA 1ZV2A 2QDVA 1ILUA 5PCYA 1GS8A 4AKQA 1J9QA 4KNUA 4G7SB 4EF3A 2XXFA 4CSZA 1JZIA 1OF0A 1AZCA 1ZIBA 3MBWB 2CAKA 3CVBA 1FWXA 1BXAA 1RZPA 2PPDA 1KCWA 2PPEA 4HALA 3AZUA 3PCYA 1JZGA 5B1JA 1PAZA 4GP8B 1F56A 3FPXA 3DTUB 4A2FA 3AG3B 5F7BA 2XYBA 1BQ5A 1ZIAA 1KBWA 2QT6A 1ZDQA 4HCFA 4KO6A 2DV6A 2PP9A 3ZIYA 3X1GA 2LLNA 3NYKA 1ZDSA 1KDJA 3S3CB 3EHBB 3SQRA 1SHWA 2TSAA 4GYBA 2IDUA 2AZUA 4RH4A 1E5YA 4BDVB 1AOZA 2GC7C 1GS7A 5I6LA 2VSMB 1ETJA 1N68A 3HEIB 1J9SA 3NP4A 1SF5A 3CDZA 5AKRA 5B1AB 2AZAA 2CCWA 2W8CA 3ERXA 2IDSA 2FT6A 2YAMA 8PAZA 3TU6A 2P80D 1OCRB 4YSTA 3EH5B 1GY1A 1IC0A 1BAWA 2FWLB 2X87A 3SBQA 2HXAA 1SHXA 4HAKA 1CURA 4QKTA 1TKWA 2IWEA 2XX0A 3FSAA 4AKPA 2XLLA 4JHUA 2EIJB 4A67A 2XWZA 1SNRA 2GIMA 5I5MA 2YARA 4E9SA 4A2EA 4AZUA 3EH3B 1MDAA 5D4IA 4JHVA 5B1JC 2B3IA 3ABMB 4DP9X 1JVLA 1J5CA 2GC4C 3FQ1A 1NWOA 4DP1X 3X2QB 1JZFA 3UAAA 2IWFA 4AX3A 3CVDA 1M57B 5I5IA 2UXGA 2XUWA 3PXLA 4KNSA 4KO7A 4M4RB 1SDDA 1NDTA 3FU7B 3NJHA 7PAZA 2I7OA 1IKOP 4FA7B 5D4HA 2OJ1A 4TXVB 1CC3A 1I53A 1RKRA 3FSWA 2XV3A 4Q8BA 2YXVA 3CVCA 1OV8A 1W6LA 4YL4A 3SBRA 1VLXA 3UGEA 5B7FA 1QLEB 1GW0A 1OE1A 1A4AA 3X1NA 3NJKA 2UXFA 4BXSV 2BWDA 3NT0A 2HX7A 3V9EA 3IBOA 1BEXA 4E9RA 4Q89A 1J9TA 3FT0A 3QJTB 1BYPA 1AZRA 3V9CA 1DZ0A 2BP8B 2YAHA 3FSVA 3WNIA 2UXVA 1MG2C 1XB8A 1FA4A 4A2GA 1EZLA 2FNWA 4G7QB 5B7EA 5TK2A 2PCYA 4NAJA 4YSOA 2R7EB 4YSPA 2BP0B 5F7AA 1HAUA 1YLBB 3N55A 3QJQB 5E9NA 3CG8A 3UACA 1TEGA 1JZHA 2FT8A 1W8EA 1JZJA 4NERA 3NJJA 1E5ZA 2BHFA 1ILSA 2VM3A 3ABLB 2YAPA 2IAAC 1GS6X 2MRYA 2J5WA 3KW7A 5I6PA 4G71B 2DYSB 3X1EA 4M3HA 1XMEB 1XB3A 4P5RA 2TSBA 7PCYA 1MG3C 4E9YA 1AZUA 2AFNA 1XB6A 2Y69B 2HLEB 3HB3B 4ENZA 3PAUA 4DP0X 3OQRA 3S3DB 4GY4A 1NIFA 2QPDB 4ZK8A 4BK5C 4DP4X 4GXFA 2YAFA 4HHWA 5I6NA 3WI9A 3D12B 2H47C 2WSDA 1OOWA 3GYRA 5ANHA 4WKXA 2VM4A 3AG4B 3FYIB 3L45A 3PAZA 5I28A 1CUOA 2HZHA 3FQ2A 2DYRB 3TBCA 2IWKA 1KV7A 2YAOA 1X9UA 4DPBX 1AG6A 2PP7A 1BQRA 1E30A 4DP6X 1A4BA 4UF7C 1AZNA 1IBZA 4DP8X 4DP5X 2DY2A 4E9TA 1JXFA 3WNJA 1ASQA 2IDQA 1OCCB 2FTAA 3UADA 4G7RB 1X9RA 3IN2A 3ABGA 3QJRB 3NJIA 2J55A 1KCBA 1E65A 4KOBA 4UAHA 2FQEA 1JZEA 2NRDA 3T6ZA 3SBPA 5AZUA 1BYOA 3UABA 3JT2A 1WS7A 4PAZA 4N4YB 4F2FA 1PNDA 2Q5BA 3WIAA 3PAVA 1GYCA 2OV0A 2ZXWB 4F2EA 2HRHA 1KGYE 3CDZB 3H56A 1L9SA 1SJMA 3NSDA 4A68A 1ZPUA 3KW8A 3FU9A 1NINA 2GBAA 4DPAX 2EIKB 1R1CA 3AG1B 2XV0A 1PNCA 1OE3A 1URIA 2XU9A 2H3XC 2WO2B 4GP4B 2CBPA 1N70A 2EIMB 3UAEA 4X4KA 3QJUB 3NJMA 3RYMA 2ZWNA 3CZUB 1SF3A 5IY5B 5B7MA 3GXUB 2I85A 3FS9A 4JKNA 1BXUA 2IH9A 3AG2B 1WA1X 1AQ8A 4N8UA 2XXGA 4YVNA 5FC9A 2B08A 4MFHA 4L0PB 1PMYA 1IBYA 4HHGA 1SFHA 2VW6A 3DKHA 2GI0A 3NP3A 1UATA 2GSMB 2J56A 1AG0A 1SDDB 3PLYA 2RACA 1CYXA 1JXGA 1ET7A 4BWTA 1BQKA 5I6MA 2UXTA 1TEFA 1WS8A 2YAQA 1WA0X 1AACA 1ET5A 1NZRA 2ZONA 3NSFA 1PZBA 5B1BB 3S3BB 4WTQA 1GSKA 2FQFA 3T6VA 1L9TA 2GHZA 1ID2A 3OMAB 4W9ZA 2OCCB 1AIZA 2DWTA 1RCYA 5I5JA 4KO9A 3FPYA 1AZBA 3OD3A 4BXVA 1J5DA 2BZCA 2JKWA 3QJSB 4BWUA 1M56B 3S8FB 4E9QA 4AI7A 1A8ZA 3T6WA 4E9VA 3FSZA 2VW7A 4DPCX 4YSCA 1JERA 2BO0A 1A65A 4DP7X 2Y1AA 5D4JA 2AVFA 4F7KA 6PAZA 4BDVA 4CSPA 2BW4A 2E86A 1GY2A 1AR1B 2PPCA 2PPAA 4G70B 2BW5A 2HX8A 2GB2A 4UANA 4AKOA 1TU2A 3IEAA 3IN0A 1NTDA 3NJNA 1M9WA 3TASA 3QQXA 2HRGA 4KNTA 1NPNA 2CUAA 2PLTA 1T5KA 4YSEA 1HFUA 1KDIA 1IUZA 3N2JA 2VN3A 5AFAA 1PZCA 1MZZA 9PCYA 4K9JA 3NSCA 3X1FA 1L9QA 3FYEB 2XVBA 3T9WA 5TK4A 1L9OA 3ZBMA 1QHQA 1W6WA 2MTAA 3BQVA 4YSDA 3T71A 4YSUA 1AS6A 1A3ZA 2YQBA 1PZAA 1GR7A 1AS8A 2UX6A 3FQYA 3NSYA 2FQDA 2IDTA 1V54B 1SFDA 3TA4D 1RZQA 2Q9OA 2VMJA 1JOIA 1PF3A 3ABKB 1B3IA 2W88A 1EHKB 3WG7B 4BWWA 1KBVA 2P80A 3GDCA 2EINB 2QDWA 3NJGA 3OMIB 3FU7A 3X1BA 4W1TA 2EILB 3T6XA 2XV2A 1WA2X 1PY0A 2IH8A 2CALA 3OMNB 4DP2X 1MZYA 3C75A 2JXMA 3JTBA 2DWSA 2UX7A 3EH4B 1E67A 3ASOB 2QPEB 4G72B 5LDUA 2BZ7A 1HAWA 1OE2A 4HCIA 2BWIA 5B1KA 1JXDA 1NIAA 1AAJA 1NICA 1NIBA 1PCSA 3AW5A 3IE9A 3QJVB 5I6KA 3G5WA 4NB7A 1BXVA 4P5SA 3WKQA 4KOCA 1J9RA 1NIEA 1A4CA 3WKPA 1NPJA 1JVOA 2JFCA 1PLBA 2BP8A 3QPKA 3NJLA 4A2HA 1OCZB 1PLAA 2N0MA 2XX1A 1V55B 1WAEA 2HX9A 1L9PA 1ASOA 3EF4A 2X88A 4PCYA 3PPSA 1FFTB 2J57A 2ZOOA 2I7SA 5I26A 3TBBA 5I6OA 2A3TA 1AS7A 4YSQA 1CYWA 2FQGA 2R7EA 2BP0A 1AANA 1KYAA 2VW4A 1ADWA 1L9RA 3U25A 1NIDA 3FU8A 5A7EA 5EHFA 5B3SB 2WO3B 3DIVA 3S8GB 2FJSA 2YXWA 3ZDWA 1OCOB 3AY2A 4HCGA 2IDFA 1DYZA 2CJ3A 2FT7A 2PP8A 3MX0B 4HIPA 4YSRA 3H4FA 4FAAB 1ASPA 2PCFA 4E9XA 2YAEA 4YSAA 3ZX1A 3BVDB 3NJFA 4YVUA 4A2DA 3H4HA 4KO5A 1QNIA 4GP5B 1ET8A 4YSSA 4A66A
chains in the Genus database with same CATH superfamily
3D0VB 4M00A 4ETQB 2V2TA 5PAZA 2I26N 1JK9A 1BBJA 1TVHB 3C9NB 4NZUL 2OX5B 3OM3B 2E47A 3ETTA 5FW6A 3ZR6A 4F7EB 4QAWA 1ZVYA 2O93L 32C2B 3KNBB 4QLWA 4MJIA 5F96H 1OHZA 4DFIA 1OD9A 1QKZH 5HY9A 3WAKA 1IGJA 3BVVA 4HUWB 5CCJA 4PTUB 3ML9A 3TEWA 4M1CD 3L3IB 3HMWL 2A77L 3R0NA 1ZIBA 4MQTB 1G7HB 4NQCA 3TZVA 4YHIA 1HNYA 5AD0B 4AM0B 1JGVL 1YN6B 1FL5A 1U8MB 4ZO8A 4APQC 4RIRB 5FOBB 1E2WA 5HHQB 2PNDA 1KPVB 2CDFA 4NC2B 4OGYH 3W39B 4OIBA 1MHCA 1DCLA 3ZRSA 5EIVA 1M05B 3HRPA 3FN9A 3LZPA 5BS0E 1YJDH 2UUDH 2BK8A 4HCFA 2GJZA 3D69B 3MV11 4JFXA 5EU6D 3P0VH 3K0YA 1HKLH 3TO4A 4L1LA 3C2AL 5EC1B 4N6QA 1QFUL 1EBAA 4ANVA 1SHWA 3QYCA 4GYBA 3VXPA 4XP1L 4BDVB 4I0PA 5FDWA 1DFXA 5TJWK 5IQMA 2IPKA 3QUXA 1X7QB 1N68A 5KAQF 1A9VA 5IT2L 3ZTJH 3SE3A 3BVNB 3EHBC 3ERXA 5HHVH 3U0WL 3WY4A 1X5AA 8PAZA 4DGIH 2PXYA 3QNFA 1BWMA 3GLAA 1QW9A 3PQYA 3KXFD 1K8IB 3MJWA 2NDFA 2R29A 2WUCL 1XIWB 4RGNB 1OTTD 4Y9BA 5DYOA 4JK0D 4NFBA 4GIOA 4PJHF 4PJHA 4WV1A 4PGEB 2ZX7A 2EDTA 2V2XA 1EX0A 3HMXL 1AQKL 3GEFA 1KXTA 4MLIA 1JVLA 4M7ZB 4PJEF 1OAQL 2ZKHL 3BP5A 3IAQA 3P4MB 3OJVC 3DX9B 1G9EA 1QW8A 2VTFA 4J27A 4GSXA 4W4NA 4YWGL 3VXTB 2YUVA 3ORJA 1ZA3B 4FKEA 3ARFC 3MRRB 3SB3A 1U3JA 3AXHA 4EI5D 1JIBA 2CH8A 4NSKB 5JW4Q 2HFGL 5KWYC 2MNWA 4KRNA 3SDCD 2R2HB 4U6VL 4JY5H 5HDOA 4DAGH 4YAQB 1IKOP 3N3EA 4Y2OA 1OTSD 4TF4A 4BUQA 1QFWM 2VDNH 2BNQA 2IXQB 4LVNB 1Q0YH 2ERJB 4UQBA 2AQSA 4IEFB 4FL4C 2F7PA 1PX3A 3VFSB 3IF1B 4DGWC 4K7PX 1OY3B 1CE1H 1L9NA 4I18C 2ALAA 3QRLA 4IBUA 2W38A 4R90H 2CKBA 3L3JB 1DJGA 3DDFA 3O8XA 3DBXA 4BXSV 2YGQA 5KANG 4QRRB 3FU3A 3ESNA 1R5VB 4LSVL 3FHQA 4NO0B 2W1NA 1XCXA 2WKOA 3KBPA 4A37A 3UIZA 4BIKA 3CDFA 5FWQA 2VDNB 3J07A 3BP6A 4UV4L 5EMYA 2X2JA 1YECL 4FHJA 1FDLL 1DQDL 3QCTL 2VMFA 1P69B 3V0EA 1CWVA 5T1DL 3IE4A 3MRBB 2Y2TA 4OQ1A 3FT4A 3GXIA 2Q3XA 1AGFA 1QQDA 1HSAA 1TEGA 2FWUA 2YD6A 2ZUVA 8CGTA 4I1NB 5C0AE 4ZYKB 5K1JA 4ZMTA 3B9AA 1CICC 2A6DA 5CILL 4AJWA 2ENPA 3HI1A 4FFVC 5KBNC 4WWKA 3S98A 4LLDA 4X4YA 1URZA 4LHUG 2XWBB 4BFKA 2DQIH 2NXYB 1ADQL 1FH5H 1IGTB 2ED7A 1CLVA 1BDYA 1MFUA 4LPWA 5GGUB 5TF1L 3S2CA 4DO4A 1AZUA 5CCKL 2Y69B 2YS4A 4HUMB 3MV8E 4O51B 3IDIA 3NFNA 5GS0C 1K2DA 5JHBA 3FBKA 2XG4A 1RZKL 2AI0H 4ZDHA 3IGAA 1E4XI 1UUNA 2R69L 4JKWA 2VDQL 1OF2B 5C3IA 2OMUA 3C8HA 4NCC1 4XNXH 5ICZB 4LMQE 4X7TA 1KV3A 3WE6A 5D1QE 1U6AL 4NUMA 3QYMA 1B4JL 3NFSH 4F8NA 2VM4A 4IJ3C 1A6AA 4S10A 3AAZB 1IC7H 1WCQA 3PUCA 4B7IA 1BLNB 4BRJA 5E00B 5E6ZA 1NCAH 2ZPKL 4IU3B 4A2MA 5TE4H 1T2QL 3VXMB 4DZ8B 1XH0A 1KGUA 1I8LC 3CX5K 5KJ4A 1VDGA 5ACLA 5I1IL 1FNEB 4HWUA 3WELA 1FI8C 3BVXA 3TT3H 1HCVA 1RURL 5CEZD 1YUHA 1PZ5B 4LK4A 1SEQL 1X44A 3L9RA 3EUUA 3UEZA 2DRUA 2Y06L 3BOVA 5H35B 1KB9K 1Q94B 5DWUH 3PIQB 5DU7A 5EIIG 4IM8A 5I6XB 4K7PH 4HJIA 1SMDA 1XAUA 4OCWL 1OB1A 1SXCA 3OPZL 4OGQC 4EO5A 2BNRA 4UOW1 3OXSB 1CXKA 2AQPA 3LNFA 2K45A 1FFOA 5IHZB 1BAFL 4G9FB 2ZE0A 1NFDA 3MGOA 4ODXA 3VG9B 2I5YH 4HPOH 1D5XB 1AE6H 4L8SC 3M7OA 4ACTA 2BIMA 2GUOA 1YEKL 3BMWA 2WVUA 1DLHA 1FL3B 1SOQA 1TTRA 5JW4M 1KN2L 1L9SA 2NNFA 4PJ8D 3ZTNL 4YHNA 2R2CA 3TN0C 2W80C 4AEHL 2BNUB 4B9JA 2D7OA 4NHUB 1UZGA 2JQAA 3IVKB 3ZSTA 1GC1H 3S4SA 1CL7H 4IRZA 5L9DL 2E46A 4BKSC 3KJ6H 1E27A 1PPIA 3TA3D 5FO7A 1E3FA 1JTPA 1VB9A 2IEPA 4U6HB 1K4CA 1YC8A 3D0VA 3FT9A 3H7BB 5E08L 1GAFL 1TVHA 2BSED 3C9NA 3KPSE 4PWGA 3OAYK 4UT9A 2OX5A 1K6QH 5G4NA 3X14B 1GGCH 32C2A 3CZGA 4AGNA 2HAZA 4JPKL 2XXGA 2AJUH 4KKCD 4X98B 3SDAD 4HUWA 5FO2A 2OXGB 4FFYL 3D39E 5I6MA 4WW2F 3L3IA 2FCBA 5I0VA 4OSUH 4BSJA 3RZCD 3MUUA 1WS8A 4DTGL 4HFUL 4PV1C 4HK3J 3NDYE 2IMNA 5AD0A 2QQLH 4AM0A 1YN6A 2X41A 1ZLDA 4FDWA 3SO5A 1JDDA 4W9ZA 5MENE 2OCCB 1U8MA 3KE0A 3QDJD 5FOBA 4YQXH 3HG2A 2ODIA 1W0VA 3P2TA 3W39A 4ORZC 3R7RA 3VQ1C 5DZJA 3MREB 4U7MA 3ZKQD 1M05A 3VA6A 1UC6A 1BFTA 5L7XL 3D69A 3MV7E 3T4AC 1HZHL 3P77A 3T6WA 1V3MA 2NSQA 2P5WE 5EC1A 3KL3A 2WBWB 4LMQI 3RWJA 1IGFL 5IB4B 2X1PA 2W07B 3JVGC 2NY5L 4WWNA 3WDHA 2D2OA 1HHGB 3WTXA 1Q9KB 2IFFH 2OP4L 4L2YA 4BDVA 3WBDA 5C2BH 1E5CA 1KULA 5C92A 2VZSA 1F3DJ 3HUJF 1X7QA 2DLFL 2MKWA 5E2WL 1FN4B 3BVNA 5DRXB 2E0PA 2N1KA 3OHMB 4YSEA 4DGYH 1WG3A 5GJSL 1UD4A 1RL1A 3N2JA 1SOSA 1K8IA 3LIZA 1TTCA 4KQ4L 2HPTA 1I9IH 2R83A 2YKLL 1PEZA 1RZ7L 4NUGL 3OG6B 3QG7L 5JOPD 4PGEA 3SKJL 3R7QA 2WMPB 2FJGB 2E8ZA 3MUGA 4K23H 3MBEC 1X5KA 2E7HA 1D5RA 3HC0B 1WFTA 3BWAB 3OAWA 3P4MA 3DX9A 4RMTA 1ZLSH 2EDLA 1KTRL 4UINL 2Z8RA 3VXTA 2AP2A 1ZA3A 1L7TL 5KBDA 4IK6A 5HI4C 1JRHI 3MRRA 4DZBA 1AO7A 3ZVVA 4LLAA 4TNWF 4LOVA 5DT1H 1TZAA 4NSKA 2R27A 4H1LH 4BWWA 3F8UB 1NAML 1U41A 4AWJC 2CO7B 2R2HA 3BQUD 2VN4A 3IDXL 4OCMC 1T6VN 4PJDB 3X1BA 1EJOL 4YAQA 1GJIA 4YEFA 2G4EA 3ZT5A 1BQSA 3C75A 1DSFH 1HYRC 3DXAA 1FVCA 1F1AA 4JQVA 3VFSA 3IF1A 2H1PH 3GS0A 4IOSD 2IAMD 1Z9MA 3MO1B 4LGRB 5D4QA 4PRIE 4AQ1B 5HVGB 4JKPL 3MAWA 5TQ2L 1BM7A 3L3JA 4XB8A 1NIAA 3K6IA 3L1EA 1G9MC 4H1LB 4QRRA 3BN9C 3QAQA 5D70L 3VD3A 1R5VA 3L9EA 3D05A 2J1YA 4KTEH 2YMOA 5AB0A 4RRPM 3RFRA 4DKTA 3I9IA 3D52A 4ZUWA 5ID1B 1L9PA 5JO5B 3PPSA 2FEEI 5J1AB 3DJSA 4DNLA 4JMXA 5AOJA 1IZKA 2TRYA 3JV5A 1IBHA 1L9RA 2A73B 3BPOB 1TPXC 4FJYA 1MAML 2P45B 3QULB 4PW9A 1NBZB 4QLRA 3UCQA 3KPRE 4LBAA 4ZYKA 5AL0A 2VMEA 1OCOB 1QG3A 1PL3A 2XQYG 2Q2LA 3BH8B 2VL5B 4OKVB 2AJZB 4HK0B 4XP5H 3REVB 4E9XA 4LRIA 1U8KB 3IDYC 3CCHA 2Q3ZA 1IGTA 2PTVA 2Y72A 3ARBA 3BVDB 1NMAL 1KJ3H 4CSTA 3B2DC 4X7FC 4O51A 1EXGA 3T2PA 4N2GA 3QCUL 4RFOH 1LP9F 1EAOA 1LP9A 1F3JB 1ZHBA 3HNVL 4B9IA 3JWDC 3MZGB 1IAMA 3NRPA 1O6VA 2AQ2A 1OF2A 3QZPA 5IQLA 4ETYA 1FUNA 5ICZA 4BUGA 1TQWA 2MSPA 3GMPB 4DEPB 5LGHH 3MN8A 5DRZB 5ISZB 3M88A 4LSTL 4ODSL 3EJPA 3MFFB 4BELD 2D7QA 2AJ3B 3AAZA 1BLNA 2XTLA 1IVTA 4AL8H 2FUTA 1WJ3A 4IGBD 4IU3A 1KYOK 3MBWB 3VXMA 5ENWB 1ITCA 4IRJC 2VR9A 2PPEA 1FNEA 1GSMA 5JLZB 4JKKA 1RUKH 2Q6WB 2ZF9A 4E5XG 3I2CL 1PZ5A 2YOCA 5BRZB 4JE0A 1QUNB 3DUSB 3NDZE 4GP8B 2AS5M 2LV4A 4JVWA 4KRPC 1SM3H 3B37A 3MLWH 4OUUA 1ZIAA 1KBWA 3DOHA 1VKXA 1UD5A 3QI9D 2LLLA 5DJ0B 3H3PH 3FN3A 2JTDA 4LL1A 5LUMA 1A4JB 2DQUH 5I1DB 1QRND 1YG9A 3QXVA 2NX5A 1VEOA 3LQAH 4G9FA 3VGAB 3D34A 2QSCH 3ARDA 3GGWA 1MFDH 4A7UA 2QVTA 1FPTL 2ENSA 1AHWA 1P4IL 2KQNA 4LEXL 5DCCA 4P2OB 1LDPL 1FL3A 3GRGA 2AXGA 3FTUA 4BFOA 2BNUA 3NOIA 4NHUA 2PKDA 3ZDZB 2PWGA 2HH0H 2KHAA 4GEJA 5DD0L 2PR4H 3ECQA 5DD6B 5FV2A 1SHXA 3IVKA 4O4YH 3CU7A 4PWEA 3WXWL 1TKWA 4TTGA 4HOMA 5EORL 3VWJC 1B3JA 4A67A 4BFFA 2V9QA 5JQIB 2M2DA 3FTGB 1N4XH 1L7IL 3HRZA 3L95B 1RHFA 5CCGE 4HWEL 4U6HA 3GLDA 2NXZD 4GB9A 2NY6D 5C1MB 1O9WA 3ABMB 4JR9H 5CSBA 2EECA 3H7BA 1UA7A 5AYQA 4N9GB 2X1QA 2VN6A 5D1XC 5KW9L 1B2WH 2FEEL 2WTPA 4GT0A 5J11B 3X14A 3FQXB 4LCWE 4NO2B 4XP6L 4IOIB 4P9HC 4JEGB 1EQWA 2HKHL 1M57B 4RGOH 4X98A 4ZTPL 1MFEL 2UXGA 4KI1A 4PGJA 4DUWA 4U33A 3ZOAA 5GS2D 2G60H 2OXGA 3WKML 1E6JH 2X70B 4HEPG 4XH2B 3GINA 2WANA 4WHTB 2QADB 3CN4A 4LASL 3U30C 4KWUA 1I53A 4Q0XH 3WNMA 5D7LE 3RHWF 1VAHA 4QYOB 4EOWL 3ARUA 1X9QA 4ORGB 4X2UA 1NANI 4H0HB 4ZX3A 3S88H 1OV8A 4GQRA 1INEH 3K1KC 5E1IA 1G1YA 4DGVL 3O9WC 4NQED 5TTRA 4PJCB 3ETSA 1RZJH 1KC5L 1KENL 4UBDD 3MREA 5CNHA 4YDLC 3DVIA 4TS6A 5HGGS 3GF8A 4FHKA 2VMCA 3AXLB 4B9KC 4FA8A 4LU5L 4GW4B 5IB4A 1FYTE 2W07A 2FLRT 3L1OH 4J3BA 3WNOA 1Q9KA 4ESKA 5J8OA 5C08B 4ZUUB 3HAEG 3TOPA 4H25B 4KKBC 1ETZB 2NY1B 4AMWA 1WAAF 1FN4A 1YLBB 2R9HD 4MJID 5MP6H 3CG8A 5FYJD 5IJDC 2NQDA 3ZZSA 1PEWA 4IIZA 1DJXA 4W9CC 4KI5F 1B0GB 1UJ3B 1BVKA 4Q9CA 1VGKB 2IGTA 3LHAA 2DH3A 1P84K 1DSYA 3BWUF 5ABZA 5BPPA 1WV7T 2FAUA 1JFHA 3DX0A 4L5FH 4MA1B 4W93A 4G82A 1MJUH 2DW5A 2XG5B 3IPFA 4NQCD 4ERSL 1XMEB 2WMPA 2FJGA 3O6FA 1XB3A 2TSBA 3HC0A 4OQTH 1JUFA 3B83A 5DD3H 3VRIA 3NCEB 3C6SA 3BWAA 3H3BC 4Z95H 5IHHA 1S7TB 5FUZH 1Z2KA 3BWZA 4JDTH 3T0EC 3I75B 4GY4A 1NIFA 4BK5C 4QXGL 1EEZB 4F92B 4MQ7B 1ZY9A 4FZ8L 1TQBC 1TQSA 5IQ9B 3QRGH 3EBAA 4NJ9H 3TO4D 4ZAKC 3UH8A 4PJDF 4PJDA 5JA8B 4YFEA 5CUSL 3IDGB 1MXGA 2QHRH 3FB7B 4MBRA 4I0PD 3UC0L 2IWKA 1LWRA 3QUXD 1EEYA 3U4BH 1IGCL 4Q2ZB 3T04D 2YPLE 1Q9WB 5AOIA 4YPGB 1FGVH 1SLVA 2AAVA 1S4IA 3MO1A 1TJHH 2PXYD 1F5WA 1QNZH 4AQ1A 4DP8X 3FH5A 1QD0A 4JQIH 4B6ZA 5EDSA 3LRLA 4BSVA 2R0KL 1NLDH 1L0XA 4KZDH 3KBFA 5E5RB 4GRLD 4OI7A 2DWXA 2VLLB 3JWOC 3UABA 4PJGE 3X3GH 1WS7A 2YWZA 5D2LE 3F7QA 1USZA 5L2KE 5JO5A 1BAGA 4Q9RH 3DDGA 3FAWA 4NZFA 5DI8B 3UC2A 1YY8B 3ZK0A 1X5IA 4OZHB 5J1AA 1WWBX 1HXMB 1JGEB 2A73A 3FQNB 4LLQB 3AS3A 3RWIA 5EO9B 3QULA 3BX7C 4PS4H 4WDIB 1G6RL 3H56A 4HQQH 4G9DB 3SYOA 3BH8A 1U8PB 2VL5A 2VCOA 2Z4QA 2CJTA 3K5SA 4YBLB 2AJZA 3OF6D 1RULH 4IS6B 4WO4B 4FG4A 4F7CB 2GBAA 3REVA 1U8KA 3ECWA 4M29A 3RNQB 1YEGL 4PB0H 4I3SH 1H5BA 1R1CA 3NQIA 2BNQD 3W0WE 3CHSA 1JGDA 4HJEA 4HK3N 1LEIB 2F2HA 2BVOB 3S5LG 2YD0A 4F8QA 3J7HA 4E9LA 1E5UI 2N56A 3QWNA 3UAEA 4GKNB 5D7JC 3KMDA 4M62H 4N2EA 4XVTL 1XF3A 2ZX6A 3ZR5A 3SPCA 3I74A 4N90E 4N25A 4KTGA 1AXIB 2GJ6B 2Z34A 3GXUB 2LAGB 3O8XD 4KX8A 2P4AB 4FQQB 1IBFA 1IEHA 4X9IA 3G5ZA 1OANA 4TVPD 3O3DA 1ONQB 1OSPH 2WNKA 3DYMA 2NYKA 3GSVB 4L0PB 3HI6H 1HXKA 3MFFA 2AJ3A 1Y7VA 4JRLA 4PP2B 4YXLH 1FLRL 3VFTB 3MYJA 2RACA 2WBKA 1QABA 3CZNA 2EYSB 5C0NC 1MCHA 5IW1B 2GTZA 1REIA 1ET5A 1U30A 2ZONA 5AQ0A 5JLZA 3DSNB 1NC2B 3HS9A 4S1SL 1TO4A 5D96C 2EDMA 3IRCA 3VWKC 1KZYA 3I9GH 3BE1L 5BRZA 2AJXH 3ARZA 1QUNA 3DUSA 4WWKD 2KKQA 3OKOB 4Y4FB 3L5WA 1IC5L 2AK4D 1A6WH 1NUFA 3GUTB 2I9LB 3MLZH 2H2PC 3RUGE 4PJIB 4NKIL 1CI3M 3AREC 4IIQC 5C7XL 5DJ0A 3J2PA 3SD5A 5IB1B 4BQ8A 1MCDA 5DS1A 1A4JA 3OKLB 1KLGB 1CFVH 2B1AH 5I1DA 5DJAB 5KSBA 5SX5K 4A38A 5KSBF 5D1XE 5LLIC 1JL8A 4KROB 2XWTB 1HDMB 2YD7A 5FPIA 3L7EB 2J5LB 4G70B 1I3VA 4MQSB 2DZEA 5GGQH 1Q38A 4NZTL 3IEAA 2EUVA 4P2OA 4NUPA 1E8XA 2APFA 3OAYH 3SPVB 1FC1A 3JTTB 2VH5H 3F2LA 2FBJL 3ZU8A 1CGSL 4R5VA 4ABQA 4HUUA 4N9OB 1BMWA 5DD6A 4TNGA 1N19A 5HYSG 2CO2A 4BM7A 3L95A 2ICWI 1L9OA 4LSUL 2A6KA 1FNLA 2DQFB 2G5RA 4IMLA 1JVKA 3CHXA 4KKRA 4YLBA 4YSUA 1PCXA 2F54E 5ESVB 3D3VB 4ZW6A 3CLEH 4UYPA 3KM1A 4F1SA 3E38A 3FQXA 4NO2A 4AM0Q 4IOIA 3RDTC 3B3BA 4FQXA 3ARVA 4NUJA 5FCUH 1LK3H 3HE7C 3GMNB 2ZX9A 1D9KD 5C86A 5DD5H 4MNQB 1OVZA 1PZSA 3RIKA 4XH2A 4K94C 3GO1H 3T6XA 2FEDC 2F5AH 4I13B 2IH8A 3RIFK 1CLZL 1HSBB 2HT2C 2IANB 2E7LA 1GCFA 5I15H 1LM8V 2DWSA 4QYOA 4CC0A 4ORGA 1A14L 5IOKA 4BCXA 4KH2A 2EDFA 3MX0A 4WI8A 2VZUA 2NNRA 1ZD6A 3LEVL 1BWWA 2BZ7A 4PJCF 4PJCA 3DX7B 3NACH 2V7NB 2DQDL 5FM5O 4F33B 1INDH 1HL5A 3BH4A 2C7UB 2ZOWA 4HBCL 3RTQB 1CLYH 3DO7B 3KWTA 4WK4B 3WKQA 4M43H 2X6AA 3AXLA 5HYIA 4NNPH 4P05A 4GW4A 2PETA 3SBWA 3K4DA 4ZOBA 5C08A 1IBGL 5CGYC 3D33A 3FCTB 2I7SA 2BRRH 2JB5L 2YN3A 1CFTB 3FONB 1QLFB 4GT7A 4KXAA 1N5YH 4XE0A 2CPCA 4FCAA 5D72H 1I7RA 4MD4B 1CFNB 3BEWB 2C26A 2IOMA 5BQDA 3VD5A 5I18L 3S8WA 4LCIH 3GMRB 3QXDB 3S8GB 4AQAA 5K59F 3PFUA 5JPMB 2X6VA 1B0GA 3MRLB 4JFQA 2XOTA 1VGKA 2IDFA 2A83B 2WBJC 2ZUQC 2H32H 3OX8B 3ULSB 4KRLB 4DQOH 1G9ML 5GRJL 4OIAA 1F8TH 1M4KA 1IQWL 4TVSa 1HESA 3RI5F 1RY7B 2IG2H 3N1FC 5EUKA 5E5MB 1SJHB 4F9LA 3BKMH 2X9ZA 3ULVF 3MRNB 1D7BA 4N8VB 4AYID 3EFDL 1S7TA 3CN3A 5I17B 1MCWM 4S1DC 2I32A 4Z7QE 3I75A 1EEZA 5IFHH 5FECB 4HZ1A 2Y3NA 2WLHA 5IQ9A 5T3XE 3MRKB 1MCLA 2DDQH 4EUPG 1NBQA 1RPQA 4TM9A 2BIHA 3D06A 4YDIL 4MDRA 2VDOL 3IDGA 1H8SA 2MOVA 3FB7A 2Q87A 1T03L 1MCCA 3U1QA 1Y1DA 4OQTA 2XZCH 1G43A 3OB0H 5ITBL 1GTFA 4Q2ZA 2V3FA 1IC4H 1XF2B 4N8PA 4MA3A 1IGYB 1Q9WA 3LH2H 1DDTA 5E6RB 5BQ7A 5BZWB 1RIHH 2FX9H 1X7SA 2PYEE 1ZXQA 5IESL 2OR9L 1NMBH 2RFXB 4XNBA 3QYNA 1N7ML 1NGQL 2W0LA 1UGNA 3D50A 1XIWD 3ARXA 3JWDL 4RGND 4C4KT 1YO4A 3MBXH 2C9XA 3FPXA 1NCIA 3PV6B 1XF5A 3CX5J 5EUOF 1JZ7A 3VDCA 4X0KB 4L05A 1LEGB 2VLLA 5E2JA 4BYHA 4LARL 4HP5A 1WC7B 1G7QB 1W15A 5JHLA 2YLHA 3KHOA 4BH7B 2TSAA 1NM9A 4B3EA 5DI8A 1YY8A 1LXMA 3QEGH 2WKGA 1JGEA 3FQNA 3WLWC 4LLQA 5EO9A 4WDIA 3FT2B 5AUMB 4HH9B 4XX1E 4CMMB 2IBZY 4G9DA 3QQDB 3GB7A 2FVNA 3VXRA 1U8PA 5AKTA 5GRVK 4IS6A 1R17A 4WO4A 3DRTB 4F7CA 1CBJA 3QXUA 3RNQA 3OAUH 3EH2A 4H26A 2HXAA 4GLRH 5L2JB 1ERNA 2X4TA 3I6GB 2CJUH 2BVOA 3NIGB 1QWUA 4C58B 4FE9A 3AY4A 4JO2H 5E8PB 5GJTH 4PJ5B 4GKNA 4A2EA 2QKIB 1E5BA 1KBGL 3ZYZA 1BVZA 2GJ6A 3EAKA 5ALCH 4LPYA 4TYUA 3JV4B 1Q9OA 3K2UH 4FQQA 5GSRB 4QRRD 1FZMB 2VDLL 2O5XH 2MOQA 3B2MA 2B59A 4R4BB 3RZWA 3TVMC 1Z3GL 1ONQA 4NO0D 2Y07H 2WAQA 3GSVA 1I4FA 4FD0A 4QTIL 4QGTA 2X2YA 2VAAB 4F58L 4P3CH 5TQ0L 4R2GB 2K0RA 1T2JA 3DJZA 3P69A 3TH3T 1N8OE 5KSUB 4QOKB 3BCFA 4PP2A 1JWSB 4NHCL 2AMUA 4JFSA 1P9MC 3VFTA 5JMOC 2FB4L 1J10A 2EYSA 4TQEH 5DVKA 5IW1A 2LU5A 4HMEA 4EE2A 4TXVB 2EYTB 2MNUA 4KZEH 2GTWB 1WK0A 3RU8L 3HN3A 3M17B 1MF2H 1TZ8A 2GBVA 5HXMA 4M7KL 5EO0B 3PL6B 1KJ2H 1P4BL 4Y4FA 4F2MB 5D7KD 1ANUA 3GUTA 5KVDH 2I9LA 3PGFH 3MXWH 2Y36L 2OK0H 1BYPA 2NXYD 3POHA 5IB1A 2ZCHL 1CGYA 4UWQB 3SCMA 4YC2B 4FLSA 2JELL 3OKLA 5DJAA 3V0GA 2CRYA 4PB9L 4AENB 1MFCL 3ARGA 4C57C 1QATA 2SODB 3L7EA 2AITA 5F9JA 3WNLA 3LNDA 5B7EA 5AKSA 3A6CH 5I1HL 1V3LA 3DVGB 3C2SA 1HQRA 2ADGB 3EUDA 3B9VA 1KJ2B 3SPVA 5T33H 1DVFC 4XMPL 4P9MH 4KXZH 4PG2C 2KDYA 3SGKC 1VFOA 3FFCB 2J88L 4K73A 3MLPA 4GG6E 2HB0A 4JFDE 1X5ZA 5D2NB 2QSTA 3DJTA 3V6OA 1T1WA 3VXMD 3OMZA 2FDBP 1NGYA 4H13C 3TYGH 3X1EA 2F53E 2DQFA 2HYMA 4P2RB 3U6XA 3SODB 2QEJA 4TQIA 1QASA 5ESVA 5JIIA 3D3VA 2WQAA 3MJ9H 2YZ1A 3S3DB 5C07E 3NZHH 3M1BB 4PJAE 4G6AD 3W3BA 4HC1A 2V9RA 4OLZH 3DROB 3VXNA 3K72B 1ODAA 3GMNA 2WSDA 4MZ2A 4HZAA 1QBML 4GUCA 2BSSB 5J7CC 3PAZA 2P5EB 4JGMA 1AR1C 1XBDA 4G9FD 4G43B 3LCYA 4WJ5B 2I9TA 1DQLH 3TBCA 2X4SA 4WW2C 4WI9A 4YE4L 1HSBA 2IANA 4G11A 2B7DT 4X5LA 3T0AA 4DPBX 4MB3A 5EU5B 4PJFB 4WLCA 5EU7C 5LXGL 2R4SH 3H9HB 3V0WH 4Z0BL 3MV01 5F93C 2WCGA 3LKRA 3P0YH 1O7VA 4DP5X 5E4IA 4C56E 3DX7A 2V7NA 2BPBA 4F33A 2W81C 4TUUA 1XSIA 3RTQA 3SD2A 2MCPH 3IMSA 1J1XH 2WLNA 4M6NL 4OD1H 4UNTA 4ZOCA 3DO7A 5F1IA 1A3RL 1E65A 4HIXL 2Q76B 1MW3A 4X80H 5A43C 3G5YA 3WFDL 3VG0L 3T6ZA 1JPTH 3V79C 4LSQL 1BYOA 1DBBL 1NAKL 1BF2A 4Y5VC 4BE6A 4NPYB 3UXFA 4FP8L 2HKFH 5LHDA 1RZ8A 4F2FA 4PRBB 5HYJA 3R1GH 2EIEA 2AV7A 3CZKA 3FCTA 4JFEB 3VACA 1ZKAA 1CFTA 3FONA 1QLFA 2IV9A 4XNYH 5DUPL 5IBTH 1J8HE 1U95B 5FFLA 5HJBA 1CFNA 3BEWA 4AYFB 2HA1A 4S1RL 3GMRA 3QXDA 5JPMA 3MRLA 4IBZA 2Q8BH 2ZOLB 4FEMA 3OX8A 4ODHL 3ULSA 3IFLH 1ZTXE 1JYVA 4Q6IB 5CD5D 2VERN 4DPAX 3BT2H 4FQHB 4RA0C 2UZIH 3UTSB 2NY0C 4ZW5A 4Y7OC 5T3XL 5E5MA 2JKIS 1O7SA 2ZXEB 1BMGA 5D7SH 1Y18B 3JWOL 4N1CA 5JYLA 3MRNA 5AB2A 2ZKYA 4N8VA 5I17A 3P4OB 4FKKA 2ID5A 4ZSOB 1IIKA 5FECA 2D7TL 1KGIA 1IFHH 3PWVB 4CMHB 5BUPA 4G7VL 4X7SL 4TN9A 2H32A 4W6WB 2XQYK 4FTVB 4MBOA 2VLRB 1N10A 5HGHA 1H8NA 2V2WB 3CHQA 3GIZH 3PWNB 1MCFA 2E7CA 4XNZC 2ESVB 1JNHA 2OL3H 3DO4A 3FRPG 3QDAA 2J56A 2NQ3A 2APTA 4MMZB 1P1ZB 2B1HL 1TEFA 3EYQD 5IHUL 1XF2A 1AACA 1IGYA 3DHUA 1JMZA 4LDLB 5K9QI 1K5WA 4QRAA 3M1CA 5BZWA 3NK3A 2VDRL 3QNXA 4XP9L 5EN3A 5T5NG 4KKQA 1ES0A 1YVLA 2X12A 4KI5D 3VVVA 4AT6A 5AZ2H 1E4WL 1AVAA 5E2VH 4CVWA 4XN7A 1YSOA 4LCCB 5FGSA 4X0KA 2LABA 3CFBB 3W9DB 3WMSA 2OL3B 1A8ZA 1LEGA 4OD3H 3FSZA 5AW8B 3BESR 3CJJA 1WC7A 1G7QA 4FNTA 4H88H 4NJAL 5LN8A 4DPCX 3FT3A 4R97B 3JWNH 5AVRB 4BH7A 4ZMXA 2OMYB 3WFCH 5DSCB 2BW4A 3Q05A 1TUPA 2N1TE 2PPCA 4KY1H 1S46A 3QCVH 3WGUB 4ZFOL 5AUMA 4CMMA 4ONHB 1QEWA 3B2VH 2UY7A 3KPPB 4Y2DB 2KDGA 3NCXA 3QQDA 1PU0A 4U6YB 3OZ9H 4G6JH 3LIUA 9PCYA 3NSCA 1UT1A 1F58H 1Y6NR 5HHOE 3TBWB 5I0WA 5L2JA 2Z8VC 1T0NB 4I48A 2FD6H 3T8MA 1XGZA 1F41A 1KPUB 2Z4TA 5E8PA 1JF6A 1UM4H 4PJ5A 2MTAA 4PRPA 3NCFB 3V0VB 1NC4B 2O5ZL 1JD7A 4ZXBA 3IETB 5CMAA 4MWFB 5J12C 2UWEB 2DMKA 3JV4A 5GSRA 2P3YA 3BLBA 1HEZB 1GCYA 1DLFL 1RMFH 1R34A 4FYTA 5F9WB 5I30H 1JYXA 2NW3A 4HUKB 2X44D 2VAAA 3TIDB 2ED8A 3ES6B 4GMTL 2W88A 2VLMD 1EHKB 5KSUA 5BO1H 5KSAB 4JPVL 4QOKA 2VC2L 3QZOA 3DTXB 3ZZQA 4DOHB 3QZBA 4X4ME 3IK2A 4PBWD 2YR3A 1M71B 2Y7OA 4KFMA 4R96A 1OL0A 1T83C 4TNVK 5SX5H 3RURA 4JUSA 1DBJL 2EYTA 3FCBA 4Z7WF 4Z7WA 3L48A 4ODTL 3RG1C 3M17A 1BVLB 4JRXB 4TSAL 3DMMB 3WFEH 4NT6A 4F7MB 2OTPA 2MQ0A 4G7YL 4G8FA 2ETWA 1FFNB 3BAEH 3PL6A 2D0GA 4N0CD 4F2MA 1RK1A 3WN6A 2B5IB 2E8YA 3BUYB 5AW1B 1NCDH 3L5XH 2E9JA 5FO8B 3B8SA 2BERA 3MODL 4X8GA 3QZMA 4J5VA 4NCC2 5E1QA 5F97E 3NIFF 1FE8H 3QS3A 2PCXA 4B9YA 4X6DB 3DJRA 1SOKA 1A1MA 2DL2A 1SVZA 3BKCL 4AENA 2A9CA 2CRZA 3QPQD 3ROOA 3DVGA 5CWSB 4HG4K 4HT1H 1GGTA 1KJ2A 3CZJA 2ZAIA 4L3CA 2FHBA 5A2BA 2UY6B 3FCSB 3MJ7B 2J7LA 1OXYA 4MD5B 4K3HA 4LQFL 3BSGA 5IQ7H 2WXGA 3DETC 1DN2A 5ADPH 1MY7A 3FH8A 2EO7A 4JREC 5D2NA 3WIFB 4LZKA 1ORSA 4EDXA 2H3NB 4ZI8A 4KJQC 3T5WA 1S9XB 3U7WL 4Z7UE 5EU7E 4HWZB 3WIIL 4OUOA 4R3SB 5FO9A 3E8VA 5H94B 1C7SA 3QUMA 4A66A 5BRZD 2F5BH 4NDMB 2MCAA 3KR3H 5I75C 1QA9B 4KVNH 4AIZA 3EO9L 3D4GA 1XMWA 3TH2T 4Z77B 5I8OH 3UPRB 2NZ9D 2VSKB 1N12A 1SYSA 4YJZL 1R3HA 3DROA 3K72A 1GGBL 3S0PA 3LSOA 4OCYL 4L48A 4QD2E 3TF4A 2BSSA 2YPKA 2WCPA 2E59A 3LKOA 3OR6B 2VLJB 1DJHA 4X4ZA 3RWDB 3VH8G 3IM1A 4G43A 4WJ5A 5JNYA 3HUJE 3DIFB 5BMFH 1FAKT 4HS6B 4JG9A 4XX1G 1S7UB 1CF8L 5EU5A 2FJFB 4P2OD 4PJFF 1JPSL 4FQLH 4PJFA 3GT6A 4Y1AB 5JMRA 3H9HA 1PD1A 3M8OH 3VD4A 2BY1A 1IV8A 2KBGA 1TTGA 3O3BB 3TL5A 5F6HI 2K4AA 5ESQB 1U3ZA 3II2A 3MDJA 5F7NC 4ZODA 4DIXA 1KJMB 4HS3B 5JA9A 2JCCB 4H7VA 5C0CB 3P4NA 2QT6A 2AJYH 2VXQH 4BD4A 1G0DA 3UTPE 2EDDA 4PRHA 3EJCA 3PXHA 4NPYA 3LD8C 3V52H 3BRDA 4PRBA 3SQRA 1ZTXL 1D5IH 1WFNA 2OJEA 1TO5A 4XXCC 5TF0A 4JFEA 4QWWD 2MMXA 4EIGB 1KSRA 5JDJA 5DEGB 1JYWA 2VSMB 1S9VB 3Q8BA 4JG0H 4AYFA 5GGTL 2VABA 3SDDC 4NFCA 4E36A 1FH2A 4NQDA 3T3MB 1H3TA 2ZOLA 4UNIA 1D6VH 4HZLB 4Q6IA 3WEXB 4QXVA 4M1CC 4PM1A 4AEFA 2WGXA 4FQHA 4HIHB 2Y5QA 2J6EH 2QADD 5E8DL 4HAKA 4U0RB 1CURA 5L4FA 5H2BB 1OARL 1Z66A 3DBSA 4KU1A 3BZ5A 3SDXB 3ULUE 1YEHH 4MXVF 4Y4KB 3TJHC 2BH0A 3D8MA 3HNTL 4NKQB 4ZSOA 5GGSY 5CJOL 1MNUL 4I77H 1NWOA 3AM8A 2P24B 4AVIA 3PWVA 2PWEA 4P2AA 3CUPB 4YEEA 4GAAA 1JZFA 2DJ4A 2E7MA 4A7QA 4Z3TA 1NCWH 3RX5A 4XMXA 4XNDA 4OFIA 4G2AA 3NGBB 1T0PB 1TJMA 4U1GC 1HHKB 1R6VA 1RFDH 2VUOA 3PWNA 4PBDA 5JXAL 4GO8A 4KO7A 1AQDB 2ESVA 3IFPA 3LQZB 3N40F 2YMXL 5C08D 4AV0A 1GYWA 1P1ZA 4DKDC 4FA7B 4HISA 3RPIB 4P23C 2WP3O 4R7DB 1XGPA 3HA0A 2EE2A 1DJWA 3C2AH 2NY1D 4CC4A 5BVJB 2KPWA 5IHWA 3DHPA 1CXHA 4NKMB 3RGVB 4BSWB 1BMZA 1RUQL 1LWHA 2FX8H 1FO0H 3TGXA 5E56A 2WZPA 2QV2A 5HHME 2LGNA 5DYFA 4LCCA 3FUJA 3CFBA 3W9DA 1PTZA 1M2OA 2XBTA 1KTDA 3F12B 4GMSL 4ZT1A 1JP5A 1SZNA 5A2CA 12E8L 4EIUA 1M7DB 3QIWB 4FRWA 5T1KB 2R23B 5DSCA 2PN5A 3SZKC 2HT4D 5DTFB 1E5AA 3HZKB 1MOEA 2H2SD 4O58H 2OQJB 4I89A 5DVNA 2KZWA 4BJLA 1FO0B 4HOZA 3HMXH 5C6TL 4MJJA 5F7MC 3FH7A 2XIIA 4G42B 3KPPA 1CDUA 4ONHA 4Y2DA 2ZKHH 1N18A 4Y5XC 1THCA 4HJ0D 4M1DL 4U6YA 5IFAL 3MHZA 4MMYB 3W38A 1OTSC 3TBWA 5KYUB 2NNXA 2PCFB 4G1EB 1T0NA 1SQMA 4Y7MA 5D7IB 3LEYH 5AAMC 1I9RL 1KPUA 2Q0ZX 4U6VH 3V0VA 1NC4A 2NNAB 2X10A 4XPFH 3WO4C 4JFZL 5AEAA 2UWEA 1JTOA 4XNQA 3L81A 3RPKA 4L9LC 5I24A 5B39B 3DHJA 4DP0X 3VGFA 4ZK8A 1H6EA 3F85A 1I31A 3VI4B 2QGDA 2R15A 2ZSVB 3EOTH 4HUXA 1TIUA 5DMYA 2VXTL 5TPWH 3F00A 2F68X 3BPLC 3TIDA 1XSJA 5KSAA 3AC0A 1IKNA 2MPAL 1QAWA 3DTXA 3ZQXA 3A47A 4NLAA 2CLRB 1GMEA 2YPVH 1OQOA 5AW2B 3OBAA 1X5LA 3SHSA 1NGZA 2XY1A 1MJ7H 3GZPA 3NFPB 4LL4A 1TMCB 3ZTCC 3HKFA 1X9UA 4GKZB 1BVLA 3BUIA 3O2VH 3DMMA 4JRXA 4HF5L 4F7MA 1E30A 1HILB 2Y7LA 1EXHA 1VA9A 2ENJA 1P6FA 1QBLL 4WO4D 2WLKA 3PHSA 3VGDA 3O2DL 2FX7L 3BUYA 2JF1A 1I7UB 4HS8L 3STZB 5B8CC 4UOQA 4CGTA 2JKSA 3L4TA 4ZOEA 1A7OL 5FO8A 1J0IA 4YK4B 1SJEB 2F61A 2YD2A 4UIKL 2F19L 5IQOA 1QZNA 4YL9A 2UZXA 4P0DA 1FIGL 2ICCA 3IKCB 5I82A 4H20H 4YHKH 4DESA 5KG9B 3CXFA 2GJ6D 5CFHA 5CWSA 3BFWA 5JIKA 3PAVA 1ADQH 1NEZG 4JG1L 1GYCA 5I71C 4JVUA 4UM9B 3Q2WA 4LVHC 4JN1L 2UY6A 4PVBA 1C16B 3MJ7A 4HXAL 1SJMA 4N5ED 4LNRB 4POZC 1RZKH 1BXXA 1MW1A 2G3ZA 4OZIB 2YD1A 4I4WB 3LRMA 4DEUA 3OXRB 4QHLB 3WIFA 2AEOA 5FYKE 2FECI 2XV0A 4ZMYA 2VLKE 1I1AA 1S9XA 4J4PC 3P4LA 5FYLH 4DKEH 4HWZA 3C8DA 3E3QC 4Y19B 5KVGE 1PY4A 1NC2D 2FIRT 4HIEB 3T08A 3RE0A 4R3SA 1GPOL 2LTQB 5ES4B 5H94A 4OFPA 4NDMA 3BLKA 5IB3B 1QA9A 2DEYX 2ADYA 3MRHB 4TULL 1KGWA 4Y4FD 4ANUA 1T2QH 4OGXL 1UWXH 3NAAH 4ZMZA 3G5VA 4Z77A 3UPRA 2ZUUA 3ECBB 5I1IH 4ELMF 2O1AA 1AHKA 5G55A 4M48H 3SE9L 1CGUA 1WT5C 1I3RB 1RURH 3CX2A 3OR6A 4PYGA 3RWDA 3HVDA 4KROD 2B15A 1GTNA 3RIFF 3VFPA 2D03L 2VXVH 1PKQE 1T7YA 2XRAL 3DIFA 1YN7B 4ZMLA 1S7UA 2V5TA 3L2LA 4C8XA 2FJFA 5F0LB 2C3WA 4OCWH 4YHLL 2F58H 5HD8D 1WAAE 2FQFA 1INQA 1DQML 1M7UA 2EIBA 4IMKC 4PJ8C 4Y1AA 1CU4H 2XACC 4DVRH 2FUQA 2IDCA 3EJRA 4ACPA 2DM7A 1LMIA 4FJ6A 5ESQA 2OYKA 4BXVA 1BZ9B 1KJMA 1YEKH 4HS3A 4JJHA 2JCCA 4BA0A 3DARA 4UTAH 2Z3FA 5C0CA 5IFJB 4NN5B 4ZFGH 1A6UH 3ZTNH 3HZYB 4GBXB 4R8WH 4H5SB 5AB1A 3G9AB 4NWUH 4ZTOH 3ZL4L 5BOPA 5F2FA 1RUML 3D3VD 5F8RC 1B4TA 2J21A 1UXWA 1RERA 5GXBB 2BVTA 5DEGA 4IBWA 3TPUB 1LE9B 1S9VA 5EU6E 4NGHL 2I07A 3QDME 1YYLL 4KKCC 4PR5B 5AW5B 3ULUL 5E08H 4OZGF 1T5KA 2J1XA 2NYYD 4LKXB 4MNQD 4V33A 3UZEC 4FFTA 4LDEB 3V4LA 5EEYA 2H0JA 2NR6A 2OSWA 3QORC 3MA9H 3UDWA 1MZZA 1UOKA 2VXQA 1OGAB 4HZLA 2GBUA 2P7TB 4N2DA 3Q2VA 1YPZE 4UM8B 4HIHA 4XP4L 2G5UA 4XO3A 3WHE0 4JPKH 3K91A 2R0LL 4JZJA 2IAND 2XVBA 5LNGA 2OMXB 5LCVH 3SDXF 1MFBH 3SDXA 1P5UB 2AEIT 4Y4KA 1W6WA 1BQHG 1BBDH 1YC7A 2Z7YA 3KXFE 2H8PA 2OKMA 4H8QA 1V7NL 3EBIA 2BFVH 3EDDA 3HJ0A 1V7ML 3VU1A 4KJYB 4DTGH 2P24A 2IC2A 3RTQD 3ZDYE 4C4BA 4B5ZA 4FXTA 2OYLA 1QPPA 3CHPA 5AZEL 3UJIL 1G7LB 3HPJB 4OTXH 2J6EA 2OTUA 4NYLB 1Q1JL 1ETA1 5DUMH 3K74B 4LHUA 1AQDA 1E6OH 3LQZA 1VHPA 4JN2B 2RBLA 2NY3C 4CKVX 4HYTB 4LDCA 3C5ZB 1FGNL 5HYJD 2D73A 2FECL 5L7XH 4R7DA 3MCYA 3ZE1F 5IQNA 3FCGA 3K4ZA 5CJXC 1HU8A 5BVJA 2GITB 5IMKA 2WN3A 4NKMA 3SE4C 2KZBA 1ZAGA 1RQ5A 2HT3C 3KWVA 3SGDH 2CM6A 5MI0B 5HHXL 1AAJA 4S0SD 1IAOB 5E2WH 5EA0L 1OT2A 4OLWH 1HIML 1XCQB 5FM8A 4WI4A 2G4GA 3B1TA 3Q43A 4K4KA 2YGPA 2HG5B 4GKOA 3T3PE 1M7DA 4Y8AA 2IPTH 1FFRA 3WJJA 3QIWA 5T1KA 4WNQA 2R23A 3KVPA 5CP7B 2J8UF 2E27L 1LEKB 2J8UA 3ZXAC 4KQ3H 3SKJH 2OQJA 1FO0A 2QGEA 1AANA 5IVZB 4G42A 4QHKI 5D71L 1CE6A 3MA7B 1UB5B 4KVCL 1E4JA 4MMYA 1N64H 4WEUD 2XWXA 4HJTA 3F7YA 2YZ8A 3AFLA 5KYUA 5JW4R 4LLMB 1IGML 1N6QL 2PCFA 5D7IF 5D7IA 1MVFA 5DR5H 2YQGA 2V17H 3ML8A 2ZXBA 4L1TA 4PMEA 2V7HB 3O6MH 4HLZG 5GQBA 1YY9C 2AXWA 5G5DB 1EZVY 4I3RH 3IDXH 3GPEA 2NNAA 4N8CL 4OD2B 3H4HA 2ZXDA 3T2NL 2JJUA 1DJIA 2FJUB 3PHAA 4JCLA 3HMXA 5B39A 4Y2NA 3Q9PA 3SYCA 1IT9L 2ZSVA 4KK6D 2GPZA 3E0GA 2TRHA 5DJ2B 6PCYA 1IEAB 4FABL 4I8DA 4JZOB 4RFEB 1MI5B 1QFWI 2MFNA 1PLCA 5T5FH 5IROA 2FO8A 2JE8A 2KERA 4XN4A 2X2IA 2OLDA 3EFOA 4G7SB 5FGBC 4PPTA 3BUTA 3NFPA 3S5ZA 2GJRA 3ECUA 4MAYB 3ZJAA 2ATPB 3CFKB 1H3PL 1K9TA 4XCCH 3H53A 2HN7B 1HILA 2PPDA 4GEIA 2DD8L 1ZVSB 4KK5D 1KCWA 2DLHA 3MXVH 3NSJA 1B9ZA 4Z3IA 1SVCP 1JSYA 4OF7A 5B1JA 1JN6B 4W6XB 1MCIA 4P49A 4JFFB 1I7UA 5LGJB 2HP4A 4OVVA 5KOMC 1EAQA 3EYUH 1G9HA 1BQ5A 3APCA 3E3QE 4K55A 1SJEA 3H9ZA 5DQDL 2VT0A 2XTSA 2YPVA 3S36L 4Z76A 5JDSB 4TPRL 2DV6A 4PJ5D 2V37A 2WLYA 5CEZE 3IKCA 4WGVB 3OZLA 1MWOA 3MOAH 4E41E 1RU9L 5KG9A 4OGAD 4N2IA 5C0AB 1FYHB 3LH9A 2HCZX 2KZ1B 4CU7A 3HAEH 2HFEB 1PZUB 3F6LA 5FYKL 1NMAH 2Q86B 3K6NA 1A9EB 1OK0A 1SF5A 1C16A 2WZ5A 4PIRF 4XMLL 5E6IB 5KVGL 4R2GD 2E74C 2IDSA 3UAJA 4AEIH 2EKJA 4QOKD 3QBTB 1R33A 3EH5B 1UWFA 3FCUB 4I4WA 4FJZA 4OLXH 4QHLA 5HPMB 5IMMB 5EG6C 4BHUI 1TQCB 5BV7H 3IFOB 1QPXA 1A7BA 3DX4A 4Y19A 4LSTH 4HIEA 3TBTA 5F72S 1UKQA 3HAEB 1ADQA 1J12A 5D4IA 3K81A 3PL6D 5D1QB 3A4DA 3REWB 3E80A 4XO4A 3N43F 4BGDA 4NRZB 1KYDA 3P73B 3ECBA 2AABL 4LOUD 4B0MB 1RZGB 1XGTB 3IJYB 1QZ1A 4Y9FA 5SWSE 3LEXB 4H2CA 1I3RA 3I84A 1DDHB 3BFOA 3QHTC 4FG6C 4PLJC 3PXLA 4J3TA 5BV7B 3FU7B 3NJHA 1WBXA 3CSFA 2VKXA 4HBQA 7PAZA 4OLYH 3BZFB 2CR6A 3BW9B 2CBTA 4MA7H 2OMZB 3L5JA 2DMCA 4IKKA 3ZE0F 5I5RA 4W9DC 5EZOH 2ZSWB 4OF0A 1JG9A 3US0A 5CP3A 3SDYH 4PGBB 4OAWB 1OQXA 5HJ3B 3FFCD 4ZMAT 4HU8A 1V3JA 3DPDA 2DBLL 3HVNA 1BZ9A 4L4VE 4LEXH 1W9XA 2FWOB 1BEXA 1LDPH 1QFWL 1J9TA 1RH8A 3FT0A 3BIKB 3BH9B 3HZYA 3Q06A 4GBXA 2B20A 1ZVNA 3KG5A 3ATEA 3QDJE 4H5SA 4P2RD 3SY6A 1DZ0A 5HDBF 1UASA 1F97A 3DV6B 1PZ2A 4LFHG 3U9PH 2XDHA 3MGTB 3WXWH 4JM2C 5EORH 2GHWB 3VYNA 3LNEA 2ZNWA 3TPUA 1LE9A 4F8LA 3SJVB 3H2QA 1UH2A 2EJ1A 3ZPDA 2BP0B 1XGYL 4JHWH 3LZLA 5A6MA 4J3UA 2FT8A 3A24A 4UTAA 1SLWA 1GXEA 5KYWB 3NJJA 4JPWL 1ILSA 4UM8A 2XHNA 3CC1A 4XP6H 1RUAL 4RNRB 4LVEA 5DJ8A 1OP3K 4CL7A 3T4YB 2OMXA 2F0CA 1MCNA 2OSYA 4QGYA 1T20B 1MKFA 2Y0SA 2G9HB 3ZYIA 3WN5B 3P30L 3GXFA 4C83A 3GRBA 4Y1TA 2PW1B 3OQRA 1Q0XH 1NBYA 4TOYH 2EABA 5C71A 5JOPE 5DVOA 2XQYA 5B3NA 1LK2B 1G7LA 3HPJA 3W81A 4YX2L 3WEXA 5MERB 4NYLA 4PRHD 4X5WB 4C4KO 2R0ZH 3M07A 4NZRH 1EJFA 4FADA 2B2XL 4JN2A 5FHBL 1ND0A 3UBGA 5LCVA 3D18B 3C5ZA 5CLYA 5F9DC 3V4VH 1NUGA 3GMOA 4FFYA 4JFED 1C1EL 2EUZA 3FUHA 1F86A 1OM9A 3GSNB 4TV3A 4W4OA 2HVJA 4Q9QL 1CFMA 1A6TB 1YNKL 2GITA 1THAA 3LHPL 1MIML 5BS0A 4PJ9A 3QDGE 5HBBA 3RDJA 3G5XB 2EDNA 5GZNA 3MV7B 4UF7C 4NQDD 3CLWA 1HWGB 3D08A 5I76B 5JZ7C 3WHXB 3UBFA 2L4OA 3HG1E 2DIJA 2IDQA 4DN3L 4X6CE 1IAOA 1B4RA 5E51A 5DVPA 2QVIA 3IN2A 3KH3A 1OTUD 1XCQA 4IBYA 3V4VB 4B50A 3A0OA 2ZWLT 1GHFL 2HG5A 1HVXA 1KACB 3ILQD 3O2WL 3QVAA 1GYVA 2VR7A 2CZNA 3MUZ1 3DX2A 3LV3B 1PNDA 1LEKA 4M93C 3UTQB 4E5XA 2OV0A 5HP5A 1A21A 1H6TA 5ANMB 4P99A 3MA7A 1UB5A 1S78D 4DK3A 3GBNL 4AJ0A 3BSZH 2ESVD 1RIUH 4PY7B 5EEVA 4HG4J 1NINA 2V5MA 4HW6A 1IJ9A 4NP4H 1CK0L 2XZAL 2ADIB 4FG2A 1J7VR 2GJPA 2V7HA 3W11C 4OCRL 5G5DA 3SE3C 4XHQA 3VFOB 4GW1B 4OD2A 5SWQB 3MOQA 5JIDA 5D5MB 4Z7OB 3NJMA 4MZIA 4P5TC 1TQTA 2DWYA 1WWAX 4AJVA 2BDNL 3VD1A 3VRJB 2WZPD 2HWZH 3MLXL 1GRWA 3FS9A 1CFBA 1JDCA 1BXUA 1CDCA 1YEFH 5DJ2A 1IEAA 1U8OB 3QJXA 5LAXA 4JZOA 1QYGH 2H3KA 4GRLC 2HVKB 2CK2A 3QJZA 4YVNA 5GS0H 1PMYA 1WFJA 3S35L 1GMIA 3D09A 4NO3B 2LVEA 4UQIM 3GPSA 3HB3D 3SOBH 2AXJA 1DBAH 1NAMA 2I60L 5IM7B 1UATA 4TNVF 1CICB 1UZ6E 1P2CB 1EANA 1YNLL 4KTDL 4P4KC 3AITA 4XZUB 5CXPA 3EXJA 3ARWA 4JPSA 3RIAK 4MAYA 3RQ3A 2ATPA 3CFKA 1GIGH 3NSFA 5CCHE 3TFBA 2HN7A 1C5BL 2VRQA 4Y2DD 4WEBH 1SVBA 2JKRM 5CEZL 3P11H 4Z1PA 2QQNL 3QNYB 5FHAH 1JHLL 3KYOB 3BGMB 4JFFA 1LVEA 4M9OA 5T5FA 1T22B 4FQCH 2NSMA 3MQIA 3IMBA 1G6RH 3S8FB 1Q1PA 2J20A 3CBJB 4HEPA 2XZZA 3PHQB 2WQXA 3QUZB 1NC4D 3R8BB 2F15A 1SXZA 4I85A 4I88A 3UAFA 3NTCH 2EH8L 1P7HL 3W2DH 2GBTA 3CU1A 4DEWA 1OCWL 1S3RA 3OGCB 5C0AA 2BO0A 2ZCKL 4IJ3B 4WI5A 3WKNA 2AQTA 3ESMA 3MLSL 2Q86A 4L1BA 5SX4I 1WLHA 1XH3B 1RSYA 2V5YA 2G3MA 3DOIA 2GQHA 4O5LH 1SBBA 3WAJA 1KCRL 3NCJH 4LPXA 2YUZA 4KNTA 4R84A 5KSAD 1IBDA 1UKSA 2CUAA 5LGKA 1KELL 1EMTH 2RH0A 3O6KH 1UCBL 4LQ1A 4NKOB 4D8OA 1G6RB 1T1ZB 3QZNA 4J3SA 5HPMA 3BP7A 3U46B 4NRYA 3WJMA 3OKNB 1RK0B 3QWRA 3IFOA 5C6WH 4OBRA 5KJRL 4JRXD 3DMMD 5TK4A 3BGFC 3HAEA 1DL7L 3BQVA 2A9NL 3F7KA 4ELDA 2ADFL 1OAJA 5D1QA 4ES9A 4U0QB 1CR9H 1IFRA 1K4DB 2YQBA 2EH7L 3HG5A 1MRFH 2X0WA 2UX6A 4NRZA 5ILTL 3P73A 3EO0B 3LZRA 3DOSB 1RZGA 1XGTA 2CM5A 1I85A 2Q9OA 5E9DB 2G2RB 2WVVB 3JBG7 4L8SB 5HYFA 1DDHA 2DM3A 5I0ZA 4B41A 2GG1A 2Q7AA 2Z31B 3ETBJ 3EFFB 4P46B 2P80A 3GDCA 1IC5H 1FFQA 1N5AA 3BD3A 4B27A 4DPRA 5DLMH 3FU7A 3TN0B 3E9TA 1MQKH 3AGWA 5F9OL 5IG7B 3ZE2E 5HDLA 3BZFA 3QZWB 3V6FB 1R4XA 2Z92B 3DVFA 3BVUA 3OKMB 1Z5LB 2EVGA 2ZSWA 2UX7A 3NIDE 1N26A 4M9PA 2Y6SC 4PGBA 2CA3A 1BQUA 4HGMA 2AJSL 4G72B 5HJ3A 2Z35A 1HAWA 1UM6L 2ZAHA 2R4RL 4HD9A 5M94B 5L6YH 5K39B 2FWOA 4K3DH 1NEPA 3VRLE 4HFWB 3BH9A 3IS0X 1T7ZA 4ODVH 4KOCA 1CGSH 2N4IA 1USQA 4U3CA 1BPVA 4H2AA 4NQEE 2ZUYA 3DV6A 1UYWL 4XAKD 3NG5A 3JSSA 4JO1H 5F7FA 3ZQ9A 3CWGA 2X88A 2J57A 3IDNB 1PFCA 1MVYA 4DETA 3NK4A 1AP2B 1VFMA 4LSUH 2NNCA 5F70A 2A99A 2BP0A 5HDQL 1XBRA 1VGEL 2C3VA 1D9KC 4D9RD 1D7DA 5KYWA 1R0AH 2APBA 2VLJD 3L8QA 4MS6A 4HCGA 4WW1B 1DYZA 2CK0H 5DO2C 2N7BA 1KJVB 2B0SH 4M8QA 4EN3C 4RNRA 1FHGA 3T4YA 2J71A 3GI8L 4CVUA 4BA8A 4MJIE 3VW3H 1RVFL 3ALPA 5FYJE 4YDMA 1T20A 1TQVA 4IDJL 3NJFA 4Y1AD 5E24E 2K6ZA 1O0VA 3GNML 3T4AB 3UO1L 1CO1A 5A2AA 1F4YH 5I1GH 1AD0B 3RGHA 2PW1A 4Y5YC 1YMME 4X5RA 1A7QL 3D39A 4XR8C 4JBSA 5CKAA 1NWPA 5A2IH 5C0CD 2DQJH 3L3GB 2H5UA 2W9EL 2K6WA 3OLEA 4UILH 4X5WA 3KEDA 1KFAH 5CSZB 2DQDH 1VERA 1JZ2A 3D18A 2N59A 2Z65C 5DRWB 2GUYA 3CK0L 4JFYA 3FTZA 1E50A 1UQSB 3I02A 5SWZE 1HKFA 1AIFB 4FOMA 3IGKA 3V10A 3U36B 1CD0A 2JNZA 1FWXA 4PIBA 4Q4IA 4HJ1A 5KYYB 3WTYA 4IOFC 3MV7A 4AYGA 1QTPA 1G6VK 2HTKC 4UQEA 4WUUB 2AJVL 4EIBA 5I76A 2NR6D 3WHXA 1UH4A 1NCBH 1OLLA 4PGZA 3WO3B 3MI6A 4OFVA 1PAZA 4JQXC 1XVSA 3KPTA 2VSDA 2OMBA 1MREL 1PD0A 3AG3B 1OSYA 3LZFH 5IUSA 3V4VA 1BJ8A 1ZRUA 3ARFA 3V4PL 4Y4KD 3CFCL 3ZIYA 4J6RL 1MFVA 2RCSH 4GRWE 3LV3A 1HINL 1T89C 3WIHL 3GBEA 1WHPA 1A66A 1UXMA 3GXNA 3UTQA 4JJ5B 4AW4A 1KUMA 2ISDA 4QI3A 1U36A 3O41B 3KYNB 5JW5B 5IUCA 3RY4A 1J0JA 3VB8A 2KPNA 2PTTB 1RLBA 4PY7A 4P07A 4I18A 2HTLD 2QPFA 4N26A 4J8RB 5A3ID 3VE0A 3QUGA 2J44A 4GW1A 4YDIH 5MEOB 2VDOH 5SWQA 3RGVD 1UD6A 5I23A 2Y5EA 4AZUA 1T1YB 1QTSA 2JJWA 2WQVA 4DKAA 5F7EL 5CIPH 5IBUG 4DKFH 4O02L 3VRJA 1BFVL 5ITBH 1A6PA 1XIWC 2OSLB 4RGNC 2BNQE 5CJ8A 4XWOC 4CADB 5EWIL 4ZZKA 3E2HC 1U8OA 2VQUA 3W9EB 1A7NL 1S3KH 2HVKA 4BFBD 4L3AA 1OB0A 2TAAA 5JYMA 4XMTA 3I3EA 5IESH 2OR9H 5DJ6B 1C9SA 3ATFA 2XIBA 4M7ZC 4NO3A 5HYSA 3QIWD 5T1KD 3DGGB 4YFLI 1CICA 1P2CA 4XZUA 2I7OA 2VDOB 3CBKB 4TVPE 5IW6B 1WUNT 4FNLL 5DA4A 3IDYB 3VD2A 5CIPB 1GZHC 1O5DT 2XV3A 2BRQA 2BIIA 4M7LL 1AI1L 1T0OA 2VITB 1P7BA 3QQ4B 4A6YL 2P26A 1L4IA 3KYOA 1OK8A 1TTBA 4K3JH 4HDIB 1U8LB 3NH7L 4PRDB 1T22A 2UXFA 4LVNC 3NT0A 5D2LB 1BQLH 2A6IB 3S96B 4OCSH 3U7AA 4NQVB 3RFZC 2A9MH 4Q89A 3QJTB 3D25B 3HN8A 3PHQA 3QUHA 1I8IB 1TEYA 2WQ8A 4O2CB 3MRPB 4RRPG 3KJ4B 5I1CH 1EBPA 3AMLA 3JV0A 1IGIH 3CXDL 4P2YA 2OM5A 2YAHA 3OGCA 4XPHH 2L7JA 2AK4E 2Y4SA 3B9DA 4PWIA 5D93B 5EOCJ 2UVEA 5C0BE 3VNZA 5FXCH 2PO6B 1HHIB 1JI2A 1G94A 2XJKA 4FGMA 4YSOA 2ROYA 4DK5A 4HMCA 2R51A 4N1EA 5IJBC 4IRJB 1KBGH 4XBGB 1I8LA 5IROD 2OR8A 5CGBA 3N9GL 2J6WA 2FH6A 3N6YA 3Q3GA 1G6RA 3EZJB 4NKOA 3UZVB 3VXUB 4DWHA 2XN9B 2VDLH 1DN0B 3NRFA 5GRUH 3U46A 5A16B 3OKNA 5L88L 2J5WA 3TJPA 4G71B 2QR0B 1COBA 2CBQA 2I24N 4KRPB 4F58H 5TQ0H 5ADOL 5D1ZB 4UZUA 4M3HA 1DQJB 1I1RA 1HNGA 4RZKA 2DLTA 1MG3C 4IYKA 2FB4H 3LXBA 1KFGA 4XO8A 1K4DA 3U83A 2H26B 3L17A 2NT0A 3HKZA 4Q6YA 4GOSA 1FORH 3WJLC 4Z23A 1TJIL 1DO5A 3ZO0A 3GMQA 3UL4A 1EZUA 2VDLB 3L6FB 4L8SA 1KEML 2FH8A 4M7KH 2H47C 1ZEAH 1KIUB 1X4XA 4P46A 1P4BH 3RNKB 4WKXA 5F7UA 1TJXA 4FNRA 4U1LB 3TN0A 3AWEA 4P9HH 2F08A 3FQWB 4F80A 1T5XB 4MHHG 5F1NB 1Z5LA 4WTZG 3N0PB 15C8L 3CHRA 5A2JH 5DS2A 3QUYB 4Z78B 1AMYA 3H6JA 1JBJA 1BQRA 3RUGB 2RMNA 1A3LL 4RFNC 1A4BA 2VO8A 3AVEA 3RBGA 3UAJD 4AYEC 3GBML 1IBZA 1NFDE 3T77A 4IQHA 3AS2A 4IRSC 2YLKA 3MTRA 5FFOA 5K39A 3WNJA 1I9JL 4KKLC 1D6EB 4ZS6D 1FV1B 4PJ7E 1KLUA 4ZFZB 1KCBA 2CE6A 3OQ3B 4KOBA 4AGMA 4Y19D 2EEDA 1G4MA 2X4RB 1OP3H 4PS7A 5F1SA 4AUYA 1AFVH 5E95B 4PLKD 3A67L 4CBZA 4PAZA 1WBYB 4ZQKA 4DQAA 1ZGLB 1TETH 4G6ML 4G6AC 1FZKB 1F6FB 1AP2A 4I9WD 1H0DB 5I6XC 4FF9A 5FYJL 3T6QC 1HCFX 3U30B 1KGYE 3D48R 4FMKA 1A64A 1L0YA 1DUYB 4ISVB 4YXKL 3RKPA 3NSDA 5FYLD 4WW1A 25C8L 2GAZA 4XPTL 2HG0A 4D9QD 5JPNB 4WCYL 4M5ZH 1G84A 2F54B 3BKJH 2WNWA 1S7WB 1NGWB 2P42B 1XXDC 4YDLB 4NWTH 3GK8H 3T4AA 2P52A 4EXKA 4KJWC 1MCQA 4N22A 2EIMB 4GH7B 1KN4L 3ARPA 1AD0A 2C5DC 1Z6JT 4TL4A 3RYMA 1EHLH 4FMVA 4KGLA 4JY6B 1JTTA 5IY5B 3JVGA 4KHTL 4DO5A 4Q74A 2B8OT 3KLQA 4JHBA 3G6JE 3L3GA 3Q13A 4KC3B 4WU7B 1KBPA 4CDHA 4F37K 5LXGH 1NDGA 1OWRM 2BMKB 4GBXD 4LCUB 3EGDA 1A6VL 3H2PA 3N42F 5D7LA 2C4FT 4M6NH 1T5WA 3QW9A 3RP1A 1UQSA 2G9KA 1A3RH 1CYXA 1ET7A 2MKLC 3V0AC 4TTDD 1B0WA 4P8QA 3U36A 3AROA 4ONFL 4OFYA 1GC1C 5KYYA 4PP1C 4TKWA 5H37G 1L9TA 3H8NA 5DDHA 1HK6A 4LF3B 4WUUA 1ZHLA 3MBEA 2ZYHA 4IW4C 4OLVL 3UPCA 5BXFA 1OGAD 4KO9A 3RAJL 5LBVA 5CD5C 1JFQL 2C9SA 2OS7A 2GABA 5DUPH 1QI4A 2EQDA 5GSVB 4PHXA 3T0EB 5J3HC 4K07A 1YNTB 3O81A 3ZZLA 2JKWA 4S1RH 1QSEB 1HJCA 4DERA 2EXYD 2ICWJ 3RWGB 2XN2A 3G6DL 2KUTA 4ENEC 1F90L 1T1XB 1U2HA 4ODHH 3BAXA 4LAJH 2D31B 4JO8A 4LLUA 4RGNE 4P2CG 4CSPA 1T80A 5T3XH 4NCDA 3MNWB 3K8MA 1WTLA 3STBA 1HHJB 3MRFA 4GNKB 4AKOA 3O41A 2GB2A 4HWBL 1TU2A 3KYNA 5E7FA 4RMRA 1ZT4B 1M9WA 3TASA 2HRGA 3QG6A 4ONGH 5A40E 5I19H 1KLFB 2GFBB 1SXBA 4D0DB 2D7TH 2R1XB 3C5ZD 4J8RA 1R3KB 1AXSB 2AV1B 1NSNL 3AQYA 1F1DA 1JDAA 4Z8FL 4IHOB 2BXYA 3MLYH 3RVXC 4AOFA 5MEOA 1HJBC 2HLFC 5BS0D 1EV2E 1VPOH 4BQCA 1X5JA 4PTTB 1PLGL 1CS6A 1A7PH 2BCKB 4BFIB 5DD1L 3P9MB 2OSLA 5IHUH 5GISL 3KBEA 5IEKB 4D3CL 4M7JH 3TTYA 3GKWH 2YJQA 4WEMB 5CZVL 4TVPL 5IR1B 2N3JA 4J23A 1KTLB 4IGBB 3R0MA 1JXJA 3C6LC 2O5YH 4RX4A 5DJ6A 1M3IA 1IU1A 3KCWA 4F7PB 1G5GA 2J4WH 4HKJB 4QF1B 3VO0A 4W9FC 1I7TB 5EBWB 3NJGA 4QRRE 4APXB 3QDHA 3KL5A 4E2OA 4LEEA 5IW6A 5DHXB 5EOTB 1A2YB 2VM9A 2NTSP 1VFUA 1BECA 1XV8A 3SQOL 5DUBB 1IFGA 5AG9A 2DQTH 5AVXB 4UB0H 4D8PB 2VITA 2H41A 3B2XA 3QQ4A 2GY7B 2X53A 1QACA 4NBYB 1Z5YD 4XVJH 5GS1C 5LDUA 5D7JB 4QXUL 4HDIA 4PJGF 1U8LA 1XCTB 5D2LF 1QRNB 5D2LA 5GGVL 2VIRA 3S96A 4OM0H 5L2KA 4NQVA 3HNSH 3D25A 4LAQH 1MRCL 3HHMA 3MRPA 4O2CA 1X5XA 3SKNB 4K5MA 2X40A 3GMLA 3GHEH 3D0AA 4QRSB 4MJ6B 2YRBA 3Q01A 4YZWA 1HHIA 4G59C 1AS7A 3TFKD 3HHRB 2ICES 3TH4T 4YSQA 1CYWA 2NUTA 5EZIL 3FQUB 3PDDA 3W0WA 2VW4A 3FUFA 4IRJA 4XBGA 1MFMA 1J1OH 4KKAD 3UZVA 2XI9A 3VSUA 2XN9A 4Q14A 3D85B 1DN0A 1Z9OA 2XT1B 2YA0A 3VWKB 5A16A 4QHNA 5HSFA 3ESPA 3TWCH 1D5BB 4PV9B 5I74B 5JHAA 2QR0A 4MAYD 4X99B 4YDNA 3MNDA 1JI1A 1R75A 3DVNB 3BAIA 4GMTH 2BOLA 1DQJA 3N85L 2BLFA 3AREB 2YO3A 3O11B 4IIQB 4GI8A 3U9WA 2KLSA 4JO4L 2MQGA 2ZKMX 4KKZA 2H26A 4JFFD 1V10A 2NQCA 3WFHB 4DN4L 3CVHH 3HFFA 2OMNA 4TSBL 5AAWA 1SDAB 3LXUX 1WDAA 4MQXC 3L6FA 2QQKL 2W0PA 3DJ9A 3BDYL 3UYRL 1KIUA 1QTYT 4XN5A 2I27N 1YA5A 1KCSL 5C0AD 4EBQH 2L7QA 4FI7A 1MHPL 4F57L 3FQWA 3QPQC 1T5XA 4H0GA 3B5HA 5F1NA 2YK1L 2BCMA 4YIQB 4HOWA 3EW3B 4DEPC 3VWJA 4Z78A 1U2YA 3RUGF 5E6ID 3RUGA 4GSQA 2LW3A 3KS0H 3CVHB 1AJ7L 3FO2A 2Y1VA 4D9LH 4K94H 1W2KT 4XHJC 3BAYA 4G9FE 3B6SB 5JUEH 4ZMPA 1D6EA 2PWDA 1N59B 1F56A 1FV1A 4ZFZA 1BBJB 4NM8H 1PAMA 5AENA 3F58H 4RCAA 3K8KA 1KCUL 2B14A 4U49A 3RDTB 1WVZA 3HE7B 2ICEC 5D1QD 3P40A 3S3CB 2FATH 2H4EA 5EEXA 1CG9B 1WBYA 4UT9L 1ZGLA 2QBWA 3SOTA 3LRKA 3U7WH 1RIVH 3QWOA 1GGIL 2GK2A 4EIZC 1H0DA 5T5NF 2F7RA 1CDBA 2DM4A 2HKAA 3U1SL 1DUYA 4ISVA 5L8KB 3IRPX 4NQCB 3TZVB 2K7PA 2OTWB 2P80D 1TJGL 3VGAC 3ZO9A 1SY6L 2X3AA 3FULA 4NM4H 1IC0A 3O9WA 2F18A 4KK8C 2ZZUT 2F54A 5FR3A 2OFQA 2CDFB 3S48A 2ARJB 1NGWA 1U93B 1UURA 4MXQD 2IQAB 3WMPA 3UCRA 1MHCB 3F64A 3IAPA 4JHUA 4AGQA 4PJAB 4LRNH 3II1A 3BAWA 1M1XA 1Z3RA 2ED6A 3PNRB 1BIHA 2EC8A 3RVUC 5IBLD 5F96L 2JJSC 3VXOB 3C60C 4JY6A 3CBRA 1G7PB 5HHNA 1IC1A 3FQ1A 4XCNB 1CF8H 2VWEE 2AEWA 2QSVA 3LQAC 5FDWB 2BMKA 4LCUA 4XTRD 2IPKB 2IBBA 4KZCA 5AYUH 2FEJA 4ADJA 1J8SA 1TTFA 1G87A 4YXHH 5L8JB 2V9TA 2XUWA 1ZLUK 1P7QB 2VUKA 2WBJB 5ABAA 1YEEH 3PQYB 5FKPB 4C56B 1IMHC 4LLVB 4OGYL 3SJVD 4YBQD 5J13B 1CC3A 4ES8A 4C54A 2XTJC 2JXMB 2XWEA 3VDAA 5DYOB 1KY7A 4PJHB 2JK5B 1YJDL 3A3YB 4WV1B 4LF3A 4K2UL 2YSSA 3Q6FA 3P0VL 2C8NA 1HKLL 5B1CA 5BNXD 4B0MM 1OE1A 1A4AA 1RSFA 1PY9A 2QADC 3GXPA 3T0EA 4PJEB 1YNTF 3QJFB 1YNTA 2E7LC 4JAMB 2CXKA 4BK5A 5J1TC 2QZ5A 3ZRCC 1UA6H 3RWGA 3LDBB 1T1XA 4R26H 1IQDB 1EXUA 3N91A 4WWPA 5DQ9B 5A2FA 2D31A 4ZAKA 2CHZA 3SQBB 5DZLA 1MG2C 3H9YA 5E8DH 2H6OA 4A2GA 2B39A 1BVNP 1MCOL 4DGIL 3MNWA 2NY5C 2WWNA 4H8PA 5DVLA 2AC0A 4Z3FA 1CXIA 2EAEA 4L1HA 4NKDB 5LB1A 1ZT4A 4G80A 1PS3A 4HAGA 3E7JA 3N41F 3QJQB 3N55A 3HNTH 4HEMA 5IJKC 1KLFA 2BSDA 2XJLA 5CJOH 3IJ7A 3EHBD 1IM3B 1YAZA 1FL6A 2R1XA 2C4XA 3GSUB 1FG9C 2FHFA 1JPEA 1R3KA 1AXSA 5DURB 4Z7QF 4LSRH 5I6PA 2F8OA 3O8XB 2APXA 2NY1C 3MGAA 4IHOA 2WUBH 4CU6A 3MV7D 4PTTA 1A0QL 1UJ3C 4P5RA 2VR8A 1EGJL 3LPOA 4BFIA 4X9FA 1RUPH 3P9MA 2IQ9L 3F6IA 5IEKA 2Y23A 4P4RA 4ICXA 3JT0A 4PYHA 2K6YA 4JY5L 4DAGL 4DW2H 3FQRB 3A4AA 3KLKA 3MJ8B 4KPHH 1E9OB 1JF1A 1KTLA 1H3VA 2J1KA 4EI6A 3IJEA 4WZ9A 3X3FL 2JWYA 1RUQH 1SXNA 5TDOB 4F7PA 3FT4B 4HKJA 3J27A 5C09B 1QQDB 5EBWA 1I7TA 4EZKA 2HT4C 4APXA 2PYEA 4RMUA 5DO8A 3RIAF 3WSQH 1UGKA 4UQ3B 5EOTA 1A2YA 2XWRA 3EADA 3HI1B 2DOCA 3GEWB 4R90L 2QELA 2W60B 4WHYG 3KGUA 4GMSH 3TX4A 5DUBA 4ZX5A 4XCYA 2VLME 4D8PA 3QE5A 3D4CA 5JR1L 1CL7I 2Z91A 3NRQA 5ALBH 1AZNA 4R5XA 5D7JA 5E1AB 2OJZL 1XCTA 4WAFA 1UWYA 3BYTA 4XBMA 4MGXA 4AVJA 3NFNB 2FTAA 4XOBA 1SLUA 1UACH 3GLEA 2XA8H 4ZDHB 2CMRL 2EDEA 1MNNA 1ECYA 3H7LA 4Z0XB 4F3FB 3KLDA 2D3LA