2VW4A

Nitrite reductase from alcaligenes xylosoxidans - 2 of 3
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
ADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title On-Line Optical and X-Ray Spectroscopies with Crystallography: An Integrated Approach for Determining Metalloprotein Structures in Functionally Well Defined States.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 91
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw4A02
3NP3A 4AX3A 1E67A 1RKRA 4G70B 3ASNB 2ZXWB 4A2EA 5I5MA 1J9QA 3WI9A 3AW5A 3H4HA 1OCRB 1QLEB 3UAEA 1IC0A 4QKTA 3QJVB 1AIZA 1AR1B 3TASA 4DP0X 3PCYA 3NSFA 2I7SA 4DPBX 1BQRA 4A67A 1BQ5A 2WO3B 3S3BB 1L9SA 2BHFA 2MTAA 2AANA 3GXUB 2FQDA 3QJUB 4GP5B 4BXSV 1DZ0A 1AZRA 3ZX1A 2TSBA 4G72B 1VLXA 1WAEA 2UXTA 1KBVA 3DIVA 2TSAA 1TKWA 1V54B 2UXVA 3V9EA 1AANA 2VM3A 3FU8A 3TA4D 4E9YA 2IAAC 2FTAA 1AG6A 1ID2A 2IDUA 3WKPA 1TEFA 1GS8A 1NPNA 2Y69B 4M3HA 2XUWA 1GY1A 3FQ2A 1GYCA 1MZYA 3WNJA 4W9ZA 2XV3A 1SF3A 1NIFA 3FU9A 3UABA 2FJSA 5I6LA 1IBYA 3NP4A 2IDTA 4WKXA 1NDTA 1WS7A 1YLBB 2GC7C 3X1NA 2I85A 1JXFA 1IBZA 2PP7A 3MX0B 1ET8A 2FT8A 1FA4A 1KV7A 3QJQB 1AQ8A 1XB6A 1NPJA 1PMYA 1SDDB 2H5UA 3C75A 2ZWNA 3H56A 1PZBA 4YSRA 5B1JC 4N8UA 4YSPA 2IH9A 2VSKB 1B3IA 2R7EB 2YAEA 1OE3A 4JHUA 5B3SB 2XV2A 1FWXA 1HFUA 2BWDA 3IN2A 3BVDB 2FQGA 1WA1X 2IDFA 4DP6X 4HHWA 1JZHA 2QPEB 2HX9A 2FWLB 2GBAA 2QT6A 1N68A 1PZCA 4QLWA 3EH5B 2YXWA 2HLEB 4YSDA 1ZIAA 3ZBMA 4HCIA 1JERA 3T6XA 2YXVA 1UATA 1AAJA 2LLNA 4G71B 5IY5B 3UGEA 2BZ7A 2IDQA 3QJSB 4BDVB 2PPDA 5I5JA 1A4BA 1MG3C 3X1FA 5AFAA 4E9XA 3GYRA 1BAWA 2BP0B 5AKRA 2UXGA 1NWPA 2PCYA 4HCFA 3UADA 1ILSA 2GB2A 3T71A 5I6KA 3S3DB 1GSKA 3HB3B 1GY2A 4L0PB 4Q8BA 3TBCA 2HRGA 1JVOA 3V9CA 1I53A 1W6WA 4UF7C 1GS6X 2PPCA 3X1GA 1L9RA 2J57A 3FQYA 4UANA 3NT0A 1QHQA 1A8ZA 3FSAA 1SDDA 3PPSA 1ASPA 8PAZA 3QJRB 7PAZA 1V55B 1EZLA 1SHXA 4HIPA 2R7EA 2FT7A 4NB7A 4X4KA 2BP8B 2OCCB 2XU9A 3ABLB 3CDZA 1ZDQA 3AG1B 1L9OA 1AS8A 4DP9X 1E65A 1JVLA 1XB8A 3TBBA 1SFHA 3NSDA 2HZHA 1OE1A 2BW4A 3WNIA 2WSDA 3X1EA 2IDSA 2Y1AA 5B1KA 4AKQA 3G5WA 3U25A 2BW5A 3IBOA 2BO0A 4BDVA 1SFDA 2I7OA 5F7BA 3FYEB 1IKOP 3T9WA 2BP0A 1EHKB 2PLTA 1ZV2A 2IWEA 4GXFA 3FSVA 4KO9A 1NICA 3FT0A 4E9RA 2GC4C 1ILUA 2RACA 3NSCA 1OOWA 2PPEA 2VW7A 4AZUA 2VM4A 4YSEA 3AG2B 3PAZA 2QPDB 5D4IA 3IN0A 1ET5A 4KNSA 1PZAA 6PCYA 2UX7A 4KO7A 2W88A 2EIKB 3OQRA 3AZUA 1V10A 1BXAA 4KOCA 3N55A 3NJMA 4G7QB 2N0MA 3SQRA 1RZPA 4PAZA 4DP5X 4A2GA 2PPAA 2JKWA 3HEIB 4YSAA 4AI7A 1KBWA 1PF3A 2XV0A 6PAZA 2XXFA 3EHBB 4E9SA 2GI0A 1A4CA 5FC9A 2FNWA 2YQBA 2DV6A 1HAUA 1AS7A 4G7RB 2YAOA 3N2JA 1AOZA 1JZEA 1ZIBA 4YSTA 1MG2C 1BQKA 2HRHA 4ENZA 1W8EA 2QDWA 1TEGA 3FS9A 3FU7B 2AFNA 2CCWA 1GR7A 4E9TA 2AZAA 2DY2A 3CVCA 4HCGA 1L9TA 2EIJB 2EINB 4GY4A 1AS6A 1DYZA 2X88A 3NJLA 2J5WA 4YVUA 4DP7X 4P5RA 3CVBA 1KDJA 1JXGA 4HALA 4YSUA 4A2FA 3QPKA 3X1BA 2NRDA 3FSZA 4A66A 2YAFA 1W6LA 4AKOA 1J5DA 2YARA 2B3IA 2JFCA 5TK2A 2VMJA 3ABMB 3OMNB 1PCSA 1JZFA 5I26A 3T6VA 1PLAA 4TXVB 2VSMB 3ZDWA 1PLBA 3QQXA 1NIAA 1CUOA 4GP4B 2BWIA 4WTQA 1JZGA 2YAMA 2IH8A 2W8CA 3NJJA 3NYKA 4UAHA 2UXFA 5I6OA 5EHFA 1RCYA 4AKPA 1WA0X 2CALA 1CURA 1AZUA 2P80A 1A65A 3FU7A 4HAKA 3JT2A 1R1CA 4KOBA 9PCYA 1AZBA 1CYXA 2OV0A 4KNTA 2DYSB 1SHWA 1ASQA 1PY0A 1GS7A 4F7KA 2J55A 2EILB 3OMIB 4GYBA 2XX0A 1AZNA 1GW0A 1NIDA 4EF3A 4E9WA 2PP8A 1WS8A 3QJTB 2Q5BA 5D4JA 3CZUB 4F2EA 3S8FB 3WIAA 2GSMB 3UACA 3ABKB 4CSZA 1A4AA 1J5CA 3AG3B 3PAVA 1OE2A 5I5IA 2VW6A 1M56B 2FT6A 1SJMA 3GDCA 3SBRA 2ZONA 1ETJA 1FFTB 1OF0A 1TU2A 3AY2A 4DP2X 4BWWA 3NJFA 3ERXA 1OCZB 5PAZA 4BXVA 4NAJA 1BXUA 2DWTA 5B1JA 3CVDA 4YSQA 1PAZA 7PCYA 2FQEA 1HAWA 1NZRA 1KYAA 1N70A 2PCFA 4CSPA 3EH3B 1ET7A 2IWFA 2PP9A 5I28A 1JOIA 1BXVA 2DWSA 1T5KA 5I6MA 3NJGA 1WA2X 3NJHA 4KNUA 2UX6A 3TU6A 5AZUA 3EH4B 4NERA 2BP8A 3CG8A 1E5YA 1QNIA 1L9PA 4KO5A 2EIMB 3S8GB 4HZ1A 1M9WA 3MBWB 4JKNA 4PCYA 1ADWA 4DP1X 2MRYA 1NIEA 4Q89A 2GIMA 2HXAA 1JZJA 4G7SB 4N4YB 2XWZA 3IE9A 4BWUA 5D4HA 3NSYA 3DTUB 3WG7B 2CBPA 3FYIB 3JTBA 2Q9OA 2JXMA 1M57B 3NJIA 4A2DA 4K9JA 3T6ZA 2CJ3A 4DPAX 1JZIA 1KDIA 1E30A 4A2HA 1OCCB 3KW7A 2WO2B 2DYRB 3FQ1A 3PAUA 2AZUA 5A7EA 2FQFA 1KGYE 1BYPA 2H3XC 1JXDA 4P5SA 3BQVA 3PXLA 3D12B 1PNCA 3IEAA 2XX1A 1PLCA 1CYWA 5PCYA 2VN3A 3FPYA 1KCWA 4YSCA 5E9NA 2J56A 2XXGA 4A68A 1KCBA 1RZQA 2YAQA 4DP8X 4YSSA 2YAHA 2AVFA 3ZIYA 2CAKA 1SF5A 1L9QA 4ZK8A 1NIBA 3S3CB 2BZCA 2OJ1A 4DPCX 1E5ZA 3OMAB 5ANHA 3CDZB 1J9TA 2ZOOA 3FSWA 3OD3A 4W1TA 3SBQA 5LDUA 1XMEB 4HHGA 1X9RA 2GHZA 1ASOA 2CUAA 3ABGA 3NJKA 2VW4A 1AZCA 5B1BB 1NTDA 4DP4X 4E9VA 1CC3A 1OCOB 5TK4A 1BYOA 4YVNA 2QDVA 3DKHA 4KO6A 5B1AB 1NINA 1ZDSA 1AACA 5F7AA 1ZPUA 1MDAA 1A3ZA 1MZZA 4F2FA 5B7FA 2HX7A 2IWKA 2XVBA 4M4RB 1X9UA 3RYMA 1SNRA 4FAAB 4RH4A 4BWTA 3AG4B 3NJNA 3UAAA 3PLYA 2HX8A 3H4FA 3OM3B 1IUZA 3FPXA 1J9RA 3X2QB 2H47C 3ASOB 1J9SA 1NWOA 4MFHA 5B7EA 3SBPA 2PPFA 4JHVA 2X87A 1F56A 1OV8A 3T6WA 1XB3A 4GP8B 2E86A 5I6PA 2P80D 4YL4A 5B7MA 4YSOA 2B08A 2XYBA 4BK5C 3KW8A 4E9QA 3L45A 4FA7B 5I6NA 2XLLA 1URIA 1AG0A 3WKQA 1PNDA 1BEXA 2YAPA 3EF4A 2A3TA
chains in the Genus database with same CATH superfamily
4WI6A 3B5HA 3PPEA 3AFLA 2L8AA 1AP2A 1DQIA 4YGAB 5JDSB 4RMQA 4FGMA 2VDKH 4A2EA 3UYOD 1GCYA 3WI9A 2W0KA 4AGNA 5DGRA 5LQBL 3G6JB 1XGTA 1NCHA 3BVNB 1RIUL 4R6UA 5HYSB 3NCWA 1K9TA 3WIFA 2H1XA 2X2IA 3IS0X 2LFGA 4ZOAA 4Z95H 5A1AA 4FL4B 1BQRA 4Q2ZA 5D5MF 4NJ9L 3MRRB 4JFHD 2C4XA 4LCYB 3EOTH 2CIKB 3W9EB 2WWMC 4EN3C 4QRBA 2NYKA 1ETB1 3O11A 4WHCA 2NR6C 3CBKB 3NCYP 4KROC 1T3FB 1KBVA 1EDHA 2WZ6A 5FF6B 3MO1B 3N9GH 4NZUL 4G8FB 4P2RD 1K6QH 3VXMD 5J5EA 5KWYC 3BD5A 4OD1H 1GVIA 5F9WC 3FO0L 2ICES 1EFQA 1Q9LA 4QRFA 3WJMB 3DX2A 3V0HA 4WO4C 4BFJA 2X4UB 3LRGA 4NNPL 1S7RA 1WDAA 3FW6A 4Y9EA 4TNGA 3V0JA 1MEXH 3JUZA 3WE6A 3Q8FA 4LRNH 3HG1E 5DVOA 4G43B 5DJYA 5C07E 4JFEE 2VDPH 4JHZA 4UWQB 1SF3A 3FU9A 3QNZB 1BIHA 1E3FA 3RKPA 1THAA 4WFEE 3VFPA 3RTQB 4Z7QB 4KMTL 1LO3H 1PX3A 2Z93B 1U8JB 3APMA 2CHDA 3H53A 1N18A 3ET9F 1FA4A 2BM3A 5EA0H 3TN0B 4QJ3B 3ARGA 1JRHL 4ZUTA 3CLEL 3GKWL 4ODUB 5HGGS 3MC0A 1J1OH 5EUOF 2LT9A 5GXBB 4PI2A 4A6YB 1B3IA 1DN0A 2GW5A 2VQTA 4TUOB 3FO0H 3F7YA 4GRLD 3ULVE 1LEGB 5DJXB 3MRCB 4FADA 3CN2A 4HJGA 1TNNA 5TDPA 1JPGA 1WA1X 3MGOB 4XCYB 1FL5A 4L5FH 2J1XA 2A73A 4ALAC 3LH2L 5ADPL 1F3DJ 1KYFA 1FYTA 4MXVF 4FFYL 1BJ1H 3QCTH 2HLEB 1JERA 1RJLA 4ZPVB 2UWEA 1MI5A 4HGKC 2IDQA 4X7FC 1MCOH 4PJ9B 3RWDB 3VRLE 4JGJA 1BAWA 5C71A 2BIQA 4MA3B 1CBJA 3TNMB 4FNTA 2GB2A 3V5HA 3T71A 4QRRD 5I6KA 3PXHA 5E5UB 1KWGA 1VFBB 1ML0A 3PHOB 3M17A 3CLEH 3QQ3B 4XVJH 3T0AA 1JVOA 3PNWB 3V6FA 4UTBL 4Y9FA 2LE9A 1AO7A 1GS6X 3MX0A 1DR9A 2FL5B 3G6AA 5JIIA 1HEZB 3LD8B 3LOWA 3CN3A 4TOYL 2NY5C 1A8ZA 4G1EB 4B5ZA 1O75A 1ASPA 3EYUL 1BQSA 3G04B 4BQBA 1CTNA 3BGMB 4PP1D 3GJFH 1FZMA 1A9VA 5ADPH 4EVNA 4KJPD 1GTNA 4FFYH 2QL1A 4I3GA 5C09D 2PCPB 4XBMA 5M94B 4X9BA 2K3TA 2B59A 4RFEA 1E5UI 2A6KB 2IANA 4JY5H 4WWOA 2BIMA 2IGLA 4TL4A 4DEPC 4ANUA 4OAWA 1UWXK 5DUPH 1RZGA 2PYFB 3SJVA 4YDJA 4ZD3H 4PJEE 1JG9A 2IVFC 2FH6A 3H85A 3NK4A 4C56E 4F7CB 5J6HB 5L8KB 4N9GA 2ZUXA 4KJWC 4PJGE 3W11D 3H7BB 5A43C 4GG6B 4PCTA 2WYHA 3IBOA 3GMLA 3GSXB 3P9LA 3D18B 4GEJA 4UTBH 2CGRL 2PLTA 3WLWC 5EOCJ 3BUTA 4U2YA 4TOYH 3SOBL 3GFUA 3H54A 4IOSD 1LO4L 2NY2B 5ISZE 3EYSL 4X98A 4C8XA 2IEPA 2R2CA 1H6EA 3BP7A 5I17B 2F54D 1HYSC 3NIGF 1FUNA 2OI9C 3T0EE 1V7NL 1IC4L 5D2NC 1E27B 4C58B 1QFPA 1MELA 4OD3H 3BAEH 4NQSB 3SYQA 3TJPA 1MLCB 2A4EA 1UC6A 1XHHA 3IJYA 5ALBL 5JW5A 3PG2A 4JN2B 1TZIB 1BVZA 3SQRA 4FFZH 1I9IH 3QO0B 2HP4A 4Y16D 4BZ1H 1HL4A 2BOCB 3BEWA 2ZWSA 2Q8AH 4PREB 3FO1A 3VD2A 3UP6A 3CVHB 4WI7A 3IFPA 2EE9A 2D9CA 3EYFB 1GOHA 2UZIL 2HJFB 2B4CL 1KCUL 1CE1H 1ZHBB 4JFPB 1J05B 5T5FH 4HH9A 2XN2A 4B9FA 3EYSH 3IGFA 4UDTA 2MCAA 5LB1A 1F02I 3L4VA 4OGZA 2NUTB 4XN1A 1AZZC 1V7NH 1PKQB 1IC4H 2JNZA 3B9KB 2EC9T 3BWZA 1N59B 1AVAA 4ZS6C 5CF3A 2FAUA 3L7FA 3FT3A 5DEGB 3VTTA 1E0OB 2EIJB 4HVBA 4QF1A 3OGCB 1S3RA 1BZEA 5E2WL 4JDTH 1BJ8A 1PSKL 2ARWA 1XD1A 1E4KA 3UCRA 1W91A 5ESVA 2UZIH 2B39A 4HKBA 2PXYA 4DGIL 1XF1A 2Y6TE 5DWPA 2BY1A 3Q06A 3IU4L 4XP4H 3QYCA 2CE6A 4U1IB 3QA3A 4WENB 4IBLT 1CUOA 4GBXA 1KELL 3VI3A 5FM5M 4CAGA 3E2HC 1TU2B 4RRPM 5AUMB 4I1PA 1YNKL 1IAII 1OCWL 2AABL 3NJJA 2ZP0T 3QI9A 3SDXA 4CBPA 1AIFA 2R2BB 4RRPG 3SDYH 3U4AA 3UDWC 4IBSA 4Y4FA 5EHFA 1ZLEA 1UZ6E 4ZXBC 4F7TB 3RB5A 2OTWB 2AQQA 1T1XB 5E2WH 2R9HC 3HZMB 5K1VA 3ZO9A 3V0AC 5E4EB 3L2LA 5EZLB 6TAAA 3ARBC 4AQOA 5I0ZA 4XMKH 1WEJL 4GI8A 3K7UA 1A0QL 3R0NA 3GLDA 1IGML 1SPDA 3KDMB 3WN5A 3OMIB 4TTDD 5C3TA 4U6HA 4DGIH 4H26B 3VA2C 2PP8A 1X7SA 1MREL 1GPOH 1YY9C 1EEZB 2Y1YA 2ERJB 1BZ9A 4NPYB 4DKTA 1ED3B 5TDNB 1FL3A 2YGOA 5DK3A 4ENEC 4OQ1A 2QV4A 3DWTA 1OCWH 2X4NB 4RISL 5DMYA 5IQ7L 2J2ZB 2EO9A 2WN2A 2HKFL 3VCLA 2OMNA 1MHCB 3BH8A 5J3HD 5FYLL 4PJ5E 2NT0A 2JXMB 4U1JA 3CN4A 1Z5HA 2XTSA 1QTYT 2JQZA 1MVUA 3RZCD 3TZVB 4PWFA 3OKOB 4BXVA 4L3EB 4IRJC 4ZAKB 2KDYA 3ZGIA 1PAZA 2W60A 4TVPH 2Z1KA 3OXSB 4XWOC 1H8LA 3VXOA 1WEJH 5C7XH 2NY1C 3UPCA 3MJ9A 2R1YB 2EYSB 1LK2A 1N64L 1GKEA 4Y2DD 5MEQA 5AW2B 2OULB 3FCGA 1BOYA 3IDGA 4JL1A 4ZQKA 3QO1A 3MRLB 3UBHA 1Z5LA 3SGJA 1BMWA 1NCNA 1M7DB 2NXYB 2UX6A 3DXAB 4QAWA 4XCFH 5E70A 5F96L 5AZUA 3WUWG 4BSWA 2N59A 3NCJL 3MRNA 5BVJB 4HIHA 1VCAA 1JUFA 4NPJA 4Q9RL 4XMPL 4MJHA 2HKFH 4HXAH 5EOQL 1M9WA 2KKQA 5FYLH 3ZR5A 1YDPA 4IHOA 1VFOA 3BUBA 1C9SA 3KPQB 3OR6A 5E00B 3RGVC 2HKHH 4Q89A 3V6OE 2X42A 2XWZA 4CW1B 4LLMA 1ICTA 1TYRA 3WU1A 3ZRCC 5KZCD 3ZYZA 3DTUB 4JFUA 4HV8B 1KCVH 2IV9A 3VFSA 5LXGL 1PW3A 3F6JA 4NQXA 4H5SA 5BS0B 1FNEA 1P7QD 1S9WA 3FC8A 4XN4A 4B41A 1N64H 3TJEH 4Z3JA 2YUVA 1KIQB 4I18A 4A2HA 2VUKA 1HSBA 4XBEH 1LL1A 1QR4A 3CH8A 2DM2A 3QIUC 5IFHL 2WCSA 2H3XC 4MD0A 4UB0H 3TCTA 4HMDA 1N0XL 5GJTL 1F3DH 3PXLA 3NCJH 5E51A 2EE2A 1I9RL 5BZXA 5PCYA 4AQ8A 3FPYA 5ESAA 4XMPH 4LBEA 4LHUG 4Q9RH 2AJSH 2EVIA 4LSUL 1HHKB 2G3MA 5B3JF 3J07A 5TDOA 2OTUB 1FNFA 5T1KA 5E99H 4YIQA 4MCYA 1FNHA 4L3FA 2DLIA 3LRHA 4BKSC 1EXUB 2XG5A 3TBTA 1PVHA 2GJZA 4KX8A 5HYFA 1TIUA 3WL9B 1S7SB 3ZT6A 3L6FA 3H9HA 4F33A 2CAKA 2CPUA 2IXQB 3UTZA 1SF5A 3AXHA 4YPGB 4NBYB 1P5UA 1U8MA 3PE9A 3X13A 5I1IH 3KYOB 4RGOL 4O2CB 3MRHB 1QR1A 3OD3A 5DJ2A 2CMRL 4MCMA 3T4AA 1TQCC 2X6UA 5I1GL 5KVEE 4A7SA 2EC9U 2GUOB 4YDMA 5I8KL 4JRWA 1DQLL 3N44F 5GJTH 5C0CD 4LSVL 3R7RA 5EG6C 3DKHA 1I9RH 1WGVA 3HW7A 4PLNC 4OCXH 2N7SA 3FZUD 3VWJA 3MCKB 1Q9WA 1FVCB 1MZZA 1YMME 5E2UL 3IJ7A 1A7QL 3OGOE 3MV9A 1QEWB 4AYBA 4PUBL 2PO6B 4UYPA 3SPCA 4BWTA 2EICA 3U7WH 5F8RC 1ZTXE 1CD1A 3HZVB 2ISDA 5HJ3A 4ZUWB 3X2QB 2ROYA 4N1HB 2IIJA 3FTVA 4PRBB 4QUOA 1ZLSH 4UOQA 3ULSA 5D71L 1O0VA 2PPFA 1ID5I 1L3NA 3LN9A 2X53A 3MA7B 3PAYA 3QPXL 2XHNA 3M86A 1FIEA 2OSYA 4KVCL 4RRPA 5EOCH 4BFFA 4G8EA 4JJOA 4LP4A 2WWMD 4M8QA 2CMRH 3V7AG 4EN3D 5I1GH 3IDJA 4H88H 3HBPA 5TJWK 3TCLA 3ULVC 3B1TA 3R1GL 3U0PA 1NFDE 2P80D 4YL4A 3SGEH 4HP5A 1DQLH 3FN0L 2CO6B 1LJMA 1SXBA 2HLAA 2YPVA 3HMWH 4M5SA 3K80A 5LDSA 3TVMC 3FU0A 4ZQTA 4ELMF 4YXLL 5EU3A 3MV7D 4HUXA 4JJ5B 4K3EL 4WO4D 4PUBH 1CDBA 3MRKB 1MJUL 3O9WB 2HG5A 3CX5K 1MQKH 5I5MA 3NIDE 4Z7WA 5D7LA 1DEEB 4P05A 1EWHA 2ZSWA 3B9EA 3WD5H 1ACCA 2W0PA 3BIAX 3EBGA 4EI0A 2YLHA 4I0KA 4WI3A 5I8OL 3WNPA 4KK6C 3IKCA 2CO7B 3PCYA 3CGTA 3QPXH 1UJTA 3D3VE 3P77A 1RPKA 1UVQA 1YPZF 2KYIA 5KVFH 1ANUA 1E9QA 1A2YB 3FB5B 5CU5A 1PG7H 3L4WA 5DHVH 4ELDA 2QMJA 2UZXA 3V4VL 1KGIA 2ZKMX 4LAJH 1QPXA 5INDB 1J8KA 3QXDB 1UA7A 1GXEA 5T3ZL 2IMNA 3BEVA 4XRCA 2FNBA 2VM3A 4ZG1A 1XH3B 4YXLH 4ODHH 2F18A 2CLZB 4K3EH 2YD9A 4W9KC 3Q8BA 3K91A 3S5LB 1LMIA 5GSVA 4CDGC 3BZEB 3KZ8A 1K4CB 1I9JL 3WUWA 2JELL 2BC4B 1FVDA 4APQC 3MLUL 5CEZL 1EMTH 3G5VA 3K81A 5I8OH 3UYRL 3OC5A 2XV3A 1IKNA 1S7WA 5IB3A 2OYKA 3UABA 1IAKB 3K2KA 4IIQB 3ECBB 3MMEA 3DHUA 4M62L 3RI5F 3CJJA 2XZCH 2GC7C 2KQMA 1VERA 1A4KB 2CIIB 3UMTA 1F3RB 3DI2B 1A6VL 3G6JE 4JZJC 3L5XL 1NDMA 4G8IB 1KTBA 3O4LD 5IBLD 1A47A 1MSPA 2ZWNA 5T3ZH 2CBQA 1GGIH 2C9RA 2X4QB 5E8EA 3T0EC 2N0KA 5BQ7B 5TGBA 2X2HA 4NZTL 1CFVL 4NAQA 3FSOA 1QI3A 1NSNL 12E8L 4FC3E 1TQWA 3QHFL 1ZT4B 3FB8A 1I9JH 3NBNA 3L3JB 1CFMA 1M2VB 2YPKA 3I75A 3UBXI 1GYAA 2ATPB 5D1ZC 4KWUA 4Q6YA 5EBLA 5GGUA 3UZEA 4Z77B 5CEZH 1IZJA 3UYRH 4LHUA 1D5ZB 2R0ZH 2O6EA 2Y3AA 1FLRL 4KK9C 1YHPA 3RWIB 3T08A 5IMLA 4NC1C 5F7DA 5FO9B 4HPYL 2B1HL 2NY6D 1OKEA 4V1DB 4KJWD 3KBFA 2ZPKL 4PEEA 3ULUE 1SY6A 2CBMA 3EJPA 4GINA 2XFXB 2EVFA 4KQ0A 3L5XH 1KXQE 2GEEA 2E56A 2XC8A 3IDXL 3C5ZA 3KBHE 4FLSA 4EXPX 1UTDA 4KVPA 4PRHD 2W91A 4YAQA 1ZA6A 5D6DC 5KSAC 3JYBA 3M45A 4NZTH 1CFVH 1V3JA 3RU8L 4Z7QE 1UXWB 2JKLA 4J6IA 3V0EA 5A2JH 2JE8A 4LLAA 1T6WA 4PM1A 4XBPA 1LYQA 3HN8A 1HYSD 4CRPA 5IQNA 1A6ZA 3GNML 4WVRA 4Z23A 1BIIB 4R96B 2Z31D 1WCQA 4OB5H 4PWKA 4J23A 2QHRH 3WFZA 5D1QC 5G4NA 3P0VL 5FA3B 1ZDQA 2BSTB 1FLRH 2I26N 2YMXL 1RUPH 4XN8A 4KZDH 2B1HH 1BQLL 3G08A 3H42L 2K9FB 3TP4A 2WSDA 2YN5A 4G5AA 3VJ6A 5GS1B 3QUXC 5CLTA 4G5ZH 3GIZL 4O02A 4MRBA 5E5MA 2BO0A 4HS3B 2GYSA 1B0GA 5DQJB 3BDBA 4MQXC 5DMJB 3SE4A 2WQVA 2BVOA 4UTAL 1KBGL 5DC2A 4KKZA 2YUWA 4KO9A 3OXRB 1UURA 3JWOL 3NSCA 4KKBC 1I8MA 3Q8EA 3RILA 5T1DL 3DX1A 1LDPL 3FUEA 1DQQA 5BRZA 1NC4B 4OJAA 4ZMZA 2BCKB 2P44B 3Q3GA 4TQEH 1VGKB 3A6BL 4QT5B 3ARZA 4ZS6D 3L1EA 5C0AA 3P0VH 3FDWA 1AQHA 4HKJA 3CQQA 1NCBL 4FFWC 3OQRA 1L5GA 4IDJH 1BXAA 3DTXA 4G7QB 3BIBX 5D8JL 4L4VA 3L4YA 3G5YB 2XVKA 1HHGA 1SJEA 2RA1A 4XNUL 2XIBA 3MBEA 3BUDA 1VB9A 3GIZH 4JVUA 3SGDI 2MCPL 4WUUA 4OD2B 2ZKWA 4TSCL 3O2DA 5AYQA 3V79C 3OLEA 2VC2H 3RDTA 5AENA 4WFFD 4NKIL 1KBGH 1RZIB 3MV11 3GMPA 3U6XS 1BWWA 1HAUA 4X2UA 3OB0H 3JWOH 5C0JA 1YMHA 3CXFA 2IAMB 3HZKB 1HKFA 3NA4A 4LO9A 1W80A 1BQKA 2ZNWA 4GG6E 1RERA 2HRHA 4WJ5B 1KF9B 5L9DL 4R2GD 3PWPA 2OMXA 4JM0A 3PL6D 2Z8SA 4HD5A 5DJ6A 3NJVA 4U1LA 1MHEA 2JJWA 5JOFB 2W65B 5FYKL 3KPOB 1NCBH 1TQTA 2BRRH 5E5RB 4ZXBD 2XJKA 5KVDL 3ARDC 3QUYA 3CFCH 4XPHH 4AEEA 2Q1EA 4BRJA 4OJYA 5HGHA 4ORGB 4IW4C 1U8OA 3AU1B 1USZA 2EYRB 1PD6A 4U33A 3I50L 4OLUL 4AH2A 4A2FA 3BPCA 3VDBA 3KG5A 1CF8L 4TSCH 5DUJA 5EBWA 1D7DA 1T7WA 4KY2A 1M42A 1X7TA 5IW6A 2ZSVB 4WJKB 2B3IA 4NKIH 3TYFB 5J1SC 3ABMB 3MV01 1PCSA 4YK4C 5F7HA 1JZ8A 1WFUA 4RQQA 3F6LA 2YIHA 3GXDA 4AOFA 4I5BB 2C26A 4K71C 1OSYA 1HDMA 1UOLA 5I1AB 3WNKA 1U3HC 4MXQD 2DWDB 1WTGT 2E7HA 4F5CA 2OX5A 1BREA 2OSWA 3U36B 2VJ8A 4DW2L 3DI3B 4U1KA 1GYWA 1CDCA 3GUFA 5DWUH 3DX4A 1M6OB 1N5AB 4QRPB 5JYLA 4WU7B 1S7TA 4UV7H 3S35H 4O2EA 1AHKA 3MLRL 1KJ3L 3O4OB 1W8NA 3JT2A 4N20A 3QG6B 4G3YL 3D25B 4N2IA 3I50H 2OV0A 4OLUH 4J3WA 4XWOD 2YO3A 9PCYA 3G5XB 3MRMA 1CO1A 3TO2A 5CD3B 1R3LB 2NXZB 3QRFM 1PKQE 1C1EH 1PZ3A 5CBAB 4G6AC 3SCMB 3KPSB 3W56A 1LK3H 5I0WA 1GW0A 1OWWA 4L29B 2C9VA 1BWMA 1C12B 1GHFH 1SVZA 2GBUA 3MNZA 4E9WA 2FR4A 1WS8A 3FQRA 4R7LA 4P2QB 4R7DA 2JLLA 2M1KA 4WFHE 3EG9A 4KUZH 1MXDA 4UNUA 1UENA 4HPOL 4QRSA 4JDEA 2AHIA 4XAKD 3MLSL 2DM7A 3OKYA 4M6OH 4XC3L 4DW2H 3O6ML 4XT1C 1FZOB 3VXSB 2CRMA 5HHOB 1ZWIA 4YDVB 3GSVA 3RGVD 3K6SB 1VDGA 4WJG3 2R29H 1KLGA 5D7IA 2GTZB 4QD2E 2WZPD 5I76B 1YEEL 3FFDA 4EI5C 1DDTA 3N44B 1BXUA 1TCMA 1AC0A 2PW1B 1ZXKA 5ABAA 3AXLA 3GGWA 5J56B 3DLQR 1FCCA 1QLEH 4YFDB 1F4YL 2J44A 2AJYL 2P49B 1BXVA 3B9DA 1HE8A 4N2EA 5CCKL 4JRYB 3RDJA 3TT3L 3X14B 1HH6B 4JPVL 3TT1L 2QQKH 2HT3C 4PS4H 3RFZB 1QFWL 3K2UL 1RHHB 3KPPB 4HPOH 4LCCB 3UGXA 1EHAA 3GJFA 4XC3H 3WTVA 1B4TA 3T77A 1OWRM 4XGZA 1WBXA 4TULL 4U1NA 1XSJA 3S8GB 1T1ZA 4PJFB 3UTTB 4E9LA 4HZ1A 2ZUQB 2ZKXA 1INDL 4MJIA 4NO0A 1YEEH 4G7SB 3V8CA 5KYXB 3RL1B 1HNGA 1MFEL 3B5TA 3V4UH 1U8PB 1M57B 1YEWA 4YHKH 1USQA 2BLFA 4ELMB 5DHYA 1MWAH 1X5GA 4UTBA 3WFCH 5E6YA 5EPMA 3TEWA 1DJIA 4LMQE 1JTOA 4Y5VB 2F5BL 1DO5A 3TT3H 3WEXB 1I8LA 4L3EE 1U41A 2I5YH 3QRBA 3RGBA 1RJZB 1BM3L 4JFFD 3K2UH 5ERWA 2UY7A 4JPKL 1MH5B 1EZVY 1NGPL 3K74B 2BNRB 4TULH 3E38A 2WB1A 2GFBA 3OKKB 1E6JL 4DZ8B 5A40E 3L9BA 1MFUA 1INDH 1OL0A 1XSIA 4IRZH 5EBGA 4K7PX 1JNHB 1RU9H 2AEQH 1TVBA 3P0GB 4P23B 5AVTB 2ALAA 4DZBB 5JPNB 1FCGA 2JKIS 3DXAE 2IG2L 1KPVB 4M6ML 4OSUL 2FECI 1M3IA 2SEBB 4FFZA 3S3CB 5DD0L 1A21A 2X89D 3HC2A 4JPQA 3ZT7A 4BZ1A 4YDLB 3LSOA 3QIBC 2Y72A 1X5IA 2FSDA 3B2XA 1Y7VA 1N12A 4X7EC 3ZZLA 3OF6D 2FJFA 1XXFC 1ZVYA 4XC1H 5GHWH 4ELKB 5CKAA 5GIRB 5GS2D 1I8KA 3S3JA 1BX2B 1D5XA 3ABGA 4POUB 2H26B 5T5FA 1BM3H 1MNUL 2Z91B 4U4BA 5DRWA 3RX5A 1IGCL 4UTCA 3WKYA 1RPQA 1RZ7L 5GGRA 1AP2B 1F18A 4RAUB 5I6XC 1DDHA 3SZKC 5JW3H 3AADB 5ICYB 1CVSC 4K9EL 1IBHA 1QWNA 3ZK0A 2BNQB 5ESQA 5B7FA 1XGTB 5BS0E 1J0IA 4P4KA 5E8PB 5DJAA 5DJDA 3WIFB 1IFGA 1CXHA 1E9PB 3BIKA 4G6FB 4N28A 2HX8A 3AACA 4Q2ZB 4BKLA 2IG2H 3FFCA 3H9SD 1IUZA 2J8HA 3AITA 3MRPB 2Y5EA 2OMVA 4L1DA 4L1BA 1NWOA 4MFHA 3L08A 1BVKA 3FQWA 3BN9C 4L0ZA 2NYZA 1B2YA 2ENQA 1OY3B 4M8RA 1DSWA 1MIML 4IBQA 4DHLA 2J1WA 2D7OA 2YR3A 2WQXA 5T1JA 4QOKA 2MQCA 5LNDA 3RVVC 1KG0B 1RL1A 1IGCH 3CMGA 2B0SL 1UT9A 3GS4A 5A2KH 3SYAA 2TRHA 3BD3A 4NHUA 5EEUA 4J3SA 1AGCA 4OJEH 4OY9A 4BH8B 1S7RB 3MOBH 4K9EH 4U7SA 4A7GA 2C1PB 3L2NA 4Z7VA 2ZG2A 1SLUA 1UCTA 4NX0A 3L5JA 1YAZA 3L95B 3WE6B 2QQNH 2WO4A 2J5LB 2HTKC 4JQIH 4APXA 2Y1VA 3NFPA 4Y1AA 4LNRA 3QCUL 1CZ8L 1OCRB 5CJBA 3ULUC 1SHSA 4APQD 2P7TA 4OF5A 1IC0A 1JGVH 5IMKB 4PY8I 2A74A 3OAYH 3BPNC 3QIWB 3FCTB 3QS2A 4M93B 4DP0X 2W9DH 3LCYA 5AEAA 5I15H 4LESA 1MIMH 1RLWA 3ARGB 4NLHA 2CR0A 3QQNA 1H5BC 4XR8C 2BHFA 2XBDA 3HNSL 2JIXA 3L3OA 3RTQC 3HG3A 1DCLA 1DN0B 3OMZA 5I74B 3F7YB 3ZE0F 2B0SH 3ZTNL 3UYPB 4PGCA 2XNAA 4RMWA 1FJ1B 1FL5B 4N2LA 1Y6MR 1E7UA 2J8UE 4K23H 4AZ8A 4B9GA 1S7QA 3L48A 3SPVB 3VD7A 2J4WL 3GEWB 4AY0A 3STZA 2UWEB 2WJ7A 4GXVL 2X5PA 2YPLA 3QCUH 1MI5B 2IDUA 2ZUYA 4GAYB 3CSTA 1GS8A 5D1ZD 1CI5A 1SN5A 2FIKA 3EJSA 5CZKA 4L3CA 1XWVA 4KK9D 4CN4A 4G42A 3PDOA 1U8CA 4Z7WF 1U8LA 3BHBA 4MB3A 1YJDC 4X4YB 2CKBL 4F80A 2OZ4L 1UEYA 4HIIA 1LEIB 5C0FA 3QPQC 5FEBA 4QXUL 1YLBB 3AB0B 3X1NA 1G9ML 3DYOA 4BCXA 1IBZA 4M7JL 2PP7A 3MX0B 2ZOLA 2H0FA 3G6AB 3RUGF 4OGXL 1IGIL 3HI5L 2FEJA 5A2AA 5I18L 3SSGA 4ZUVA 2WUCL 1FZMB 4DH2A 5KVGE 1MCNA 4EVNB 1JI1A 1T5WB 4J8QA 2VR8A 1DVFB 2ILLA 2YD8A 4S0SD 3L3DB 3LD8C 1KGUA 1RK1A 2J4WH 2B59B 4HFUL 3V4PL 4RFEB 4GXVH 5CJQL 6FABH 5E0FA 2E9WA 1JDAA 1JZHA 2D9QB 5F9OL 4QTHA 3VXNB 2QT6A 1PAMA 5D1QD 1RZGB 5C3IA 3SJVB 4YDJB 2V2TB 3D87B 3HRZC 4N9GB 1TO4A 1A5FH 2EDJA 2EDEA 3SBWC 3UGEA 5HYJD 4NUGL 3GMLB 2CKBH 1MG3C 1NLDL 2ZUVA 5F1NB 4MLSA 3QUXD 1G9MH 1NCOA 2Z92A 2JKXA 3L4TA 4M7JH 3QDGA 5IVNA 2FYYB 2NDGA 4HKXB 1WFTA 2VLKE 4OIBA 1CLCA 1JMZA 4X98B 2WUCH 1CJYA 4UF7C 3BP7B 3BVUA 3LV3A 1A9BA 1P1VA 3U1QA 3K8MA 4KKBD 2H6PB 3FB6B 4HFUH 1DVSA 1G5GA 5DK2B 2YOCA 2NY2C 1X3DA 1FYTD 1LQSR 3D0AA 1CPUA 5AVUB 3IJYB 2BNUA 5JW5B 1NAMA 3MLYL 1IGFL 4YDNA 3CDZA 4FFWD 1K4DB 3BEWB 2CDEB 3D4ZA 4NUGH 2VKWA 3UAFA 3KE0A 1NLDH 2EIEA 3PP3H 2Y1AA 4DN3L 1HOEA 3G5ZA 5C7ZA 4IMKC 1K2DA 3C5SB 5KUMA 2Q0ZX 3DURB 3G5WA 1DSFH 3IAPA 4S11A 1HHIA 1KYUA 2Y36L 4NGHL 2EDMA 4C4UA 2VLJA 1AO7D 2F8IA 5F6HI 1A14L 5LCVH 5J6GA 4FNPA 4ZO9A 3FQNA 3KPLA 4V1DE 3MFFB 1KB5L 4DK3A 1BOGA 3OV6A 5CSBA 2FE0A 3L7FB 3FT3B 3BGFB 5IB4B 2DQGL 4QF1B 3TWCL 5BQDA 1LO2L 2R0LH 1KGCE 2IAND 1FH5L 4FERA 3RG1C 3B9KC 3ARDD 3UCQA 1LGVA 3REVA 3T1FB 5DZPA 2FJGA 1X5FA 5E8NA 3VMOA 3KH4A 3P3TA 3SPGA 1WAAF 2H45A 3BP5B 1HILA 3GEFA 4ZMYA 4HKBB 3LQZA 2PXYB 3MLWH 4HCRL 4FTVD 5EZOL 2P5PA 1GYVA 3WTWA 2CRIA 3FJTA 1FFPA 1U92A 4X9YA 3SDCA 4PJBF 1FH2A 4XNZB 4GSXA 3VI3B 2WQRA 2NNAA 4ZUSB 2YUXA 3BLPX 3CU7A 2YAOA 4LPUA 5E94B 3QI9B 3M1CA 3TS8A 3BH4A 4AMKH 1U3HD 1QBLL 1Y18A 1FPTL 1YEGH 5B38A 2DQGH 3TWCH 3MLVL 3N43F 2B3RA 2DQIH 1FH5H 1BW8A 1F45A 1MF2H 4XPAH 3IFNH 3C09B 4ABWA 2CD0A 2R0KH 2YFOA 5F3HB 1S4IA 3WN5B 1ERNA 1UFUA 1SMAA 4GO6B 5DHVA 5E2VL 2KBGA 5IHLB 4JM2F 4LPYA 1GGUA 1CICA 1LNUA 5E4EC 5HDBF 3SB3A 4OZFH 5JQIB 3K8KA 2VT0A 2CNZA 2DLEA 3LS5L 5EF0A 3IM1A 5LNEA 4K8RL 1NA8A 2CRYA 1FL3B 2F53A 3QP3A 4QRTA 3VCLB 3BVTA 4MRCA 3BH8B 3VWKD 3F5WA 1J5IA 1H3GA 1QBLH 1HT6A 1ZT7A 4AXWA 2ERJC 4U1JB 4X9IA 4XPBL 3X12A 3NH7H 4XOAA 3RA7H 3MLVH 1MVUB 1CL7I 1SQMA 1SN0A 4ETQB 3QEQD 3CLFL 2W60B 5I6OA 1IQWL 2MNWA 4GAGH 4P3CL 3QORA 1BZ7B 4P2AA 2EYTA 2VLLA 5B39G 4EI5D 1A65A 2JMRA 3D08A 1LK2B 3L4XA 3TZVC 4PJAF 4HUMB 4ZAKC 2JI2A 4ZQKB 3QO1B 3PJLA 3UO1H 2WHVA 1Z5LB 1MCWW 2H9GB 1U93A 1XGPB 4X6BB 4ZPTA 4BSWB 3TBYA 4U6YA 1WBZA 3MRNB 1JK8A 4HIHB 2XX0A 2YHGA 2YK1L 4Y4HD 5F9DC 3ZMEA 5C0IA 5H37H 4EUPH 4FOMA 4XMUA 3RY6C 3L3GA 4TQ8A 4U3SA 1P4BL 2PKDA 4HH8A 1B0RA 5INCA 4XZUB 1YDPB 2ED8A 4IHOB 4XN7A 2NXYC 1G84A 3T04D 1MLBA 4WW1B 2RJMA 3S0PA 4NUJB 1QO3A 3U46A 3PAVA 4X7TA 4LLMB 1L7IH 4Y4FD 3NEXA 3GDCA 4L9LC 3K6IA 4UU9A 2VQ1A 2XQBH 5FW7A 3RWGA 2XFGB 4NFCA 3EZJB 4OIAA 1Q0EA 3VFSB 5BW7A 2NZ1A 4NQXB 1JHLL 4H5SB 2Z8RA 4JMNA 4AEIL 5C9KA 3MLXL 1EHXA 3CVDA 1A7PL 4I18B 4OLWL 1HSBB 3O8XA 5DUMH 2ZX5A 4E68A 3VVVA 4MD0B 3RAJL 2PCFA 4LL4A 4NP4H 3D05A 3BAJA 3FONA 4QRPE 2B16A 2AK4D 2YK1H 4WHYG 5SWZA 4L8DB 5ESAB 2QGDA 5I6MA 3WENA 2I9LB 4PV9A 3MYJA 4OLXL 2DRUA 1VIWA 5F1IB 1WFOA 1MRDL 4MCYB 3PJSA 2DEXX 2XG5B 3TBTB 2GJZB 5B3JE 2ZCZA 5JA8B 4MAZA 5IBTH 3SQBB 3KPSE 3H9HB 3L6FB 3CDGA 3SHSA 2OR8A 3N91A 2E59A 2PF6A 5E1HB 5EEWA 3K6FA 1P5UB 1U8MB 3FQXA 5AVRB 2XN9A 4P2QE 3X13B 1ZVSA 5K59E 2B14A 4KMQA 4LCVA 1NL0H 4AEIH 3P9WB 3D85A 5AVVB 3V0GA 4CMMA 1QR1B 3MJ8A 5JIQA 3QIBD 4OLWH 1HTYA 3T4AB 2VR7A 3PU7A 4K15A 1ODAA 2JCCA 1NCCL 1OGAA 3VXSE 3MROA 2X09A 5HHOE 4DPAX 3HZ3A 4U2ZA 4XCNA 1G9NH 2DBLH 2Q76A 3NACL 5GRWA 5AVSB 3KW7A 5FFLA 3EBHA 4TUJA 1FL6B 4Y8AA 2AZUA 1A1MA 5CWSA 5A7EA 4ZYKA 4ZTOL 5ABDE 4AL8L 2APXA 3MV9B 4M1GL 2VRQA 3QC5X 1ETZA 3D69A 4AYFA 4JNXA 2OXHA 1CYWA 2YSSA 1KCWA 3MODH 1CD1B 2P5WB 2EE3A 2XXGA 2Z7UA 3QDMA 5HD8D 5KSUA 1MCPL 4DFHA 4A68A 6CGTA 3QS3A 3Q05A 3ULSB 5IQMA 1AI1H 4JRYE 1C8PA 2VMDA 1Z7JA 2PO6C 4HWNA 2AXFA 4NWTL 3ZIYA 3FTUA 2Q87A 2J73A 1BLNA 2QGCA 4M8QB 1BYNA 5DJ8B 2WVSA 4PJFE 3UTTE 1UM6H 3Q48A 2GK0A 3I6GA 3ILPA 4H0IA 4Y9BA 2HLAB 4PVNA 3VB8A 1TSHA 4KZEL 4G9FA 3POCA 5D1ZI 4ZTOH 1UM5L 2HPOA 1NGWA 3JWNE 3R4RA 4HUXB 1OCOB 2D73A 5LN4A 1WWBX 2JK5A 3CZGA 4WCYL 3WSQL 4Z7WB 1MDAA 1ZPUA 3MRBB 5D7LB 4ELME 5T1KD 4EKJA 5AVWB 1ULVA 1KJ2L 1I1AC 2B77A 4FAAB 4WEUD 1OM9A 4NWTH 3P77B 1FNAA 3RUGB 1Y6KR 1IAIH 1IC7H 5HGBA 4K3JL 2J88H 1E9QB 3KM2A 3VSTA 2G2NA 4Z0BH 2BNRE 3VGHA 4P3DA 5EBMB 2X87A 1F56A 3GI9H 3W5NA 3HFFA 3TURA 2MHAA 2VDMB 4FQXA 4KZEH 2CLRA 3VU2A 4LSSL 3NCXA 3BEVB 3HVDA 4XRCB 3EJTA 1ZY9A 3RIAK 1CXEA 5B39A 3TYGH 3E6HA 3U7YH 4B9JA 5C2UB 4RGMB 3N1FC 4QHKI 4E0RA 4BK5C 3VWJD 1D6VH 4XNXL 4WCYH 4M61A 1URIA 3T4YA 1ZK9A 4RDBA 4RZCA 3T5WA 5EUKA 3WUWB 3RWEB 3EF4A 1KJ2H 4NKDA 1KZYA 1NFIB 4LQFL 4UQDA 3IJSA 4Y4KA 4YHPA 3SD2A 4JHAL 1UWEL 5IUCA 3LNHA 1EJ6A 2WZAA 4KRLB 4I8DA 3ASNB 5FAAA 1S7WB 1R33A 1G7QB 5IB3B 1J9QA 4PJHF 1OPOA 1F11A 3MMEB 4K3JH 2V0AA 4XVOA 2XA3A 2XVGA 4DUVA 4JQVA 1AR1B 1CGWA 3TASA 2BNQE 2VJXA 3O41B 3UGUA 2WQ8A 3QPQD 1ROWA 5FYJL 4IIQC 4ZO6A 1BQHG 1P7HL 1TZOA 3LHPH 4S1RL 5TGBB 2FX7L 1RXLA 4PRNB 2YRLA 3CK0L 4XNYL 2HSIA 2EDOA 4XNXH 1U8HB 2LVEA 4JRXB 5LBSA 4NQCA 1FO0L 1G4RA 3I75B 3FU8A 4LQFH 4Z7UF 3CH1A 3HLAA 3RY5A 5EBLB 5GGUB 1UWEH 4F8LA 3JZYA 4LHUB 2R29A 4Y2LA 1OAUL 1AG6A 4I85A 1NC2B 5IMLB 5F7DB 1S78C 3WTTA 2A6IA 2H41A 4Y1TA 3MLTA 4P5MA 5GZOC 1KCLA 3WNJA 4N2FA 3LZLA 3EYQD 2CNYA 3TV3L 5K9KA 3C2AL 3L17A 4LDLB 4UT6L 3BXNA 2NY4C 2IDTA 3CCHA 2OZNA 5FYJH 2B4CC 3C5ZB 5DFAA 1NDTA 4YAQB 4AUJA 5IB2A 4P5KA 1Z9LA 1ZA6B 4S1RH 3WGUB 1OW0C 5E2TL 1OT1A 3CK0H 4OZIA 5C0BB 3Q5YA 4BFGA 5L2KA 4YSPA 5FUOL 1OB1A 4W6WB 3MJ7A 1IBBA 4R4FH 4M8VA 4AJ0A 3B2MA 5I9QB 3WXWH 2P45B 1R19A 1OAUH 2B9BA 1QLFA 4OCYH 4JZOB 4GSRA 3ARFD 4ABUA 1P4LA 4LCWA 1RZKL 3L13A 3IU3A 4PJBB 3TV3H 3VJ6B 3HA0A 2OCFD 4BBWA 2NLJA 4MJ4A 5E5MB 2X1OA 4XNQA 3LNEA 1E4XL 4WI0B 2VXTL 1MWAA 4UYQA 2UWEE 3TH3T 5KSBF 2BVOB 2DQFA 4IBYA 1MI5E 4QDGA 1KV3A 2F5AL 5EWIH 2C3XA 4U7KA 2V5YA 5GS1C 5E6IB 5E2TH 1X4YA 4XNBA 4CKQA 3N43B 4QTIH 1I8MB 1A64A 3T65A 2HRGA 4W6XB 1G1OA 3H3BC 1L9NA 2CUHA 2EZ0D 5FUOH 4DGVH 3BRDA 1DQQB 4EI6A 5BRZB 2XZZA 4JGNA 3Q3GB 3QWRD 3QCVH 5FKPA 1JPFA 1DBML 1PPIA 2EDKA 2XQ0A 4OGAC 3SKNA 4LRIA 4IRZA 3APFA 4HKJB 2HVBA 3IGKA 3C6LB 4N87A 5AVXB 3DTXB 3GS7A 3ULAB 4L4VB 3PQYB 1RZKH 1L6XA 4ODSL 5AW9B 1HHGB 3GLAA 1E42A 1SJEB 1L9OA 4CJ0A 3MBEB 1UD6A 4WUUB 2J1KA 1E4XH 1N4XH 2VXTH 2W1NA 4WGVB 3HZYA 4CU8A 3RDTB 4WFGD 1UKSA 3UJTH 1HZHL 1MFCL 1YEJH 2F5AH 4G6MH 2X9XA 3GMPB 4I4WA 5B1KA 3QUMH 4OJFL 2F8VA 4FNQA 5HY9A 4QHPA 5MP6H 5JR1L 2VRKA 3SJVE 1YMHB 1GAFL 4FQLH 1YEHL 3BFWA 2C9AA 4M03A 4NRXA 4LLDA 2VDKB 3FSVA 1ES0B 2IH3B 1JWSB 3IVKB 3PWPB 2OMXB 1URZA 3GK8L 3D07A 1CMOA 1EX0A 5DJ6B 1SMOA 5C08B 3WMQA 4U1LB 1UCBH 2VW7A 1WC7A 2YJQA 3GB7A 4N8CL 5D7SL 2IAMC 4UM9D 3TBWA 4EZMA 1UB6A 3QUYB 2E27L 5E6ZA 2BXZA 4QY8A 4DTGL 5EU5B 2V2WA 5DUBB 3HJEA 1U8OB 3H7LA 1YO4A 3IN0A 4PYHA 5AAWA 1ZEAL 5EIQA 1AGDA 4NN6C 2F68X 3BPCB 1NCGA 2ADIB 5DF0A 1SN2A 5EBWB 3WY3A 2DMBA 2EDBA 3B7TA 4QHMA 1HZHH 1MFCH 3NN8A 1ZK5A 1WAPA 2IPKA 2WXQA 3GMMA 4RQQB 3HEIB 4TNVK 3HBGA 1PF3A 1GAFH 1T21A 2MJWA 4NM8H 3CFQA 3VGAC 2ZUWA 3CBRA 4YO0A 4GQPH 4H20H 4OJCA 1CF1A 2OX5B 2YD2A 5IT2L 2JJSC 2N7BA 3ZOAA 3GK8H 3O0RL 2N1TE 4F8PA 4PMFA 1BQHA 2QSTA 2YQGA 4RX4A 1NJ9A 4JQIA 1WLHA 4B95C 2VDPB 2E27H 1EAOA 4DTGH 1QHOA 4O2EB 5C0AD 1TEGA 3BVXA 3KXFA 2MNUA 1GTFA 3R8BB 4HJ1A 5DVPA 4N8PA 3MRMB 3TO2B 2WUBH 2JSFA 5LJYH 2X88A 3FBKA 3TZVD 3WY4A 2A83A 2NNRA 1CD8A 3AU0A 3O6FA 3P30H 1DJHA 3VSUA 1KDJA 4YSUA 2IPTL 1ZLDA 4N3TA 4CBZA 4N25A 4R7DB 4CGTA 1CQYA 3EG9B 2NXZC 2RH0A 4QRSB 3KCPA 4BFKA 1UWXH 1P2CA 4LOEA 4ONFL 1JZFA 5F9JA 1GH7A 3L81A 3QJFA 5HXMA 4JREB 2JJTC 1LMKA 2VO8A 3GSVB 3QUHA 3IETA 1KLGB 5EZIH 1JZGA 5D7IB 4XB8A 1HXMA 4OFDA 3FFDB 2ZCLH 5F70A 5BZZA 2APVA 4HMCA 2HA1A 4OZFG 4BA0A 3PP4L 3VI3E 3LVTA 5IOPB 3E8VA 2ZXAA 1T0MA 1IE5A 3AXLB 3POHA 4OTXH 4U31A 4DKAA 3SDXE 3WELA 5E4OA 2CALA 4AIZB 1VRSA 4ANVA 4HBCL 5FGCB 1BDYA 2V7HA 1HU8A 2DQUL 4F20A 3WO4C 2EADA 4DJMA 3HNVL 3NGBB 5F72S 4YL9A 2LGNA 2WQAA 4HF5L 2EILB 5D9SA 1Z3RA 4ONFH 1AZNA 3GJFB 3D33A 3T77B 3CX5J 3K5RA 2WBJA 4U1NB 4KTGA 3MAWA 1T1ZB 1H3VA 1NKRA 3CZUB 3L16A 3QNXA 3RIFF 4N2MA 2ZTBA 3S8FB 5EC2A 3GHEL 4MJIB 4UT7L 4AM0Q 4CDHA 4NO0B 4LCCC 1GRWA 5DYOA 1J0JA 3H0TA 5CZXC 1D6EA 3PP4H 1TQBB 4K0OA 4N5ED 4ZMNA 1FFOA 4Q0XH 1C5BH 4FMFA 4MCNA 2CKBA 1KGXA 2WP3O 4HBCH 5H37G 2C4FU 5DHYB 5CCHE 4BWWA 4EUPG 3K3QA 2HUHA 4D3CH 2G3ZA 3QWOA 2DQUH 3AT0A 1QACA 1BLIA 3EIFA 2WTPA 4M7LT 3HNVH 3JWNC 4XN5A 1ZHLA 5EH1A 1N70A 3EDKA 3OZKA 1AD9A 3CFJA 3Q9PA 5ERWB 5EIIA 5JW4R 2DWSA 4XO9A 2AV7A 3IMWA 1P5VA 3FN3A 5LG6A 1ZA3A 3F83A 1AY1H 2TAAA 3FOMA 4M02A 2GFBB 2Q7YB 4ISVB 2GY7B 3CG8A 4UAOC 3GHEH 4B9IA 1TVBB 3RPIA 1HINH 4P06A 2YKLL 2GJ6A 1EPFA 5IVXF 1G6RB 2VLRA 3ZUCA 2X4SB 4KTEH 1JYNA 2WD0A 3LSOB 3PS6A 4PJ7F 4NUPA 1KTDA 4Y89A 1NGQH 1JZJA 4P23C 5JPNC 2EVJA 4IRSA 4NJAH 1BPLB 2FJFB 3C60A 5JXAH 4RA3A 5IW1A 1I8KB 2VDRB 4YDLC 3ALPA 4HUVA 1E8YA 1D5XB 2LLLA 1D9KC 1L6ZA 3HE7B 3QZWB 2ADFH 4EEEA 5GGRB 4NSKA 1LVEA 4Z76A 1DDHB 3GSNB 5LCVA 3SY0B 5CN3A 1BVNP 5J9PA 3BWUF 5I71B 4P5SA 5DU7A 1RK0A 4UIKL 5DJDB 3IEAA 3BIKB 1K85A 2YKLH 4BKLB 35C8L 4YSCA 4AW4A 5E03A 1XL6A 1I1AD 1LILA 2AJUH 2OMVB 2DMKA 2WNWA 5I0YA 2D2CC 4Y1SA 2DJSA 1BVKB 3H6AA 3FQWB 3S96A 2VDNL 1XAUA 4DP8X 3PWUA 3S9DB 2QKIB 2LFEA 1QTSA 5LGHL 3U9UA 3HRPA 2W38A 3ZRSA 4POZC 4ZK8A 2N1KA 5JXEA 4QOKB 5HJBA 1UWGH 1X5JA 3FUDA 3CAFA 3ZSSA 3ZL4H 4LVEA 5CJ8A 5DTFB 2C9QA 3FSWA 3A6CL 1OPGH 3JTTA 4ZOEA 1I3RA 4NHUB 3SPHA 1CG9A 2ARJA 4I0PA 5LBGA 4GAAA 2P3YA 3RVWC 2DKMA 1KSRA 4EXKA 2QZQA 4Y9GA 3S97C 3SPJA 4LVHB 3NCMA 3PV6A 4X4MA 1R3JB 2QDVA 4LHQB 4XO5A 3NFPB 1JD7A 4Y1AB 1ZDSA 1N5YL 35C8H 4TLUA 4S2SA 3P54A 4U05A 3EYVA 2P7TB 2AXGA 2WXLA 1K72A 2BVQA 3IMRA 5HBBA 2A74B 2BCMA 1AC6A 3DMMC 1IKFL 2J5LC 3WTUA 4PV8A 1T83A 1E9OA 3OM3B 3MV9E 3BD4A 1AXIB 1QSED 2ZP9A 3QE5A 4PTUA 5CSZA 3TA3C 4HJTA 1XX9C 2JIXB 2Z7YA 3L3OB 2P5WE 3AS0A 3CSFA 1JPSL 3QIWC 3OTTA 4OZFA 5CEXA 1YQVL 3HPLA 4LLWA 4HGWA 3QUZD 1LEKB 4PGCB 1EAQA 3U83A 1E7VA 5TTRA 3ARGC 4DVRL 3OPZL 1JWUA 2PWGA 5F0MB 3VB9A 1JHKL 4AZ8B 3A22A 1IAIM 4N6QA 5AYUL 7FABH 1RY7B 1S7QB 4FKEA 1JGDA 5I74C 3WDHA 1HEHC 2J20A 3STZB 1L6PA 2EKSA 2YPLB 1N0LA 1RHFA 2FEDC 1BEXA 3FMGL 2XTJB 3HNTH 5E9DA 3SYPA 8CGTA 1DVUA 4K2UL 2XXMB 4XXWC 1RKRA 2WWNA 2BVYA 1IKFH 3PDOB 4G42B 1U42A 3FTZA 3OZ9L 1P9MA 2BY2A 1FN4A 3BHBB 5DRZA 4FABH 5I16A 1DVTA 3D9AH 3BLKA 3UAEA 1U6AL 5ITFB 4HIIB 4A1RA 5C0FB 4L2YA 3LRSA 4Z5RA 4J3XA 4Z7WE 3WGVB 3PFQA 5D7LE 1JPSH 3O3BA 2ZOLB 2WXNA 4P59L 2NY4D 5K9JH 4KXZI 3UTSD 4KY1L 3N0AA 4X6CA 4F91B 2R1WB 2TSBA 5H37A 3AB0C 4EUPA 5AYUH 3GXNA 1WT5A 4WSJA 1EJFA 1WAEA 2XRAH 3OQ3B 4KDTA 4R90L 4FA6A 5A6MA 1RK1B 2LR4A 3RRQA 5C8JA 4FTDA 1V54B 3Q8AA 3RHWF 5CLZA 4L1TA 4DIXA 3SE3C 1FVEA 3CBJB 3FMGH 3PDDA 1FAIL 2QPUA 3Q2NA 4QTHB 5B22A 4K2UH 4GFTB 4TRPL 3DGCR 2D7TL 3W1ZA 4WK0B 2OYPA 1DVFC 2FTAA 4KVNH 5FOJA 1S2EA 4FQHB 1MW1A 5I0DA 2BIPA 4HFWA 4KQ4H 4YHZH 1I8UA 1U6AH 4XODA 2VERN 1UXSA 1U8NA 2Z92B 4AGMA 5F6HJ 1AMYA 4Z8FL 3DIDA 4P59H 1QW9A 1J87A 2VN6A 3C5JA 2VR9A 3T2NL 3RWCB 4G83A 1QWHA 3RPBA 2CO3A 4NCC2 4Q6IA 3L5WB 3TXAA 1KPRA 2Y2TA 3VE0A 1A9BB 4HU2A 4JW3A 4UQBA 2P46B 3VFVA 3TIDA 1O7DE 4RA0C 4H25A 4JO3L 4JO1L 4IMLA 2R0WL 4O9HH 3TJHD 2NW2A 3H8NA 3WFBH 3RL2A 3BPOC 3QEUA 2K6YA 1E5AA 2L7QA 4OGAD 1FAIH 2BNUB 3F05A 2ZWYA 1NAMB 4HUNB 3W81A 4XO3A 3IJHA 4XH2A 5GRXG 4KMLB 2H8PA 4HU8A 4NNYA 3VH8G 2BMKA 4DP6X 3I6LD 1TR7A 2QGEA 1PZCA 1UA6L 4U3HA 4JRXE 2WC7A 4UZUA 2NY0B 3LAFA 3DJZA 4YHNA 3G5ZB 4Z8FH 1K2DB 1KJMA 2ZD0A 3KYNA 3Q9QA 1HHIB 2PPDA 2VZ1A 1PZDA 3T2NH 4LLQA 4DCQA 2VLJB 1XGQA 2UXGA 1VFAA 4WI2A 2BFGA 1ILSA 1BBDL 3CDFA 3AY4C 3FQNB 3OKEA 1E28B 2F74B 3U48A 1GSKA 1J1XL 1B4LA 2NY5L 2X6MA 1EAJA 2R51A 3APDA 5AWNL 1BOGB 3V0VA 3EGSB 1MW3A 5F9AC 5HYQA 3X1GA 4ALAH 5LGKA 1IC5L 2HH0L 2K4AA 2GSIA 2VXQH 2NYYD 4GT7A 4NQVA 5FYLD 5IJBC 1SDDA 1JV2A 3US9A 3K46A 3BSZH 4QIRA 3REVB 1DBKH 2Y7MA 3V6BR 2FJGB 4FD0A 2XICA 5E8NB 1B2WH 3ZYIA 5C0BE 5JHDD 1HILB 1QBML 5AW4B 4EIGB 3S4SG 3LQZB 1FHGA 3GHPA 2KH2B 1D5IH 2W81C 1SFHA 4ETYA 4WI5A 4RWYL 1WD9A 1FFPB 2XBZA 2XI9A 5I75B 1P69B 1U92B 3SDCB 1WAAE 5C0RL 2QQLL 4ONHA 2NNAB 3BWAA 3IAGC 2NY5H 2O5XH 2XETA 3MJWA 2NSXA 4PJBE 5AWNH 3MRDB 4KTDL 4MXWL 1N26A 2CDGA 1SLWA 2IWEA 4MNHA 1Y18B 1OANA 1ZTMA 4XNZC 4JM4L 4DGYH 2RACA 1R5IA 1ZHKA 1FBIL 3QG7H 4GAJH 1M05B 4GO9A 4MD5B 5GZNC 1G7IA 3ZDXF 3V7AE 4S0HA 4J3OF 1DP0A 3QXVA 1YCSA 3AREA 4C4KT 4IHBA 1QBMH 3UP1A 4KNSA 5BRZE 3WHE1 3NEOA 4FYTA 1ZGLM 5E24E 1CICB 1LNUB 4RWYH 4KOCA 4BZ2H 4NKMA 5T3XL 3PFUA 5FGBA 3C09C 3HN3A 4R97C 3PWVA 2Q6WA 2QKSA 4L4VE 1MHPL 2BIOA 3PQYE 4P2OA 1EO8L 4QRTB 4J2XA 3WS6C 1WUZA 2E3VA 3F58H 3SDAA 4E2OA 1VZGA 1RP9A 3F5WB 1CLZH 3NZUA 5I30L 4MXWH 1NOLA 1ZT7B 3EHBB 5DLMH 3PXJA 3S5ZA 4WUUE 1C5DA 3X12B 4AXWB 2ATAA 1H6UA 4YSTA 4MJ5A 1QKZL 3US1A 4NENA 1M1XA 1FBIH 2CA3A 2Y0SA 1HQ4A 2E46A 2H1PH 4XNMA 5I19H 2HT4D 3QORB 3WV0A 2EYTB 2VLLB 3D0VB 2ADYA 4H4NA 1D2PA 1KACB 2AXWA 3CQFA 5F7UA 2ZYRA 5HHXL 5JHAA 4UMSA 4F57L 3PWPE 1L9TA 1UB5B 4LOUC 3LIUA 1G7LA 1R3KB 3MNWB 5C08E 1U93B 4ZPTB 4EBQH 4FI6A 1TLKA 3TBYB 2GVYA 3DVFA 1A1NA 1WBZB 3OHXA 1JK8B 3TF4A 2B5IC 2IOIA 5DURB 1CK0H 1XIWA 2LTQC 2VN4A 1A7OL 1T22A 3L3GB 4GKNA 4U3SB 5HI4C 1B0RB 2G2RA 2O72A 1NBCA 3QGVA 4HQQL 5INCB 1BV8A 3SGJC 4Y19D 4GRWF 4MDIA 3WXVH 1MLBB 3TO4C 4GB9A 1EQWA 3S37L 2DQTL 1UGKA 4PJ7B 3U46B 2ESVD 4RWHA 4X7TB 4NQDD 3STBA 3LH9A 4ZW5A 3LKSA 4NRZB 4X7SH 2BWIA 1OGPA 3ELAT 2VQ1B 3GBNL 4UU9B 2WQUA 3R4DA 2XWTA 3RWGB 4U0QB 3EO0A 2J72A 4M5YH 5D7KD 1HZKA 4UM8A 2E6JA 4XMLL 3GUTA 1BPVA 1AOHA 1FHNA 1T2XA 1V7ML 4OCMC 4DKEL 1J12A 5GPRA 3CD4A 1TCRA 4HAKA 2PCFB 3FU7A 5CP3H 3FONB 2Z9TA 1KTLA 3VH8A 4ZMAT 2BINA 4DGWC 2DYSB 5SWZB 2QSCL 4KAQL 4DGUA 4ZNEA 1QUPA 4I18C 1AD0A 1OTUC 2F1BA 1KEGH 4F9LA 4HQQH 1W72H 2NQ3A 4H13C 2F53D 3HE6A 3PJSB 2GITA 4PGDA 4Z3IA 2R1XA 4HEMA 2OP4L 4RETB 3S37H 4CVWA 2DQTH 4CC0A 3LXBA 3NFNA 3ECQA 3SGKA 1SOSA 4YS4A 2BX5A 3UZVA 2GJJA 3LDBB 5HHMD 3GBNH 1TITA 1RMFL 2BP3A 5E23A 3UBXG 4HOMA 3FQXB 1OVZA 4NRYA 4NWUL 4JY4B 4M5ZH 1WFNA 3K0WA 5EO1B 1FORH 3B43A 1QVOA 3D85B 3LXAA 3MJ8B 1IGJA 4L5FE 1QG3A 1V7MH 3DO4A 3SBRA 4K5LA 1FFRA 4TSBH 3HS9A 4MWFA 4WQOA 1BFTA 3NJFA 1EXGA 4L1LA 4ZW8A 4XCNB 2Q76B 5C2BL 5D7IE 5GISH 2FGWL 2QSCH 3G7TA 1BF5A 5HDQH 4W9EC 4BE5A 3N42B 1A1MB 1MXGA 5CWSB 4ZYKB 1D9KD 3VXMA 1NZRA 5T3ZD 3RI5K 3S4SA 3MTRA 1ETZB 3D69B 5B4MD 4AYFB 3IXAA 4ZJ9A 2OXHB 3DOIA 2OP4H 2YSSB 3FT4B 1GCFA 5I1KL 1GOFA 3OX8A 1BEYL 3QDMB 5H8DA 5A2BA 4IOFC 4EMZA 4BGDA 4WSGA 1RMFH 1BXXA 1FE8H 1UUNA 2G30A 3HUJF 4MAYB 3T0VA 1N67A 2K6ZA 5CEZD 3HFMH 5F44A 4PG2A 1BLNB 4XVSL 1TJHH 2VDLL 1RIHL 4OCNC 4Y7OC 4OZGF 2FVNA 1RVFL 4W9CC 5DRXA 5DS8A 2L7EA 3W39B 2YA1A 2G4EA 1I1CA 2VC2B 2GK0B 3I6GB 3ILPB 4QHKJ 1GZHC 4X5WB 3C6EA 3NSYA 5C2BH 4MJIE 2FGWH 2XV6B 4NZJA 1EO5A 1AQDA 3WG7B 4NXSA 3U0WH 3QUMA 1ODUA 4G9FB 4P57A 2IOMA 3P3SA 4UUJA 1J5OH 1NGWB 3ZMRA 1EGJH 4GOSA 3RVWD 2JK5B 5GQBA 3RJDA 1E30A 1JTTA 4FP8L 3UFIA 3MUUA 1P7KA 1ZGLA 4B7IA 5MI0B 4DQAA 4QHNA 2EE6A 2FBOJ 4WWID 4NCC1 4IKIA 4S10A 2KDGA 3Q0HA 3GSWA 2J56A 4NAMA 3QXAA 4J4PD 3DMMD 2ZX6A 5HGBB 2ZT9C 1RIHH 3DX6B 2XN9D 2XT1B 4M7LL 2X10A 1KCBA 1TEYA 1RVFH 2YAQA 4OIFA 3TA3D 4P3DB 3RX7A 2EDHA 4QXGL 1SBSH 2MHAB 4FQXB 5G55A 2CLRB 2YEQA 1OGAD 2O5YL 2BZCA 4RMBA 4Z0XA 1G0YR 3QIWD 1MJ8L 5B39B 2WTRA 3VD0A 1MVFA 3E6HB 3GD1C 2VLMD 1VF5C 3VD5A 4AV4A 4Q9QL 3SKOB 4XP6H 1R75A 3F7KA 4ZDHA 1NBYA 5IESL 3FHQA 4M61B 2ZG1A 3T4YB 5B8CB 4FP8H 2Q10A 4RZCB 4P5TA 5HHVL 3B7YA 5EUKB 2RR3A 4YHPB 4NKDB 4Y4KB 1NTDA 1NKOA 3IJSB 4XE5B 3WYRA 4AJWA 1NMAL 2YGNA 4DETA 1BYOA 2Y5TB 5BUAA 2WYTA 1TJIL 5T1LD 4KRPD 1F6AA 1F11B 5A16A 1ZVNA 3K1KC 3AM8A 4M56A 4AMWA 5J7CC 3U4EA 1PYWB 2D3NA 4OT1L 4HOWA 1MCHA 2DQHL 4GI6A 4HEPG 2D7PA 3RKDD 2IPUK 4JL2A 4KUCF 3PGDA 1KIPA 2P43B 3EXJA 3UTPD 3FFCE 1O7DC 1PZ5A 2DTML 3ULVL 2JWYA 2D0HA 5DMKA 4YWGL 2OL3H 3ULVF 4MD4A 2VIRB 4JFQA 3WJJA 4ODVL 2DDQH 1MIEL 4IOSA 4X50A 1PZUB 1H8NA 4NQCB 1WRFA 3IJEA 4X4XA 3HLAB 1NMAH 2V17L 1ZKAA 4JG5A 4QOKE 5G5DA 3TM6A 2G9KA 5GGTH 1NMBL 5GS0C 5I6NA 5JO5A 1TJIH 4LP5A 4XP5L 2WXOA 3BKYL 2A6IB 2VUYA 3C08H 3VRLF 5DS2A 2X9ZA 3MLTB 1DVFD 4JFDD 4P5MB 3NP3A 4XCCH 3R7QA 3RX9A 2GBVA 4OT1H 1UT2A 5FDYA 1OGSA 3UZEC 5K9KB 4HETA 3BXNB 1QLEB 4F24A 5TF1L 3CCHB 4P9ML 4X0KA 4BINA 4QKTA 3UBXA 3C8HA 4Y1AE 5DZAA 4OLVL 4R0LB 3NTCH 5IB2B 5F89A 4HJ0C 3SKJL 2G75A 1R6VA 1OTTC 2PCXA 3MGAA 4K73A 4EAEA 5GS2H 1A66A 1J11A 2Z4QA 3WKNA 1L9SA 5J4MA 4OZIB 4AV0A 8FABA 1OAKL 2A0LC 4K7PL 2PYED 3C5ZC 4G72B 4XBGB 1DCEA 2AEPH 1AXTL 1VLXA 2MKWA 2NSQA 3KL0A 2OMBA 1YRKA 4PJCA 3ZYJA 1QLFB 2CXKA 1FNSL 1UYWL 3BKYH 4H0LC 3DX3A 1P4LB 3QQ9C 5FYKD 5IKCA 2KLSA 4PJEF 4PIRF 4PJGF 3IU3B 5K1NA 1DANU 2W59A 2NLJB 1ID2A 5I1EL 1WJ3A 4XNQB 1NPNA 2Y69B 3O81A 4LSRL 3BAXA 1AHWA 4P9MH 1MWAB 3JYCA 2VR6A 1H8SA 2Q86A 2YPLE 1YN6A 4F2MA 1WFIA 4RSYA 3SKJH 5JPMC 3KJ6L 2XTJE 3GF8A 3LIZL 5E6SB 3PHAA 1SVCP 1OD9A 4DQOL 1IM3B 1IEBB 3T65B 4Y7MA 4QI3A 4TVPE 5DVKA 1OAKH 2F1AA 4HISA 4WW2F 2IBZX 5FKPB 5EU7E 1JPFB 5C0ND 3ZDXB 2NZ9C 2DN7A 4PVLA 2LAGB 5E6IC 1HZLA 3GMOA 2EQDA 3JBG7 3F7VA 4JHWL 3I84A 4OM1L 4JK0D 1FNSH 2EDDA 2ORBL 1WFMA 1FGNL 4M6NL 5I1EH 1AJ7L 3LY6A 5DD1H 4LLYB 4LSRH 3IFLL 3C6LC 4JM2C 3KD4A 4F1SA 3I9PA 4I4WB 4OZHF 3T09A 4PJ6A 3W0WA 1AZVA 5ECJE 1YEFH 3FXIC 5I5JA 3MBEC 3T0WA 4ZS7L 4DQOH 4XXDB 3GBEA 5CINH 4K8RC 2AVGA 5C0GA 4E41B 3E8UL 4LLDB 1J9CT 3VXQA 3QHZL 2VISA 3MUJA 4B9CA 3HB3B 2CO4A 1I1RA 3IGAA 4Q8BA 5L2KD 3GB7B 1INEL 1WC7B 2CK0H 2W9EL 2HVJA 3QDGE 3RE0A 3V8OA 1UWFA 1UB6B 1MAML 2VZVA 5K1JA 2ORBH 3S7GA 1GGBL 4LVOC 4QY8B 3F01A 2HJLA 3QUGA 3ZHLA 2V2WB 3VGBA 1FGNH 2BHUA 3RZCA 1G0XA 1EFXD 1E2WA 5GZND 1RIVL 2C1OB 3K1DA 4LCWD 1SHXA 2VDQL 4HIPA 4XP1H 3KS0J 3QUYC 5JOPE 2A9NL 4DEWA 5FO7A 4I48B 4QHMB 3NN8B 4AG4L 1KN2L 4Y2DA 2IPKB 3P3RA 1JVLA 3GMMB 1N2RA 1B3JA 2VDOL 4L4TD 5D1XC 3FH5A 4N8VG 4O5LH 1J1PH 4YO0B 3WAKA 4O00A 5FWQA 4HEPA 3KLQA 4XVTL 3QHZH 1DFBH 2IBBA 3DJTA 2PTUA 4MX7A 3SDDB 3U25A 4JFVA 1MY5A 4FQ2H 1BQHB 1C08A 1RSFA 1KB9K 1INEH 3K2IA 5DD6A 1B6DA 1MAMH 4GXFA 3P4LA 1UZ6F 1GGBH 3FT0A 3JV6A 2VLJE 3DECA 4LK4A 3KXFB 3P69A 4M4PA 1T0NA 3VXRD 4JGMA 5K93A 3ILDA 2YD5A 4KI5D 4I9WD 1PDKA 1RIVH 3UZQB 5KW9L 4LCUA 1O9ZA 2VDQH 2V5MA 3MNDA 1OARL 1U3ZA 2A9NH 4NCDA 2A83B 3O6FB 5CIPH 1P7QA 1F3JA 2VRAA 3GC3A 2H2PC 4HIXL 4LOUD 4LNVA 2X40A 4KK5D 1QTPA 3B56A 3ZY7A 1FF5A 3R06A 3KCPB 2WSKA 4N3UA 1U36A 1P2CB 3ZT5A 5KG9A 5EEXA 4A2GA 4R9HA 1AXSA 5F9JB 3GRBA 5L4JA 2Y7OA 4JFOB 3QJFB 3QQDA 3TO4D 2NY7H 4XI5C 4L8SC 3VFUA 4IGBB 3R0MA 2Y1ZA 4FI7A 2JVUA 4LASH 5LWYL 1T0MB 2CDFA 4JREC 5FR3A 1OARH 4TLSA 3L7EB 5GRVL 3BUYA 1N8ZA 3HTLX 5DCCA 5BMFL 4PRPD 4EDWL 3CVCA 3P2TA 4FHBD 3MACL 3K2MC 4DWHA 3CFDA 3X11B 4AT6A 2J5WA 1R9FA 3GDBA 5C0CA 2DWEA 4GLRH 4XPTH 3HUJB 4O4YL 1U3JA 3OAYK 4ZFFA 2QR0B 5FHBL 4AL8C 2WBJB 5KVFE 1A6WH 1NCUA 1OSZA 3NGBC 4AIEA 3NCYS 3QNXB 4NN5B 2WWKO 3ISWA 4I1RA 3MYZA 2E6PA 3RVTC 1QNZL 5MENA 1M7UA 4WHTA 3AWEA 3OMNB 4NO3B 4Z3TA 2X41A 1UD8A 5DYOB 5DVLA 3L1OL 1SJHB 1D6EB 4KKAD 3CDCA 1XD0A 2HFGL 3DROA 3DGGA 3FCBA 5LWYH 5HHQA 1BG9A 2F2HA 5I1LA 4WGKA 4MQTB 1CT8B 2M83A 1BVOA 3QVAA 4IS6B 3AT8A 1A02N 1RUML 2V8MA 1HH9B 2UXFA 3H3PH 4EN3A 1TJGL 1MW0A 1TQBC 1HQRB 4YEFA 3GMQA 1ZHLB 1OGTA 3I6KA 2P80A 4XE0A 2X9WA 1AE6L 1AD9B 3CFJB 4CSTA 1Z9OA 3MCYA 4TLKA 4PGEA 5ID1B 1ZA3B 4DVBA 3BKCH 2YD4A 2F7QA 2DAVA 1CWVA 3MV7A 4WO4A 2X6BA 3KGUA 2IF7A 1XF3A 3OWEA 3RPIB 4AJYV 4U6VL 4EF3A 4GW5A 4LIQE 3F3HA 4IU2A 2GJ6B 4UOJA 2VLRB 2Q5BA 3FH7A 4ZFOL 1ZCRA 2HFGH 4ABVA 4F2EA 3EJYC 5GJSH 4AQEA 1E3ZA 1KTDB 2WW8A 5I1CL 4IRSB 3QFDA 2G3NA 3P4NB 5JW4Q 3C60B 5KVEL 1L0PA 1O6TA 3LZRA 4Z3GA 5IW1B 4RIRA 4PJ7E 2VXSH 3GMRB 2XWCA 1FC1A 1YNTA 5KAQG 1AE6H 1CYGA 2X70B 2FBRA 3D39B 4NSKB 4PRIB 5BCAA 4Z76B 5KBDA 5C07B 1F4XH 2YQ2A 4M5TA 3UEQA 5J9PB 2WNXA 2D7QA 5CKGA 2QBWA 1CTMA 1RK0B 1ZTXL 2WIMA 3AGVA 3B3IA 3HE7C 4U6VH 4XPFH 3TLRA 2WY3B 2VXQA 3MI6A 4HUWB 4XX5A 3LMJH 2F58L 5SWZE 3BSZA 3N5AA 3S96B 5I71C 3LRLA 3PWUB 4N0UA 1ZSDA 3FTYA 2YUZA 4Y88A 1DUZB 2GIXA 3CZFA 3VGDA 4YMPA 1MFAH 5KVEH 3PABA 4OFYA 4L8CA 1NFDF 1XF4B 3TPUA 4AE1A 4W9HC 3CHPA 3O4LA 2QKIC 5D4HA 5ACLA 3JTTB 1RSYA 1I3RB 3ZYOA 1CG9B 1E4WH 1JHTA 2D8KA 4I0PB 4IKKA 2AQ1A 3QWNA 4GAFB 3FKUS 4A2DA 4UNVA 3KPRD 2WCPA 3QDJD 2RAMA 4PR5B 3INUL 1DFXA 2IFFH 3PV6B 15C8H 1OGAE 3IRCA 3CZLA 4BUQA 2KPWA 1KWKA 2WO2B 2DYRB 1G7PB 1JTPA 1I1FA 2V3EA 3EYVB 4D0CA 3VXTA 4HWUA 2BVQB 2A7BA 3HIZA 3FB7A 2P8MA 3VFNB 4KFMA 3QXUA 4KKCC 4Y5XB 4PV8B 4MA7L 3EO1A 1E9OB 3NSJA 4EIBA 4DUWA 4U1SA 1N6QH 1YEIL 4PTUB 3S88H 5CU9A 1U3YA 1UD2A 2FWOA 3UC0H 1WYJA 2QVMA 3MR9B 5C6TH 2ADJB 3CZJA 4QRQA 2A74C 3QR2A 2AJVH 3QDME 3P40A 4OZFB 4YPJA 1OP4A 4GEIA 3HPLB 2YAHA 4LLWB 4BZ2A 4YLCA 5CEXB 4P46C 1DJGA 2XA8L 1S5IL 3DSNA 3AAZA 1OAQL 1JCKA 5MHSD 1CBVH 2KC0A 1JGDB 5GGQH 3INUH 3UPRA 2RHEA 1SJXA 1CD0A 1RULH 4FQ1L 4W4OC 4HHGA 4PJGB 1N0LB 1XGRA 2GHZA 3MXVH 4X6DA 5EF1A 5E9DB 1P6WA 2Z31A 3KS0H 5K39A 2R8SL 4G9FE 3BRGC 3QFJD 1YUKB 5DRZB 1FN4B 4TQPA 2P47B 4YUEL 4CVXA 5I16B 1Q72L 4S0TD 1WIUA 1YEIH 2QADD 2EDWA 2XTJC 3LRKA 4D9LL 4Z5RB 3B2PA 5AKTA 4MSWA 1JP5A 5T33L 2DM3A 1QSFD 3O3BB 4AVJA 5DFVD 3H4FA 4R4NC 4UINL 5DMGD 4NO5A 2XA8H 1S5IH 2YD7A 5IJVA 2FSEA 5B7EA 4HJ0D 4NKOA 4X6CB 1I75A 1OTTD 1MAJA 3AXIA 4EUPB 2WXPA 3KLDA 2DF3A 2HLFD 3QZLA 4EQ2A 4G8GD 4M29A 1MFDL 1FZKB 4KI1A 5CGTA 5C8JB 1DLFH 4FCHA 3T6WA 5ITBL 5JIDA 2EJ1A 2F8OA 1FVEB 1IFRA 2GPZA 2HJKA 5BZDB 3ARQA 3EOBA 4FHKA 3LEXA 1BECA 2E6QA 4GSDL 4OZHB 4YUEH 3CFEA 1Q72H 4HFWB 5HVGB 2YAPA 3T1WA 3ULUL 2ETWA 3E0GA 2UYLB 1UXSB 4M1DH 1TZGH 3E6FB 3ULUF 1LE5A 4FKKA 2AJ3A 4OV6F 2BY0A 4D9QE 3BAKA 3FUFA 5I66A 3H4HA 2VJ0A 3C5JB 1M1SA 4GIPD 5CP3A 1RUAH 4PJ8C 2R4SH 1OM3H 3HC0A 4Q6IB 5K69A 1KPRB 1DBJL 4NP9A 5DO2D 2FB4L 3LNDA 4ODTL 4PMEA 5FUZL 3VE0B 3ZGHA 4N2AA 2X0UA 4Z7QF 1DL7L 3N04A 1BQ5A 3TIDB 3VFVB 3A67H 4JJHA 1W72A 5IMOA 4G59C 2IQ9H 3I9GL 1BFSA 1CGTA 1U4FA 3EJZC 4GKZA 4AYDC 1AZRA 4X5LA 3SE6A 3IS1X 2AGJL 3X3FL 4OUOA 4HDIA 2KL6A 2NZ9D 2HRLA 5E6ID 4A6YL 3E9TA 3IJHB 3PL6A 3MRJA 4XH2B 3CHSA 4ECNA 1VENA 2H8PB 4FZEL 2UZYA 3E9UA 4NNYB 2BMKB 5KS9A 3DGDA 4XX1G 1PS3A 4ZXBA 2ITCA 4AYMC 4DN4L 2QTVA 2X4PA 2QHLA 4XOBA 2WK2A 1PG7W 1QPPA 3NSXA 2QELA 4BIKA 4NQCE 1HKLL 4YHNB 3CVIH 3QRGL 1KJMB 2QTEA 3KYNB 4KH2A 3VXUD 4Y2OA 3KVDD 4JM2D 4K3DL 4ACTA 4LLQB 1YN7A 5AVYB 4DCQB 5JMOC 2CJTA 1OAXL 2BRQA 1XGQB 2J8OA 1X7QB 1DBJH 1LLAA 5FUZH 3GBML 3OKEB 1OSEA 2NY0C 4PSPA 4XN2A 5I6LA 4GMSH 1VADB 3OJDA 1IBYA 4K8RD 1DQDH 1ZS8A 4I3RH 3ZKMC 5IV2A 4MCZA 2NOYA 4OV5A 4LL9A 1YYML 5HYQB 2GUYA 4L8BA 5I1DA 1E43A 4NQVB 3RVUD 5CLYA 3EDDA 3KVPA 4A6YH 1SDDB 1CFTA 3WFEL 1XF2A 5SWSA 3H56A 2ZQKA 3NVQA 2K70A 1BVLA 4FQIL 1NGYB 2VERA 2YAEA 4OZIE 1HFUA 2EH8L 4IRJA 3BQUB 5E9AA 1HKLH 2EO1A 2KMWA 5AB0A 2VE6B 1FGVH 5IG7A 3K71A 3LKQA 1H3PL 4HHWA 1YJDH 4K3DH 4ODXB 3E1F1 4TL5A 3SO3B 4Z7IA 5IWLC 3AQDA 3ZBMA 4ONHB 3LKPA 4GSUA 4MBOA 4NZDA 3BWAB 3EJUA 5CJOL 3QJSB 3HS0C 5D1XD 1KC5L 4FKHA 3S48A 3AMKA 4XHJC 1EGJA 3LPGA 5I75C 3UADA 2CDGB 4W9IC 4LARH 4OFKA 4MNHB 3KWTA 4NYLB 5DT1H 4LAQH 1XGYL 2ITEA 2D3VA 1R5IB 1ZHKB 5JORA 4FQIH 1LTXA 1X5MA 3RGVA 4K5MA 1G7IB 2JI3A 4B7LA 3O2VH 1R5WA 2D03L 1HCVA 2WZPA 3AREB 4J39A 2K0RA 1F2QA 1IARB