1OV8A

Auracyanin b structure in space group, p65
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
b'ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auracyanin B
publication title Auracyanin B structure in space group P6(5).
pubmed doi rcsb
molecule tags Electron transport
total genus 37
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ov8A00
1NIDA 1M9WA 3T9WA 2IDQA 1L9SA 4A68A 5TK4A 3AY2A 1WA2X 1NIFA 2YXWA 1AAJA 1AQ8A 3U25A 2CALA 1V54B 3FU7B 3X2QB 4EF3A 2DV6A 2VM4A 4E9XA 3SBPA 2A3TA 3FYEB 2BW5A 2IH9A 1PMYA 2FT8A 3WIAA 5B1JC 1OE3A 3TU6A 4BWUA 3EH3B 1NWOA 5E9NA 1A65A 4KNSA 4HAKA 4HCGA 4YSUA 3IN0A 4L0PB 1DYZA 1MZYA 4A66A 3NSYA 3OM3B 4PAZA 3RYMA 1KCWA 1J9QA 2IWKA 1SDDA 3OQRA 1PY0A 1ET5A 1W6LA 4AKQA 2P80D 1SNRA 4P5SA 4YSRA 1I53A 2PPAA 1X9UA 3FYIB 3SBRA 5B1BB 7PAZA 3FSZA 3WNIA 3ABGA 3KW8A 2J5WA 3SBQA 1JZIA 4X4KA 1N68A 1GR7A 3D12B 2BZCA 2XYBA 3EH5B 2DWTA 2FQGA 2HX9A 2RACA 4KOBA 1E30A 3FQYA 2J55A 3NYKA 4DPBX 5I5IA 4A2EA 4HZ1A 1T5KA 4KO9A 1ILSA 1A4CA 1M57B 1MZZA 4GXFA 4WTQA 2FWLB 4TXVB 1AZNA 3N2JA 4G72B 2VN3A 1J5DA 1L9PA 1BQKA 4HCIA 5AZUA 1J9RA 3WG7B 4AZUA 3CDZA 3AW5A 3TBCA 4BDVB 8PAZA 4F2EA 4HIPA 2Q5BA 4BXVA 2JKWA 1YLBB 2FJSA 1BYPA 4DP1X 1ASPA 2I85A 2PPCA 2XX1A 4E9RA 4CSPA 4E9SA 2XV0A 3QJRB 1KCBA 2UX6A 4DP6X 1RCYA 4UANA 1PZCA 3L45A 1DZ0A 1JVLA 3UABA 1CC3A 1PF3A 4KO7A 1QHQA 1B3IA 3NSDA 2J56A 1QNIA 4CSZA 3V9EA 2Y1AA 2PPDA 2EIJB 3WKQA 3QJTB 1WA0X 1GSKA 1GYCA 1SFDA 4M4RB 3NJFA 1NINA 3G5WA 4M3HA 2EINB 1N70A 1XB8A 4JHUA 4Q8BA 4YSQA 1NPNA 1BYOA 2BP0B 3NSCA 4KNUA 3PCYA 2QT6A 4DP8X 3AG4B 2GB2A 3OD3A 4F7KA 3UAEA 3OMIB 2X88A 2UXTA 3ZBMA 2AZUA 2H47C 3NJLA 3ABMB 4PCYA 2EIMB 3NJNA 1TU2A 4QKTA 4NAJA 2JFCA 3AG1B 2PCYA 2FQEA 1GW0A 2IH8A 2OJ1A 3KW7A 4N8UA 3WI9A 4JHVA 1NIAA 3X1NA 2XV3A 2R7EB 3X1BA 4BWTA 2QPEB 3UACA 2GSMB 4KO5A 3X1EA 1JXGA 4YSSA 2GI0A 1KDIA 2BWDA 1KBVA 1RZPA 2FTAA 4KOCA 3T6ZA 1OF0A 1BQ5A 1WAEA 1OCCB 2XV2A 4G70B 1XB3A 3MBWB 3NP3A 1NZRA 2AZAA 4AKPA 1MDAA 4UF7C 4QLWA 4G7RB 1OV8A 1PNCA 3ZIYA 3ZX1A 2NRDA 6PCYA 2VMJA 4JKNA 5I6MA 1SF3A 1NICA 3FU8A 2BP8A 3ABLB 3MX0B 4AKOA 3TA4D 3EF4A 2BZ7A 1ET7A 2DYRB 3GYRA 1NWPA 1PZBA 2I7OA 2ZXWB 1RKRA 4WKXA 2DY2A 5I6PA 1AANA 5TK2A 3DKHA 4UAHA 2BO0A 3QJVB 4Q89A 2ZWNA 1ID2A 3NJKA 1UATA 1J9TA 1ILUA 3S3BB 1L9OA 2XXFA 3UGEA 3X1FA 1GS6X 1J5CA 2XVBA 4RH4A 5AKRA 1E5YA 1OOWA 2W8CA 4YSDA 3T6VA 1PLAA 3H56A 3SQRA 1AZRA 1BAWA 4FAAB 1AG0A 4DP5X 4DP9X 2YXVA 2PLTA 3EHBB 5D4HA 4N4YB 5I5JA 3FU9A 1EHKB 1XMEB 4HCFA 4E9QA 2IWFA 2JXMA 1ZPUA 2CUAA 2CJ3A 2WO2B 3FS9A 3S3CB 4NB7A 2N0MA 4A2HA 4KO6A 2VM3A 4ENZA 1OE1A 3DTUB 3H4HA 4E9VA 2AVFA 1L9RA 3NJMA 2EILB 4YSEA 3BQVA 1JOIA 2IDUA 4GP4B 3CVBA 2YAPA 3S8FB 5FC9A 3PXLA 1E5ZA 3HB3B 4KNTA 1A4BA 4HHGA 1JZJA 1MG3C 1FA4A 4GYBA 1OCRB 1CUOA 1HAUA 3CG8A 2TSBA 3CZUB 3FSVA 3FU7A 1NTDA 1CYXA 2H5UA 3S8GB 2XWZA 2GHZA 5B1KA 2AANA 2CAKA 2Y69B 1SHXA 3WKPA 1ASOA 4G71B 4AI7A 1JVOA 5I28A 1J9SA 1F56A 2YARA 2BW4A 1HAWA 3GXUB 1IBZA 3FQ2A 2PCFA 2Q9OA 2DYSB 1TEGA 5B3SB 2AFNA 3FPXA 2YAOA 2GIMA 2GC7C 1PLBA 2QDWA 1NIBA 2HX7A 2ZONA 3DIVA 4DP0X 5A7EA 3V9CA 1X9RA 2YAQA 4HHWA 3AG3B 1EZLA 2WSDA 4HALA 4AX3A 1NPJA 3NJHA 1JERA 4A2FA 1ZIBA 2FNWA 2WO3B 3OMAB 1NDTA 4F2FA 5AFAA 4YVNA 3TASA 4GP8B 1VLXA 4YVUA 3T6XA 1OCZB 3CDZB 2UXFA 3CVCA 5ANHA 3BVDB 4YSOA 1PNDA 3ASOB 4P5RA 2X87A 5D4JA 2FT6A 1A8ZA 1KGYE 3QQXA 3PAZA 1CYWA 2B3IA 1AS7A 2VSKB 2QPDB 2VW7A 2ZOOA 1NIEA 2MTAA 2H3XC 6PAZA 1ZDQA 2IWEA 2GC4C 1PCSA 3FQ1A 2XX0A 3NJJA 1PLCA 4NERA 2YAFA 4G7QB 3EH4B 4YSAA 4BDVA 1A4AA 1L9QA 4W1TA 1L9TA 2OV0A 1QLEB 1OE2A 2E86A 2HX8A 3CVDA 1GY2A 3NJGA 1E67A 3NP4A 1ZIAA 3C75A 1TKWA 4DPCX 4E9YA 4A67A 1AZBA 2HRGA 1IC0A 2J57A 2YQBA 4BXSV 1GS8A 4FA7B 3TBBA 1R1CA 2YAMA 2W88A 1CURA 2LLNA 2VSMB 3T71A 1IUZA 1MG2C 1KV7A 1XB6A 3HEIB 4YL4A 3GDCA 3H4FA 1JZGA 4DP4X 2FQDA 3NSFA 5B7FA 4MFHA 3FSAA 3X1GA 1GS7A 1A3ZA 2PP7A 3IN2A 4W9ZA 2XU9A 1KDJA 1TEFA 3ASNB 1BXAA 1V55B 1W6WA 2PP8A 1BXUA 1AOZA 5I6LA 2BP0A 2VW6A 3NJIA 1ZV2A 3IBOA 5B7EA 1JZEA 4DPAX 5I6OA 3FT0A 2B08A 1SJMA 4ZK8A 2CCWA 3JTBA 4G7SB 3QJUB 3OMNB 1IBYA 9PCYA 1AS6A 3UADA 3AZUA 1AR1B 3QJSB 2I7SA 5B1JA 1IKOP 4DP7X 1JXDA 3JT2A 3PAUA 3T6WA 1KBWA 1WA1X 1E65A 2HRHA 2IDTA 3FPYA 1URIA 4DP2X 1AACA 4YSCA 1V10A 2YAHA 1AG6A 2R7EA 3AG2B 3IEAA 2TSAA 2EIKB 1FWXA 2IDSA 2BP8B 4YSTA 3UAAA 1SDDB 1WS7A 1JZHA 2PP9A 2IAAC 3QPKA 1BXVA 5D4IA 7PCYA 3ERXA 5EHFA 1W8EA 1ET8A 1JZFA 1BQRA 2OCCB 2BHFA 2QDVA 4E9WA 1AZUA 3PAVA 2P80A 2HLEB 5F7AA 1GY1A 2PPEA 2PPFA 2FQFA 1AIZA 1PAZA 2UXGA 2CBPA 5I5MA 1SFHA 3S3DB 4BWWA 4GP5B 1ZDSA 3PLYA 4A2DA 2YAEA 5I26A 2HXAA 2XLLA 1ASQA 1ETJA 1FFTB 5PCYA 4BK5C 2HZHA 4A2GA 5PAZA 5B7MA 2XUWA 3NT0A 3FSWA 3ZDWA 2FT7A 3IE9A 1SHWA 2UX7A 3PPSA 1SF5A 3WNJA 1AS8A 4E9TA 5LDUA 1PZAA 1RZQA 2UXVA 2BWIA 1M56B 2DWSA 1JXFA 3QJQB 3N55A 5I6KA 1HFUA 3ABKB 5F7BA 1WS8A 5IY5B 4K9JA 2IDFA 2XXGA 2GBAA 1BEXA 5B1AB 5I6NA 1KYAA 1ADWA 1AZCA 2VW4A 2MRYA 1OCOB 4GY4A 4YSPA
chains in the Genus database with same CATH superfamily
2IDQA 3DX2A 4OUOA 4X0KA 1HI6A 1RLWA 3REVB 5IESL 1JGDB 3GZOA 3RPIA 3ASWA 4FHKA 5DVMA 4ACTA 4ZFQA 4NSKB 3X2QB 4CU6A 4J39A 4YR6A 1BECA 4HJUA 4OD1L 2ICES 1H6FA 4GS7B 2IH9A 5JXED 1XZ0A 5F89A 3FT4B 4PRIA 3C2SA 4TQPA 5EOCJ 5IROD 3Q13A 3MBXH 2AK4D 1GMEA 1WVZA 5E9NA 3C6LB 1KJVB 1JRHI 4DO4A 5LQBH 3O2WL 4RESB 3DX6B 2PCFB 2DJ4A 3C8KB 4KKAC 4PI2A 4XH2A 2IQAB 5D7LA 1GPOL 2DN7A 3F8UB 1MJ7L 4JRYB 4HT1H 1BJ1J 4HPYL 3V0EA 1LO5A 4R5TA 4EOWL 5CHNB 1UTDA 4XE5B 4XR8C 3CFTA 3GMNA 2C8NA 4HOXA 3UERA 4J23A 4K5OA 1J9QA 5GRVK 1KCWA 3GMMA 3RIFF 5LN4A 3SQOL 3ZU8A 2P80D 5AD0A 4ZXBA 5HD8C 2AEPL 5MP6L 2H1PH 4BQ8A 3IDMB 1IAKA 1KIUA 1DUZB 3VI3F 5C0AE 1PZSA 1WRFA 3MR9B 1QRNB 2A6DB 1BP3B 2OL3A 1S6NA 1LTXA 5FOBB 1D9KA 3RVWD 1N68A 4X8CA 1G7IA 1JPGA 1BEYH 2C7UB 3RGVD 4L3EE 1AD9A 3W0WB 5T1LA 3D18B 4N1HB 2ZUQB 3TT3L 5BRQA 3O6ML 3U1PA 1IT9L 5EA0L 3ILQC 4EDXA 4HIXL 3BN9D 2FX9H 3MRNB 4XO9A 4DKDC 1E30A 3GKWH 4DPBX 1HXMA 4FFZL 3VXUD 3HG3A 3MHZA 2EO7A 4PRAB 4ZFFB 1RIHH 3KXFA 5I75B 3ARDB 2BVUA 4HIJA 4X8GA 4AXWB 4Q0XH 3R1GL 3AWGA 1G7PA 3K71A 3AADB 3QEQD 3O9WB 1A7BA 1I8IB 1T4WA 1HL9A 2R1YB 3L9RB 3RPKA 2APXA 1S7QA 4E68A 4W9HC 1MWAH 1ETZB 2ED9A 3APDA 2IADB 4BXVA 1G5GA 3QIBD 2QSQA 2WC7A 1ADQL 4F2ME 2ZSWA 5F1NB 5I1LB 1FHNA 4DP1X 1EFXD 4GQQA 4XZUB 4TULH 2HH0H 4MAUH 4YHOL 1UH2A 4UQAA 3HAEG 1OTSD 3QJRB 1IGJA 2CM5A 1H9DA 5SWSE 1TLMA 4ELME 1IGCL 3DUSB 1BFVL 3QDME 3MUHL 1F6AA 1NBYB 3L45A 5BVJB 1K5NA 3E1ZA 4E41D 1TIUA 2HTLD 4LSVH 3VGGA 2X1WL 4R7XA 2PPDA 1P1VA 2FB4H 3QI9A 3CHRA 3IJEA 5MEPB 5TQ2L 1OTTC 3MBEA 1ZV5A 2C9UA 4M3HA 5GJSL 4O02L 2HVKA 2XHNA 3TN0A 2OSYA 4QIRA 4A39A 4QHKI 1LEKA 4ADIA 1KWKA 1DQLH 1KCRH 2C7FA 4YWGL 1WZAA 2X38A 3V52L 4GW1A 5I8EA 5E2JA 3ZHLA 3BSGA 2VDPB 1SYSA 1LQSR 3NIGF 3R18A 4YHIB 4F7KA 3DX4A 5DK2B 4UU9B 2X88A 1JWSA 2NYYC 1CG9A 3V7AE 4M1GH 1KB3A 2BJMH 2J72A 1OSPH 1DJXA 1GIGH 4TVSa 4W6YB 5GS2D 1JNNH 2OJ1A 1BBDH 1J12A 1DBJH 3MZTA 1BF2A 3SDCA 3EYVB 3RY4A 4DVBA 2Q1EA 2XQ0A 3G6AA 4OFQA 4BWTA 5LUMA 3X1EA 4ZMXA 4UBDC 3HE6B 3SYQA 4JM0A 1KJ2B 5SWZD 4N6RA 4PQXA 2FHCA 3Q5YA 5F7FA 1DBMH 2P4AB 4G70B 2R27A 1XB3A 4M5SA 4N0UE 4PJ7A 1KB5H 4HK3N 1E27A 1NCAL 3C87A 5DVLA 2AZAA 3VFSB 3E9UA 4UQBA 3BPNB 3GRWL 4PLJC 1QSEE 2K6WA 2NMSA 2PWGA 4M6NL 2AEQL 3SGKA 3T65A 2VL5A 5MI0C 4WU5B 2WLIA 1I85C 3SO5A 4YHML 2VMJA 5D71H 3GUFA 2Y36H 4XC3H 1WUZA 3NCYP 1LEIB 3S3JA 4N2MA 2HN7A 2ZXWB 3UIYA 1MLBB 1HKLL 1A6AB 3WEMA 5IMMB 2G3ZA 4P2RD 3CN1A 2DY2A 2FZ3B 1T1WB 5ISZA 3GMOA 1A7QH 1AXTL 5E56A 5TE4H 3UYPA 1EEQA 2XRAH 3KLDA 5HHOD 4UDUA 1ID2A 4G8EA 1FCGA 1L0XA 2DQHL 2HKHL 2E47A 2ITDB 4HSCX 3MREB 5I9QC 3G7TA 3H9HA 1OT4A 4Z3JA 5CKAA 5FFLA 1BAFL 1KENH 3BVTA 2P3YA 3UL4A 1YN6B 2YMTA 3EDFA 2G9KA 2WLKA 3BPLC 5FW8A 4X6DE 2Q7AA 3HW7A 1RAMA 2JJUA 3FT2B 5GZOA 1JUFB 2C1PA 1TZIB 3JWDH 4M43H 1WBXB 2CU9A 1T5XB 4JN2A 1NFDE 4NB7A 4LOVA 3DTXB 2OMNA 1LO4H 1FNGA 4RZKA 1OGPA 3P3SA 3UYOD 3QBTB 1OHZA 4YEFA 4KTEL 1GKEA 3CSFA 2EILB 2DDQH 4MNGB 1DFXA 2YLKA 4ONGL 3PXLA 1F41A 1E5ZA 3B43A 5D93C 2QGEA 4LEBA 2FHFA 1A4BA 2XZQH 5D1QA 4R84A 4P4KA 4PJ9B 3WEOA 4KJQD 3CAFA 4GEIA 3VQMA 4XN1A 1B0IA 4LDOB 1I7ZB 3QAZC 4N0YH 5J11B 2RB8A 4LCYA 2FH6A 1MFMA 3O11B 1CDGA 1KOAA 2CBQA 3V4PL 4PSRA 5D5MF 3QFJE 1KFGA 1DVFB 5BJTA 2EEFA 5CEXB 2WXNA 4CSSA 3G6JB 4M1DH 2DWDA 1L3WA 1ZJBA 2XBZA 4HKZB 2G0LA 4JFPB 1DBBL 3L3IB 5CXPA 4ZAKA 3UTZA 2JCCF 3G5ZB 4KU1A 4DN3L 2VLME 4LVEA 2R4SH 2GG1A 4JZNB 1MFUA 1MKFA 5DJXA 1EQWA 1X44A 1WQVT 3L95B 4DP0X 2PW1A 3H7BB 4OZGF 3PREA 5K1VA 1MNUL 4AH2A 2XACC 1TLKA 5ETUA 3AQZA 4XHJD 1JERA 1XXDC 2IAMA 1RJZB 2NX5E 1K6QH 3CSYA 1T0NB 3CZSA 3C2AL 4JR9H 5ICXB 4QHKJ 3UO8B 4YVUA 4OF7A 3IJ9A 2LFEA 4NCC2 4PJ8C 3MLZH 1FCCA 5K9QG 5EO9A 3I75A 1J10A 1Y0LB 2JJSA 1DQJA 1DE4A 3BC9A 4TTDC 4YXLH 4LPVA 3VYOA 3PUUA 4HPOH 4P5RA 4BFRA 5IEHB 3PABA 2ICEC 5KS9A 5EO1A 2B59B 1HHGA 3BHBB 1CYWA 3PWVA 3PXHA 3FUJA 3KPNB 2G2RA 3QHFL 3TTYA 3KYKH 1TVHA 5DD1L 3GGWA 5HI3C 5C9KA 5DO2D 1OM9A 2NY0D 2VR4A 3VXSD 1J5OL 1Z0NA 3WKYA 1ED3A 4N3TA 1BX2B 2QLYA 1AGBA 1YMHB 1RLBA 4HF5L 4OQTA 4FD0A 2EUXA 2Z3FA 4K55A 4QTIL 3IFPB 1XGZA 3QXDB 5IB3A 1D5ZA 3U6RA 2B1HH 5EEXA 4HDIA 3C60D 1OE2A 5EU7C 3WJLA 2WXOA 1OQXA 5ALCL 5I0WA 2RJMA 2ZP0T 5ID0A 3N1GC 4NENA 5DHXB 3UGUA 5JXEC 3SDXA 5D2LA 1TNNA 2CLZA 3KWWA 4MCYB 2ESVA 1PW3A 5IROC 2K78A 1IC0A 2VITA 1FVCA 5KOMC 2BNRA 5I16B 3K8KA 4UM8A 4FA7B 1R1CA 1CURA 4UQIM 5D9SB 1U0QA 3RHWF 4KJYB 2Q3ZA 2D0GA 1G9HA 1XB6A 3MA9H 3FZUD 1GC1C 4ABUA 4MFHA 3DGCR 4HG4K 4MDRA 4ALAL 2AJZB 5LGKA 4AM0A 4W9ZA 3VGAB 3DBXB 3HPLA 4RA3A 3FFOA 3ILEA 1FFPA 1C5BL 3NEOA 5CBAA 2VO5A 3V95A 1B9ZA 1UWGL 1T0MB 1NMAL 4G6FB 2ZNXA 5DMIH 2VW6A 3H53A 4ZRGA 2GBTA 1JZEA 4DPAX 3VXQB 3BEVA 4A04A 3RVWC 2NY1D 5J7CC 4PRPE 1KGWA 4NT6A 4YR6B 3NFNA 2YD4A 2EDJA 3RGVC 3O4LB 4LHUD 1YYLL 3AZUA 3BN9C 4PRIB 2PW2B 4ECNA 3MRLA 3W1ZA 3JT2A 4HBCL 1MHEB 2DQJL 1FNHA 2K0RA 4QGTA 4UQEA 4XH2B 1Y1UA 1ZGLA 1Q94A 5HHMB 2ZSVB 1RJYA 3E3QC 1KIQA 4C56D 2G9HA 4Y2DB 4PY8I 4TLTA 1ID5I 4AGQA 4O2FB 4WJ5A 5HYQA 1VADA 3HA0A 4WUUD 2D0FA 4PTUB 3NQKA 3PE9A 3K4AA 3QIBC 4FX5A 1LP9E 4F8TA 3O0RL 2QDVA 3UYRL 2IFGA 3QUYD 5D6CA 5TDOA 3U46A 2Y5TA 4YC2C 4HX1B 1OP3K 1OTSC 2JTDA 5F6HI 3U1QA 5JW3L 1NKRA 2BERA 1KLFB 3KG5A 3CVIH 5JNYB 1D9KB 1Z9OA 2BHZA 4LHJB 5BRPA 2MTPA 1HX0A 3HUJF 5I26A 4J8RA 4DFHA 1DP0A 1XCTA 2V4LA 4YDIL 5GSRB 2HTLC 4OV5B 1FFTB 3MA7B 4F7MA 3M8OH 3IJHB 2Q6WA 5J12C 4JFXA 4YDKL 4ZX6A 2UX7A 4DO5A 1FNSH 5CR8A 1SF5A 3O4OC 1G7PB 2NUPB 3FFCB 2BVOB 1EO5A 1DUYA 1FC1A 4UM9B 4DETA 2EDWA 1T6BX 4HJJH 1XF5A 5BS0A 5I6KA 1TJIH 4YBLC 2RCSL 4PR5A 1P7KB 3BMWA 2H0FA 3SGDH 3OSKA 4NM8L 1DZBA 5AZEH 3M1BA 1K2DB 4UZGA 3FB6A 1V7NH 1DJHA 3UBHA 1JWMA 3PDDA 4FYTA 1ZV9A 1L9SA 1QFWH 1RP8A 3HZMA 3ULUD 1QO3A 2O1AA 3DMMD 2WANA 5ICZB 2UUDK 1FL5B 3ARXA 3F7LA 4X6CF 4E9XA 5D72L 3G6DH 4KMLB 2VDMH 2L7UA 2VMFA 3P40A 3WFEL 5C2BL 2X0WA 3VAEA 1EEZA 3Q8FA 3SGEH 4DVRL 4MMXC 4ZUSB 1OE3A 3O8XB 4LKCB 5FOJA 1BG1A 2D7TH 1H3PL 4C4KO 4BH7A 1U3HA 4UTBA 5DHVB 2AJSH 2NY5L 1A14L 1DTUA 1M7IB 4PJ5E 4YSUA 1A1MB 5E6ID 5JHDD 1LEKB 4GLRH 1X5JA 4RWYH 3OPUA 4O02A 2UY6A 1YEJL 4NZJA 4F91B 1GGIL 5F9DC 3ZHNA 4GW1B 2FJGA 3VQ1C 4OFDA 1RULL 3DX0A 4OCMC 4I4WB 3U1SL 3NCBB 4LPUA 2ENYA 1AI1H 3CZNA 4LAQH 5I0VA 3DRTA 3M07A 1ACCA 1CG9B 1NGYB 3NOIA 3PIQA 4JPVH 3WN5B 2OR9H 3FSZA 4M5YH 1M71A 3Q06A 2JQZA 1LD9B 4TPRH 3KW8A 4WWID 5A43C 3SDCB 1GGTA 2ZCLH 5J6SA 2DBJA 4B9JA 3D0VB 1RXLA 1CIDA 1TVBA 2XYBA 1JK9A 3JTSA 1Q9WA 1UENA 1R33A 3DOSA 4F15B 2DWTA 2LLLA 5C7XH 5JTWA 3V4UL 3CC5A 3KPSB 4N6RB 1O7DE 1ZTMA 1M05A 4LSUH 3VFVA 3V6FB 4IQHA 3F3HA 1BXXA 1E27B 2GJ6B 1YPZB 1F1DA 4PV1C 4UB0H 2BIMA 1S8DA 4Z7VA 4Y5VA 2VL5B 3R4DA 3MN8A 4HCIA 3GRWA 2WLIB 4NQSA 2AV1A 3BKCL 4OF3A 1OXYA 4Q56A 4OCRH 4OT1L 4EIBA 5D70H 1N59A 3ZKQD 8CGTA 4E9RA 4J5VA 4LL9A 3W37A 3P4OB 4M5ZH 5ISZB 3BWAA 4AQEA 4HUWA 4GUPA 1UUNA 3EYOB 4MNQB 1NC2B 4KJQC 4RRPG 1VA9A 3PQYD 3EYFB 4BSJA 5IJVA 1Z9NA 1CGSL 3GTTA 3H9HB 1TSHA 4RQQA 5C0IA 4G83A 1TTGA 1BD2E 2P28B 4XO8A 4W81A 2VC2L 3UBGA 4I18A 1YQ2A 2KI6A 1CLOL 3HCVB 2XQBH 4KKLD 3NIDE 2XKNB 2RMNA 2BP0B 5E4EB 2I26N 1U8JA 3S9DB 3H3PL 1F13A 1JNHA 2WLHA 3B3IB 4QRPD 3ZT6A 1TOXA 3TYFA 3DBSA 2J1KA 4KKBD 5EWIH 4KQ0A 2XY2A 1SQMA 4QTHB 2D03L 1QFPA 5IB4B 3B6SA 4PGDB 4RVBA 5E2WH 1C5CH 1ODUA 2KDYA 2WD0A 4OLXH 4QHLB 4U49A 4U6TA 4XHJC 5GRUH 1N9PA 3KPQB 4P4KB 3FTGB 1LK2B 4ZO8A 1DL7H 4OY9A 1XCQB 2P1YA 3BP6B 4HJIA 1R5IA 1WG3A 3UC0H 3ZQ9A 2VDPL 5IBLD 2YFNA 2HFGH 5FKAA 4JFFA 2A9AA 2DQUL 4TOYL 2GSMB 2IJ0C 3VTTA 2NY2D 4I3SH 5KVFE 3T1FA 1U92B 4LOFA 1OAQL 4HPHA 4TL4A 3PHAA 3GBMH 2Z31B 3V4PA 2JJVA 3ZDXE 1XCXA 3LXBA 1F4HA 2EDOA 4UF7C 4WK0B 5EOCH 3SJVE 3VGEA 3CK0L 1QPXA 2ZX5A 1FVDA 4ZAKB 5DO2C 2NY0C 4P23D 1CGVA 1TF4A 2Z7ZA 4JY4A 4MMZA 1KJ2L 1KT2A 4CL7A 3B7YA 2PW1B 5AVSB 4JANA 1DJGA 2O5NA 1PZBA 3HJEA 3OMZA 3NCWA 3GXFA 4YDLB 3C60C 5HXMA 5EBMA 1D6EA 1B4JL 2H6PA 3BXNB 4LMQI 4P9HL 5MEOB 4ELKB 5LNDA 4HIHA 4PD4J 1JJUA 2YSTA 3NJKA 4RNRB 4LHUG 4B95C 1N5YH 4N2LA 4G6KL 1N67A 2AJYL 2Z0UA 3S3BB 5C08B 3PWNA 2YJQA 5IQ9B 1SJHB 1OQOA 2DM7A 1GS6X 1EGJL 3I75B 4U1HB 1DE4B 3WNMA 4OLUH 5GS3A 4IRZL 1KGXA 3PABB 3FZUC 2W8CA 4X6BA 3CPUA 3PWVB 1RI8A 2G2RB 4H5SA 1AZRA 2IF7A 4M4RA 5I17B 2P5PA 5L2KA 3KWTA 5IMOB 3TV3H 4ERSL 5C7ZA 2YN3A 3F7YB 3GLZA 5KW9H 3FU9A 1EHKB 3AXLA 4UIMA 2CO4A 4KVNH 3IFLH 4OV6F 5FHAH 1AQDA 3H4HA 2G3NA 5H94B 1RJLB 5IB3B 2VLJA 3H9SB 3AMLA 2WVVB 4YE0A 2NY1C 1CD8A 5HPOA 4GP4B 1ZKAA 5I0DA 1UM4H 2VUKA 5F7HA 3DX3A 1K8IA 2M1KA 2BVQA 3ETTA 4PJBB 4FULA 1TQCC 1V3JA 3SDXB 1X5AA 3N40F 1FZKB 1IC5H 2ESVB 3MNWA 4KVPA 5EOQH 2VITB 4OTXL 4DQAA 4UM8B 1F4WH 2X7LA 1T1YA 1NTDA 5KUMA 3ALXA 4JFQA 3ARGB 1EZVY 4GAYA 2WXLA 4J3OF 2OQJA 3UIZA 4PI0A 1VRSA 2Y69B 4FQIL 2QVTA 4OI9A 5FYKD 4G71B 4RZCB 1AQKH 4ICXA 4JM2B 5CS7A 3VFOA 2R8SL 4TVUA 4HK3J 1JHLH 1IBZA 3KYMB 1KJMA 3D2TA 4GAGH 1JBJA 2DI8A 4U1IA 1II4E 3PJNA 2CGRH 3QUYC 4MJ5B 3FQXB 3UG5A 4PMEA 2VRQA 4M9OA 3STBA 2X12A 2YAOA 1CL7L 3CFKA 1NCIA 2PO6D 5CSZA 3NCMA 3TJEL 4PMFA 3V9CA 4LOEA 4M6MH 1XIWA 3FMGL 5FYKU 3I9GL 1A9EB 1MJ8H 2VZVA 3ROLA 4X9BA 1U41A 5H2BB 1NPJA 2UWEB 3QORD 5JORA 1OAXL 5LO7A 4HWNA 4GKZB 4NQEB 5DT1L 4A7TA 3CX2A 5ITFA 3ARZA 3KM2A 4GKSA 5AB9A 5BPPA 1RJYB 2EDHA 4RMQA 5B8CC 1A4KA 1AE6H 1KIQB 4QRUB 1MH5B 1TTRA 3U83A 4XNMA 3UG4A 4HBQA 4BQCA 1WIPA 5JHLH 1I7UB 2DWEA 1XGYL 1HE7A 4Q9QL 3FB7A 3LV3B 4V33A 3P0YH 4UQ3A 4ZO6A 2R69H 2AJVH 4U0QB 5TDOB 1VCAA 3MYJB 4Y16A 1OVZA 3UZEA 3CFDA 3PHOA 3O45B 12E8H 1HL4A 5LBVA 3ULUC 2V9QA 3DMMC 3G6JF 4W1TA 2FLMA 4J8RB 3K1DA 1RIVL 4FQ2L 3E9TA 3ARBB 2X28A 3LH8A 4PH8A 5KOVC 1ZLSH 1BM3L 1WBZA 2EVJA 3BO8A 3LYRA 1M7DB 3ARUA 4WGKA 5AKVA 3H54A 5F0PB 1EXHA 2NPLX 1AZBA 1SMDA 4Q4EA 1RUMH 1IQWH 4PGJA 4TLSA 4LLUB 5DD5L 4XP9L 4YQXH 3IMVA 5GGRY 5I1IL 1MQ8A 1CQYA 2FE0A 1DUYB 2FK9A 3WLBA 4L8CA 4X7TA 2C9VA 2QADC 5C0AD 3TZVA 4L4TE 3STZB 4PLNC 2I60H 3OAZK 3QIWC 4Y4KD 2WTPA 3LVEA 2YBGA 1CFQA 1PY9A 3FB6B 1S7RA 1FBIH 2YWZA 1N3NB 1UXSA 3QK0A 1QR1A 1X6LA 3QW9A 4L3ED 5D7HA 1I3UA 1R3LB 43CAB 3HR6A 4OIIL 4EIUA 3HE7D 1F42A 1XGPA 5LGJB 1R5VB 4LKXA 4KC3B 4KZEH 2JB6B 5C9JB 2DBLH 2QKSA 4I9WD 1CLZH 4P05A 1RURL 1A0QL 4E42B 1K4CA 3SPHA 2K45A 1E40A 1EEZB 1MEXL 2YOCA 1MXGA 4XOCA 2H1XA 4F9LC 3KWXA 1E4KC 2C3XA 2BHUA 3V0HA 4P2QA 1LK3H 1T89A 4Q7DA 1ZVSA 4BH7B 1ESOA 4DP7X 1KBWA 1LJMA 3ATDA 2HRHA 2IDTA 1URIA 2ADIA 4MJ2A 4BE5A 3S2CA 2KQMA 3GRGA 5I76A 4U1SA 2IDSA 2FJGB 4Y8DC 1T80A 4PGEA 2DLHA 1L6PA 2IPKA 5L88L 5SWSD 3L08A 3QPKA 3NDZE 2DQEH 2E7MA 3QDMD 1FZJA 3ERXA 5L8LB 2OCCB 1F00I 1XVSA 2D9QB 3QNFA 4IW4C 2B1OA 5EEWA 3FQNA 1JF5A 2FQFA 2OR7A 5J57B 4XXCC 3BSZH 3VI4A 1OW0C 2FYYB 4JDZA 3V0IA 4F5CE 1G7MA 4Q4IA 4P2AA 4CA4A 1KXQE 4OD3H 4UIKL 4UV7L 5E8DH 3KWUA 5ACLA 5IVXA 1TVBB 2HXAA 2W65B 2ZCHL 3AQXA 1ZANL 4M7LL 2FBJL 1DJWA 1E6JL 2J73A 2PR4H 5DXWA 4FZEH 4N28A 3TCTA 4BUGA 1R3HA 1GZHC 1CDCA 2XN9A 3GJFA 4G82A 3VFVB 3VDCA 3IE9A 4IMLB 1AZZC 3WNKA 3UCRA 3ML8A 1MY5A 3QARA 5JXAH 4NUMA 5BZWA 1PZAA 2GVYA 4Z7VB 3KPLB 1KPRA 2GI7A 4KKLC 5HDLA 5FLUA 1IM9A 1E5UI 1I1AA 1E4JA 2J1XA 3SBWA 2FD6L 2AV1B 2BK8A 1JXFA 3STLA 3GSQB 5F7BA 2Y23A 5C0CD 4NZDA 4OM0H 4XNXL 1XEUA 1TJGH 2WXMA 4IU3B 4MZIA 1RP9A 1F02I 1BOGA 4KKBC 4Y4FA 1YAIA 1I4FA 5CMAA 4XAWH 4GSRA 3L4WA 4GY4A 1ZLVK 3CXHJ 5ACZA 4X4MA 5KSBE 1O6VA 1XTLA 2GAZA 2NTFB 5KTEH 1WA2X 3EJQA 3WXVL 1IBHA 5D7SL 1B88A 4E5XA 2A6IB 3CD4A 5AYUH 1BZOA 4ZSOB 4ISVA 4RAUA 3VXRB 1S9XA 1TZOA 1L0PA 5IBLC 4XCYA 4D9QE 1CFNA 3MCKA 4QI3A 3SY0A 5C0IB 1GXEA 2WYZA 1BF8A 4TL5A 4B27A 1IGTB 2BW5A 2NY2C 4WFEE 1QSED 3B8SA 2DZEA 4NHUA 5JW5A 1MRCH 2QZQA 5MENE 4YBHA 1TQUA 4FG4A 4I18B 1MCPL 2P43B 2CMRH 1OEZW 2QPUA 3OAZH 4FLRA 4AK1A 5D1XB 2IALB 1UHVA 1B6UA 3UJTH 2HFFB 3K81A 3OZ9L 3PWPE 4S1QH 4OCWL 2UY7B 4ZTOL 1PIGA 1U8JB 5DJCA 4PAZA 4FQPA 4D0CB 4FXKC 3QZOA 1FO0B 1GTFA 2AITA 3HFMH 4P23C 4R4BB 1QI4A 1EJOH 4CC0A 2OTWB 2P5EB 1ECYA 5AG8A 2X42A 3MRRA 3VD3A 2X4PB 5JOFA 3UJJH 5IG7A 2X6UA 5K9KA 1J0ZA 2ZOKB 4UT6L 3MNVA 3SBRA 2K9FB 2Z91A 5E0FA 5C6TH 4LQ1A 1JXJA 4L4JA 3BE1L 3BEWA 3QDJA 1OY3B 4G42A 3ZR6A 2OK0L 3V5KB 4JFFB 3PGCB 4RWHA 4AYEC 1ZSDA 4M7ZB 1QBAA 1MCDA 3T1FB 4KOBA 3I50L 4XCNA 3BRFA 1S7SB 2FO1A 4R97C 4ODTL 5JOPD 5BO1L 1T5KA 3BUBA 4FQLH 4AEEA 3D0AA 3SDAA 1G9NL 5I8OH 2B4CH 1A4CA 3MV7A 1M57B 3TP4A 5K9OA 3POHA 5JUEL 3WNPA 2HWZL 1F3JA 1BREA 1XD0A 4XZ4A 3REWA 4H25B 4MMZB 3FHQA 1JF1B 4JY4B 4NGHH 1KT2B 4HIPA 2EDQA 2Z8RA 2JK5A 2IDCA 2WBJB 1G84A 2O5YL 5E8PA 4J7RA 4W9JC 2XX1A 5I1JL 1HHHB 3P11H 2X9WA 3UAFA 4G80A 5D7JB 4CSPA 2R0KH 1XL4A 3VFMA 4XMLL 5I66A 4CC1A 2DQTH 1UQSB 5D1ZD 4IKKA 1ZT1A 5AOMA 3QFJD 3OKEA 3QR0A 4N0CD 2H6UA 2OSLA 2NY7H 4Y19E 5C0BA 3B8YA 3PWNB 4C4UA 1A1NA 5DUJA 4GW5A 4Y2NA 3ULSA 4KX7A 1RZGA 4IKNA 4IRZA 1EHXA 2J8HA 5E00A 4H5SB 1FAIL 2A74B 2ZUYA 5L8KB 2C3WA 2VLMD 1TG8A 4M4RB 4KQ4L 1KEMH 5LG1A 3KPMB 5LCVH 1BLNB 2I69A 3WTXA 4L8SC 2VOTA 3AXLB 5ESAA 4HHAB 7FABH 4AWJC 3NFPB 3SHSA 5EF0A 1UURA 1OKEA 3OGOE 1F4YH 4HAGA 2PO6C 3MRFB 2VLJB 4G6ML 1YPZF 3CFQA 3TH2T 3TO4B 4YHYC 1BZEA 3VE0A 1FPTH 5HPMB 1I75A 1HVXA 4WI5A 3QORC 1ZVHA 3EO0B 3MNWB 4N8UA 4Z23A 1IKFH 1KXHA 3WS6C 2DQCL 5FPIA 1T1YB 4R96A 4GT7A 4JFQB 4I9XA 4LASL 3UACA 3V5HA 2Y1YA 4S0TD 2OQJB 3QH3A 4ZD3H 3LKOB 5J89A 3JVGC 1U95B 2BC4A 1OCCB 1INEL 4PLKD 2NXYB 3S4SA 2WVSA 3G04A 3VFOB 2H32B 1GYVA 2WBXA 4U1KB 2VCOA 2YRPA 4NKDA 2QQKL 4H8QA 2BCMA 2HG5A 3ZE2E 1IAMA 3WDHA 3X14A 5CSZB 5C86A 2I5YL 2E9IA 3MX0B 1J8KA 3FRPG 4HV8B 3GYRA 4NWTL 1GZPB 4TNWK 2ZOLB 1RZFL 5KVEL 1J7VR 1YYMH 4O2CA 4IOIB 2QKIC 4MJIA 2DMGA 1H3XA 1W15A 4PRHE 1QQDB 4MXVF 4EVNA 3MLWL 3QO0A 4UAHA 5BXFB 7CGTA 1CBJA 3WN6A 1HT6A 4PHXA 3OJDB 3TEWA 1UATA 1GAFL 3O3EA 2V7HA 4JG1L 4PWIA 3VFNA 5AKSA 3IGKA 3MUZ1 4GKSB 3MV8A 2AJUH 1BMGA 1G9ML 4Z1PA 1J5CA 2XVBA 3K8LA 2C9SA 3HBQA 5BQ7A 1CZ8H 2HFEA 2IANE 3AFLA 1Q9OB 5DTFA 4K94H 4YSDA 3V6BR 3ARTA 4JPSA 2YD9A 1MFEH 4Y4KC 3OLEA 3MRPA 1Z9PA 4KX9A 4N4YB 5DS8B 2A5UA 5DI8A 5I5JA 1UCBH 3ZKXC 4M7KH 5J6GA 1CU4H 1E9OA 1R6VA 1R3IL 5EIIB 1FLRH 4QYAA 1QPPA 5DSCB 4MD0A 3HE7C 2AVFA 2VUYA 3CZGA 3L2LA 4YHZH 2NR6A 3WTSA 3DDGA 1WBZB 2A83A 2CO6B 3MQIA 1JGUH 3U2JA 4BFEA 5K69A 4XNBA 3HG1A 1NEUA 4KHXL 4GYBA 4S1SL 5E1HB 4NN6C 5A2FA 5A7BA 4W9DC 5KVGE 2GBVA 1MCJA 3FB5A 2JWYA 1KG0B 2HCZX 1QLFB 1UT9A 5C07B 4BZ1H 3AUVA 4XRCA 3O6FB 1YECH 5J6HA 1KV3A 4XP4L 3SKJH 2E7CA 5KSAB 1JIBA 2Q7NA 5IBUB 15C8H 3PHSA 3B1TA 4LRNH 1EJFA 4NWUL 2EVIA 2R4RL 3QAQA 4OAWB 2CUHA 3LQAL 1CK0L 2DTMH 3V7AG 1MFBH 4OZHB 3UXFA 5I1GH 1WGVA 3QISA 4CUCA 3TF4A 1QR1B 5D7IA 2NYZA 3HMXA 5DVNA 3UMTA 4EZMA 1NPUA 3U9PH 2YGPA 2XIBA 4B9CA 3MRDA 3KHOA 3DETD 2ZONA 1OAYL 4U33A 2FGWH 5E03A 3UTPE 1NSNH 3PDOB 3ZE1B 2DLFL 4IEFA 1L0QA 3ZSTA 4BZ2H 5F7YC 5CZVL 4CVWA 5DUBA 3FUFA 1W80A 2XG5A 4NQDB 1IC7L 2WB1A 1UOLA 1KIPA 4KUZH 4TVPD 1R3JB 1AGEB 4WUKL 4FI8A 5FUZL 4FQQB 5FGRA 2FSDA 4JFTA 4UINH 2AV7A 4EIZC 3ATFA 5FYLL 2VLRB 3C6EA 5FYJU 2P8PB 2FL5A 3VJ6A 1YMMB 5C0FB 1MY7A 3OR7B 4OBSA 3APMA 2K8MA 3ATBA 4PJBF 4H8PA 1O9ZA 3KLAA 3SDXF 1QSFB 2E7LC 3CLWA 5AQ0A 4LL1A 2IPKB 2J43A 1WO2A 4D0DA 2ZCKH 4GUOA 1AXIB 4MNHB 3QIBA 3IFNH 3PDGA 2A77H 1ZS8A 4N2AA 3RFZA 4K8RH 1B0GB 4GG6A 4S10A 3FTYA 5D55A 3TVMA 3OLDA 3TV8A 3N1PC 4NQCE 2NTSP 3Q0HA 1I7TB 3D52A 3EH4B 4K7FA 5DJ2A 5DQJB 5F93C 3TJPA 4CSTA 5IB1B 1WP6A 4L4VD 4JM2F 1IGYA 2ADJA 1X7QA 4GAAA 3QQDA 4E41A 1U3JA 1N7ML 3C5ZD 3F58H 2PWDA 2YO3A 2ZXCA 1J1OH 1H15A 3NJGA 1F97A 2QGCA 4U6YA 1D3CA 4R4ND 1UZGA 3GSOB 2C3VA 1NFKA 4OI7A 5GGUA 4IIQA 4MAYD 4KVCL 2WCPA 2Q2LA 3IDXL 3P77A 1I31A 2AVGA 4M6OL 2CNZA 1WZ1H 4PJGA 4R8WL 1E2ZA 4X98A 3V0WH 1IUZA 3D0LA 5H37A 2Z8VC 4LCWD 4KGJA 3LX9A 4PS3A 4Z3GA 4B6ZA 1U6AL 2QSCL 3LIZL 3FTSA 5LG6A 5DC9B 5DYFA 5GRXG 1YNTA 4EN3A 5D6DC 4B0MB 4JFDD 2OP4H 2I9LB 2K4WA 1CT8B 5CP3A 4V1DD 2DLEA 3M88A 5TGBB 2NNXA 5EO0A 3MJ9H 2A6JA 5EORL 4K3EH 3IFOA 1A2YB 4GSDH 4RAUB 5DJ8B 4W68A 5L7XL 1A6PA 3MCKB 3BWSA 3WY2A 4R7NB 4QPEA 1BBJA 4ZMAT 3L54A 5AVVB 4AIZA 1HE8A 3C8DA 4PJEB 4LEEA 2CPCA 1NFIB 2GYSA 2HRLA 1WEJL 4B9GA 3RIFK 2BVPA 3RWIB 4WJG3 2R2HA 5I8CB 3V4LA 3BKYL 5FW7A 2DQDH 5AKTA 1V10A 1TTAA 4Y4HA 5J4MA 2OMXA 3TBSB 1VEMA 1J0IA 1F58H 1RZIA 3FCBA 4F7PA 4XBPB 2AF2A 2F18A 4KITB 4J3TA 2O93L 2B1AL 3EYSH 2OI9C 3RWGB 3HAEB 5JOFB 4LCUB 4YUEL 2YFOA 1ITBB 3TM6A 1M3IA 3QUXD 5FGCE 1A7RH 1T66D 4NQUA 4WNQA 1MIEH 1EBPA 3IMRA 4UT6A 3BH8A 3HC4H 2Y7LA 3O41B 3F6JA 4XMXA 1ERNA 1CICD 1FYTB 1BD2D 1ZA6A 3MNDA 1ND0A 4MLSA 4N6QA 1AY1L 1YN7A 5D1ZC 5MEQB 4M48H 4N0CC 1MFCL 1PKQA 4Z77B 4S1RL 2HZHA 2VZUA 5JPMC 3L2NA 2Q86A 3R8QA 1BQLH 3D48R 1NH6A 4PG2C 3DROB 5DEFA 2FT7A 3TPUB 1SHWA 3I02A 3Q48A 4E36A 3PPSA 5AAPA 1CFTA 2CBMA 4Z7NE 2VAJA 4AIOA 1F3JB 5KBNC 3HS9A 3JT0A 4ILDA 5T3ZH 2GTQA 3HLKA 1SRDA 2OXGB 3DI2B 3T5WA 3FQ4A 1L4IA 3SDDC 4R26L 4IGBD 5E8PB 2QEJA 5J0BA 4ZODA 3LRKA 3KPPB 3DGDA 4JGNA 4RGOH 4OB5H 5EBWA 1GGCL 2JB5L 1MHPH 1MCOL 1Q0EA 3MGTA 2J8UA 4QO1B 4XCEA 1RK0A 4Q14A 2WYTA 2J25A 5CLTA 5DJZB 1ZT1B 1OP4A 2B5IC 3L4TA 1A1NB 3CXDH 5I9QB 2LU5A 4FXGC 4D7BA 1J05A 1RZGB 2MMXA 4X6EB 1CL7I 1TQWA 3MJ8A 3W5NA 1G1CA 2JTYA 4EUPA 3OB0K 1I8KA 3IAQA 1INQB 3FAXA 4JM4L 2EVFA 4HIIB 5E51A 1JHTA 2P52A 1XH0A 2NW2A 3ARED 3FFDB 2DQIH 4LCVA 4PLKC 5D1QE 3M7FB 3CUPA 3RNKB 1L7TH 1A65A 3DXAB 4KNSA 1MELA 4CU8A 4O4YH 2ZPKL 1CTNA 1JZDC 5LGHL 2FAUA 2WLNA 3DJ9A 5CINH 3T0ED 1YAZA 1F86A 1ML0A 1JZ5A 2IWGA 4YAQB 3QVAA 1SDDA 1KUMA 3DC0A 1BV8A 3GK8H 4NJ9H 4WTZG 3D3VB 3QIUA 1A6WL 4WI8A 4AKQA 5I2IB 3FAWA 4Z7VF 2JVUA 4XP1H 4P5MA 5D93B 1S7UA 2F53A 1MJUH 1KBGL 1AHWC 2WTRA 4ZOAA 3ABGA 3PV6A 1UM6H 1FO0L 4YK4C 5DRZA 4LVNC 3CLEH 1BFOA 4K7PX 3QSKB 3D12B 2C3GA 3QAZB 5DWUL 3QJZA 3EBIA 4KXBA 5JIQA 1OLZA 4K2UH 5HP5A 5D7KE 4PRDB 5IESH 1FNFA 5I5IA 4YLCA 4AQAB 1NKGA 3U9WA 2YK1H 3ZYOA 5EIQA 3VMPA 1ILSA 4OD1H 4NXKA 2VN3A 2VZOA 1Z0MA 3KHQA 3A22A 4LXFA 5AZUA 4AZUA 3QZBA 3BZ4B 4NAQA 2HJLA 3CDZA 3QG6B 1PIFA 1DJZA 1FG2A 3TYGL 4CAGA 4X99B 1FL3A 4N85A 1FFNB 3VG0H 4KTGA 3O2WH 5JHMA 1CDBA 2GUOB 1E5AA 4UQ9A 1Q72L 4QMEA 1NMBL 1GPOH 4XCFL 4YXHL 3ORJA 4MJIB 4EOWH 4N2GA 2CDFB 3AU0A 2D8KA 3OR6A 1TZGL 4EVNB 3HLAB 4H1LH 2V9TA 3L3OC 4APXA 5JYMA 2CXGA 3SQOH 5JIPA 1MI5E 2ORBL 2AEPH 5E0QA 5MP6H 3VFNB 4A7UA 4Z7UA 3L1GA 4OBRA 4PJ8B 5ELIA 5LNEA 1J0YA 2GJRA 4GQRA 2Y1AA 3CBJB 3M17B 5ANMA 5AW7B 4B0MM 3HN5A 2HFEB 5BQ7B 2EIJB 2RQ8A 2SEBA 2ICEB 4YX2L 4ZDHA 1PFCA 2OMUA 3K3QA 1KXTA 4B97A 5BOJA 2SODB 3G5WA 3ZZ1A 1NQBA 5L4FA 3TT3H 4ABVA 3O6MH 1IT9H 5EA0H 2UYLA 1D5IL 3O6LL 4HIXH 5KG9A 1W0WB 1A9BB 4FFZH 1OK0A 3MRGB 1SJEB 4A6YB 3JUZA 3IWVA 3OD3A 4OGAD 4BELD 3DETC 2VDQL 1MVUB 3T08A 2EVGA 2VMDA 4LMQE 4ONOA 2IO5A 3R0MA 2A83B 3T0VA 3IJSA 2OYMA 2V9UA 2EDMA 1S9WB 1X3DA 3VUAA 2XKUA 4ZUWA 5I0XA 4Z8FL 3OVUB 3RWDA 1ADQH 2YRBA 3OAWA 1P2CA 2CRIA 1NIAA 2WWMD 5AWNL 2AK4B 1N8ZA 2YD5A 4JBSA 3VI3E 4BCZA 4YHOH 3WUWA 2I25N 4KO5A 5EMYA 1IGCH 1YSOA 1BFVH 2CHXA 2NNRA 1SY6A 4OLVL 2V5YA 4NP4H 1QNZL 3Q5OA 5F70A 5FYJH 3DIDA 2F5AL 5D7IB 2LU4A 3TNMB 3U7WL 1EWHA 1Z2KA 5K39A 5SX5K 5TQ2H 4ZMWA 1A6ZA 3KGSA 3VRJB 5GJSH 4EI6B 3JWOC 4O02H 3V6ZB 3KPRA 3V4VL 2ZXAA 4HXBH 4YWGH 5TDNB 3RGVB 1AJ7H 2J20A 2PTTB 1TTCA 2IMMA 3L9YA 3V52H 2Z9TA 2D9CA 3B9VA 3FB8B 5AW4B 1KN4L 5A2LH 3VXUB 5FO7B 4EI5D 2BS9A 4R4NC 1GGYA 4P3CL 5DJDA 1RUPL 4ZOCA 1M3JA 4AV0A 4MAYC 2EO9A 3FU5A 3H6JA 2FL5B 4NN7C 4U6HA 1NAKL 4H0GA 3QEQB 5TDPB 1FI8C 1JV2A 1G6RH 1Y6NR 1AO7A 4IK6A 4GKLA 3ZL4L 4HIEA 1G5AA 3UTQB 4DKAA 4I77L 4ZW5A 4IRSD 1BAWA 3BUDA 1AG0A 2J8OA 2WYHA 3QIBB 1KCVL 1EFXB 4JHWH 4HUVA 3GJEA 2IG2H 4GRLD 4YC2B 4PWHA 1ZPUA 1MCIA 4DT2A 4AVHA 3JV4B 5DJ2B 2JV6A 4KO6A 4MWFA 1H8NA 1IGYB 1D5MA 1IVLA 1NCAH 1O7DC 4LFHD 3WJJC 2E9WA 4NLHA 4BBWA 4KV5E 3RHWK 4E41B 2PXYD 4M6NH 1MHHB 1OWRM 2IDUA 3DSNB 4DGIL 4YHMH 1KELL 5J12B 5C09A 1NLDL 4P3DB 2ADGA 3NIGE 5GGUB 1OCRB 1CUOA 5E08L 3O4OB 4LARL 3CZUB 3DRQA 1HKLH 1ZTXH 2R0LL 4P46D 4X98B 4AW7A 3H0TB 2YUXA 4UOW1 1WDAA 1AXTH 3ZPDA 1J8HA 1K4DA 3HNSL 4JFZH 4YBLB 5T1KD 5FM4A 1W9XA 3VU2A 1ASOA 4OD2B 3QIWA 2DQHH 2HKHH 3LIZA 3B4NA 1MNNA 3CN0A 3V0DA 5I28A 2O5XH 2BW4A 2YARA 4MXWL 4NQTA 4NKQB 3FQ2A 3QUXC 3WO3B 3SKMA 1BAFH 5HHNB 3PY9A 3ZIMA 1T66C 3H85A 5CO1A 4QYOA 3WE6B 3DIVA 1CICC 1XF3A 4OCLC 2HPTA 3QFDA 5FDWA 5ICYA 2AP2A 1X5HA 4X6FB 3FOMB 3ML9A 3AG3B 4IHOB 1RH8A 1T1XB 4KI5F 4KWUA 4AX3A 4OJDH 4LHQB 2OW7A 2WN3A 4MMXB 5DFVD 5SWZB 2KH2B 3J27A 3NIFF 3CMGA 2FEJA 1OO2A 4B9PA 4KTEH 2X4SA 4JX0A 2ZX7A 3K1KC 4JEGB 4N0FA 4YPGA 1CXKA 3F7QA 4ONGH 4BD4A 4JO4L 3BVDB 4LCCC 3T8MA 4F7PB 4ZT1A 1UACL 3BH9B 1TZHA 1P6FA 3D39A 3IU3B 4JQXC 5SX5H 4NCC1 3KL3A 4FYRA 1S7WB 4OJCA 4Y2LA 5SWQA 5IFJB 2F54A 3IXTA 4IGBC 5CWSA 2LOEA 2H3XC 4R7LA 4DN4L 1TETL 1R75A 4ODXB 1C9SA 4D9QD 3FBQA 4L8BB 4P2RB 3UTTD 1OP9A 4LBEB 3KWVA 3V0GA 3WIHA 4G7QB 1IM3D 4I0KA 1KXVA 4WFED 5FKPA 3F7VB 4BUHA 5EZJB 5HHOB 1YN7B 1REIA 3V8CA 5MEND 4OKVA 4OZHF 3CH1B 3AM8C 1JAEA 1PKQB 1DBBH 1IRAY 2OZNA 2GSGB 2XA3A 3VXMA 3BRGC 4J4PD 3HZYB 4BSVB 4DN3H 3K5RA 3PWPD 1I3VA 1GZHA 1N0XL 3OX8B 4EI5C 2BSEA 1TKWA 3LKNA 3VYPA 3D07A 1CDJA 2IPTH 3T1WA 1O7VA 3EJYD 4PIBA 3RA7L 3AREC 4U1NB 3TBBA 4PJDA 1MNUH 3ZE1F 2VSMB 3LSOA 3EFOB 3T71A 1VGKA 3RDTD 4Y89A 4LLWA 2VQ1A 2X40A 1GJUA 3T0EC 3RL2A 1UJ3A 3GPSA 3DVIA 3C2AH 2B20A 3BQUD 2W80C 2R56L 3FN9A 4QRPA 2WIIA 4K7PL 2APSA 4FG2A 3CSTA 5JMOC 3PWJA 3TEXA 3BIAX 4IKIA 1V55B 3DYPA 1AGCB 1YEGL 4IKLA 5J1TC 3HC0A 2PP8A 5D5ME 3T2OA 3LMJL 3NACL 2GT9A 4PGZA 4UNVA 3QHFH 2LAGB 1MCFA 3EBHA 5DD1H 2VSDA 5AAMC 3JYBA 5EUKB 2ZYRA 1SJMA 1J5OH 2Z35B 2Z8WC 2VKXA 2JCCE 2XZAL 1KCRL 3AMKA 4J3OD 4R4FH 5T1DL 1IBYA 3SCMD 1MQKL 1AS6A 3P4LA 4HF5H 4P2YA 4WWNA 4QTIH 1JMXA 3V0AC 4Z0XA 4OZGE 4ZPTA 4JGMA 1UZ6F 4FNLL 3RZCA 3CUPB 2AXGA 5ALCH 1LO3L 5B1CA 2CDGB 1EEYA 2R7EA 3WTWA 4JFSA 1JG9A 2X4RB 1YC7A 2MPVA 2ZWYA 4FXKA 2WMPA 3EOAB 5D7EA 3NH7L 4PJIB 1SDDB 1WS7A 3RG1C 2VDRH 1GW6A 3VSVA 3SGJA 1UWFA 4NUJA 4NHCL 1PX8A 2E8YA 2FECL 2MOQA 4HJGB 4PJAA 2RA1A 5JW4M 5HGDA 4NO0A 4Y19D 4AEFA 1EHLL 1S7VB 1S7UB 5EU6A 5LJYH 2WTRB 4JFOA 3WIIL 1LE5A 4ALAH 5IEKB 2PYEA 4TTGA 2RFXB 3ZUNC 1UJTA 2APVA 2DL9A 3LZNA 1KB5L 5I71C 4ONHA 4MA3A 5FECA 1UVQA 3GIVB 3EH1A 1F4XL 2XI9A 3RQ3A 1UWGH 3U7YL 4AVIA 3IB4A 1NMAH 3FTXA 1X5LA 1ZHNB 2XUWA 2EKJA 1PZ3A 3CIQA 3ZGIA 3LZQA 4XN9A 4PRNA 3EXLA 2X05A 2EIEA 2Z1PA 2ITEA 3VRIA 3N50A 1QBMH 5IQOA 4GEJA 3MO1A 4ZUUB 4YGVB 5K9JH 1YYLH 2NY0B 3Q2WA 4NM4L 3VXSB 4PJEF 3R19A 1ZRUA 2ICWA 3P1VA 5TE4L 4HBCH 1BAGA 2DQJH 4HK0B 1ONQB 4TNFA 4HC1A 1LEGA 2X09A 4EXPX 5B1AB 4RCAA 4OGAC 4RIRB 3B5TA 4O2EA 4B41A 3P2DA 3C60B 5KANG 4WEEA 5C0GB 1NIDA 5L2KE 3OR6B 3ZMEA 3RNQB 4BQ6A 1EXUA 4F7EA 1U8PA 3E38A 4ODUA 4QJ5B 2Q8BL 4APXB 2DIAA 2V2TB 1SGKA 1XF4A 3O0RH 4Z7UB 5B39A 2WWMC 3UYRH 3WFHB 2KZKA 3S48A 2ATKA 5IJBC 4MHHI 5B22A 3ARYA 3CTTA 3GDBA 2SEBB 3UJIH 5IW1A 2OMUB 1LO4L 4ZQTA 4GUQA 3UZQB 5AVXB 1KLUA 2TAAA 1UA7A 4D8PB 4LSTL 4OFYD 2MNUA 2WGNB 4XVSH 1SYVA 4HAKA 1VGEL 2UYLB 5EG6C 3BZ5A 3K2KA 4L0PB 4L8SA 4NQVB 5C6PB 3P9WB 5KYUA 5HYJA 4N9GB 5IKCA 3V7MA 3ZRFC 4M7JL 2XZQL 3N3EA 4M1CD 2XNAB 3SYPA 4B7LA 4OFIA 4MMYA 1HWWA 2OCJA 1W6LA 2ED7A 2HLFD 4MZRA 2EJ1A 35C8L 1I53A 2NY1B 3WFCL 3EJUA 1XH3B 2BM3A 2OMTB 4OUUB 2WBKA 4ZYKA 5EEVA 1EUTA 5F9WC 4LFHG 2RCSH 1TQCB 4LHUB 5F88A 2J5WA 2IAND 2QPSA 4NM8H 1X5ZA 5D8JL 1NCOA 1DQIA 1N8ZB 1W16A 2Y5EA 3O3BA 4BRVA 4Q9RL 1CGXA 5HVFB 2O26U 3GMPB 3N0PB 1EVUA 1S4IA 2AQSA 1OM3L 2D4FA 4MLIA 5DK0A 1ORSB 3BUQA 4C56B 2MJWA 3U0PA 3VWKA 3JVGA 5BRZA 3RX7A 3HUJE 3B2PA 2C5DC 4HGWA 4JL2A 4KO9A 1V7MH 4WUUB 4IRSC 5E1AA 3U36A 3NVQA 4H2AA 5D72H 2JKTM 4GW4A 3WFEH 1EAPA 5C2BH 3Q6FA 1MCBA 4G7VL 4DVRH 1L9PA 3QUYB 3IPEA 1EBAA 1QVOB 5GJTL 3GSRA 4GRLC 2C9RA 1H3PH 3HNVL 4QHPA 3LZOA 3NABL 2NY5H 1A14H 1XQ4A 4PU2A 1PEZA 1RK7A 4D0BB 5IHHA 2Y7OA 1GZQB 1DCLA 4AVKA 2PXYC 1WC7B 1GGIH 4N86A 3OXSA 5BUPA 3DHJA 1RULH 1MCRA 3U1SH 4XP6H 4Y1AE 5G55A 1VFBA 3L16A 4N1EA 5A6IA 3V8OA 3NSDA 4F57L 5A1AA 4BGDA 4PRID 5B8CB 1QNIA 4P46C 3T4AA 4G9DB 3WKQA 4KUCD 2BY3A 4XBMA 2GHWB 3KDMB 5D7LD 3DV4B 1IGMH 3NJFA 3FO1B 1M7UA 4RSVA 4BCXA 3V4UH 3VRLF 4WKZB 1BZDA 5E5MA 1XWVA 1NC4A 2QT6A 2WXRA 3B3BA 4HMCA 3BUPA 4L9LC 4FKEA 4Y88A 4ZXBD 3UBXA 5AZ2L 3WO4C 4X5RA 3LOWA 3DMMB 3S8WA 2Q76A 1IJ9A 2DM3A 2Y3AA 5HJ3B 4GRWF 4DH2A 2MCG1 3BD3A 1X5XA 4TUOB 3BWUC 3BKCH 1SVCP 3K7UA 3MXWL 2YQ2A 4TQ8A 1NLBL 3ME0B 4QKTA 4XPAL 1ZLUK 4OT1H 4WI0A 3DIFA 1QKZL 4A6YL 5T1LD 4O51A 1TR7A 1PX4A 2WLLA 2DH3A 4NZTL 2V7NA 3SB3A 4C4BA 5DZPA 5JHDB 1VPOL 1LLAA 4WI2A 3KXFD 4F2MA 5FM5M 5I1AB 2BINA 1HNGA 5HGBA 2QADB 5K5YA 4MD4B 3VH8G 1BQ5A 4NRXA 4RRPM 4LL4A 5AVQB 4XNQB 2C4XA 4AK2A 3AB0C 1CGSH 4ELMA 4RFEA 4OIBA 3V5DA 1H3GA 5IIEB 2VC2H 5FXCH 2WNGA 3L3JB 5DZ9A 1GC1L 2GK0B 5E6SB 1HHIA 4G5ZL 4PVMA 4Y9CA 2AW2A 3WE1A 5ICYB 1H5BC 1HH6A 1GOHA 2I7OA 3BH4A 3FH7A 3K2UL 5KZCD 2K4AA 3H3PH 3LXAA 4J4PC 1AANA 3QS2A 2EKSA 4EZLA 2O61B 4J3OG 5TFSL 3FQWB 5HDQH 2D03H 3AS1A 3BLPX 2X4SB 4MA1C 4DUXA 3VI4E 4N0FB 1QW8A 3EJYC 4B60A 4EQ2A 4JRYE 1X5FA 3OKNA 3QI9D 2APBA 3O0LA 4Q9BA 1HHKA 3TPKA 3RDTC 3UTSE 5ERWA 2CSPA 3MBED 1WIOA 4BK4A 4JKWA 3QYNA 4YZWA 4PV9A 1NGXB 3T6VA 2W60A 3TN0D 4CNIB 4GMTL 2ATAA 2VDPH 3BQUC 3G5XB 3MGAA 4HCRL 2OTPA 4DP5X 3BVVA 2DQUH 4TOYH 1U8KB 4P2OA 2CZNA 4WCYL 5JA8B 2IOIA 3EFFA 2AXHA 1OAQH 3W56A 1T03L 3L2MA 3I3DA 4E9QA 5CLYA 1UGNA 3S35X 4W9CC 1A6UL 5J6GB 1RHHA 4U6XB 3NRFA 3UROR 1E4WL 3ULVL 3LPGA 3W0WE 4R9HA 1W8OA 1HWHB 3PQYB 3ZE0B 5IZ7A 1PZ2A 3CK0H 1YNLH 1DN0A 4YPJA 3IJYB 5D7IF 4N0UA 4Z5RA 4EXKA 2VDOB 3TBVA 5F7KC 1KJ2H 1YJDC 3SCMC 1TKWB 3MLYL 1MWAA 4HUMB 2KZBA 2J1YA 5AAWC 5HYSA 4M5TA 4GINA 2MFNA 4MDIB 3LN5A 4C57C 1B4JH 4P9HH 2EH8L 4AQ8A 1SDAB 1FAKT 2NW3B 4K8RD 5DRWB 1ZHLA 2GHZA 5T5FL 2WZPA 3RL2B 3SE6A 5I1EH 4HS8L 3S98A 3QDGA 4QRPB 5KSUA 4MS8D 2F8OA 4ZOBA 4G6KH 3LDBC 5EULV 1BLIA 1EGJH 4Q97A 1N10A 3ZHFA 4IRZH 1U8IB 1L3NA 1M1XA 5F7EL 3QNXB 5K1JA 1QWNA 4H8WC 1Z5LB 2CIKA 2QDWA 3HBGA 3QXUA 4ERSH 3QC6X 2MCAA 5ISZD 2YAQA 4OIFA 3EBGA 5JZ7D 4BFJA 4XCCL 4X6DA 4PBWD 2NY2B 2ZWKA 1FVEA 2Z92A 5E94B 4KDTA 1OCWL 1C1EL 2GIXA 4Z0XB 4YVNA 1NFDA 4G8FB 2AXGB 1E9QA 3QDJE 1EEYB 4X4YB 4XVJL 1Z5YD 4QXTB 4AZ8A 4FXKB 4M5YL 1XGUA 3EUDA 4P23B 1TITA 2M83A 5GZOD 4I88A 4OTXH 3EADA 4FEMA 3WJMB 2YBRA 5CD3B 1AS7A 1TCMA 1WBYA 3N41B 3PF2A 4RFNC 2OAAA 4X9HA 2Q7YA 4OF6A 4XXWC 3LHAA 3MV7E 4FQIH 5LN8A 1BW8A 3TCLA 3MRCB 4JFOB 1VENA 4FQHA 4LSUL 5IB2A 1UT2A 1O9VA 4YDZA 4NBXB 3VTMA 4YSAA 1P4BL 1XGRB 3AS2A 2R8SH 3GSXA 4PS8A 4UB0L 1JPSL 1KB5A 1U33A 2Z4QB 3FOLB 4PRBB 4M3JA 5D1QD 3B7UX 3FNKA 1MWOA 1RZJC 4NO5B 5E24E 1CL7H 5CGMA 4R97B 2ZUTA 4QUOA 4NFDA 4BRJA 3TJEH 2IV8A 2E6PA 2WCSA 3C8HA 4QXUH 5DQ9B 3FMGH 4AYFB 3P30L 5H35A 1BQHG 3I9GH 1YNKL 3G5YA 1JZ2A 3BZEA 1TDQA 4JJOA 5B3JE 1ODAA 5DC4B 4B9KC 2PYFB 4NRYB 1DDTA 1WCBB 2P7TB 3LEXB 5C0BE 5LLIC 2HT3D 3TNNA 3QQ3A 2FIRT 3H4FA 5CLWA 4L1SA 5CZKA 5E7BA 1OP5H 4M1CC 4PLOB 3CMOL 3SDDA 1BVNP 3U0WL 2PP7A 4MJ4A 1S5IH 5DT1H 1MXDA 2R0ZL 1FF5A 2HLFC 2NX5A 4ZAKD 3VU1A 1SZNA 3WEXB 4I5BA 2CG9X 5HYEA 4YHPA 3SZ6A 3B83A 3LZRA 1WT5A 3PG2A 3ECQA 4Q9QH 1XGYH 1Z9SA 2D7QA 4HWBL 2OYKA 5EFIA 4IIZA 5I6OA 2FJUB 3C5SB 2XQYA 1XR9B 2NUTA 1S7XA 2IAMD 2ATKB 3I9IA 2H26A 2HUEA 3UP6A 4ES8A 1Q38A 1RHFA 3BGMA 5IW1B 5HHQA 1PLGL 5EU3A 3QS3A 5AVUB 4G1EB 2YUVA 1KLUB 3G5VB 1RIVH 4FQ2H 4PWJA 1SYVB 2NQCA 2ZX9A 4L8SB 1BM3H 2QFRA 1JI1A 3IMBA 1F18A 5E2WL 2HFTA 5T1JA 3LRSA 3OKYA 2J5LC 2F8XC 2OMWA 5LDSA 4MMYB 2EIZB 1DL7L 2BSSA 2PO6B 4XP9H 3BPCA 2EUVA 1I7RB 4MNGE 3VFWA 1KGCD 3KR3H 1W8EA 5DUPL 1JZFA 2E59A 4TUKH 3QZMA 5I1IH 1T6VN 2AJXL 3FUNA 4GXUM 1P5VA 4YHYB 4I3SL 2E75C 5GISL 2XWJA 3UAJA 2UV3A 1FORL 3CHXA 4QGYA 1VFMA 1SOSA 1AHWA 5I5MA 3QORB 3I6GA 3NCCB 1I8LC 3PLYA 3E6FB 5T1MA 1BVKA 3ZVVA 3T04D 5EOCL 4BK5C 4IMKA 2IMNA 3UBXI 2L7QA 4OIIH 2V8LA 4M4PA 3U0PB 1S9YA 4O5LH 5JLZA 2BNRD 5IGXL 5A3ID 2Y06L 3FQRB 2LW3A 1RURH 1A0QH 5C0ND 4N8PA 1EAPB 2A6KA 4LSPL 3OKOB 3WEAA 3ZDYF 1M56B 3GSRB 3V0JA 1R5WB 2EDNA 3MV8E 4PRPA 4WK2B 4ZXBC 2EC9U 4I48B 5EBLA 4DERA 5GS0D 1N5YL 1CDHA 3DVNB 1EV2E 4HKBA 3U2SA 1T3FB 3GMLA 4PG9B 2QKIB 2F61A 1C8QA 1IFRA 2KBGA 4KK5D 1DQDL 5L88H 3KZ8A 1VFBB 4PJIF 3UFIA 4HKXA 5J9PA 3D9AL 3L3OA 4JZOB 1NUFA 3WFBL 1AGDB 3FUEA 2X6MA 2ZG3A 2ROXA 4JFUA 5I15H 3LKRB 1I8MA 3FYEB 5G4MA 3ARRA 4FCAA 4JUSA 3CZLA 1LP9A 2HT4D 4XOBA 5AW6B 1UB6A 4MA7L 3FCSB 4A37A 5C0AB 1E6OL 4JO2L 2VE6A 5CILL 4UIKH 4UV7H 2GTWA 4Y4KB 4FJ6A 1FNEA 1G7QA 4OLZL 2ZCHH 1G0XA 1ZANH 2FBJH 1E6JH 5ENWB 2VDLB 1O6SA 3L13A 3ZKXB 1PFOA 5JW4N 3KGUA 5E5MB 4ZS7L 1Q1JL 1UWEL 2YPKB 4L3EB 4OU3A 3FRPB 3BLKA 43C9B 3ZT5A 4IBUA 1OGAA 4KH2A 2AXFA 5AW9B 3HE7B 3L1OL 4E2OA 5KAQF 3D85A 1EAOA 3QQ4B 4L3FA 3TBTA 1X9UA 5H37H 3EJCA 3QNYB 3LKQA 2FD6H 4NZ8A 5GZNA 3ZZQA 4ZNEE 3AAZA 3MFGB 4Y9BA 4CVZB 4CJ1A 3PL6D 4AV4A 3C09C 4XNXH 5BOPA 3DIFB 1YEEL 3MNZA 4NN6B 1QEXA 4PB0L 4OH2A 5ID1A 2FIKB 4ZUTB 1YUHB 4KRMB 3QI9C 4XT1C 4F2MB 2CGRL 3S35L 2O6CA 4AV5A 1HXYA 1OOAA 3MBEC 5D7SH 1T21B 4F93B 5AG9A 4OGXL 3RKPA 3TN0C 1QUNA 5SWSB 4L48A 4M6ML 4Z7UF 3QO1A 4ELMB 1MCQA 2F1BA 3VWJA 1KCUL 3QDMB 2CNYA 5BS0D 2Y5QA 4XO3A 3TOPA 2R2BB 4BDVB 1HHIB 5DVKA 3V10A 5DYOB 1IBDA 1MCPH 5BQDA 5EN2B 5HBBA 1YLBB 3OZ9H 3O4LE 4LSRL 5IQ7L 1UH4A 3KLLA 3NSJA 5DD0L 5ESQA 4ZTOH 4E9SA 2ZOTA 4ES9A 3IVKA 4AC2A 4I7ZC 2GBUA 4PJ5A 4RMWA 3I74A 3M7OA 4Y9EA 2DKUA 1PZCA 4FI6A 2J71A 4M03A 5CBEA 2AQNA 4DKFL 4LRIA 2IH3B 3SKNA 3CZFA 3OKNB 3HZVA 1NBZA 3MLTA 4HH9A 4PHZA 1FSKC 3HB3D 4JPIB 3QUKA 1BIIB 1RFDH 4K8RC 1VACA 1U3HD 3WHE1 1HSAA 4PV9B 3VD7A 12E8L 3BE1H 2EEXA 2OK0H 5C0CB 3QZWA 5GGVY 4MS8C 3HS0A 1BPLB 3I50H 1D2PA 4PJXB 4OQ1A 2DM4A 4ZW8A 4H0IA 1EAQA 4CKQA 4LK4A 4ODTH 2LQRA 3D69A 1WYJA 3FXIC 4EKJA 5BO1H 5IFHL 4PJGE 3VFRA 2P8LA 1G9NH 1IQWL 3BAKA 3WJJA 5JUEH 1CDUA 2CLVA 4FCHA 2BRRL 5T33L 2OYLA 1DN0B 1DFBL 2V33A 4N0UB 2KLTA 5CEYA 1IFHL 1TCRB 3MLVL 5FWQA 5JZ7C 4BFGA 2A9ML 2D7OA 1QSEB 3AG1B 5AVYB 2FECI 2O5YH 3FFCE 1NCDH 5I1JH 5KWYC 3W9DA 1XO8A 2CHDA 3I6KB 2BIOA 2GITA 2BIQA 3K0WA 3BAEH 4HD9A 3ZY7A 1BQSA 1JXGA 4XMLH 1JZ7A 4ATTA 3MOQA 3ARSA 2FTAA 1I9IL 4HD5A 1WAEA 3S0PA 1J1PL 2EE9A 5GZOC 4HS3A 4YMPA 4CBZA 1XR8A 4U1JA 1M1XB 2H8PB 4GH7B 3SOTA 2YC1B 5DJ6A 1FAIH 1KTDA 1NICA 2BOBA 4KQ4H 3PGDB 3V6OE 4IOSA 3LCYA 2CIIA 1EDQA 2X4TA 1B6DA 1FV1B 4DGYL 5KVMC 3LKPA 4KXDA 2VIRB 2ZXQA 1FZMB 4LLVA 5D1QC 2DD8L 2WCGA 1R24B 4WTWA 3BESR 1FDLL 1SEBB 2KYIA 4LDCA 5AW8B 2DIEA 3ULUF 2W0PA 3JTTA 4G6MH 4AL8C 4YDJA 5CJQL 5TQ0H 3P3YA 5I1KL 1XH1A 5CP7A 3ZJAA 2WZ5A 3TWCL 2B9AA 2COVD 2I9TA 4PBXA 3RKDC 5AUMA 3KPOB 3VM7A 1EZUA 2XG4B 1VZGA 2HT3C 1JZ6A 1J8RA 4UZUA 5LBSH 5IMLA 5DCCA 5AL0A 2VXUH 2DQCH 2OI9B 5JR1L 1WBYB 1JPEA 2ENQA 4LASH 3HZKB 4IGBA 5FCUH 5JDJA 1M42A 1E8YA 3X11B 2BCKA 1U8MB 2JXMA 5IB2B 4QJ4B 1INEH 4APQA 1CD1A 2X4OA 4KKCD 3GSXB 3L3DB 5D1ZB 1U30A 3DUUB 3QFJB 4S0SD 2WXPA 1IB5A 5E8NB 3KPSE 3MJGX 4Y1TA 3ZT7A 5I73C 2IAMC 2QQKH 1WHPA 1MVFA 5JPMB 2XICA 2XVKA 1A8JH 1J48A 3TBYB 3SJVA 3DX9A 4Z78B 5FB8A 1PZ5A 3CHOA 1FA4A 5H35B 4NWTH 4LNRA 3S37X 3FU7A 5KBDA 1HKFA 1RZFH 5KVEH 3T3PF 1T5WB 3QUHA 3GSWB 3K2MC 1OIOA 4FERA 4WHYH 3MLWH 2KKQA 4ZPVB 5GGRB 5HDRA 4ODSL 3SDDB 5BV7C 2PABA 1GAFH 1WV7T 5T3XD 1L9NA 3CQPA 3ARFA 4Z7WA 4CRPA 1TJMA 4ODHL 4M8QB 1XX9C 1MJJA 2I24N 1G9MH 2ZG1A 3EJTA 4I5BB 4PJ6A 3WUZA 1OT2A 2NNAB 3U30B 3CHSA 3WIFB 5DD3H 4A7VA 1JV5B 4D9LH 1F3DH 2CJTA 3NTCL 4MNQE 3IMSA 4QOKA 5GGSA 5FGSA 2QSVA 1O75A 4U1LB 5BW7A 2JH2A 2CMRL 1A4JB 5FEBA 3WJLC 2B5IB 4IBTA 1TZAA 2JKNA 4JLRA 5EU5A 5F3HB 5F8QC 3ALPA 2FVNA 1Q9LB 4FXGB 4NZUL 1R3IH 4MASA 4HP5A 3B37A 1FIGL 5EU3B 5DMKB 4S2SA 2RR3A 1RMFL 2VISA 4HEPG 2R2EA 4JAMA 3UCQA 1IILE 1E2VA 2F53E 1SUJA 1VLXA 2F7OA 5MI0B 5A3IC 3ZE0F 2AK1L 1YEKL 4KH9A 4JG0L 4LZKA 1OAUL 4C83A 5C0NC 2ENJA 1NDMA 3QG7L 3LRSB 1UGKA 5GS1A 2WOBA 4S1SH 2LT9A 2J44A 3U4KA 5IF0A 4TMPA 5L2KD 3RIAF 3UP1A 3U0TA 4RGNE 4ANXA 1RPKA 5H8DA 5GS0C 5HI5D 3EUUA 5DA0B 5C0JA 5IK3B 1Z3GH 2G2PA 3ZZSA 4XP4H 3RVUD 2IWEA 1MVYA 5LXGH 3BZFB 1JDCA 1OZUA 1AHWB 2EEDA 3MCYA 5TE6L 3GI9L 4KK5C 4NWUH 4WI6A 4YK4B 5DZVA 2R4RH 4LVNB 1RK1A 1J88A 1H6EA 1UOKA 1CK0H 3LQAH 5L4IA 2B4CL 5BUGA 3MRJA 1ZOXA 3SE4A 3VX1A 3SOBL 4J27A 1H9VA 3T4YA 5C97A 1N8OE 3CFJB 2YA0A 1LM8V 1MLCA 1S9YB 2GTZA 2JLLA 3NP4A 1Y6MR 1UYWL 2ZTBA 2HT4C 4NKOA 1OAYH 2XKSA 4XMKL 5KVEE 1EZVX 2GCYB 2DLFH 1PG7W 3CVHB 2TRYA 1GS8A 4L1TA 5CZVH 3D5OF 4DKEH 3P11L 2CXKA 2BOCB 4YHLL 1BZ9A 1IC7H 1MG2C 2R0KL 3S3PA 3UX9B 3IGLA 3RWEA 4XX5A 4WUKH 5FUZH 3ZYZA 3K6DA 4PY7A 5AVZB 3T77B 1ZWIA 5ANME 2AQ1A 2VLLB 5FW6A 1QD0A 4HKBB 3VXTB 3EXJA 5CGYD 2ZOWA 4XNYL 3RI5F 4ZFGL 2IH1B 2Y2YA 3AQYA 1B3JA 5C0EB 3BT2L 1C12B 1XIWD 3PL6C 1A7PH 3L3OB 4HKXB 5J9PB 4UDTA 5B7EA 5C08E 5FM5O 3BFWA 4A55A 4DCQA 2P47B 2MHAB 3LIUA 4P4RA 4XBGB 2GEEA 2OMZA 3LNGA 2BNUA 3D25B 4GIPD 4HLJA 4QXWA 7FABL 4TV3A 8FABA 1JE6A 1X5IA 2Y24A 1NFAA 3MRBA 4GQPH 4FGMA 2FJHB 5K33A 1IEBB 2OFQA 4J28A 3GLDA 4NPJA 1UD5A 3CBRA 3VMOA 4WSKA 5C0RH 2VMEA 3Q2VA 2Y2WA 3Q3GA 1ZLDA 2BXYA 3PS6A 2F7RA 4RMBA 4OJEH 1A7NL 1XFPA 1YEHL 1KGUA 1ZT4B 3ES6A 4KVCH 3VD4A 4X7EC 3PAYA 3IDXH 5C8JA 2OZ4H 2Z8SA 3QDAA 1ET8A 4M6OH 5FYKL 3G08A 4Y16D 3TBTB 4E9WA 3LKQB 5DZNA 3AAZB 3TJHD 4ZD3L 1LE9B 4Q2ZB 1U6AH 2QSCH 2VMCA 4RETB 1M9SA 1S5HB 1QEWA 1W72L 5F3BB 1CFSB 1A3LL 4TQEL 3EJSA 2NY3D 4L4TA 3PWLB 4UTAL 5AEAA 2ZX6A 1U91B 2AKRA 3WHXA 1S7TA 3C12A 4ANUA 3HB3C 1A6VL 3ZQXA 5EORH 2YN5A 3FSWA 4AIXA 1U3HC 5JQIB 5INCA 2C1OA 4MD5A 5L7XH 1AKPA 3R8BB 2NLJB 32C2B 2DLTA 4HUNB 4Y9GA 4GAJL 1YYML 3TZVD 1UUSA 4HLZH 1A3QA 3ROOB 1D5BA 3BKMH 1F0LA 3QUZD 5DF0A 1WEJH 5ESVA 5FYLE 4LVHC 4I13B 1J9CT 2A4EA 3BPOC 3WTTA 1AO7E 2A9BA 4L4VB 4RISL 4A7GF 1VFOA 4OW6A 2J3SA 2UWEE 4PGBA 5BCAA 2EEBA 4UYQA 1U93A 3TFBA 2YLHA 4QY8A 3A47A 2B1AH 2DMCA 1AAJA 2ILLA 3K4ZA 4NQEE 3MLUL 4YUEH 5FK9A 5JHLA 3CZFB 2BVEA 4MAYB 4TNGA 3HZVB 1B9KA 2FSEB 3UEZA 4HH9B 4NN7B 3FTVA 1EA9C 1IAOA 1NUDA 1YDPB 4P2QD 1UB5A 2IOOA 2R69A 1VACB 5ILTL 4P46A 5MHSE 3AXIA 1YYCA 3RWCA 4ZMZA 2VXQL 4LCWB 2OR8A 1AY1H 2B15A 5TF0A 4YHZL 1HN1A 3N0AA 5KJ4A 5C09E 1MFCH 4Y5VC 1GL4B 1T04A 6CGTA 5HGHB 1FNLA 4F5CA 2OX5B 4JFDB 2CJUL 3WTUA 1KXQA 4V1DB 2WQSA 3DV6B 3ZYJA 4PVNA 1O5DT 1WZMA 5EDXA 1AQMA 1WTLA 4ZFOA 1HJBC 3NK4A 3QPXL 4ZNCD 2YPVL 3AU1A 3VFPB 3LY6A 1YECL 5B1BB 5ES4B 3WMSA 1DQTA 1LDSA 2N1TE 4IBLT 1KLGA 3M1OA 5KBPA 2H0EA 2G75B 1DANU 4R26H 5DRXB 4CGUB 2Y6SD 4G9FE 2PN5A 4X4KA 2W38A 3IU4L 1GR7A 3SYOA 4P5KB 2W81C 2XBTA 5I1GL 5FHBL 2XN9D 2GITB 3B2VL 3B34A 2D4DA 1GGCH 2JB5H 2RACA 3EJPA 1MCOH 1A25A 3Q2NA 1FL6A 3BAWA 3IAGC 3RJQB 4R5VA 1FN4B 3FT3A 3KPTA 3I6LE 5DJAB 3ET9F 4HS3B 5KSBA 1NAMB 1IM9D 4L29A 1I9RL 1I1AD 3QJHA 3GSNB 3ZSSA 1AZNA 2ZUUA 3A6OA 1XR8B 4G72B 3SKOB 3QUXB 4BQ9A 3GFUA 4R0LA 4JVWA 5IHUL 3LAFA 2VGLM 4Z3HA 4XAKE 4Y4FD 5EC1A 2WKGA 2DI7A 3SYCA 1CICB 2VRAA 5K59F 1BD2B 1RZ8A 4CU7A 3S37L 4KKCC 2ERJC 2ZPKH 5LGHH 2CA4A 3G9AB 3QGVA 4LLVB 2F54E 3VQLA 1YEDA 3I3BA 3LS5L 2X6CA 3EO1B 3EW3B 1RCYA 3KJ4C 1OGTA 3P0GB 1A6WH 1JVLA 2GJJA 2ZCKL 5JYLA 4YDJB 4ODBD 4AMXA 1PF3A 2X4NA 2JKRM 5AOLA 2YWYA 5CP7B 1W8NA 5F0LB 1Z66A 4LCCB 1KBGH 1ZHBA 1Z5HA 1LWJA 2CO2A 4ZTPL 1FO0H 4DUWA 4G43A 3MPCA 1UXMA 3BSZA 3VXME 1SFDA 5DWUH 4IGBB 4JHUA 1PKOA 4JJ5A 1I1CA 3LTVA 4LEOA 4MRBA 4YHNA 3KAAA 4KJPD 4PJDE 4RMSA 2J6EH 4KNUA 3PCYA 1K8DB 4EDWL 1D7DA 2GB2A 4DGIH 1JF6A 3O3AA 1OF2B 1A1OB 4ELMF 4N2HA 3LH2L 1A9VA 3QEGL 4X5WA 1BYNA 2Z93A 1CE6A 3OLGA 3KH4A 3QWRA 3NFSL 3QDJD 3RWHA 3TYGH 4RGMC 1KIRA 2JFCA 1D7CA 2WXFA 1T1ZA 1ZY9A 4YNYA 4CVUA 3GF8A 2ITCA 1Q72H 3DGGB 1NMBH 2EDFA 2VQUA 4JFYB 3AREB 4XCFH 3CFEB 5FF6A 5DVPA 2D31B 4L1BA 4Z7OE 4X5XA 2A99A 4EIGB 1TZGH 3T0EB 3PNWA 3MJ9L 3SDAD 3QCTL 1CGUA 3MV7D 2ARJB 5DFAA 1EO8H 4OGZA 2ORBH 4AMWA 3O2DL 4LCIL 5IREA 3MBWB 4P06A 4G5AA 4YXKL 5CN1A 1AKJD 5JPNA 4JHZA 5HI5C 4ELDA 4MQTB 5EIVA 1TMQA 2XSKA 3P9MA 3U82B 4HZLA 4AUJA 2WUBL 3RVUC 3TO2B 2BMKB 4ZFZA 5GGSB 4YX2H 3IM1A 3PGFL 3QUML 2BP8A 3VXRE 4FFVD 4WDIA 4JY6A 3S5LA 2ZUXA 4DAGL 1P4UA 1KTKE 3O6LH 1D5IH 2LABA 4PJXF 2DKMA 1N0LB 4LDLB 1AGFA 2X4QB 3LZFL 5I6PA 3D6GA 2MNWA 5EU4A 4PJAE 4BHUI 3S36X 3QE5A 5C0BD 2JIXD 4RSYA 4F3FB 4X4XB 4IS6B 5D1XE 2UZYA 1WFTA 2VDQH 1KYUA 3FRUB 4H26A 3ZTJG