1OV8A

Auracyanin b structure in space group, p65
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Auracyanin B structure in space group P6(5).
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Auracyanin B
total genus 37
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ov8A00
1L9OA 2EINB 1J5DA 3ASNB 1CUOA 1PNCA 1KGYE 4YSAA 3JTBA 5LDUA 4YSRA 1R1CA 1X9UA 4AKQA 4MFHA 2FT8A 5F7AA 1JOIA 4DP4X 2XVBA 3G5WA 1UATA 1NIEA 3CG8A 2PP9A 2YARA 1PLCA 1KCWA 1AACA 2TSAA 1GS7A 3PAVA 2EILB 2J56A 2VW4A 1GY1A 2XXGA 3EHBB 3NSYA 4P5RA 1L9RA 5AFAA 4UANA 3CVCA 5I5IA 3T6WA 3UABA 1AAJA 2IAAC 1OCZB 2VM3A 2YAOA 1ILUA 1J9QA 2HX9A 2LLNA 2FQFA 2W8CA 1AQ8A 3KW7A 3CVDA 3NJLA 5B1AB 1RCYA 3UAEA 3TU6A 3PXLA 2ZXWB 4KOCA 3IEAA 5PAZA 1KYAA 4G72B 2ZWNA 3GYRA 4HALA 1AS8A 1W6WA 2CAKA 1JZEA 1ET7A 2VSMB 2PP8A 3ABLB 1ZIBA 3NJFA 3NSFA 2YAEA 1KBVA 1PAZA 3FSZA 4DPBX 4YSEA 1A4CA 1ID2A 2QDVA 2AFNA 2QT6A 3ABGA 3EF4A 2FQDA 4KOBA 1KBWA 2IDQA 4G7RB 5D4IA 1M57B 5EHFA 1BAWA 2BWDA 4BDVA 1AZCA 3H4HA 1A8ZA 5D4JA 5I5JA 1AOZA 2FQEA 1JXDA 2UXFA 2HLEB 1V10A 1CC3A 1V55B 4NERA 4WTQA 3TA4D 4G7QB 4KO7A 1RZPA 2BP0A 4W1TA 4TXVB 1OV8A 2RACA 4NB7A 4HZ1A 2GC4C 1IBYA 3FQYA 3QPKA 3AG4B 4KO9A 2PLTA 2I85A 3JT2A 3TBBA 4E9WA 2R7EA 2IWEA 2GHZA 2IDFA 1ZIAA 2PCYA 1XB6A 1SDDB 4EF3A 1OE1A 6PCYA 1IKOP 1NTDA 4G71B 2X88A 2YAMA 1QHQA 2GIMA 3UADA 1XMEB 3ERXA 4QKTA 2VSKB 3WKQA 3OQRA 1CYWA 1L9SA 4GY4A 2HRGA 5A7EA 4M4RB 4DP1X 4BWWA 1JVOA 3H4FA 3OM3B 4P5SA 1BQRA 1NIFA 2GC7C 1ZV2A 1X9RA 3UGEA 4A68A 1N68A 2GSMB 2BW4A 1PCSA 2W88A 2J5WA 1PZAA 1TEGA 1SFHA 2J55A 2YAPA 5B1JC 5I6OA 3NP4A 5I5MA 2I7SA 2XWZA 2J57A 3NJIA 3T71A 5B1JA 2IWFA 1J9TA 1NICA 2YAFA 1BQKA 2DY2A 2IDSA 1F56A 3FU9A 4YVUA 9PCYA 1PLBA 1WS8A 2GB2A 1E65A 2CALA 3UACA 1A4BA 2FJSA 1MG2C 1J9RA 2BHFA 2DWSA 2XV2A 1JZIA 4YSQA 3S3BB 4F7KA 1IC0A 3UAAA 1J5CA 4A2EA 2Y69B 3S8GB 3QJSB 1KDIA 1NIDA 4HAKA 5I26A 3WG7B 3CVBA 4AKPA 1AG0A 2EIKB 3QJQB 1RZQA 5D4HA 1PY0A 2BP8B 4DP0X 2WO3B 1OCCB 2HX8A 4AKOA 3AG2B 3X1NA 1DZ0A 3NJGA 4X4KA 1L9QA 3FSVA 3WIAA 3NYKA 3FQ2A 4QLWA 3N2JA 1TU2A 1BEXA 3FSAA 1OCRB 2CJ3A 2VN3A 2AZUA 1ZDQA 5B3SB 5B1KA 2FT7A 2XV0A 3PLYA 2BZ7A 1EHKB 2YQBA 4KO6A 2XX0A 3RYMA 2QDWA 4CSZA 2XU9A 2XX1A 1NPJA 2XV3A 3MBWB 4YSOA 3S3CB 3T6VA 3N55A 1NIBA 1BXUA 1OOWA 2PCFA 1E67A 1ASQA 4DP9X 1BXVA 2FTAA 2MTAA 1AS6A 4DP6X 1E5ZA 3ZBMA 2PPDA 4A67A 2UX7A 2A3TA 3FSWA 2GI0A 2IH9A 2UXGA 3BVDB 3NJKA 3X1BA 3ABKB 1EZLA 1NWOA 2PPFA 3X1FA 1PZBA 2BW5A 4E9YA 3SBPA 4YSCA 1IUZA 4W9ZA 1SF5A 4KNSA 4AZUA 1WAEA 1NIAA 1OE3A 1PZCA 2UXVA 1GW0A 2DV6A 1BQ5A 2EIMB 3BQVA 1DYZA 1JZGA 2P80D 2XLLA 5AKRA 2DWTA 4GYBA 5IY5B 1BXAA 4GP5B 1AANA 3KW8A 2PPAA 3FYEB 2JKWA 2JXMA 3X1GA 1NZRA 1MDAA 1KDJA 4E9XA 4ZK8A 2Q5BA 1A3ZA 1L9PA 3FPYA 4JHUA 3D12B 4DPAX 1JXFA 3WI9A 1WA1X 1OCOB 5E9NA 2DYSB 3L45A 2WSDA 3IE9A 1CURA 2OCCB 1AZUA 2B08A 2FQGA 4YL4A 3EH4B 3TBCA 3FS9A 3T6ZA 1M9WA 2QPDB 2XXFA 1ASPA 3ZDWA 3PCYA 4KNTA 2HZHA 2IWKA 2BP8A 3DKHA 4N8UA 2DYRB 1FWXA 1TKWA 2XYBA 1A65A 3WKPA 4FA7B 4DP7X 3FQ1A 3FYIB 2FWLB 3HB3B 2R7EB 1JZFA 3NSDA 4KO5A 1SJMA 1RKRA 2WO2B 1AZBA 1NPNA 1XB3A 4Q89A 2VM4A 2TSBA 4Q8BA 1WS7A 4YSTA 5B7MA 2UXTA 3ZIYA 4A2FA 2IDTA 3FU7B 4PAZA 4HCFA 1ASOA 1ET8A 1KCBA 2E86A 4HHWA 3HEIB 2MRYA 1SFDA 5TK4A 1SHXA 2IDUA 1OF0A 4HHGA 4AX3A 5B7FA 2X87A 1BYOA 3EH5B 3FU8A 4BK5C 4F2FA 1FFTB 2AVFA 2AZAA 4FAAB 5ANHA 1T5KA 2I7OA 3IN0A 3NP3A 3IN2A 1SNRA 2QPEB 1ADWA 3GXUB 2BWIA 1FA4A 3NJNA 4M3HA 3FT0A 2P80A 3DTUB 7PAZA 4E9QA 1XB8A 4YSSA 2CBPA 3H56A 4YSDA 2VW7A 4HIPA 5FC9A 1ZPUA 1AS7A 3NJHA 2BZCA 1B3IA 2PPEA 4DP5X 3V9CA 1HFUA 2BP0B 4UAHA 3CDZA 4JHVA 1AIZA 2HRHA 1OE2A 4HCIA 2JFCA 2CUAA 4GP4B 5I6PA 3X1EA 3C75A 3OMNB 3NSCA 2NRDA 1E5YA 3CZUB 3QJTB 4K9JA 1MZYA 4JKNA 3TASA 4F2EA 2H47C 2HX7A 1PNDA 4YSUA 1ILSA 1GYCA 1NDTA 1ZDSA 3EH3B 4G7SB 1YLBB 1A4AA 1I53A 5I6LA 1NINA 2EIJB 3AW5A 4DPCX 1JZHA 8PAZA 2ZOOA 1JERA 2YAQA 1N70A 4AI7A 1SHWA 3SBRA 1VLXA 3ZX1A 4N4YB 3ASOB 3NJMA 2UX6A 4BWUA 1GS8A 4WKXA 3SQRA 1W6LA 5I6MA 3PPSA 5TK2A 3U25A 2BO0A 3OD3A 1NWPA 7PCYA 1MG3C 1MZZA 2VW6A 1E30A 1JXGA 5B7EA 1AG6A 3X2QB 2YAHA 1W8EA 1J9SA 4PCYA 2OV0A 3T6XA 1AR1B 3AG3B 4L0PB 2HXAA 3AZUA 3ABMB 3QQXA 1AZRA 1IBZA 1L9TA 1PF3A 1GY2A 5I6KA 3S8FB 3IBOA 1AZNA 5PCYA 4NAJA 3FU7A 4YSPA 3T9WA 4RH4A 5F7BA 4CSPA 2YXVA 1JZJA 3FPXA 1V54B 4YVNA 2XUWA 3AY2A 2ZONA 3OMAB 4A2HA 3DIVA 5I28A 2H3XC 3NT0A 3QJUB 4A2GA 1QLEB 2FT6A 3GDCA 1SF3A 3MX0B 1CYXA 1BYPA 4BDVB 3PAZA 3QJRB 4DP2X 1ETJA 4E9RA 1KV7A 3V9EA 4GP8B 1GS6X 2YXWA 4KNUA 5B1BB 4E9TA 1WA2X 4BWTA 2FNWA 5AZUA 4E9VA 4UF7C 1GR7A 3WNIA 2Q9OA 4G70B 4A66A 2PP7A 2GBAA 2Y1AA 2B3IA 3S3DB 1URIA 3CDZB 1HAWA 2AANA 3PAUA 1ET5A 4BXVA 2OJ1A 2VMJA 3NJJA 1PLAA 2N0MA 3OMIB 4HCGA 1PMYA 4BXSV 2CCWA 4GXFA 4A2DA 4ENZA 4DP8X 5I6NA 1WA0X 4E9SA 1SDDA 2PPCA 1JVLA 3WNJA 1QNIA 1GSKA 1M56B 3QJVB 2H5UA 1HAUA 6PAZA 3SBQA 1TEFA 3AG1B 2IH8A
chains in the Genus database with same CATH superfamily
1L9OA 3WS3B 4X50A 4G80B 2A6KB 3DHPA 4MB3A 1J5DA 5DVMA 1CUOA 4HDIB 2CO7B 2I25N 3CFBA 5DRWA 1OF2B 2J1WA 3MO1A 2E5EA 1X5ZA 4XBPA 4MZ2A 5C0RH 3N1PC 4CBPA 3U30C 2G75A 4JPVL 5IVXE 4U1GB 3H55A 3MRLA 5DK2A 2X4PA 4B9PA 2P5WB 4BIKA 4CC1A 5I30H 5MHSD 1CICC 1AACA 4AV0A 3VX1A 3F12B 4P5RA 3Q6GH 1QLRB 2WC7A 2WKOA 5FCUH 5BO0D 1O6TA 4UANA 4JCLA 1AAJA 1GTNA 3QUYA 1BFVH 1Q0YL 2WQ8A 3ATAA 1JPFB 2FQFA 4WWID 3O8XD 7CGTA 2X28A 1YQVH 4JPKH 4O00A 3U4AA 2FWSA 3ULSB 4FABH 1SJXA 2V7HB 4KOCA 3TH2T 4JQIA 4AEIL 4Z3IA 4KZDL 4ZMAT 3NA4A 5I1CL 2WBJA 1CD1A 2GAZB 4R90H 5F70A 1S5IL 4JFOA 5D7IB 3HC0A 3ZYZA 2F7IA 1KACB 1XGPA 2CCLA 3D69B 6FABH 4LMQI 4MQTB 4HP5A 4PJEE 2EABA 5TDOA 2XT1B 2DKMA 4ZPTA 2R56H 3VSVA 1BGXL 4G7RB 32C2B 4BZ2H 4N0RA 5I8OH 2IFGA 4RVBA 3WIHA 1C5DA 1TT6A 3VFOA 2VR5A 3D2UA 5H2BA 3C08L 1CQYA 1T7XA 2F1BA 1M1XA 4XZ4A 2HN7A 3GUTB 1WDAA 5F2FA 1IT9H 5J12B 2J5LC 3GI8L 1W8OA 5KOVC 4UYPA 1MCBA 1RZPA 4K7PY 1RH8A 2O30A 4R8WL 4KXZH 4MA3A 1GZHA 5SX4I 5ISZA 1A6ZB 3R4DA 1SVZA 1Y6MR 5E2UH 5DC0A 1DJYA 1TF4A 3P4MA 1Z5LA 1IFRA 4ZXBA 5F9WB 1LE5A 3ETBF 5ETUB 1YPZF 2C34A 1D5MB 2QQKL 4G83A 1XF4A 2AJZA 4GAYA 5FA4A 3T0DA 1IIIA 1SDDB 3IXAA 3MPCA 5I8EB 1IKOP 4YGAB 1ZT7A 2DQGL 4PRHE 2E59A 2Q76B 4MDRA 4P4KD 4QTHA 3ISYA 4Y5VA 4L05A 2VSKB 2HKAA 1WUZA 3ML8A 4PJCE 3TJEH 3VSQA 4B9KC 4PJGB 3KGRA 4FNRA 1N5AA 5F89A 5DI8B 3OC8A 2DI9A 2W0LA 4O2CA 5JLZA 2XA8L 4WWKD 2E4FA 1N68A 4KDTA 5IMOB 2C1OA 3N0AA 1KEGL 1A25A 4ZW8A 3DO7A 3V9FA 4FMFA 1Y0LA 5IQ7L 1CZ8H 3X14A 1UA3A 1DQTA 4YE4H 2W60A 4MJIE 3U4EB 1MRCH 2NY3C 4U6HA 4X2UA 1MAJA 4AYFA 1RURH 1AR2A 3IETA 4UOZA 1J0JA 1CFQA 2NQCA 1MFBH 3KCWA 2EZ0D 4JB9H 4R96B 3DUHA 3KPNA 5DHEA 2XXMB 1DP0A 1OGAA 1BZ8A 4IMKA 1HH9A 3GBML 1A4BA 3MV7B 4FQ1L 5EIVA 1HVXA 3EJCA 5E94A 3QG7H 3GRBA 2NCMA 3K2IA 4FKKA 1D7FA 5ESVB 2AERT 1IGFH 2ATKA 2F19L 1NCJA 2EC9U 3N9GL 1IEAB 4WO4D 3WG7B 5JHLA 1AZVA 4K7FB 1HS6A 1TVDA 4DGIL 2O6DA 1BV8A 3BIKA 5AEAA 1ZHKA 4FG6C 4MAUL 1JK8B 3KDMA 1IAIH 3K4ZA 5DZJA 4MJ2A 1TQBC 3MRFA 5LG1A 2GJ6A 5FYLL 4F9PA 3RWCB 3VRIA 4E0RA 2X1WL 1QO3B 2DMGA 4G8AC 4J3OF 5D4QA 2R0KL 2VN5A 4HH8A 4WQOA 2RCSL 1PIFA 1TQCC 5FO8B 1CTMA 2Z35A 2IF7A 4FL4B 4LSTL 2XJLA 3P30L 1W2KT 1BEXA 2VXQL 3EOBA 4FFYH 5LQBL 5E6IB 2YD3A 3LQZB 5GRUH 1YMHA 4ZPVA 3S48A 4X83A 2FT7A 1HL4A 1AHWA 4EI6A 1JI1A 3K0WA 4JZOA 4KDVA 43C9B 4KXDA 2ICWJ 4LCUB 1S9YA 4XMPH 2QDWA 1D5BA 4M62H 2NSXA 4YQXH 3SGEI 3EYFB 4S1QL 1E5CA 2DJ4A 2OKMA 1BVKA 5C9JB 4NFBA 3V0VB 2HLAA 3EJYC 1BXUA 1T83A 1P4IL 1UM4L 3GBLA 1IRAY 4NHUA 4P2QD 5DS8A 2LW3A 4LPYA 3UPAA 3ZRSA 5EEZA 2UZPA 1YN6A 2CLZA 2ESVD 5KAQG 2OSLA 4Z7OB 3FOLA 2IJ0C 1Q1JL 1A64A 4NEHB 1N59B 1MWAH 3PIQA 5ID0A 1R0AL 1VAHA 5FKPB 4AZUA 4HWBH 2P43B 3DX7A 5FYJD 3ZSTA 4DSYA 1CLZH 2C1PB 1MCSA 1XCWA 1ZT1B 3OWRA 1UOVA 2XZAL 5IY5B 4QKXB 2P80D 4JG1L 3S4SG 3TJPA 4QOKD 3P0YL 1OGSA 3OPZL 4NZFA 4WEBH 4AVJA 5L4FA 3F04A 2V2XA 4L8SB 3K6OA 2MPAH 2B4CC 2FX8L 2PF6A 4E5XG 5LGJA 2AHIA 2X3CA 4RZCB 2LU7A 1HXMA 3PWPA 3EGDA 2C3HA 4WV1A 3O2DA 1WA1X 5AUMA 1J8HB 4GFXA 3DETD 1OCWL 4UQEA 4K7PH 4OKDA 4JUSA 2VTFA 1J8HA 2B08A 2YD4A 3LKQB 1E8XA 4MD5B 3QULA 4OLEA 5EU6B 4ZDHB 3W39A 2XBZA 3IF1B 3QISA 1I1AA 3HAEH 2NNAB 3SE6A 4IKLA 2BNQD 2L7UA 3QQDB 5CU5A 5F97E 3OSVA 2BSEA 3BD3A 5GZOA 4MMXC 1YUHA 4HK3N 4N2BA 1R4XA 1A65A 3CXHJ 4ETQA 3HCVB 2VDKB 3O8XC 3HZKA 3KD4A 1X3DA 3Q8CA 4WO4C 3EOTH 1T22B 3QYNA 2BY0A 32C2A 1UHVA 2ED6A 4YXLL 2X4OA 5FUCE 1OSZA 5BQ7A 4DAGL 1FSKC 3DX3A 4B0MB 1FVDA 1TU2B 2R1WB 4HUUB 4QRUA 3GLZA 4GAJH 4N90D 4Y16A 5FKPA 1XGQA 1H19A 1OVZA 4X8JB 4GW1A 5G2NA 2F54A 4TVPL 5I8KH 1GMEA 2QLYA 2VN7A 3SE4A 1A7BA 2XZQH 3HZMB 3WKML 1Q0XL 3NQKA 2HRLA 1GYVA 3WXWL 2R4SL 3TNMB 3K6SB 5DHVA 2BSDA 2CLVA 1VFUA 5DQDL 1QSZA 1F1GA 1DQLL 2V7NB 2X87A 1BWWA 1KELH 4BSJA 5KVEL 5DWUH 5EIIB 3D3VB 5KVDL 3BUTA 5FWQA 1P7QA 2GG1A 3V4VA 2R51A 3LZNA 3C5JA 4NUJB 3GS7A 2R0LH 4U6YB 5CSZA 5FCSH 3PP3K 3N9GH 1SOXA 4TVPD 5I1DA 5E2VH 4HGWA 3ZHNA 4BGLA 3OMZA 4TLKA 4S1DC 2C26A 3CPLA 4U1MA 4PMEA 4H7VA 3QI9A 1LQBC 2C9QA 2YN5A 4AIXA 3VGAC 2B15A 1XH1A 4PVLA 3CLEH 4LSPH 4NENA 1T0MB 3Q48A 1MIEL 3REWB 2D3LA 4NQCE 4YPGB 1MPAL 2XTJE 4DK5A 5E8OB 1RUAH 1G7QA 3DTXB 3FT2B 2QQQA 1LDSA 1JHLH 4P4KC 1QVOB 2NY4C 5D2LA 1LEGB 3C75A 3A47A 3GXPA 4OCSL 2X6MA 3RNKA 3WNKA 1L6XA 1CG9B 5FGCE 4Q4IA 3LS5H 2R1WA 4L4TE 4YSUA 1ILSA 4H8UA 1W0VA 1ROCA 3PE9A 3HR6A 3ECQA 2ICEA 5DJ2A 3VFTB 3MRKB 3TS8A 2IG2H 5DJCB 4M5ZH 4YX2H 1EXHA 2NZ1A 1KG0A 1SQ2N 4YGVA 3P73A 4MNQD 2FO1A 1FZOB 1DSFL 2DQUL 2OMVA 2OR9H 3VD3A 5LWYL 2DMCA 4E0RB 4LGPB 2YBRA 4N2CA 3C6LD 3SZKC 3BKCH 3I84A 2R0ZH 3RJQB 3CQPA 3A6BL 3KPLB 5D7KE 1JXGA 1X7QB 3DBSA 3ECBB 3PWPB 4Q14A 3BGFC 1HHIA 2YQGA 4HD5A 1A7PL 2Y7NA 4LSSH 4UINH 3G6DH 3LH8A 5IB2A 4FKHA 4UV7H 4UTAL 4PWGA 3KAAA 3O3AB 4U05A 4F15C 4XPFL 2YEQA 43CAA 4NAJA 3D39A 4TUOA 1UM6L 3KCPB 3IMBA 4PB0H 2JCWA 2FL5B 4WCYL 3FPXA 2ESVA 3V5KB 4P2OB 1FYTA 4HUXB 5F9WC 2ZXEB 1TTUA 1ZS8B 4Y4HD 3W9DB 1ANUA 1QPXA 3AY2A 2R1YA 2K1MA 3L4TA 2ATAA 2MMXA 3HNVL 2VIRA 2AJYH 3QJRB 1QTSA 1RMFL 4FYSA 1D5XB 1QUNB 3D85B 4WHCA 1MLCA 4J3WA 1BQHB 2IANE 3BT0A 3SBWC 4Y4FC 1R3KA 3NH7H 2ZG3A 4K5MA 2ITDB 4FNUA 1I8MB 1LO2H 1FL6B 5TTRA 2OXHA 4YQXL 2BC4B 5MI0C 1OD7A 3VFWA 4LLMA 3WUWB 2B3IA 4Y1AB 2VXQH 3D7PA 4N6QA 5HDLA 5FYLE 1PX8A 1FRGH 2A73A 1KFAH 1ZVYA 4JO5A 1IU1A 5C0GA 2QTEA 2JLPA 5IMKB 2YPKA 4YXKL 1GGUA 4EUPA 4CSTA 2YRLA 3ECBA 3RI5K 5LAXA 4CADA 5JA8B 5E6UB 2V3FA 4JZNA 4CMHB 4PRHB 1GL4B 4XP4L 3ULVF 3UAJC 3ARQA 3EW3B 5FR3A 3LEYH 4K8RD 1TG8A 5JDJA 2VXTL 1OALA 2YGOA 2WXOA 4NN5C 2RBLA 4LIQH 4H0IA 4DEWA 3GMPB 3HKFA 3DA0A 5E99L 4H8WL 1R3IH 3PQYA 3KXFA 3I9IA 5IEKB 1TDQA 4FQCH 3JTBA 3HAEB 3QFDB 1MREH 1ZSDA 5G4OA 4NJ9H 5BZDB 4Y16D 1HSBB 4ZMYA 3RIAF 4OJAA 5IVNA 1XL4A 1U8HB 3ULUC 2CD0A 2RFXB 4ODHL 1QSFD 3UC0L 4AY0A 2XXGA 3PWLB 2IPTH 1TSRA 4XNQB 5JHAA 2EVIA 1BZDA 4FL4C 4QRRB 2R2EA 4FFVC 2E8ZA 2I9TB 1CFQB 1KSRA 4AIZA 1ETA1 2NTFB 4HX1B 3ECUA 3Q8AA 4KAQL 1KULA 4J2QA 1G1OA 5HHME 1J1PH 3GJEA 2MCG1 1LP9A 3JVGC 4N2LA 3MNVB 4PWHA 4CDGC 1G0YR 2MHAA 4LE8A 4P46B 5HYJB 3NCYP 4RFEB 4OUUB 5JW3L 4YXHH 3W38A 4Q52A 4NM4H 3D3VA 2DQGH 3LHPH 4L0YA 4NT6B 1M05A 3GSNA 5LBVA 3CMOH 5ECGA 5L2KD 2VWEE 4C56E 1UXSA 7FABL 5ETUA 1H6TA 2EICA 1Q1PA 1S78C 4YSEA 2WQAA 5DUPL 1CD9B 1JV2A 4WZ9A 3TO4A 2HJFB 5D4IA 3U7YL 1TQTA 4KX8A 2GK0A 3U82B 1EO5A 4EI5B 4NPKA 4GRMA 3SQBA 3HNTH 4H88L 3RUGA 4ELMB 4TUKH 1GVIA 3QSKB 3WBDA 4ONHA 3FMGH 1YECH 1E4JA 3DXAD 3IWUA 4XPBL 4ZG1A 1L3NA 4WU5A 5GXBB 5BW7A 4XXWC 1U6AH 4HZ1A 4NQQA 4ZMVA 3BWAB 2BHUA 4BSVA 4JKWA 3W11C 5E8EA 4MQ7B 2PLTA 4PGEB 1NCIA 4TRPH 4F58L 4DGYH 4IBUA 3BGAA 4U6XA 5KYWB 1GZQA 4OT1H 4QYOA 4BK8A 5CCGE 1UKSA 4IHBA 3SOBL 4OV5B 4XNMA 3SQOL 4AZ8A 1EFXA 3PXHA 1PX3A 4ZSOA 3WEOA 1SBBA 3NEOA 3PQYE 3V10A 1JIBA 3QCUL 5GRJL 2N7SA 4F7PB 5BXFA 4XI5D 5EA0H 1BLNA 1ETZA 2YD9A 1MVFA 1SJEA 4GY4A 2ESVE 3BVUA 3WNNA 2C9SA 3VXQB 1N59A 3PIQB 3IDJB 3JV5A 5D72L 2ADJA 4AIOA 5BS0B 1QHPA 1Z3GH 2K8QA 3KL0A 4XB3A 4LLAA 1YEGH 4JRFA 4WO4A 4Y9EA 5E1QA 5I5MA 3F12A 1LK2A 1F1AA 1IFHH 2Y7QA 2CPUA 2I24N 1JYWA 1B2WH 1E2VA 5K1VA 3MXWH 5AYQA 4I0PC 5F0LB 4IHOA 1F56A 3WHE0 3DC0A 4UNTA 3UBHA 4X0NA 4NNYA 3HFML 1Z7JA 4XZUA 4M6NH 1FI8C 4N24A 5DR5H 5AOLA 3AB0B 1J5OL 2DWSA 1IGYB 4OB5L 2J3SA 4KPHH 5L9DL 2HKHH 3MRQB 1NOFA 4XHQA 5FO2A 1OGAE 3QJSB 4N2MA 1NIDA 5D1ZI 2D3VA 2LE9A 5DTFB 4RNRA 2MQCA 3K4AA 3IFOB 3EYFA 2W65B 4MXWL 4WCYH 1U8CB 4OLZL 3NA9H 4ATWA 3VD4A 1YMMD 4FXKA 4KRPD 1IEBB 2FD6H 5KYXA 1RZJH 1W15A 2QR0B 1KPUB 1PY9A 2B77A 1KCRH 2LGNA 3NZ8A 1JPTL 5I0YA 4POZC 1KPUA 3BW9B 3FU0A 1ADQH 2B20A 4I0PB 5JW4N 3GMRB 5E56A 2CK0L 2G60H 4YDIH 2VLRE 1OF2A 1QYGL 2X89D 3MO1B 1JI2A 5D1QA 5A2BA 5GZNC 2QADC 2J2ZB 2VDQL 4H44C 4KO6A 5IVXF 3VXOB 4IBZA 4QNPF 5F0JB 3GXFA 1E4HA 4ODSL 3VXOA 1ZHKB 2A9AA 1NMAL 1TVBB 4Z77A 2E7MA 1BECA 1J1PL 3FCSB 5JIKA 3U2IA 2Z31B 3MBWB 1V8HA 1LP9F 3ME0A 1IC5L 4K5OA 4OFQA 5D1ZB 3RWCA 3SE3A 5F1SA 1ZA6B 3BPLC 3N42B 3ZW3A 2WLMA 4JFZH 4NWUH 1G6VK 3KDMB 2ZKMX 3MREB 3QFJB 4LHJB 5DYOB 3QXDA 5J8OA 5KS9A 2GI7A 3E6FB 3PRZA 4QHNB 5D6CA 4NXKA 3N0PB 5BMFH 1DJHA 1DO5A 1BVNT 4L8CB 2VQTA 1RJYB 3UFIA 1T3FB 2UXVA 1BEYH 1UADC 1RQ5A 3I85A 5C3TA 1NBVH 4BUGA 4O9HL 3HPLB 1XR8A 4HKJA 3MMEB 4HOWA 2Y5TB 2AMGA 1F5WA 3K4DA 3ZR6A 1UGNA 1DBBH 1F4WL 3CDGB 5ECJE 4BH8B 4NRYA 2DH2A 4RGOL 5CILL 4CUCA 3LX9A 4W93A 4M9OA 5GISH 4TTDC 1B9ZA 2AP2A 4KI5D 1GZPB 5HI4C 1JGLL 1HN1A 3RL2A 2Q5BA 4LFHD 1VACB 2K70A 3BH8B 3ILDA 4DPAX 5C6TL 5LUMA 4M56A 2E7CA 2O5ZL 1ETZB 4R5TA 4XNXH 1MFNA 4FFWC 1CURA 3WFHB 5DSCB 1CXKA 3HC3L 3U2SB 5E94B 1D6EA 3CFTA 4K8RL 1AP2B 2YOAA 3IK2A 4NQSA 4HJSA 4QRFA 3U6RB 4PW9A 3CBKB 3PGCB 1WFIA 4PN6A 3DKHA 3QWRA 4HXAH 5D5MB 3QEQE 5D7JA 3ZZQA 4ES9A 4EOWL 1SM3H 5F6HJ 4YHMH 5DD6B 4Y2OB 4ZFQA 3CN1A 5HGAA 2WWNA 4K0OA 2P47B 4L5FH 2FB4L 2ZYIA 4PP1D 4IW4C 1FVCB 3MCKA 4UQ2B 3MLXH 4DZ8B 3NK4A 4U1LA 1FN4B 4MDIA 1TNNA 2DQ6A 1YY9D 3BGMA 1N5AB 4HBCL 4N2HA 5FK9A 5ICZB 2MH4A 4XE0A 5AW8B 4NX0A 4NQDB 4YDLC 3DUSA 3IFPB 5CJBA 5H4YA 4XTRD 4HK0A 4TV3A 3FUJA 4WKZA 3IFPA 2A0LD 3ZJAA 4JDVA 1NGZA 1XXFC 2LABA 3REVB 5C08E 1BYOA 2ZOKB 4TLSA 3IJSB 3CDCA 4WWKC 3OR6A 2B7DT 4G6KL 5CUSL 5DUBA 4WFFD 5E2WH 3WE1A 2EC8A 3SZ6A 4P4KB 4PJHE 4GQQA 5ANHA 5TF1L 4BUQA 1UQSA 3MV01 1U3ZA 3KPRB 2DLGA 4JQIL 2R4SH 1HYRC 4NKMA 4PS4H 3GZOA 1DVFD 4J4PD 1A47A 3RI5F 1VZGA 3DTUB 1F90L 3QFGA 2WKGA 4H20L 5T1DH 3K72B 4D8OA 3H56A 1HHHB 2VR9A 3A6CL 3ALWA 1KTLA 1ORQB 2JK5A 1W80A 3TEYA 1FZMA 3SDDB 1PZUB 4RAVA 3FKUS 5DJ2B 2DWDA 3BPCA 4ZTPL 4JLRA 3FF8A 3MHZA 3ISRA 3V9CA 4P9HC 4PJ5D 4UAHA 1E3ZA 3GSOB 5F8QC 3ZE1B 4ABQA 3BZFB 4IOIA 5GZOC 4Z23A 3WSQH 4QO1A 1TJIL 3K46A 1BZ9A 2NUPA 3ZHLA 2RQ8A 3NESA 3I02A 3FT4B 4XC3L 5E8PA 3PS6A 2OZ4A 3D4ZA 4O51B 3G6AA 5DC9B 5JXEA 2APTA 4YDJA 3PQYD 3V0FA 1KIRA 1H8SA 3UTQA 2VDLL 1L7TL 2YFNA 4XPGL 2YPVH 1L7IL 3KPRD 4S0TD 2WZ5A 3WLBA 1RUPH 3U2JA 3ZUCA 2WBWB 3TPKA 3REWA 1ZLUK 3AW5A 2ARJQ 4YK4C 3NOIA 5JDSA 4WEEA 3CFCL 5I0VA 1JERA 3QBTB 3W0WE 1QRNE 4TVPH 1SHWA 4MB4A 1WK0A 3O9WA 4PBXA 4IBWA 3F7VB 3CVHH 3EBAA 1KLFA 1JJUA 4JG5A 2VDKL 4ODXA 4ILDA 5FEBA 5IG7A 1AI1H 4P5KB 1GS8A 1W6LA 4ORZC 2AEPH 3PPSA 3HCVA 1HINH 4B50A 4PCTA 4L5FE 3Q3GB 4Q56A 3EJZC 1QBAA 2COQA 1CPUA 3Q3GA 4GQZA 5D8JH 1HKLH 1OP3K 5C7XH 4GRLB 4KKAD 3MV7A 3T6XA 1AR1B 2EC9T 4L0PB 1O0VA 2FLRT 3O6FB 4J3OD 1FH5H 1IJ9A 1T7ZA 4WW2A 5FO7B 5FYKU 4DKFL 5E9DD 2E6PA 3MRMB 4PREA 4X5WB 3FFCE 1DVSA 1Q0EA 4WY7L 3HUJF 3L3HA 1CXEA 4K71B 2YJLA 4HPYL 3LEVH 2XFXB 3HRZA 2OJZH 2ZSVA 3FCSA 1S7XA 5IBLC 1TO4A 3ZTNH 2JTDA 4U6TA 5EOQH 4R0LB 3TVMD 3WTSA 4GSDL 2CDFA 1AGCB 4PSRA 1DE4A 2AV7B 2FCBA 4F80A 5E8PB 4EUPB 3POHA 3VI3A 1ZK9A 3I02B 2Z31C 2A4EA 1BEYL 1ETJA 1T7WA 5T1MA 5A2IH 3P4NB 4WJKB 4LB8A 2Z0BA 2VQUA 4TM9A 4MRCA 4L9LA 4M1GH 3TTYA 2EVGA 2IQAA 3PHOA 5FYJL 1ZJAA 3KE0A 3LRMA 5DO2D 1VGEH 3ARDB 3WJJA 3ULVE 1KTDB 1QKZH 3DV4B 3SDCC 3MTRA 5FGBC 3ESPA 5J89A 1KV3A 3K71A 4MAYC 1I1AB 3D25A 4XCNB 5J1AA 4NPYA 2WQWA 2Q20A 2MKWA 2IANA 4MTMA 3MRBB 5FYKH 2XWXA 1XD0A 3L5HA 1FYTB 4HUXA 2XFGB 1Q1JH 4MNQE 5JMRA 3OB0K 4NN6B 2YQ2A 5C09B 4OZIB 4HOZA 5ABDE 3H85A 2VIRB 4K7PL 1OT1A 2N0MA 3HJ0A 2AJ3B 2W95A 3OMIB 2OYKA 1QWNA 4JN1L 4XP6H 3JSSA 1KBPA 5IOPA 2NTSP 4Y7MA 1FZJB 2PNDA 1A1MB 4OV5A 5SX5K 1YEJH 3G9AB 3WSQL 1QUPA 5D7JD 4NUGH 3QYMA 1G1YA 3L1OL 5D5ME 2ADFL 4EE2A 2H8PB 1MRFL 1UWEL 4J8RB 1PNCA 2NXZC 2XWDA 2ZKYA 1OAZH 3ALXA 4PIBA 3V55A 1BAGA 2OMVB 5GSRB 3HI1A 3QUKB 4GKNA 4MFHA 4GEIA 5AG9A 3S37H 4QTIH 1SPDA 5DGRA 2DQJH 2GHWB 2Y3AA 4H20H 5T1DL 1D2OA 5JXEC 1LO3L 4EMZA 5CR1A 4B9CA 4HSQA 1KIUA 3FRUB 2YBRB 3SJVE 4UOQA 3ZSSA 1G7JB 3LEVL 5IW1B 1DLHA 1E2WA 3LEXB 4QAMB 1IL1B 4AC4A 4WI6A 4HJIA 2Q3XA 2KI6A 1RIHH 2APFA 4OTXH 3VFPB 3B2XA 2IPUG 1CLYH 2LTQC 3QUYD 3QUXC 1YYML 2HMIC 1TJIH 2D7OA 2VLJD 2VUYA 2LLNA 3OZLA 4N22A 1NCBL 2FECI 1JVKA 3J07A 1SYVA 4LCVA 1B4RA 1T2JA 4TUJB 3S3PA 3COOA 4Y4HB 1JUFB 1V5JA 3T8VA 5IJCC 1CGSL 4G59C 4ODVH 1RPUA 1A9BB 4LVOB 1XBDA 4PFEA 3OG6B 1T5XB 3B8YA 1EIBA 3NCBB 3G08A 3MLXL 2OTWA 1UT1A 3AUVA 1EJFA 4APXA 5JZ7D 2VDQB 5IVXA 5D72H 3STLA 4KPHL 2ORBH 5EU5B 5C7ZA 2QT6A 3TONA 3BRGC 4KVNL 1CN4A 2IDQA 4YZWA 3O81A 1BAWA 4EOWH 2D9QB 2EYTB 3NDZE 2GVYA 1EFXD 3P4OA 5J4MA 2YD2A 2LVCA 2UXFA 1FVEB 4LCIH 4W4OA 5C07E 1J87A 3RA7L 2QSTA 3FZUC 1H0DB 5AW2B 3AJ7A 3ELQA 4M7ZC 3QHTC 1LEIA 1ETB1 4PB9H 1E6JL 2BJMH 2FHCA 3V4PA 1U2HA 4YHYB 1IBYA 3OC5A 1U8IB 3BT2H 1RZJL 4ZMTA 3AACA 3O4LE 5GJTH 5BV7L 1Y1DA 2VLKA 4UILL 5AOMA 2CKBH 3KPPA 2VXUH 3MRIB 2CGRH 4G6FB 1YECL 1TLKA 3LEXA 5SWZB 5IJVA 4O02H 4LHUB 2GK2A 1UWFA 3LMJL 4EF3A 1AMYA 3KJ6L 3FTGB 1QHQA 5C8JA 1YY8A 5ID1A 5LNDA 1E6OH 1A6AA 1HXYB 3ROOA 2HRGA 2CKNA 1OK8A 4PS4L 5F88A 4PGDA 3VFMB 1CFBA 3T04D 2X6VA 4JRYD 1AQKL 2PYED 1CICB 1U3HD 2VSDA 2A7BA 3N43B 1L3WA 4AH2B 3K5SA 3PWPD 4FQJH 5A3IC 4LNRA 4KXZI 3EYQC 2Q1EA 4JFFD 2XWEA 5D7IA 1G0DA 4P0DA 1I7UA 2B1AL 2J57A 5F1IA 3IRCA 5E5MB 3IJHB 2ZOWA 2GCYA 2EVFA 4EJ1C 3CXFA 3VWKB 4FS0A 1S7RB 3DX8B 5FB8A 2LFGA 3L3IB 1PG7H 3MGOA 3FCBA 2SEBA 1GTFA 1WS8A 3TTSA 2W80C 4XHJD 5CIPA 4UMSA 3WN5B 4MQXD 3GHBH 5LAPA 2X6UA 3EO9H 2L04A 5C71A 4I48A 2BHFA 1HDMA 2SODB 3LJ3A 2TRHA 4XGZA 5JIIA 4JGUA 4KQ4L 3WUWA 3O11A 1R5IB 4K71C 5I8CA 2P8LB 3CFEB 1AP2A 1P9MC 5K1JA 5E2JA 5INCA 3VTTA 4OKVA 1A7RH 1DQDL 1CFNA 2D9CA 4U4BA 3I6SA 3G5ZA 3V6BR 4CSSA 3TBVA 4OR1A 5DK2B 4HH9A 3G5ZB 4QHPA 2HX8A 1MCWW 4ZX6A 2RAMA 5KUMA 1BSIA 2X6CA 3DPBB 4FQCL 1D9KD 4WDIA 1AH1A 4OM1L 5EEVA 1DANT 1Y07A 3I2CH 3QC6X 1RY7B 4RWYL 1DQJA 4LQFH 5EEYA 4JVUA 5JQHC 2YUWA 3JV6B 1FVCA 3QUGA 5LN4A 3W3BA 2UYLA 3HE6D 4R7NA 5FM8A 3FSAA 2YD7A 4BQ9A 1J11A 2VZ3A 1J18A 1OAUL 1KGUA 3ZYOA 3LH2H 3BUYA 1IV8A 2IPTL 3D50A 4QOKB 1RK1B 2B1AH 3PU7A 1EHKB 2BK8A 4NSKB 2AJSH 4MNHB 3FZUD 3ATDA 1AGEB 2A77L 4RZKA 2WQXA 5FW7A 4DUWA 4Y4KD 3T6VA 3U4BH 3C09C 4JHWL 2X9XA 1GZQB 2Q2EB 1FBIL 3WGUB 3HBPA 3BP7A 5CLWA 3IT8D 4DP6X 3DMMD 4R6UA 4S10A 3FSWA 3X1BA 2IH9A 1VACA 3BH8A 4YL9A 3W2DL 5HHNB 1CDJA 1PZBA 4XP5H 1MFEL 1RVFH 2OSLB 3K1KC 4YSCA 5J7CC 4JM4H 5GRZA 1URZA 4G80A 2OSXA 1P7QD 1PZCA 1OLZA 4N0CC 3GZPA 1MHPH 4BJLA 5L6YH 2WUCH 5D1QB 3VXRD 4B3VA 5CJXA 4Z77B 1JZ2A 4K3EH 3EG9B 4MJHA 3KPPB 3FYEB 4ZX3A 1U3HC 2B59B 3DO3A 3QNYA 3PDOB 5F7DA 1UFGA 5EPMA 1NC2A 4MCYB 2WGNB 3HOGA 3VD1A 5DVNA 5EPMB 3ZHKA 4JFYA 1QNZH 4Z7WB 2OMTB 5A2LH 1RXLA 2DW5A 1YEGL 3GRWH 1DBAH 1SHSA 4Y5VB 4HVBA 1VHPA 2WVSA 4P57B 5AKSA 1XQ4A 2ZUYA 3SOTA 3NA9L 1DEEB 5JW5B 2D7TH 3MAWA 1KZYA 4QMEA 4KMTL 3G5VB 5INDB 2Y7SA 1K4DA 4MMYA 3MLWL 4MXWH 3Q5OA 4Z76A 4YDVB 1IMHC 1VPOH 1E27B 2WZ6A 3UYOD 4GXVL 4F33B 1KB3A 2WAHA 5I9QC 3ZLQC 3IDMB 3QCUH 5GRJH 1QFUL 3WKPA 2IBZY 2AQ1A 4D0BB 2YXFA 5DURB 2J8HA 2QQLL 3KM2A 3MBED 4ZUTB 1VKXB 1L5GA 2APVA 3BEWB 3CHXA 5FA3B 1EHAA 2BIQA 5EN2A 2W5PA 1KXTA 2GUYA 3PHSA 3C5SA 3KPRA 5IFHH 5IWLC 3BQUD 1HHKA 5DMKB 1FL3B 2NY1B 1XB3A 3P1VA 3D52A 2VM4A 5L4JA 1JPST 4JM0A 5BUGA 3LHPL 1S6NA 5GJSL 5DEGA 3F7QA 5J9PB 3O11B 1RUQH 2HLFC 1YJDH 2Y1VA 4IIQC 3HE6C 3FT3A 3HEIB 4OFYD 4NAQA 2C3VA 5B7FA 2BIHA 2YD5A 5IW6B 2I27N 3RGHA 5C1MB 1NJ9B 4FQHB 4MMXB 5TE7H 4JUTA 1CR9H 2QZ5A 5FM5O 1UJ3A 1UTDA 1F00I 2PYEA 4WVRA 2G2NA 1HEZB 1E4KC 3LQMA 4M3HA 4WUUA 2DOCA 2WCPA 5EO9A 3WFCH 5C07B 3OZ9H 2YPLD 5KSBE 3DX9A 4LVNC 4YSSA 3MLZL 2QVFB 3DX9B 3CC1A 3HR5B 4HWZB 2ATPA 1HESA 2V9RA 1DL7H 4PJIE 5ICZA 2D2CC 2ATPB 2CA4A 3HLAB 3IF1A 1CD1B 1UC6A 3NFNA 3F5WB 2DWYA 2VDPB 3QPXL 3KHQA 2NPLX 2VDMB 1M7XA 3IFLL 2P8MB 3VYOA 4BGDA 3S3SA 3TL5A 4RDQF 4EBQH 3FO0H 3HRZC 4UT6H 5HYFA 3EADA 4L8DB 5HYQB 4LEEA 1G6RB 2CHXA 2IQ9H 3T0BA 5HYQA 1Z9OA 2ZAIA 4ZAKD 3LRSA 4HC1H 3QUXB 5IZ7A 4P59L 3S96B 3ZPDA 1EGJL 4NZTL 3RVWD 3WXVL 2QVMA 5IK3A 4GKZB 4TNGA 5GSVB 4EUPG 3QRGL 1OQOA 3MLTB 3WELA 4AYGA 1DN2A 4EI5C 4M3KB 2EDJA 1JCKA 2J8OA 2X2YA 2R0LL 3D30A 1MFUA 1UB5B 4Z7OE 3MOAL 5ADOL 2P5ED 3WAJA 3EFOB 4JFFE 4JBSA 4W9FC 3WO4C 1EUUA 1O7SA 4QXGH 5AD0A 1OD9A 2Q3ZA 1UJ3B 1OM3L 2CBQA 4ZODA 1OW0C 4LEBA 5DQDH 5B1CA 4NDMA 7PCYA 4KRLB 4CVWA 5LLIC 3X2QB 2X4QA 2W38A 1TYEB 3GJFB 4X5LA 5FUZH 4I3SH 2HXAA 5D71H 2KDYA 1DEEA 2DQJL 3EYUL 3KBFA 5DD0L 3OB0H 2ZXCA 3QARA 2GFBB 4LO9A 3VFRB 5ICYB 3AITA 1GY2A 4F27A 2LLLA 1KXHA 3F7PC 2X7LA 4X8CA 3LZQA 4YHYC 1K2DB 4FLQA 3IMTA 1MJ8H 1BVKB 4RMSA 2LOEA 4Z7IA 5IEKA 3IMWA 5DC2A 2B4CH 1I7RB 1NDMB 2BMKA 3G6DL 1A22B 3WDJA 5BZDA 4BK5A 5I0DA 1U58A 3PNWB 4N3TA 3TT3H 4R7DB 4OLWH 1TQWA 5T33H 1DN0B 5AYUL 2YXWA 2OI9B 4F9LA 3IPBA 1I7ZB 4LLUB 1RUML 5C0AD 4KK8C 1ZLVK 2IBBA 3CFMA 5AVXB 3VYPA 4LOUD 2VLLA 3FCTA 5L2KA 5L0QC 3CV5A 4EN3B 4AGOA 2NZ9D 4WHTB 4D2NA 1UD6A 2O5NA 5BOZG 4X6CB 2H32H 1A0QH 1URIA 1KY7A 5F7KC 3U1PA 1XGZA 4UYQA 3AQXA 1MAMH 1U8NA 4ZUWB 4ZJ9A 2XG5A 4DEUA 5AD0B 1MJ8L 2YWYA 1S9KC 4HCGA 5GHWH 4QXUH 4XVUC 3L81A 5CSZB 5FO9A 3K6NA 3R06B 4Y5YC 3VE0B 4B3EA 5JHDB 5DO8A 4K2UL 5I6NA 3ENEA 3GTNA 4KI5F 4BINA 2Z93A 4WSJA 2VE6B 3FULA 3GMMB 2H5UA 1EFQA 3QZWA 3MTXA 3LOWA 2ROXA 3BX7C 3NG5A 4OGXH 4YR6A 1A14H 1MH5A 1AKJD 3BAYA 4PLJC 4FP8L 3ASNB 5TF1H 4LPWA 3ARBC 1KGYE 1KJ2A 4XCNA 5J1AB 3X14B 4BH7B 4WY7H 2RR3A 2NX5B 1IVLA 3RZCA 4PJHF 1P5UB 2ZKHL 1EXGA 3V5KA 4BFFA 1A4JA 1CXHA 4OFIA 5BQ7B 4X6DB 2XTJC 2XWRA 3OGCA 4QR7A 3KHOA 3TVMB 3T6WA 4Z7VE 3AQDA 4G6AC 1YYLH 4I18B 1N2RA 4D7BA 2J6EH 2O5YL 4PG9A 5F9AC 1G9NC 3OX8B 5JNYB 4G42A 4M1CD 2ITFA 1E42A 2QKIB 2BNUA 2D0FA 1A7QH 4JW3A 2W0FA 3UAEA 2FHFA 2LHAA 3MC0A 4KV5F 3P73B 5L8KB 2BSRA 4PRDB 3U9PL 2M2DA 2NT1A 3ARWA 1MIEH 1JWSA 1NJ9A 4FQHA 4WLCA 1E4XL 2K6YA 5HGAB 1K8IA 2H1PL 3TX4A 2PP8A 1SEBB 3ARYA 1DUZB 3V6ZB 4CN6A 3KPSD 3TBVB 4X7DC 5E4IA 3VUAA 1PKQE 4YHIB 3LRGA 2Y7QB 3D2UD 1IM9A 4GRWE 4WO0A 1IAOB 1HHIB 4PI2A 4R7XA 3FB6A 5ILTL 3N04A 2CLRA 1E4WH 1A6AB 3BWUC 3DVGB 4P5MB 2YGVA 2JCCE 5CXPA 1RERA 3FUFA 1EMTH 3MV8B 3WFCL 1OEZW 5GRXG 2QQKH 3B9KB 4AMKL 3NN8A 1G7QB 1IIKA 1WV7T 2BIPA 2H6UA 1UKTA 5J6HA 3HS8A 4KWUA 5HPMB 4W6WB 4OCXH 3DMMA 2WIIA 2CPCA 4Y19D 4OD3H 3LIZA 4OF8A 3SN6N 4E9WA 1AE6L 5E5MA 3KEDA 4Q6KA 4XNQA 5E6YA 5HDRA 4AWJC 1ZIAA 2EECA 3CFNA 1XSIA 2V2WA 5E2WL 3J8F7 1DVYA 4JFDE 2XWTA 1NFKA 5J13C 4Y2DB 4UUJB 3HLKA 4PRBA 4QXGL 4PJXF 3KLHD 2Q3AA 3D2TA 3L1FA 3KWXA 2ENSA 2HTKC 3EYOB 5B22A 4HDIA 4NQEB 2VZUA 1RJLA 4G43A 4EEEA 4HUMB 3WS3A 3QH3A 1NBZB 2ILLA 1LM8V 2IPUK 3FU5A 3MRPA 2EAEA 3R0NA 5ACZB 5HYJA 2J55A 3M1OA 4L9DA 3D34A 4QT5A 2IO5A 2IGFL 4HCRA 1X5MA 2NY1C 3BP4B 3LS4H 1NC4A 1EDQA 3WKYA 1PLBA 2XOTA 4GG6A 1E65A 3QORA 3RPBA 4JAMB 1WFMA 5KSUA 3BRDA 1QFPA 2Q8BH 4U1HA 3MV8A 4JM2C 1WFTA 5J13B 3KYKH 2R23A 4JKPH 4PM1A 4PRNA 3GMOB 4ZO9A 4KK9D 3HAEA 4O2EA 5SWZD 1YDPB 2ARJA 3UZEA 3RILA 1N7MH 5I1KL 5I6XB 1AGEA 1M3JA 3QHFH 3BO8A 2B5IC 2GIYA 4IBLT 4XBEH 1D5XA 1OCCB 1QUNA 3V5DB 2YUZA 4G1EA 4KZDH 4JPIA 3U79A 3WYRA 3X1NA 4MS6A 1MHPL 4RWHA 4YHML 1NPUA 4PJIA 4PLKD 5E8DL 1WO2A 3NYKA 5JNYA 3D9AL 4N26A 3BP5A 4A7QA 3JWNE 1ZHNA 4HEPG 4UI2A 1ZRUA 5HGBA 2WHVA 2EEXA 1W91A 5MENA 5IB5A 2BNQE 3GMRA 4UV4H 4JRXD 2Z6FA 3KGSA 3VGFA 3M7OA 4KQ3H 5KVGL 1D6EB 4FZ8L 3VMPA 1IO4C 3IYLW 5HYSB 2VLKE 2DQHH 2PETA 2H1XA 3C08H 4JM2B 4MLSA 3KPQB 1JRHI 3QUMB 4QAWA 5CN3A 1CFNB 4KK8D 1XWVA 1XF5B 1DUZA 4HJUA 1QQDA 1MWAA 1TZ8A 1LK2B 3A23A 3LH2L 1H3VA 3G9VA 1II4E 2AQSA 4PRHA 5DJZA 3ZE1F 4LCWB 5FDYA 2R4RL 3W37A 1RU9L 2LAAA 3N06B 4CU8A 4HIJB 4OZGE 5JPMC 2NY7L 3NJXA 1E40A 3LXBA 4GBXB 4NFDA 4XWGL 4KVPA 4ZQTA 4GBXA 4OLWL 3EDEA 5I1AA 1IUZA 3FNKA 1XL6A 3RPIA 3LVEA 1IGYA 1MFAL 4L5FL 4L0ZA 4LLVA 6CGTA 1RP9A 4AT6B 1MIML 3VXUA 4BE6A 3HUJE 2ESVB 1OP5H 3W82A 2DWTA 1UACL 2VAJA 3LVTA 4K3HA 3OAUL 1ZWIB 1BZOA 4ISVA 5ELIA 1KCRL 2ZWYA 4U6XB 2JF1A 5KYWA 1G84A 2MJWA 1IGIH 1XSJA 3C6EA 5D2NB 4F3FB 1A7OL 2ZXAA 1H5BC 3QAQA 1NSNH 5GRUL 4TVPE 5IKCB 3OKDA 3ILEA 1CF1A 1BMWA 4BFOA 4LCYB 1KWGA 4YC2B 2VDOL 3FO2A 2MIZA 4JHUA 3T2PA 3GBNH 4BKLB 5A1AA 1UH2A 2E4TA 3DHJA 1BYNA 1HDMB 3IE9A 5DMJB 4CVZB 3O2DL 1E3XA 5HHMD 3O3UN 5E00B 2X10A 5I74B 1QRNB 4V1DD 1YEFH 4PJ9D 4Y4KB 3MV7E 3T6ZA 5HVGB 5IP4A 3F6JA 1QP1A 1RVFL 2AMUA 2XXFA 5FF6B 4G8GD 2E9GA 1XV8A 1J5OH 4MMZA 1ZGLM 3WHXA 3BYYA 4R4BA 3QEHA 3QHZL 5BOJA 2OMXB 4UQ9A 3MJ8B 4X9HA 4K7FA 4BZ2L 4J5VA 3FTWA 1GGTA 1XAKA 3QUHA 3QQ9C 2XRAH 4ALAL 4ZO7A 4EDXA 2VQ4A 4ZXBC 3TGXA 3ECVA 1DHKA 1MJUH 1BIHA 5C0JB 4JAMA 5HI5C 5BO1L 2VRKA 3E3QC 3FU7B 4WNQA 3EYSL 3QCTL 3JV0A 2IQ9L 4P5TA 2GBUA 5CS7A 4PLKC 3TJHC 1S9VA 4PJ6A 3TO2A 3SDXA 3HG1B 2PWEA 3CFJB 4OY9A 2DQFA 5HJ3A 5KW9L 4Z7NE 5TK4A 1SHXA 1X6LA 1NCCH 3HHMA 4F2FA 1TO5A 7TAAA 2AVFA 4RGMC 1GGYA 2P8MA 3QIUA 4LLDB 3BP7B 1UZ6E 2WXLA 4S1RH 1GGIL 4NKOB 4XCCH 2NYZA 4BZ1L 1VDGA 4Y4FA 3E8UH 2P80A 3VGEA 2O6EA 4XWOC 3T0EA 1DQDH 4XNZC 5FYJU 1N6QH 4U0RB 4ES8A 3K72A 2BRRH 2EYSA 2F53E 2A6DA 2PO6C 1K72A 3GLDA 1TJXA 5MEPB 3CC5B 4PJ5A 5GS1A 4BFBD 3U0TA 1KJ2H 4EKJA 4JHVA 5ESAA 1XH0A 4I1PA 3DLQR 3W2DH 2EO7A 3LIUA 1JV5B 1KCKA 4JZNB 1OLLA 3QZNA 1IAMA 1Q0YH 2CUAA 4GP4B 1FNGA 4L4TA 3ULAB 1M71A 2X4NA 3RWFB 3WIHH 4C55A 4EXKA 4WWOA 2NRDA 3JTTB 4Y1TA 3DPBA 1BZ9B 2JQZA 5DHDA 3VU1A 4HKZA 3QEGL 5KN5B 1MCEA 5GJSH 4FLSA 3MRGA 3BXNA 4PJAA 3H7BB 1AKJA 1H5BA 3QHZH 3QZMA 4PJAB 2DQEL 2DL9A 1XH3B 1SJHB 4WUUB 3VTAA 1IC7L 3DX6B 1FNLA 3HR5A 4HWZA 2EE3A 4XPHH 2RIKA 2I60L 4Y9FA 1O7VA 2X09A 3U9UA 1U92B 3SBRA 1PLGL 1AE6H 5CD5C 2PMZA 4KAQH 1L5GB 4A6YA 3IDGA 2AQRA 1T5WA 5CZKA 1CIDA 3DRTA 3BFQG 3HG2A 4GSRA 1MG3C 3KJ6H 4QTIL 4PJ8B 5BNXD 5DS8B 1SJVA 3GKZA 1N3NB 2DI7A 3RX9A 2NY0C 1W8EA 4HLZG 5TQ2H 4W6XB 3H2QA 3NMEA 2CK2A 4XBEL 2A9NL 3TO4B 2F8IA 5BJTA 4QRRD 1QG3A 4I18A 2EJ1A 2J1YA 3H3BC 2FSDA 4P49A 3SOBH 4PS7A 5DFAA 2BOCB 4PY8I 4HPOL 4I77H 2G9HB 2P44B 2ZX9A 3IKCB 2YXVA 1M71B 5IQOA 5I15H 2GTZA 3W9EA 5EBMB 5CJ8A 3WY1A 3MVSA 1QW8A 5D1ZA 1QLEB 2FZ3A 2QMKA 2ZICA 2HTKD 2XSKA 3FQTA 3MBXH 4J3SA 2LU3A 2PXYA 1E9QB 1BOGA 5C0JA 3U9PH 2L4OA 1A21A 1NCNA 1R3JA 2FX7H 2PTVA 3V9EA 2QGDA 1BJ1H 2OM5A 4LEXH 4UTAA 2VZVA 3ZKMD 5AZUA 4FZ8H 1G7PB 3D5OF 3EFFB 3ES6B 4H5SA 5DJDB 5K59F 1MREL 4P23C 4PLOB 1QAWA 3U4BL 3UTSA 4HT1H 3QG6A 2V0AA 4LL1A 5K9QI 2Y1AA 3IPFA 4QHKI 2DAVA 2F5AH 1HAWA 2BSED 4OLUL 5LDSA 5IG7B 3DDGA 5KYYA 3EGXA 1PVHA 4J28A 3F7RA 5AVVB 5BVJB 5JW3H 4ODUB 4GXFA 5F0PB 1QVOA 1YEHL 1FE8L 4R4ND 1KEMH 2OTWB 1VZIA 3D18B 1NA8A 3NPSC 2GSIB 1JVLA 4HF5H 2OK0H 2UWEB 4UQ3A 4J1UB 1HAUA 4IRZH 4P2CG 4GRLA 4H40A 4FLOA 1DVZA 5DJXA 3AG1B 5C7XL 1AO7E 3RVUD 1FO0A 3I6GA 1KN2L 4AK2A 5HHQB 2VDOH 4Q9RH 1FH5L 4KDWA 4G2AA 3VFTA 2GTZB 3DHUA 3Q44A 3SCMD 1FL6A 3QUZD 2JI3A 3KPMB 4AKQA 4WWKB 3RY6C 4Z9KB 3G5XB 5CMAB 1L4IA 1MNNA 4XP9H 2B59A 2IEPA 4LCWD 4MBRA 1H3PL 1VSCA 5MERA 1BOGB 4FNLL 5A7BA 1UACH 4UM9D 3EHBB 4H8VA 5JIQA 5I8KL 5I5IA 2ROYA 5IVOA 3AAZB 4JS7A 1U3HA 4OM0L 3OXRB 4MKMA 1LGVA 3BUPA 4XOEA 4PG2A 1E0OB 5G5DB 5DT1L 1J9QA 3IJEB 3GSQB 5C0AE 2NY0D 3MN8A 4N86A 3ARGA 3GSXB 1YYCA 5ICXB 1T0MA 1QKZL 5FOBB 2Z92B 3S4SB 4TQIA 4DN4H 4HWEL 1W72H 4HCRL 3GHPA 5TGBA 2EXYD 3IJSA 5I0ZA 1BVLB 1ET7A 3QNFA 4HS8H 1QATA 5E0FA 1MCWM 4M1GL 1N3NA 2PABA 1OARH 1ZLEA 2AFNA 2AJ3A 2DLTA 4U6VL 4GBXC 4RFOH 3BVNB 5FHBH 5EHFA 1N8ZA 2ZNWA 3K8LA 4HZLA 4GKZA 3RVXC 3BPCB 2WINB 4RIRA 1U8PA 1KTCA 1CE1L 2OQJA 2WM0A 3O4LA 1JTTA 4ZQKB 5KUKA 1CC3A 2FX8H 2V5YA 2OZNA 4NERA 2G5RA 3B34A 3VXTB 3MA9H 3RVTC 3GJFH 4BK4A 3GF8A 3IFNH 3BHBB 3K2UL 3NIFF 4IRSC 4EN2A 3L2MA 2F0CA 1QSED 3NEXA 2NY2B 2DEXX 5FOJA 1T4KB 1NCOA 4M5YH 3BXNB 2IWEA 4HCRH 3ARXA 2GHZA 1BMZA 5IUSA 5T1MB 2X4SA 2C9UA 5J5EA 1RZ7H 2V3DA 4HU2A 3ZHFA 4I3RH 5A6LA 2DLFH 2VXSH 3DOIA 1XH3A 4B6ZA 3QEQA 4U1LB 1XB6A 3CH1B 3DK2A 3CPUA 2VUKA 2EUVA 8CGTA 4G71B 3IXTA 4Q9CA 3BQUA 4FN0A 2EDEA 1PKQA 3TV3H 5BUPA 3VXSB 3NGBC 4JANB 4Z3EA 1YO4A 2F53D 4P2YA 1B0GB 4NO5A 3KPRE 3X3FH 3KWVA 2O93L 3OXSB 3QS2A 3QQ9D 4Z7UF 1U4FA 3UGEA 4P9HL 2W94A 2W88A 4PJCA 1ZHLB 5DUML 3T65B 2V7HA 4A7GA 3TCLB 1HK6A 1KYOK 2WMPA 1T5XA 4AENA 4H26A 1I1FB 3HVNA 5GRVL 3WTWA 1BJMA 1YYLL 3LZLA 3TJHD 3UDWA 2G4GA 4MGXA 2AI0L 4U2YA 3QJHA 4ANXA 3VRJB 1IGML 2XVLA 4JGNA 1RZ7L 3VXRA 1A9EA 3ROLB 5GS2D 3D0LB 4UB0L 5JTWA 4UUJA 4AQ1C 4KJPD 2XV2A 2VZOA 2NTFA 1FDLL 2O5ZH 3U7AA 1E8WA 3JTSB 4A2EA 3TF7C 3W5MA 2V33A 2OMZB 4G7VH 1IEHA 4B95C 5D1XC 3CVBA 1AG0A 3PDDA 1TSHA 1CFMA 3L9RA 4C8XA 4P46D 5I73C 1MQKH 3ZQXA 4AMKH 2P5WD 4AYID 2WLIB 3CH1A 3GMNA 1FV1B 5DD3H 1MPAH 1GGBH 5I9QB 3BKMH 2WXGA 5C09D 4XCFH 3FSVA 4DERA 4MCZB 1XF2B 4L4JA 3KXFE 3RKPA 1IM9B 1T1ZA 5F7DB 4V1DA 3VMOA 3RHWF 4XP9L 2G2RA 3EOYG 4IJTA 4DTGH 1TUPA 2BNRA 2WNGA 4G8GA 4JB9L 4OIAA 4XX1E 5DRXA 5C92A 5MEQB 5DVPA 1DQQB 3QQDA 3MOAH 5SWSB 5JHLH 5B1KA 1XGTA 5CLXA 3TCLA 4GUQA 4AJWA 3PLYA 5HBBA 1C8PA 4FNQA 2HTLC 5IW3A 3APMA 2CGZA 3EO0B 5FYLD 3LCYA 2XX1A 4MMYB 5DXWA 2ID5A 3C5XA 1JD7A 5E9AA 4J3OC 4JY6A 3H9SB 3C5ZB 3QDMD 1F3DJ 3L2LA 4U2ZA 4ZMOA 2B1HH 4L37B 3EDKA 2DI8A 2BM3A 3MLWH 1NMCC 1E5ZA 2HFEA 3QWOA 4JPWL 4WUKH 2GI0A 3LKOA 4KJWD 1MHEA 2VL4A 2PPFA 3THML 4XVTL 5H8DA 4UTBL 2V17L 3ZDXB 3SBPA 2UWEE 4Y1AA 2I9LA 1TITA 4U3SA 3WFBH 2BC4A 1HZKA 2VXSL 4TNFA 5HYSA 3MJWA 2EIMB 3A6CH 3DGCR 1JZGA 4XN5A 2IBGA 3S35X 1BXAA 1UEMA 2PR4L 4Y2NA 1TYRA 5K9KA 1P7KB 4ZYKB 4TULL 3V4PL 4ZFGH 1ADQA 4PJ8C 3BDYL 4U1NB 3VXUE 1Z5LB 4OZHF 2XIBA 3ZL1A 4OB5H 4U1NA 1PEWA 5EZJA 5GGVH 3GSVB 4GKLA 3O3EB 5I5RA 5F9DC 1JFQL 5KYUA 3DROA 4DQAA 4G6KH 1JHTA 5IHUL 3CAFA 3VFVB 4DGIH 3DV4A 3HRPA 3L95A 2X1QA 3EYVA 2UYLB 4R7NB 4OBRA 5DJYB 1FNEB 2PXYD 1H9DA 3MXWL 2A6JA 4YL4A 3Q9QA 2A83B 4KRNA 1DVFA 4HHAA 4L48A 4O2EB 3IAGC 1ASPA 5CWSB 3PCYA 5DD5L 4AT6A 3GXNA 4QXUL 4UU9A 1TKWA 3P02A 1EK3A 4LEXL 3GBMH 1RUKH 1TYJA 2N1KA 3BWAA 1HXKA 3N44B 4GI6A 1XGPB 3T09A 1JGDB 3EZJB 4M03A 3B2VH 2R83A 3ZDZB 1U3NA 4LVHB 5I1GL 1GYUA 4B5ZA 3WNLA 4WJG3 2JMRA 4EDWH 2EEFA 3UZVB 4Q89A 1UUSA 4ODSH 4NHUB 2EXYC 1JXJA 3BPOB 2VLRA 1L0QA 3OLEA 5IQ7H 3SKNB 1HYSC 4GPVA 1NCWL 3X3GH 5HSFA 5JR1L 3DYOA 4QRBA 3G5YA 5I76A 1A7NL 4YGVB 4ERSL 3DIFA 3WIIH 5IF0A 3ESOA 4LQFL 1FO0H 4Y19B 4FEIA 1CGYA 4MA7H 2XWBA 3D85D 3FFCA 1GYWA 3CSGA 4GW5A 4NBZB 4NKIH 4TRPL 4F58H 4AEHL 2PO6B 5CD3B 4X98B 4TQ8A 2P8LA 3CFEA 1FLTX 2CNZA 2FUQA 4L8BB 2FR4B 5EC1B 4NT6A 2VDML 3KM1A 3GEFA 4NIYE 3KPLA 3ZKNC 4YHPB 3NQIA 4PTTA 1AHMA 2QHRH 4WWNA 4OZGA 2NLJA 1X5AA 2LQRA 3IN2A 3HMXH 3IN0A 3QDJD 3P3RA 4G5AA 1XF2A 2FEEL 3RWJA 5JUEL 3JBG7 3SPVB 4I5BB 4N2NA 1SXAA 2IH1B 2X4RB 3F62A 3AM8C 7PAZA 1IBGL 5AVYB 5ID1B 1XB8A 4GINA 2JWYA 4M1DH 3QFJE 3SQBB 3VWJC 5D1QC 4GO8A 4F37F 1DANU 3KR3H 1NOAA 3BKYL 4N8CL 3SJVA 2XQ0A 1N5YL 4CAGA 2VISA 4AH2A 5JZ7C 4N6RA 4HKBA 5HD8C 2Z91A 1KIQA 1U8HA 4GAAA 4ELME 2LAGB 1IFGA 3Q2LA 1E5AA 1YNTB 4WU7A 4QRTB 5D1QE 5JOPE 3MOQA 4DIXA 4IM8A 5ISZD 3HZKB 1XR9A 5DMGC 3UGXA 5CCJA 2DPKA 3TASA 4Y2DA 4F2EA 2H47C 4XRCA 1F11B 4UM8A 3SGDH 3LYRA 4WV1C 1YPZE 3B2MA 1U8MA 2NW2B 3VFUB 1SOKA 1NINA 3CHRA 5HTSA 1TZGL 5CJXC 1ZVNA 3CUPA 4HJEA 1KTLB 1M7DA 1ORQA 3QH3B 3T6QC 4YIQB 2JCCF 2XZCL 2WLNA 4XN4A 2FLBT 4YE4L 2WYHA 3QCTH 4AQEA 3CX5K 3DX4A 3IKCA 1NKOA 1AQDB 5C9KA 1ORSA 1EVUA 3NFSL 1AJ7H 4PJ5E 3EFOA 5EA0L 4B27A 25C8L 1XHHA 4BZ1H 5JORB 3CN4A 4ANUA 4QHKJ 2VR7A 4TSAH 3RWEB 5EIIA 5HGGS 3IXAB 3MRGB 3QAZB 4R2GD 4AV4A 2YAHA 1EO8L 2OV0A 2AJZB 2NY5C 4F15B 3GTTA 1OAQH 3HHSB 4ADGA 5IHHA 1VJSA 1FZKB 4MD4A 1NAMB 3IAQA 3U36A 5A2AA 5EU4A 3PJSA 3DGDA 4JL2A 5GS0D 1LO5B 3QXUA 4UQ2A 5D93C 3B7YA 2ED8A 4OQ1A 4ZUVB 1DUYA 5JHDD 4NPJA 1JWUA 3BE1L 1NEPA 3HC4L 4GW4B 4ZO8A 4IGBC 4QOKA 4X7SL 5AW0B 4J3VA 5A6IA 5KANI 1A6TB 3GO1L 4DCQB 1LK3L 1R34A 1MFDL 1OP9A 2XUWA 3GBNL 5EIIG 1N0LA 1KB5B 1NBVL 2KZ1B 1SGKA 3F5WA 5AWNL 3S35H 4AM0B 4XMKH 5DJAA 3AM8A 4QRQA 1TFPA 4HWNA 3UO1L 3H0TA 4ODVL 3OKDB 4KQ3L 4OCWL 4PY8J 4LVNB 5GS0L 3P3SA 4U4IA 1JF5A 4L3EA 1GS6X 3JWOL 1BDYA 2BIMA 3T8XA 4E9TA 1Z3GL 1WA2X 2K6WA 3SGJA 4F8QA 1Q9WB 4APQC 4BFIA 1GR7A 5KG9A 4LQ1A 1JGIA 2V9QA 1UOWA 2MOQA 2WXJA 2OQJB 4ZQKA 3V0AC 1U2YA 3ZDYF 4YHLH 1BPVA 1KNOA 1BBDH 4G1MB 3RWHA 1E6OL 2ZT9C 3FF7A 1JE6A 3VRIB 4WI0B 1WICA 2DLIA 4L8SA 1PMYA 1SHMA 1WGOA 4FABL 1H15B 5SWQA 4JKPL 3R06A 2EDRA 4Z7NB 4YFDB 3CCHA 2JLLA 5EU4B 3BN9C 3BESR 1YUKB 3EGSB 4DKTA 3NRPA 1FZKA 1GSKA 1TMQA 35C8H 4W9HC 1QW9A 4RAHA 4ALAC 5G55A 3UTZB 3CN0A 1XCTA 2IQAB 2QPFA 1CBJA 3MA7B 2HVBA 4IJ3B 4JPWH 3QG6B 3BH9A 4HIIB 4FNSA 1RFDL 4ODWA 4ZPVB 3M1BA 3ZXAC 2ZZUT 2V2TA 4PG2C 4X9IA 1PIGA 4D0BA 1D9KB 3O9WB 4IBSA 1KJVA 1JNNL 4OD1L 2WXKA 3S34H 2J12B 1UZ6F 3CG8A 4C57C 4JY5H 3V79C 4NRYB 5AW3B 1KCWA 1FFOA 4AUJA 1KENH 4U6HB 2B1OA 4WI7A 1DQVA 3KPTA 2NY7H 2VL5A 1ONQA 2VW4A 4P2AA 4YXKH 2XN2A 2WLZA 2X41A 3UZQB 3N50A 5BVPL 2ICES 3GJFK 4LEOB 3II1A 2VM3A 5DRNB 2IOIA 3N44F 2HX9A 3FTSA 1F8TH 3KW7A 1A9EB 4GSXA 4D9RE 5EUKA 1UB5A 5HHQA 3E6HB 4R4BB 4XWOD 4N87A 4FOMA 4HIEB 2F8VA 2WQSA 4JO8A 4PBWD 2ZWNA 3IGAA 4KJWC 3UERA 4W4OC 5I1IH 4QGTA 1A4KA 3N6YA 3KYAA 1BVZA 4O02L 3WAKA 1JPSH 4M61B 3CCHB 4YEFA 4UQCA 2FBJL 4X4YB 1E8YA 3ZTNL 3OKKA 1PAZA 4POZD 5B39B 2BNRD 4HC1A 4B7LA 1IARB 2QDVA 3ABGA 5LAXB 2A0LC 1E9QA 1H8LA 3V2AR 1XIWC 3FTVA 3LKPB 4N0FA 2NDFA 3WLBB 3PUUA 3QCVH 3OAYH 3QIWA 3WMSA 2J25A 2G2PA 1F18A 2YUXA 4JANA 4NKDB 2PWDA 4M6OH 1JGUH 2C1OB 4OIIH 5HDQH 2ZX5A 3NCXA 1OTSC 4P23A 3UTOA 2XKNB 3PWNA 4QWWC 4C54A 4R3SB 2QMJA 3AROA 1K2DA 1XEDA 1ECYA 4ODXB 1T2QH 3UBXG 1F6LL 4E36A 2XYCA 3CFKA 4I2XA 4UV7L 2I85A 1YUHB 1SRDA 4LCWE 4QRPB 3HZYA 4UBDD 3QUXA 2BVOB 1IM3A 5AAWA 5C0BE 4FQIL 4HW6A 1RHFA 5C08B 4OGZA 1C1EH 5MEOA 4ODTL 4WI8A 2QKSA 1MFAH 1O9ZA 3VFGL 4M02A 1KFAL 2CSPA 2X88A 1CGSH 1ES0B 1USQA 1RUKL 1X4YA 1ZTXL 4X42A 4UZSA 3OQRA 5CR8A 5DJ6B 3GNML 5HDBE 2FNBA 5HHVL 4CC4A 3UAJD 2FDBP 2QKIA 1LILA 5DURD 5KVGE 2W07A 2GC7C 2R2HB 3KYNA 1EHLH 5HJGA 3CMOL 4DESA 5HHXH 3GI9H 4DAGH 3NIDE 2J71A 5D96B 2BIOA 3MNWA 5FYJE 2AQ3A 2V2XB 1U8QB 3BZFA 2NXZB 3KVPA 3TWCH 1JYXA 1SFHA 2AJUH 1ITBB 3IMUA 3BHBA 2PCPA 5DWPA 4HG4J 1Q94B 4WI2A 4BHUA 1N5YH 4U31A 5E70A 4AG4L 2FATH 1PYWB 1RPKA 4N25A 4U1GC 2P5WA 4EIGB 3QIBB 4LFHG 3MLPA 1LO3H 1CE1H 3L3GB 3L16A 4ZMXA 1J5HA 4NO0B 9PCYA 1HH6A 1J48A 4LHUA 1RSYA 1HH6B 4Y8DC 3EIFA 1EVTC 4OCXL 3W39B 4KX7A 1AIFA 2A74A 4ZW5A 3SO3B 1KT2B 1RK0B 1MH5B 1VCBC 3MOBL 2ZG1A 1R5WB 3NFNB 4HUWB 1VB9A 3VXRE 4RFNC 2ZCHL 4PRNB 3IDUA 5GGTA 3LD8C 1IM3B 4JREB 3AVEA 3EO1A 3HE7D 1S5HA 4QD2E 5AAPA 5EDXA 4QNPE 4NUGL 3QXAB 1HHKB 5DMKA 1R3IL 2OMNA 4QRSA 4LARH 4IGBD 2RHEA 1JXKA 5ENWB 5IIEA 4JFOB 2G3ZA 4HFUH 4OZFB 5DJ6A 1EZVY 5T1KD 3RVVD 1DLFL 5BRQA 1ES0A 3V7AG 5B21A 1M2OA 3STLB 3O45B 4AIZB 2PYFB 5FYKL 4N2DA 1T7VA 1B90A 1DQLH 2VN3A 5AYTA 3LV3A 4GRWF 1ZDQA 4XX5A 2PTTA 5B3SB 4QHUA 1K5NB 5DMGD 3SKUD 4UIKH 3SKOA 1VEPA 2UV3A 2FLMA 3IGAB 1FCGA 5L2JB 2A1WL 3GUFA 4XXCC 1KY6A 3OSKA 1OHZA 2D03H 4X9YA 3QO0A 4Y4FD 1RZ8B 2XU9A 4J6RL 1J10A 1M6OB 4PJ9B 4YSOA 5IB1A 5I1DB 2K9FB 3T3PB 1A3LH 3BD5A 5IMLA 5LO7A 1PG7X 4EZLA 4JO1H 5A2JH 1VFOA 4CBZA 3B7SA 2A3TA 3Q5YA 2ZX7A 3OHMB 4NZRL 4MCZA 2WXMA 4Y0GA 3EJSA 2UVEA 5F44A 2CHZA 1QACA 4PJBA 4LKCA 3WN6A 4URTB 3HS0A 4N3UA 4HETA 1CLYL 4OFDA 1SF5A 2H7WA 1KEML 1NEZB 5DRZB 4BKTC 5EF3A 4HEME 4G6MH 1OANA 2R9HD 2YN3A 3LKSA 4U0RC 3EGXB 1EHXA 3B1UA 5EBWB 4OM0H 1NOLA 3T8MA 4HFUL 4OGXL 2R1YB 5EU7E 5H35B 4DK6A 1OSZB 3ZTJG 4X6CE 2J7LA 4WFHD 3RPKA 1ZLSH 4KKRA 3SDAC 1G9NL 5C09E 1D2PA 2ADFH 1F6AB 2WD0A 1UB6A 1T1YA 3CVHL 3SSGA 5C0IA 1VRSA 2DWEA 1SN0A 2ADIB 3SB3A 3BKJL 4L4TD 5K9OA 1IEBA 5KYXB 4FE9A 3T1FA 4C59B 3V4VL 5F9JA 3NIFE 4LCCB 3ZUNC 1B0RB 3EF7A 3EDFA 2J6EA 1JNJA 4HWBL 2Q6WA 2GBVA 4OQTA 4PD4J 4DKEL 2Q6WB 4DH2A 5CFAA 2MNWA 1R3HB 1TZIB 1DJWA 2AXGB 1QQDB 1WZLA 2MOGA 2HB0A 5I73B 3L3GA 4KKZA 2VDQH 4L3CB 1KPRB 3CQFA 3VU2A 1PD6A 5LN8A 1OM3H 1WFOA 3TWCL 4PWEA 1ZE3H 1UD5A 3HS0C 2OYMA 4ZNEE 2NQ3A 3MJ7A 1C7SA 4XO5A 2VDLB 5D7LB 3TYFA 2A4ZA 3BH4A 2R23B 4KRPC 1WWCA 1ZS2A 1GGBL 4UT7H 1RK1A 3AY4C 5C0BB 1OF0A 4OZIA 1A6TA 2N4IA 2BZDA 3MKKA 4AX3A 4H2CA 5JPMA 1NQBA 1LHZA 2FX7L 3H9HA 2R27A 3LDBB 4N9OB 3D3VD 4LPTA 1OTSD 2I60H 4I2XE 4WFHE 2GCYB 3GXUB 4WW2B 1EFXB 2BWIA 2YPLA 4M1CC 4WEBL 5EUOA 1KGIA 3T1FB 4LAJH 2SEBB 3Q05A 5F7NC 1HKLL 3BSGA 1UA7A 1RJLB 1MJ7L 2DLFL 5I8OL 3Q01A 5C0FB 5J9PA 2H3NB 5C0DB 4M7KL 4K2UH 1TNMA 2Y07L 3WUWG 3ZE0B 2AV7A 2GJ6D 2WWKO 3Q8EA 2IPKB 4RMBA 5DVLA 3VTMA 4UIMB 5EMYA 2X4PB 1WBXB 2DIEA 5BMFL 5F72S 5KVMC 4H25B 1RZKC 1BG1A 3MA9L 1P9MA 1E5YA 3MRNA 1GSMA 2DMKA 3RL1A 3SD2A 3L1EA 4AEIH 4J39A 3QUYB 5E1IA 1UYWL 4RCAA 5F8RC 3FRPB 5FFLA 4P2RD 1A4AA 4LRIA 4MD4B 1JN6A 3EUUA 4TN9A 2X4RA 4HU8A 5HI4D 2IC2A 4HV8A 4YFLF 5JW5A 4GMSH 3TBYA 2V5TA 3BVTA 4ELKB 3VGGA 5IQMA 1SDAB 2ZWLT 3MV9D 4OZFG 3CHSA 4YBLB 4BELD 2IAMC 3FH5A 1RHHB 2DKUA 4H26B 2DQEH 4LSTH 1B9KA 4FQXA 1C8QA 3LRLA 3SQRA 3P3YA 2HTLD 4HF5L 2OK0L 1DR9A 3QJHB 4IK7A 2VW6A 4AYFB 4HUNB 2R2EB 1BD2D 5FDWA 1LP9B 3ABMB 4ZMZA 3QO1A 4KMLB 4NKMB 3MRRA 4TLUA 3T0XA 2JELH 3W11D 1E5UI 1KIPB 2ZPKH 4RGOH 5CILH 4E41A 3ZYIA 4NYLB 5FV1L 1EQWA 1C7TA 3IBOA 2L3BA 5PCYA 3BZ4B 4GW1B 4Z5RB 3GSNB 3T9WA 4FQ1H 4CMMA 2PO6A 35C8L 5CD3A 1WBZA 1WBXA 5E4OA 3CZJA 1QFWH 1BGXH 5EBLA 3ZDYE 5DQJB 3VSTA 4RRPM 4XCCL 1T4WA 2APXA 2BDNL 1MXDA 3WY2A 2HH0H 1XF4B 3US0A 3O2VH 1NC2B 5ITBL 2E7LC 2H0JA 3PAZA 4MWFB 3DGGA 3WHE1 1S5IH 4XPTH 5DC4B 3V6FB 3FK3A 1A3RH 5K39A 4JM2D 4L1HA 2I26N 1OP4A 4KNUA 2J1ZA 3M45A 1R3JB 3ATBA 4LP8A 4Z18A 2XIDA 1EV2E 2FNWA 4JDZB 5L6YL 4Y4KC 3UH8A 3FTXA 1UM4H 1XMWA 3ASWA 2ITEA 3O4OC 4MNGA 2Y6TE 4U1SA 4NN5B 3N42F 5KVEE 3LKQA 4MD5A 3WKNA 4A66A 2FBJH 1HIML 3JWNC 5DK0B 4JM4L 5F3HA 4AYBA 1KGJA 2VJXA 3QW9A 5GGUB 4U1JA 2ODHA 4UZUA 3PAUA 4HOXA 2Y2TA 3V0VA 1JGVH 3KPSE 4XODA 4BXSV 1BX2B 3O4LD 1U21A 5TDOB 2AV1B 1S8DB 2ICWA 2BSSA 2F54D 2AK4B 4L3EB 5AWNH 5C0IB 3S35L 3OKNA 5J57B 5L8JB 5EH1A 4RMTA 3A67L 2YK1H 3ZQ9A 4QXWA 1M56B 3RL2B 4PIRF 1BCIA 1NCCL 4BSWB 4G8IB 1I8AA 5I30L 5DSCA 1KCVL 4PWIA 4XGZB 1MI5E 1IB5A 4JFDA 5ADPL 4HUVA 4RIRB 1YEHH 5AZEL 3MRHB 4EN3A 2L7QA 5K9KB 4GG6F 4YSRA 1U93B 4URKA 2C3VB 1X9UA 3MRHA 1PDKA 4FTVA 3H54A 4Z7WF 2APBA 2XVBA 5D5MA 1L0XA 2A4CA 3TXAA 1JK8A 3DX1A 5L88L 2R8SH 3JWOH 2ZIDA 1G7IB 3PAVA 2BVPA 3DPDA 3V0IA 4JRWA 4D0DB 1QLRA 3ZKQD 1T20A 1MCPH 1NCDH 3L5JA 3NSYA 4O4YH 1OB0A 1X5YA 4ORGA 2E9WA 2J88L 4ZMWA 1OTTD 3EBHA 3NGBB 1Q9LA 4BFNA 3CZGA 4NNPH 2R69H 1W72B 4CKVX 2E7BA 2PTUA 1MFBL 1JHKL 5IGXL 1WEJL 3NIFB 4KKAC 5TQ2L 3GO1H 5H37G 3GWJA 1RCYA 2X2UA 5CCKH 1M7UA 4F33A 5HYSG 3GSWA 3NCCB 4AE0A 1KJVB 4JX0A 3IDYB 3UYRL 1JPEA 2HLAB 4FNTA 5IFJA 3E8UL 4AJ0A 3L3DB 1IQDA 4EI5D 3MGOB 3ZOAA 3RNQA 3V52H 2C9XA 1BAFH 2FIKA 1ZLUH 4NXSA 1A6WH 2DIBA 5ES4B 4FJZA 4XRCB 4LL9A 2F54E 3NZHL 4YDIL 3HBGA 4Y2LA 1NAML 4OZFA 3CFIC 1CCZA 1HWWA 3RWIA 3TIEB 4A7GF 2IMNA 3HE6B 3FOMA 4X0KB 5HDBF 2XG4A 1J1XH 2XI9A 4OCWH 1F58H 4TTDD 4KO7A 1AHWC 1QPPA 4X6DF 2DQCH 1C16B 4BEIA 2RACA 2Z31A 3EO9L 4NB7A 2P9RA 3RWHB 4JLRB 3TH4T 3HPJB 5K59E 2X9WA 1SLXA 3L5IA 5CZXC 4NQED 1TQBB 2Y06H 4YAQA 4ENED 2YOCA 3ZL2A 3RGBA 1XIWB 2X3BA 3ULVC 5T1KA 4JE0A 5EF2A 1EEUA 4LKXA 1F45A 3BE1H 2IH1A 3HC4H 4F8LA 3A6OA 1P1ZB 1I4FB 15C8H 4NNYB 4M5ZL 2X3AA 5AB9A 3C5JB 3B3IA 2VLMD 3ZQWA 2GIMA 2ZF8A 4ZTEA 3QDHA 3TN0A 4ELKA 3V0GA 4MA7L 1MRDH 1SYSA 3TFKC 3ULUL 3VI3F 3EFFA 3IPEA 4H5SB 3D8MA 5BZWB 1ZJBA 4S1RL 1ZV2A 2FEDD 3O9WD 4WENB 5LNEA 4IMLA 1CQKA 4MD0B 3WTTA 4WKZB 2PUQT 2CG9X 1BD2B 3DRTB 3SPIA 2E27H 1CD0A 3LIZL 4ZOCA 4Z8FH 1S3RA 4BFKA 5J6HB 3PFUA 1ACCA 3WJLA 3EJJX 1I1CA 2X70B 1S7WA 2AJSL 2EDOA 2I5YH 4OF6A 4X5PA 5I23A 2FJFA 3LZFL 4KJQC 4BRVA 3QORD 2CKBL 3RG1C 2X4OB 1BIIA 1ZLDA 2PO6D 4YVUA 5T3XL 2CGRL 3CJJA 3H6AA 3MACH 2BOCA 4M7KH 1J9RA 3Q6GL 4TNVK 3WTXA 2FYYA 2AK1H 4E5XA 1F0LA 1GGIH 3TOPA 3ESVF 1N18A 1IC0A 3VD0A 1J5CA 2W07B 2P48B 4OT1L 2M83A 3LPGA 4FYQA 5AQ0A 3VXTA 3W56A 2X4TB 1JFQH 3B9AA 1PY0A 2OL3A 3QIBC 2ITCB 3SDXF 3VNZA 2APWA 4ELMF 3DJSA 3BVVA 5GS3A 1TQSA 3PWJB 5HHOB 3EGDB 2CUIA 2WK2A 1CMOA 5IW1A 3FN3A 4OZIF 1IAKB 4RZCA 1A1OA 3O6LH 4KJYA 4ZFOL 1XAUA 3NACH 1VEOA 4ZDHA 3BQUB 1BQUA 1JV2B 5E0QA 2OL3H 2FAUA 3Q0HA 2BVYA 4JJ5B 3HZVB 4IMLB 4MD0A 2CJ3A 5KVFH 1TPXC 2FO8A 4GAJL 5BZWA 1G4MA 2JKIS 2R2BB 3SYPA 5TGBB 2WXRA 4J3XA 4G6AD 2ARWA 4CSZA 1YYMH 1YEJL 2VKXA 4XXWA 2Y1YA 2WVTA 4O02A 3S36X 3TA3D 1HSAA 2DYPA 1E43A 3U48A 4B5EA 1T0NB 2P49B 4AXWA 1WIPA 2YGPA 1PY4A 5ID0B 4I1NB 4E9YA 1D7BA 4RAUB 5ABAA 4ICXA 3SCMB 3V4PH 2RQEA 1LMKA 4S0HA 4G8FB 2F15A 2NSQA 5C70A 2VZSA 3TESA