1OV8A

Auracyanin b structure in space group, p65
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auracyanin B
publication title Auracyanin B structure in space group P6(5).
pubmed doi rcsb
molecule tags Electron transport
total genus 37
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ov8A00
3OMAB 2Y69B 2QT6A 1KDIA 3FSWA 3H4FA 2N0MA 2FQGA 3NSCA 1OCCB 2FQEA 2W8CA 8PAZA 3T6WA 1JVLA 1V10A 4GY4A 4DP2X 1JXFA 4JHVA 2GBAA 2BP0A 3WNIA 9PCYA 1B3IA 2BWDA 3OD3A 4F7KA 3FPXA 4AI7A 3ZX1A 2AZAA 1SHXA 2FWLB 5B1KA 4AKPA 3EF4A 1W6WA 1NIDA 4KO9A 4UANA 3AG1B 3IE9A 3PAVA 1NPJA 4WKXA 3WNJA 1KBVA 2GSMB 3IN0A 2DYRB 3T6VA 4N8UA 2BO0A 1KBWA 3NJFA 5B1JA 4AKQA 4KNUA 4DPCX 2PPAA 2MRYA 2I85A 1L9OA 1ASPA 3UGEA 3H4HA 3S3DB 1NTDA 1WA0X 2EILB 2CAKA 3AZUA 2WSDA 1PMYA 1WA2X 1XMEB 2ZXWB 2HXAA 3SBRA 2PPCA 1TU2A 3ZIYA 1GY1A 3IEAA 2GI0A 1A65A 4FAAB 5B7FA 4YSAA 5D4JA 3PAUA 1WS7A 5D4IA 4DP4X 3CDZB 3EH3B 4BWUA 1PZAA 2YAPA 4ENZA 3WKPA 4E9SA 4HCIA 4HZ1A 3SBPA 3CG8A 1ZV2A 3JTBA 3AG2B 2GB2A 1QNIA 2YAMA 3V9EA 5PAZA 2QPEB 1OCOB 1OE2A 1AZUA 1IC0A 2PP9A 3CVCA 2TSAA 2YQBA 3N55A 2PCFA 5AKRA 2ZWNA 1OE3A 1FWXA 4HCFA 2Q5BA 4DPAX 2UXFA 1NIFA 1J5DA 2XLLA 1GSKA 1TKWA 1UATA 4A2GA 3UACA 4A2EA 1NIAA 4BXSV 4HALA 5F7AA 5I28A 4KO5A 2QDVA 2LLNA 2I7OA 3H56A 2BZ7A 1ILSA 1PY0A 3FU9A 4G71B 2FT7A 5AZUA 2OCCB 2IDQA 1JZFA 4UF7C 1EHKB 2XV3A 5PCYA 1ZIBA 4A2FA 2BWIA 2AVFA 1I53A 5AFAA 1AIZA 1NDTA 1M57B 2EIMB 3FU8A 4DP9X 2J56A 4YVUA 2YARA 3FS9A 4HCGA 2IDUA 1E65A 4UAHA 2P80D 3X1BA 1JZHA 1BXAA 2WO2B 3IN2A 4M4RB 4QKTA 2DYSB 1L9QA 3QJTB 2YAQA 4MFHA 3L45A 3DKHA 3GDCA 4E9RA 4G7QB 3PAZA 2YAOA 1NICA 1W6LA 1X9UA 3AG3B 1PNDA 5I6OA 1PAZA 4AZUA 3TBBA 1TEFA 4A66A 3IBOA 2XX1A 4E9VA 2UX7A 2UX6A 2JXMA 2HLEB 1XB3A 5I5IA 2I7SA 3DIVA 4QLWA 3FQ1A 2J57A 5B1JC 1SDDB 4CSPA 1A8ZA 2BW5A 5FC9A 4HIPA 2VW6A 3T71A 3PCYA 1KV7A 1ADWA 1CYXA 1NIBA 1JZJA 2WO3B 1SFHA 4YSOA 1MG2C 1CURA 4M3HA 6PCYA 1V54B 1RZQA 3GXUB 3QPKA 4E9YA 4E9WA 3EHBB 3MBWB 1NINA 1IBYA 4YSUA 2HRHA 3FSVA 5B1BB 2YAEA 4BK5C 5EHFA 1HAWA 3NJGA 3T9WA 3D12B 3AW5A 4TXVB 1OOWA 3TU6A 2CUAA 3UABA 3KW8A 1MZYA 1E5ZA 2HZHA 2VM4A 3FPYA 1NZRA 2BP8B 1IUZA 2J55A 1L9RA 2FQDA 3UADA 3FU7B 3UAAA 1SJMA 4AKOA 1AZBA 2XVBA 4KOCA 2CCWA 5ANHA 4GP4B 3PLYA 1WA1X 2PPFA 5IY5B 1ID2A 1PLBA 1PLAA 2OJ1A 1JXDA 2X87A 2XUWA 2R7EB 3CDZA 5I6NA 2VSKB 2QDWA 1JZIA 3WKQA 3MX0B 1KYAA 3QJSB 2X88A 3NJHA 3BVDB 2IH9A 3FT0A 3NJNA 3HB3B 2Q9OA 3ABLB 1XB8A 4BWTA 4Q8BA 1DZ0A 2PP8A 3WI9A 4A67A 1SFDA 2DWSA 2H5UA 2IAAC 2XXGA 1AANA 2BZCA 4G7RB 1HAUA 1R1CA 2EINB 2YAHA 3NP4A 1GS7A 3OMNB 3CVDA 2PPDA 3S8GB 6PAZA 5I6LA 1A4BA 1E5YA 3WG7B 2MTAA 1ZIAA 3EH4B 4WTQA 2GHZA 1A3ZA 1KCWA 1KGYE 1GR7A 4YSSA 1AS8A 3NJJA 5I6PA 1BQKA 4DP7X 3V9CA 1M56B 4YSQA 1CUOA 2HX8A 3ABKB 4GYBA 2GC4C 2AANA 1GS6X 2VM3A 1PZBA 2UXVA 3ASNB 1GW0A 4DP5X 1BQ5A 1PLCA 2W88A 1ASQA 1PCSA 1PNCA 2E86A 2IDFA 1F56A 4RH4A 3X2QB 1MZZA 1JZGA 4W9ZA 1W8EA 1MDAA 1A4AA 2VN3A 1J9RA 1ET8A 1L9SA 1YLBB 1BYPA 1SDDA 1T5KA 3TA4D 4DP8X 3PPSA 1PZCA 2PPEA 2Y1AA 7PAZA 2P80A 3ZDWA 1BXVA 2YAFA 2AFNA 1VLXA 4BDVB 5I6KA 1URIA 4JHUA 1OE1A 2CALA 2IWFA 1A4CA 1FFTB 2J5WA 1ZPUA 2XWZA 1QHQA 4G7SB 1E67A 4ZK8A 2JKWA 5D4HA 1XB6A 2VW7A 4DPBX 1BYOA 4GP8B 1AQ8A 3S8FB 1JZEA 3SBQA 1OCZB 4N4YB 3FYIB 4YSPA 2TSBA 5I26A 4FA7B 1IKOP 2IDTA 2XV2A 4A2DA 4E9TA 3X1FA 1JXGA 1OF0A 1IBZA 2EIKB 2HX7A 1M9WA 2FT6A 3FSAA 3KW7A 2XV0A 1NWPA 2GC7C 3NJMA 1WS8A 4A68A 1TEGA 1FA4A 4YSTA 4HAKA 1BEXA 1NPNA 3X1EA 3FSZA 1PF3A 1SF5A 2EIJB 2FQFA 1OV8A 3NSFA 1GYCA 1GS8A 2UXGA 3QJQB 2PP7A 3NSDA 4PAZA 2BP0B 2BP8A 4K9JA 4E9XA 4GXFA 2H3XC 5LDUA 4KO7A 4X4KA 2DV6A 3NJKA 4CSZA 3FU7A 3QJRB 7PCYA 5B7EA 3FYEB 3N2JA 4NAJA 3ZBMA 2IWEA 4G72B 1SNRA 4P5SA 1X9RA 2PLTA 4PCYA 2GIMA 3G5WA 3NSYA 4KO6A 3ABGA 1SHWA 1AZCA 2R7EA 5F7BA 3ASOB 1J9SA 1BQRA 2IDSA 3CZUB 4BWWA 3S3BB 2A3TA 1AG6A 1MG3C 3EH5B 4P5RA 3SQRA 2DY2A 1BXUA 1L9PA 4F2FA 3NJIA 1ZDQA 5I5MA 3NYKA 1J9QA 2RACA 4KNTA 4DP0X 3CVBA 4GP5B 2UXTA 3OQRA 2CJ3A 2FTAA 3UAEA 1ILUA 1JVOA 2XYBA 2YXVA 5B1AB 4L0PB 5E9NA 3T6XA 5B3SB 3ERXA 4F2EA 4KNSA 5TK2A 2B3IA 1ETJA 3C75A 1GY2A 1AAJA 4YL4A 4W1TA 1RKRA 2JFCA 5I5JA 4YVNA 3FQ2A 4YSCA 3RYMA 2XX0A 1N68A 1BAWA 3QQXA 1NWOA 4AX3A 2XXFA 4A2HA 5I6MA 3U25A 3OM3B 1JOIA 1AZNA 1QLEB 1RCYA 3QJVB 3S3CB 2FNWA 2BW4A 1N70A 2ZOOA 1J9TA 2VSMB 2PCYA 1ET7A 4Q89A 1NIEA 3T6ZA 4E9QA 5TK4A 1SF3A 2NRDA 3ABMB 3JT2A 1AS7A 3BQVA 3TBCA 1AACA 1HFUA 2BHFA 1KDJA 4YSEA 1OCRB 1L9TA 1KCBA 1AS6A 1AOZA 1EZLA 5B7MA 2HX9A 2XU9A 1AG0A 4HHGA 1JERA 4JKNA 3FQYA 4YSDA 1CYWA 2IH8A 3PXLA 4NB7A 3NJLA 2DWTA 2AZUA 2FT8A 2ZONA 1J5CA 1WAEA 4G70B 3GYRA 4DP6X 1E30A 1AR1B 3X1NA 2VMJA 4EF3A 1V55B 4NERA 2VW4A 3WIAA 4DP1X 1RZPA 3NT0A 4KOBA 3X1GA 3TASA 1ET5A 4YSRA 2B08A 2QPDB 4BDVA 4BXVA 3AG4B 2YXWA 1AZRA 2HRGA 3QJUB 2FJSA 2IWKA 2OV0A 2CBPA 3OMIB 5A7EA 3DTUB 1CC3A 1ASOA 3HEIB 1DYZA 2H47C 3AY2A 4HHWA 3NP3A 1ZDSA
chains in the Genus database with same CATH superfamily
1RJZB 2Q2LA 5CS7A 3OMAB 3ZDXF 2Q3XA 3HAEH 3Q8EA 5DD1L 4NC1C 3J07A 5I73B 1Q0XL 3CXDL 3NSCA 3BO8A 4K55A 4V2BA 3FQTB 2P3YA 5AALA 1D6EB 2JE8A 2D9QB 3ZYIA 3ARRA 1Q4NX 1CFVH 1T6WA 5EULV 5K39A 3WHE0 2WC7A 4BHUI 4DP2X 3REVA 1KTJA 1CTNA 5MHSE 2J71A 1A7RH 3QG7H 4OF7A 3SDDB 1LO4H 3QEUA 5I1LA 3KPMA 4OI9A 1H8SA 2WD0A 1VGKB 3O3AB 3EBAA 3DYMA 4HOZA 2VJ8A 4ZW3A 4NQDB 4LASL 5DJ2A 1ITBB 1AGFA 4IRZL 1TNNA 4GW5B 1BM7A 2HJLB 1MCDA 3VD4A 2GSMB 4XPGL 1RI8A 4ZFGH 2I07A 4ONGL 2Z1PA 5HHMB 5AAWA 3ARFB 3ARPA 1YYML 3N5AA 3QS3A 4ILDA 2CGRL 5F7KC 1ZK5A 4U6VL 5IW3A 2PO6D 4L8SA 4PG9B 1NOFA 5CLZA 5B3NA 4J23A 4KQ3H 4PJBE 4WV1C 2YD5A 1NANH 2ZX6A 3CFCH 2EJ1A 1L6XA 3Q9QA 2HXAA 4Y4FD 3OXSA 1KV3A 2AK4D 1A65A 4GINA 4M3KB 4Q2ZB 5HDBE 5HD8D 5IHWA 3KGSA 1TQVA 3LZOA 1B4TA 4P05A 5D4IA 3V4PH 3PHQA 1FYTB 3K8LA 4TUKL 4A7SA 4M9OA 1NGQH 2NNAB 3MLWL 4TTGA 4HZ1A 4JG1H 3TBYB 1NBQA 5H2BB 5PAZA 1KTLB 2JLLA 2ATAA 1CFTB 1PZ5B 5E8PA 2HKHL 5DK2B 1I7UA 4P4KB 4OJCA 1T1ZB 4L1SA 4KXZI 4OGXH 1I7TB 4TVSa 3HZKB 5K9OA 4GKSB 3F7KA 1RJLA 2R27A 4D0CA 1DQTA 3DGGB 4X80L 2QDVA 4Y4HA 3DX1A 2BZ7A 3F7QA 2KDYA 1KELH 4U6TA 4YNYB 1A9VA 2WHVA 2P43B 2YMOA 2Z92A 2OCCB 4UF7C 1U8OB 5PCYA 3WGUB 3BVVA 5JPMA 2EIMB 3FU8A 5CIPH 4YVUA 4AMWA 4K3GA 1WSST 1UT2A 3VXOA 3MRKA 1L3NA 4KX7A 5EUOE 4XVSL 3BD3A 5DHYB 3H9SB 1AKJB 2ZCHH 1HWGB 1MHPH 6TAAA 1A22B 4HJJL 1BQHA 3KJ4C 1NC2B 2WUCH 1KB9J 3PAZA 1NGXA 2E5EA 1IFRA 4CJ0A 3OHXB 5I6OA 3NIDB 6CGTA 1YNKH 5C7ZA 3WBDA 1DBKL 4QRTA 2DMGA 3EG9B 1F90L 3VGAB 4GRLC 4DUVA 1F4WH 2BNRB 2HLEB 2XIBA 3BLKA 3QGVA 4JQIL 5AW5B 5C08A 4ZS7H 3EFDL 4LDLB 3C09B 4CSPA 3ILPB 3QIWC 1KG0B 1U9KA 2FEEL 1VACB 2ICCA 3B5TA 4AK1A 3MXVH 4ZMVA 3BP7A 4EI6A 2WBJB 3KHOA 3GF8A 4GXVL 4QWWC 3I02B 3O45B 5C1MB 5CP7A 3UTTD 2F8XC 1A14H 3DHMA 1A1OA 3MA7B 3HG1B 1PFOA 4U0RC 1ZT4A 1MG2C 3RKDD 1PJWA 2ICEB 2NY4D 4HF5L 4JPWL 5LDSA 1KIPA 1P0SE 2R2HA 3OB0K 1XMWA 4CMHC 1KJ2H 3BSZL 5EU4B 1AD0B 3HCVB 2CNYA 3RVTD 2JB5L 4DWHA 1II4E 2WUBL 1CD8A 1M71B 1UH3A 2DZEA 1T3FB 5T1KB 2EDJA 2YAEA 4EQ2A 5K33A 3ROLA 2Z7UA 4LZKA 2E27H 5IHZA 4Y2LA 1GPOH 5E95B 3MV01 3JYBA 4N3UA 2CRZA 3UTTE 1PD0A 1YN7A 3CFDB 5KVFH 1MFBH 4X6CE 3BRGC 4HLZH 4L48A 4FXKC 3K4AA 1YPZB 4HC1L 1CFNB 4NN7B 5I24A 5E1IA 5GISL 5D5MF 5T33L 3DXAA 3PXHA 3TOPA 4P5TD 4DFIA 4NPKA 1X5KA 3L3JB 5D55A 2E74C 4IKNA 2YMTA 2D7TL 1MLCA 2W65A 3A22A 3FNKA 1PLAA 3TESA 3MLPA 2AGJH 5IJCC 1UHVA 3CAFA 1S5IL 4KKNA 5JPMC 2HP4A 5D1ZI 3BZEB 3MX0A 1WFTA 2VSKB 3BH8A 5DD6B 4ALAH 3DJSA 4RDQF 2D7MA 3ECWA 5LCVA 4Z7QE 5KG9A 2VSDA 3BUPA 2CO6A 5EN2B 4LHUB 1K8DA 4AVHA 4XVUD 4Y1AD 1J88A 3LKNA 2A9MH 2X1WL 1ZLDA 2QBWA 3MV8A 4JGUA 1ONQB 1EZSA 4IMKA 2H5UA 4GKLA 4OLZH 4JHAL 2B4CL 5EC1A 32C2A 1N19A 3DV4B 1QRKA 1FYHB 1RK7A 1TNMA 2G3ZA 2BZCA 4LPYA 2GCYB 1ZHLB 5I0ZA 1C5CH 4E5XA 1R1CA 2ICWA 3ESUF 4NXKA 2I26N 3CFNA 4HIIB 3CSGA 1FZOA 3TFKC 3D0AA 3O3DB 2A83A 5IFJA 3JTSA 3WJJC 3HI5L 3RY6C 1KCLA 3EOAB 1H8LA 1TR7A 3WEMA 1CXFA 4NUMA 3EDDA 5GGSB 4DN4L 4PWFA 4MAUL 3R4RA 1OTSC 4MDJB 3U36A 2VLKB 2HRPL 3S5LG 1W9XA 4Y1AE 5I6PA 5BUAA 2CK2A 2XY1A 3KVQA 2XV6B 2OW7A 5G55A 4WO0A 4MNQB 1Y1DA 4H0LC 2XPGA 3X3FL 2H26A 2AANA 1FDLL 4I77H 2C9AA 1S9VB 4NUPA 2XN9D 3AGWA 2ADIA 3RB5A 4WV1B 1KTKE 2X44D 4IGBC 1IAKA 1NCBH 1K3ZA 1MI5D 1QG3A 4PPTA 4WW2F 2W38A 3NEEA 4OR1A 5F0MB 2XWBA 4IOSD 3FCUB 1LTXA 1UQSA 3VE0B 4WLCA 1BZ9A 3RUGF 3BGFC 3ECVA 4PCSA 3S98A 1G94A 1NGWB 3U83A 1PKQB 2A74B 4XO4A 2EIZA 1NC4A 3LIUA 1BMZA 2EIEA 5CEYA 3GJFB 4Z23A 2OL3H 1PZCA 1S6NA 3UAJA 7PAZA 3CJJA 1OB1A 2XN9E 2OR7A 1PDKA 3DPDA 3IF1B 1O7DC 2DLHA 2O4EA 4HIEA 4WK2B 1QHQA 3IJEB 2HVBA 1MI5E 3L95B 4Z7OF 5DSCA 2OMUB 1A7NL 1R24B 2QGDA 4PJFB 5L8JB 1I8IB 5A2LH 3GSVB 2GFBB 3VI4A 4BK8A 3D3VB 3X3GL 4LEXL 5ADOH 3WFDH 1M9WA 4ZAKA 4HS8H 3S4SB 3TCLA 4GXUM 4XPHH 4S0TD 1N6QL 1E2VA 4HFUL 5I2IA 3JWNE 4PBWD 4GBXA 5KOVC 4FLSA 2AK1L 1JI1A 4G82A 1O0VA 1XAKA 3HUJF 1KGUA 4JPVL 4IMKC 4N90D 5ISZA 3GTVA 4ZFFA 4JN1H 1EFXD 1F3DH 2UXGA 4F58H 3GLDA 2YMXH 1J11A 1NCDH 3QEUB 2K4AA 1E2WA 4WSJA 5CD5C 3E3QE 3KPMB 2J8UE 2DV6A 5D7SH 2C9VA 2MTPA 2UUDK 1Q0YL 3K1KC 4NAJA 4KVNH 2IWEA 4ELMB 1BQUA 4NN6B 3OKYA 1X9RA 3CSPA 2LAAA 4GMTL 3GWJA 4XNYL 4UTAH 1JSYA 2AEIT 4L8CA 5DD3H 3K4DA 2PKDA 5DHVH 1SXCA 2I07B 2XI9A 5DS2A 4N90E 4FOMA 4Z77B 1L7TL 1G6RH 4PW9A 2WZ6A 4L8SB 5DZNA 2OMNA 1MWAH 4Z7NB 5C0EA 1EVUA 3GEFA 5I5MA 3VGDA 2XWXA 3IDUA 3VSUA 5GRWA 2JVUA 4WNQB 1J8RA 2OCJA 2CKBL 5EU6D 4ZG1A 2W9EL 4RGOH 4XP6H 4Y4KB 4DGUA 1HHHB 1P7KB 2I9LA 2C8NA 4X6FB 2WQSA 1AAJA 1H6EA 2JFCA 2DQUH 3LSOA 4W9JC 3ZUCA 4Q9BA 3HNSL 4HQQL 2NTSP 3UAJC 4N86A 1EWHA 4BE5A 4KKZA 1EIBA 1IC4L 1RZJH 1YC8A 3WMQA 5E8PB 1I7UB 2ZXEB 4MS8D 3IGAA 4NRZA 4RFNB 4QGTA 1CL7H 3FSOA 4APQD 2YJQA 2XFGB 5EU6E 5K9OB 4I85A 4HEMA 1D9KA 2FBJL 4Y4HB 4A55A 1LEGA 3E6FA 2QGCA 3Q8AA 4RCAA 4Z7VF 4N0YH 4ZAKC 3SKMA 2KZ1B 4AQ1A 1AOZA 1EZLA 1H3PH 3QXDA 2Z92B 2ZAGA 1YDPA 3RL2B 3WLBA 4UIKH 5CD3B 1HCYA 2WVTA 3NJLA 5JPMB 3MBXH 5F72S 4YK4C 4RFOH 3SGEH 3WNNA 5HYSA 3RVUC 5JHLL 3VXOB 1SJEB 2PXYA 3MRKB 3LB6C 1SVZA 2HTKC 1N8OE 4LDOB 4PGDA 4XNZB 3ZU8A 2PETA 3NGBC 4PR5B 2W9DH 4H5SA 3WAJA 3DJTA 4PIRF 5F7FA 3FOLA 1FAIL 4BDVA 4D8OA 2ZUSA 2A6KA 1O9VA 3T1WA 1ZVYA 1CDUA 3PWLA 1CF1A 4OY9A 2YPVH 4QRPD 4NJAL 2WLHA 2XRAH 3O6FD 1TFPA 5L6YH 3E8UH 3SY0A 5CLWA 4QRTB 3ZJAA 4HGMA 5EFIA 1ASOA 3HEIB 3DSNA 4HHWA 1RU9L 3MLUL 4XPFH 5A2JH 3QNZA 4ANXA 3VXUA 1YY8B 2Y69B 5C08B 1THAA 2MKLC 2QZ5A 1CIUA 3FSWA 4WGWB 2XICA 5LQBH 2N0MA 2AABH 3T4YA 2FQGA 4MMZB 5E2WH 4EI6B 3F2LA 4YEFA 1IT9L 2EDFA 3MRDA 3QUXB 3E1F1 2W8CA 1JPSL 4JRXD 3ARYA 4E0RB 4PB9H 4QRPE 3ASWA 3WNIA 5I5RA 2JI2A 4LIQL 5FHAH 5BZDB 1UWGL 1ZT4B 1FGVL 4MB5A 3F65A 4XZUA 5JW4Q 1JGLH 4LHJB 5MI0B 3HI6L 3SD5A 3VXQB 2EDOA 4YFLF 2XPYA 2F08A 5ESAA 15C8H 4UANA 1IGFL 3AG1B 3UFIA 1O9ZA 1K6QL 2NY7H 1GYWA 3KHQA 4FQ2L 5JR1L 1UKSA 3FL7A 3ARXA 5CEZL 3ROLB 2WOBA 1R0AL 4JRXE 1DQLH 2YPLB 3O4OC 5JQ6H 4MZ3A 2C9RA 1W16A 3IGUA 5C6PB 4XX5A 3P30H 3CC1A 5JA9A 3SDAA 3NCYS 4OCRH 1OK8A 3NIFE 4I9WD 1LE9B 3B43A 1OT1A 1W15A 4Y9FA 3C08H 1D9KC 5FGCB 3TS8A 1T1XB 1TU2A 4PS3A 4XO3A 5MP6H 5T1LB 3SDCA 3IEAA 4AQ1C 3FOMA 4FAAB 2W65B 3PNWA 4Q74A 3OGCA 2J4WH 2VDRB 4ADIA 5KAQF 4QOKA 3BH8B 4A7VA 4NNPH 3UG3A 1KN4H 4E9SA 2R2BB 3IMVA 5KG9B 4WTZG 1D7DA 1E4WH 2CO6B 4JFHD 5I74C 5MEQA 2K70A 3GLAA 3LKNB 5HHQB 2O5YH 5FO7A 2YO3A 3MV8B 1U42A 4I9WE 4NXSA 1OKEA 4G42B 4JO3L 3V7AG 3K72B 1N2RA 3NABL 3PP4L 1E7UA 5F9JA 1GZPA 32C2B 3X11B 4FTDA 1TXKA 5A40E 1EEQA 2IF7A 2QKIA 3CFKA 2V7NA 1GZQA 4F2ME 4PVNA 5EOQH 5J1AA 1OE3A 4BZ1L 5DFVD 2OTUB 4E5XB 1J5DA 2XLLA 1VGEL 1UATA 1V3MA 2A83B 3VU1A 3D33A 3QHTC 1VEPA 4MAYD 4E2OA 5IIEA 3LVTA 4OLUH 4OB5L 5EPMA 2A6JB 2YLKA 2AVGA 3KR3H 4U1JA 2M83A 3SQBA 3U36B 2QADD 4TVPL 5L4IA 4JFHE 3UROR 1WFOA 3CZSA 2Y25A 2X4NA 1RHFA 1SXAA 3F7RA 2MJWA 5IMKB 3S3PA 3HG4A 4L8DB 3QRGL 5KTEH 1G1CA 1W8NA 2VLJA 1HWHB 5FW7A 2AI0L 3WAKA 1RZKH 5E2UH 3F58L 3IPBA 4BD4A 3VACA 5C0ND 5HYFA 1F45A 2BVUA 3CQPA 5HI3C 3C5ZA 3FTGB 4MD0A 3SKNA 2VN7A 3QUHA 5IVNA 4ZOCA 3TBBA 2Y36H 3PDOA 3FRPG 4A66A 1F42A 3NIDF 2XWBB 1BJMA 3A6OA 2VTFA 2J44A 5J8OA 3BYYA 4K0OA 1UQSB 2KPNA 3VSTA 2XC8A 4E9VA 1A3QA 1BZ9B 1J1OL 1L0QA 3BN9D 3L5XL 3TIEA 2AJVH 2J57A 4ONOA 1NC4B 4MXQD 5BZXA 2GUOA 4FD0A 1A6UL 1T5WA 2UYLB 5CEYB 5DD1H 2ZWKA 2WTPA 3JWOL 1ODAA 2D8KA 2AKRB 2BVTA 5F1NA 4LVOC 1AGCA 1UT1A 1QLRA 2NY3B 4HIEB 3K81A 4ANWA 1H0DA 3UTPD 2G4GA 5DQ9A 4HH8A 1A9EA 4KGLA 5ABDE 4S10A 4K9EH 3CXHK 3SDCC 3B7SA 5I0XA 2O6EA 5JW5A 3GMOB 4QXTA 1F3DJ 3VI4B 3TJHD 4B7LA 1OD9A 1RZQA 2XTJD 3BAEH 4FF9A 5KSUA 3ZE1B 4BFKA 3OWEA 3ZKXB 5JOPD 4OCYH 4UQAA 3D08A 4Y2DA 4KZDH 2W81C 1T0OA 4L4VA 3GMRA 2CDEA 3T0BA 5E8DL 5I2IB 5KZCB 4GBXB 1RUML 4F20A 3S2CA 2CGYA 2G75A 1AQKL 1YY9C 2KH2B 5ISZB 1MZYA 1E5ZA 1GW6A 5CZXC 2YZ8A 1KTDB 3UTPE 2QKIC 3GO1L 3A24A 3ZTNL 4U6VH 2GJ6D 4IDLA 1YPZF 3BRDA 5I0YA 2ZOTA 2FO1A 2JCCB 3EJYC 2WVVB 2XTJE 2CCWA 2KLSA 3QPXL 3GHPA 1UEYA 2BFVH 3FQWA 5JOPE 5E1AA 5IVXF 1JXJA 1HZHH 3B9VA 1RFDL 1AGBB 3WY4A 4Y16D 1OQXA 2VXQL 3V6FB 4PJDE 1AE6L 3RKPA 4M7ZC 2MPAL 4MA1B 4NBYB 1FG2B 5C7XL 3F7PC 4UT9H 4DO4A 5H4ZA 2IH1A 4XOEA 3EF7A 4Q9RH 2W92A 3LX9A 4NZTL 1J1XH 1V3KA 4IS6B 3DK0A 5DURB 1U95B 2GJ6E 2QSCH 4MQ7A 5D7IB 2F54A 5HHOA 5C0RL 1KXQA 5AUMB 3KPPA 1U8CB 1UOVA 2HKHH 3QAZB 3C5ZC 5EU7C 3GXPA 1E3ZA 3VWKA 3O6LH 3CHOA 1LILA 2BXZA 3UJJH 4M7LL 2D9CA 4YHLL 5C92A 3KPTA 1P53A 4XNMA 3MNWB 2VE6A 4G6MH 3WUZA 2WVUA 1CGSL 4ABVA 3PYCA 4X80H 4L1DA 2MTAA 1X5ZA 2P5EA 1F1DA 2R69H 2WO4A 1KGYE 3GJFH 2CK0H 2NX5A 2AXWA 3L3GA 3O4OB 2F19H 1DFBL 1XVSA 1M6UA 1NSNH 4NRZB 3D07A 2JKRM 4N22A 5DZJA 1G9NC 1Z5YD 3WHXB 4NOFA 3RGVD 1E9PB 2CMRH 4HJJH 3VJ6B 3WFEL 3W0WD 5K9JH 4KI1A 1D9KB 3FRUA 2YSTA 2G2RA 3BCDA 1IBBA 1LEGB 3A4EA 3E6FB 3OXRB 3S48A 3SKMB 3QJFB 1ACYH 5C0DB 4Y2DC 3QXDB 1N26A 3WLBB 2A4CA 1YDPB 2NR6D 3MRPA 2B1OA 4JUTA 5I8OL 1L9SA 5KYUA 4EMZA 1Z9OA 3QC5X 3QIUD 5D2NA 3TONA 5IEHA 1MNNA 2EVHA 5KJ4A 2PXYB 1NDGB 2BS9A 4QLRA 3NIGE 1XEDA 4RVBA 5HYEA 4GW1B 1XL6A 1NA8A 2AFNA 3BZFA 4BDVB 2X2JA 2Z65C 1OE1A 1UXMA 4ZXBD 3W0WE 3EDKA 2ZE0A 3PWLB 1RK0B 3K8KA 4H1LG 3QHZL 3SPIA 4M43L 2JKWA 1XB6A 2UZXB 3SY0B 1XFPA 1JGEA 3S8FB 2R1YA 5EFIB 1PX4A 5FO8A 5D9SA 3NFPB 3VXUB 4TM9A 2VR6A 3MUJA 4BA0A 5IMOA 1QEXA 1P7QA 1F58L 3GSWA 5E6IA 3H0TA 3T4YB 1L0YA 4U1HA 1A47A 4X4YA 2LVCA 3MRDB 1M53A 5C09A 4HS6A 1GOGA 4OV5A 3MYZA 4KKBD 2CUHA 3VWKC 5FPIA 2A1WL 4JGJA 4C83A 2G3NA 5JA8B 3LRSA 7PCYA 1G7IA 4NBZB 2VDNB 5I1JL 3RWGA 3HAEG 3IYLW 1YJDC 4EDXA 4FNLH 2EO9A 5DMGD 3G08A 5ESAB 3VVWA 5J12C 4MHHI 4WEBL 2GIMA 3FB5A 1BOGA 3NSYA 4B9FA 3D0VA 2R7EA 3JV0A 1U58A 1KN2H 2APTA 5CEZD 3C60B 2YA2A 1JCVA 5KWYC 1S5IH 2YWYA 1DO5A 3ATFA 1J5OH 3CZUB 5AW2B 1MSPA 3NCEB 2JIXA 4FMFA 4BWWA 2ZUYA 4N0CD 5TH2A 1EVTC 4FQXA 1BBDL 1JF5A 3QXTA 5L2JA 1JP5A 4MSWA 3RVXD 4NBXB 2CO2A 5FLUA 3SDAB 5KVDL 2OTWA 1LP9E 3TEUA 2J6EA 4MNHB 1M7UA 1ZDQA 4KXBA 2K3TA 4LVOB 3PGDA 4HAGA 3T65A 5FV2A 5I9QC 4HK3J 3SJVB 5D7JC 3UTOA 5IBUB 4ZW5A 3L3IA 2IDCA 5B1AB 3SDCB 2N1KA 4KNSA 4F7TB 1CXLA 2ADFL 3P40A 3VTTA 5CEZE 3IXTA 5D2LB 5LUMA 4HKJA 1JPFB 1IGCL 2XZCL 4PTUA 5CN2A 4OFYA 5I1CL 4X7TB 3FQ2A 2VDLL 1IIIA 1NCWH 4WCYL 4MXVE 4UTBH 4L1TA 1SY6A 4W9FC 1RD6A 3B1UA 3H7LA 1RCYA 3RWEB 2L7QA 5FFGA 2R29L 4DZ8A 3MGTA 4PLJC 1GHFH 4IYKA 4HG4J 2DL9A 1NDMA 3QZNA 2NZ1A 4XT1C 2QKIB 3CFKB 2V7NB 1GZQB 5J1AB 5KBNC 4FXTA 3U0TB 5B39A 2AEQL 3I6LD 3A3YB 3TVMC 1E8ZA 1GJWA 4AQEB 1JZ6A 1MOEA 3MJ8A 3VFOA 4LK4A 2VERN 1SXBA 5CJXA 3WNKA 4X50A 2KMWA 1BQLH 3AWEA 5EPMB 1F4XL 3FQYA 2QHLA 3QO0A 4CRPA 1FNGA 3R1GL 5MEOB 5BCAA 2C3VA 4BSVA 1CLZH 2X4NB 2MCG1 4BH7A 3FN3A 1PLGL 3BE1L 3CHRA 4EO5A 2QVMA 4WWID 5ERWA 2FGWL 3TASA 2RHEA 3QORA 2Y24A 3GMNA 2JWYA 3ARZA 4N2HA 4PG2A 4HJ0D 5IGXL 3FBQA 1E5CA 3I6LE 2IC2A 1J0JA 1T04A 3MFFA 4N2KA 5AW8B 1MCQA 5E2VL 1QATA 4X8JA 4ZMYA 3PHSA 3ZDXE 3WS3A 4F9LA 1X4YA 2B2XH 3VFMA 3PDOB 4L3EB 3EOBB 3P0GB 5E23A 2JH2A 1WC7A 3SO3C 1E6JH 1SQMA 1BF8A 1UZ8A 2KQNA 1CFSA 1FZJA 3LNIA 1FV1B 5E6SB 3QZWB 1U92B 4FNPA 1I3RB 3GXTA 3LKRB 1T5WB 1N6QH 1I7ZA 2EVGA 4HFUH 3UG5A 1OCCB 4XNQB 8PAZA 3IDJA 4NZUL 5IT2L 2AK1H 1AGCB 2UV3A 1QLRB 2CIIA 4ZYKB 4JPVH 5DA0B 2F1EA 3WTSA 3U1SL 4QRRA 5CR1A 3ZDYB 1NCAH 4CNIA 4IDJL 5JW5B 1B3IA 4HWNA 1UGKA 3I6KA 4F7KA 4DGWC 1NGYB 3CDGA 4TNFA 3DNKA 1SHXA 1D5BA 1EJOH 5KSUB 1W6WA 1LMIA 2VDRH 3O3UN 3HR5A 4H8PA 4GMTH 4KWUA 5HDQL 4ZRGA 4PI0A 4L4VB 1E27A 5J9PA 1QASA 2CDEB 1EK3A 5JOEA 1LWRA 5E2TH 4XB7A 2ZUQC 2X2UA 2NDGA 4J3SA 3X17A 5AL0A 4NQSA 1C1EL 1JRHH 3RY4A 2GKIA 4Q6IA 5G5DA 2VZSA 5K5YA 1KEGL 4QXGL 1X5IA 4NHUA 4AUYA 3BLPX 4HBQA 1FORL 5DUML 2XZQH 12E8L 2AQPA 4R5XA 3MLXL 3ZT5A 1YEWA 1RP8A 2WWKO 2Y7MA 2CRMA 2PPCA 5J89A 2I9TA 5J4MA 2PWHA 1P4IL 5CJXC 5E1AB 1UXSA 3S5ZA 1WS7A 3LS4L 1FIGH 1X44A 3GMLA 1N5YH 4AJWA 4L5FE 2FR4A 3MUHL 4HZLA 2NXYC 4UQDA 1F3JA 4FL4C 2IFFH 2WB7A 4WHDA 4HLZG 2OYLA 2BIIA 2BS8A 3DECA 3HNTH 4HCIA 2XHNA 5ACZA 2GK0A 3BP4A 3AG2B 4JRWA 2L0DA 4YR6B 3RIKA 4DH2A 4POYA 5I1EL 3QORC 3AWFA 3GRWA 1BJ1H 1CICB 2G4EA 2J43A 4PG2C 4MQ7B 2F54B 2VIRB 2N1TE 4FC3E 1J86A 3KPPB 4BGLA 4FA8A 2PCFA 3RGBA 2HT3D 4F9LC 2Z4TA 1O6TA 4YXLH 1RZ7L 1Q38A 1TZHB 3DI2B 4C59B 4Z9KB 1UB6A 1SLXA 1FCGA 2NMSA 2P8LB 4OLVL 3O0RH 4AYSA 5I28A 3AT0A 1PVHA 2VE6B 3VFWA 1NCCL 3GSUB 4JPSA 3Q6GL 1AC6A 3C8HA 1DN0A 1DQQB 5KW9H 2PTTA 1AFVH 4PJHA 3DVFA 1ZIBA 1ETA1 1AIZA 3UTSA 4FQHB 5IB4B 4MRCA 3TJEL 2WTOA 1S8DA 1VZGA 1A6ZB 4LQFL 3WIHA 1N6VA 3UJIL 1WH0A 3L3GB 4ZUVA 2HG0A 1F1AA 1IFHH 1TSHA 3MI6A 3N44B 4S1RH 1L0XA 5TGBA 1MAJA 3RL1B 2V2WB 2LAGB 3VH8A 1RIHL 1EGJH 4N2LA 3NACH 4P4RA 1H9VA 2KC0A 1NEZG 2VNCA 4K15A 4X5XA 3EW3B 2Y1YA 3DMMD 3FRUB 3MOAL 3WENA 1P1ZB 2G2RB 3VD9A 2QMKA 1TEFA 3A67L 3HPJB 1SUJA 2HG5A 5GRUL 1OAZL 4GRWH 3HS0A 3EYFA 5C0JB 4ZPVA 3V0IA 4I89A 4P59L 5FDYA 1T2JA 3B9KD 4OCSL 1H3TA 2GT9A 4M62L 1DFXA 2BP5M 2MCPH 4P23B 2J7LA 3AUVA 5D2NB 1NAKH 2A99A 1USZA 4I4WA 3H1ZA 4OZGE 4XP9H 1KULA 1JHKL 5F7YC 3RVVD 2QSVA 1U93A 1BZ8A 4WHCA 4ZMNA 5I66A 4H8WC 3BZFB 2YQ3A 5DJXA 2ICWI 1UD5A 2OPCA 3LPOA 3VI3B 3CDCA 2WPGA 3OV6A 3PF2A 3MU3A 1D2PA 3HN8A 5CINL 3OAUL 3DSFL 4D0DB 2A73A 5TF1L 1AD9B 1T2XA 4J39A 5DHXB 4UOZA 4LIQH 4OZFA 5TQ0L 3WLWD 1XSJA 3PP3K 4RZCB 5GHWH 2R1YB 2OULB 2AJXH 3MRGA 5D9SB 1G9MC 4O4YL 5FWRA 3VI4F 3DOIA 4NT6A 2XWEA 3ZE1F 4ZW8A 1QKZL 1Z9LA 4XMVA 5E6IB 1WWBX 2DWEB 2N01B 4NNXA 3BVUA 4ZX6A 3T2PA 1H5BA 4KTDH 1BZOA 5C09B 2VQ4A 1MVFA 4HS6B 3UABA 2C4XA 3DJRA 5D5ME 4OV5B 1ZLWK 3AJ7A 2HAZA 2NY6C 5DO2C 2WB1A 2DMKA 2FE0A 4EZMA 5BW7C 4J6IA 1L9RA 4C83B 2IO5A 2XT1B 3UG4A 2CG9X 3VG9B 1SJMA 2OMYA 1BFSA 2YGQA 1WJ3A 2OFQA 4UB0L 3K2KA 1J05A 3LHAA 3Q2LA 3CZKA 3ZL2A 4NQCA 4HV8B 4JKPH 3T2NL 1BOGB 2ATPA 2GQHA 4C56D 3D0VB 4U3HA 1TJIL 2R7EB 1NLDL 3U1PA 2A0LD 3U46B 1JZIA 1OO2A 2VC2B 4LNRA 3PQYD 3HZMA 3WKQA 3EJTA 1KYAA 5AWNH 1E5UI 4XBPA 1AXSA 2CM6A 1ZTMA 5TH2B 4RQQA 4FQXB 3IMSA 2PR4L 3U6RA 3QJOA 1YNTA 4H44C 1IFGA 4R4FL 4TUJB 2OTWB 5D70L 1LWHA 2VZOA 4PJCB 5H94A 3N06B 2E4FA 2MPVA 3PGDB 3L2NA 1T5XA 5EO0A 4NYLA 4AENA 3QT2A 3Q3GB 1HILB 3DX6A 2IV9A 3PP4H 5K1NA 5EF2A 3L3IB 1YG9A 3LS5H 3S8GB 2WYZA 3LPPA 5CO1A 5F9OL 4C56E 3H3KA 3QVAA 5I30H 2R2EA 2KS0A 3OB0H 3IXTB 4EKXA 1B3JA 4HKJB 2FB4H 1ZJAA 3PQYE 4AW4A 4GS7C 4PTUB 2WXNA 3D7PA 4LAQL 4APXA 2J1XA 3NFSL 3WY3A 1GR7A 3T8XB 1YYCA 4AYEC 5DVNA 1KCRL 4PUBL 4TVPH 1FBIL 1KBPA 1YEJL 5FA3A 3CVHB 1E28A 3DO4A 3O11A 4EIGB 1OP4A 3RDTD 5CJOH 4B9IA 4FFZA 3MGTB 4W9EC 4GG6E 4PP1D 4B97A 3CDFA 4M6OL 5F8RC 1VFMA 3WFZA 4YHKH 1CFQA 4LPUA 4AM0A 2FJHB 4WWOA 3F58H 1ASQA 1HNYA 1TTBA 3RWCA 5ETUA 3MXWL 2CUMA 1JZDC 5AAPA 2K6ZA 4KXZH 4Q9CA 3BKCL 4KXDA 4BCYA 5GGVY 1TUPA 3QO0B 4X7EC 2Z3FA 1NGZA 1RERA 4OUUB 3DC0A 4BFRA 5DVKA 1JUFA 1TETH 4CL7A 1J1OH 2C3VB 1H5BC 3TBVA 2IG2L 4Q4EA 1FHNA 1HHGA 4XC3L 4HLEA 4Y9CA 4Z7OE 2P80A 1HINH 1LDSA 1KYFA 3GMNB 3V4VA 2YAFA 3F85A 2YD1A 1G6VK 3JXAA 4QD2E 1T04B 3MFFB 1F02I 2VDNH 1J5HA 4I8DA 4ZK8A 3WS3B 1KGIA 1QX1A 4KROD 3TN0C 3VFMB 4BIKA 1CR9L 3WFCL 1AQHA 5CBAA 2DWDB 1WC7B 1SUHA 4N2FA 2MQCA 2IDTA 3LXCA 2YZ1A 1SXZA 1JXGA 2WCSA 1UZ8B 1MXGA 2HX7A 1CFSB 1FZJB 3HUJE 5DEZA 5AVUB 3Q8CA 3WN5B 1R3LB 5AYTA 1FA4A 2D31A 3FUHA 1QZ1A 1I7ZB 2TRHA 3LNEA 2F61A 3FZUD 3QUZA 5IB5B 3OJDA 3V4UL 3KPRB 4M5YL 1AO7D 3IDJB 4BYHA 1Q72H 2YBGA 4YGAB 4K8RH 1DR9A 4GI8A 1NFIB 1ZE3H 1AQKH 4K94C 5BS0B 2UY6A 1MCKA 3B7TA 3EO1A 5LBSL 4KKPA 1GGUA 2DD8H 5KYNA 2HLAA 4LEOB 2C26A 1Y6MR 3AQYA 2C7UB 4U3SA 3N2JA 5DC9B 2NY2C 2R1WA 3CDGB 5IB3B 4O2FA 1DBAH 1D5BB 4P5SA 1I3VA 1WFUA 5IK3A 2Y1ZA 3X14B 4GUOA 2XQYG 2JJTA 3H3PL 4Q56A 3ATBA 4K71C 1E27B 2Z31D 5DJ6B 5J9PB 1I3GH 1TSRA 1EFQA 4W4NA 5E2JA 1RZIA 2YRLA 4NUJB 4YHOH 5HPMB 4K2UL 3VYOA 4U1LA 4PRPB 3VD2A 4NQSB 2FYYA 3BWUF 3CBJB 2UZYA 3P1VA 4AQZA 4Q6IB 2W60A 4P06A 5G5DB 5GS2D 2C9SA 4NHUB 2X1XR 1JD7A 3VUAA 2RACA 4B0MM 3LPGA 3NAAH 5A2CA 5GPRA 1BJ1J 3ARUA 2A9AA 5T1MA 1J12A 2V9RA 4HLJA 5L8KB 1GOHA 2C3HA 2Z4QA 4YDIH 2I9TB 4DKTA 3ERXA 2DH3A 2FIRT 3P11H 1QVOB 1OAYL 1WZAA 5AAMA 3T0DA 3KLHD 2ZKXA 3OSKA 4GQ9L 4HZLB 3SZKC 4WHTB 1CGSH 1F3JB 3QUYD 2J8HA 2YD0A 5D2LF 4DGVH 43C9A 1G4MA 4YSCA 2X10A 5ACZB 3BP4B 3EBIA 1T1WA 3LQAC 2NY0B 4O9HL 1KACB 3I9IA 4K3DH 3TPUB 1ZD6A 4FERA 1I1FA 4X4MA 4HK0B 1TEYA 4Q89A 4HIJA 2PCFB 5AVQB 4LSRL 3TT3L 3I6GB 2VITA 1JGDA 4NLHA 2NRDA 1BG1A 3EFOA 1UB6B 3RZCC 2BHFA 1VDGA 2AQ1A 3FCTB 4JM2B 3SGDI 2ZAIA 3VFWB 1A6AA 1TO4A 1AS6A 4KK9C 2BSRA 4H2AA 4LHQB 5FYKU 2PTTB 1E4XI 4BM7A 1BVNT 4KJYA 3HMWL 1X4XA 4GSRA 3QUZC 1BF5A 1IQDA 2CJUH 3LDBC 1B2YA 1PCXA 1CFBA 1LO2L 3GRGA 1VPOH 1WD8A 3QWNA 1LE5A 1S7TA 1KPVA 1TFHA 5TGBB 2PW1A 1LJMA 3VH8B 3CFMA 3W2DH 2LFEA 3SDDD 1DBJL 2YXWA 3AG4B 4P4RB 1KY6A 3GMMB 3MLYH 2VLRD 4X5XB 4D9LL 1Y6NR 1MRFH 3QHZH 2Y72A 1Z66A 4OLXH 4YC2B 2CCVA 1YAIA 1KCUH 2Y06H 3DDGA 4X8GA 5FXCH 2F5BL 1W2KT 2JJTC 3EYFB 3HS0B 1R75A 4ZPVB 1I8MB 2FUTA 2MIZA 3VXNA 4MAZA 3WL9B 5CAYB 3H8NA 2GT9B 1XCTB 1GCYA 4GS7B 2Y2WA 4MKTA 1HOCB 5IVOA 5HHMD 3UBGA 3KBPA 3VRLF 4YWGL 4J6RL 1MFDH 2R83A 2WJ5A 4BQCA 5I66B 2V4LA 1Z3GL 5T3XH 4LXFA 2X2HA 3GB7A 3TWYA 4LF3B 2YD8A 5HGBA 1ERNA 5DJXB 2EUWA 2GBAA 1SDYA 2VLRE 3FFDA 4Q58C 1ZS8A 1WGVA 4AMXA 2B59A 2VRAA 2HT2D 1OSPL 2A73B 3ZDYF 4OFKA 4OZFB 5AAMC 2XSKA 4DKDC 2OXGB 5DRNA 5GGVL 2AZAA 1GIGH 3Q13A 4RMWA 3MRGB 2ZOKA 5FM5M 1FYTD 4I88A 1NIDA 4NT6B 3CVIL 2BDNH 1QRND 3HBZA 4MCYA 3ROOA 4EUPB 2FX9L 4JFXB 5HHME 1KBVA 4YBQD 3WIFA 1JZ2A 2X4OA 4WSGA 1XGUA 4KKCD 2RGSA 4F92B 2AQRA 1I1YB 5ANME 4QHNA 4DPCX 2PPAA 4MLIA 1B88A 3KPLB 3HMXL 5J1SC 4X0KA 4P5KA 4P4KD 3GK8L 5FYJL 5DZOA 5ELIA 3D4YA 2EDYA 3L17A 1O7VA 1TJGL 3UGEA 3NA9H 1NFAA 3U48A 4EDWH 4HXBH 4JN2A 5KVDH 4I3GA 3BEWA 5IBLC 1T7WA 1JPTH 1NKOA 1GAFH 1RZGA 1QI4A 2X4SA 2ZAHA 4LSPL 4R96B 3MRBB 4DNLA 5TFSH 1WQVT 3LH9A 5IB1A 2H6OA 5AOJA 1FYTE 5KJRL 1J05B 4KI5F 2GI0A 5HJ3A 1OT4A 1QRNE 4HFWA 5DQDH 4RGMB 4NQCB 1INQA 3E7JA 1O5PA 3ARGD 3BYTA 3K3QA 5DS8A 4ZUSA 4GXUN 5DFTA 4OM1L 2K6WA 3ZVVA 1Q0EA 5GJSH 1IGCH 3GHBL 5GSVA 2FHFA 1MCBA 3CG8A 2AXHA 5IV2B 2FX8L 4RQQB 4WCYH 3HBQA 4JKMA 2QPEB 1D5IH 3U6RB 1YNTB 2GYSA 1AKJD 1CLYL 3H9SD 1EPFA 5LGJA 3IGLA 3LYRA 1RH8A 3X13B 1NC2D 3L4TA 1DN2A 4NQTA 3WXVH 4NYLB 5HYJA 4ZJ9A 4IU2A 2DLGA 3QDJA 5DYFA 2BRRL 2PYEB 2WXKA 5H37G 4KX9A 4IBSA 3B6SA 4BCZA 1XT5A 4JO1L 4G71B 2BVEA 2Y2YA 1KIQB 5JNYB 2VT0A 3N40P 2BNRD 4YH6A 4XCCH 1JDCA 3QI9D 3BLBA 4NHCL 1JZ8A 5HGAB 3C12A 2X89A 1OSEA 2W59A 1IM9B 2IDUA 3H9SE 3L3HB 3CBKB 3EUUA 2IGFH 2VUYA 4RGNB 3BE1H 4JREB 1ZVSB 3N44F 3L45A 2FGWH 1CFQB 3L7FB 1K2DA 4F7PB 2EEXA 1A6WH 4AM0B 3WXWH 1ZGLB 3MOBL 3H2WA 2R23B 4EN3B 4KRLB 2EUXA 4UAOC 4KRPB 5I1HL 1I7RB 1R4XA 1XF4A 1YMMA 3RWCB 5DLML 4ZW7A 3JT0A 5ETUB 5C6TL 2BNRE 2ADYA 3CGTA 4BKSC 5IG7A 4PJIB 2XBTA 5C0FA 1WWCA 3DUSA 3MBEB 1NGZB 3QXAA 5T1KD 4H88L 4U05A 2X05A 4ANVA 3NTCL 4ZI8A 2R8SL 5HP5A 5ESVA 4N2BA 3SHSA 3RE0A 4NZRL 2X53A 1HHGB 5E9DA 2BVPA 1U8QA 4S1SH 1KCVL 4FYTA 3OKOA 1R5IA 5GZND 2C9UA 1TCRB 3OR7A 3CZLA 3AT8A 1UM5L 4WO4D 4PRHA 4RNRA 5LG6A 2K45A 2EEAA 3K2UL 1UWEL 5SWSB 2DQFA 5DJ8B 4DQAA 1JYWA 1ORSA 4H8HA 4YSOA 3VI3F 2DQDL 3KJ6H 4ZUWB 4M8QB 1PYWA 4TOYL 1ES0A 1MRDH 2V33A 6PCYA 1GTFA 2B9AA 1BFOB 3DRTA 4NWTH 3HRZB 4XMUA 5CU9A 5DD5L 3MODL 3FKUS 4LVHB 3VYPA 3ZLQC 3X1FA 1YUHA 2A9NH 2VC2H 1EANA 3KPOA 3DVGA 2OZ4A 2UZPA 3VSVA 4YQXL 2D31B 5LCVL 3R0NA 5DZLA 3W9EA 3WS6A 1KIUA 4LL4A 5CBEA 3BDXA 3RU8H 1YPZE 1ZSDA 4Y88A 2CUAA 3KGUA 5SWZB 2BHYA 4Z0XA 2ENQA 1ZGLP 4HPYL 2IMMA 5EZIL 4WWKA 5F7EL 1MY7A 3EO1B 3JV4A 4FJZA 4PJ8B 1KEGH 5IVXE 1OGPA 2F7QA 2HLAB 2FQDA 3ZZQA 7FABH 5HD8C 4U3SB 3CU1A 2UZIH 4FXGC 4KOCA 3RGHA 3L08A 1G7HA 1EO8H 4X99B 5KSBA 4P0DA 2ITDA 5F3HA 2ITEA 4HA1A 2NYKA 5IK3B 3CPUA 3RWIB 3U4BL 4NC1E 3V5KB 4XPBH 1MAMH 4I2XA 3GRBA 4AC4A 3UJTL 2WBWB 1RPKA 1RZIB 3V0GA 5LGYA 2J1KA 3SYQA 4N26A 3CVHH 2H1XA 4U3CA 3BHBA 3PWUB 2EE9A 4L23A 2UZYB 2IBBA 1Z3RA 2W60B 4TLTA 3CFIC 1TMQA 4PS7A 1YEDA 2BP3A 1GYAA 1U41A 1LK3L 5FKAA 4JO2L 4OTXH 1HQ4A 2IAAC 1G4RA 5T1MB 2WLIB 3FHAA 4XWGL 4IK7A 1RQ5A 4NENA 3OMNB 3CVDA 4RMVA 3ECUA 1RZ7H 1CE1H 3OX8A 5L2KA 3UZQA 3O8XB 2K8QA 2VLKE 3EGXB 3B2UC 3IFLL 5LNDA 5DJAB 1MFEH 1NCUA 1TQUA 2X4PA 5F88B 1BV8A 2J88L 4NN5B 3KPSA 4YGVA 1DUZA 1SN5A 4MNQE 2O93L 1T1WB 4OD3L 2YA1A 2BM3A 4KGJA 1DDHA 1YQVL 4GFXA 3B2XA 2GJZA 3ZK0A 2V5RA 2A5UA 1U8JA 3IJ9A 5HHNB 3UJIH 5FGRA 1I1FB 3WKNA 5D4QA 5DEFB 1UXWA 5IJDC 4K5NA 4MXWH 3MCG1 1K5NA 2DTML 4OD2A 3EFOB 3TO4B 3BEVA 3MV7D 4ZTPL 4K3JH 5TDOB 4NIYE 3D3VD 4JO8A 4U6XA 1YQ2A 2AHIA 3JWDC 2CHWA 1A6AB 4NZ8A 2BSRB 1QSVA 3KYAA 1FRGH 1B9KA 2K9FB 5D93B 1F8TL 3MJ7B 5J13B 5INDB 2YC1B 1JBJA 3U6XA 3SBWA 1ET8A 3P2BA 5E5MA 1IQDB 1DJXA 2EEDA 2V5MA 3WS6C 4P3CL 3QO1A 5FDWA 4M62H 5IF0A 3ZSSA 1T22B 1HNGA 3M17A 3PPSA 3OKLB 4XTRC 3UTZA 5JW4R 2Y1AA 1KPRA 3PG2A 5I23A 5DMKB 1LE5B 4I3SL 2NLJA 1S7TB 1KPVB 4WWKC 4S0HA 4H8VA 2PW1B 5MEPB 4WQOA 3QDMB 3CBRA 3GIZH 4AQAA 2NY4C 3G04B 1DSFL 1HXMA 3MV7E 1A64A 5TE6L 3D3VE 4MWFA 4LKXA 2WLKA 3VXPB 4QYOA 5D4HA 2P47B 5AW3B 4NAQA 1I9RH 4KJPC 5FF6A 1XR8A 2W80C 4GP8B 3KVPA 2EYTB 3QJHB 4HKXA 5JO5A 1A2YA 5EIIB 1QFWI 2CWRA 2P5WA 1S46A 3VXNB 4JDTL 1IC5L 1EEZA 5EB9A 3KW7A 4NKIL 4FQLL 1MFNA 1FH5L 1WS8A 3QRLA 5IREA 4N2CA 3UYRH 4HUWB 4AC2A 2NY5C 3I9AA 1PF3A 1KJMB 1FI8C 1OAUH 4QWWD 3RLSA 4LSUH 3NSFA 3LIZH 3FFDB 4UOW1 4ELKA 1ZS8B 3WKML 3DX9A 4JFUA 1BF2A 5EG6C 7CGTA 2QQKL 2Q7YA 3ZBMA 4XMWA 1YA5A 4FLQA 5DRNB 3EO9L 2GSIB 1D3CA 1FN4B 1W72A 4ZS6C 4RX4A 4MCYB 2Z35A 2DBLL 1EAPA 1Q90A 3G9AB 1HSAA 3T2NH 3WIFB 4MA8L 3DBXA 2X4OB 4CC4A 1JNHA 3LPWA 5F96H 4KQ4L 1NLDH 2ZXCA 2MFNA 3KLAA 1TTRA 4PSRA 3BQUB 3L1OL 2PTUA 4QHNB 4D0BA 4Y5YA 1GRWA 1XF2A 4P5KB 3UBFA 1C5BL 5AVYB 3IFOA 1L9PA 2PR4H 4PJGA 4GSQA 4L3FA 2Q7NA 5DRZA 4OF6A 4DP0X 2UXTA 2X4SB 4NZDA 4Q0XH 4HIHB 3U9PH 4HEPG 4Y4HD 5IB1B 5HJ3B 3V8CA 3FO1A 1INQB 1UGNA 4P57B 2OK0L 1WIUA 3FT3A 2V2TB 2O61A 2NQ3A 5DS8B 4ZUSB 4BFOA 4P2RA 1UOLA 5I16B 5L9DH 4ODSH 4LCIH 4F7CA 1F6FB 5SWQA 2H4EA 3SPVB 4FQCL 4MCNA 3DX2A 1FAKT 2E6JA 4R7NB 4Z5RA 3T3PF 1KCRH 4YDJB 1WEJL 1ID5I 2Y1VA 4PREB 3BXNB 3S5LA 5LGJB 2APXA 3L4WA 4I5BB 1SOKA 4U4IA 4MBOA 5HYJB 5LXGL 4Z7WA 1IGYA 3QDJB 4PMFA 4Y5XA 1AS7A 2VZTA 4J3XA 3QR0A 2Y7SA 1HFUA 3MRLA 1D5ZB 2WP3O 2ZOUA 4BSWA 3TFKD 3D48R 1DBBL 4JM2F 5C08D 4JKNA 1P5UA 1R3IH 3BCFA 3BKCH 1ADQA 2ZONA 3UBXB 1OTSD 3HR6A 2R1XB 3JWNC 2Y2TA 3PWJA 3AXLA 4L9LA 4X7SL 1AGDB 3SIKA 3K2MC 3A6CH 4OCXL 4NERA 2VW4A 4NGHL 4X5LA 3VXSB 1OOAA 2BVQA 1TQSA 2IG2H 3NCYP 4AL8C 4ZO8A 2VISA 3KYKH 2QQNL 2AV7A 2X6UA 4K4KA 1KPUB 1K2DB 3CZGA 1K8IB 3VMNA 3T77A 2XWJA 3IB4A 1MAKA 3KG5A 4OT1H 5F9AC 4XP4H 1XF4B 1YMMB 3NCJL 4DKAA 1TTUA 2O5ZL 5DZPA 3H7BA 5C08E 5IG7B 4LLYA 5HGGS 5IOPA 3DUSB 1WZ1L 4EUPH 1ZDSA 1IM3B 5HVGB 4CC4C 2QT6A 1K72A 1KDIA 2GY7B 4G8FA 5T5FA 3DX7A 1XH1A 1ZEAH 2B1AH 2G9KA 3ZN6A 2WTRB 5ESVB 1QW9A 2FWUA 5E6UB 4Y5YC 1E4XL 1WWWX 1OK0A 2BVPB 2R4SL 1U8QB 5D1QA 2RJMA 3OKOB 4OLWH 1CB4A 4XN9A 3T6WA 1UKQA 2CO1A 4PRHB 3IJSA 4M8VA 1YEKL 4RNRB 1JXFA 3ZL4H 4N2IA 3B5GA 2DQFB 1OAKH 4P9MH 1BFTA 4Z3EA 3DXAD 1CVSC 5EF0A 5GJTH 4KNQA 4M1DL 3BKMH 4AI7A 4P2CG 5IVZA 1XGPA 3DRTB 4YXHH 4E36A 4KO9A 4YN3A 5CZKA 1YUHB 3G6DL 2F74B 1YZZA 3KPOB 3IN0A 3DVGB 4AJYV 1FE8H 3Q0HA 3H3PH 3KPNB 3W9EB 4FG6D 2IEPA 4IKJA 3SGJA 4AKQA 3OJVC 4MJ2A 1HE7A 1R6VA 3N40F 4KNUA 5CBEB 1SM3H 1ED3A 3MV8D 1O7DE 2HLFC 2YGPA 4QXUL 2EYSA 4KAQL 1J1PL 5FGCE 3SE4A 1S3KL 1AGEB 3DXAE 4NQQA 2QELA 4I0KA 4Y5XC 1NTDA 3OAWA 3AZUA 1PMYA 4PY8J 4C4BA 3EFFA 3T0XA 2VZVA 5AW4B 3ZRCC 2WKGA 1G7HB 4X9BA 2ITFA 5F3HB 4KHXH 3POCA 3P9WB 3MJ9L 4G8GA 3LAFA 3DO7B 1P5UC 4IRSA 4BWUA 1M7IB 3F12B 4I2XB 4HWZA 3ILQC 4L9LC 1U6AH 1H6TA 4BQBA 3B9AA 3CPLB 5DEGA 3IFNL 2E75C 3MV8E 1CGVA 2FCBA 1HXYA 3RRQA 1F6AB 2LR4A 4FFZH 3T0VA 3PJSA 4RLDA 3BWAA 1YEDB 4APQC 1MIMH 1YNTF 1EHLH 2BIPA 4NQVA 4X6DA 1JGUH 5DK0A 2F7PA 1CXEA 1GGYA 4MQXC 3IDXH 5E0FA 4A2EA 4Q9QL 4U6YA 3OF6A 4HALA 2J2ZA 4OF5A 2CLVB 4AGOA 3QYCA 2VH5L 1OHZA 1IAMA 2IPUG 1H3UA 4ZTEA 5FM8A 5I1DA 2O1AA 2X4PB 2XG4A 4S1QL 4YGVB 1RUAH 5MENA 1DUZB 1NC4D 1XXDC 2ZKWA 1NDTA 1QLFB 2D2OA 1CLVA 3JV6A 4ZOEA 2P24A 3B7YA 5D1QC 5DUPL 3JUYA 4O51A 4NZFA 3UGXA 2EACA 3UAJD 3AVEA 1DDHB 1E65A 2GHWB 5J06A 1PG7X 1JHTB 4AE1A 1C5DA 4GQZA 2OXHB 1AY1H 2AMUA 2ZX5A 1BWMA 5AB1A 3RTLA 3ZT6A 1OGTA 3DKHA 2Y5TB 2A7BA 4XB8A 1M2OA 1BIHA 1TLMA 2V5TA 5CF3A 2WZPD 1ROWA 3CLFL 1G9NL 1MREL 3KVDD 4OD2B 5I1KL 3D06A 2WQVA 1NCJA 3FQ4A 3K6NA 1CF8H 1MQKL 4U6XB 3INUL 5DUJA 1HZKA 1BEYL 1V7ML 1QPXA 3MV9A 4ZAKD 3BZDA 4PJIF 3THML 5C2BL 5ALBL 4DPRA 2I7SA 2WZAA 3DIVA 3K0YA 4JL1A 2Z91A 3QIBA 4GBXD 5FDWB 3CSYA 4UT6H 4WI2A 5FC9A 2WBXA 1E8WA 2ARJQ 3M17B 3MROA 1SLVA 4WIQA 3RVUD 1KPRB 3PDDA 4KFMA 5FAAA 3SE4C 4BEIA 5ISZD 3LB6D 1S9YB 2HTKD 2IPKA 1A4JB 1B0RA 5IHHA 1ZV9A 4AQAB 3K71A 1HXMB 3LJ3A 3EO0B 1OP3K 3VI4E 4S11A 4LKXB 3D85A 2EH8L 1FPTH 4QYOB 4Z0BH 3ZE1E 5FO2A 2EIBA 5FF6B 1NH6A 2CR3A 4I0CC 4HKXB 5E94A 4IRSC 4LLQA 2X7LB 3NH7L 2P5WB 4J3OC 1S5HA 5CP3H 4N5EC 4MJ5A 2BY2A 3NRPA 4OGQC 2X1QA 3O2WH 4PRBB 4IBWA 3FMGH 2DIEA 4XPAH 3QXUA 5IB2A 4XBGB 5A1AA 4D3CH 1NL0L 1HAWA 4JZNB 5ISZE 4M1GL 4JLRB 2I5YL 4JG0L 5A6LA 3QBTB 3KYNA 4GIAA 1MNUH 4XCYA 3BKYL 4M5TA 1NZRA 5C0CB 2BMKA 2EUZA 3HMXH 4ELKB 5KVEH 3BWSA 3DX9B 3RP1A 5FYJH 1LQSR 1UG9A 1KTBA 1A3LH 2AS5M 3W38A 4LP5A 2PMZA 1INDL 4ORGB 4LSPH 5K9QI 1YJDL 1JXDA 2XKNA 1P6FA 2Z35B 3CDZA 1EAPB 4X9YA 5DHDA 1HSAB 3IDMA 1QYGH 3KH3A 3DBXB 3UIZA 4OGYH 1TCMA 2N7BA 4RMSA 4X98A 3BVDB 3SE9L 4X4XA 4D0BB 1T6VN 4Y5YB 1FL6B 3ZQWA 4CU7A 5C9JA 2FX8H 2IJ0C 1TQCB 4FQ1H 3UO1L 4PJGB 4ERSH 4WTZA 4ZFZA 1R3KA 4J5VA 5DRZB 3WFHA 3MGOA 4MA7L 1D9KD 1U8KA 3P9LB 4JZJA 4UU9A 1OGAB 3QPQC 4XO9A 2Z8WC 3N0AA 5DD0L 4AGMA 2Y23A 3FO1B 4A2LA 3FT3B 2O61B 2QADC 1ITCA 3LZPA 1WWAX 4NO3B 4JO1H 3QIBC 4MNGB 2WXIA 4F7CB 4GT0A 3IAPA 3P77B 5AZ2L 5SWQB 4NJ9L 4AY0A 4FQIL 4GI6A 3L9BA 4DP7X 4GUCA 4BQ8A 1Y6KR 3WUWG 3TP4A 5EEYA 3S5LB 5C0NC 3FUIA 5KN5B 1JF6A 5LNEA 4CVWA 1ZLWH 4HEME 1P4UA 2CZNA 1QOKA 5IQ7L 5D96C 5AW6B 3HE7A 1MEXL 1IGYB 1FFNA 1CG9B 3CHXA 3NZHL 5EO1A 4ETYA 5FM4A 3ZHLA 4BSWB 3R19A 3U30B 3CMOL 1I1AC 2E0PA 3VXUD 3BWZA 3T4AA 2GPZA 4PRNB 4NFCA 4DKFH 1WBXA 1BYPA 2FH8A 3ZMEA 1SDDA 5DRXA 2HWZL 2OYPA 4L3AA 3SQOL 1M7XA 3AXLB 3NTCH 2BX5A 3P3UA 2WWNA 4AIXA 3BGMA 2BVQB 4IEFA 4U31A 4NZRH 3BVNA 5KYYB 2VISB 3CC5A 3Q2CA 4LQ1A 2AV7B 4PJ5A 2FZ3A 1BA9A 2G5BA 1C7SA 1FZKA 3T77B 4MB3A 5FFOA 2XWJB 3TJHC 4NWUH 5HI3D 3WU1A 1J0ZA 1ZT7A 4K7FA 3VXUE 5EA0H 2XPZA 3S97C 2NCEA 3H7BB 4NP4H 4LLYB 4N4YB 4YSPA 3IS0X 4NKOA 2BJMH 4PS4L 4E9TA 3KDMB 2PYFA 3LKSA 2H2SC 2XN1A 2BOCB 2Q3AA 5F70A 1CQYA 2EE0A 1YC7A 2DQCL 2I60H 4XP1L 4GH7B 5ALCH 5IFAH 5D1QB 1L3WA 4PV1C 5J7CC 2FQFA 3TV3L 3IJSB 2CPUA 2J6EL 3QJQB 4PAZA 5ENWA 4YX2H 1IGIL 3LV3A 3GD1C 4XPTL 1JZ4A 2MSPA 4P2QB 5B7EA 3FYEB 3SDCD 4NQEA 3DV6A 5IVZB 4DIXA 1XSKA 4DGYL 2YEZB 4NFDA 1XGPB 1CJYA 1A5FL 4RDQG 3T08A 2FWOB 4LCYB 4LLMA 3CV5A 5J11C 1F5WA 4KKAC 4FN0A 1CDYA 4TPRL 2H8PA 1IZJA 1HNFA 2HRLA 4QOKD 5F7DA 2LVEA 1VESA 2XXMB 4XHQA 3RBSA 5T5NF 1QFWL 2H45A 2MNWA 1HSBB 4OLYH 4N8VG 3RPBA 1ED3B 1BBJA 3GUFA 3ARTA 2EYSB 1YY9D 1BXUA 5F6IC 5CZXD 5AW1B 3QISA 5KYWB 4BINA 4DAGH 2UWEA 2NUPB 3E80A 3PV6B 1KWGA 3BJ91 2XA3A 25C8H 2W9LA 4Y19A 4YFEA 1BG9A 2FLMA 3EJYD 5EZLA 1A66A 3LQZB 4QOKE 5AVTB 3T4AC 4G8GB 2GVYA 3CN0A 3O2DH 4WFGD 1ZLSH 3RX8A 5JHDA 3EDEA 5LGHL 1GY2A 5A7BA 4A1RA 3GZKA 1KGWA 4HWZB 3P3YA 4UZSA 3ALXA 3EYQD 5DEGB 1YNLL 1EXUB 3QDAA 1RUKH 3DIFA 1AZNA 2VLJD 3BSGA 3DDFA 2BW4A 1N70A 3PJSB 4HCRL 1CGWA 1V8HA 4XAWL 1WBZB 1XSIA 2OMZA 4IBYA 3C2AL 4N0UA 4YHZH 3TEXA 3LHPH 1UA7A 1NIEA 3RTQA 3C5ZD 2HB0A 6FABL 5EORH 1JFQH 2FX7L 1RVFH 4XXWA 5JUEL 2JV6A 4HSQA 1F4AA 5CCGE 4XBEH 4WFGE 1KDJA 2VXVL 4J12A 4J27A 4XH2A 4AG4H 1KLFB 2J2ZB 4YSEA 5ACMA 2NR6C 3W9DA 2E7MA 3MACH 4UQ3A 5CGYC 2VM9A 5B22A 5TTRA 2CLZA 1AHWB 1XGTA 2YRZA 3ESVF 4GEIA 5MENB 2DWTA 3JV6B 1NEPA 2FT8A 4GIPD 4HETA 4L29B 3ZTJH 2P24B 2VLJE 4YIQA 3AB0C 1OEZW 3S37X 1ULVA 3ARDA 2X3CA 1YECH 3ULUC 4O02A 1C5DB 4M6NL 3HLAA 3GSOA 1ACXA 2YOCA 3Q1SL 2DDQL 3VO0A 2BXYA 1DBMH 3BZ4A 4I3SH 5EU7E 1OGTB 1LMKA 5H8DA 4B5ZA 4AYBA 3WTTA 1KZQA 3FUMA 4MGXA 3FF8A 4BRJA 3SE8H 5F6HI 3OMIB 5A7EA 5ICYB 4HWEL 1Q9OA 1FFOB 3MV9B 3AY2A 1ZXQA 4Y2DD 3BP6A 3R06A 4L4VD 4OH2A 4RA0C 2A9BA 1MIEH 3IMBA 5B21A 4G9FA 2EDQA 2V17L 2Z91B 2E7LC 3ECQA 4NKIH 3VFRB 2XQBL 2Z93A 1CLOL 1RUPH 3P3TA 3EYVA 5JDSA 5E0QA 1G5GA 4FKEA 2IPKB 3O2VL 1B0RB 2ARJB 3ZDYE 1KCSL 5HI5C 1EBAA 4DEWA 3VFTA 4H8WL 3K71B 4S0SD 2BP0A 5DTFB 2P28B 4KI5D 2ROXA 3D85B 4JS7A 1OSYA 1N5AA 1J9CT 1ZANH 2FK9A 2FD6H 4NO2A 1R33A 2QQKH 3EF4A 4LLQB 4AKPA 3AFLA 4L4VE 2HUHA 1JYXA 3D2TA 3HAEA 1XD1A 1Y7VA 2IMNA 5EO9B 1G9ML 4KJWD 1IBDA 5I8KH 3RAJH 3CH8A 3TA3A 4QEGA 2DBLH 2VUOA 2BO0A 4BE6A 4AEFA 1DLHB 1UA6L 2JF1A 4Z3HA 5IBTH 4F7EA 2XIIA 1HTYA 3WTYA 3GRWL 1Y18B 2EE2A 4XCYB 2F54D 2WINA 5HHOD 3RILA 3HBPA 1OB0A 3RTQC 1X4ZA 3WMPA 4KI5E 4NS0A 4WRLA 4XXWC 3VWKD 2PWDA 2EILB 2DQHH 3VXRB 1P4BL 4FZEL 1U3HB 2L8AA 1I8AA 1XMEB 5EBMB 3ZY7A 1COBA 1MFCL 4JFOB 1IGJA 1MFAL 1NMAL 2V5SA 4FFVD 2JI1A 4WK4B 2YIHA 1KBGL 3H6JA 5ILTH 2XKNB 2JSFA 2P5ED 3CDZB 2CBQA 4PU2A 3ISRA 4G6FB 4XGZB 3CD4A 2VDPB 4UV4L 3IDMB 1OM9A 1XZ0B 3GS7A 4MMXB 4YHYC 3LKQA 3HIZA 4U1SA 4X98B 3ARDC 1ZV2A 2F54E 1WBYB 1IQWH 2NX5D 4KKQA 4X4XB 5HHOE 3WIHL 2WLMA 3OAYK 1KXQE 4JO4H 1FP5A 4ADJA 5T8IA 1QMUA 5FX3A 2JNZA 5DT1H 5C9JB 4BQ6A 2YQBA 5JYLA 4X9GA 3TWCH 1CBJA 1RIVH 1WEJH 4OIFA 3BESR 1TYRA 1QBLH 1O75A 4TQIA 1FWXA 5IM7B 2Q5BA 2F53A 3TBWA 1U8KB 3CK0H 2VDKB 3GKWL 4JZJB 4LSTL 3FN9A 4UU9B 2BHZA 2QHRL 3GHEH 3WEBA 4OZIA 1QZNA 3QZOA 4QDGA 2WWMC 4JG5A 2P5EE 5KVGL 2E7CA 1PY0A 4AYID 2D2CC 3IMRA 3PREA 1BIIA 1DDTA 3IKCA 1EHKB 2DN7A 2GBTA 4MZ2A 3U7YH 2NX5E 3V4LA 4A6YB 1GGIL 3OKDA 2OJEB 2E47A 5C3IA 1KSRA 5A43C 4ENEC 3MUZ1 3NEOA 4LLUA 3UTQB 4HJ0C 4OW6A 4YBHA 4H2CA 4QKTA 3F6IA 4FQQB 1I9EA 3QJTB 2NW2A 2OJZH 3T3MB 2G0LA 5F6IB 4M29A 4LCWA 3HE7B 3QFDB 4JL2A 2Y6SD 4JFEA 1MVUA 4W9CC 4YL9A 1PNDA 3TIDB 1JYVA 2O5NA 3F64A 5EO1B 5D1XA 4MQSB 2FAUA 3V6OA 4E42A 3P2TA 4P49A 2YS4A 3VG0H 1PG7H 1WIOA 1RP9A 3HE6B 4JCWA 5DVPA 5FGBA 5AVXB 1GCFA 5D2NE 2UX7A 1P7QD 2JXMA 3TA3C 2H32B 1WBXB 3V9FA 3HN3A 2B8OT 3FRPB 1WZ1H 2VMEA 3HZ3A 4R3SB 5CIPA 3FQ1A 5E6ID 1SDDB 1JI2A 2C7FA 4J3UA 5GGRA 5FB8A 4UT7H 5C09D 3MRJA 5HHXL 4UYPA 1NMCC 3BGMB 5DJDA 4IEFB 4Z7AA 4ZDHA 3BVNB 3CC5B 3UC2A 5IESH 5I8CA 4PJ5B 2FZ3B 2IVFC 2G5BB 4FNSA 4L2LA 3LXUX 2ADJA 1BVLB 5ECGA 1YEKH 3SKOA 3K1DA 1HJCA 1H8OA 3QEQB 3EKCA 1ZT7B 2VQUA 4K7FB 4G7YH 2VDOL 4NDMA 4BGDA 3SGKA 2CDFA 3VNYA 5AW0B 1F4YL 1HC1A 4NKOB 4ACTA 4ONFH 3QPKA 3EIFA 1F2XK 3MJ6A 4FRWA 1J8HB 2ZP9A 3GSNL 5C09E 1IE4A 2JIXD 4GPVA 3D4CA 4FQXD 1JNJA 1ZT1A 2ZF9A 3MDJA 4BKLA 3QCUH 2FSEA 1VENA 3DYOA 4FS0A 3UAFA 3K0WA 3WDJA 2L3BA 1GH7A 2DQTH 5ENWB 3VRIB 1J1PH 5BO0D 3NG5A 1FVCA 2FWSA 3LV3B 4K94L 3PXJA 4YE4H 4OAWA 1BM3H 1CPUA 1KJ2A 3N0PB 4NQEB 1W8OA 1EZVX 5HY9A 1NMBH 3H6AA 4NO0A 2H8PB 5F7WC 4OFYD 5F7DB 1CFMA 1SEQH 2F1AA 4JFQB 5IQMA 3P02A 3MJ9H 4UUJA 2Y7QA 3VXMA 1CZ8H 2QDWA 1QSFB 1AIFA 3TNNA 1MCJA 1VERA 4LRNL 1GA2A 2ZKHL 5T3ZH 4DTGL 3BH4A 4X6EB 5GZOA 3SDYL 2Q9OA 3GBLA 1V27A 3FULA 3LN9A 2RCSH 1M3JA 4CBZA 1MJ7H 1OTTC 1INEH 1JAEA 4CW1A 2VDQB 4PJGF 3BPNC 3ZW3A 3VX1A 5D1XC 3V6OC 1FFRA 4DZBB 4Y19B 5D71L 1CU4H 3D39A 4NC2B 3UX9B 2WZ5A 5FGBC 2Q8BL 4GLRI 3TV8A 4GAGH 1XF1A 5F7HA 4CBPA 4WTQA 1CD1A 2R4RL 4PI2A 1OAQL 3WO3B 2NXYD 3SO5A 2C34A 2XQYK 5LB1A 4DKEL 1G7QA 1AS8A 3FFCA 1EHXA 5INCA 4IKKA 1BJ8A 4Z8FL 4PW4A 1N12A 1XCWA 4JJ5B 5DUPH 3LQAL 5GGQH 3QORD 4YOKA 4NCC2 4J1UA 2OR9H 3V4VL 2OMZB 4HJUA 4GKNA 3NRQA 3PWVA 1EBPA 1NOAA 2IAMA 3OL2A 3RTQB 5I0WA 5EOTB 1GW0A 4A37A 2W88A 3PWPA 3I9GL 1K9TA 2R0ZL 3IS1X 4KTEH 4Z7WF 5FYLL 1G9EA 1PNCA 3P4NA 3RUGA 5I1KH 5EBLA 1NEZA 1MQKH 2CLZB 3QQ4B 2LU4A 2OSLA 3HG3A 5F9DC 1QTPA 3O3BA 2AEPL 3THMH 1Q94B 4KMTH 5CHNB 3KLQA 3L5IA 1BD2A 2PPEA 1MRCH 1YEHL 1FLRH 2ZPKH 3HLAB 4MDIA 2IANB 3GSOB 4U1NA 2VXSH 5CLYA 1UH2A 3IXAB 3QA3B 2GJPA 2OI9C 3BZ4B 1URIA 4QRRD 1FNSH 3FQRA 2OW6A 1EZUA 3VFPA 5L88H 3CHPA 4ZQTA 1DLFL 1GMEA 1JV2A 5AYUL 1WAAF 4DFHA 1Q9OB 4AT6A 3VDCA 3QYMA 3WKYA 2OP4H 1IKFL 4PLKC 4OJFH 5I26A 1YEFH 4FA7B 4H1LB 4JR9H 3OPZL 2WOYA 3NH7H 3R06B 1SYSB 4HT1H 1TDQA 1ZY9A 3L5JA 5CILL 4UNVA 2EQDA 1R5VA 2Z93B 4HAKA 2OL3A 5FECA 2K3HA 3WEXB 4DN3L 3EYVB 5JDSB 4JDZB 1NL0H 4TSCL 3BFQG 4QRRE 2EVIA 5CZVL 3QW9A 1GYCA 1JPGA 3FT4A 3BIAX 4HGKC 2I5YH 3QWRA 4LSSL 3VFTB 4AMKH 5LKNA 2BP0B 4LVNC 2NNXA 5EUKA 1TZGH 2BC4A 1N5AB 1OW0A 3FN0H 1Z5LB 3OKNA 1SNRA 3TBSA 3CUPA 2CR0A 3DROB 4KHTL 3S35L 1TENA 2WYTA 5LO7A 4ALAC 2NY1B 4JY4A 4BH8A 4OSUL 3HAEB 1HH9B 3CN1A 4R8WL 4BZ2H 4HG4K 1QHOA 4FABL 1YJDH 1KGJA 5DR5H 4XNUH 4CKQA 1ZHBA 3W56A 3K74B 1YRKA 3AREA 2JK5A 1R3JB 4F7EB 5CFAA 3DPBA 1I85A 1GVIA 4M93B 2WINB 4PJEB 4X7CC 4EPSA 1T7ZA 2IAMC 2XWTA 1LK2A 1LNUA 1KB5B 3KEHA 3NYKA 2NY6D 4M7KH 5DO2D 4QT5A 4JKLA 3UO1H 4R7LA 3UCRA 3D51A 1MCPH 2JMRA 4TQEL 3VMOA 3FCBA 1MCSA 3T6XA 5E9NA 2ESVB 2KUTA 4FYRA 5CGTA 5AD0A 1UTDA 1T0NB 3HS8A 3LRLA 4UTAA 1IE5A 3PPEA 3VD1A 3RNKA 1T03H 2AK4A 4OVVA 1FNAA 3GUTA 3U4EA 2VR7A 4YL4A 2IXQA 3T3PE 3UTSD 5DHVA 3LKQB 4LPCA 4U1SB 4IMLA 3RIFK 1BAWA 3AQZA 2ZCLL 1RJCA 1AH1A 3WTUA 3DO3A 1V3LA 4PV9A 4G1MA 4WUKL 1G6RA 5AZ2H 1QLEB 2HVKA 4OIIH 4TS6A 4UQ9A 1BPVA 1L7IH 1MWAA 3MLVH 4JRYA 3ZXAC 1XH0A 4JRFA 4HUVA 1ND0A 5D72H 3TBWB 3IBEA 3DIDA 4ZTOH 4FCHA 4Z7VA 2ZUUA 4HS3A 4X6DF 3GQFA 3UMTA 3UC0L 1MEXH 1U8IB 2ED6A 4I0PB 4U7MA 4PJHE 3OSVA 1PIGA 5EZOH 1UUNA 5DC2A 1ORQA 1D5RA 4EI5C 3UTSE 4QRAA 3Q05A 1BIIB 4MHHG 2HX9A 3IKCB 4YSDA 2QVFB 3PIQB 4P5MA 1HDMA 1JCKA 2IH8A 3WNMA 3TZVC 4GRMB 4DCQA 4QY8A 4FLRA 5B38G 1AJ7H 1YSOA 3EGSA 3GGWA 3GYRA 4G70B 4XNXH 2NPLX 5FFLA 4LLUB 2VMJA 2HWZH 2PN5A 3KLSA 4FZ8L 4RIRA 2B08A 2EKSA 4PV8A 1OW0C 3QNXA 1AMXA 1HEZA 4G1EB 4JFEB 5KVGE 1MVUB 3ZQ9A 3HHSA 4R7DB 2GTWA 3K6FA 2IQ9L 4RMQA 4F8NA 4E42B 5L4MA 2ITCB 1SMAA 3Q01A 1EMTL 1RJZA 1IZKA 3M88A 3QEGL 5C3LD 2JXMB 2X70A 5GS0H 3HHRB 1AC0A 1EXHA 3AREC 1JMZA 1ZMYA 5LBVA 3FQTA 3GXMA 1D2OA 4FI6A 4WI4A 1D6EA 3FO2A 4JJHA 3SPJA 5LAXA 3MRJB 4H20H 2C9XA 1HKLL 2CUIA 2WGNB 3FTWA 3MUUA 4PB0L 1YHPA 2WLNA 1QEWB 1KBKA 2F58L 3ULSA 2YUZA 4EZKA 4V1DA 5BMFH 5BOPA 5I8CB 2WSPA 3GS4A 4J3WA 4KZEL 3QUMA 5BNXD 1VGKA 2ADJB 3O3AA 2DQEH 5CJQL 1CI3M 5BRZA 3OD3A 5IW6B 3TL5A 4IU3B 4NDMB 1WZMA 4NQDA 4XPTH 1BAFL 2HSIA 2DJMA 4NQCD 3CX5J 4F8OA 3BI9X 4OVUA 3GINA 4JNXA 1HX0A 1IIKA 4GW5A 2HJLA 2DWXA 2FYVA 2Z31C 4O5LL 3H9YA 2ED9A 3LKPA 2VDPH 3GJFK 4KX8A 2ETWA 3TF7C 5D8JL 1T7VA 3ZTEA 1P7BA 1D7CA 2COVD 3ARFA 1T2QH 5A3IC 2CE6A 5JXAH 3IGKA 3T0EB 2FSEB 1CGYA 2FH6A 2GI7A 4IIQC 5SV3A 3D50A 4R4BB 3U9WA 3GBMH 5F7NC 2VDKH 4K73A 1DL7L 4NQCE 3US9A 4B5EA 1DVYA 3B4NA 1XF5A 4OAWB 4DUWA 1KJ2B 2W0FB 3P0VH 4AV0A 3QJZA 2NY2D 4WU7A 5HY9B 4IBUA 1BX2A 1LYQA 5DMIH 3BUYB 4P99A 3NZ8A 1DEEA 2OM5A 3L81A 4GSDH 4NO0B 2NNAA 2VB5A 3BUTA 5DQJB 3VXMB 1AIFB 3WKPA 1KXTA 4A6YH 1RZJC 4B9YA 2EVJA 3RHWK 3TBYA 3SBPA 1KTLA 1DQDL 3ME0A 1PZ5A 4M5ZL 5DK2A 1YNLH 1YUKB 4RGND 4L37A 1QSZA 3CVCA 3UPRA 3ZKMC 4YPGA 4L4TB 3D9AL 1G0YR 1Q8MA 4HCRH 1VADB 2RD0A 2YN5A 4XAWH 4CW1B 5LLIC 2X2YA 4XHJD 1RULL 4KPHL 4Z95L 1BP3B 4MCMA 3SDXA 4NUGL 4KRPD 4PRDA 3SSGA 3HFML 4LVNB 1KC5L 1L0PA 2KBGA 4YNYA 1RURH 3IMTA 3FU9A 2FLBT 5KSAB 1U8OA 1ANUA 5I73C 3FTZA 2H32H 2WY3B 3TX4A 1KWKA 3VFSB 5AFAA 2N7AA 1G7QB 3REWB 3U0WL 5INCB 1SLUA 4U1GB 4XMPH 1CWVA 1E42A 4RGNE 3S34L 5IFHH 3EJZC 2P80D 2YN3A 1BYNA 4GMSL 1MJ8H 2E6PA 5FKPA 5DHYA 1BXAA 3SDDC 3IN2A 1BQHG 2Q7AA 4TSBL 4J1UB 4FHBD 3ES6B 1BGXL 3OHXA 3Q1SH 3B2VL 4H13C 3T3MF 2YAOA 4PS8A 4TRPH 5FYLD 2VXTL 3SCMA 1N8ZA 4KDWA 4DVBB 4U6HA 3V0WH 4N0FA 3MNZA 3BH9B 1NEZB 2H0EA 2DEXX 1TOXA 1ZA6B 1FZMA 4LBEA 3I9PA 3BT2H 3JWDL 4KK9D 3BDYH 3DUUA 3ARFC 3ILPA 1KG0A 1FVDA 4WKZA 4XN1A 2ZJSL 2OZ4L 2WBJA 3TLRA 3SPGA 3QUZD 1MHEB 3I02A 1EJ6A 4R2GB 1KY7A 4M6MH 3BD4A 2V17H 1BD2B 2XZAL 4HIPA 3G3LA 1TZAA 4MDIB 1QR1B 2PF6A 3ISWA 1CLOH 1ADWA 1NIBA 2MHAA 2NTFB 3FQXA 5DZVA 5ADPL 1XX9C 3MA7A 3HG1A 1N0XL 2FUQA 4MTMA 5FUZH 2X0VA 5FYLE 3WO4C 1OARL 2OS7A 4JPIA 2DMBA 1JV5B 5FEBA 5CCKH 2HH0H 3FT2A 3W5MA 2FGZA 1JV2B 1AD0A