1OV8A

Auracyanin b structure in space group, p65
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Auracyanin B structure in space group P6(5).
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Auracyanin B
total genus 37
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ov8A00
3CVCA 2P80A 4NAJA 1NZRA 2PPAA 4A2EA 1A4BA 4G71B 3T6ZA 2JXMA 1PZAA 3X1BA 1BXAA 2W8CA 2DWSA 5D4IA 1TEGA 2BWIA 3OMAB 3ABKB 3X1FA 3FPXA 3S3BB 3T6XA 2PPFA 2JFCA 2CAKA 3FT0A 3UAAA 3WNJA 1CC3A 2YQBA 3ABGA 4UF7C 5EHFA 1AZRA 2IDSA 2BWDA 3AZUA 4GY4A 1BAWA 3PAVA 1ADWA 4GP8B 3AG4B 1NICA 2XUWA 2HX9A 3L45A 2X87A 1OF0A 1NIDA 2PPDA 4HHGA 1PY0A 1GS6X 3ABMB 1NPJA 4WKXA 3H4FA 3WI9A 5FC9A 6PCYA 2CJ3A 2J57A 4MFHA 4RH4A 4WTQA 2DY2A 4KO7A 4E9TA 1JZFA 1FA4A 2X88A 3QJSB 3ZDWA 3HEIB 4A68A 2ZWNA 5A7EA 2CALA 3FU7A 4N8UA 1AAJA 1KCWA 3BVDB 3NJIA 5I5JA 4YSQA 3FSWA 3GYRA 2J5WA 1WA2X 1KBWA 2XWZA 1TKWA 1RZQA 2XV3A 1ID2A 2UXGA 2IDTA 3H4HA 1X9RA 4HCGA 4KNUA 2GI0A 4E9VA 2OJ1A 2EIKB 2XYBA 5AZUA 4FA7B 4KO9A 1MG2C 3OMIB 2EIMB 4DP5X 1E65A 3FQ2A 2EIJB 1AG6A 5I28A 1ILUA 1SJMA 2E86A 2YXWA 1A8ZA 2YAEA 2YAFA 3NJHA 1L9PA 3TBBA 2IDUA 3GXUB 4G7SB 4QLWA 1ZV2A 2UX7A 4AZUA 4BXSV 1JXFA 1A3ZA 5I6OA 5ANHA 7PCYA 4E9QA 3NJGA 3NJJA 3FS9A 3KW8A 4FAAB 2VW7A 3NSFA 5I6MA 2QPDB 2UXVA 1BEXA 1ZDSA 3CDZA 4JHVA 4GYBA 7PAZA 3PCYA 1OOWA 3JT2A 1WS8A 1GW0A 2FQEA 1PLBA 2GSMB 4GXFA 5B7MA 2BZ7A 2XX1A 1IBZA 1J5CA 1J9SA 2PP7A 1QLEB 3UADA 1A4AA 1TEFA 1ET5A 4BXVA 3CZUB 1NINA 1AOZA 2VN3A 1PLCA 4PCYA 3RYMA 4YSEA 3MBWB 5F7AA 1OCOB 1AZBA 1PNCA 2H47C 3X1NA 2HRGA 3ZX1A 1SHWA 1M57B 3PPSA 2BZCA 3IBOA 1SF3A 1JOIA 2BW4A 1OE3A 1NIBA 3CG8A 2AZUA 1HAUA 1OCRB 3H56A 4BK5C 1V54B 2IWEA 3WKQA 3T9WA 1RZPA 2I85A 1EZLA 1OV8A 2QDWA 1BXVA 3OM3B 5B3SB 2YXVA 4P5RA 2YAOA 1M56B 1KCBA 3DIVA 1E5ZA 3NT0A 3ABLB 2DYRB 1VLXA 3DKHA 4KO5A 3T6VA 1QHQA 2B3IA 4HCFA 3UAEA 1F56A 1GR7A 2HLEB 1PCSA 5AFAA 2AANA 1KBVA 4NERA 4YVUA 3V9EA 1SFDA 3X1EA 1GY2A 1W6LA 1KGYE 4E9RA 2BP0B 5LDUA 3NJNA 1AS6A 3ASOB 4YSRA 2AFNA 1L9SA 4UAHA 3X2QB 1SDDA 1YLBB 2FWLB 3CVDA 3QJRB 2YAHA 4AKQA 5B1BB 3IEAA 1JZHA 2YAMA 4DP8X 9PCYA 3NSCA 5D4JA 2OCCB 4YSTA 1J9RA 1MDAA 1CURA 2B08A 1BYPA 1AR1B 5D4HA 2MTAA 2FQFA 2VMJA 3ASNB 4NB7A 2GIMA 2PPEA 2UXTA 2CUAA 3NP4A 4Q89A 3S8FB 2EINB 4BDVA 5I6KA 4UANA 1FFTB 4BWWA 4DP2X 1V55B 2HX7A 5I6NA 2H3XC 1KYAA 3NJLA 3AW5A 2VW6A 3FQYA 1PNDA 1AZUA 2HX8A 4M4RB 3QJUB 3ZIYA 3UACA 3FU8A 2UXFA 3V9CA 3S3DB 1WAEA 3AY2A 4F7KA 3PAZA 2FQDA 1T5KA 5PAZA 3WIAA 2VSMB 2GC7C 2HXAA 4DP6X 4EF3A 3IN2A 3QJVB 1OCZB 1HAWA 3NJKA 4CSPA 3CVBA 3N2JA 1NWPA 2IH9A 1ETJA 2IWFA 1KDIA 3NP3A 1KDJA 3OMNB 1NDTA 1ZDQA 1W8EA 1JERA 4A2HA 2FTAA 1JXGA 1NPNA 1IBYA 5B1JA 4P5SA 2VW4A 1DZ0A 3QQXA 3T71A 4DPCX 2N0MA 1BYOA 3EH4B 3FYIB 1URIA 4A66A 1MZYA 1MZZA 1XB3A 2BO0A 1V10A 1RCYA 2BP8B 4YSUA 3QPKA 4DPAX 1AQ8A 1ZPUA 1GSKA 2DYSB 1ZIAA 1QNIA 1PZBA 1NIFA 2GB2A 5B1AB 2I7SA 3G5WA 3NSYA 4YL4A 4HIPA 1PLAA 4DP7X 4E9WA 4GP5B 3EHBB 5E9NA 2UX6A 1TU2A 4HALA 4X4KA 8PAZA 1XB6A 3NJFA 2GHZA 3OD3A 5PCYA 3ERXA 4A2DA 5I6LA 1CYWA 1SNRA 3EF4A 2YARA 4A2GA 1ET7A 2FT8A 4YSPA 5TK4A 4N4YB 4W9ZA 4AKOA 1OCCB 1AZNA 1AS8A 2J55A 4AI7A 1AS7A 3AG2B 3WNIA 1L9RA 2IAAC 4Q8BA 4PAZA 1IC0A 1L9QA 2TSAA 4YSAA 2IDQA 1BQ5A 1PF3A 2QDVA 4YSOA 2CCWA 2HRHA 1PMYA 1NIEA 2XXGA 2BHFA 2I7OA 3U25A 2ZOOA 4YSCA 1A65A 1OE2A 2FJSA 1CYXA 2PLTA 1WA0X 1XMEB 2VSKB 2LLNA 2OV0A 2PCYA 2VM4A 4QKTA 2FNWA 2PPCA 1J5DA 3DTUB 2WSDA 4DPBX 2J56A 1ILSA 3NYKA 4YSSA 2Q9OA 2W88A 3MX0B 2AZAA 1RKRA 4A67A 4YSDA 3TASA 4ENZA 1L9OA 1UATA 4E9XA 3HB3B 1KV7A 1W6WA 1FWXA 1GS8A 2DV6A 4L0PB 1CUOA 4AX3A 4CSZA 5B1JC 1NIAA 4M3HA 1AANA 3X1GA 1GYCA 4KO6A 5AKRA 4JKNA 1X9UA 2YAQA 2GBAA 1DYZA 2PP9A 2XLLA 3FSVA 3IN0A 4HCIA 4BWTA 4E9SA 3UABA 1AZCA 4KNSA 2BP8A 4HZ1A 1WA1X 1IUZA 3WG7B 1AACA 3KW7A 4GP4B 1ASQA 1MG3C 1PZCA 2R7EB 3FSZA 1A4CA 2MRYA 3SBPA 1N70A 4KOBA 3TA4D 1B3IA 1SFHA 1NTDA 1XB8A 4DP1X 1M9WA 3PAUA 5I26A 3T6WA 2GC4C 4A2FA 2FT7A 3SBRA 4HHWA 3ZBMA 4G7RB 2PP8A 1SHXA 3WKPA 1IKOP 2BP0A 3FSAA 4G7QB 3AG1B 4BDVB 2CBPA 1E67A 2FQGA 1J9QA 3QJTB 4KOCA 2XU9A 2HZHA 3PXLA 4F2EA 4JHUA 1SDDB 1E30A 1AG0A 3JTBA 4ZK8A 1BQRA 2BW5A 5B7EA 1BXUA 1JVLA 1HFUA 3PLYA 3SQRA 4G72B 4E9YA 1JXDA 2IH8A 3N55A 3OQRA 5I5MA 2JKWA 2FT6A 2Y1AA 3NJMA 3UGEA 4G70B 1GS7A 1R1CA 1JZGA 2XVBA 4DP0X 3S8GB 2YAPA 4YVNA 1PAZA 3BQVA 1WS7A 2ZXWB 4K9JA 2WO3B 4TXVB 3FPYA 3NSDA 2RACA 5TK2A 3TU6A 3TBCA 1ASOA 4BWUA 2XXFA 2ZONA 2XV2A 3GDCA 3EH5B 3FYEB 2TSBA 3AG3B 2EILB 2P80D 1ET8A 1NWOA 3IE9A 1ASPA 4DP9X 1E5YA 4AKPA 1BQKA 1L9TA 1JZEA 3SBQA 5IY5B 3D12B 5I5IA 1EHKB 4DP4X 3EH3B 1JZJA 1N68A 2IWKA 3FU9A 1JZIA 2Q5BA 2PCFA 2XV0A 2A3TA 1ZIBA 6PAZA 4F2FA 5F7BA 3S3CB 4HAKA 1I53A 5I6PA 2IDFA 2QPEB 3FU7B 1OE1A 3FQ1A 4KNTA 1JVOA 1AIZA 2NRDA 2Y69B 3C75A 2QT6A 4W1TA 2H5UA 3QJQB 1J9TA 2AVFA 2XX0A 2VM3A 5B7FA 1GY1A 2WO2B 1SF5A 3CDZB 2R7EA 5B1KA 2DWTA
chains in the Genus database with same CATH superfamily
3AWGA 4PJ7E 1J0JA 3IGKA 3KPMB 3ZMNA 4FQLH 4XCEB 3BKYL 4YDIL 1F6FB 1OVZA 3ROLB 3BUYB 4YWGH 1MJ8L 4G6KL 3J8F7 3HI1A 4QUOA 4UYQA 5BS0B 5DMYA 2BWIA 3IJHA 4U1LA 3FHQA 1M1XA 1AQMA 3GGWB 1OGTB 3ZZLA 3ULVH 3WNJA 1S7VB 3ABGA 3UYRL 1F8TL 2RHEA 4FFVD 3RI5F 4X8JA 2EABA 5LNGA 5FW6A 4YNYA 1FL5B 1TETL 3DI3B 3DX2A 4PJFB 4PJ8D 5F0PB 2AJZA 3WFEL 4TTDD 4O2EB 2G5BB 3C60C 1FC1A 2G2RA 3IAPA 3ZKMC 1UH4A 2BZDA 4X7CC 4K7FA 4KI5D 5L6YH 2X1PA 1XCWA 1TLMA 2APBA 2EEAA 2RTTA 1QP1A 2XV6B 3NIDB 5J89A 4K3HA 3FH7A 3L5WA 4PRHA 2VR6A 1ND0B 5JOFB 1F97A 1UM4H 1I82A 3G08A 1CF8H 3F5WA 4NM8H 4OGXH 2X70A 4EDWH 3VD1A 1MAMH 3T3ME 5EO0B 2ORBH 3TO4A 3ZDWA 3WNKA 3GLZA 2R83A 3LN5B 3GRWH 4ZQTA 1AVAA 4A6YH 4N8UA 3L9BA 4O02L 4AYMC 4D0DA 1NCDL 1MCSA 1KCWA 4I5BA 4LLYB 1U92A 3BZEB 4YPGB 5IJKA 2MCPL 1R6VA 3A4EA 4WEMB 3EKCA 1G7HB 4XPFH 3QNXB 3LN4B 4Z3IA 2NY1B 5AG8A 3HTLX 1Q9WB 5H4YA 5HI4D 1GIGH 1JVKA 4CNIA 5F88A 4CKQA 4PJFF 5C0CB 1DBAH 3QWNA 3WTXA 4BUQA 4HWBA 1GYVA 5B38A 1UA6L 1ZLSH 1CYGA 1LWHA 4HUUA 5FOBA 3K5RA 3WCYA 1SJMA 3SE9L 1AO7A 2YXWA 2EEFA 1NAKH 1S3KL 2F7RA 3IU4L 1YPZB 3H7BA 5FM4A 1EEQA 2Z93A 4KHXH 4XH2A 4F2MA 4QLWA 5GZNA 2ZCKL 3K4ZA 4H1LA 5KBLA 5DSCB 1HQRB 3JTSB 3CIAA 3MV8D 4RBPH 1JK9A 4JG1L 4I2XA 4XAWL 1HWWA 4LFHD 2OTUA 1H9DA 4ZW3A 2HJLA 2IPKB 4BCXA 1SXAA 3TYGH 1U9KA 1HN1A 2KZBA 3OB0H 3M17A 6TAAA 1E4XI 1ONQB 3GJFK 3IFOB 3LIUA 4FG6D 2Z6FA 1EVTC 3N40P 2XX1A 2V9UA 1FIGH 3LN4A 4MKMA 3HPLA 3W57A 4HMEA 4KRPB 4L3EB 1XGRB 3QCUL 4G3YL 1TEFA 3UADA 4L8SB 1RZJC 4O9HL 4CKVX 3QCVL 4MJIE 5KJ4A 1HOCA 3UBHA 4GRWH 3MV8B 5H37H 1XGYH 4LCIL 5KS9F 3FMGL 5E0QA 4N28A 1E4KA 2V5MA 3FQRA 4BH8A 4FMVA 1K5WA 1JOIA 5KYWA 2BW4A 3UTQA 2GJ6D 5MENB 3DBXA 1MI5A 1SVZA 2HT3D 3IKKA 4FG0A 4DWHA 3C5JA 3O81A 2WXOA 1TYRA 1I4FA 3BKJH 3II1A 3RI5K 1M56B 3MXWL 1QHQA 1OGAD 2FNBA 4Y4HD 3KYKL 5DZLA 1AC0A 5MEQB 2QQKH 3ARDA 1PCSA 3GPSA 2ZE0A 3EOTH 2HT3C 2N01B 4PRPE 1QFHA 4OLUH 4OLZL 2GEQA 4S1DC 3ULVE 1JF1A 1KPUA 4PREB 4UNVA 1TQWA 2ZX8A 4JX0A 5KSAD 5JW5A 3ASOB 2OSWA 1HNFA 5LQBH 3H42H 4XMLL 5AWNL 1CFQB 1NL0L 2AFNA 2ZYIA 4KMTL 5DLMH 4WFHD 5E7BA 5F9WC 1OAUH 4XMXA 1F4HA 4HZAA 4MA1C 4NDMB 1A25A 5J1TC 4JE4B 3OGCB 3U7WH 2FWLB 3GTTA 2X40A 3JWOL 4IHBA 5CZXC 5KBDA 1XZ0A 1X5XA 3UTZB 4N1EA 2G9HA 5KOVC 3AXLA 2YAMA 4UB0L 5HI3D 4G3YH 3C08L 5EB9A 5EC1A 3P9MA 3STZB 1SOXA 3AB0C 3AREC 2BS8A 3FF7A 5GJTH 3MRLA 3ZVVA 3V10A 2AP2A 2MWCA 1KJ2A 4Y16D 5CWSA 1ZRUA 4KTEL 1TEYA 2VIRB 3A21A 4P46A 4DOHB 4E42A 3FU8A 4LLDB 2WAQA 2W95A 3GEFA 3S3DB 3M7OA 2DMKA 3L5XL 1NFAA 3TWCH 5FCSH 1FP5A 2ICWA 4APXB 3V2AR 3QJHA 4WKZA 4KJYB 2GY7B 1P6FA 1IB5A 5DI8B 1E2VA 5DEJA 3GNMH 3QJVB 4K23L 1OCZB 4PBVC 4LEXL 1ZJBA 2F15A 2VR8A 1T04A 3MGOB 4MJIA 4FFVC 4ZMYA 4ORGA 4UOZA 1WTGT 4KROB 1JERA 2QQKL 1DLFH 4RGND 3F7VB 4YUEL 1TZOA 3KLKA 3ZKMD 3S3SA 1U8HB 2FD6L 4QKXB 4EUPB 1DE4B 3PWVB 5A2JH 2WOBA 2H0FA 3U1SH 1ZE3C 1RZ8A 3MRLB 1BGXH 4ZQKA 3D2TA 3SKJH 2GTWB 4PBDA 1S7WB 3QPKA 4GSDL 3M86A 3VNYA 4LSSH 3LRGA 2LFGA 1SOKA 3K71B 4CNIB 3ZE0F 2DQJH 1Q9WA 3DXAD 3RL1B 1SN5A 1KTRL 4LNRB 5DK2B 4OM1L 4NN7B 4RAUB 4ZS7L 2GCYB 4CN4A 4U6YB 5BW7A 2F8OA 2CKBB 5A2FA 8PAZA 3NJFA 3RKPA 4D0DB 3OG6B 3UOAB 35C8L 2JJUA 1S7UB 3DK2A 2ZXQA 1JF6A 4P46C 3SQOH 3VSUA 1LQSR 3WFEH 3FN9A 3KBHE 1BFTA 3L1OH 4PJ7A 4TVPH 1Z9SB 1JN6A 2XCMC 1E4WH 1DSYA 2F53E 3HB3C 4PRHB 2CJUL 4YSPA 4AC2A 2K6WA 3O4LB 1IVTA 3JWNG 5CP3A 5CD5D 1PSKH 3PAYA 1A4KA 4QDGA 1VENA 4H8WH 4N2NA 3WEOA 2EYSA 2IO5A 2OMYA 2XPYA 3EHBD 3JV0A 5LAXA 4YSOA 4RGMC 2CCWA 1OB1B 2CU9A 4QXUH 3R4RA 1WCQA 2D7MA 1AZZC 2X5PA 1BOGA 3NZ8A 3RX9A 4CBPA 3MBXH 4PYGA 2YK1L 4HV8A 4YSCA 3DIFA 4ONHB 1CYXA 1L0PA 3G6JE 1H15A 3KNBB 5BZWB 2VDML 5E4EC 3ZLQC 1TJMA 3G5ZA 4JFXA 3KR3H 1U6AH 1CDHA 4I8DA 2AQ1A 3BKML 4P3CH 5J6SA 2ZJSL 2ZYRA 4OB5L 3MV7E 4OLVL 4QRPB 2ZXAA 4Y19B 5E2WH 1DSWA 2EH8H 5C08B 2A5UA 4WIQA 1OAQL 1NLBH 5DFAA 4OFIA 4X7FC 4JHAH 4Z23A 1ZK5A 3TPKA 5FPIA 3VD4A 3U2SA 5FYKD 1F6AB 4AYSA 1UXWB 2GITA 4HWBL 1YEDA 5DMJB 3WJMA 3LEVH 4WW2B 4L2LA 3E1ZA 3QDAA 5BRQA 5IQOA 4O2CA 3OKDB 2LLLA 3W39A 3CXHK 2Y1VA 2MOGA 4E9SA 4U2ZA 4ELMF 3CMGA 4RQQA 1RP8A 4Y5VC 4OCYH 3VGDA 2Y7SA 3D06A 1V3MA 1L3NA 3FT4B 4DN4H 2J8HA 5HGAA 4BFJA 1XBDA 1VZGA 3G6JB 4LDLB 4TQEL 5T1JA 4G11A 1WUNT 4ODVL 1ZHNB 3VXUA 1U8PA 3L48A 1T20B 3QUYD 4RVBA 5JHBA 5IKCB 4R5VA 3UZQB 4CN6A 4HH9B 2VABA 3BAXA 3C6LD 4W4NA 2GC4C 3T6WA 3MRHA 1H19A 3J7HA 4X7SH 4KTDL 3QIBB 3Q9PA 4QXGL 3B9KA 3QJHB 1RJZB 1XSOA 2ZP9A 1HXMB 3HG2A 2Y6TE 4KOCA 2R2HB 2CSPA 4BD4A 2AK4E 1IU1A 4EBQH 5SWSE 1WZ1L 4JUSA 4KZCA 2B5IC 5FYJU 4OTXH 1THAA 1OD7A 4KITB 4TSCL 3OQRA 3TBVB 5GS0D 2IF7A 3P3RA 1ODUA 4NBXB 4OIBA 2EIBA 1OXYA 1L7TH 4NFDA 1A6WL 4N9GA 3TV8A 5L8JB 4I3GA 5EC2A 3W0WD 4FL4C 1LO2H 3PE9A 4FD0A 4HKBA 3V4PA 5ETUB 2IBZX 3I6LD 1WISA 3TVMB 5FYLD 3IU3B 4C83A 4EI5A 1T1YA 1CL7H 1YMME 4R5XA 5DRNB 2IADA 2WO3B 1RUML 2NDGA 1TR7A 3KPPB 4UOQA 2OYPA 2V9QA 5A2CA 1CDJA 1A4KB 3ECWA 1TTAA 5HVHB 2NNAB 1FN4B 3PNWA 1GRWA 4HJ0C 1VIWA 4TUJA 1FVCA 2H3KA 5BS0A 5EF1A 2Y23A 1DCEA 3K4AA 4H8PA 3FHEA 4FN0A 1V05A 2XTJB 2BCKA 4HU2A 4QY8B 1S7UA 1RERA 2PNDA 1XF2B 1MREH 4XAKD 4OF7A 4F9PA 4XZUA 1MWAL 5EU3A 5GRUL 2APFA 1MRFH 4ZMAT 1OTTD 4NKOB 1E9PA 4GUPB 4LBEB 5HGGS 4B9CA 1JV2B 3GUTB 1G9EA 4TULL 2GYSA 2ZWZA 2NY4C 3OPUA 3S88L 5DK2A 2AMGA 4AVIA 1TTGA 4R3SA 3WY2A 1OAZL 5DFVC 3SKNB 3D85D 4H2CA 4X6BB 1B88A 4YC2C 4ZFOB 1YYLL 4MSWA 5KYXA 2RBLA 2R27A 1VFMA 5AOKA 2WLZA 4IK7A 3OMAB 3K6IA 1GGTA 2GTWA 2GSIA 2HH0L 3PYCA 2A9MH 3JVGC 4M62H 1CQYA 3AGWA 3M1BB 3V5DB 4M61B 5KVEH 4ZTOL 1U8LA 4PWEA 4IEFA 3GIZL 4FYQA 3APFA 4P5TC 3QZMA 5F21B 1FL3B 4R7DB 4GRMB 2ATAA 3LKQB 4C56A 2IOOA 4H20H 3GSXA 4L9LC 2M1KA 4P2OA 3OJDB 3CD4A 2R4SH 3NCJH 4FKEA 2WPGA 4DGWC 5E23A 4HT1L 3CZKA 5A2BA 3MODL 3S37H 2IBBA 5AW4B 1CE6A 1OZTG 4KXAA 3UBXI 2Z8VC 4Y2DD 3ARWA 1DJHA 2WZ0A 2NR6D 3ARVA 3AZUA 1FCCA 2EECA 2DICA 3PHQB 1NICA 1YNTA 3KVPA 1T20A 2AXGB 2VXTH 3FL7A 3EJYD 5AZ2L 3BWSA 4OCNC 1NBYB 3L3KA 5I23A 5JHAA 4FXKB 4D9QD 2OZ4L 5J3HD 3IDXL 4N3UA 3D08A 4HOZA 1EMTH 2YPKB 4PGJA 2OXGA 2DLGA 2OMWB 1JP5A 4J4PD 4Y2DB 4F7TA 3VXNA 5MERA 3NGBB 3FFCB 5EIIB 2VWEC 1DBBL 3ILQD 4P5MA 1BQHA 3X14A 5ESAA 4PRDB 5DUML 2P7TB 4OGAD 3OHXB 4K94H 2Z8WC 2PYFA 1HHJB 2ED6A 4WW1A 3L81A 5D7LA 2UXGA 1J05A 5D72H 5BQ7A 1YYLH 4HCGA 3DX9A 4Q4EA 1CIUA 2OJ1A 4E9VA 4QHMA 3EYSH 3F05A 3LD8C 5AZUA 3QIUC 3BDXA 1E3ZA 3MLZL 5ICUA 4YPGA 3ILDA 4W4OC 5KSAC 1YEFL 3L3OA 3C5SB 3WJLA 1SLUA 3TO4C 3EH1A 4WCYL 3TPUA 3NIGB 3WL9B 1P1VA 2P8PA 4IRZA 3OZ9L 3N85H 4KDTA 1UQSB 4XO4A 2QTVA 1INQB 3FF8A 4D0CA 2IG2H 1K8IB 5DUBB 1QI3A 1VPOH 5CLWA 4AL8H 3RUGB 3NJJA 4N87A 4XP5H 4ZOAA 4OQ1A 4G8FA 4JPKH 2GJ6A 5C09A 5J57B 4DTGH 3NSFA 3VSVA 3LYRA 4DF9A 1JPFA 1KN4L 3I2CL 1ZDSA 2ZICA 3GSRA 4GYBA 3TEZA 4N0UB 4MA8L 4K3DH 3QEUB 4PRBA 5J9PA 1UYWL 4BCZA 2VLRA 4J3UA 1D5IH 2JLLA 2K78A 2RCSH 4PRAA 1F3DH 3RIFF 4BEIA 1TETH 2WIMA 1NBVH 1P5UC 4N5EC 1FZKB 4JO1L 3LMJH 2HA1A 1Z0MA 2AQ2A 4ZUTA 1DJXA 1JZDC 2JKXA 3G9AB 3HUJF 3L3GA 4FE9A 3MBWB 4GSRA 4XNMA 4DQOH 1MCHA 2W81C 4NP9A 4XE5B 2P8LA 1PNCA 1HNYA 2WY3B 1FG2B 1R3JB 2X1QA 2YR3A 3C5SA 5BZXA 1HH9B 5HYFA 2D9CA 4KUCF 1I7ZB 4MHHI 1RUQL 1CD9B 3PWUB 4X7TB 4K8RD 3CG8A 1XF2A 2AI0H 2FLMA 4DZBB 3OPZH 5TDOA 1I8KA 5GS2D 1H8SA 4TSBL 3US1A 2D31B 1E5ZA 1JHLL 4HFUH 1I3RA 1NFDA 2MMXA 3QUZD 1WH0A 3SDCD 1QPPA 3KLHC 5FF6B 1GZPB 2I32A 3ILPB 1HSBB 4Y4FD 4Z7WE 2EC8A 5IB1B 1SFDA 1CIDA 2QSVA 2A6KA 1W6LA 4LT7A 2W9DH 4TMPA 5GRXG 3ULVD 1B6UA 2WCSA 8CGTA 4NKQB 3KDPB 2XA3A 4C83B 1LO5A 3UTPD 3C6LB 4EI5B 5IT2H 1LE5B 3PF2A 1RK0B 1I9JH 5FA3A 1QSFB 2C3GA 2Y7QA 4RWYL 4JRYB 5FCUL 4IRJB 5C0CA 2Y72A 2CPUA 25C8L 3QQDB 3NCMA 5C0RH 1GXEA 4XZ4A 1F4WH 3QHFH 2H0EA 3HHSA 4IDJH 3S35H 1U8IB 4AIXA 3INUL 5L8KB 4DP8X 2BNQA 4Q2ZA 4X6CE 3ZMRA 1MDAA 3W9DB 3UIZA 4MQSB 1GH7A 2ITCB 1AR1B 2OK0L 4YHPB 5D4HA 4GUQA 4XAKE 1MFCH 2F0CA 4Q14A 4IU3A 1O5PA 4U1IB 5EF2A 1OALA 3PIQB 4G6JL 1E5AA 2GSGB 3JV6A 2K9UA 4AQ1C 4AT6B 5IJVB 4GRLA 2O61A 4H5SB 5B22A 4PG2C 1NEZG 5FXCH 1FNSH 3AW5A 2TRYA 3MREA 2E6JA 4XNQA 5HHMD 4Z77A 1U6AL 2JB6B 2VZ1A 5D2NB 2AK1H 3ETBF 4PJAF 3TVMD 3LN9A 2W91A 2YIHA 5MERB 2H6PB 3K6SB 1IGJB 2E46A 3CXHJ 1FORH 1BFSA 4HSQA 5C3TA 3QG6A 4LRNH 2V9RA 1CPUA 4OCLC 4ZFGL 3RFZC 2G2NA 3HPJB 4M8QB 3WIAA 3DVNA 2EVIA 1DDHB 2JJTC 4J3OC 4JHWL 3HZMB 3EJRA 2KL6A 4TQIA 2X0UA 3QNYA 3RKDD 3NP3A 1PFCA 3WDIA 1XIWB 3FTGB 3IDGA 4MKTA 4ZD3L 1XIWC 2ZKHH 3T71A 3RPKA 4LLMA 5EU7E 3VQ2C 2R0KH 4DKFH 2I5YH 1PG7X 2NY5L 3BD3A 5HYQB 2BNRE 3QRLA 2OPCA 2VT0A 2AQRA 2YOAA 1E8YA 4TUKL 1ZMYA 1H3UA 1AFVH 1N10A 1NM4A 1W16A 3EJZC 1M05A 3LPFA 4FFZA 4P2RE 1HL4A 4GRMA 3DHJA 3H1ZA 4PJEA 1L5GB 3VE0B 3N06B 3WHE1 3K74B 4U6HA 5D71L 1NJ9A 3NSYA 3LV3A 1PLAA 2Q3XA 1T2QH 2Z31C 3VGAC 3O8XC 4IGBD 1KY7A 4L4TD 3ASWA 3WD5L 2HUHA 3U9PH 4X9IA 1I1FB 1OSZB 3CX2A 5EZIL 3DHUA 2PCPB 2WP3T 1QBBA 2CG9X 3WENA 3BDYL 5D1ZA 3V7AE 3SKJL 1JWSA 1ET7A 5EN2B 2J12B 4H1LG 2NY0C 5D5MA 1E9PB 2DQUL 4HUNB 1X5HA 1N4XH 2PW2A 2ZWKA 3IDMA 5BRZD 3BLPX 3I6KB 2P5EB 2EO7A 3MBEB 1JXJA 2EDMA 5F1IA 2YSSA 1KSRA 3Q0HA 2MPAH 2FIRT 2XSKA 2BVYA 3R0MA 3S5LA 1JNNH 3LZLA 1RUPL 2NX5E 1FZMA 1Z9OA 5T3ZD 3NTCL 2QKIB 1PMYA 4IRSD 4MJ6B 3VFGH 2AJVL 2JSFA 2ZOOA 1P0SE 4FFZL 5IFAH 5E00B 4B95C 2VM4A 4QKTA 3B8SA 4KV5E 2PPCA 5ELIA 5IHWA 1WFNA 4IU2A 3L4YA 4JDZA 2BNRD 1YNKL 2JNZA 2F5BH 5DQDH 4ZMOA 2JK5A 1QQDB 5GSVA 4FQHA 3QG6B 4OCYL 2CLZB 4PJHF 3D05A 3KPSD 3VXUD 5KTEL 4YLQT 1FZJB 3NCXA 4ATWA 3Q3GB 5IB3A 1C7SA 2BDNL 3AROA 3WLWC 4WW2A 4Q9RL 4PRDA 1FWXA 3LS5H 2YXMA 2VXQH 2DV6A 3KPNA 4H5SA 2WN3A 5I1EL 1Q90A 4TLTA 5J6HA 1LD9B 2F7QA 3E8UH 4JY4A 5HHXH 1G9MH 4G9DB 3B9KD 2QVKA 5JQ6L 4Q52A 3KWVA 1IGCL 4ZMQA 3RQ3A 1K4CB 2VDOH 5FYJL 4ODTH 5EV7A 2G60H 3UZEA 5JO5A 4BQCA 4TUOB 3T09A 1ZA6A 2BP8A 3QB7C 4WU7A 3RVXC 3BKMH 1DEEA 4P3CL 2VLRE 2APVA 4JZNA 5E70A 5L2KA 4GP4B 4PGDA 3MOAL 3X12B 5A2LH 3BAYA 1QFWM 5ISZB 3QUZC 4FNLL 2WZAA 3AY4A 4HCRH 4QXVA 5EWIH 2FZ3A 3LKSA 3KLHD 1DL7L 2YSSB 3KLSA 1B3IA 4JRYA 4XN5A 3RWDA 4DESA 2VDLB 2J71A 4BUHA 4YBQC 1FNGA 1LXMA 1HL8A 1NCOA 1TQBC 4AGQA 2LR4A 5GGRY 4LGPB 4YDLC 4Z6AT 1ETZA 3PS6A 5EOQH 3HOGA 4OD3L 1NAMA 5HBBA 1DLHB 4YK4B 5TQ0L 3BCDA 3H9SA 3EYUH 4KRPD 5IMKA 4QPEA 4I87A 4YAQB 2P48B 3A47A 3ATAA 4MJ5B 4YBQD 1OCWH 3QH3A 3HZ3A 3EJZD 4EAEA 2HLAA 4EIUA 2CKNA 1JTPA 1GYUA 2LAAA 3PXLA 1D7FA 1GMIA 4GT0A 5GGTH 3V79C 4J3SA 1MOEA 3FW6A 3IVKA 1UENA 4UQAA 3MA9L 1CLZH 4KXZH 1UOKA 2Y25A 3SQOL 3WNMA 5KBPA 1OTSC 2NNRA 4PSPA 4FHKA 2FBOJ 4NHUB 1O9WA 1XZ0B 2FO4A 5BPPA 1F00I 3ISRA 3OAUL 3Q6GH 4GUPA 4LBEA 5AB9A 4IRZH 3QCVH 5E6IB 5HYQA 2OSXA 4PRPD 4E36A 2QQLL 2ADYA 4NKDA 5FUOH 2V8LA 3DTDA 3ZQWA 3CPLB 1WIUA 1FIGL 3D85A 1BD2B 3I3BA 4P5KA 2F74B 4ZAKC 1JFQH 5E95B 2IV9A 2HKAA 4H8WC 4WAFA 5FCUH 5IMKB 3FH8A 5LGHL 1BBDL 5IG7A 2LAGB 4LLUB 4JKPL 3HJ0A 3EO1B 5K9OA 4LB8A 1XGUA 1HEZB 1T4KB 3D12B 5SX5H 3CLWA 2YZ8A 1HINL 2R23A 3DBSA 3T5WA 4C56D 1Z2KA 1Q9LA 5KVMC 5EOQL 2J2ZA 2PCFA 3GO1H 2VERN 2DIJA 1JAEA 4QF1A 1BVNP 4IBVA 3QIUD 1CFVH 4H0HB 2IDFA 4NC1C 4X98A 5B8CA 4FLQA 4UDUB 4TUOA 2C7UB 1IQWH 2XN9B 4H8HA 4ELKA 4Z7OF 4NM4L 4WI8A 3VG0L 4ZS6D 4CSSA 4Y4KC 3P54A 5IHBA 4YC2B 5I1LB 4TYUA 1Z9NA 3IXTB 5GJSH 1C9SA 4WI5A 4NAJA 5TPWL 1AKJA 2BMKB 2K7PA 4JR9L 3VCLA 5ACZA 2G3MA 3MCKB 1PZAA 5ISZE 1FFRA 2W8CA 4UQ2B 4TF4A 1MSPA 4WTZG 4U7SA 3QEGL 5FW7A 2JKJA 3LH2H 2Y06H 1J8HB 5LN4A 4MYPA 2PPFA 3RJOA 4IM8A 2JFCA 2Z31A 1CC3A 2BC4A 3KWWB 5G4OA 1ACYH 5BV7B 5I16B 5JPMA 2BWDA 2BY2A 3UERA 5C0IB 5DVNA 5F9AC 1ADWA 3WN5B 4UCFA 4P3WA 2EDBA 3K2UL 4LOUD 5AVSB 2ZXCA 2A9AA 5C7ZA 5ICXA 5HHOE 3L6FB 3P3YA 5FECA 5F7UA 5E1GA 2ZKXA 3FCTB 4ZX6A 1OF0A 3KCWA 1WFUA 4ZDHA 1CFQA 3SE6A 3NQIA 1IE4A 4IDLA 1RAMA 3VVWA 3VFMB 4KY2A 4AEFA 2VKXA 5D1QA 2WM0A 3QAZC 3P4OA 4KK9D 3VTAA 1AKJB 3Q8CA 1MCWW 1SXBA 3WKNA 4NXSA 3JQOB 3UMNA 2NXZC 1S8DB 4ATTA 4FDWA 2Q3AA 3HE6B 3QUHA 1CE1H 1WA2X 1ZD6A 3WIFA 5FHBL 1AXIB 4QHNA 1K3IA 1QRND 1WT5A 1N4XL 4NN5C 1N5AA 1I3GL 1OTSD 3LQZA 2YKLH 4ABWA 1S7TA 3T08A 3H4HA 3PWPB 4AE1A 1RXLA 5E5MA 3BIKA 1HE8A 1J8KA 1JDAA 2Q7YB 5CXPA 4XNXH 2CR6A 4I77H 4MMXB 1H3XA 3GJFA 3OL2A 1CE1L 4KVNL 5BXFA 3LKPB 1OD9A 2RFXA 2FBRA 5BRZB 3CHOA 1KB3A 3O9WA 3V4UH 1XF3B 3G5XA 4MLIA 4XNYL 3U46A 1SXZA 2I24N 3U83A 1ZV2A 5D93C 2RD0A 2EE2A 2UZYB 5JDSA 2AQQA 2Q6WA 4GBXC 3GXTA 4OCMC 4UV7H 1N5YH 4G9FA 1F11A 1TT6A 4NZFA 1UGKA 5FYLH 2J44A 2F2HA 3RZWA 2VW7A 4S2SB 5IB2B 2BCKB 4KUCD 2X4UA 3ZU8A 3T0EE 2AQPA 3O4LA 4PJXF 4JHVA 2KLTA 4ETQB 4B41A 5CR8A 3NEXA 1IGIH 5MP6H 4BCYA 1AKPA 4IMKC 4PGDB 4OQTA 5EBGA 2YUVA 3PCYA 1JK9B 3BI9X 4BM7A 3X11A 4XAWH 1PLBA 1Z3GL 5CJQL 4BBWA 1B6DA 1F02I 1PCXA 4PW9A 4AYEC 4LSQH 2YUXA 4QRSB 1QLEB 3FKUS 5J12C 2ENYA 4CA4A 2BOBB 1EWHA 3P2BA 3V95A 4JFHD 3PQYD 2C1PB 4PVBA 4PCYA 1FBIH 1YZZA 1A9BB 1OCOB 2O5XL 4HIHB 1J0ZA 3FO9B 1N8OE 4E41A 4HG4K 1YAZA 5EC2B 3T4YB 5E1AA 3V6OE 3P2DA 5ESAB 5HYJE 1HX0A 3FTZA 3N9GL 3QQ9C 3R0NA 4UMGA 2HFGL 4X2UA 3PPSA 5I8EA 1QSED 2CGRH 2ZSWA 4L3CA 4CADA 3QI9D 2COVD 3MCKA 2AZUA 1CTMA 3CFDA 3FHAA 1RD6A 4N90D 3DETC 3ULUF 3KWUA 3GINA 5HGDB 5I9QC 4BZ2H 1IQWL 2YAOA 5DHVH 5F0MB 2P26A 4QRTA 4AQOA 1H9VA 2VN4A 5DZNA 1MRFL 4KJWD 3IKCB 2QGCA 4LKCB 1N3NA 1WC7A 2HVJB 3SGJC 3DOHA 1GY2A 1X3DA 4M7LH 1KGYE 4DH2A 3GMNA 3VXQA 3W5NA 3UTPE 3VI4F 4MQXC 4Y4KB 5HHVL 3WUZA 5K9JL 2IQ9L 4HISA 3LX9A 5EU4A 2WLIB 2OYLA 1HSBA 4JCMA 4CBZA 1KC5L 4N2MA 2O6PA 1JCKA 5LCVH 3KZ8A 3TBTA 4M5ZH 2FR4B 1IZKA 1T1XA 3UMTA 5ERWB 1NUGA 4CW1B 1CG9B 1MHEA 2AW2A 1WBXB 3OX8B 4JG9A 2CH8A 3CFCL 2BNQE 5GRYA 2JKTM 1J9RA 2OJEB 1MH5A 2QVFB 5IBLD 3UTTA 1MJUH 4N1HB 3UJIH 3QDMA 2IH3B 5C2BL 1UB6A 1FRGH 5K33A 4OZGB 4NO0A 2XTJE 1Y0LB 1JMXA 3ROOB 4LKXB 4HXBL 4Y4KD 4JNXA 3ARGB 4RFOH 1I7ZA 4IW4C 2BX5A 3VU1A 4R7XA 5TE7L 1CK0L 3TV3L 4JRXD 1EAPB 2QV4A 4LPCA 4DUWA 2FLBT 1I3UA 4KKLC 3EGDB 3D0VA 1YC8A 4R83A 4FQQA 1ZGLM 5JPNA 5E9DA 4PJDB 5D7EA 4ZYKB 4Z78B 4QXGH 4CVXA 3HG1A 4K3EL 1YDPA 1KCSL 1KG0B 1CTOA 5LGKA 1QLRA 5HDBF 1MCKA 3X17A 1FNEB 1X5LA 2Z7ZA 1NWPA 2IWFA 3B5GA 5F7HA 3L5IA 3LMJL 2AEIT 2WVVA 5ID1A 2AJXH 4KMQA 2IANE 5ESVA 1ZGLB 3A67L 2WMPB 5D1ZD 3HI6H 3VGGA 2Z35A 3GJEB 4GAFB 4GXUM 4L5FH 3ZO0A 2QKSA 3K1DA 2BP3A 3PP4H 1NC2A 1QSVA 5D7KE 4OF3A 2QPUA 3U46B 3R1GL 5BRZA 4YFLF 1UM5L 4HS6B 4BZYA 1E4HA 4JQVC 4YSUA 1MLBA 2W9EL 4DPAX 4NO3A 2X4QA 3OKOA 2NXYD 1AQ8A 4P2RA 4QOKE 2HWZL 5JA9A 1YEKL 1YJDH 4ZXBC 2HJFA 4NP4H 1PZBA 4KROD 2WWOA 4YK4C 3N85L 3QZOA 5JPNB 2JF1A 1JG9A 3OJVC 1FLTX 4WHTA 1HU8A 1TCRA 2YA0A 5CO1A 1CMOA 4EJ1C 4GQPH 1DVXA 3F7LA 2CHWA 4L8CA 2A99A 1MW0A 5I1DA 1MJJA 3Q05A 1UACH 3E6HA 2WCGA 4WU5B 2ZWYA 3CVHH 4NGHH 5I6LA 3EYSL 1ESOA 3EJSA 2FWSA 3RVWC 5LCVA 4WQOA 4F93B 1ZT4B 2FT8A 4DJMA 1XCQB 3GSNA 4FZ8H 4P0DA 4HIIA 1HH6A 4N86A 4EOWL 2D2CC 4IQHA 4MHHG 4TOYL 3VMPA 3BD5A 3NIGF 1G9NH 5H35A 2XQYG 4L37A 5J1AA 3B2VL 3HZMA 3BN9D 1NGPL 3I02B 4HKJA 1I8IB 3C6EA 5DF0A 1DDHA 5C70A 2X89D 1FYHB 3BE1H 3K6OA 1J5IA 2ESVE 3N41F 2WJ5A 4OF8A 2DQGL 1JL8A 1IC4L 3AU1A 4Z7UE 3TH3T 5JMRA 1YC7A 2FWUA 2Z7YA 1TJHH 4LVNC 2PMZA 1J5DA 3KPLA 2F7IA 2F61A 4X6EA 1QFUH 1V3JA 5E9DE 1A9VA 3ZT7A 1X4XA 2AZAA 3LSOB 3JV4A 4YSDA 4APXA 1Z5HA 2AMUA 5CFAA 1P4IH 4R2GC 4WU5A 1QUNB 4X5XB 1SXCA 2X9ZA 3TT3H 1ITBB 4Q0XH 3F83A 5IMOA 1UATA 1Q4NX 3PU7A 3ZE2E 1GGBH 4FRWA 4XP1H 4MZ2A 4NWTL 3MJGX 3E3QC 4R4ND 2IPTL 4LLVB 4AM0A 3QDJA 1VGEH 3QR2A 3TBWA 4AC4A 3ZZQA 5IK3A 4CSZA 1HZHH 3X1GA 3GSNL 3R8QA 4NWTH 2D2OA 5J11C 4QLRA 2NR6C 1MCFA 1ND0A 1R4XA 2QFPA 2GK2A 3FSVA 5CN2A 4FZEH 1OAXL 5T1LA 3T0EA 3L5WB 3T2QA 1NC2B 5BRPA 1AZCA 2IGLA 5FK9B 4HZ1A 4NZTH 5CLXA 3I9AA 1SN0A 5CJXA 3KGUA 3KW7A 4I3SH 4DEPC 1YYCA 4EXPX 3FSZA 3S36H 4YHNB 1DFBH 2A6JB 1F1GA 4YDNA 2I5YL 4JN1L 4UBDD 3IGAA 3TYFA 1LHZA 2OCJA 4LHUD 5GRJL 4KX9A 3MV11 5EMYA 4YHIB 3GXIA 3TGXA 3HUJE 5HYSB 5E8PA 1Z5LB 2CUHA 1L4IA 4PJDA 4OCXH 4Q6YA 3UEQA 5F96L 5SX4I 3TJEL 3K8MA 1E43A 4FQQB 2E3VA 4KK8C 5AYUL 2ADIB 3L3JB 1RHHB 1RULL 2C9VA 5HYEA 1RLBA 3WMQA 4NI6A 1A3LL 2CNZA 4Y2NA 4JKMA 2HJKA 3U6RA 3T0DA 4AMWA 5JXEA 4EUPG 3HN5A 1FORL 5H2BB 3KH3A 1SDDB 3SJVB 3IB4A 4WZ9A 3RJQB 3BQUC 3BSZH 1K5NB 3PDOB 2EDKA 4JKLA 1XGZA 4ZO7A 3SQRA 1XO8A 1QPKA 2PYFB 5IOPB 3T0WA 3ARFA 1QTSA 5DJXA 2K9FB 5IW3A 2P24B 1Y6KR 3BLKA 3D9AL 4U3SA 1RZ8B 4NQED 2YAPA 2RA1A 4TSCH 3K80A 2W9EH 4JR9H 4YIQB 2YD0A 4IU3B 3HKZA 5EU6A 2ARJA 1DLHA 1YEKH 2FX8L 1KTDA 4LCCC 2Z34A 3K91A 3CLEL 3EXJA 5DZ9A 3VI4E 2P4AB 2GKIA 4QWWC 3S4SB 3VG0H 1IC5H 2APWA 4XMKL 3JV4B 4S1SL 2Q7NA 4B0MM 4HUXA 2V7NB 4L3AA 5F7FA 1T5XB 2XWEA 2Y6SC 2D3JA 5K5YA 3TO2B 2HG0A 2IPKA 4Z9KB 3WE6A 3GMRA 2MSPA 2O6EA 3V7MA 1UGNA 2BP5M 2PO6D 3NEEA 1DVZA 3BZ4B 4LRIA 4S1RH 1NCWH 5FGBA 1JRHH 2DS4A 3WO4B 4PJGB 2LLGA 3MNZA 4GXUN 2KS0A 3SJVE 3I02A 2H5UA 1CXHA 2HT2C 4NX0A 2HT4C 1LYQA 5E24E 4OR1A 4GMSL 3B4NA 3FOLA 4HHAA 5TE6L 2HTLD 2H32H 2K3HA 4ONGH 4LDEB 3QJFA 1K9TA 3FO9A 4M3JA 3P9LA 4L3EE 4PPTA 2F7PA 1PZDA 1EH9A 4K8RC 4PRIB 2X41A 2IGFL 4WFED 2GI7A 2PYEA 5DEFB 2UWEE 5KZCD 4MAUH 2BHZA 1MWOA 1N18A 2ZPKL 1AD0B 2VQ1B 3OKLA 2CNYA 4KRMB 4I48B 5DR5H 1ITCA 3RKDC 5ES4B 3IMVA 3F62A 1OT2A 2BSRA 3DSNA 3QG7L 2O93L 5AW7B 5ILTH 4APQD 2WBWB 1CTNA 5EHFA 4FNTA 1QBML 1QLFB 2A83B 2UZPA 3RTQB 3ARRA 1NBCA 2HMID 1ZE3H 4Z3HA 1WO2A 2XRAL 3O3AB 1RZKH 4JLRB 2Q8BH 3FOMB 5HDLA 5KSBF 2YRZA 5INDB 1MIML 5KAQF 3ALWA 4BKLA 1RIHL 5CP7A 5KZCB 4P07A 5ABAA 1IIKA 2XQ0A 5E6UB 4GQ9L 1KWGA 1XF3A 1LP9E 3G5XB 3IDMB 4FQPA 3MBXL 3D69B 4NWUH 5SWSA 5JA8B 3QUYC 4M7LL 4PB9H 3S97C 2DLEA 1K2DA 2B9AA 4G2AA 4WTQA 2YPLA 1K72A 1WBYA 5CLZA 1A7QL 1PKOA 4ZO8A 3WS6A 1JZFA 2XVKA 3BP6A 4P23D 4PLJC 4NC0B 3QIWD 1T1WA 4G9FD 3D18B 2ADGB 3FTUA 2I9TA 3ZSTA 2YN3A 4HGKC 2X4SA 4G5ZL 4J28A 3Q6FA 1ANUA 3FSWA 5I5JA 4HPHA 1YEFH 1L7IH 1DCLA 4JCWA 3LEXB 3MOAH 2BSTA 3U2JA 2HKHH 3NZUA 2XYBA 2EIKB 4L8SA 5C0NC 1D7BA 4E9LA 2Z0UA 4K7PL 3BRFA 4MRBA 2Q3ZA 4PR5B 4X5XA 4WFEE 2YC1A 5GZOD 2YD6A 1X9QA 4K94L 3WHE0 3B9KB 5F6HI 5CD3B 3T1FA 4P8QA 2OSLA 3RL2A 5MEPB 1D5RA 3P0VH 3NJHA 1L9PA 1OEZW 5IW1B 5C0ND 4BFNA 4LSQL 2XNAA 3HNTH 1IGYA 1VADA 4ALAH 4BXSV 2WC7A 3GSUA 4HK3N 2EDFA 5ANHA 7PCYA 4LIQL 1OAKL 1YRKA 2GUOB 4OZIE 3QI9A 1IAIH 2H32A 4XCFH 2V5YA 2Y7OA 2OI9B 2QPDB 3L3HA 3QORA 2DTMH 1JGUL 3IXAA 2BVTA 4DVRH 1UZ6E 1AI1L 2NCMA 4MTMA 4QHLB 1OHQA 3MV9B 4NQDA 3PDGA 2GW5A 2BZ7A 5FS5A 1BVOA 3TZVA 4L0ZA 1SBSH 2NPLX 3OKMA 1DLFL 4PHXA 3FUFA 2FZ3B 4XNYH 2NW3A 1A22B 1TMQA 2X1OA 2WIIA 4YSEA 5CGMA 4HBCH 5T5FH 1P7KA 4FTVA 4I88A 2NMSA 4RMWA 4GRLB 1R34A 2X1WL 3UZEC 3C60D 4OAWB 2KI6A 4PJ8A 4PCTA 4I5BB 4G8GA 4EEEA 1A7RL 1ZHLA 4M62L 1RU9H 2GJPA 1EFXB 1HXMA 1GJUA 4LAQH 4GG8B 1G7PA 2JXMB 4AXWB 2FIKB 3MV9D 4BK5C 2ADFL 3CU7A 1BVNT 3G7TA 1CXFA 2BNQB 5I2IB 4PWFA 2CUIA 3BDYH 3JTTA 1E5BA 4OFQA 5FYKU 1BXVA 5F6HJ 1SXNA 3DIVA 3KLAA 3KLLA 1KJMA 2E7HA 1J5OL 2ZX6A 4L3FA 4LK4A 2AANA 5EZPA 2R1XA 4O2EA 1AGCA 1FHNA 5CEZD 3DMMB 3X1EA 4NN6B 5DJZA 2OMYB 1D5ZA 2OMXA 4HW6A 4PJAE 5CBAB 1KIQB 3F6LA 2EC9T 4X4MA 1GZPA 1MRCH 2Y5TA 4HKZB 1HS6A 3QUXB 1G6VK 3QUXC 2AABL 1BIIB 5E9DD 2R51A 1JN6B 3CVDA 3GBMH 5LO7A 2I26N 3KMDA 1ACYL 2NNFA 1X5ZA 1U93A 2R15A 5B1BB 2FK9A 2NNAA 1JZHA 4YXHL 1TXKA 1MF2L 2IJ0C 3NSCA 1TQVA 3QIUB 4LQ1A 4OLUL 1LLAA 1S2EA 3BP7B 4TNWK 4XODA 2QELA 1IFRA 1MNUL 3E6FB 1A1OA 3EOTL 3D87B 1IM9B 2UXTA 3Q2CA 4JDTH 5CJBA 2V3EA 3RIFK 1D6EA 5SWZE 1ZT7B 1W72L 1NCGA 1G7IB 3ZKND 1HH9A 1Q1PA 2X0VA 3DO3A 5F9DC 4CVWA 3ML8A 1N2RA 4NQQA 3BW9A 5HHNA 4PB0H 4YHYB 1KYAA 1TJGL 1PNDA 2Z91B 1J0HA 3IVKB 4HJGB 4JFEB 2KKQA 3UACA 1F0LA 1KYFA 4LAQL 3TBSA 2ZUTA 4KKQA 3BP6B 4KGLA 4WO0A 4EZMA 1RJCA 3OKKB 3FMGH 5PAZA 2NSMA 3TA3A 2HXAA 2MQ0A 2NY7H 1BJMA 4YAQA 1VA9A 1W91A 2E59A 3MLYH 4HBCL 4GIPD 3IDUA 4F1ZA 4Y5XB 2A7BA 5B3JF 4LSRL 5I17A 1ETJA 2BM3A 3F7QA 3HS0A 3BPNC 2H45A 5A6IA 1P7KB 4FTVB 3MSPA 43CAA 3MRMB 2K0RA 5F89A 2E7CA 5B1JA 4G8GE 2A77H 2OJZH 3N5AA 5FUZH 3QQXA 1QAWA 3W56A 3MV8E 3II3A 3HRZC 4WWKA 2K6YA 2WQAA 1XB3A 4RWYH 2JI2A 1V10A 4L8BB 4G82A 2BP8B 4WU7B 3NABL 5G55A 4M4RA 3TURA 1OAKH 1K6QL 2C9XA 3RBSA 4UQ3A 1X5AA 5CWSB 4RA0C 2QQLH 4YJZL 5I1JH 7FABH 1F4AA 2BJMH 2AEOA 2H32B 3TJHD 4DOHE 2Q1EA 3CZFB 3BDBA 4YLCA 2Q76B 2ZT9C 1SJEB 2X9YA 4DK6A 3ZDZF 2L7UA 3IFPB 3WXWL 3ZDYB 3UXFA 4HUVA 4HFUL 4PIBA 1XR8A 4FX5A 4A55A 5FKPB 3W82A 1URZA 4I2XE 4M6ML 3G9VA 2LW3A 3CFTA 1GIGL 3P4NB 5HHQB 4FYSA 3SDAA 2Q20A 2ZUQB 2Z1PA 2DMCA 4B5ZA 4FKHA 4YL9A 4FA6A 3FQTB 5A6MA 3H85A 1HJBC 4Q2ZB 4F57L 5L4FA 4ZNEE 4Z7NB 2X4QB 4M48H 1JF1B 1KPUB 3CQFA 3AS2A 3FB5B 2ADGA 1A7QH 4OD3H 1TQSA 1W8NA 2QL1A 1NIEA 3TZVB 3X3GH 4PB9L 4OCRH 4OUOA 3BH9B 2R0WL 3QUMB 2L7QA 3DX8A 3KVQA 2OA9A 3R18A 4BK8A 1U8NA 3MRKA 2OM5A 2WSDA 1NQBA 4WO4A 1WIOA 4BE5A 4O51A 1B0GA 1HEHC 3QHTC 3RZCD 4Q6KA 6FABH 1QSFE 1QLRB 4JO4L 4G6FD 2VDOL 4R7LA 2QZQA 2AQ3A 3MRQB 1D5XA 5CGTA 5AOZA 4I0CC 4U3CA 5D1ZC 5CILH 3OAZH 3NUKA 4DGIL 2R0LH 4G6KH 1GYCA 3EW3B 4UYPA 5JORB 3D51A 1A6UL 4JKNA 2YAQA 3MBEC 3RHWK 2CLVB 5GGSA 3QXTA 4K4KA 1A1OB 2DLIA 2WAHA 5DTFB 1FG2A 4HLZH 4Y7OC 4J6RL 4O4YH 3QFDB 5ALBH 1MUJA 5LBGA 3TF7C 4Z95H 2OR8A 4L9LA 4DKEH 3LNDA 4QJ5B 5HYSA 1EZVX 2AAAA 1N0LB 5DD0H 3ZK0A 3B2XA 2R4RH 3SZKC 1KGIA 3R4DA 4LU5L 2NCEA 2V7HA 4PM1A 2HT4D 3L4VA 4Z7NF 5I73B 2DD8L 4R4BB 2ILLA 5DVPA 4QOKB 4JDEA 2MQGA 4GW4A 1RUPH 3DOSA 4EZJA 1YHPA 4JB9H 4Y2OB 2OCFD 4N0FB 4OKDA 1G9MC 1I8LC 3VWJA 4BDVB 4Y1AE 2CBPA 1MFAL 4HIIB 5T3XL 4GKNB 2X05A 1WGVA 5E2VL 1JGDA 1SY6H 2P8PB 1K4DA 2WKLA 3VJ6B 3NEOA 3FTVA 3PUUA 3FAXA 4ADGA 1HZHL 3GWJA 3ZHDA 1OY3B 1VZHA 5AW9B 1Q94A 1DJIA 4XRCA 1WITA 1L0QA 4ZW6A 1J87A 1E9QA 4Y9CA 5E4OA 4J8QA 3PXJA 2A4ZA 2R2HA 4JCLA 1XAUA 3U4AA 4G70B 4GI8A 5I1GH 4K0OA 3BD4A 3F6IA 3P4NA 5HHQA 1ZAGA 4ZMXA 4YHPA 3BH4A 2ATKB 2F7OA 1J48A 3BGFB 4TUKH 4HD5A 4X6EB 1GOHA 4FYTA 3D52A 1LEGA 2QVTA 1F5WA 5AW6B 4J12A 2C26A 3TU6A 2ZONA 1NBZB 2X7LB 4RISH 4XB3A 2YQGA 2VZTA 2DF3A 4UOJA 1L3WA 3VQ1C 2Q76A 4ODXB 1TQBB 3IE9A 4MD4B 4H1LB 4ODHH 1UJ3B 2Z64C 1TDQA 2F19H 4OZFG 1KENL 4YLBA 4OZ4B 3MMEA 4YXLL 1CLCA 2DQ6A 1N0XL 1ACZA 3I9GL 4DP4X 5IG7B 2NNCA 3C2SA 3VI3E 4MXVF 1Z5YD 4NC1E 3T3MF 5AVTB 4PGEA 4ZX3A 4AQZA 3OR6B 1GOFA 1R5WB 3QR0A 5FO7B 4WWOA 4HYTB 5FGSA 3VTTA 2OAAA 3VG9B 4MZIA 2F8IA 1YNTB 3HIZA 3GHEL 2BIQA 3SPGA 2AJUH 1OE1A 1U41A 2E27H 4GKZB 1JVOA 5I15L 3P0GB 1IM9D 5JZ7C 2DQDH 1EJ6A 1DUZB 1P4BH 2YEVB 2LU4A 4DEPB 4MXQC 3GXNA 2DQHL 3DVFA 1GZQA 4V1DE 5KSBA 3D39E 5AD0A 4PP2B 3GM0A 1FL3A 1OAXH 1KCUH 1UURA 4H0GA 1J5HA 1A4BA 1USQA 4NZUL 3UTSD 5K1JA 1JWMA 1YEIL 5TE4L 2J6EA 3QIWA 1G1OA 4NZDA 4K9EL 1N5AB 4C59B 1T21A 3S96B 4WLCA 2UVEA 1CU4L 2MH4A 4UF7C 1F4WL 3QHFL 3W0WE 1NCTA 3INUH 5H2BA 2ED8A 1IM3B 3D8MA 3EO0A 3VFNA 3VG9C 3Q01A 4NKOA 5C71A 3HCVA 3P02A 2DDQL 3QUMA 3D4ZA 4QAMB 1WEJH 1MFAH 4X5LA 3MRRB 3M07A 5GGQL 5GZOA 2K3TA 5JR1L 3PWPE 3RNQB 1QD0A 1K8IA 5DUBA 4PJCB 3MRFA 1DJZA 3FTSA 1J0KA 4ZDHB 2A38A 2A4CA 2JB5L 2ZWSA 4L8SC 3FB8A 3V0EA 1U91A 3GMLA 5EZJB 3NPSC 4KH9A 2BSSB 5I71B 2AVGA 3E80A 1HCZA 5A7EA 3DURA 3UBXB 2XWBA 1QI4A 2P8MA 4ODVH 4X4XB 4GLRH 4JL2A 4QCIA 1J18A 5J6HB 2DJUA 3K7UA 4QHPA 5CCGE 1PYWB 2MNWA 4RFOL 3RA7H 2C7FA 4ELME 1JTOA 1RZIB 1TKWB 1UACL 3QJFB 5IJKC 1JYNA 3MO1B 5K39B 5JHDB 4DETA 3EUDA 3GSOA 4Z76B 1FRGL 2R0LL 4JY6A 2DMHA 1SHSA 2CK2A 4YDKH 5I28A 3L95A 1F4XH 1R19A 3CFKA 4DT2A 2YBGA 4L8CB 3MNZB 5LGYA 1LP9F 2JI3A 1NBVL 2EVGA 1NC4B 2EDTA 3C60A 4FULA 4U1IA 5GISH 1MFEH 3P3TA 2E7MA 2X6CA 2EXSA 4G8GD 2NY5C 3MRDA 5FYKH 5EO0A 4UQCA 1Q94B 4XRCB 4BFEA 1JMZA 15C8H 5B4MC 2GAZB 2HJFB 1P4UA 2AEQL 2YEZB 4FGMA 4WV1A 1KIUA 3QC5X 2WBKA 1UKSA 4FQ1L 5FO2A 3VGFA 5JW3H 3AT8A 1UD4A 4FG2A 4NUJB 1NGXA 1S7SB 3C5ZD 3DX6B 1QVOA 1WS8A 4UUJB 1JIBA 2P1YA 5MENE 3QFJA 4OFKA 3WFHA 3GSXB 2WNGA 2WB7A 5EN2A 3APCA 2Y9RT 3C87A 3OMZA 2VN3A 4R26L 4F3FB 3WJJA 3T8VA 1T03H 1R3KA 3BGFC 3CK0L 5E7FA 4FABL 2CBTA 5DWPA 1N12A 3CXFA 4WEBH 3QUMH 2GSIB 2E9IA 4JAMA 1S5IL 4Y1AD 3TEWA 4ENEC 4PHZA 1Q0EA 3WE1A 2EYRA 2FE0A 4ICWA 1KB9J 3VXRD 3IGUA 3QWRD 4NOFA 1X7QB 5AQ0A 4JFYA 2O6FA 4ZTPL 3THMH 1OANA 3VVVA 3QDGB 4ODBD 3W11D 1OV8A 3E6FA 3CFBB 4P3DA 3KWXA 4QXTA 4BQ6A 4CJ1A 5DJ2A 3ARTA 5JHLA 2K7QA 5ENWB 5JORA 4OF5A 3ARGA 2H1XA 1BQLL 3KH4A 4NZJA 4UT9A 4NCC2 4LLQB 4JHZA 2OZ4H 3SGKC 5D2LF 1E9OB 5AZEL 1JBJA 5E1HB 1KPVB 1RIUL 4ZW5A 2LVEA 3O3UN 3IDXH 4WW2C 4MJ5A 3CBKB 2FYVA 1WEJL 3TJHC 3MRCA 5D7LD 1EEYA 3P0YL 3F12A 2LU5A 1OW0C 1DEDA 3MV7B 4Q7DA 1XCXA 3QDGD 1J1XL 1AGCB 1O5DT 2AK4D 2ZOTA 4NPYA 1KCLA 3MC0A 4KI5E 3CUPB 5AVWB 1GC1C 1ODAA 1FL6A 2GY5A 2OL3L 3KDMA 4KC3B 1HDMA 1KXVC 2B08A 3X3FL 5GHWH 3ZY7A 1AJ7H 1BVLA 2P28B 3FQ4A 4R2GD 2F68X 1GW6A 4HWNA 4XWOD 5L2KB 1OK8A 3CC5B 2GTQA 5C09D 4WWKD 1ZHLB 4LLVA 4AM0B 5HYJD 3ESNA 2C9RA 4XWGL 3TEXA 2BIIA 3I75A 1KLGA 5DVKA 4HQQH 2D3VA 1OAZH 5HPMA 3ULVF 5IP4A 3V9CA 1R24A 2IPUG 1ZPLA 4EDXB 4RGOH 4ANKA 3HRZA 3O11B 4PGBB 1P7QB 3OSVA 2FBJL 3DMMC 4IBZA 3CVBA 2OTUB 2LFEA 3UP1A 3FT3B 3I9GH 1KXQA 1NDTA 3VFSA 1KB5A 2NY6D 3GBML 2OMWA 2EZ0D 1IBYA 3IGFA 1WJ3A 1KEMH 2X4TB 4KPHH 2J1WA 4TM9A 3UG4A 3KPQB 4OCWL 4FHBD 3RWFA 3LPOA 3V8OA 4E41E 1QWHA 1URIA 2DM7A 5I16A 1NUNB 3MLPA 3VYPA 4M5TA 3HMXL 5J8OA 1OAUL 3DX3A 1MLCB 1FFQA 5EU5A 3AQZA 4OFYA 3UPRB 2WXKA 3A24A 5FYLL 4FI7A 1T66D 3D85B 5L0QB 3P77B 2E56A 4UV7L 2XWCA 1KPRA 2F54A 2YA2A 4FQ2H 3Q5YA 4QAWA 2UZIH 4UINL 4YL4A 4UAOC 5AW0B 4MB4A 5FUCC 2W07A 4WW2F 1G6RL 2Y0SA 3MXWH 1C5BH 5GGVH 2AERT 1XB6A 4XNUL 5BZDA 3MX0A 5C0GB 1KJ2B 3O9WB 2VZ3A 4FJZA 4CMHB 3MDJA 4WHTB 5PCYA 4MMYB 4XNXL 4WO4D 1GZHC 4XCNB 3RY4A 4XWGH 5C0CD 4U3SB 5F44A 5D7KD 1U8KB 2X6AA 2X2UA 3BGAA 1D7DA 3PWPA 1D5BA 1P5UA 4Y4HC 4AG4H 3TS8A 3V5HB 1BOGB 2Z8SA 4JB9L 4QHKI 1OB1A 4GXVL 4LCIH 1TTCA 2L7EA 1GJWA 3H3KA 5JDJA 1YJDC 2YA1A 3N0AA 1G7IA 3OWEA 4JVPA 3HB3D 4WF7A 3MLXH 2I7OA 5ESVB 2XHNA 4W9DC 1XWVA 3L3JA 2EC9U 4XBEH 3G6AA 3FOMA 2PETA 4TVPE 2UWEF 2BY0A 2ZUUA 4U3XA 1M42A 1H3PL 4DVRL 4XCFL 2VDPB 2GUYA 4PGEB 5D6CB 5JOEA 4ZAKB 4KZEH 2Q9OA 5F1NA 5JIKA 3LKOA 5IBUG 5EF0A 1L9OA 3GZPA 3Q9QA 1D5MA 5FUOL 2DYPA 2DI7A 4HWBH 3P0VL 5D70H 1U8MA 3REVA 1CR9H 5BO1L 2V2TB 2VJ0A 4V2BA 1CUOA 5E8DL 5AOIA 2BSED 4J6IA 3MUHL 3L2NA 4RMRA 3RWIA 4PY7A 3U4EB 3NGBC 4ZT1A 1BF5A 2C4FT 3GEWB 3IN0A 1DYZA 2EH8L 3IK2A 3BYYA 3RDTC 4FTDA 3VYNA 3DO7B 1IC1A 2EXTA 3UABA 1LMKA 1BJ1H 1L7IL 2P3YA 3VXMD 2XICA 1MH5B 1SRDA 4XBGB 3NIFB 2E74C 2FUTA 4G8GB 1PLGL 4IGBC 3WELA 2ROXA 5L0QC 5FV1L 5AEAA 2IQAB 2GJJA 4RFEB 1A8JH 3ELQA 2B0SH 4UWQB 3HPLB 3SO3B 1DVUA 2IAMC 4U4BA 5GQBA 4GW1A 1CGSL 2WQVA 3RVTC 3DSFL 3VACA 4DP1X 4YDLB 4L23A 1KTJA 2VWEE 1QEWA 4G7VL 3RIKA 2B0SL 2UY7B 3GTVA 4NWUL 5AAWA 1PZUB 1P2CA 4U6XA 1G0YR 2YQ3A 3GC3A 4HH9A 4JFEE 1MIMH 3HE7C 3DECA 2WGXA 4HK0B 4IBUA 4JG0L 1T4KA 4R4BA 4PJXA 1UWGH 4R5TA 4JY5L 4NCDA 2AITA 4X6CB 2FWOB 4KGJA 4JHUA 2FATH 1KB5B 1N7MH 1WDAA 2OQJB 5GISL 2X6VA 1VCBC 3N3EA 1I3RB 1NCBH 3QR1A 4M7JH 4PWIA 5H35B 3TBSB 3ZZ1A 1KJ3H 4NFCA 4FLSA 3ZTNH 2IH8A 4MXVE 1OSZA 3Q3GA 1BVZA 4MAUL 2WXLA 3GKZA 2WQ8A 4IRSA 2FGWL 4R0LC 1XF5A 5BQDA 3V9FA 3UG5A 2CIIA 2J6WA 4DP0X 5HDRA 4PMEA 5KTEH 1FFNA 2OMZA 3BKYH 1DQJA 2DQJL 3ETBJ 1A21A 4GSXA 4IOFD 1KBGH 4JDZB 5F93C 5HXMA 4JREB 2ZXWB 3SDCB 5J4MA 2DKUA 2V2XB 1T7ZA 3TONA 4BWUA 3P40A 4NNYB 3OZLA 2ZOUA 4QJ3B 3CHPA 1FC2D 3GFUA 5TDNB 5IR1A 4TV3A 3AG3B 2W0FA 4KY1L 1ET8A 2ITDA 3FCUB 3DVGA 1CS6A 2BOCB 1JZEA 1NCWL 2EXWD 3COOA 1XH3B 5CCJA 5BUGA 2BVQB 4YHIA 1M7DA 4J27A 3PGDB 1FN4A 3OKEA 5E6ID 1IEAA 1IX2A 3UTSE 2VR4A 4Q9BA 3G6AB 4UV4L 1TVDA 3VUAA 5LNDA 1JZIA 4OZIB 2VLJB 5JR1H 1SJXA 3ECBA 1A2YA 4N2BA 4B50A 2J5LC 1BW8A 1I53A 1L6XA 4JFDB 3RVXD 3FQ1A 2XN0A 4BKLB 1ZGLA 2WXRA 4QRUB 1I4FB 2J21A 4XCYB 2HFFB 2HPOA 2VLKB 4MMZB 5L2KD 4OQTL 4YBLC 3OXRB 1WFIA 2ZCHH 4U6VH 5GS1C 3VW3H 1FDLL 1UXSB 4OD1L 3DUUB 3D3VE 4L29A 3VFRA 5HI5D 3D39A 1G1CA 3CVCA 4HIEA 2G60L 3L3OC 1AQKL 4MB1A 2P52A 3U9PL 4ODSH 4BSVB 2JXMA 4AXWA 1QLFA 1O75A 2A83A 2R39A 4LPVA 2FYYB 1EFXA 2VLJD 4JZJB 3C6SA 4A7GA 3V0DA 2QSQA 1BQSA 2IBGA 3MGTA 4U6TA 1DQDL 2EDNA 1J10A 4PRIA 4N8VA 1SVBA 3BYTA 5HDBB 4LSPL 4JFOB 3UAAA 1AD0A 4MXQD 1AZRA 4GS7C 1BIHA 2Z0BA 4RRPA 4ZUVA 4B60A 1OOAA 2I60H 3M46A 3VXRE 1FNLA 3GBNH 3UZQA 5IEKB 4WUUE 1V5JA 2HPTA 4WNSA 3WFZA 1BQUA 4NKMA 5KUMA 1A3LH 4Z3TA 2EDWA 1EANA 3HZYA 4BQ8A 4POZC 1B0WA 2F5AL 3QO1B 4X8XA 4XH2B 1NPJA 2L04A 3QWQB 4U0QB 3TFBA 1AOHA 3D3VB 3HFMH 2XI9A 4OZ4A 5CS7A 3LCYA 4PRHE 4QRQB 4YXKL 4UV4H 1U3HB 4MNGA 2E9JA 3ABZA 2AXGA 4ORZC 4E9TA 4YS4A 5KYYB 4JMXA 3TBYA 1UWFA 2QKIA 3S36L 2CALA 3DX7B 3LKSB 3HKFA 5GRJH 5HJBA 32C2A 2HLFC 3EOYG 3SGJA 3NJIA 3RNQA 3SKMA 1C8QA 3BN3B 4Y5YA 1COBA 5IIEA 3S35X 3RX5A 4G6FB 2JTDA 2OR9L 5EU6E 3RUGE 4FQJL 5F70A 5CCKL 1PGRB 2MEJB 1EVUA 4JPVH 1DQIA 1XGPA 5CN1A 4FA7B 3BVXA 3IXTA 4DP5X 2E9BA 1RHFA 2KMWA 5DUPL 2CHNA 4RZCA 1EX0A 3HR5A 3KWTA 3GSNH 2B1AH 5ADOL 4P23B 1SEBB 4Q6IB 1GGBL 4XP1L 1A7NL 5HDQL 3QCUH 1AR1C 4M7LT 1ROWA 4X98B 5B8CB 1TVHB 4NRYA 5FHAL 4O9HH 4QJ4B 1NCBL 2P44B 3V0JA 4J3OG 4G42A 3ESUF 4E9QA 4FFYA 1X4YA 1I7RA 1WBZA 5GSVB 3AWFA 3KW8A 2RGSA 2VM9A 4CILA 3VXRA 1FJ1A 5H4ZA 3TFKD 1EBPA 4Q9QH 1ULVA 3CDZA 1VSCA 2ADIA 1AGBA 1RV6X 2WLYA 2X42A 4MVBD 3CQQA 2SEBB 4TVSa 4R84A 2IFGA 4L8DA 4OLWH 2GBTA 2DD8H 2E5EA 3PP3H 4I85A 4P57A 2A9CA 3IU4H 2IV8A 5KYNA 4ETQA 2R4RL 1EUUA 2JIXA 5SV3A 5FKAA 2KH2B 2ENQA 5DLLA 5F7EH 2XETA 5I6XC 2WSPA 5GIRB 2B2XL 2W60B 3LH9A 5KOMC 4GNKB 1IVLA 3GMPA 4JO2H 4XPFL 3BEWB 4IKKA 1HAUA 4R8WL 5D2NC 4ZW7A 3ML9A 4JPQA 4MA7L 1NDMB 3W2DL 2YGNA 2ENPA 3OJ2C 4YO0B 3DPBB 4RX4A 5CP3H 1C8PA 3LVTA 2QDWA 5TDPB 1AC6A 4HX1B 4J3VA 1LO4H 3A6CL 5AVVB 1ORQB 4PJEE 2K8MA 3TL5A 3GMOA 3DKHA 3BT0A 5EIQA 3T6VA 4MA3B 1FG9C 4KQ4L 4IHOB 1NKOA 3VRIA 3ZSSA 1RJLA 3T2LA 1FFOB 4NC2B 1JYXA 4KUZL 2XWJA 4YE4L 2CRIA 4YHKH 2XT1B 2CDEB 3CVHB 4YDMA 4CSTA 4J3WA 4EDWL 1J7VR 6FABL 4MD0B 1XH2A 3VWJC 1BYNA 4QR7A 1PDKA 1AS6A 2GJ6B 4N2KA 1BX2B 3GDBA 5C9KA 2NXZB 4N24A 2NY1C 3RJDA 1L9SA 1LDPL 2VDQB 3D34A 4XBPA 3O6FA 1S4IA 1UM6H 3UYPB 4IRJC 4JPKL 1BP3B 2CK0H 3KLDA 2ID5A 3MLSL 5DS8B 5IQ9A 1KUMA 5FYKL 2EXYC 1IT9H 3S4SA 3MLXL 4YHML 5CHNA 3QNYB 2P47B 3H0TB 4WO4C 5KS9E 1CD8A 3TZVC 4JM0A 3RDJA 1XAKA 1UXMA 5ICXB 2VMJA 4UI2A 3V0IA 1FO0H 3MLVL 2WXPA 1IKNC 5FWRA 5HGDA 3U36A 1U95A 4JJ5A 1TSRA 1NMCC 4Z7OB 1CLYL 1J12A 1VACB 2H6UA 2YMXH 1P4LB 4H25B 4PW4A 4AG4L 2H6PA 3CAFA 4IKLA 3DROA 4DEUA 4FQLL 4N2LA 3SDYL 5D7SH 1FQ9C 3ALPA 3WJMB 2A1WH 1Q72L 3ZIYA 1KYUA 1EZUA 2I9LA 3KYOA 5ICZB 5TDOB 2GTZA 2O61B 1NOLA 4AT6A 1PZ5B 2B1HH 3SPIA 3SE8L 2BOBA 2DQEH 2GC7C 4EN3C 4Y19A 1MJUL 4PU2A 1OM3H 1CICD 5DCCA 1HAWA 2VLLA 3BZDA 2MOQA 2VMDA 4CSPA 1DVTA 1Q0XH 1R3JA 1LNUB 1KDIA 5ITFB 1TO5A 2ZUSA 4GLRI 2XYCA 1B9KA 1M7UA 3LY6A 4JO1H 5CJOL 3NABH 3VXSE 1K4DB 3P30H 1U91B 5EZJA 7TAAA 1CXLA 4WI4A 2DKSA 3U9WA 4HS6A 2EKJA 3O0LA 4IOIA 4M5ZL 4EZLA 3F65A 2NQ3A 2C4XA 3LRMA 3S5ZA 2EDHA 3LEYL 1BYOA 2GIYA 3MRMA 1TTBA 5F89B 3UYPA 5LG6A 4N5ED 4ELMA 2VUOA 1A6TB 4XXDA 4M56A 3EJYC 1A6VL 4HJUA 4K5NA 4NJAL 3SO5A 3U1PA 3VXTB 1VCAA 4XP5L 2P5PA 4HAFA 4XNZB 5I30L 4AL8L 1V8HA 2IVFC 1PPIA 1WYJA 1WWCA 2C3VA 4QHUB 3FFCD 4Z7QB 3L9EA 5T5NG 3F04A 2Y5QA 1KELH 3WU1A 3GMMA 3G5YA 4X99A 1OIOA 3K72B 3BH8B 4TNFA 4HIQA 3WAKA 2J1ZA 2BOCA 5IVXF 4UTAL 4FCHA 4AQ1B 4TNWF 1G1KA 1A0QL 2H41A 3EJUA 3PHSA 2GPZA 3IJYA 4E0RB 3ERXA 4FQXC 4FXLA 1NJ9B 4AMXA 1J8HD 2WP3O 3L1GA 3WTYA 2EDDA 2BWQA 3GSQB 5HHOD 3FTYA 2G75A 1GYAA 1XD0A 2AJUL 2Q2LA 4L48A 4C56E 2XKNA 5CJ8A 2IH3A 4K15A 3PWLA 1FBIL 2J88H 2DM2A 2OL3H 3VRLE 2VZOA 4M4PA 4ONFH 3BWUF 3VXSA 1XIWA 1NPUA 3IDGB 2CM6A 1VACA 1WPCA 4H25A 4MNQB 3K46A 1NOFA 5ESQA 2P5WA 3VXMA 1G6RB 2IADB 4P2YA 1NH6A 4PJ7F 5DZVA 5FA4B 2VL5A 1NBYA 1KJ2L 2XPZA 3HPJA 3MCG1 1HKLL 1P1ZB 1RKRA 3B3IB 2BY3A 3AQYA 5ECJE 1T80A 3S34L 2ATPA 1T5XA 5DI8A 4NUJA 5HDQH 2WW8A 5GRVK 1XZWA 1G0XA 3O6LH 1HHHA 2EEBA 3RG1C 4NPJA 2WLJA 3HAEA 1GS8A 3HNVH 3B2DC 1A3QA 3F7PC 4I1PA 3NAAH 5J12B 2CO7B 1NFDF 3ZYIA 2ZOKA 4PS7A 5T1KD 4X4YB 4AVKA 1JGLL 5IHZA 4KO6A 4R7DA 1PVHA 3EYOB 2KYIA 4PCSA 1QNZL 4JY4B 3RZCB 1CD0A 1I31A 1CXEA 1ZT1B 4HEPA 2JJTA 3WG7B 2N3JA 2YKLL 4X50A 3G6JF 5EO9A 3STZA 3RWIB 5JHDA 4ZUWB 1XL4A 2MRYA 2ALWA 4MSWB 5CSZA 1TOXA 1FSKB 4YO0A 2AXWA 4UU9A 5C07E 4D7BA 3B5TA 43C9A 4BIKA 3M1OA 1IAKB 2QQQA 2CLZA 4ZZFA 2FCBA 4AQEA 1CFBA 1IC7H 3CH1B 4OZHE 3C5ZB 5FGRA 4DGVH 3HUJA 2D7TL 4OVVA 1NGZB 5IW6A 1A6ZA 4NHCL 1FYTD 4FXKA 5DT1L 5ABZA 5F3HA 4IBSA 3TNNA 3CFQA 1W0VA 1EAQA 4G7RB 4QTHA 3ZR5A 2AHIA 5ID0B 3RWEB 3ZKXB 4PREA 1T7WA 2ZIDA 3GSVA 2JQMA 1U4FA 1E67A 4UT7L 2JCCF 1T3FB 5E8PB 4BRJA 2JJSA 5ANMB 1Z9SA 2OYKA 2EH7H 3HA0A 4NGHL 1RQ5A 3RPIB 1M3IA 1NOAA 4DKDC 4ZK8A 1RUMH 4HKZA 3HNTL 3PL6B 3FUMA 3U7YL 1TZHA 3QI9C 1PY4A 3CV5A 5L8LB 1LO3L 1OGAA 4Y4HA 4AGNA 2BVOB 2FB4H 4XVUD 2FSEB 5C7XL 5I5MA 3NCYP 3QORC 3TCXA 3ARDD 3LKQA 4ICXA 4NCC1 3TN0D 4M5YL 4JZJA 4N26A 2KDYA 2PN5A 3V0FA 5HYJB 1LO4L 3A6CH 1CCZA 3OHXC 5A3ID 4LL1A 1EHAA 5FGCB 5KYWB 4BKSC 1OGSA 2WXJA 4JAMB 5GRWA 3FXIC 3FULA 4ECNA 3IMUA 3O3DA 2Q0ZX 4K9JA 3BHBA 2P5EE 1PG7H 2FEDD 3GK8L 4WUUD 4I1RA 2XV2A 2BHUA 3MNMA 4ZMPA 4JO2L 3I6GB 4PWGA 4LL4A 3WIFB 4EN3D 1UKTA 1CG9A 1MHEB 4F3FA 1INDH 1KACB 3LHPH 3UIYA 4DP9X 4HWEH 3RHWF 2HP4A 4WEEA 3SODB 3SBQA 3U0PB 5D1QC 4EMZA 3GO1L 3PHOB 1FE8L 2JKRM 2VLJA 4GQRA 1FNGB 2FLRT 4U1GB 1CFVL 1KB5L 5KJRL 3MRGB 2JB5H 5CINH 4XPHH 2UUDH 4PRID 4IOFC 1MQKH 4KZDL 2WANA 4AH2A 1G9NC 6PAZA 1PAMA 2X4PA 1N67A 1V27A 3DX7A 3HZVB 1YUHB 1AIZA 3NIDF 4YOKA 1R5WA 1SYVB 2NUTB 1S9WB 3QWOB 2PXYA 5IREA 1BFOB 1CFNB 5IJCC 1E65A 3NRPA 1E8WA 4LLAA 5EUKB 2EICA 3RVVC 5BVPH 5I8OH 1O6VA 3OKLB 4OBSA 2P80A 4LHUA 1DSFL 2J1XA 4OT1H 1I1CA 4L2YA 5L88L 4PV1C 1OKEA 2G2PA 2FEEI 1QX1A 5T33H 2ZSWB 3KWWA 4O00A 3MU3A 3CFJA 4TTDC 2YFOA 1JNHA 4QYOB 4K3GA 4ZUVB 3I50L 3RVVD 4N3TA 3OAYH 4XI5C 2W0KA 2BK8A 1KULA 5E2WL 3NCBB 2ESVA 5HY9A 5MI0B 3C2AL 4I4WA 1EXUA 2P5ED 3MBED 5FO8B 1U36A 2XUWA 1RVFH 2UZXA 2CGZA 2ZOKB 3GBDA 1S9XB 4Z7AA 2O5ZL 3S2CA 1KBKA 4HJJL 1MHPL 5E5LA 4WKXA 3C9NA 1VFBA 5EO1B 3D39B 3MRHB 1L6ZA 3H4FA 1GAFL 3TOPA 4B9PA 3A6OA 2J57A 5CINL 3VGEA 4B9JA 3D18A 2ATPB 4HS8H 1FNFA 1MJ7H 3DTXA 3H2QA 4LPTA 4K7PY 4MMZC 2X88A 3QJSB 4DUVA 5J6GA 5HI4C 4IRSC 4FNLH 3WLBA 2WQSA 1BWWA 2PCXA 3H3PL 1AXSA 1J1OH 5JHMA 1VHPA 2P5WB 1FNHA 3US0A 2X4OB 3A3YB 1ZLUH 4U1NA 1QFPA 2PWDA 1OGTA 2CGRL 2VZSA 1B4LA 5BV7L 3HC3H 2D73A 3KPTA 3B43A 1M2VB 3MJ9L 4NKDB 4JLRA 4HJGA 1W72H 2ZUWA 3DPBA 1BG9A 4MQ7A 4XCEA 1D2PA 4Y8AA 5EA0H 2WQRA 4KVPA 1AG6A 1EO5A 5GS0H 1C08A 4DFIA 3EYVB 2R69L 1QHPA 1RFDL 1M53A 1UT9A 3T4AC 5AB2A 3LS5L 3PJSB 2BNUA 2IDUA 5C86A 3MUGA 1EGJL 4YDJB 2P49B 3ECQA 4M1DH 4S0TD 5DRWA 4KFMA 4BGDA 2KBGA 2FSEA 3NJGA 4Y8DC 3RL1A 3MUZ1 4P9HL 3HC4L 1Y0LA 5FGBC 3TA3C 5BZZA 1XF1A 5TH2A 3BAEL 4HJSA 4D3CL 3ULUE 3ZDXE 5CGYC 4RX4D 5KVEE 3OBAA 3SDAC 2NSQA 1I1YA 1HCFX 4FFZH 4OIAA 4XHJD 5IFAL 3T3MB 1J5CA 5ACLA 1E42A 3MKGA 3KPQA 3RWFB 2EUXA 2XZQL 3ENEA 4XVTH 4PJGA 3MLWL 4KROC 5SWSB 3U79A 4U0RB 5IMLB 4M8QA 4AQEB 2DQTH 3DV6B 3MXVH 1KTLA 1OSPL 3RWDB 1NGZA 4JFUA 2GT9B 3UBGA 1PD6A 3F7RA 3UL4A 2WUBH 4LCCA 4ZS6C 1ED3B 3RURA 5CSBA 5HP5A 3MROB 4XNQB 4N9GB 4FQIL 2CO4A 3HJEA 1UQSA 2CKBL 2KHAA 4UQ2A 4OJFH 3QEHB 1CDIA 1IFHH 4C57C 4LLDA 1I9IL 3GS4A 3L2MA 4MS6A 3CN0A 5SWSD 4RZKA 3N6YA 3H9YA 2HVBA 3B6SA 5E8OA 1OAJA 3IF1B 4GT7A 5HDBE 5GS0L 3RVTD 3HNSL 1A6AB 1OQXA 4QT5A 3UH8A 4D9RE 2B3IA 1ORSA 1A7PL 3DA0A 5HY9B 2OL3A 2ZXDA 3UX9B 1KBVA 5HHPB 4PUBL 4JFFD 1XGTB 3N1MC 5C9JA 3SKMB 4BQ9A 1HKLH 4OGZA 2CCVA 1XR8B 1XXDC 4G9FE 4N2CA 3NZSA 3VWJB 2W80C 1EFQA 5GZOC 5I71C 4JMNA 5T1DL 5LN8A 1TNMA 1KEGL 5DD6A 1F4YH 3O4LE 3ISYA 3PWVA 4FOMA 2VN5A 3CSGA 4WNQA 1GGCL 2ED9A 3Q2WA 4ODWB 1I9RH 3BAJA 5CEXB 4G8IB 5D96B 5SX5K 5A2KH 1F13A 3IBEA 3DGGB 3LRSB 1I8AA 3X3GL 1I1YB 3CZSA 3LXAA 3VWKA 1C5CH 5E6RB 4FQXD 2HG5B 5LGJA 2XIDA 1UH3A 3HBPA 3SZ6A 5DJAB 2CRZA 1H8OA 1M71A 3FQXB 3NP4A 3QFDA 1IGYB 2QHLA 4UNTA 2CO6A 3ZMEA 4EI5D 4G83A 4AH2B 1S6NA 3ARDB 5I6KA 1RP9A 3WS3A 4FXGB 1LMIA 3WXVH 3BWZA 1URLA 2WZPA 1NEZA 1ES0B 1WLHA 2WVUA 4PV8A 2YBRB 2HX8A 4RMQA 1OF2B 2WNXA 4JFYB 4UQIM 4UM9B 5BS0D 4DSYA 1WAEA 4M6MH 1YEWA 4F27A 3ZRCC 4F7KA 1I85A 4LXFA 1FFPA 3L3DB 2DAVA 1N8ZA 3O6MH 1MRDH 3G6DL 4R2GB 1YPZF 3T0EB 1FZKA 3K72A 2EACA 4G6JH 3UDWC