1OV8A

Auracyanin b structure in space group, p65
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Auracyanin B
publication title Auracyanin B structure in space group P6(5).
pubmed doi rcsb
total genus 37
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ov8A00
1VLXA 1BXAA 2H47C 4P5RA 5TK2A 5I6MA 4M3HA 3SQRA 1TEGA 4HZ1A 3PCYA 3X1BA 3QJTB 2Y1AA 4YSRA 1AACA 1J5DA 2JXMA 3QJSB 5B7MA 2W88A 2XYBA 1RZQA 3FSVA 5F7AA 3QJVB 1BXUA 3NJGA 3FU9A 3IE9A 1W6LA 1L9SA 1PZBA 2JFCA 1PLBA 1J9SA 4YVNA 1NIBA 5B1KA 2XVBA 3FSZA 4BK5C 4DP7X 2GIMA 3UAEA 1E65A 1A4AA 3QJQB 2VW7A 1J9QA 2W8CA 1GYCA 1PZAA 1AZNA 1SHWA 5B7EA 4KNUA 7PCYA 1E5YA 1PNCA 2WSDA 3UAAA 2B08A 2CJ3A 1NIFA 3PXLA 4A68A 5FC9A 3AG2B 1JVOA 3ASNB 3IBOA 4NERA 4YSCA 1KYAA 2WO2B 3N2JA 3PLYA 1AZBA 3V9EA 1SHXA 3CZUB 1BQRA 3SBPA 3S8GB 1NICA 3CDZA 4BDVA 1JZFA 1NIAA 1RZPA 1JZGA 4YSUA 1GR7A 4E9XA 3T6ZA 3H4HA 2GBAA 3HB3B 5I5MA 4YSPA 4DP6X 1AG0A 4KOCA 2OV0A 1SF3A 2AANA 2FJSA 5E9NA 1SNRA 4K9JA 4FAAB 3FQYA 2GI0A 1HFUA 4KNSA 3FU8A 4Q8BA 2XV3A 1MG2C 4G7RB 5B7FA 1ASOA 3OQRA 4HAKA 4HCIA 2PCFA 2NRDA 1RKRA 3X2QB 2VW6A 2IH8A 1ZDSA 2X88A 2QDWA 2XLLA 4G70B 4A2HA 2MTAA 4AKPA 1M56B 1WA2X 1NIEA 1RCYA 3BVDB 1A4CA 1QNIA 5I6PA 1T5KA 2GC4C 1ID2A 3WKQA 2AZAA 3AY2A 1GSKA 4GYBA 3EH5B 1ILSA 5AKRA 1OV8A 1E5ZA 2BP8A 1L9RA 4DP8X 2IDUA 2YAHA 2BW4A 2YQBA 3OMNB 1SJMA 3NJNA 4X4KA 4E9TA 2GHZA 3TASA 4GXFA 1SF5A 3ZBMA 3JT2A 4G71B 5B1AB 2IAAC 3KW7A 1AZRA 5TK4A 3FU7B 2XXFA 4MFHA 1BQ5A 2HZHA 2IH9A 3H56A 1NPJA 1M9WA 2GSMB 1J5CA 5F7BA 1X9UA 1L9QA 1BXVA 3DIVA 3OMIB 3NJJA 4QLWA 1ZDQA 2HLEB 3EHBB 3WG7B 4BXVA 2ZOOA 2J55A 4A2FA 1J9RA 2XXGA 1BAWA 3FPYA 2PPEA 3GYRA 1A4BA 1E67A 1MDAA 2X87A 3V9CA 3FS9A 7PAZA 2QDVA 2J57A 1OE2A 4YSDA 3AG3B 1CYWA 2B3IA 5ANHA 4NB7A 1ET7A 4G7SB 2XU9A 2OJ1A 3RYMA 1OCCB 4DPCX 3BQVA 2P80D 1CURA 4UF7C 2ZONA 3CVCA 3NJHA 4AKQA 4AZUA 1SFHA 1ZPUA 1CUOA 2QT6A 2CALA 3WIAA 3QQXA 1AG6A 1PCSA 2UXFA 3S3BB 3ZIYA 1WA1X 4M4RB 1BYPA 3EH3B 2IDFA 1CC3A 3AZUA 2PP9A 5I5IA 4HCGA 1KBVA 4W1TA 4AKOA 2IDSA 4G72B 4YSAA 3NSDA 1OCZB 4DP2X 2EILB 1NWPA 3T6XA 4A2DA 2PP8A 2BP0A 1GS8A 4JHVA 1KDJA 4BWWA 2YAPA 3FPXA 1FFTB 1FA4A 3X1NA 2YAFA 4AX3A 2IDTA 2EINB 1L9OA 1BEXA 1ET5A 4E9VA 2CBPA 1OCRB 4BXSV 1AOZA 1AS8A 3SBRA 4HHGA 2FT6A 1SDDA 2IWFA 1NTDA 1N68A 2AVFA 1F56A 2FTAA 1PLAA 3T6VA 4DPAX 2FQDA 2JKWA 4E9SA 4DPBX 2YARA 1OF0A 2FQGA 3UGEA 2GC7C 3H4FA 2H5UA 1W6WA 2FQEA 4YSQA 2DWSA 1PZCA 2XUWA 4PCYA 1XB8A 5B3SB 2HRGA 5I5JA 3IEAA 3EF4A 4JHUA 2PPCA 3WI9A 2FNWA 1NZRA 4HHWA 1ZIAA 4ENZA 4GP5B 1ETJA 1ZIBA 2MRYA 4A2GA 4CSPA 1WA0X 3MX0B 1J9TA 3ABMB 5B1JC 1V10A 4E9QA 1EZLA 1M57B 1KCWA 3AG4B 2IWKA 3ERXA 3FT0A 2YAEA 4L0PB 2FT8A 1IBZA 3TBBA 5B1BB 3NT0A 1NWOA 2TSBA 4CSZA 3QJRB 2HXAA 2BZ7A 2HRHA 5AFAA 6PCYA 2DYRB 2VM3A 2UXGA 4TXVB 1NPNA 2H3XC 3DKHA 1JERA 2IWEA 3ABKB 3GXUB 1URIA 2BHFA 4F2EA 2ZWNA 3ASOB 3X1FA 2J56A 1B3IA 2CCWA 1MZZA 3CVDA 3CVBA 1JZIA 2FWLB 5AZUA 2R7EA 1WS7A 2VMJA 1HAWA 1L9TA 2EIMB 3FQ1A 2P80A 2Q9OA 3UABA 4F2FA 3NSYA 2XWZA 4WTQA 5B1JA 2YAOA 2BWIA 3U25A 1WAEA 1KV7A 9PCYA 3PAUA 1NIDA 1DZ0A 2PCYA 1JOIA 1JZEA 1KDIA 2BW5A 4E9WA 3PAZA 1V54B 3IN0A 4Q89A 1TEFA 2UXVA 4YSSA 2Q5BA 4A2EA 4KNTA 1I53A 4JKNA 3NJLA 4YVUA 3OM3B 4DP5X 8PAZA 4YSEA 1IUZA 1OE3A 3ZDWA 3CG8A 3FQ2A 4E9RA 1N70A 2FQFA 3S3CB 5I6KA 1ILUA 1ET8A 1PAZA 1YLBB 4WKXA 3OMAB 4A67A 1GS7A 2A3TA 2PPFA 1OOWA 3PAVA 1AS7A 2DV6A 1A8ZA 2VSKB 2CAKA 1QLEB 1W8EA 4YL4A 4GP8B 2VW4A 2IDQA 1JXGA 3NSCA 2VN3A 4QKTA 4FA7B 4DP1X 3S3DB 1JZHA 2PPDA 2QPEB 2HX9A 1AANA 2VSMB 3MBWB 4RH4A 2BZCA 1WS8A 1AAJA 4N8UA 3OD3A 5PAZA 1A65A 5D4IA 3X1EA 3WNJA 3FYIB 3NJKA 3QPKA 4NAJA 2XX0A 4YSTA 3NP3A 3T6WA 4KOBA 1E30A 4E9YA 2E86A 2PP7A 2XV0A 4DP9X 3AW5A 3NSFA 2TSAA 3IN2A 2ZXWB 4DP4X 1AZUA 2FT7A 2XX1A 2YXVA 3FSAA 2QPDB 1KGYE 1SFDA 1OCOB 3UACA 2BWDA 3ABGA 3AG1B 5I6OA 2UXTA 1IC0A 1X9RA 4YSOA 1ASQA 1AQ8A 1HAUA 2YXWA 3ZX1A 1KBWA 1AS6A 1PLCA 5I6LA 4F7KA 3S8FB 5D4JA 2HX8A 2I7OA 3L45A 4BWUA 2BP0B 1FWXA 1IBYA 1JXDA 2WO3B 1ZV2A 4EF3A 3FU7A 4KO5A 1JVLA 2OCCB 4P5SA 1R1CA 3FYEB 2XV2A 1ASPA 3SBQA 3C75A 3WNIA 4KO9A 3HEIB 3TA4D 5EHFA 3N55A 1L9PA 1SDDB 1AZCA 1V55B 4N4YB 4PAZA 3EH4B 5IY5B 1JZJA 1NDTA 3ABLB 4KO7A 3CDZB 1QHQA 4BDVB 1PY0A 4HCFA 5I6NA 2HX7A 3JTBA 3PPSA 1JXFA 2Y69B 1DYZA 1NINA 2UX6A 5I28A 1XB3A 1CYXA 2CUAA 2PLTA 2PPAA 1MG3C 2BO0A 5D4HA 2I85A 3DTUB 1BYOA 4KO6A 2GB2A 1GY2A 3FSWA 4W9ZA 5LDUA 3D12B 1PF3A 3UADA 4GP4B 2DYSB 1GY1A 1IKOP 2EIJB 1GS6X 3NJFA 3NJMA 6PAZA 3NJIA 1PNDA 2AZUA 1OE1A 2VM4A 2YAMA 2EIKB 4AI7A 4BWTA 3WKPA 4UANA 3KW8A 4G7QB 2J5WA 1BQKA 2DWTA 3TBCA 1TU2A 2YAQA 2N0MA 5A7EA 1EHKB 3NYKA 1UATA 3QJUB 3T71A 3G5WA 2BP8B 1PMYA 3GDCA 2LLNA 1MZYA 4A66A 2DY2A 1XB6A 4ZK8A 1GW0A 3T9WA 4HIPA 5I26A 4UAHA 3NP4A 2I7SA 2R7EB 1KCBA 1TKWA 4GY4A 3TU6A 3X1GA 2RACA 1XMEB 1AIZA 1AR1B 2UX7A 1A3ZA 1ADWA 4DP0X 5PCYA 2AFNA 4HALA
chains in the Genus database with same CATH superfamily
3O4OC 4Y19A 4OLWH 3PY9A 4YHIA 5E24E 1A0QL 2O61A 2AJYL 2VDOL 5EU3A 5FHAL 1KUMA 1SMAA 1X4ZA 4HZ1A 4AYSA 1A21A 3NIGE 4IBVA 1R75A 4PN6A 1NCWH 1HHGA 2Z93B 4X6EB 2X6VA 4OBRA 4HKZA 2A38A 4TL4A 5JXED 3KPPA 5IB1A 3FUJA 4OZ4A 4ACPA 3ZJAA 2CMRH 2VR3A 4WO4D 4J28A 4QCIB 1XZ0A 3ULVL 4I1NB 5B1KA 1QW9A 4NKIL 3FSZA 3D07A 5I9QB 3V4UH 4FXGB 2NZIA 4KKQA 3VG0L 2J43A 2W9DH 3HOGA 4KQ4L 5GGUA 4GO9A 4LSTL 5E95B 4GAGL 4O2EB 5DWPA 3EO1B 4I87A 4PLKC 5GS1A 2E0PA 2HTLC 2NUTA 4KNUA 3BH8A 1WT5A 3FF8A 5BRZA 2FIKA 4J3OF 3DX7A 3WMQA 3GSUA 5KJ7E 5J4MA 1E4XH 2ZXGA 3NFNB 2ENJA 2QADD 1EAOA 4NERA 3VFRA 4BUGA 4NXKA 5I24A 4MB4A 2YSSA 3DHPA 3ESUF 5KVFL 3JV4B 4GQPH 2FAUA 4LCCA 5C2BH 1MLBA 4U1MA 4MA7L 4OD2A 1L9MA 3GHBH 1JMXA 4JFED 1IO4C 1SJXA 4LPTA 1I8LA 1RZPA 1I4FA 2J21A 4NHUB 1GR7A 2VWEC 5IFAL 5D7IE 2FX8L 2K1MA 2D3JA 1WDAA 2HWZH 1UT2A 1FC2D 3GHPA 2WLLB 3O11A 4L3FA 2WTRA 5JOPE 5C0EA 3KR3H 3HVDA 5J12C 3RWHB 2FX9H 4PJDB 3L6FB 3TBVB 3U4EB 1U8KA 1MFCH 3C08H 2VDQB 4OCMC 4P2OD 4M6AA 3VNZA 4F24A 4WFHE 4FTVE 4JRXD 3DUSA 5AYUH 3WJJA 3IXAB 1KGIA 2NLJA 1A64A 1OB1A 2WZ0A 3CHRA 3CX5J 3QDAA 3WLWD 3QISA 2V9QA 1PAMA 3ZDXB 3DO4A 1NCAL 3V0IA 4I0PD 4M1DL 3TO2A 2DM7A 4HCIA 5AZ2L 2F9BT 1GOHA 4AV0A 2XLLA 4X6BA 4JFYB 3DV6A 3MCLH 2GJPA 4M8RA 1YECH 3C12A 1EO8L 1MNUH 2H6UA 4IMKA 1E4XI 1CGSL 1L9NA 2BM3A 4N0FA 4X4YA 2IO5A 2AZAA 4N26A 5F7DA 1NAKH 1ILSA 2GJZB 4G43A 3GNMH 1NCBL 1E5ZA 1QKZH 1T0NB 3DETC 1IARB 4WI0A 4R4FH 3FTWA 4XRCA 1IM3A 2O6EA 3BKYH 4FERA 4XN4A 1L7TH 4OLUH 1IBDA 1I9JL 2GHZA 3L1GA 4JRLA 1IBGL 4QUOA 5JHLA 1T4WA 2RAMA 3FO1B 3QHFL 4N3UA 4PGCB 4UT7L 4PRAA 4HWBH 4GW4A 4WWKD 1AZRA 1HQRB 1YC8A 4PJBA 3FFDA 2EDJA 1PJ9A 3MLXH 1JHLH 3PGDB 3EZ8A 4U1HB 2HZHA 3QXAB 3KPRD 3O8XC 4P59H 4O58L 4DOHE 1I7UA 1KTJA 1L5GA 2GSMB 4JQIL 2VRKA 3LPGA 3E1ZA 5J13B 5C0BE 2VLRE 3P9LA 3HC2A 3EHBB 2WXHA 2J4WL 3AT0A 2WQSA 5DFWH 5I8EA 1D6VH 1QWUA 3L4ZA 1WBXB 4OZHA 4Z7QF 3NFSH 3HG1E 5D5ME 4FCHA 4F8NA 1JPEA 1F00I 2B3IA 5GGTH 2PYEB 3UTSD 2CDFA 3VWKC 1JZ6A 2KS0A 5IREA 1BF8A 4H8PA 1FV1B 4WSJA 4D7BA 2BIIA 2H2PD 4A6YB 1BQHB 2MIZA 4YFLI 3OAWA 5E4OA 1CJYA 4AKQA 5E1QA 4XCNA 1T5WA 1HOCB 1F2QA 2DB8A 5HHMD 5FWQA 2C9VA 3WO4B 4CRPA 3Q2WA 3S3BB 4MJID 1V5JA 2B0SH 4TLSA 3QCTH 1OM3H 2XFXA 4LOFA 1CC3A 1XF3A 5F7UA 4ZX6A 4KVNL 5KVGE 5ID0A 2XVKA 2VZSA 3NSDA 1S7RB 3X12A 1I82A 1R3JA 4C83B 4JDVB 3TEYA 5KYUB 1PW3A 3BO8A 1JDDA 3ZTNH 4HWZA 3ZIMA 1LO4H 4ZUUA 4K4KA 1CLOH 1Q9KA 4P4KD 4EPSA 1LEKB 2FB4H 4AYGA 2NY0B 4KXZH 3N1QC 4AL8L 4W81A 5LVEA 3BDYL 3TWCH 4KXDA 3X13B 1GZHA 3L9RB 2C5DC 3LEVL 4KUCF 3FAXA 5GGRA 3GSNH 4ABWA 1M7DA 2FTAA 3MYJB 4GG8A 4KROC 2XXCB 3F84A 3OAZH 1MXDA 4OUUB 1G1CA 4DPBX 2FQGA 4DERA 2W81C 4OTXH 3MV9A 4G6JL 5DVPA 3GT6A 2VERA 2XV6B 1T89A 1Z9SB 3NA9H 3QHZL 3FUEA 1P4LA 1P53A 4XO8A 4ES8A 3P9MB 3TYGH 3ISYA 4MA1B 1CG9A 4QF1A 3HBQA 2EYRB 4WGKA 3FCSA 4M7KL 1YPZB 3DURB 3FO0L 4LSVL 3KMDA 5T1MA 5LGKA 4N0RA 4NAQA 3CFBB 4Z5RB 3GWJA 1ZHKB 4LOUC 2FR4A 1V10A 4G7YL 3O6MH 4LOEA 3RBGA 4IJ3C 1KCWA 1UVQB 3NN8A 4KXZI 2X6MA 3T4YA 1E8XA 3B3IB 5J1TC 3BEWB 3K5RA 3O4OB 2XHNA 2BZ7A 3ULSA 5CIPB 1W72H 1EJ6A 1U8NB 2BNUA 2AKRB 1OLZA 3KWWA 4M61B 4R7LA 3GXUB 1NM4A 4P3CL 4OLXH 5CJQL 1QMUA 5J9PA 1PL3A 1VJSA 1RZKH 1AD9A 1NEZA 3PJSB 4JPKL 3VFNA 1HWHB 4HLEA 1KY7A 5F70A 1T83A 4KK9D 3BE1H 2EDWA 1E6OH 4F2FA 4L29B 2A6DB 1GGYA 1CO1A 1DJZA 4MASA 3QP3A 3S88H 1YAZA 1RZJL 1S78C 2PWDA 2HUEA 2M1KA 4X4ME 1NC2A 1HHKB 3UO1L 4AGOA 5C0RL 1LMKA 1ZJAA 4F8TA 2VDPL 3KM2A 1I1AB 4TRPL 3VXUB 3CQFA 4GSDL 3LS4L 3WE6B 3RVWC 4NNYA 4Z77B 3V5KB 4PTTB 4N2HA 1GC1C 4OZFA 4QXUL 4BCZA 2Y36H 4Z1PA 4OLYL 3CFJA 4BQ8A 5F7MC 4JE0A 4NDMB 4DN4L 1CD9B 2XPGA 2VDLB 3FQ2A 2ZCHH 2K3HA 4B5ZA 4JFOB 2E9JA 3B43A 4KTEL 5I6KA 5J12B 3BFOA 1IM3D 3WNOA 1O7DE 4JG0H 5J11C 3U46B 2E59A 4HHAA 4MZ3A 3CN2A 4R0LA 4H0HB 3D0AA 4QY8B 3W11D 3FUIA 5T1LB 4WNQB 4JKWA 5KVEH 3IGAA 4RAHA 5BV7H 3WS6C 5CFAA 1M42A 5LNEA 3HE6A 2ZUYA 3UXFA 1QLEB 1HH6B 3ILPB 4CC1A 1CYGA 3LQMA 1NCCH 1E6JL 4MYPA 1MI5E 2CUHA 2YEVB 3PPEA 3SPGA 3RZCA 1J8RA 4FZ8L 1MW1A 1AANA 8FABA 1Z9OA 4DO6A 1CDHA 4URKA 1Y6NR 3SPJA 1TKWB 5E8OA 1MDTA 4IOIB 3FT4B 2MSPA 3AMLA 4U1NB 3CMGA 3T6WA 2EDQA 4K73A 1KSRA 1CGVA 4AIXA 5CN1A 4W9IC 1UZ8B 4QRRE 4GRWH 3V6ZA 1DFBH 5CMAB 3W9DA 2AEWA 4F7PA 3O8XB 2AGJH 4X5LA 3W0WB 2LU7A 3FKUS 4GIPD 4M5YH 5D6CB 2QPDB 2AEPH 1KGYE 2HRPH 3IDMA 4LHUB 2OSXA 1RERA 4XPFH 5CS7A 3ZKSD 2GUOA 1KPRB 3F04A 1T6WA 1AQ8A 4QAMB 3O6KH 3WJMA 1T4KB 3IM1A 4GFTB 4L4JA 3OB8A 4XP1H 5TE7H 1R0AH 1S9KC 3VRLE 3EFFB 2V5MA 1U2YA 4BWUA 3CU7A 3MDJA 1EEUA 4I13B 3TEUA 3HN5A 2GVYA 5E4EC 5EUOB 4P5SA 5EC2B 4M62L 3K8KA 4QHKI 3VWKB 1LO3H 3EGDB 5ACZA 4KO9A 4PU2A 1G6RA 3EFOB 2F19H 3BX7C 3L08A 2VR8A 3SDXE 5AUMB 3B2MA 1BREA 1R5VB 1TO4A 4NM4H 1FZKA 4X4XB 2J73A 3FUFA 4JLRB 2OMBA 4PJGF 4RMSA 1ETB1 1U30A 2WXMA 3I6KB 3M88A 3KL0A 3KS0J 3QORC 2C9QA 1IC4H 5I16A 3FN9A 2B1AL 1DJSA 2ZP9A 5FOBB 4ZMYA 3MV9D 4PHZA 2E7HA 3S4SB 2LOEA 1GIGL 1RHHA 3ESMA 1BYOA 2GB2A 3LKSB 1ES0B 4R2GC 2Y06L 2VDQH 3GJFB 3ARGD 1GGBL 3L2NA 2BWQA 4HFUH 1SLWA 7CGTA 3TLRA 5DO8A 5IQ7H 4JFDA 2Z0UA 4Q9QH 2QTEA 2VXSH 1P7KA 3ARDD 4KV5F 5HJ3A 2ZQKA 3CXHK 4HFWA 4X7CC 3WTWA 1A1OA 1J1OL 4WFGD 2Q87A 1T21B 4PJCF 4JJ5A 1PD1A 2YD2A 2C7FA 3FFCB 2NSXA 4IBQA 4M8QB 1LE5B 5DQJB 4KROB 4RIRB 3ECBA 1BYNA 4HWEH 1W0YT 5IB2A 3Q48A 1CFQA 3IE4A 3HN8A 2H41A 1KPVA 5FB8B 2H1XA 5D2LF 4NPYB 2ZYRA 4OSUH 4R96A 1M2VA 4JMXA 4QTIL 3UAJD 3MLYH 3U0WL 2Q10A 4WI7A 4YK4C 6CGTA 4H8WC 4U1SA 4RGNE 4NKQB 3TV3H 3QFDB 5A2AA 1TDQA 2E8ZA 1XIWA 3DMMD 1KIRA 3JTSA 5I1KH 3ZKND 4N2NA 1P1ZA 4XNQA 2UX7A 1GVIA 1IGJB 1UEYA 4OFIA 5IR1A 3APCA 2ATAA 1BXAA 3CLWA 4JR9L 4M3HA 3SQRA 3MAWA 4IJ3B 1UD3A 5F7LB 2I27N 2O1AA 3AY4C 4BFIB 1SBSH 1E0OB 4HEPG 2XQYA 5LGJB 1MREL 2P5WE 3MJ8B 3RVTD 3CFKB 1OWRM 3MUGB 4Q6IA 4WUUE 5BW7A 3H54A 3DJRA 4NWUL 4EVNA 2R4SH 2WCGA 4PRIA 5DD5L 4BH7B 3C60D 4Y4FC 5E8EB 3S35X 3CC1A 1L7IL 4J6RL 2VQTA 4JFQB 3K72B 4MB1A 5C0DA 2HVBA 4UDTB 3VXSA 4A6YH 2HB0A 3ARUA 7PCYA 1INEH 2R0ZL 4FC3E 4AE0A 1KEGH 3FMGH 3T09A 3ULVH 4N0UE 4D3CL 3FFOA 3AG2B 1JVOA 2MKWA 4Q14A 3ORJA 4LLDA 2HT3D 3OC8A 4HQQH 1QBAA 1QZ1A 2NY1B 4GAGH 1N5YL 3DYMA 4NNXB 1AE6L 2EDYA 5FO7A 1G7JA 4MD5B 4WWPA 2BH0A 2ENYA 1CU4H 1E5CA 1S46A 2J8HA 1OAUL 1MJJB 2QSVA 2X10A 2D31A 4N8VB 1IT9H 3UYRH 2EE2A 2OYMA 5KVFH 2NQDA 1R34A 4PJ5D 3T3ME 4XBPB 5DK0A 1FIGL 1WBYA 2K7PA 1WFTA 3FB5A 2AXHA 5DVNA 4L8BB 5DMGC 5GS2D 3VAEA 2VLLA 3TT1L 4C8XA 2VAAA 1NKOA 3VI4F 5IFAH 3F7VA 3QDJE 3CZJA 3WTYA 3A6CH 2OR8A 5J11B 1KPUA 1OTTC 2BCKB 3HR5B 1JSYA 1YMMB 2R23A 3EJYC 4ZFOB 5K5YA 3ULUD 3ZZSA 1HEZB 4HA1A 2X9XA 4NO5B 1NMAL 4JFEE 3Q5YA 3GSVA 3KLLA 3QIBD 1GSKA 2WAHA 3I6GA 5DJ2A 1KTLA 3RWEB 2ZSWB 1R5WB 1VESA 2CO7A 3HC4H 4HKXA 4BRJA 1E9OA 2YQBA 3OZ9H 3DVNA 5AVSB 5J6SA 2NYKA 2WQAA 1EERB 1EO8H 3AACA 3ZSSA 2CHXA 2VABB 2PYFB 3OJ2C 4JRXE 3SJVE 4PJEA 1WISA 4JEGB 1Q94B 2WZPA 3EUUA 4P4RB 4NQSA 4NQEE 1UWXH 1H3UA 3GJEB 3EOAA 5ALBL 1BQ5A 5DLML 2Y2YA 4ONFL 2DF3A 2KT6A 4QO1B 2V5TA 4Y9GA 3V0EA 4G8EB 4HWUA 1U92A 5KN5B 1E3XA 1I9JH 1IBGH 1EK3A 3RIFF 3QYNA 1MHEB 3ZE0E 4IBWA 4OZIA 2ITDB 4UT7H 1ML0A 1I8IA 5DURB 1QLRA 3VXOB 5DQ9A 1CFTB 5ITFA 1DZBA 4OIFA 4H1LG 4V33A 5I1CL 2BSRB 1KLUA 3MZGB 4EIZC 4DW2L 4PUBL 2MQGA 1SN2A 3AG3B 1CS6A 1L0YA 5HI5D 4C54A 2OX5A 3QUZC 4RNRA 4AIZB 4DCQA 1NCDL 1X7QB 4LIQE 5DRZA 3V0VA 4NQDB 4YHNA 3QXVA 1AR1D 2P80D 5I19H 3QH3B 5FDWB 3NJHA 2VIRA 2XKUA 3Q05A 3KPRE 5DHVH 2VXVH 3C6SB 5SV4A 1K2DA 5D70H 4E42B 2CO4A 3O6FC 4M4RB 1U95A 2A9AA 4DF9A 1X4YA 2Z31A 1HQ4A 4M3JA 3V0FA 1U8CA 2PTUA 3P54A 3RY6C 1MAML 4J7RA 4G72B 4V1DB 2GK0A 5F9JB 3U9UA 1EFXB 3POCA 4JZJA 2V7HA 1AYOA 1BVNP 1EGJH 1WFJA 1BD2A 3EJZC 4NJ9L 3QORB 3TJEH 2A0LC 2F18A 1UUNA 3BP7B 1X5LA 2VDLH 1KJVB 1H3VA 3QXUA 2DRUA 4LEOA 4KVNH 4QHLA 5DHXB 2IDTA 5ANMB 5ICYB 1WHPA 4NIYE 2KZ1B 4N2KA 4YO0A 2ISDA 3T0AA 4B41A 5BS0A 4PWEA 4IGBD 4R2GB 1ZWIA 3ZRCC 3A6OA 5IB4B 5F6IC 4A7SA 4CU6A 3I9AA 5HHME 5D2NC 5C71A 3OPUA 4GKSB 1FNLA 4E9SA 4P46A 1SEBB 4C56B 2UZIL 1PLGH 1Q72L 4UWQB 4JO5A 4AUJA 2GC7C 4YSQA 2GI7A 1F45A 2ZAGA 3BDYH 4LPWA 4S10A 4ZTEA 3QDMB 1M9SA 3QULB 1KTCA 4H88L 3WUWG 4KMTH 2XUWA 1RUPL 5T3XH 3P77A 4HUUA 2XKNA 1L6ZA 4LFHD 2FNWA 1NGZA 1RUAH 3L4CA 2HKFL 1J8HB 1S7QB 1X5FA 4BGLA 4EUPB 2MRYA 3MR9A 4G6JH 3S96B 2UY6A 2WQUA 3SKUD 4CSPA 3VU2A 3PABA 3PV6B 3KDMB 2CK0L 4YK4B 3CZFB 2VN6A 4IRZA 4H20L 4B97A 2Y9RT 3TIEA 5JHDE 1KENH 1MCCA 4FFWC 4HW6A 1ZEAH 2AV1B 3BT0A 4LSVH 1BV8A 4H0IA 3ZTJH 4GQ9L 3QUXA 5HI3C 2H32B 1R3LB 4ELMB 1EEZA 3QWNA 1FPTL 1RPQA 2ZJSH 4O4YL 2B4CH 2GY5A 3DRQB 3GRWL 1MWOA 4LEXH 4PJXE 3SO3C 3SQBB 5D1QD 5HGHA 3RDTD 5E2WL 2CHDA 1B3IA 6TAAA 5E2JA 3L4WA 4OFPA 3E0GA 2EDMA 4UTBA 1H15A 3WOVA 4J3BA 3NCYS 2Y7LA 4WJKB 1CDIA 1JWUB 1TQBB 3UEZA 2H8PB 3ME0A 1RPUA 2WC7A 2J88L 5CR8A 3IGKA 3HPJB 5CJQH 2ENQA 4JRWA 1N6VA 4ELKB 1XGUA 1ZRUA 4HCRH 3PWLA 1DBAL 1MHCA 3UP6A 1U91B 3IN0A 4U3SA 1AIFA 3IFPA 5HXMA 2AQ3A 2OMUA 1RZJH 4FEIA 2R2CA 5D72L 4EDWH 3C6EA 1N18A 5C0RH 3W38A 3RILA 1D5IL 1QBLH 4XPBH 1U58A 1EJ8A 5GRXG 3VD1A 2ZG2A 4TRPH 3ZDWA 2DKMA 3LS4H 1TCRB 4HOWA 3S0PA 3GBML 4A39A 4HUWA 5B4MC 5LXGL 4K07A 4QXUH 4MD4B 5B39A 1DVUA 4OLYH 1JZ8A 5CEXB 1S7UA 1URZA 5DVKA 4N2LA 2NCMA 3ETBF 4JE4B 4I9XA 1AHWC 4YAQB 4O9HH 2MH4A 1FVDB 1DQMH 4GRLA 3JTTA 3UROR 2WLZA 3LZPA 4XBEL 2B5IC 1I8MA 1KF9B 2CAKA 1NDMB 3OPZH 4DK3A 3OLEA 1W8EA 3FHAA 2P8MB 5CWSB 2YOAA 3GMLA 4ZAKA 1QSED 5DD1L 1FZMB 3OKKA 1Z3GL 2HX9A 3ZE2F 5HPOA 2BZCA 1QRNA 1UB5A 5GSRA 1RZIA 2H2SD 3N50A 3OR7A 4FP8L 3KLQA 1RJYB 3L16A 1YNTF 4JDZA 4DQOL 4NI6A 5E2TL 2X4OA 4EI6B 4EIBA 5IMKB 5JMRA 2HG0A 3WFBL 4A2LA 1AO7A 3U0TB 1OAKL 3QZOA 1E6JH 3OLDA 3B7UX 4HWBA 4IOFD 4FZ8H 2XG4B 2KHAA 1IZJA 3CHOA 3MROB 3NSFA 4B9KC 1LO2L 3QC5X 4YHMH 4OFVA 1KB3A 1UKTA 3VNYA 3O4LB 4JO3L 4LKCB 4TVPE 1O5PA 3VSUA 4YNYB 2I5YH 3BQUD 4Z7VA 5CM1A 2UXTA 2WLYA 4JRFA 3QI9A 5AAWA 1FL5A 3BP4A 4W9JC 4KVCL 1VGEL 4XGZA 3ZMEA 4JB9H 2K6ZA 3FRPB 3FU5A 4CSTA 2C4XA 3L2LA 2OYKA 1X5XA 2QQKH 5GRJL 2XN9A 4P99A 4OZGF 5CBAA 5IQ9A 1ZV2A 1A7PL 5GGTA 4PS4H 3PV7A 4Z0XB 1CE1L 1UXMA 3QUZB 3CFDB 1WWWX 5LO7A 3VA6A 3N44F 3QEHA 3D39E 4TUOA 4P5KA 4FNLL 1DHKA 1BWMA 5DQDH 5E00B 4JL1A 5KYYA 4QHUB 3NH7L 5BS0D 2J44A 1NDTA 5DUMH 1N2RB 1QHQA 3AC0A 5EIIG 2MCAA 3WLBB 1KTKE 4MD0A 3O6FB 2EXSA 2MCMA 1ZGLB 4XN9A 1OSEA 2OJEA 4XN5A 4NNPL 4Z0BL 4P46D 2XA3A 4TQIA 1RMFL 1KV3A 4PJ6A 1MY7A 3LQAC 3SDAD 5FO9B 2BO0A 5AOIA 3N85L 5SWQB 4U2ZA 3OKOB 2FHBA 2G2RA 1N4XH 1EDQA 4ZMVA 5D71H 2P3YA 3C6LC 4PJ9A 3OKYA 2B2XL 4L2LA 4D7PA 1E9PB 2K9UA 4F8OA 2P5EA 4N2DA 3RVXC 3F5WA 4X7DC 3ROLA 3NJMA 1LNUB 1YJDC 1GYWA 3OKEB 4MCZA 4KJQC 5DC9B 1OE1A 1GIGH 5F6IB 3GSNA 5FA4B 1YN7A 2Y06H 3IJHA 3L3OC 4H4NA 3N06B 4WENB 1NAML 4WFED 3QJOA 4G8IA 3TBYB 1WICA 5AVXB 1VCAA 4ODHL 4FFVD 4PRHA 1AGCB 1PVHA 4KK6D 4LZKA 5I0WA 3WAKA 4U2YA 5I1IH 2R0KH 1EBAA 3D2TA 3FK3A 3G5WA 1Z5LB 2O6FA 1CK0L 2AQ1A 3RFZC 2DLFH 5GGVL 1E8ZA 1H3PL 4XCCH 2AK4D 5HDRA 1V3MA 5I8OH 4PJ7F 2P8PB 2A4CA 4NAMA 1XH1A 5T3ZD 4IIQC 1DO6A 3O3EA 4AYDC 4KX7A 4UQCA 5SWSB 3FQWB 2XWBB 1KIQA 2EADA 3BC9A 5D8JL 1TVBB 1UD4A 2VUYA 5T5NF 1F2XK 5BOZG 3SKMB 2KPNA 4IU3B 4G8GA 4X80H 5B38B 1PG7W 1N12A 2GSIA 2BNQE 1RJZB 4Z76A 2IG2L 3U0WH 4KK5C 1AACA 2RFXB 3UCQA 5KS9A 4A04A 3UP1A 3KVDD 3NFPA 4PBWD 4RWYL 4OKDA 1WZAA 2YBGA 4JFFA 5C09A 5IF0B 3PJNA 3CC5B 1ZVHA 1S5HA 2O6PA 2B59A 2X1PA 2Q0ZX 4RQQA 1W72A 2N7BA 3EUDA 2VLKB 1CPUA 1U33A 4OJYA 3V6OC 1GMIA 2GIMA 4HLZH 1H3GA 1LK3H 3KCWA 4E0RA 2W8CA 3WIFA 5FO8B 5EEVA 1MREH 1T04B 4QMEA 1ZXKA 3VFWA 4K94L 1V8HA 3UMNA 2H6OA 4ODSH 4KRPC 1YYML 5FC9A 3F6LA 4LCYB 3WNLA 4PB9L 3SE9H 4XAWL 4OIAA 5H4ZA 4TPRL 1MUJB 2PXYD 4LESA 5FYJU 3S5YA 4JPQA 3TYFB 1R3IL 5E0FA 2DMBA 2WP3T 3QJFB 1UA3A 5K1JA 1AP2B 1FYTE 4I89A 2R0ZH 1BJMA 4U3CA 4X6DB 3QIUD 4GRLD 1VZGA 1BFVL 5IBLC 4D0DB 4D3CH 4HJUA 2AAAA 1JBJA 3GDBA 1FFNB 2V17L 3BH4A 2P9RA 1MEXL 4HZLA 1BXXA 1N5YH 2HFFB 2R2EA 3E9TA 1M3JA 3VH8B 4RMWA 2OR9L 3R06A 2YD0A 3VFGH 1ZT1A 3KVPA 4UIKL 3B6SA 5F21B 3FC8A 4FAAB 2Y07L 1QRND 4KI5C 2A1WH 3BCFA 1OAUH 1HK6A 3RP1A 2DLGA 4NRZA 4OCRL 1NFDB 5CGYC 4NPJA 1PQZA 4KY1L 2NNAA 1XF2A 1CICC 2QDWA 4X83A 3V4VL 3K6OA 1Z9LA 3Q01A 1AO7D 4R4BB 2FGWH 4ANUA 4DK6A 2R1WA 4BUHA 3LZQA 3MACL 2Q7AA 1JGDA 1G4MA 3BVDB 5A7BA 3CXHJ 1AHWB 1MRFH 4Y5YA 4YHYC 1TJGL 1UXLA 2YPVL 5ABAA 3ZMNA 2GC4C 2O4EA 1B0GB 5DYFA 1ORSB 4NX0A 3SE8H 4S1QH 4KGLA 1ZTXL 4MXVF 3U0PB 4L8DA 2B5IB 3EH5B 4AQAB 2YD1A 3GRGA 2CIIA 4Z8FL 1O6SA 3E3QE 1U36A 4FHBD 4EUPH 2XOTA 4PJ5E 4P3DB 3QI9D 4GXFA 2XTLA 3TF4A 4OCXL 1WF5A 2ZKWA 1FC1A 1X5AA 1NGPL 3FU7B 2HLAB 4EO5A 4OT1L 1UT9A 5JYLA 2DBLL 4NUPA 5KBKA 4P57B 1HNGA 4PB0L 2WANA 4YHPB 2BSDA 5DCCA 3OJMB 2H32H 3EOTH 2E47A 1UZ6E 4X5PA 3KPLB 4OD1H 2Z93A 1TFPA 4X6EA 2YD6A 5SWZD 2CNYA 5ALBH 2XG5B 1QI4A 1T1YB 4GBXD 3KEHA 1JRHL 1B6DA 3V4PL 4EMZA 2AQNA 4B7IA 2XDHA 3MKGA 2J1ZA 4JQXA 4QCIA 2M26A 5C0ND 4IU2B 3QNZB 3QUYD 3CH8A 5G4NA 1H6FA 4HIHA 2OP4H 2OJ1A 4BM7A 4TQHA 1GGIH 2VITB 2YSTA 2ZONA 5DJCA 4Z7WF 1F3DH 4HJJH 4A37A 1CTNA 3WIAA 4DW2H 2RH0A 3ZIYA 1AG6A 1K9TA 1EJFA 2JF1A 4B7LA 3UTTB 4N2BA 4W9EC 1NCDH 4HCGA 1R4XA 3RHWF 4LL1A 1GJUA 3JV4A 1LYQA 5HHOB 2EILB 32C2B 4PBVC 4W9CC 4L4TB 4NHUA 3MCKA 5EULV 2VLJA 5FYJE 3QVAA 3QNXB 3BN9C 4JHVA 2WLLA 2YPKA 2APFA 4YDIL 4HU2A 5D1XB 3ZR6A 3TBVA 4HBCH 2G5UA 1MAMH 2KI6A 1JWSB 3U4EA 2FBOJ 1HC1A 4BKLB 2ZKXA 2WHVA 4BXSV 2AJXH 3MPCA 5HD8D 1TOXA 2Q8BL 3M1BB 3C6LB 3VSQA 2JB6B 3K2IA 5F1NB 3IXAA 1YDPB 3WEOA 1CFSA 2CKBB 1OPGL 2AQQA 3RVUC 2XBDA 4ODVL 1DQDL 3LXAA 3SN6N 4Z7OE 5F1OB 2DI8A 1P84K 1G7LB 4LLQB 3ENEA 4XNUH 1F8TH 4H44C 4GXVL 3UGEA 3MRFB 3GRBA 3L3OB 4OGAC 1IKFL 2ED6A 4IKNA 1OAJA 1MH5B 4IS6B 4GUQA 1S9WB 3L7EB 1QR4A 2WBKA 4Q7DA 4TN9A 5C09D 3U1PA 1DVTA 1T0NA 5DHMC 5JDSB 1GTFA 2PMZA 1IJNA 1Q72H 3RFZB 3VVWA 3FOLA 3LEXB 4G8FB 3WJLA 2LLLA 2YD7A 3QNYA 3KGTA 5FYKU 4AGNA 2JKIS 4JFUA 4RRPM 4ZX3A 5ISZB 4KKBC 1T3FA 4U1HA 2NNFA 3PGDA 4L9LA 1WITA 5DHDA 2ZSVB 3QXAA 5TGBB 4Z7AA 4PJGE 1NBQA 4XB8A 5ADOL 3HMWL 2OSWA 2HXAA 5AFAA 4FLOA 2DYRB 3QNFA 1WCQA 4YDKL 5CLXA 1T1WB 4MMXC 3QDGD 2Y2TA 1Y1UA 5TF0A 1X4XA 2D7QA 1KB5B 1WBXA 2CU9A 5CU5A 1I31A 5EOQL 2GBTA 2HVJB 2W0FB 2CCWA 2VDMB 2Z8RA 5IROA 1MZZA 4YHOL 4HOXA 4GQ9H 1A6PA 1EUUA 1UJTA 3G6DL 4KTYA 1DVFA 1D7CA 5EC1A 4KV5E 3TA3C 1L9TA 3WNNA 1Z9NA 1A6TB 3IWUA 2ZWKA 1P5UC 3ARRA 5C3LD 3E8VA 1FV1A 4Z3EA 3KNBB 1MFEH 4PJCE 4K8RL 4HSAC 1BQHA 5HHQA 5E2WH 4XVJL 1AXTH 1IGCH 2PR9A 2QV2A 5CEZE 1A7RH 1M3IA 2PWEA 4M1CD 3EJCA 2ZICA 3LSOB 2F5AL 4KRPB 4ZO7A 3RPKA 1QSZA 2F54E 5DUPL 4M8VA 2AQPA 2A6IA 3QYCA 1JYVA 3BH9B 1DANU 3H6JA 4JG9A 4OJCA 1S7RA 2FEEL 4QHNB 5DRXB 5FUCE 4G2AA 2QFPA 4C58B 4C83A 1JZDC 1Q0EA 1A1MB 5KYUA 4Z23A 1A6ZB 1HNYA 3SYCA 4WTZA 4Y2OB 2WWNA 4R3SA 1DBAH 2XA8L 1A6UH 1UWGH 4E9RA 4E5XB 1A4JB 3ZT6A 1D2PA 5EUKA 4G9FE 1EBPA 3L13A 2W59A 4N87A 3DXAD 5DD6B 1EQWA 3QXTA 1P6FA 1N3NA 3X13A 1D5IH 2YJLA 2BC4A 3KBPA 3QJZA 3JV0A 1GS7A 3RI5F 5M94B 5HHNB 3MREB 3SSGA 2LR4A 1P4BH 3MYJA 5LKNA 4ZFGL 2ATKA 4OUUA 4UQ3B 3T65A 3WHE1 3QQNA 1CICB 1WIPA 2G4GA 9CGTA 5LXGH 4KKAC 4UOW1 3FTGB 1JPFB 5BMFH 4LXFA 3TFBA 5B8CC 1A9EA 4YHYB 1J8SA 3GIVB 1JXGA 4HAFA 1Z9SA 4UNVA 2L4OA 2NW2A 4GW5B 4W9KC 5E8DL 1LE9A 4M48H 3AS1A 2EYRA 3RDJA 1YPZA 3LYRA 4GNKB 4XBEH 2F68X 5E6RB 3FCBA 2GUYA 2NY5C 1C08A 2R0WL 4L8CB 3CK0H 5BXFA 4OLZH 3CFBA 4Z5RA 2M8XA 4PJBF 4KOBA 5DD1H 1ZHKA 5E56A 3H2PA 4XP6L 4HJGB 1JFQH 3TT3H 4LGSB 1PSKL 3BRDA 2DJUA 3IPBA 1S7WB 1UVQA 5LBVA 4DP9X 4N85A 4FP8H 5IBUB 2D7TL 5A6LA 3HCVB 2ZXWB 3BEWA 3N41B 5E2TH 1LHZA 1BVOA 4D2NA 5BZDB 2VUOA 3CN1A 3P4MA 3WFBH 1OAKH 1U8NA 2IGFL 3NVQA 2AKRA 4OZHF 4YQXH 4DIXA 5C0AA 4BFRA 4DO4A 1DUZB 2DQUL 1QSEE 1FRGL 4NLHA 2ITCA 1OP3K 3SYQA 5I6LA 3D0LB 4TSAH 3BKCH 4YJZL 1BWWA 1A1NA 3QUHA 4D94A 4JM2C 3NCJL 3VI4E 1S9YA 2OBGA 4P9HL 5LJYH 5T1KD 3IJYB 3MV7E 5GJSL 4ORGB 4MJJA 4M5ZL 2EEFA 4I3RH 3WFDH 5E6IC 4CKVX 4WNSA 2MEJB 1ZJBA 1VGEH 1WZ1L 3SE4A 4Q9CA 3VA2C 5HBBA 3N55A 1RD6A 5DHVA 1HHKA 1PIGA 3BIKB 4WLCA 4K7PL 1A7PH 4JK0D 1UD6A 1BOGB 1I1AA 4F1ZA 3VXUA 1CE1H 4M5TA 4D9RE 2Z1KA 2Y7OA 3WE6A 2VH5L 2WAQA 2WQVA 4QRQB 2WZ5A 1IGTB 2ZUUA 4Z77A 3V5KA 1T7YA 4PGEB 4PTTA 3CHSA 4JG5A 1JAEA 2X4UB 4GSRA 1EGJA 3AVEA 4H25B 4N1EA 4CN6A 2E7BA 2BDNH 3DTUB 3RIFK 3KYOB 4U6VL 1GY2A 2XRAL 4FQXA 2WIIA 4A7QA 4H5SB 4RZKA 4GIAA 1A22B 2BIOA 4FKHA 2OMXB 2CIKB 4N2CA 3QEQB 4NENA 4RGMC 4JFOA 3FTXA 2ZP0T 1WJ3A 3BAWA 2O5XH 2BIMA 1G4RA 3HA0A 3UYPB 3NIGB 1U3HB 2PN5A 5BPPA 4AEIL 3PGFH 3A47A 3BDXA 2X0WA 2ZCKL 1CVRA 5DFTA 1M1XB 4UANA 4ODXB 5HPMB 2B2XH 3SKNA 4MAUL 3SCMA 1EEQA 2BK8A 5KUMA 5F7HA 1HH6A 3ILPA 3VXQA 4X9FA 2D7MA 2ZX8A 4ZUTB 5MI0C 5C1MB 4Q97A 3EJRA 3CN3A 4FQIL 4L05A 4CDGC 4W93A 5KVGL 1NAMH 1YEHL 1MY5A 3ECWA 4ODHH 1S7TB 1TKWA 1ZCRA 3PQYB 2DWEB 2OMZB 4IOIA 2W9EL 3SE3A 3FT4A 3GXTA 4X6CF 3CZGA 4XPGL 3RWDB 3RTQD 3DIFB 3F58L 4WTQA 4U1NA 1DVFD 4J3OG 5DMIL 1YQVL 2FWUA 1HEJC 2X3AA 2EXYD 1TQVA 5MENA 3BZ5A 4F5CA 4DN3H 3Q8CA 1MLCB 3MRMB 1IAIL 1J5DA 2NSQA 2QMJA 3IRCA 2BY0A 1QFUH 1KCRH 3E6FA 5AVWB 3W81A 2CDGA 3ULVD 5J8OA 3BZEB 4IRJD 2WOBA 3GHEL 2D2OA 4MMXB 4PGDB 1AGDB 1T4KA 1FAKT 2YK1L 1KXVC 1O7DC 4NSKB 3ZRFC 1KT2A 2AK4E 3SD2A 1FNSL 2MOGA 1O75A 3MLWH 4H13C 5T3ZE 3JWNE 5JIMA 4M29A 1MPAH 3VXMB 4F8PA 3W57A 5EUOA 3LH2L 4HX1B 5EC2A 3BWUF 3MUY1 4L9DA 3TA3B 5JW3L 1P5UB 3EGDA 5AZEL 3D4ZA 5JPNC 1F1GA 2CO6B 1WIOA 1ADQL 2XIIA 3EFOA 1PX8A 3BGMB 4GAYB 5CUSH 4APXB 3L54A 2L7EA 1R5VA 1XGZA 4DEWA 3SBPA 4HCRA 2D9CA 4BFOA 3CCHB 4K94H 3CSYB 3PWPD 1DLHB 3I6KA 3FUDA 4AUUA 1YYMH 2RR3A 2WM0A 2QR0B 4E9XA 4ZMZA 1PTZA 1A6AB 2DQGL 2IBGA 4TPRH 4UQ2B 3NTCL 4M6OL 5FOBA 4XNYL 3ZYZA 1T6VN 2GJ6B 5KSVB 5DJZB 2KERA 2GHWB 3LKSA 1ES0A 1JGLL 4C47A 2XY2A 1B4JL 5DO2C 2P26A 4K9JA 3ZQXA 4HVBA 2TRYA 1RJCA 2GAZA 2GITB 1X7SA 3QZWB 4XN2A 5K9KA 2O93L 4AYMC 1BFVH 1KFAL 2CKBH 3MLTA 2GTWB 2V17H 5EBMB 4JQVC 1XH0A 4WFFE 2VLRB 1ZAGA 4PVNA 5CP7A 2X88A 1YJDH 5DJ8B 1T21A 3OKDB 3DGGA 1DANT 4A2HA 5GS0D 3KD4A 3UCRA 1M56B 4AKPA 1NIEA 1ZHBB 1X5GA 2UUDH 5I6PA 1TYRA 2Y07H 4M8QA 4HS3B 3QS2A 1T5KA 4RA3A 5DS8B 5DQJA 5EBWB 2UY7A 1LE5A 1TMCB 3LN5A 2CG9X 3WHE0 4AIEA 4S1SH 3RNKB 4OCRH 2HT4C 2ESVD 1XVSA 4KY1H 4PV9A 2C3VB 4UOW0 4Y16D 4NPYA 2IDUA 5B8CB 5JIPA 1WCBB 3MACH 1A25A 5C0AD 1K3ZA 3PG2A 3AUWB 2BVQA 4OR1A 3T8MA 3TN0D 4G71B 1YUKB 3ZDYF 2EXWC 5JIKA 4LPUA 4QWWD 4LARL 2WXKA 3Q5TA 4FQHA 1KJMA 1FL3A 5F7YC 3GSQB 3HMXL 3DYOA 3IGFA 4LASL 4BFIA 3LKPB 5F88B 5EF1A 1D5ZB 4OT1H 1F90H 1KB5H 4N2MA 3CFKA 5H35B 3MUGA 3V9CA 3FS9A 5HHXH 2QDVA 3TO4D 2VO8A 3QZMA 2AF2A 2EEXA 1NCJA 2CNZA 4BH7A 1T7XA 5TFSH 3F7LA 1CXFA 2XU9A 3RYMA 1T66D 4JFQA 2NOYA 3AU1A 3K72A 4JM2B 4AH2A 2ZCZA 5IQMA 1XZWA 3BP6A 3KJ6H 3KH3A 3B1UA 3QARA 1SFHA 1TNMA 2W92A 5CJXA 5K59F 3MRCB 5DXWA 1E4WL 2CALA 4HUMB 3SHSA 4R8WH 4MMZA 1PCSA 5E6IB 1KCUH 3SQOL 2ZF9A 2ZOLB 2Q7YA 1KBVA 1S7VB 4JN2B 5HYIA 4MQ7B 1PEWA 1NOFA 2YMTA 3EBAA 4MD5A 4QYOB 5SWZE 4HV8B 3LXCA 3DSNB 4XX1E 3ZE2E 5FFOA 1J5HA 4RGNC 1HHHB 4YH6A 3MV8D 5CSGA 1SVBA 2DD8H 2C3WA 3SCMD 1SJVA 5IBTH 4N8VA 4JG1L 3RG1C 1JNHB 4AEHH 5FR3A 3LKOB 1KBPA 2AABH 3NK4A 4P2QD 5E8PB 4KXCA 4FQ2H 4L8SC 5IJVB 5TQ2L 1B3JA 2R69H 3DA0A 1TMQA 3GEFA 4L8BA 4XXWA 2OI9C 1HILB 3K6IA 4J4PC 4AJ0A 4U0QB 4WU5A 4RGMB 3JZYA 2FJFA 3E9UA 3MUUA 1D7BA 1PLAA 4QIRA 3I6LE 3O3AA 3IPFA 2FEDC 2JKWA 4HPYL 4YDIH 3IMBA 2YARA 4RSYA 3U1SH 2BCKA 2XTJE 1XD0A 4ZFOA 1YMMA 3S37L 5MEND 1ZA3B 5IP4A 2GFBB 4C59B 2VZ3A 3WS6A 4OZGE 1TJMA 1BBDH 3CUPA 3MBEB 4KQ3H 4AXWB 4BQ6A 1OANA 3IXTA 5CLWA 1N8ZB 2ZSWA 3BJ91 4W9FC 1R5WA 2C1OA 1CF8L 4GXVH 3VFUB 3QYMA 1NH6A 1K72A 3AS2A 3EIFA 2NR6D 3MRBA 3KYMB 4A2GA 1IKFH 2W91A 2VABA 5B1JC 2PYFA 7FABH 1M57B 4U31A 4IDJL 2NW3B 1O9VA 4P4RA 2A73A 2ZT9C 3GJEA 4URTB 1XGYL 3EJTA 4M7LT 1ACXA 4OY9A 3TBBA 1AY1H 1CLZH 1WTGT 4QO1A 1IGFL 3R7RA 5DA4A 3ILDA 4G8EA 3ARYA 5KN5A 5KVDE 5IKCB 3D4YA 1MHEA 5IUSA 4MBOA 3UBFA 3H9SD 2IWEA 2UYLB 3DV4A 2KDYA 4CGTA 1Z32X 4GUOA 5A2FA 1LP9A 2D7NA 2ICES 1E28B 1UWEH 3MGAA 3LZFH 2DLHA 1SOXA 2VB5A 3HRPA 3FRUB 4HEME 2QADC 3AABA 4AIZA 1X7QA 3G6AB 5IVNA 1QTSA 2XVGA 3LEYH 1OT4A 4XPTL 1JHTB 1ZMYA 3VMNA 3QH3A 5FPIA 5FDWA 4RETB 4YHOH 4PYHA 4HXAL 1Y1DA 1JOIA 4TQ8A 4X5WB 4E42A 2J71A 5FECB 4KUZL 3WY3A 2H9GA 5JPNB 3U7YH 1RIVH 1W16A 5DJDB 4NEHB 2EVHA 4K9EC 4U0RC 4V1DA 4D9LH 1MCKA 3QDGE 5JHBA 2UXVA 1SXBA 5F9JA 4P2OC 4DTGL 4POYA 1EFXA 2RCSH 1NFIB 2BS9A 5IJKC 4X99A 4XI5D 1I53A 4L3CB 1AKJD 3OM3B 3OV6A 3CBKB 2AXGB 3TGXA 3BSHA 3BP7A 3CFIC 4FQLL 4I0PC 1KJVA 4LCIL 5DUPH 3OXSB 4EDXA 4JDEA 1I85A 4PS7A 2K6WA 2E6PA 4FJYA 4X5XB 5ANMA 4BCXA 1OIOA 4R5VA 5E1HB 5ICYA 1REIA 3BD5A 1OCWL 5TDPA 1T2JA 1VFMA 5F96H 4OUOA 3HVNA 1IAKB 2X7LB 1MFMA 4GKSA 4PGJA 4QYAA 1QPXA 4XTRD 1YUHB 4RBPK 3QT2A 1U8JB 1K8IA 2WBXA 1P84J 3CVHB 2ZX7A 4XAKD 2VW4A 2WUCL 3QULA 4PWIA 4C4KT 4WWKC 2AJUH 4JPWL 3NCYP 4RAUB 1M71A 1MW0A 2YPLD 4ZFGH 2AEQL 3BVNA 5PAZA 3Q06A 2F8OA 3FYIB 1A7QH 1KN4H 1QYGL 2GIXA 3QPKA 3HE7D 4EUPA 1S2EA 2XSKA 2OW6A 4ATWA 4N8CL 1KXQE 3PV6A 3DXAE 3PWJB 4S2SA 4N25A 4P9ML 2E86A 5I0YA 2R8SL 4XWGL 5K9JL 4HKBB 3QA3B 1EXHA 1ZK5A 3EDEA 3MXWL 5CLYA 5E70A 2AV1A 1RK1B 2R0WH 1F86A 1G6VK 4ODUA 5HGAB 2H32A 4OZIF 3TH2T 1GZPB 4FG4A 4TUJB 1EEYB 2W60B 3AG1B 1CFVL 1KBWA 1BA9A 1NGWB 2H2PC 1MFNA 3SQBA 2JKRM 3Q6FA 2I7OA 4GUPB 3WAJA 1ICTA 1NBVL 1HL8A 3B56A 1LD9A 1NL0L 4K7PX 2IGFH 4XO5A 5EO9B 3CFQA 3WIIH 1IL1A 1ASPA 2HJKB 1NGYA 1FRGH 3HPJA 4GQQA 2I26N 4Z7NB 3HEIB 3TZVC 5JR1H 4Z95H 1AI1H 2HRLA 2H26B 2DYPB 4YGVA 4RISH 4WNJA 5F8RC 4ELKA 5DMYA 1JZJA 1H5BA 5HDQH 4LDEB 4E41B 2IGLA 4KO7A 4P9HH 1A4KA 1T2QL 4DKTA 1G5AA 2YGQA 1IIKA 4IW4C 4PWFA 1J0ZA 2XZCH 2VE6A 4P4KC 2J6EH 4U1GC 1CYXA 4IMLB 3KYAA 2R0LL 1WZ1H 2VJ0A 3KLSA 3TCXA 3VXRD 3HRZA 2ZCLL 5EO0A 2MTPA 4NLAA 3WL9A 4RGNB 4HC1L 5D93B 3D9AH 5F9WB 3GI9L 3OF6A 1PF3A 1BAFL 3SYPA 2VH5H 4IDLA 2W38A 1TCRA 2XZQL 1GS6X 1QUNB 4I48B 5AALA 5LN8A 2A4ZA 4GSXA 4L8SB 2COQA 4JO1H 4X7TB 4MD4A 3C09C 2YAMA 2OI9B 4U6VH 4WHYH 4LIQL 1PZ3A 2X4PA 4AI7A 1YMHB 2C7UB 3FBKA 1X6NA 2DWTA 1X5ZA 3MGTB 1KELL 3BLKA 1KEGL 4MNGE 1NDMA 3WBDA 4CW1A 3L3HA 3FU6A 5L4JA 5J1AB 4AEIH 1FZMA 2ICCA 4PV8A 5DD0L 4HIPA 2WWKT 2ZAHA 3D08A 4MAUH 5L2JB 2JV6A 5GS1C 1RJYA 4Z7WE 5I1LA 1P4UA 2VR6A 2E5EA 5DFVD 1WT5C 4EI6A 1XMEB 2NY5H 1A3RL 1OAQL 5IMKA 1N59B 5E94B 3HI6H 1DQJB 2A9NL 5EPMB 5F6HI 4ABQA 1NGQL 2H47C 2YO3A 4FQIH 2DQDL 3D69B 3UGUA 2XG4A 4IOSA 4U6TA 2F7QA 5KVGH 3D51A 1YEHH 3CDGA 5C08A 2Z7ZA 3O2DL 1MCNA 4TLKA 2D3VA 5GGSB 3BYTA 3UPRB 4PV1C 1NQBA 5F7AA 2W9EH 4XPGH 1MCSA 3NJGA 3VO0A 1QLFB 3PUCA 1WAAE 1I8LC 2XT1B 3F58H 3HI5L 4LKCA 4UINL 4WO4B 1PZBA 3ZYJA 4HS8H 4UILL 4YNYA 5DMIH 5A2KH 2GK2A 3BXNA 8CGTA 3UZVB 3PRZA 1F11B 5CSBA 4GAJH 1VEOA 4LQ1A 3UAEA 4L5FE 1BPLB 1T2XA 2B15A 5L7XL 4GKOA 3WJJC 4FFYL 1J9QA 3ARWA 2E75C 3EO9H 4O5LL 4Q4EA 4WHDA 3D25B 2ZYIA 1INQA 1B88A 2QADB 3CFDA 3GHEH 3LVTA 3QUZA 4IM8A 3DOIA 3NCBB 3ZKMD 4I4WB 5E00A 1KIUA 2Y1ZA 4YSCA 1S9VA 3N2JA 3PLYA 5HHVH 1AQKH 5CZXC 1HE8A 1IEBB 4JFEB 3BVUA 1N2RA 1F4WL 1UM5H 3WLBA 4C57C 1H6UA 2R1XA 4X0KA 3D52A 5JW3H 3O6FA 4UV7H 1X5KA 4ZNEA 3OQ3B 1ZGLA 5AZEH 1KACB 3REVB 2DN7A 1YYLL 3VACA 1R5IA 2V33A 3DX6B 5H37G 3RY6A 3VQMA 4U0RB 3WKNA 3LMJL 5FO9A 4P2OB 1NUNB 3MRJB 2I9TB 5SWQA 1NCNA 4OJFL 4JRXB 3DC0A 3OKOA 3C5XA 4ACTA 4G1EA 3W11C 3FQYA 2GI0A 2XN0A 5ICXB 4I0PB 2QQLH 4Q8BA 1E9PA 2Z35B 3PGCB 5IQLA 2K8MA 1OD7A 3NTCH 2QQQA 4M6OH 4FTDA 4YR6B 1HE7A 2QQNL 3GBEA 4OI9A 4PS8A 1JS4A 2MTAA 4M9OA 1IU1A 5I0XA 1B4JH 1D9KD 4YXKH 5L0QC 3ELAT 4AG4L 3P40A 3SODB 4LSDA 1ID2A 1ZV5A 3PWPE 4ZMLA 4BK4A 5AKRA 2DQTH 4KDWA 4BYHA 3D3VA 3V6FB 1F97A 2YWYA 5C0JB 2IOMA 1MW2A 2YRZA 4J3WA 3V10A 4EAEA 4CC0A 4E9TA 3F12A 4WWKB 1QPPA 4P06A 5DUBB 2HFEB 2NY4C 1BMWA 1EPFA 3QG6B 2G60L 3BP5B 3PDOB 4RFNC 1PFOA 1FE8L 2ZE0A 5CZVL 4ICXA 3GMRB 5BJTA 2MPAH 3FQWA 2XWBA 2L7UA 1OWWA 1TVBA 3SKMA 4IU3A 3WCYA 4EZLA 1RJZA 2EIDA 3F6IA 3WTVA 4YHKH 1CBVH 3NIDB 2J55A 3I84A 3BUPA 3LXBA 4LSQL 1KJ2B 1RLWA 5IF0A 3CC5A 3HG5A 3BPNC 4UZUA 4D8OA 4Z7VF 1BAWA 5MEQB 4LARH 3GYRA 1A4BA 3UTSB 1G7MB 4PM1A 2VLKA 3UJIL 3N40F 2B16A 4HXBL 3HI1B 4NB7A 3COOA 1PBYA 2WNKA 3Q2LA 1OCCB 1E8WA 1KYOK 3UZQA 1UEMA 1VFAB 5FO8A 4CAGA 1GZHC 1T04A 1ZANL 2Z7UA 4W9LC 5CR1A 3GXPA 4MJIB 3OF6D 2DDQL 2LABA 4MQXD 1G9HA 3JWNG 4D9QD 3TS8A 3L3KB 3UEQA 4G11A 3IYLW 1E4KA 2YKLL 4LDCA 4MAYD 5BVPL 4XMPH 3TYFA 1TEYA 1T89C 3QJFA 4I8DA 3MRIB 3ECVA 1NWPA 5IMOB 1AP2A 1CVSC 3ARGC 5EB9A 3MMEA 1TU2B 2C1PB 4PJFA 4X6DA 3LNGA 5IVXA 5JYMA 3IS0X 4P4KB 5E1IA 4D0DA 1GS8A 3ARDC 1DLFL 3SY6A 1LWJA 1FFNA 1ZOXA 3Q9PA 1KYUA 3EBHA 4TVPL 1FA4A 1WEJH 1Y0LA 2ED9A 2HFFA 4PJBE 3VH8A 3HAEG 4E9VA 4YEEA 1EZVY 3S7GA 5DVMA 4NZDA 4HUVB 2IWFA 4K5NA 4QT5B 1QD0A 3VB9A 1XSIA 3KPSE 2ADJB 1QFPA 3ZDZF 4JG1H 1UA7A 1NFDA 3CD4A 4YHIB 4LCWA 3S6CA 4FFTA 3ARBA 3EKCA 4J1UB 3U82B 4HG4K 1VDGA 1HX0A 1H3XA 4HPOH 4R4BA 3C09B 3EYFB 4KZ0A 1HL4A 5TQ2H 1PU0A 4B95C 4PJXB 4NFDA 4L23A 1AHWA 4WK2B 3CVHH 3UAJC 1KWKA 1JNLL 2VDNB 1B0GA 4HKZB 1ORSA 5ELIA 3MV8E 3VSTA 1YEFL 1QUPA 2CWRA 3RPBA 5GZOD 3U0PA 1A9VA 2Q76A 4W70A 2PPCA 3WI9A 3ZKNC 4EN3D 2IQ9H 3KXFE 1G9ML 3AWFA 1GPOL 3D30A 1T83C 4LRIA 1MCPH 3S37H 4P2QE 4WUKL 1NAMA 4ZO8A 4P3DA 4IJTA 5GGUB 4J3SA 3ABMB 1QSFD 5EIQA 1PFCA 2P46B 3V52H 3WU1A 2BFGA 5GS1B 2NUTB 3AG4B 3RY5A 5HY9B 1U93A 3NZHL 4P57A 3RVTC 1XF5B 2MNUA 2R27A 3GSUB 4X9BA 4YDVB 2XQBL 1MWAL 4JFTA 4XO4A 3TJPA 6PCYA 5KS9F 4K3GA 5F3HB 4AMXA 3C60C 3QCUL 1U3ZA 1KZYA 2W65B 2Y7SA 2JCCA 4IDJH 5C07D 2ZWNA 2OTPA 1T1YA 1IJ9A 2D03L 4KGJA 1WLHA 1NLDH 1I4FB 1RVFH 4LQFL 5I1HL 3RJDA 3II2A 4IU2A 5C0EB 2EIMB 3GBNH 2Z65C 5BO1L 3EJSA 2HT3C 1U8KB 1EMTH 3ETBJ 1NDGA 1FNEA 4NC0B 2VITA 4ZS7H 1OW0C 3T2OA 3DUSB 3FH7A 2Z92B 4BUQA 5I8KH 1OB1B 2X44D 3BUIA 3HS8A 5M7QA 2BVTA 2B7DT 1RP8A 1QQDB 1R33A 5CN3A 4MA8H 4HF5H 2CE6A 1R46A 5D7LA 2Y24A 4CILA 3PAZA 4RGOL 4PCKA 3HE6C 1OVZA 2NT1A 3H9SE 3IRPX 3VX0A 1GOGA 2E9WA 4L1BA 25C8L 4P07A 2IALA 5IW1A 2LQRA 1Q4NX 2SODB 4DHLA 3P2DA 4HGMA 5E5LA 5F3FA 32C2A 1DEDA 4DKFL 4HXAH 5CILL 5F7DB 4L4TA 4PY8I 4QJ5B 4XX1G 3IB4A 4PMFA 4KUZH 1TJIH 3QNXA 4WI0B 3DECA 4X6CE 1IM3B 5D1XA 1BM3H 3B9EA 1JWSA 3BFWA 4DTGH 3ULUC 4JFWA 4KXAA 4NZRH 3M1BA 3C6LA 3WKYA 2JB6A 5F1NA 2GQHA 3VXTB 2CKBA 1TTFA 4NT6B 2PPFA 3L3JA 1OOWA 3GZOA 1I7UB 4TUKL 3KGRA 3L4XA 1L5GB 1N64H 5DZLA 1G7LA 4LLQA 5J56B 3DGDA 4PWGA 4YUEL 4XZUB 2DQJL 3MRFA 3P9LB 4PRBA 5DEZA 4YFEA 5L0QB 5L8KB 1UCTA 1FGNH 3D50A 3IJ9A 2JLPA 3U7AA 4DP1X 5BVJB 4IS6A 3GS7A 2FWOB 1F3RB 3L7EA 1BW8A 4FZEL 4FHJA 1D7DA 1AAJA 4LP4A 3QE5A 5JDSA 2VM9A 2C8NA 3WFCL 3LQAL 2Q3AA 4OAWA 1NSNL 1U3YA 1CCZA 2NY4B 3NIFB 4ZODA 3HUJB 4JPWH 4XC1H 3KLHC 1JPTL 1OEZW 1OAYL 5ISZA 3SPHA 2PP7A 3OXRA 4XCNB 2FHCA 4PRPD 4RFNB 2ZSVA 3QK0A 1QYGH 2EXTA 4UZSA 1TZGL 2E3VA 3C5ZD 4N8CH 2BWDA 5HI5C 3VRJA 4FI7A 4DEUA 4XAKE 3MLSL 4W9DC 4P9MH 1EANA 2R8SH 1R3JB 5DS1A 4DKAA 5I23A 1KB5A 5JQIB 3BO8B 1N7MH 3MXWH 1MJ8H 4LE8A 3TP4A 2W0FA 3TVMD 2YPLE 1MWAB 3FONA 4ZUUB 3OC5A 1SN5A 1AD0B 3DJSA 5DI8A 3SB3A 1JVLA 4XMZA 2R4RL 2CH8A 4P2RD 1IVLA 1A6TA 3JWDL 3PXJA 1W9XA 3DI2B 1YSOA 5IHLB 5F9OH 3KNBA 3TFKD 2QEJA 3OG6B 5HYJD 2EUZA 5IY5B 1JK9B 5CD5D 5GGRB 1UOLA 5LHDA 3DK0A 4GG8B 1NBVH 3LSOA 1DVSA 1SMDA 4O02B 1J0IA 4DVRL 3JTBA 2Y69B 4U6HA 4LCWD 1NBYA 3ARBD 1AGFA 3BH9A 3MV9B 1N19A 1XXFC 3MNVA 5HDLA 4QHNA 5DRXA 3J7HA 4K9EH 2PPAA 4IGBC 3ARGB 4KHTL 1UT1A 3X14B 3ZDYE 1CG9B 1A6ZA 4QF1B 4Y2OA 4UT9L 4Z7OF 5M95B 4XP9L 2IH1B 5AVYB 5LDUA 1TETH 4PJDF 1VENA 4RESB 3ARDB 3UJJL 4A63A 1PG7H 4E5XA 5T1MB 1FIEA 4QRUA 4WGVB 2EIJB 3LHPH 1MHPH 3NJFA 2NX5D 2R69A 2ZCLH 4LPYA 1UZGA 5DD6A 3BPCA 5EEYA 3FJTA 5T5NG 1EV2E 3CPUA 3ZDXF 3H6AA 3P11H 3NN8B 2AERT 4NP9A 5LNGA 5HHNA 1BVKB 4FNTA 3M46A 3N1FC 4K3JL 1ZY9A 3ULSB 2NXYD 2N0MA 1CICA 2XZQH 3LAFA 4Q6IC 3U2SA 5BW7C 3CE1A 2WOYA 3KWWB 3QQ4A 4Q0XL 3GIVA 3VXRE 1BHGA 3ALWA 3B9DA 2DY2A 4ZK8A 2EVIA 3O2WL 4LIQH 3MLRL 2MOQA 3VFNB 1LXMA 2J1YA 5KSUA 1HDMB 5K59E 4MLSA 5DLLA 4GY4A 1KELH 3OAYK 2IOOA 3U36A 1OSPL 2FVNA 1CLYL 1SGKA 4BZ1H 4G82A 2O5ZH 1TPXC 2AXFB 4L8CA 3F65A 1C8PA 3KWVA 5EZPA 1J18A 1BFTA 1HXKA 5FYJL 3VJ6B 3FF7A 5TK2A 5F8QC 3MNDA 1IGIL 4JHWH 5DD0H 3HFMH 1FH5L 4HJGA 4XPHH 2AS5M 4CC4A 3QJTB 3SKOB 5D1QC 3O45B 1SXSA 3RDTC 2W88A 2XYBA 4IRSD 3TWYA 3HCVA 2QHLA 1B4LA 2F58H 4M6MH 4A2MA 1A3RH 5BZDA 3CPLB 5JIHA 2DTMH 4NNYB 4CJ0A 3EYVA 2X9YA 3C60B 5D7LD 1NGQH 2VR4A 2DQDH 3GLAA 1OTSD 2W0KA 1DUZA 4P2AA 2C34A 3WNKA 4JX0A 1FORL 3CFJB 2N7AA 1E7UA 2VW7A 1KC5H 2LU4A 5BUAA 2XPGB 4MZRA 4UINH 3H53A 1SHWA 3APFA 4NKMB 3IJYA 3DO7B 5JW4R 4ATTA 4H2CA 2FZ3A 5IV2B 4PJAB 3ETTA 1YEJL 4HHAB 2BCMA 3FAWA 1KYAA 2QZQA 5L7XH 2WINA 1ITCA 1BQRA 2YC1A 5EU6D 3BN3B 4NQCD 1BOGA 1NIAA 3IGAB 1E3ZA 2JI2A 2X1QA 2Z8WC 4QRQA 4PGEA 2GBAA 5C9KA 3KPQB 2X4UA 4M6NH 4WI9A 3KWTA 2WY3B 2Z4TA 2YGVA 4NO2B 1CN4A 3SD5A 2JQZA 1HFUA 3RVVD 5I71C 3V2AR 2XV3A 3QFJD 1UXWB 2WB1A 3GO1H 4Y4KA 2C26A 3GXFA 3KBEA 5EEUA 3BDBA 4F80A 3QUML 2Z4QA 3FH5A 4OVUA 1ZDSA 3X3GH 4ALAC 3UYPA 3E80A 1IBBA 1U3HA 4OJFH 3IGUA 4FXKC 5DZAA 2WZ6A 3Q13A 3V6ZB 3MA9L 5FF6B 4GMTL 4R7VA 4F7PB 3DO3A 3QIBB 5K9QI 4ODXA 1UCBL 5HPMA 4PRIE 2H2SC 2VDNH 4U33A 5JXAL 3WKQA 1J0JA 5CEZL 4LCUB 1WBZA 5CHNA 3PAYA 2GUOB 3T0XA 2BVOB 2FSDA 3B5HA 1HWGB 2DLIA 2QQNH 3WJMB 2G0KA 3VXSE 1CF1A 4FKEA 4IOFC 3CSPA 3GSWB 4PRNB 3POHA 1YPZF 5LBSL 3WFEL 4AG4H 2ICWJ 3DOSB 1S7TA 2QSQA 1N6UA 5LAPA 1UENA 5EBGA 2OMZA 3D85D 4ONGL 3QO1A 1W0VA 3RWDA 3DIFA 2VO5A 4K5MA 1M9WA 5ACZB 1J5CA 3SKJL 1EDHA 3L7FA 4PLJC 5HVGB 1DR9A 2EH7H 4KKCD 1Q8MA 1HKLH 4JY5H 4QLWA 1MLCA 1ZDQA 3FB7B 2D9QB 5CU9A 4JZJC 1J9RA 4X2UA 1FE8H 2A83B 3DNKA 3F3HA 3BZEA 7PAZA 1XBRA 3T3PB 2Q2EB 2WBWB 3IKCA 4MMXA 4F57L 4PREA 5EWIL 4JN1L 2R2HA 1AGDA 2ZPKL 2YKKA 1V7NH 3HG0A 3V7AE 1JN6B 1PZSA 5EZOH 3VSVA 3HZYB 1F4HA 1CURA 4JKPL 4JFDB 5DZJA 2WCSA 1AFVH 3UJIH 1DDHA 4HT1L 4Y89A 1P7KB 1QG3A 4HXBH 2GBVA 3CLEH 4P46C 1ROWA 4GAFB 2CO6A 5C0GA 3AZUA 2LGNA 3N04A 3SDAC 4APXA 4N9GA 3HBPA 3T6QC 4PI2A 1OCZB 3CAFA 3CCHA 3ECBB 3CSYA 3VU1A 2X09A 4A2DA 4NRYB 1DLHA 2J6EA 3VGHA 1KPVB 2ARWA 3K2UL 2QR0A 2NY3D 4J3OH 1A6AA 3X1NA 4JCMA 1CQKA 2X2JA 4IGBB 5EDXA 2GJ6A 3H9HB 2JSFA 4R96B 4I9WD 5HTSA 1MFDH 3M86A 2CBPA 1OCRB 2IFFH 4U1SB 3L4VA 1ZE3C 2A99A 1KIRB 2OULB 4KFZC 2UWEE 4FFVC 4XNQB 4KK6C 2F08A 1F56A 5IR1B 1IE4A 4ADIA 4ZMNA 2GTWA 2FYVA 3AQXA 5EBMA 2ZG1A 3QUXC 4OZIE 3VRIB 3WEXB 2YHGA 2VLRA 4TVPH 5C0BA 5DJ8A 4I3SH 3E2HC 2H5UA 4F20A 2F6AA 1ZHBA 5JA9A 3CFTA 4KTGA 2EZ0D 4HS3A 1SY6H 3HG1A 4PVBA 1IILE 5EBWA 5D5MA 2YA0A 3DVGB 4F37F 2P8LA 1A2YB 4GO6B 3NMEA 3RNKA 2BVUA 5FFGA 3VI3F 4HJ0D 2C3VA 3VTTA 4EVNB 3IFOB 3PL6A 5B8CA 4DAGL 3CH1A 3GKWH 4FNQA 4PG2C 5CSZB 4OGZA 5GHWL 1XEDA 1PGRB 2R2BA 2DMCA 1YEFH 4JRYD 4HMDA 3ERXA 2YAEA 1TPXB 3ZQ9A 1A8JH 1GPOH 1B2WL 4CSZA 2MFNA 1I8UA 3LRLA 2VUKA 3GSQA 4WUKH 5AW7B 1JERA 4LSRL 5FO7B 5D1QB 3LKPA 3RDTB 2XWTB 5EBLB 1RUQH 1JYXA 2DZEA 5DRWB 2XI9A 4MXWH 1FZOB 1LO0L 4NZUL 4G9DA 3EF7A 2DI7A 3A6BL 1MWAH 1XR9B 1PZ2A 3MSPA 1XGTB 2E7MA 2QVIA 3S9DB 1ORQB 3BAEL 2P48B 4K8RD 1SXAA 3KPMA 4KMQA 3ZLQC 5IFJA 1Y6KR 2PXYC 2XWZA 1QSFE 4XC3L 1WBYB 5EUOF 3FB5B 4HH9A 2ZNXA 4JM2A 5LQBL 4N1HB 2YEZA 2VLLB 2B1HL 4FMFA 3UOAB 4G6ML 1GYUA 1W80A 1NIDA 2Y25A 1U3NA 3F7VB 3Q1EA 3QIUC 4GRLC 4LQFH 5I1HH 1KYOJ 2PCYA 4P0DA 4M93C 2GKIA 4P23A 3VFTB 3ILQC 1CWVA 2XWCA 4Y4KD 4O02H 5E6IA 2ZOLA 2D73A 3GS4A 3B2UD 4K7FB 2R23B 3K3QA 4FQ1H 2JJVA 4NKDA 1S7VA 5TDOA 4JN2A 4MQ7A 4K5OA 3SIKA 3HB3C 3NSJA 4ZAKC 5C07E 5G5DA 4QYOA 4HV8A 5AD0B 1JPSH 3WTXA 1VZIA 3GSVB 1HHHA 3T08A 1CR9L 3CZEA 3BAYA 3WXVH 4QRPD 2KLTA 1OE3A 2CO7B 1DE4A 4RGOH 1E9OB 3F7KA 1AJ7L 3NJXA 3DVNB 2IQAA 2ED7A 2LT9A 5IJVA 2K9FB 4PJEB 3H8NA 2ZXBA 4DKFH 1NCOA 5I71B 3EOAB 5E99L 3FNKA 4NBYB 3HC0A 4P04A 5T3ZL 3S97C 3LZOA 2FDBP 4M43H 4YFDB 2RGSA 3SDDA 2C9UA 4FXKB 1QSEB 4FA6A 4MRBA 3KPNB 3QI9C 2ORBL 4HG4J 1M53A 4Z3GA 2IDQA 1ZA3A 4G5ZL 5ITFB 3S3DB 3IRZA 1CXIA 5D1ZD 4UTAL 3P0VH 4LO9A 4DJMA 4TUKH 5KEZA 3KH4A 3MBEA 3H0TB 5DFAA 3ELQA 1N8ZA 4JHAL 1J88A 4YDJB 4PJHE 3VFUA 2OSLA 3N0AA 4RNRB 3KYMA 4FNPA 1FZJB 2JCWA 3NP3A 5GGQL 3V0VB 2Z34A 4YHNB 3CBRA 5EIIA 2MNWA 5HDOA 4JPVL 4WFHD 4X4MA 4FTVD 2NW3A 2VIRB 3S36L 1OAZL 2GABA 1CI3M 1Q9WB 3WFCH 4F9PC 5LWYL 3BQUB 1BZDA 3FQNB 1U95B 5FUZH 5C0NC 3QUYC 5C6TH 1U8CB 3MRGB 2HKHL 2VR5A 3GIZH 1IC0A 1JF6A 1WUNT 3U9UB 1YCSA 4JZJB 2VXTL 1GJIA 4F7KA 5EORL 2EDNA 1BD2B 1E28A 2IVFC 1HNFA 1FWXA 4M1GH 1TZGH 3ZL2A 4CVZB 4LSPL 4NXSA 3K1KC 3US9A 4LEOB 3FRUA 4QHLB 4ES9A 1DJIA 1KXVA 1OLLA 3LNHA 3C75A 2KH2B 5BS0B 4M7LL 2WLJA 3K46A 3PIQA 4K3DH 1ZWIB 1JHTA 3W1ZA 4L3ED 3P0YH 3L9YA 2E6QA 4BDVB 4X5WA 5I6NA 5I30L 2CA3A 4TQPA 2R4RH 4P46B 4CMMA 5JPNA 1U8IB 3ZU8A 5GJTL 3SZ6A 3SDAB 3W9EA 1EHNA 5C0BD 1MI5A 5KYXB 1UKSA 5I1DB 1NFIA 3A0OA 4H7VA 5SX4H 4Z7IA 4CVUA 3HG1D 5SX5K 5GS2H 4AQEA 2A9DA 4L3AA 4DVRH 2AXGA 2Y6TE 1NGZB 3QXDB 3MCYA 5JW5B 4P2RE 3MR9B 3VVVA 2P49B 4PLKD 5FKPB 1JCVA 5AW2B 3PL6D 3T2NL 4CU7A 1KWGA 3PABB 4OVVA 5I76A 1SVZA 4G6KL 3ULUH 4KHTH 5HYJE 4E9LA 4LNVA 2PWHA 4XP9H 1IAKA 4JAMA 4Y4HA 4ZFZB 2X7LA 3OWRA 2J5WA 4JQVA 3H7BA 3JWOL 2E4FA 5A7EA 3V5HA 3T2LA 3E2HB 5L4IA 2FBJL 1PMYA 1JF5A 2GT9B 5HDBB 2AK4B 3UBXB 1MZYA 1ACYL 4M00A 1XB6A 1NEZG 5HGHB 1FBIH 2F1EA 2VSDA 4OCNC 1T20A 4RAUA 4NC2B 5IESL 4K3JH 3UAFA 4ZMPA 3I50L 1IQWH 1H15B 4KKLD 2I7SA 4QTFA 1VEPA 2K4AA 2YD9A 3T5WA 3ME0B 5SX4I 3QHTC 1D5MA 4L1LA 1F4YH 2NX5E 3PWJA 2BY3A 3MA7A 3O2WH 3LS5H 2X28A 4TQEL 4XO9A 1KTBA 3FT1A 3PCYA 4HKBA 4XMWA 5JHMA 4QXTB 3RNQB 3WGVB 1EAJA 5EU4B 2NUPB 2WNWA 1OSPH 5F7NC 2O26U 1RK1A 3RY4A 3FU9A 4PH8A 1F58L 4TUJA 1UG9A 4FJZA 5IGXH 5LCVL 2IC2A 1FP5A 3QRBA 5DHEA 4JANB 1IGIH 2OZ4H 4OZFG 4FABL 1MQKL 3K8LA 1FH5H 2FH8A 2Y3AA 4N2IA 1G9NC 1NGWA 3O0RL 3EYUL 5IB5B 2Y23A 2P5EE 2WXOA 3MNWA 4GUPA 2OL3L 3RWCA 1GSMA 4ZBJA 2MJWA 3ZDZE 5EO9A 4BK8A 2Q6WA 4YXHH 3RIKA 4HKJB 1NIFA 2CUIA 2HJKA 3QJXA 4GG6B 3D8MA 2PXYB 1I9IL 4R90H 1I9RH 2H26A 1L3WA 2DYPA 2WO2B 2IWGA 1ZLWK 4ZFQA 5LAXB 1FO0B 5LGHL 3QIUB 5EN3A 4GRLB 3C8HA 5BV7C 4M93B 1QTYT 4LSSL 2Q20A 4PJ8D 2C9AA 2X2YA 5ESQB 5KBDA 1ID5I 1CXEA 1C7TA 4IMLA 3GMLB 3HB3B 2ZKHH 5KVDL 3SDDD 1VFOA 4NUGL 1XR8B 4HGWA 3V5DA 1MRCL 5IUCA 4UYPA 3QCVH 1JGUH 1GHFL 4JGUA 4XB3A 5HJGA 1QRNB 1UB5B 3PHOB 1RZIB 3PYCA 4IK6A 4N0YL 3QG7L 3CXDH 3MJ7A 3ZYIA 4BHUI 5HGDB 3I9GL 3OAUH 1VEMA 1MG2C 1B2YA 1SDYA 3WY2A 3X3FL 3AAZB 3OQRA 2EVJA 1AO7B 4I48A 1ZLSL 4P5MB 4L8SA 4FX5A 4X7TA 3FCUB 3VUAA 5KW9H 2CRYA 3CFUA 4ZFFA 2LU3A 1JDAA 1YMHA 4XVTH 2C7UA 5CGTA 1BECA 5EU6E 4NQCE 2WVVA 2P5WA 3PHAA 5D7EA 5FGBA 5I1JL 4WUUA 3MGTA 2BSBA 3TIDA 1XQ4A 2YLHA 3VXPA 1HIMH 2FLMA 2HH0H 4L48A 3LRHA 3AT8A 5FCUH 3QI9B 3QQDA 3MOBH 5J1AA 3BP4B 5EOCL 1GGCH 2R56L 4WEMB 4XGZB 3WEMA 2YMXL 1H0DB 3TASA 3UZEA 3MBXH 2X5PA 2EKSB 2WJ7A 3WKML 1UCBH 1R47A 3B7TA 5JXAH 2ZP8A 4GQRA 5CEZH 3KDPB 3QFJE 2GY7B 4N0UA 5AVRB 5IW6A 4Q2ZA 3HC3H 1HXYA 1AQDB 5EPMA 2CRIA 4TUOB 2O5YH 3VD5A 4P5KB 1IAIM 2FHFA 4C55A 4AC2A 3D69A 1FG2B 3WFEH 4PJIE 1ZTXE 2B1OA 5JXEA 2K78A 5GGSA 1RK7A 4ELMF 1RUML 4W4OA 4C4KO 1A7NH 1YNTB 1QLFA 4WO4A 1DBMH 3V0WL 1G5GA 4F7EB 3QUYB 1SEQL 3SKJH 2CO1A 2GSGA 3SZKC 4XP5H 1G1OA 1ET7A 1NOAA 4U4IA 1YEEL 3WTSA 1RZ8A 2G2RB 5ENWB 3EDKA 3P3TA 2IOIA 3NACH 4OI8A 3QDJA 3BESR 3EJQA 3D25A 4XNMA 5I6XB 2X4RA 4F57H 5E5MB 3GS0A 3UC2A 4MCZB 4I4WA 1U42A 2ZPKH 1QSVA 1MCQA 4QRRD 2DQEH 3IJHB 2CR3A 4JFEA 2FJHB 2JJUA 5TQ0L 2AV7B 5HVFB 2VDKL 3FB8B 4CVXA 4HT1H 3T6XA 2ZTBA 4M56A 2N3JA 3RWJA 3REVA 1DL7L 1P4IH 3DX6A 3BKMH 2YQGA 4P2OA 2VC2B 3WJLC 4HULB 4JRXA 3RB5A 5CJOL 3SJVA 1ET5A 2BP5M 4NQEA 1KTRL 1CD0A 3IF1A 3O3EB 4I0PA 4L9LC 4HOMA 4L37A 2AVFA 3CMOL 1WIUA 1E2VA 2BZDA 1KIQB 3D87B 1O7VA 1Q9LB 4Q52A 5ID1B 5CEYA 1OF0A 4NZ8A 3WMPA 2WWOA 4ALAH 2CCLA 2GSIB 3O9WD 4F92B 3RB7A 5I8CA 3RX9A 3FTVA 5C09B 4NWTL 1YEGH 4OM0H 1S5HB 2B59B 4GKZA 4GJTB 2HRGA 1XWVA 4UOJA 3EF4A 3H2WA 1E9QB 4ZTPH 2Q3ZA 3RTQC 1NZRA 2NY7L 5C0JA 1DVFC 1OP3H 5KSBE 5F1KC 2YZ1A 3OHXA 2EXYC 4OD3L 4HDIB 4R26L 2IMMA 4E0RB 1EZLA 4XMLL 4RSVA 4BZ1A 3KPRA 3QG6A 5JOFB 3BP5A 5L6YL 1FYHB 2VDRL 3ULVC 1TJHL 5TPWL 3GMRA 3RWGB 2H4EA 3NT0A 4AYFB 4DAGH 2DH2A 2HRHA 2JKSA 5DRNA 3VDCA