1L9SA

Crystal structure of the i257t variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLTGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA02
1BXAA 2DYRB 1AAJA 1V55B 2B3IA 2EILB 4KO5A 5I28A 5AZUA 3NJMA 1IC0A 5TK4A 1ET7A 4YSCA 3NSFA 3X1GA 2BW4A 3N2JA 2AFNA 2XV0A 1E30A 2WSDA 4E9WA 1XB3A 1XB8A 1GYCA 2VSMB 2VW6A 3X1FA 3PAVA 3BQVA 3HB3B 2R7EA 1TEFA 3S8GB 1CC3A 4F2FA 2IDSA 1JZGA 4WKXA 2OJ1A 3DIVA 4N8UA 3ZX1A 5LDUA 3WNJA 1NIEA 2RACA 1RKRA 4A66A 3IN0A 4YSDA 3WIAA 1JXDA 1CYWA 2YQBA 2TSAA 3EHBB 4E9QA 1GSKA 1AIZA 1GS6X 1YLBB 1NIBA 3IBOA 4DP0X 1OCRB 2GIMA 1W8EA 1MG2C 3T6VA 1IUZA 3CZUB 3UADA 1URIA 3EH5B 4DPCX 1J9SA 5I5JA 1SF3A 1BQ5A 4A2FA 4CSPA 3EH3B 2FQGA 3DKHA 2VW4A 3FQ2A 2HX7A 2I7SA 2Q5BA 2J56A 3FPXA 3PPSA 3QPKA 4ZK8A 1E5YA 4KO9A 2IH8A 3T9WA 4YSQA 3S8FB 2UX7A 4HZ1A 1M56B 3X1BA 7PAZA 5FC9A 1CUOA 4E9XA 4E9SA 4F2EA 3FU8A 4E9VA 3QJTB 1AZNA 1MDAA 2X87A 3RYMA 2HXAA 4Q8BA 1BQKA 1QNIA 1QHQA 4YSPA 3T6WA 1NZRA 1JOIA 1PZAA 4MFHA 2BW5A 3ZDWA 2BP8A 3NSCA 1A8ZA 3NP4A 3PAUA 2OCCB 1TKWA 2I85A 4QKTA 1BAWA 3DTUB 4RH4A 4YVNA 4G7SB 3GYRA 2XXGA 3TASA 1A3ZA 3SQRA 3NJHA 1SDDB 4YSOA 2UXGA 1BXVA 1E67A 1ET8A 2GSMB 1OV8A 2ZOOA 1NPNA 3TBBA 4E9TA 5B1KA 2W8CA 1UATA 1IBYA 2EIJB 1OE3A 6PAZA 2FNWA 2FT7A 1PAZA 1OOWA 3UABA 3H4FA 1WA0X 4UAHA 5AKRA 1KCWA 2QDVA 4GYBA 3ZIYA 3ABKB 2B08A 3UGEA 1PY0A 4KOBA 1OCZB 4AKPA 4BXVA 2YAMA 1MZZA 1ZIAA 1WA1X 2VM4A 3QJSB 2MRYA 1JZHA 4BXSV 4L0PB 2ZXWB 2PPFA 4YSSA 5I6KA 1KV7A 3D12B 1J9RA 2FQFA 4KNSA 1ASOA 1QLEB 5B1JC 2XV3A 1ASPA 2H5UA 2XVBA 3T6ZA 1L9SA 4UANA 4DP2X 1TU2A 1L9OA 4KO7A 3WG7B 1NTDA 2YAQA 2P80D 3CVBA 2HRGA 1SJMA 1XB6A 2PPDA 5ANHA 3AZUA 3FSZA 5A7EA 4X4KA 3FQYA 3FU7B 1MG3C 1SDDA 1SHXA 4AI7A 4YSUA 3JT2A 3PCYA 4P5SA 5D4HA 1L9RA 2P80A 3TBCA 2XU9A 1GR7A 1JXFA 5I6LA 1GS8A 2FWLB 3ASOB 4BDVA 1GY2A 2YAEA 5I6OA 4QLWA 3QJQB 4HCFA 3FU9A 2IDTA 1KYAA 5PCYA 2IWFA 2XYBA 1CURA 1NIAA 2XXFA 3NJIA 3JTBA 4AZUA 3WNIA 1KDIA 1ET5A 3FT0A 2XX1A 2J55A 1HAWA 2EIKB 3CVDA 2J57A 3KW7A 4GP5B 4KNUA 5I6MA 1FA4A 2PP9A 5I5MA 4HCIA 1W6WA 2BWIA 3U25A 4YSAA 2N0MA 4DP4X 4E9RA 1AOZA 1SF5A 4KO6A 4G7RB 2QPDB 1W6LA 3FSAA 1KGYE 4W9ZA 2PPEA 2HX9A 4G72B 1WAEA 1PLBA 2AZUA 2E86A 1L9PA 1TEGA 4HHGA 1SFDA 5B3SB 2VSKB 3AG4B 3S3BB 2YXVA 1NINA 1FFTB 3IE9A 3N55A 4GXFA 3S3DB 2XX0A 4YVUA 1KCBA 1OCCB 3NJJA 1OE1A 1J5DA 3AG1B 4BWWA 1PLCA 1EZLA 3EH4B 1DYZA 5B1BB 1CYXA 1JXGA 3UAAA 2VMJA 1JZFA 1IKOP 3PXLA 3FS9A 3V9EA 3TU6A 4WTQA 1HAUA 1SHWA 4K9JA 2VM3A 4G70B 4YSTA 4GP8B 1E5ZA 3NT0A 4A67A 5TK2A 4AX3A 1SNRA 1AG6A 2IWEA 3FU7A 1ASQA 5I5IA 4JHUA 5I6PA 1V10A 2DWTA 4NB7A 2BO0A 2VW7A 2DY2A 3KW8A 1AZCA 3X1NA 5PAZA 1BYPA 1WS7A 1N70A 3UAEA 4A68A 3ABLB 7PCYA 3SBQA 1ILSA 1JZJA 2CAKA 1OCOB 5B7MA 4G71B 1T5KA 4DP1X 1NWOA 4M4RB 4JKNA 2IDFA 5AFAA 3CDZA 4N4YB 3PAZA 4UF7C 5D4IA 2CCWA 1AZRA 4EF3A 2TSBA 4E9YA 3H56A 1B3IA 2JFCA 3OQRA 2DYSB 3FSVA 4NAJA 3CG8A 4DPBX 4GP4B 3AG2B 3C75A 2YAOA 2GC4C 2PCFA 2PLTA 1AS7A 3V9CA 4BDVB 4DP8X 2QDWA 1RZQA 1ADWA 2IDQA 3GDCA 3IN2A 4YSRA 4BWUA 1AANA 3UACA 2IDUA 1J9QA 2AVFA 2BP0A 1EHKB 1M57B 4FAAB 2YAHA 2A3TA 2FTAA 2ZWNA 3WKQA 2MTAA 3MBWB 2BP0B 2FQEA 1ID2A 3BVDB 1E65A 1AZUA 3SBPA 4FA7B 1JZEA 2GBAA 1RZPA 2CBPA 4YL4A 4A2GA 1NICA 1PNDA 1ETJA 2FQDA 2Q9OA 5B1AB 3X2QB 2GC7C 2X88A 4P5RA 4PAZA 5F7BA 1JZIA 1ZDQA 3QJVB 3HEIB 1GW0A 2YAPA 4JHVA 2BZCA 3G5WA 1AS8A 1A65A 2UXTA 3NJNA 1NIFA 2PP7A 4PCYA 1X9UA 2H3XC 1NIDA 2CALA 1OE2A 3SBRA 2NRDA 3QJUB 4ENZA 3FQ1A 5B7FA 2PPCA 4F7KA 3WI9A 2LLNA 3FPYA 3FYIB 4G7QB 3T6XA 3MX0B 4AKOA 2WO3B 1WA2X 4KOCA 5B1JA 1A4CA 1VLXA 5EHFA 1AR1B 1JERA 1JVLA 3FYEB 1HFUA 5IY5B 1ZIBA 5F7AA 3NJLA 2PPAA 3AW5A 2UXVA 1J9TA 3CDZB 1ZDSA 2QPEB 1NPJA 4M3HA 1I53A 1PZBA 2ZONA 1MZYA 4YSEA 2UX6A 2JKWA 1KBWA 5B7EA 2VN3A 1R1CA 1XMEB 4DP9X 2BHFA 3OMAB 4GY4A 2I7OA 2J5WA 2YXWA 2JXMA 3T71A 1AQ8A 2FJSA 3OM3B 4DP5X 1L9QA 3NP3A 1L9TA 3QJRB 4CSZA 3TA4D 1ILUA 2W88A 4BWTA 2GI0A 1V54B 2PCYA 3L45A 2HRHA 2XUWA 2OV0A 1OF0A 2PP8A 3ASNB 1M9WA 3WKPA 2BWDA 3ABGA 3NJKA 1DZ0A 3ABMB 2DWSA 2CUAA 2HX8A 2XLLA 2R7EB 3QQXA 9PCYA 2DV6A 1AG0A 1BQRA 6PCYA 2UXFA 4A2DA 2YARA 3NSYA 1N68A 2H47C 1KBVA 4HAKA 1AZBA 5E9NA 2HZHA 1IBZA 1KDJA 3GXUB 5D4JA 2BP8B 1PNCA 3NJGA 2FT6A 1RCYA 4A2EA 3OMIB 1PCSA 4KNTA 3NYKA 3PLYA 4HCGA 1PF3A 2Y1AA 3H4HA 1GS7A 1AACA 2IWKA 2CJ3A 2WO2B 1X9RA 4HIPA 5I6NA 5I26A 1ZV2A 4DP7X 4DP6X 2EIMB 2YAFA 2FT8A 4A2HA 3IEAA 4HHWA 2XWZA 2XV2A 1PMYA 1SFHA 1A4AA 1A4BA 4BK5C 3ERXA 2EINB 1F56A 3NJFA 3EF4A 3OD3A 8PAZA 2IH9A 3AG3B 2HLEB 2QT6A 2GB2A 1ZPUA 2AZAA 4HALA 2IAAC 3OMNB 1BEXA 3X1EA 4DPAX 2Y69B 1NDTA 3ZBMA 1AS6A 3FSWA 3NSDA 1PLAA 4AKQA 2GHZA 4NERA 4TXVB 1BXUA 3CVCA 2AANA 1NWPA 1WS8A 3AY2A 4Q89A 3S3CB 2BZ7A 1PZCA 4W1TA 1J5CA 1BYOA 1FWXA 1GY1A 1JVOA
chains in the Genus database with same CATH superfamily
3UBGA 5J4MA 2IV9A 2E74C 2TRHA 3BFOA 1EAJA 3DURA 1CVRA 4DFIA 3D30A 3RVUD 3GRWH 4N2CA 4O02B 43CAA 2QQQA 4KXBA 4P23A 2R59A 3C2AH 1CL7H 2NTFB 1CLVA 2PYEB 4Z7UB 1B0GB 1E27A 2LABA 3N2JA 5ETUA 3VRJB 3X14A 4CA4A 4KY1L 1T7WA 3DROB 3IMTA 2BNQA 3FZUC 4GBXD 1XGRB 5K9JL 3SDXF 4ANWA 1PGRB 2GFBB 4MQ7B 4ZW3A 1NEUA 4AMXA 2CZNA 4N8UA 2XN9D 1DQKA 4KTEH 1ETB1 1KIQA 5E6UB 5C08A 4JVWA 3VXSE 1BAFH 5EZOL 4PGBB 3EHBB 3U7WL 4P2OB 1H5BA 3SE3C 4YJZL 1GS6X 1ZTXL 2AK4A 3V9FA 3IFOB 3GSRB 4U1NA 1IGJA 3LXUX 3D69B 2GIMA 1UXSB 4YZFF 5J57B 4NQSA 3F5WA 4QTIH 3H9SE 1CGUA 2ZQKA 1PPIA 4CSPA 2BHYA 2I7SA 5CHNB 3MODL 4W9IC 4QAWA 1AP2A 4IIQA 2EDNA 5ALBH 4ZK8A 3MLUL 1D5ZB 2E4TA 4N5ED 4YSQA 5IEKA 3SPVB 1PYWB 2X4QA 4HIIA 2ZOUA 4NQDE 3FU8A 4GBXA 1AZNA 4OFYA 3SDDD 1O7DC 2WBJD 3GTNA 4DKEH 5LG6A 1DN0A 2VR6A 2Y7MA 2EDDA 1TYRA 5CZVL 3E3QC 3S3JA 3O3EB 2EVIA 2FO8A 4JFPA 1BEYL 4FLQA 4NT6B 4X6CB 5I1CH 4FQIH 1JPSL 1EJ6A 1YZZA 2RFXB 5AAMA 1IQDA 2OCCB 5I76A 4MJID 5HDOA 2IOOA 1M6OA 4QKTA 5TQ0L 5C0JA 5K9JH 3DTUB 2IAMC 1KBGL 4AJYV 1L9MA 2DDQL 1NCWL 1JWUA 4JR9H 1WP6A 3SDCC 3MC0A 2Y1YA 3IFPA 4BZ1H 1A25A 2EADA 3L4VA 1Z1WA 4IOSD 1INDL 3O4OB 4OCXH 4XMUA 4JKKA 5FYJH 5KBKA 2VXUL 2XQBL 3ME0B 4Q52A 3KPSE 3V4PL 3WIFB 1D7CA 1DBAH 2APFA 2CKBA 2RBLA 3FONA 4JFZH 1AR2A 2DTSA 1PAZA 4W9DC 3ULVC 2ZF9A 3QEQE 3TTYA 3H4FA 5AKRA 3RB7A 1X44A 2AK4D 3LEVL 3P9WB 5J89A 2LR4A 1QFWM 4G9FD 2BSBA 1I9RH 4TRPL 4LESA 3DPBA 3EFDL 4RISH 4YWGH 4TVPL 3EJRA 5AVTB 2XCMC 1KV7A 2CHZA 5DVNA 5E1HB 3RA7H 3U6XA 2JK5B 2CGZA 3GIZL 2H2PD 1QYGH 2XIIA 1NMAH 3FN0H 1AQMA 1PKQB 1B4JH 3S5LG 1KZQA 4P5TA 3DIFB 1P7BA 3CC5A 2K6YA 5D7IF 4BINA 4W93A 1DQJA 4P2RA 3LXBA 5SWZB 4UTAA 3M1OA 2NY7H 1B4RA 3X13A 4BCZA 3OZLA 3CZFB 4X5RA 1NTDA 4CILA 1ULVA 1IEBA 1EXUA 4I3RL 3BAIA 5A43C 5IW6B 3GK8L 5CU5A 3BPNB 5IW1B 3U30C 5BXFA 3FONB 5DI8B 3BWUF 3PCYA 4J3VA 2NNFA 3VAEA 1OGAB 3TBCA 4ABUA 4M00A 4JFED 1KBGH 5C9JB 5KUKA 1K8IA 4J39A 2MPVA 3ZQXA 1OAKL 2YIHA 4JFOB 4JG0H 1P4IH 2PWDA 1RSYA 2OTUA 4ALAC 4WEMB 1URZA 2VR9A 1NBVH 4HCFA 5KANI 3GBNH 5DEFA 1HIML 3T4AA 3TPKA 2A77H 3DX0A 5I19L 2BXYA 2WN2A 3G5VB 3MRJA 5GS2H 5C6PB 1XF2A 1GH7A 2BJMH 1XGQA 3FT0A 2X38A 2EIKB 1BG9A 2BS71 5I6MA 1NGPL 3MNWA 2J6WA 2BSTA 4HK0A 3SB3A 4BELD 1KB9K 3PWPA 5CP3A 1LO3L 2VDPB 5HI4D 2XWBB 4JRFA 2P1YA 1LK2B 5EUOB 4M62H 5D1XA 3UDWA 4H1LG 4MJJA 4DP4X 3WHE1 3IF1B 4G80A 4OSUH 5ICZB 3QNZB 4AQEB 4P2AA 5MI0B 4H8WC 4QOKA 4M9PA 4QJ5B 1SMOA 2WZPD 4W4OC 4PJ9A 4ATWA 2PN5A 2XWXA 4N8VA 2VR3A 2IPKA 3QXDB 1DVQA 1JTOA 4U1NB 1NL0L 2NY7L 3LKQA 1UENA 2DW5A 1KCBA 3DTXA 2WLIA 4BH7B 3AXIA 4MJ6B 5I74B 1FZOB 3EOTL 1FV1B 4F27A 1QPKA 2PWHA 2WD0A 4YXHH 1EZLA 3JWNH 1CZ8H 1F4YH 4XPAL 4GRMB 5KVDE 1KV3A 2D2CC 1JXGA 3QC6X 4RDQF 2LFGA 3M1BA 6CGTA 3VFOB 4F58H 3TA3C 1I8MB 4M48H 3TU6A 4XN4A 5EEWA 5ENWB 5DJYB 4I13B 5EN2A 4JFFD 1YECH 2ZSVA 4XTRC 4A6YH 2P8MA 3C8KA 4DKFL 3BGFB 2VM3A 4G70B 4MRCA 3TBYA 4IRZL 1CGTA 4LCVA 2O72A 5C71A 3HLAB 2P5EA 2BVTA 1J8SA 1N59A 3BUQA 3C5SA 3B7RL 4JHAH 3UGXA 2VSDA 3LPGA 4RQQB 3ZUNC 4G6AC 4MLIA 5A2AA 5KANG 3K1KC 4A55A 1AZCA 1VF5C 1KCKA 3X1NA 5H35A 4EDXA 1WS7A 2HUEA 1U93A 2ZSWB 1GGIL 3IGAB 4EKXA 5BUGA 3ARDA 1EXHA 2ZUYA 3IMRA 2VLRE 2NNRA 5EORL 4X50A 4JM2C 4MA8L 2D7PA 2VDNL 2R2EB 4IRZH 1Z2KA 2K9UA 3PAZA 2BVYA 4K15A 4HSCX 1HYRC 3I6KB 3WGVB 2PWEA 3TPUA 1BQHB 5K93A 4YPJA 2B3RA 3BSZA 1HQ4A 4KROC 4BZ1L 1YA5A 2WLYA 1G7JB 3HIZA 3VD7A 1E2WA 2X42A 1HKFA 4LBEA 3CN2A 1ADWA 4NZRH 3AFLA 1VADB 1QOKA 1X4YA 3IN2A 3RDJA 3VFOA 4R3SA 2X70A 7FABL 2X3AA 1EHKB 1M57B 1XCQB 2BIMA 1PVHA 4CNIB 4N1EA 2V9UA 4OIIH 5T3ZH 2EJ1A 1NEZB 2VL5A 3WEAA 4I2XE 3SGDI 2WXQA 3IGFA 3PDGA 3TBSB 2OL3A 1V5JA 2PR4L 1VA9A 1FGNH 1ETJA 1MHHB 2NY5C 3IJEB 4HXAL 3Q0HA 4P5RA 4J1UA 2IPKB 4M7ZC 3HEIB 4EQ3A 3EOAA 4ONGH 3UERA 3QFJE 1CXLA 3C5ZA 3D3VE 2F8XC 1GPOH 3BLKA 3BX7C 1OE2A 3OKOA 3SBRA 4EE2A 2YEQA 2QQKH 1OK0A 3OKNA 3FQ1A 2O5YL 4QUOA 4Y16A 4PVBA 2XNAB 1RHHB 3STZB 4FG4A 1UOLA 5ECJE 5KUMA 2F7OA 5ITFA 1Y6MR 1JVLA 3GB7A 4IOFC 1E8XA 5HYIA 1GKOA 1RULH 3NBNA 1CT8B 3WV0A 4Y4HD 3O6LH 1F3DJ 1TQBB 1J18A 3QIWC 2WIMA 4NENB 4HX1B 3UTQA 2PCFB 4GRLD 4R5XA 3UC2A 1JK9B 1JVKA 2XN1A 3GI9L 5E2WL 3GT6A 2CKNA 5BV7L 2WIIA 4LCUB 1HSAB 3KYMA 5LGJB 4DP9X 5DJCB 4YC2B 1IM9D 2MKLC 5I1GH 4AMKH 4M4PA 4U3XA 3FCUB 3CMOH 4OLYL 2OSYA 1P4IL 4Q14A 3NCMA 4K3EH 5FWQA 4DP5X 1E9PA 4NM8H 2Q7YA 3TA4D 3QWRA 4O02L 4LCWE 2PCPA 2D7NA 3MRRB 4XT1C 1KGIA 2IAND 2EUZA 4CGUB 1XIWB 4NO0B 1U30A 1HKLL 1ZMYA 1HDMB 1SUJA 5EOTB 5KSAB 2J8OA 4UV4H 5I8KL 4AENA 3MLPA 1K6QH 1X3DA 3IU4H 2XTLA 5IG7B 2LFEA 1R6VA 2O6DA 2PABA 3K4DA 2GAZB 4P9HC 3VFMB 1AZBA 3H7LA 3SODB 4BFNA 1YEWA 2ID5A 2YUWA 4KKLC 1A6PA 3RX9A 3TL5A 1R4XA 5HHQB 3W5MA 4X83A 3S34H 3QFDA 3FFCE 5F70A 3EFDH 4YWGL 2V8LA 4LGRB 1OAYL 3FW6A 1HKLH 4I0PC 3RA7L 5AW4B 4U1GB 4M8QA 5HYQA 4PJCA 5FYLL 4WFHE 1E3XA 4HIPA 5I6NA 3US1A 1ZT4A 1CO1A 5FUCE 1BM7A 1HDMA 4XPHL 3NZSA 4HJGA 4N6RA 4IDJL 3RP1A 4QXTB 1LJMA 4YBHA 5D7LA 3E9TA 2JB6A 3F58H 3CMOL 4PJBF 5MP6L 4F7MB 1FO0B 1F90H 3F04A 2VZSA 5LXGL 2HT4D 3BWUC 4PS8A 4YOKA 3VI3F 2GUOB 3M6DA 1NKGA 1U0QA 5LG1A 3UTTA 4AM0Q 1I3VA 3FK3A 2DQFA 3SSGA 1A6AB 4W6XB 1RUAL 5ESVB 1OTSD 1CCZA 4PRPB 2KHAA 2NNAA 2AQRA 5DJCA 2DI9A 3VDCA 5KYNA 4WI0B 2UZIL 4PJFB 5AQ0A 3U0WH 1JZ2A 4PJCB 4JREC 2B1HL 4U0RC 4D8PB 4HUUB 5IROD 5E2TH 4ZMTA 1DJGA 2Y23A 3EO1B 1MJ8H 4NENA 5DUML 2ZXQA 4U1HA 4IMKC 4U6VL 3NSDA 4JO3H 1AMXA 4LVOB 3DX2A 4NKOA 5FECA 1AGDA 2V5TA 5J8OA 4FI8A 2DQCH 5ITFB 4AEIL 5AL0A 3CVCA 3GBNL 4YFLF 3W5NA 2Z8VC 2J25A 5DD6B 3QFJB 4Y4FD 2F5AH 2VISA 1PZCA 4BSVA 5DZJA 1ZA6A 1OAKH 2D7OA 4GXUM 2EC9U 3V4VA 2VO8A 3LZRA 3E6FA 5I8CA 1BMZA 5HP5A 2HVJB 1NC4B 1QSEE 4KK9D 3GIVA 2JXMB 4QRRE 5ACLA 4HBQA 1JYWA 1G0YR 3CV5A 4HW6A 3B9VA 1V3LA 4JO2H 3ZKND 3D2UB 2WWKT 3F6JA 2RD0A 5T1LA 4F7EA 3VACA 4ZXBB 1KSRA 3TBSA 3WU1A 1N6VA 4OLVL 5IBLC 1RP9A 4KBPA 2AV7B 1OHQA 5FYLH 3U0TB 5D2LF 2X4PB 4DO6A 5DA4A 1A3LH 1YEDB 3QORA 4WWKC 1NLBL 2BHUA 2G30A 4WIQA 3RVVC 5KVEH 2J1KA 3DGGB 4AGQA 4X4ME 3TN0A 5C08B 2DLFL 1J10A 1FVEB 3EIFA 3QZBA 3GNML 2VM9A 3ZMRA 4YNYB 1TVHB 1G7JA 1YLBB 4Q4EA 4X80L 3N0PB 1RU9H 4JLRB 3T0VA 1BQHG 1KULA 1G9NH 1T1ZB 2VOTA 3NGBB 1ZHNB 1TQSA 1GOFA 1IUZA 4N2AA 3L95A 3OKLA 5F3FA 5BRZE 1SOXA 1MRCL 5HHVH 1ACXA 4YDIL 3HPLB 4YHZH 1E5YA 3QXAB 5GQBA 3U1SH 3H3PL 3ZKQD 3I9IA 3X1BA 5EULV 4M93C 1LWJA 5JA9A 1AMYA 2BSED 3EOAB 3QYNA 2H32B 3CU1A 4PJXF 2ZOTA 5IEHA 5GS3A 3P4MB 5LWYH 3US9A 4TL4A 1RULL 4ZRGA 4NUJB 5F6IC 4GSQA 3BOVA 3ZDWA 2BP8A 2VMEA 1A8ZA 3GJFK 4A6YL 3RFZA 2PYFA 1IX2A 3VQ1C 1WBYB 4D0DA 1TKWA 3CLFL 3O3BB 4J7RA 4Z8FL 4QHLA 1BAWA 1J7VR 4Y2NA 3OKLB 3ULSA 3UO1L 3B7TA 4LVOC 3S2AA 5HHPA 1FLRL 4NNXB 3VH8G 4JHBA 1HILA 1MI5B 1F6LL 1ACCA 1MREL 1VENA 4P46A 3FT4B 3QUMA 5CSGA 5LN4A 2VDPL 4NQEB 5FHBL 1U8IB 2R23B 1BM3L 3MLTB 3PQYE 3B2VL 1RXLA 1ZT7A 1QQDB 2JCCA 2WMPA 3FCTB 4PP2A 4M5ZL 3S3SA 4WGKA 4FG6C 4F3FB 5B1KA 1QI4A 4X6DB 5KYUB 1XD1A 4PP1D 4OD1L 1SLXA 1I8LC 1QEWA 2R15A 3JWOC 4G8IB 4XO8A 2I9TB 4V1DD 2FEDD 3DX6A 5JOFA 3L5XL 4O2FB 2AW2A 4QKXB 4GYBA 1B6UA 3GJFH 1FNAA 2F2HA 4WEUD 5HHOD 5BO0D 4B9CA 3U4EB 2CO6B 1LQBC 3RVXC 5EOCJ 1TTAA 3C5JB 3F6LA 5CM1A 4PVLA 3N04A 3LVEA 4AXWB 1JZHA 4L0PB 2ZXWB 4UWQB 2XWTA 2XN9B 5FO9A 4WFGD 5GSRB 5ERWB 3VMNA 2WXPA 2VH5H 4A39A 4LCCC 4CADB 4OD3L 2ZG1A 3B2MA 4IRSB 3K80A 3LIZA 1ASOA 4OJDH 1KT2A 4PB9L 4R83A 5D72H 5CWSB 3K1DA 1ZOXA 3SE9L 1UZ6E 4XMPH 3RI5K 5EB9A 2R69H 2L4OA 3BWAA 2Q2EB 4PRHE 2L8AA 3Q05A 4E5XB 1KN2L 2F7PA 1IAIH 1WFIA 1CLZH 3PWVA 3OZ9L 3N42B 3GUTA 5KVFE 1OM3H 3TFBA 4DOHB 4H20L 4QT5A 4KFMA 3ISYA 4YHYB 2AK1L 2OL3L 3D9AH 2KZ1B 4G5ZH 4PWFA 3INUL 1JGUH 2K78A 3EO1A 3X3GH 4AQ8A 1TVDA 3FQUB 4Z8FH 3BAEH 3DXAD 2XU9A 5JLZA 3U2JA 3GMMB 5HYSB 4BIKA 4MB3A 4OLEA 3UAFA 4MGXA 1G9HA 4NQCA 4OJFL 4XNXH 2A7BA 1HOCA 2X4OB 4HUVB 1SY6H 2C9AA 1VIWA 1CGSH 3UTTB 2K9FB 3ZYOA 2V4LA 2BOLA 5C0EB 3MLRL 2OL3H 2WAHA 1BF8A 1NFIB 1YEEL 2V9TA 4JDEA 4JY5H 4ELME 1E28B 2C3VA 4B9YA 3MCKB 1OPGH 3NIGB 2QQLL 5D1QE 3P4OA 4GP5B 4AQ1C 2ZF8A 1X6LA 1A6ZA 3QUML 4PJDA 2WAQA 5AW7B 4HK0B 1NFDB 5JW3L 2VLME 3QULB 3K4AA 1ZS2A 3QZOA 1JNHA 3EJQA 3CIQA 3BP7B 1K6QL 3F7YA 4KKLD 4DK6A 3I02B 4WKZB 2PPEA 5DFTA 5KSVA 4Q2ZB 1HZHH 2PR9A 2J88L 3TWCH 2AMUA 2BNQD 3MN8A 2AZUA 1YEEH 2JKLA 2P5PA 2Z31D 1EA9C 4MJIA 4Y2DB 1AZZC 5FUZL 3S5ZA 1PZSA 3GMQA 4GAGL 3GIZH 4L3EE 4DEWA 2ZOKA 1QSFB 4RRPG 5I66B 1I7UB 1IB5A 2JQMA 3GSXA 4QTHB 1WAAF 4I0PA 4X8CA 4U6TA 5CGYD 4C4UA 5JIQA 3MR9A 4OVUA 5DFWH 1ND0B 3ESNA 3O6ML 2OMNA 5HY9A 1IRAY 4Y16C 3EH4B 1IC7L 2AKRB 3SDXA 2ATKA 5AL8A 1J0YA 2A4ZA 2W94A 3LS4H 3KXFD 4E41E 2Q10A 2X1XR 4A7UA 1JZDC 2VUKA 3HS8A 3QEQD 1F3JA 3R06A 2E9WA 2ENJA 1P4LB 1A7NL 4XPBL 4GAFB 3WD5L 3ZT7A 1UZGA 5DGRA 3SD2A 3UTSE 4G9FA 1LP9F 3ZDYF 5SWZA 4FQHA 2ZX6A 1CTNA 1G7IA 3N85L 4DAGL 2EXWD 4WKZA 2B8OT 5KSVB 4IHBA 3LS5H 2AMGA 2E4FA 3B8SA 2ENSA 2DY2A 4OF6A 4WW2A 1YNLL 4L8DB 1T1WA 2VDLH 3EO9H 3UAEA 1DEEB 5T3ZE 1ILSA 3VW3H 2F8IA 4G71B 4LVHB 3MRFB 5FYKE 3DC0A 4U6VH 2HT3C 1MCWW 4UILH 3TWYA 4A38A 3QDAA 4QNPE 3WTXA 3F84A 5IEKB 2IDFA 2Q8BH 1AY1L 3PL6B 1RK1B 2D8KA 4BFJA 4EQ2A 3JV5A 3TNMA 4LNRB 3EG9B 5D4IA 4GAGH 3G5ZB 2B1HH 2J5LB 3E7JA 2KERA 4E9YA 4ZMXA 4HYTB 3C5ZB 4O51B 3CH1B 2VDQB 2ED9A 3I3BA 4PHXA 5J1SC 1I1FB 3FUMA 5ILTL 3VFWA 1XO8A 2EYTA 3EO9L 1LMIA 2X1WL 1YEJH 3AS1A 5KYXB 1LO0L 2Z35A 1UCTA 3P4NB 5IBLD 4NZTL 4U33A 3QHZH 4NQVA 4TTDD 3T0DA 2R1YB 1M2VB 4HEPG 4MS8C 2ZD0A 1A6TB 1FVDB 3DETD 3HRZA 2MIZA 2ZWNA 5AENA 3WTUA 2EEBA 2AS5M 1U8NB 1V8HA 4DK5A 1AOHA 5GRJH 1RZPA 1BDYA 2A5UA 2C4XA 4OCRH 1FZKA 4Z78B 2J1WA 8FABA 2Y2WA 5C07E 1I1AB 2QPSA 3NH7L 3QIBD 3BHBB 4YHKL 3GMPA 1SJEB 4LL4A 1S9WB 4FQ1H 4WW1A 5F7BA 1TJGH 1JZIA 1ZDQA 1CFNA 4LDOB 4NGHL 4OFIA 1T5WB 4HEME 1XXDC 3G5WA 1C12B 1GIGH 1WT5A 3NCCB 1A9BA 2DS4A 3ARUA 2LTQB 2WYHA 2NXYC 4L8CA 1FE8H 4ZYKB 4MASA 1HH6A 1T6BX 2EO9A 2XN9A 2Y7LA 4DKAA 4ODSH 3Q6FB 3WO4B 3WN5B 3ZUCA 1Q9LB 2VN6A 4J2XA 4NQSB 1IIIA 1TF4A 1A4CA 2FO4A 2XTJC 4LCWA 1WBXB 1P69B 1SLWA 1E4XL 3P1VA 4CVWA 3L6FB 1IL1B 3D39A 2IPTH 4NKMB 1U92A 3I85A 1GIGL 2DL9A 1RMFH 4XXWC 3HS0A 1KLUA 3FQWB 4HXBL 1AC0A 1H0DB 1GC1C 1RLWA 4NO3B 4YHZL 3NFPA 3PUCA 3DJTA 3OMAB 4GY4A 1G9MC 2AXHA 3GSWB 4OQTA 5D1XC 4JANB 1DBML 1FL5B 3MBXH 3ARSA 5FDWB 1X5ZA 1RP8A 2BSEA 4WO0A 1OT2A 4HJIA 4HGWB 3SPHA 1OGPA 4X5XB 3VRJA 3MLRH 5IGXL 3IDXH 2XUWA 4B9KC 3O81A 4P23B 3WKML 3BYYA 1BOGA 2DQHH 3BLPX 1DZ0A 4ZDHA 3OAZH 4M6AA 1IGFH 1CF8H 1MCKA 1P5UB 2X89A 5DHVB 3K6SB 1H8LA 4DCQA 1MLCA 3RILA 3INOA 4JKPL 4LPUA 4OD1H 1AG0A 3MV7D 1WWBX 4POZC 5KVGL 1GAFH 4NO0D 3K46A 5EFIA 3WS3B 3TH4T 1TU2B 3HG0A 2WKOF 5MEQB 1ZK9A 4N9OB 1BVLB 2CM6A 2J6EA 3WE6B 5JW4R 2HG5B 1AQDA 3DV4A 2YFNA 1JDAA 4WSKA 1B2WH 1LEGB 5CZKA 3TA3B 3WJJC 3VFTB 1L3WA 2IPTL 4QD2E 5TJWK 3K8LA 3SGJA 4FFVD 4JKLA 4WO4D 2IWKA 3IJHA 3RPIA 4M29A 4WU5B 3RKPA 4ES8A 4UTAH 3I02A 3STLA 4HS3A 2B15A 4JM0A 1U4EA 3L7EB 5DDHA 3WJLA 1KCRH 3BXNA 4KV5F 3MNMA 1RZJL 4MWFB 1SFHA 4NNYB 5DZOA 1A4BA 3T4AB 4KK8C 3Q1EA 2QV2A 2XWEA 5LAXA 3EF4A 3AUVA 2D7QA 3TIEB 4HUMB 4NSKB 5FGSA 3QIUC 1B2WL 1F2XK 4M61B 2HLEB 5KN5A 3KVQA 3BI9X 4PIRF 1OARH 5I18H 1HZKA 1KTLB 4HS6A 2EXWC 3L3JB 4KUCD 5BMFL 3GPSA 2RGSA 5MI0C 3MOBH 1IC4L 2WXHA 2JKNA 2G2NA 4J3OG 1FYHB 3GSNB 2APVA 3ARZA 1JZ4A 4YDJB 4LCIH 1R5VB 4X6FB 3FU0A 4JAMB 1FBIH 4KK6C 3VXME 4OJFH 3BDXA 4PVMA 3PIQA 1ROWA 4XNXL 2BCMA 1Q9KB 2B7DT 5F88A 3TJEH 4Z7WE 1OTUD 2XZCH 4PJ8D 3MGAA 4X42A 4NC0B 5BQ7A 4EDWH 5F3HB 1ZA3A 3AY2A 4FGMA 2A4CA 3L4WA 3X13B 4X2UA 4C58B 2AXGB 1G0DA 4NRZB 1FIGL 1FWXA 3O3AA 3VU1A 2EYRA 1PD1A 1EAOA 3TS8A 5D7JB 2BOBB 3MA9L 3Q13A 3Q3GA 2HVBA 3QQDB 4YSCA 5M94B 4NKQB 1KIUA 2YHGA 3JWDH 4LASL 4PN6A 3Q1SL 1E30A 3QEQB 4MMZA 4BUHA 2PUQT 4OGXH 2BIPA 2VW6A 3BDYH 1J0ZA 3MPCA 4RGNE 5E4IA 5DK3A 5AYUH 4BQ6A 2DYPB 2A73B 3KBPA 3O0RH 4Z7OB 1HNFA 4PWIA 5DTFA 3IVKB 4CVXB 1WQVT 1CWVA 1KFAH 1UM5H 4U1MA 3OG4B 4HGKC 3ZL4H 2VITA 3TO4C 3UYPB 4ODTL 1JXDA 3ME0A 3PWPD 4HWEL 4UQ9A 5IVXA 4WUUE 3UYRL 4O5LL 2X4SA 1JNNL 5J3HC 3RL1B 2UY6B 4HPOL 1DBKL 5HGHA 5C0ND 4TSAL 5SWZE 1ZT4B 2ATAA 4WFHD 2X05A 3M7FB 5EDSA 1RK7A 2NY0D 1D5XA 1MG2C 3KR3L 3T6VA 5JTWA 1OVZA 1WFUA 1QLRB 1SF3A 4H4NA 1D5RA 1OT1A 5A7BA 1DQLH 2J56A 1TFPA 1ZS8B 3N6YA 1HHHB 2R23A 4LHUB 3HE7B 4N2OA 4ZUTA 3BP5B 5HJBA 1IGIL 2YLKA 3NA4A 3AB0B 4ORGA 2LU4A 2V3FA 3QWRD 4KX8A 2BNRD 5F44A 2X87A 5I6XB 3O3EA 3KGSA 4G6MH 1MIEH 4UDUB 1NOAA 2Z9TA 4YPGA 3SY0A 3I9PA 5FO8A 1P4BL 1NZRA 4LSVH 3DPDA 3CXFA 4X0KB 2IFGA 1ZANH 2WQVA 4OF8A 2BW5A 3IWUA 3QZWA 3NSCA 3RFZB 3VWKB 1XD0A 4OGXL 1T3FB 1VGKB 2JNZA 2EQDA 2W92A 1TMCB 5FF6A 1NAML 5JO5B 3O0RL 4EIGB 2OMVB 1PLGL 2FL5A 1GZHC 4TQIA 1MSPA 4YDKL 1WITA 5BZDB 5C09E 4DN3L 5HDWA 2EDOA 3Q1SH 4P2RD 4PG2A 4MCZA 1PZDA 1FUNA 3BFWA 4Z95H 2A4EA 4FLSA 3GC3A 5DMGD 3RUGA 4Z18A 5EBGA 2VDQH 5FIEA 5AAMC 4Y9EA 5TQ2H 5DRNA 4BHUA 4PJGA 4A37A 2WLZA 2DQHL 2EKSB 5LBSL 4NO2A 4PJBB 5ICUA 4UAHA 1MCIA 3LB6D 3ABKB 1KB5B 2C9RA 2BY3A 2JLLA 2PO6D 3GBLA 3NEXA 4L23A 3EFOB 4NNPL 4XCYB 4UZSA 4OI8A 2XZAL 3OL2A 5C0RH 1X7TA 3QJSB 1NMBH 1XH2A 4L4TB 3QEUB 4U1LA 3SKNA 2I9LB 4S1QH 3ROLA 4D7PA 4F1SA 5IMMA 4MCYB 1DSFH 3GZQA 3X14B 3V0AC 5LAPA 3MFFA 4ANUA 3SCMC 3RUGB 1CJYA 4H0GA 3G6JB 4FJ6A 4AV4A 4MCZB 1J5OL 4QHMB 1XH0A 3SKJH 3LXCA 4XNYH 3CSYB 3LSOA 3FO0L 1OOAA 2BERA 4TVPE 3BKCL 4N90D 4KDTC 4BUGA 4RZKA 3DGCR 3BZEB 1T3FA 1VGKA 3OWRA 1GVIA 3H2WA 3K2IA 2BDNH 3MA7A 3W3BA 3CE1A 3COOA 2OMXA 1T03L 4JDTH 1KCRL 4PLJD 4NPKA 2CO7B 1RZJH 4P9HH 4FKHA 2G75A 4RWYH 3EOBB 5J6GB 4PRDB 4WY7L 5D4HA 3TTSA 1WWCA 4D2NA 3KBHE 1DQMH 2B1AL 4LCYA 1CICB 3IDNB 4GEIA 1HL8A 1MQKL 5D7EA 5DJ0B 1F86A 4M6MH 1PLGH 3TJPA 3ARFB 1BP3B 3KYKH 4OV5B 1XV8A 4UT9L 4E42A 5I1EL 1JDDA 2V5SA 1TTBA 4NYLA 5IHHA 1HXYA 1HYSD 3I9GH 4OFDA 1BX2B 2BOCA 4LARH 4P4KA 1Z32X 1AZVA 4K4KA 4ONOA 2VZ1A 4Z95L 2J72A 4MZIA 1DLFH 1TCRB 1T4KB 3K2MC 5ESAA 4DNLA 3BKML 1QHPA 1ECYA 2IWFA 1KTRL 2VDQL 1T6VN 2BSRB 3HI5L 1CTMA 1P84K 1A02N 3D18B 4PRPA 5F1NB 4OTXL 1BQSA 1TPXC 4NQDA 4X6DF 4NFCA 4YHNB 1T6WA 2FEDC 3FN9A 1NMCC 3L3IB 1KWKA 1KENH 5I1EH 3VSQA 3QI9B 3FHEA 3QDJD 2YSTA 4XE5B 4JY4A 4JHWL 1P7QA 2NY1C 4NX0A 3TH3T 5H37H 4HKJB 5I0ZA 4OBSA 5B4MC 1KLFA 2X09A 1IJNA 4DGIL 1FI8C 5SV4A 3V6FA 3QYMA 2IANE 4LSSH 3Q9PA 4MMZB 1OW0A 3DSNB 1G6VK 1LE5B 4BRVA 3CQFA 3EHBC 2OXGA 5EF0A 5KTEL 5LVEA 4YEEA 5ID0A 2Y3NA 3ILDA 4F7TB 1ETZB 3K6DA 3S3DB 5HGAB 3AITA 1OGTB 1OCCB 2BOBA 2CQVA 5DZAA 1ORQA 3VXPA 2V7HB 1EVUA 2WNXA 2DH3A 3MCLL 3ZE0F 1IKNC 1AIFA 4JB9H 4KRPD 3V5HA 4BWWA 2KYIA 3V4VL 1Z5LA 4GRLC 5E1GA 2EDQA 3CNKA 5E8DH 2NY0C 1OWWA 3UYRH 5KS9F 4LK4A 4KK8D 2A74B 4NN5C 1DDHA 4TPRH 4LSSL 2DQDL 2ATPB 5B8CA 3KGTA 4ZOEA 1A6WH 4G6FD 3UEQA 2GY7B 3GSVB 1IGMH 4YLCA 2CG9X 5C0CD 5DD0H 1TYEB 4MNQA 1IARB 1N8ZA 3MLWL 3MXVL 4AM0A 3WJMA 5C0FA 1YN7B 5FYKL 2HFGL 1WGOA 1XGTB 4KJPD 4N8CH 4M56A 4NB7A 4OKVB 2OQJA 2VW7A 3O41A 3T2PA 3AGVA 1ACYL 4FTVE 1XSKA 3MFGB 3BZEA 2G3XA 5D7HA 4KK5C 4CSTA 4HQQL 3VI4A 1FBIL 3HPJA 5BNXD 3LQZB 5CD5C 3AUWB 1TUPA 3BCDA 1INEH 4OM1H 3UTTD 4XPGL 3MNZB 1TIUA 4P4KD 3QB7C 4XP5L 4X7SL 3U79A 4N4YB 4XN2A 2G2RA 1K9TA 5D7LE 1QWUA 4P46D 5J6HB 3MJ7B 4UQIM 1FIGH 2D2OA 3GKWL 2OMUB 3CC1A 1EZVY 2GC4C 2PLTA 3V9CA 2VLKB 5JHBA 3DBSA 2WKGA 2XWCA 1BBDH 1NGXB 2VQ1B 5FB8B 4NHUA 4EKJA 3L17A 3MRCB 2UZYA 1CE6A 4TN9A 1JV5A 1LE9A 4LRNL 1J9QA 1UC6A 2DBJA 1P2CB 3FFOA 4KTEL 2YAHA 2C9QA 1QSVA 2YA2A 1I8AA 4KY2A 3FT3A 3KPTA 1JFHA 1MLCB 1BWWA 2SODB 3BAYA 3RZCA 4J23A 3IBEA 4DGUA 4FA7B 2XA8H 3FNKA 1E3ZA 2CBPA 3F62A 2XYCA 4WU7B 3RKDD 3BQUB 3BD4A 3SO3C 2BINA 4LLQA 2H0EA 5ITBH 2DM7A 1Y0LB 3P9MB 3E38A 1JNNH 3RWDA 4ANXA 1DBKH 1ZVNA 2UXTA 2Y24A 1CG9A 2PP7A 1YDPB 4QRRA 5GGRY 3ZL4L 2P46B 5F7NC 1A7NH 2YGNA 5H2BB 2PXYA 1KGWA 4Q6IA 3AQZA 2ZT9C 4AQOA 1RURL 5KSBA 4FQLL 1QLFB 2WO3B 1SRDA 2D7MA 1DCLA 3TN0D 4NJ9H 3WFBH 1JF6A 2ZX7A 4YHOL 3I6KA 3QISA 3EBGA 3KPQB 4LBAA 5DWPA 5E1QA 5LNGA 3F8UB 3UPCA 3LYRA 1CGYA 2IANB 3ZQ9A 2FZ3A 3BPOB 1HYSC 1QNZH 4R9HA 1TJIL 1CE1L 1U93B 4M6ML 4ONHB 3TVMB 1EHLH 2I7OA 2W60A 4QRTA 3QT2A 5E24E 4I2XA 5EZLB 5FA3B 3ATBA 4XTRD 2UWEF 2A6KA 4KC3B 3RL1A 1C12A 4WTWA 1I4FA 5AZ2H 4HPYL 2DIBA 4CSZA 2VR7A 4Q74A 4CMHC 1P4BH 4BWTA 5KVFL 2LLGA 2WWMD 1JFQL 3TBYB 4MMZC 4NCC1 1LEIA 3ASNB 2Z6FA 1M9WA 1JMXA 3GF8A 1TENA 2ICWI 4ODVH 1SVZA 5DCCA 2NY6B 4ZSOA 5H4YA 4JW3A 5AD0A 3GMNA 12E8H 1YY8B 4ABWA 5DRZB 4NQTA 5FYJL 1MCOL 5HHOA 2W95A 1N12A 2OI9B 1EMTH 1KIUB 3Q6GH 1NMCB 1OTTD 2X4QB 4L5FH 4MCMA 1FC2D 4N6QA 3ZDZF 1KDJA 5C0CE 5KVFH 3FTWA 3NJGA 2DTMH 5C0RL 5D7JA 1JRHH 3PXJA 4N0FA 4DQAA 1HN1A 4QDGA 1I1FA 5C6TH 5H37A 15C8L 1QFWH 1PF3A 5D5MA 4LLAA 3QIBB 2X5PA 4Q0XL 2F53B 2DIAA 1KFGA 3PGDB 5HHOE 4G83A 2AJUL 3EO0B 1NKRA 5IFHH 4YDLB 3FOLA 3KWWA 3B3BA 1KXVC 4CJ1A 1CDBA 2APSA 4WO4A 3DO7B 1GSMA 2NZ1A 1VFAA 3FJTA 1R5WA 1T5XB 3L3GA 2XQYK 4C56A 1H3WM 1JN6A 3QQ3B 4L8BB 3H9YA 4Z6AT 2R4SH 3VGAC 1UWGH 4G7VH 4L37B 4WCYL 1T89A 3O6FB 4KVCH 4PTTA 3OMNB 1ZY9A 4FXGC 4LVNB 3W39B 2ZKHH 2BHZA 2R56L 3V0FA 2K45A 4FNRA 3FO1B 1IGCH 1N10A 2NYZA 5HTSA 3T3MF 3LQAH 3UH8A 4B60A 4XC1H 2ZG3A 4IRZA 4N0FB 5CILH 4XN8A 3V52L 3VO0A 4HS8L 5HHMD 1FH5L 4G6JL 3M8OH 4L1LA 4L3EA 1JZ7A 5IOKA 2X89D 1MJ7L 5J9PA 5DWUH 4LCCB 4OVVA 2R0ZH 5G5DA 1BFTA 4FNSA 5JW4Q 4E9LA 4N2FA 4W1TA 5D1ZB 1C5BL 4HIEB 4X9GA 3CFKA 4NQEE 5GGVH 4AWJC 4ZSOB 4D0BA 2H6OA 1LO3H 5FK9B 2YSSB 4K5LA 1SZNA 1J9CT 4M62L 2ADYA 1RIUH 1U6AH 2Z92B 1ET7A 3UP6A 1IM3D 3NIDE 2K3TA 2W0LA 4RMWA 4MHHG 2X2HA 1SLUA 1ESOA 1S7XA 4UT6A 4ZOAA 1ZLWK 2ITCA 4IK6A 5AALA 4XXDA 3SYQA 4FYQA 4GB9A 3CHXA 3VXUA 1OSEA 4JO1H 4XMKH 1IAMA 2WVUA 1PKQA 3AROA 1JNHB 2V2WA 2DDQH 2OI9C 1H3XA 4PJIB 2R0WL 5EU7E 5LDUA 3ULVD 3OJDA 1E8YA 4XWOC 4WGWB 1CYWA 2QVIA 3NFSH 3CVHA 2OMWB 5FM5O 3U7YH 4DQOH 3SE4C 2TSAA 3BUYA 1T2QH 5EU5B 4D9LL 1YNKH 3MCKA 1G9EA 2FATL 4AYBA 4HMDA 1F1AA 3SO5A 4R2GB 1A7QH 2CWRA 3NTCL 1M1SA 1VERA 5F7MC 3UZVB 4FQXB 1CXIA 5AB0A 4HKBB 5BZWB 4JFQA 1H6EA 1A7PH 3EH3B 3MOAH 1TOXA 3APMA 4M6NL 1J1OL 4PYHA 5GISL 3QR0A 4XMWA 3CH8A 4JHAL 2FIRT 1MCWM 1RHFA 4Y19A 3S8FB 5DD0L 1YMHA 1E5UI 1J1PH 1HT6A 2F18A 1HQRA 1QG3A 3UIZA 3P9MA 1DTUA 1Z3GL 4XCFH 1IFHH 2MOVA 1HCVA 5F7LB 2CRYA 2B0SL 1F4WH 4W9CC 4F7CB 3TJHC 4A63A 1PZAA 3AREB 3RTQD 3CD4A 4L8CB 3MRPA 4APXA 2P24A 3VTMA 1M2OA 2E5EA 4PU2A 2YGQA 1JD7A 4K2UL 3EGDB 5C0GA 3WMSA 4RH4A 1SEQH 4YVNA 5I82A 1YYLH 3P02A 4WFFD 5IOPA 1KACB 4YXKL 4GKNA 3G3LA 4LL9A 1QR4A 3BWAB 2XY2A 1MJUL 3EH2A 6FABL 2ZYHA 4ZQKA 3SPVA 5D1QB 3LEYH 4TF4A 3K3QA 4QHNB 1OV8A 1PZ5B 3HS0C 3ARBB 2F58H 2YC1A 3VGHA 2NY2B 1DR9A 4LHQB 2EXYD 2KZKA 3BAKA 2W91A 2VGLM 1WG3A 4F33B 1BIHA 5ECGA 1BJ1J 5BUAA 3DARA 4HMEA 3CXDL 2A6KB 3LRSB 3AMLA 2D3NA 4CVZB 5EZLA 1H5BB 4YE4L 1ZLSH 3FB7A 3PWPE 4DZBA 3VRIB 4POYA 4L05A 4G1EA 1HL4A 3MTXA 5TPWL 3ECBB 1A2YA 4WW2C 4RNRB 1DUYA 3RGVA 3WS6A 3KNBA 4GIOA 1CQYA 2AEIT 1KIRB 4MVBD 4HPOH 1FH2A 1U8IA 4YX2H 4X7CC 4HFWA 3U1PA 3O8XB 3BLBA 5JORB 2XQYG 3FT4A 1MRDH 4UANA 4KJYA 2OMWA 5CEZE 3G9VA 4OIAA 3WLWD 5F21B 4N5EC 4WWPA 1S4IA 4J6RL 3VG0H 4L8DA 3O3BA 3QAZB 4HCRL 1G6RH 2EIDA 2VO5A 3RX5A 2DQEH 1DO5A 3RVVD 1MFBL 4ICXA 3TO2A 4AIZB 1SDDA 1ZWIB 4U6YB 1UASA 5AVZB 1NMAL 2EDRA 3U9PL 2WWOA 2CLVA 2XIDA 4TNVK 4X4YA 3DSFH 4ODHH 4PI0A 1NGYB 3SJVD 2XDHA 1KGCE 1R75A 3DWTA 2BIQA 5EBWB 4OLWL 3HPLA 3ECQA 4QNPF 4BM7A 3F7RA 3MNVB 4QLWA 4HIEA 3J27A 5D1ZA 3BH8A 4ZW8A 1D6EB 1UGNA 2QKSA 2WZ0A 4A7SA 5TPWH 2XYBA 2DICA 5T5NF 1CE6B 3V4PH 1SXZA 1L0PA 4JFZL 3K8MA 4WHYG 3VFSA 3MUGB 5C3LD 2A6DA 1QSFA 1W80A 2WZ6A 3VMOA 5I66A 2HKFH 4FULA 3BN9D 1LP9E 3CVDA 3QUYB 3RL2B 1F8TL 2MHAB 2OMUA 2NT0A 4FABL 2Y9RT 3SOTA 1THAA 2F5BL 3GD1C 3KLHD 5J56B 1I9RL 4G7YL 4JFFA 5C8JA 1HNYA 1YMMD 4GUPB 4E9RA 1WFTA 3ZQWA 4M3JA 1SGKA 1B90A 1PCXA 3FSAA 3IJSB 4KJQC 3HI1A 3FQRA 12E8L 1CXKA 2DQMA 4JBSA 5T1LB 4B9FA 1L9PA 4F7EB 1G7HB 3ZE1F 5BS0A 1QO3A 1AH1A 5EZPA 5D2LA 4F8QA 3AU1A 4C8XA 1NINA 2LOEA 4K3JL 1EEYB 4ADJA 4TULL 4ZG1A 1TT6A 3BESR 1A1NA 1XGTA 2F5BH 4P59H 1M05B 4K8RC 1CDYA 3S34L 1T0MB 1C7TA 4Y5VA 3NCJH 5T5NG 5GIRB 2NY4D 5DK2A 4LCYB 4H5SA 1UKSA 4TMPA 2CIIB 1KUMA 2BK8A 4PRIE 1WTGT 5I74C 1NCHA 3LKSA 4G11A 5AW6B 4OZGE 1W0WA 4WWKD 3V9EA 4YZWA 1AGDB 1N7ML 3HZMA 4PEEA 3T1FB 7FABH 1HAUA 3JWOH 3GMMA 5HYSA 1HEZB 3JTSA 4E0RB 3MV11 3ORJA 1MN4A 2BRRH 4A67A 2H32H 4L4TD 5DVOA 3D0VA 4MKTA 2B59A 4BKSC 1QW9A 5D7KE 2BC4A 4JVPA 1IGYA 4ELMF 5JHDE 2DWTA 1A6AA 4TUUA 5I75B 3KW8A 4F7TA 5B3NA 2BNRB 5CLXA 4L4TA 3REVA 4PG9B 1TEYA 5E2TL 1T7YA 1S3KH 3P11H 1EX0A 3L4TA 3RJOA 4BZ2A 1JXKA 2NUTB 4WTXA 1UD3A 4K3JH 3T0AA 2J1ZA 5SWSE 2AP2A 4XPTH 4BSJA 3QSKB 4WWKA 1PEWA 4AEIH 4ORZC 3BH8B 3FO2A 2B1OA 3ILQC 5DRWB 5DK0B 1JYNA 5L0QC 5FV1L 1AD0B 3U4EA 1FJ1B 2RIKA 1I8UA 3EBIA 1W91A 3LKPA 5KYWA 2X3CA 4XRCB 2NQ3A 3SKUD 5A3IC 3Q9QA 3CVIH 5KSBB 3DECA 4Q58C 4HUXB 4U6YA 2K6ZA 4XWOD 2CHWA 4RRPM 2WMPB 5EIQA 3HG1B 1IBBA 4WTZA 4NYLB 5EG6C 4PD4J 2UY7B 4Q6IC 1E4JA 3VGBA 1IMHC 4PB9H 1WFNA 2Q9OA 2FE0A 4JM2B 3KE0A 4N25A 1WUNT 1B0WA 1DVFA 3S88H 5SX4I 3LKPB 5F93C 4PCYA 2O5XL 5HHVL 1JF5A 2H3XC 1AXTL 3A47A 3HNVL 3AT0A 1WCBB 5AYQA 3HMXL 1JCVA 1BECA 3ARFC 5DRWA 4ZS6C 4RBPH 5C0IA 2J21A 3ARBD 1DUYB 2Z91B 1P5VA 3OAYH 3ECBA 4HOXA 1P6WA 5J1TC 3RU8H 1VLXA 2XSKA 1NQBA 4FCHA 3L4CA 4K3HA 1JZ5A 4I77H 4QHMA 2FJHA 4MNHA 5FAAA 5DJ8B 4PYGA 5KS9A 4X4MA 2ZONA 3ALWA 5SX4H 2DIJA 2JKWA 3TGXA 4HBCH 3UPRB 1I82A 2CKBH 4NC2B 5DYOB 1TPXB 2VN3A 2ZXDA 3D8MA 4S1DD 3QA3A 3VD4A 4LCIL 5GS2D 2CK0H 2E8ZA 3C87A 3ZZLA 3FRPB 4M5YH 5LNDA 2I27N 2YXWA 2RR3A 1R3KB 1U8CB 5TQ0H 4CGTA 2B59B 4LDEB 3AT9A 3ZU8A 5FWRA 1AKPA 1FDLL 4OFYD 1SJXA 4X9IA 2D03H 1EHAA 1RPUA 4E0RA 1K8DB 3MZGB 5HVGB 3V8OA 5F7UA 4OT1H 4XNQA 3U0TA 3ZT6A 1XGPA 2VL5B 3PWNB 4QXGH 3VG9C 1VGEL 5L0QB 2F6AA 1PIFA 4HIJB 6PCYA 3L5WB 2W38A 1MCFA 3HTLX 2E7MA 5FGCB 4HAKA 4RDQG 3AXLB 2HZHA 2FYVA 2XA8L 4Y9FA 3VYPA 3OKDB 2BNRE 4ZMWA 5D8JH 2WTRB 1XAUA 5AUMB 1YUHA 2YGPA 1HQ4B 5E56A 1BLIA 1KFAL 1U91A 1UM5L 5IJKC 3SDYL 5GS1B 3IJ9A 1O6TA 3LMJH 3S35H 1FNSL 3LAFA 4MQTB 1BFVH 4HFUL 4DP6X 1JHTA 4QRQB 5E94B 1MRDL 1Z9OA 4NKOB 1H3VA 1EZSA 1UJ3A 3FUJA 4HAFA 3I50H 4WW2F 3CVHB 3DETC 5L2KA 5L88L 3IU3B 4MB1A 4G8GB 4MSWB 4ES9A 4PJIF 4I3RH 4IU2A 2VXQH 3TYFB 1OB1B 1W8OA 4LO9A 2NNAB 2D31A 3VI4E 3JWOL 4Y89A 5IFJB 1U3YA 1VESA 3KWUA 5I5RA 4GW4B 1G7PA 3BIKB 4AC2A 4OLUL 1JZ8A 2ORBH 4XXDB 4FCAA 3QCTH 4OV6F 4JUTA 3VFTA 1ZK5A 2V17L 4OCWH 4U1MB 1OAUL 4GI9A 5A2BA 1NAMB 4XE0A 3Q43A 3BAEL 5DJYA 1I8MA 4AKQA 2PETA 1U3ZA 2IXQB 1TSRA 5MEND 1G7QA 2IMMA 5J5EA 1MHPH 4OM0L 1N64L 2AEQL 2VRAA 4XCEA 5C09B 2NSXA 1J5CA 2XKNB 1MHCB 4YK4C 1FZOA 3QQDA 3VI4F 2P49B 2O5NA 2CD0A 4TNGA 2I07A 3ZE1B 4ZDHB 2FX9H 4GAYA 2B5IB 2WC7A 1YAIA 2PCXA 3EFFB 2EEAA 4NZTH 2NXZC 1U8MB 3FO1A 2DMHA 4JFYA 4WENB 5E0QA 1RK0B 5AVRB 3TZVD 1NCDH 3V95A 5BVPL 5BOZG 3WIIL 4PJBE 3WENA 1XB8A 2WCGA 4PLOB 3QUXA 3BD3A 2QKIC 2Z31C 4MMXC 3VTTA 3Q6GL 1MNUL 1G1KA 3UTOA 5LBSH 4DN4H 1H15A 1P7KB 4WV1B 3OR6A 4ODXB 4XCCL 3DUHA 4F2FA 1S7UB 2JJSC 3GSWA 3MRDB 4WKXA 1V27A 2NW3A 5E6ID 1XIWA 1I9IL 4LSUH 4OCRL 1G9MH 5DS8A 3NH7H 4AIXA 2HN7B 1R24B 2X28A 1X6NA 4HZLB 3WIAA 2ZUSA 1TVBB 3RQ3A 2CLZA 3OHXC 4HIXL 4NJAL 3VSTA 3A22A 2YQBA 1KXQE 4NQQA 1UA3A 4HUNB 3PHSA 2BNUB 4QYOB 2L3BA 4OCWL 3TESA 4PJHB 3IBOA 1NSNH 3G5VA 1EBPA 1LDPH 4NSKA 5L2KE 1FQ9C 1LO5A 3EH5B 4ZOCA 2I9LA 1OSPL 3Q6FA 1WZAA 2W9LA 4XBEL 2VCOA 1SYVB 4JFOA 1XZ0A 3RY4A 2H2SD 1PZ5A 1LGVA 1KCLA 3NDYE 1DUZB 2DJMA 3MRIB 1RVFL 4JN2B 4QHNA 4L3ED 5DC0A 1PQZA 2JCCE 4HIXH 4JG1H 1CUOA 4F2EA 1CI5A 2NLJB 2N7SA 3B9DA 1WAPA 1ONQA 5FGCE 3N1PC 4P2QD 4AYFB 5EOCL 1MCDA 1D9KC 2ESVB 4FYRA 2MOQA 2HT3D 5KBNC 4JCLA 4H1LB 5EPMA 2P24B 3T0XA 1IEBB 5IHZA 2EC8A 5HGGS 4XI5C 1U8NA 3N42F 4R0LB 5BZDA 3BWSA 2MCAA 2F74B 3VUAA 4Z77B 5I0VA 3J07A 1A3ZA 2WKLA 5JXEA 4DZ8B 3NJHA 4YSOA 4FXTA 4GW1B 1FL6B 2C9SA 3KLQA 3FULA 1NCDL 1YMHB 5BZXA 4I9WD 1ET8A 2G60H 4L3CA 3UBXI 1QW8A 2Z0UA 4LL1A 1MHEA 1T7XA 3FB8A 3OBAA 3AM8A 3W38A 2IH1A 4PBVC 3UCQA 1X4XA 2VC2B 3C2AL 3TBBA 2E75C 3MACL 4ZFOB 3WY3A 4GG8B 2VZOA 3H85A 4H8WH 4O51A 4FNQA 4H0IA 3A6CH 3RDTA 5JXAH 1RH8A 4OT1L 4PI2A 3UABA 4I18A 4IDLA 1IM3A 4MNGB 3DO4A 5CIPH 4L8SC 4XN7A 1H6UA 2YAMA 1MZZA 3R7RA 1XL4A 1HS6A 3MHZA 4S2SB 2DQJL 2CRMA 4XGZA 5I75C 4JY5L 4MA1C 1QLEL 5H2BA 4PJIA 1K4CB 2VZ3A 2COVD 2DLTA 3VG9B 4NPYA 5B1JC 5IB4A 1IL1A 2PR4H 4IBSA 4X9YA 1DQTA 2UY6A 1WIOA 1L9SA 5EDXA 1TJXA 4KH2A 2AQNA 3WHXB 5FEBA 2OZ4L 1BVKB 1HH6B 3MOAL 5IR1B 3P0YL 1MCHA 2DM2A 5AEAA 3KYAA 4XAKD 1AXSB 4MAYC 5CZXD 4WNQB 4JN1L 4B9PA 1A9BB 3RDTD 3WELA 3S4SG 1C08A 1VCBC 2ESVA 1N9PA 1OARL 5I18L 1XF5B 1A7OL 1T4WA 4M43L 3KPRA 3T77A 1P5UC 2CNYA 3KYOB 3PP4L 4GRWH 4J5VA 2RMNA 1QBLH 1UTDA 1KN2H 3BH4A 2Y36H 3DJRA 1MREH 1E4XH 3AREA 4XB7A 2I5YL 4X8JA 3TEXA 1OL0A 2OJEA 3FZUD 4GBXC 4NQCE 4HULB 4Z7VB 4CC4C 4HU8A 5D1QD 5JHAA 5EZJB 4U3SA 4CDHA 1OSZB 3ZJAA 1LO5B 1X5JA 2E6QA 1HHIA 2Z4QB 3MACH 4PGDB 1NIAA 4R90H 3NJIA 2LU7A 1SMAA 1YN6A 3GQFA 3KL5A 3X3GL 1FC1A 3DVGB 2Z35B 2W59A 2A6JA 3KLAA 1N5YH 4R7DB 1IM9B 1WBZA 2H9GB 3BPCB 4XNZC 5JNYA 5J3HD 2AQTA 4UTBH 1KTCA 4LVEA 3HPJB 3I6GA 5E4OA 3UXFA 1MFCL 1OAZH 2BWIA 1A8JH 1LNUA 2WXNA 4ZUUB 1IBGH 4LNRA 3OAZK 4HVBA 1UG9A 2P52A 4Q9CA 1MY7A 3T8VA 1PLBA 4JQIA 3WJLC 3EJUA 5D72L 5C0EA 1D5MA 1NCCH 3BZFA 3HMWH 3OJDB 1BAFL 5EZOH 5IB1A 5C07D 1IFRA 1HHJB 2NXYB 3AG4B 5CLYA 3B7SA 4D3CL 1NC2A 4CN1A 1MELA 5EZIH 3TV8A 4HWEH 1F1GA 5FOBB 3HN5A 2V33A 3NJJA 2I60H 4GO8A 3AG1B 3T4YA 2CXGA 5ILTH 5A16B 3QPXL 3NIGF 4LP4A 2ITDA 3PP3K 1ZXKA 1LEGA 1IGTA 4Y2LA 4EIZC 2ICWJ 3WUWG 1HTYA 3AVEA 4AQAA 3CK0L 4P3CL 5JPNB 3L3OA 5JA8B 3TVMC 3C09B 4EUPG 3ZGHA 4PTUB 3FRUB 3PU7A 3IKCB 3IXTB 1XGZA 1E5ZA 3F01A 1FHGA 2JJWA 4NN6B 4WZ9A 5IB2B 3LH9A 3EH1A 2H1LM 2ZWYA 4OZFB 1FORH 3HW7A 4A7GF 2PXYC 1NGWB 1U8KA 3LEXB 4L4VB 4MD5A 4IRSA 3KVDD 4QXWA 4IKLA 4PJ7A 1N70A 2KI6A 4HWZB 4UUJB 5J13B 2HLAB 1S7QB 1XGYL 2PO6C 3MOBL 3WTSA 4UIMB 5IK3B 3RTLA 3RI5F 2YO3A 1XCWA 3ZKMC 3WHE0 1MF2L 1OY3B 5C0BA 4XVOA 3DIFA 4Z7NF 1HHKA 5GXBB 3GMLB 2FEJA 4KZ0A 4Z7VF 2F54E 1MFCH 1OAZL 1YEHL 3D18A 4ZFOL 1R17A 3ML9A 4L4JA 3LN5A 2FYYA 4G8IA 4NDMA 1R3HA 1Z5YD 2OP4L 3V4UH 4K7FA 3WKNA 2HMIC 4DOHE 2IGTA 1YVLA 1AS7A 4TUOA 3L16A 5CXPA 4RMBA 2V7NA 3IB4A 4N9GA 3FQTB 4DH2A 1FG2B 3WY1A 3UACA 3THMH 1D6VH 4NNXA 4R7XA 1Q9LA 3WN5A 3WNPA 4UOQA 3EOBA 5E2VL 5J6GA 3DRQB 4IBTA 2NY3C 3BQUA 3FUFA 3GINA 5DMGC 1ROCA 4NQCB 3GMRB 4IMLA 4MCNA 4J3WA 1QTYT 1J5IA 1Z3RA 3WXVL 1KCVL 4RETB 5HHOB 4CBZA 2KBGA 3BDBA 2MPAL 4LDCA 5E23A 3VFVA 4YBLB 1F3DH 3VFUA 3OB8A 4I4WA 1JI1A 1N7MH 4FLOA 4Y2DC 3BRGC 3ZO9A 3ZE2B 2QPUA 4ZO6A 3D48R 4MD0A 1L6PA 5JW4N 1QRND 2YOCA 5GRYA 4F7KA 4ALAL 5DJ2B 4G7QB 3MX0B 1WIPA 1WD8A 4GBXB 1X5AA 3BEWA 4OZHA 4G1MA 5G55A 1HFUA 1OANA 2QV4A 1YEIH 4L3FA 1GYWA 2PPAA 2R0KH 2R4SL 1YQVL 4MNHB 2AJXH 5DVPA 4WUUD 1PFCA 2VLRD 2Y22A 1YMMB 4R6UA 2J6EL 4PGCB 3BQUD 2VR5A 5ACMA 1UCBL 4ONHA 1VZIA 3TT3H 5K39B 5LWYL 2B4CC 3FXIC 1FFNA 1I1AC 4RMUA 2FR4A 4A7VA 5JPMA 3F65A 3V0GA 2AK4B 4K0OA 2M8XA 5F7DA 4JO4L 5J6SA 4X5WA 5A6MA 5HYFA 1FNGA 3V55A 1JGDB 2BVUA 2WP3O 4N0CC 1KJ3L 3NQIA 5E5LA 3P0VH 4R7LA 2OMVA 2EDTA 4KRPC 4HJSA 3T2NL 3ABGA 3ABMB 1YNTF 2UZXA 2DQIH 2G4EA 3MLTA 1XGRA 1S9VB 3QQXA 3JXAA 4JHWH 3SJVB 1HZLA 2CA4A 4CAGA 4P4RB 1A4KA 4NI3A 4UCFA 5ISZA 5G4OA 4NNPH 3SY0B 4J28A 3JV6B 3OTTA 4JPIB 1N68A 2EDKA 1EFXD 2HTKD 2YQGA 1FZJB 3QNYA 4UTBA 4KDTA 4XRCA 2KQMA 3Q5OA 4YH6A 3DBXB 3B6SA 3QDMA 5E9NA 4UQDA 2FJUB 1IBZA 4ERSH 1CBVL 2BP8B 1OGTA 4ICWA 4PRPD 4OJYA 5HHXL 5CJ5A 4WI8A 4APQC 4XMZA 4Z3HA 3CFUA 4FNLL 4LKXA 1CZ8L 1BBJA 1F4YL 1DANT 2X6UA 3NYKA 5EMYA 4EN2A 2NX5B 2QGDA 5AW0B 3L5JA 5SWSD 5KVMC 5E9DD 1EK3A 2PTTB 4F58L 2LVCA 3NK3A 1T83C 3SE9H 4NQCD 2CO2A 4DP7X 3SQOL 4HKXB 4UOW0 5E2JA 2FT8A 1MVFA 4V1DE 4A2HA 4QRSA 4HHWA 5F1IB 4P48A 1M42A 1SPDA 1TG8A 2OMTA 5DZ9A 1DL7H 2N1TE 4NCDA 4XN5A 5E8EB 4L1BA 3NJFA 5EC1A 4QR7A 3H0TB 1J1OH 4DW2L 8PAZA 3W57A 3WFHB 2X0VA 5HI4C 3DUSB 3NABH 2O6EA 4NQDB 1JGUL 4PJ7E 4HALA 3NCFB 4Q6KA 1BWMA 4OB5H 3ULUC 2BP3A 2WXMA 1AJ7L 3HKZA 4UTAL 4ZFGL 5DD3H 2ZWLT 2ZOLB 2G5BA 3FO9B 4LLDA 1AS6A 4OJCA 3P4OB 3PWJB 5I1GL 1VEMA 3L3HB 5F7EH 2NTSP 3KYKL 5KBLA 3H6JA 1PSKL 1UADC 4LEXH 1IAKA 5DQJA 1YYML 2R29A 2AANA 1CF8L 2DQUL 3EZ8A 3MMEB 3S3CB 4MNQB 3E3QE 2G5UA 1IKFH 3LNGA 4IRJA 1Y18A 2ZAGA 4NAQA 2HH0L 3VB9A 1FRGH 4P07A 2Y25A 2B3IA 3II1A 1M05A 5I28A 5GGUB 3IMSA 5AZUA 3F7PC 3IXAB 4AH2A 3KS0J 1J0HA 2ROYA 4KMQA 2F58L 3VXRB 3KPSB 3NSFA 3V4PA 3HE6A 1SMDA 1M7IA 3KXFE 2BW4A 3MJGX 2MQ3A 3CFMA 3DV6B 3FHAA 2ADGA 3GXDA 2MTPA 3O6FC 1NDMB 3CSPA 4KVPA 1G5GA 2WOYA 3SKMA 4G43B 3TONA 3CJJA 4HS6B 3HNSH 3S8GB 4Z0XA 4JRXD 3V0VB 4EZLA 4ZD3L 1JZGA 1EV2E 4F9LC 5T1MB 3DIVA 3TIEA 5DZNA 5I73C 3P9LA 2JELL 3ZTJH 1R3LB 2RACA 3C9NB 3GHEH 3TBVB 3DSNA 2LVEA 4UIKL 5DRXB 3VU2A 3ZHLA 4CU7A 5J12B 5DD3L 2I60L 4LSQL 5CJQL 3D05A 5A2JH 4KHXH 1QRNB 2FBOJ 1R3KA 1U8CA 1WEJL 3CFCH 1Z9PA 2ROXA 2VAAB 4P2OD 3RWIA 3H0TA 3BAWA 1CICC 1JS4A 4PWEA 5IESH 1EEZA 2DBLL 2XWTB 4X6BA 3SCMD 3OQ3B 1MIMH 3VFGH 2CO1A 2ZYIA 2AJ3B 4U0RB 2H1PH 3FPXA 5B21A 4B97A 1FF5A 4ENED 4ATTA 3QEGL 4MXWL 1KPRA 3VA6A 4EI5D 1N4XL 1A47A 1CVSC 3DX6B 5I15L 5JOFB 4PW9A 1MDAA 3QUKB 1G1OA 3QWQB 5IM7A 1BQKA 3S5YA 4IRSD 2K0RA 3IM1A 4ZNEE 4W9LC 2UWEE 3EYUL 4PJEB 5K1JA 2J8UE 2HFGH 2XETA 5D96B 4IS6B 1XEDA 3PRZA 2HH0H 3P2DA 4OLWH 3KLLA 3D85D 2I85A 4S0HA 4WHYH 4YLQT 1S8DB 4HSQA 1NGQL 2FIKA 2XXGA 5D7KD 3ULSB 4PQXA 4GI8A 4JRYE 2K8MA 4P8QA 1JJUA 4JJ5B 5D7IB 5HVFB 1JHKL 2EE6A 3BP5A 3TFKC 4G6KH 5B1CA 5CJXA 3AQXA 4UIKH 1PY9A 3MV8A 3VQLA 4PMEA 2ZOOA 3BDYL 3J2PA 5AYUL 3P73B 2V6HA 5FA4A 3IPEA 4X7DC 3J8F7 5LGHH 4CBPA 5LB1A 5D7SL 2W8CA 4AGPA 3B5GA 1PG7X 1KLUB 2ICES 2Q8BL 3FQWA 2EIJB 3JV4B 3NIFE 4JDZA 4AIOA 2J43A 2WK2A 3FB7B 4X5WB 2XXMB 1UUSA 3GTTA 2C26A 3EYOB 3SZKC 3WN5C 3DMMB 4DN3H 3LNHA 4OF0A 2YRZA 1KPVA 4O00A 1TYJA 3EGXA 4Y5XB 1U41A 1W0VB 1YEJL 5IBUB 3K91A 1QFWI 5ICYA 1UB5A 2WPGA 3HZVA 1CT8A 1I1CA 1CDHA 1HH9A 3FFDA 4Z7IA 1CGWA 2AI0L 2VXSH 4HC1A 2OK0H 3CBRA 4PM1A 1ZANL 4G1MB 2NY1B 2WXLA 5L2JA 5D6CA 3H55A 3RHWK 2EVHA 4BK8A 5I1IL 3DGGA 1A1MA 4FZ8L 4KI1A 2KDGA 4N2GA 3I9AA 3QAQA 4Y4FC 5KSBF 1VJSA 4UI2A 3VXMD 2Z7WA 5MEPA 2FSEB 2UZIH 3QRFM 3D25B 2ZCHH 4F7CA 5I0DA 1UJTA 1GJUA 1SHXA 4AI7A 2CDFB 2BVOB 4X9BA 1X7QB 4GRMA 1OB0A 3GMOA 4GI6A 4WRLA 3NABL 4FQPA 3V5DB 2WQAA 2YZ8A 4XR8C 5F7KC 4HWUA 2AXFA 4M8UA 4RGMC 5F97E 3O8XD 3HC4H 5E8DL 1NEPA 4F93B 2XFGB 4LP8A 4AEHH 4HIHA 5IB5B 3GEFA 3QJQB 2CBQA 1T03H 1KYDA 4Z7QB 4N8VB 1F13A 3ATDA 1QRNE 2EAEA 2ZCHL 4HISA 2QVKA 4WVRA 4ORGB 3TBTB 4QY8B 5FCUL 1KTLA 3FQTA 3GDBA 1MWAB 5F6HJ 3CSBA 4N8VG 3NIDF 4LBEB 3Q44A 2V9QA 3UZQB 5EU5A 4K71C 2DJSA 2M83A 2RTTA 2Q86B 1T22A 3A67L 2ERJC 4DERA 5KOMC 4Z7OF 2ICWB 3CSGA 2ZOLA 5DHEA 5E4AA 3EUUA 2OMYA 4AMWA 4HCIA 4RAVB 3O2WH 4LF3A 4JMNA 2HJKA 2V2WB 2VR4A 3FQRB 3E6HA 5F9DC 2LGNA 4EN3D 3H9HA 4KDVA 2LQRA 4GKOA 5FUOH 1WHPA 1HHKB 4JL1A 2BIIA 5DD1L 1VEPA 3IFNH 3WFEH 3IDXL 2R9HD 2GUOA 2UWEB 4G9FB 4MJIE 2GK0A 4AGNA 3MAWA 4Z7UF 2DQIL 3WEXB 4WY7H 3IE9A 2M2DA 3WEMA 5DTFB 5GJSH 3LIZL 4KXZI 4GKSA 5T1DH 5T3XL 1S9XB 4O58L 2JELH 2CRIA 4YXLH 1IAOB 4WLCA 5F7HA 4GS7B 3D50A 3VWJC 1E5BA 3TC9A 2YBGA 3UAAA 4ZMNA 3EF7A 5J13C 3S6CA 1IIKA 5FO7B 4X98A 3M17B 2EDLA 5IBUG 3VNYA 1QBMH 4EUPA 3B5TA 2EYSA 2WUCH 2NXZD 4TVSa 1CLYH 5DT1H 5LDSA 1SHWA 2BZDA 2JIXD 3DX3A 1NUDA 3RIFF 1KXTB 2DYPD 4RFNC 5IUCA 3N9GL 3O4LB 43C9A 3TURA 3VXMA 3RWGA 5F3HA 5I1KL 2JB5H 1SXAA 2OULB 3JVFC 4BH7A 1CLOH 4JS7A 5BW7C 3M8OL 2OX5A 1NC2B 4R8WL 4NO0A 2R2HB 3A24A 3MUHL 3E8UH 4FXKC 3ZDZE 4A68A 1NFDA 4WK2B 2YRBA 2Q6WA 1TTGA 3ZIMA 1JZ6A 1N5AB 3RVTD 3QHFH 2VDOH 5MENA 5K9KB 5E8OA 1S9XA 4YDVB 5JORA 1BXXA 3RGVC 1XXFC 1MJUH 5HVHB 3CDCA 1E4XI 5EIIB 4LCWB 1KIRA 4M5ZH 4ZFGH 2TSBA 3KHOA 4NN5B 2CKBB 2DYSB 1HSAA 2F0CA 3KYMB 4DGIH 2EH7L 4CJ0A 2WXOA 2CO3A 1UVQA 2G3ZA 2PCFA 4IKJA 5FKPA 1NCTA 4KY1H 2YOAA 4A2MA 4DP8X 1F00I 2YPLB 3E8UL 1G7MB 1B4TA 4HD9A 4DZBB 1LYQA 3LXAA 1KYOK 1JNLL 3BKJH 3BP6A 1YN6B 4RAVA 2Z0BA 2Z4QA 1HHIB 4IBQA 4PGDA 4L29A 4EIBA 4UBDC 4BE5A 2ICWA 4R7VA 4XP5H 3MX0A 2A3TA 3QDME 3F7LA 3BZ5A 2CU9A 3D39D 2BP0B 3ILEA 4WSGA 3KVPA 1FYTE 3FFCB 2IADB 2QSCH 3GPEA 4JGMA 2EVJA 4D9LH 1NGZB 2XG5B 2J2ZA 2YN5A 1K8IB 1UFUA 4A2GA 5ICXA 4JFPB 4GXVH 1MXDA 4XO4A 4PLJC 4Q9RH 3FCGA 3ZTEA 4MAYB 4OCSL 2DKUA 3VM5A 4JCMA 5I8OL 1LEKB 2HA1A 3CDGA 1AS8A 1CFTA 5IW1A 1A65A 3HHSB 1ACZA 2AABL 2CALA 3HI6H 2Z93A 4EZJA 1EJOL 3JUYA 4M03A 4CADA 1P1VA 4NHCL 1N6QL 4HV8B 3O2VL 4E41D 4U6HA 4X5XA 1XCQA 1GRWA 4PRAB 5IT2H 3CZKA 1W72H 2YQ2A 3D07A 3KPMB 2JI3A 3ROOB 2X1PA 5SX5H 4KKAC 1JCKA 2ARJB 5ISZD 1JGVH 2WTPA 3HG5A 4IOSA 4BZ2H 1SDAB 3FL7A 3MGOB 3X12A 2VN4A 2X1OA 2JK5A 3OXRB 2UZPA 3ZHDA 2H1XA 1D9KB 5HHME 2IQ9H 2I9TA 3FUEA 1KBWA 2GTZA 5L2JB 3QORC 2I24N 1A14L 1YY9D 4L1SA 5DSCB 4NDMB 2LAGB 5E7BA 1A21A 1XMEB 4YXKH 4XB3A 1OAUH 4P46C 1QD0A 4Y7OC 5E6RB 4TUKL 5CZVH 5MENE 3E2HC 5K69A 1MNNA 2J5WA 4Q97A 3T71A 1I1YA 4MNGA 3FUHA 4JZJC 4OH2A 1AKJD 2F8VA 3HE6C 3B4NA 1U58B 2N7BA 4OFKA 3WN6A 4A7GA 2HLAA 4LPXA 1Q9WA 4LLQB 4WCYH 1E8WA 3OX8A 5E5MB 1SJHB 2CUAA 1ZHBB 4MJ4A 1HU8A 5GJTL 4AGLA 3MLXL 4DTGL 2R56H 3QJOA 4JFVA 3BUTA 3C5SB 5E5MA 4N0UB 2YD8A 4PUBL 3NSYA 4GFXA 4G9DA 4TSBL 2YPVH 3BUDA 4L2YA 1AR1D 2ZG2A 5ITBL 4C83B 1IQDB 1GW6A 4NJ9L 2VERN 3RY6A 1CI3M 2FT6A 3ULUF 4UQBA 5D7SH 3BSZH 4EXPX 3QNXA 2ZKWA 4LSUL 2D4FA 2WXFA 1AGBB 2R4RH 5D2NA 5JPNC 3NCJL 3WLWC 4XX1G 2X0WA 5CEXB 5J6HA 3QG6B 2NXZB 2XKUA 2HCZX 2WO2B 3IK2A 5D5ME 1S9YB 4IGBB 4J6RH 3VG0L 2W0PA 5JXEC 1URLA 3BRFA 4IBZA 1W72L 2WHVA 4N2HA 4R4NC 4ZTOH 4W4OA 5K33A 2ARJA 3BKCH 1HHJA 3AQYA 1PS3A 3LDBC 2F7RA 1HI6A 1XBRA 4LLUB 1XR8B 3OJ2C 3QDGB 3QZNA 5F1SA 1UXSA 3MV7E 1AI1H 2IPUK 3EYQC 1J5OH 4JUSA 3O41B 3O6FA 3ZDYB 2KZBA 3ILQD 3ZE0E 1ZPUA 2K4WA 1NANI 4U1GC 4Q0XH 5D1XB 3GFUA 1WZMA 4F2ME 2C9UA 2VT0A 4DPAX 2Y06H 1EEZB 3ZBMA 2CA3A 3BC9A 1HC1A 5AZ2L 5DS8B 4PUBH 3DSFL 4ODHL 2NY5H 3CLEL 4QWWD 4FTDA 2F8OA 2M1KA 5E9DE 1CYGA 2OCFD 5GZOC 4H25B 5HJ3A 3NZHH 1P7KA 5TE4L 3LKOB 3MRJB 5EBMB 4CSSA 4JJOA 4Z23A 2QHLA 3M45A 1IBFA 2F53A 1J11A 5HYSG 3CSTA 3C9NA 4IU3A 5ALCH 1RZKH 1MQKH 2N59A 4Q89A 4QRRD 1TQUA 3T04D 2CCLA 3BSZL 4Z7VA 3W0WD 1UM4H 4UM8B 4IBVA 1NBZA 3QDMD 5EEXA 1GCYA 2VB5A 4GQ9L 3KH3A 3NJMA 2FWUA 1UOWA 5TK4A 3EXLA 3EYSL 4A04A 1R19A 4X6DE 3KPPA 1YPZA 3PWVB 2NY5L 1BG1A 1WVZA 1AHWB 4HUUA 3KPRB 5FYJE 5F89A 3T77B 4D8PA 3LY6A 2R9HC 5IJBC 4TLTA 5DI8A 1MJ7H 2H45A 5JXAL 1UD5A 3KLSA 4NBXB 4F1ZA 1CQKA 1DSYA 3PJLA 4KKRA 4PR5B 3ZRFC 2P43B 4RX4D 5IHUL 1JXJA 3HG2A 4Z0BH 1K3IA 4GLRH 4XO5A 3VX0A 4B7IA 5B38G 3MV01 1PBYA 1TQBC 2P45B 2UUDK 3WHXA 5DVMA 2FWOA 3OB0H 1W0YT 2JB6B 3ARQA 2XN2A 2E7BA 3DUUB 4KTDL 3MZTA 4KVNH 1J5HA 2LHAA 3VXQB 4QRPA 2ZUUA 3V4VH 4POUB 3TYFA 1SXCA 2W9EH 2EO7A 2G5BB 4M1GH 4F8OA 1P6AB 1JPST 5IHUH 1M53A 1T21B 4BK4A 3TX4A 4AYMC 3BPLC 5DXWA 5E00B 1RZJC 3JTTA 3QO0B 4K8RD 4AV0A 1BX2A 2FZ3B 2BFVL 3APDA 1EDQA 2EYSB 1R47A 5JYMA 5T1JA 1CIDA 5F8QC 1CFVH 1SEBB 1AJ7H 3IJYB 4E9VA 2GAZA 4GEJA 4X7FC 5EBLB 4IBUA 4JG5A 4JRXE 3WIFA 5SWQB 2OMTB 4KVNL 4MQXD 4AEFA 4XBGB 4YL9A 1BZQK 4ZFOA 1ZSHA 4FJZA 4NRXB 1CL7I 1S3KL 2AXFB 2HB0A 4XMXA 4UV7L 2ILLA 4N2NA 4KK5D 1MUJB 1U2CA 2XG4B 4KZDH 1RZ7L 5E9AA 4I9WE 2OS7A 2VLLB 4BFBD 2NX5A 3AS3A 3DHMA 3QUZC 4NIKB 4Z0BL 2F74A 1J8HD 2NY2D 2WYZA 3PXHA 2FJFA 3KPLA 3MYJB 3SQRA 4CMMB 2UXGA 2GUYA 1UA7A 3BIBX 4ZPVA 4J4PA 4L5FE 2XN0A 4HQQH 5C3IA 2WBXA 3IGLA 1FLTX 3I6LE 4FQQA 5ADPH 3BYTA 3QVAA 4L9LC 5EBMA 3ZE0B 1OKEA 1JNLH 1M7DA 3JYCA 3BUBA 1E42A 1PYWA 2CGRH 1WA0X 4HIIB 4NO5B 3MRCA 2CCVA 1TVHA 3PWLA 3ARDC 5DJAB 2XTJD 5KAQF 3SEPA 1O7SA 4PJAF 3GHPA 5GSRA 2ZCLH 2CLRA 1NCCL 4OGZA 4H2AA 5D71H 1QSFE 1CFVL 4JVUA 2A0LC 2R2BA 4K3GA 4EPSA 2Z7YA 3L8QA 3OF6A 1P7QD 5IF0A 4OZHE 2XV3A 3QUGA 5IJVB 3F83A 3VRLE 4Y19D 2BNUA 5JIMA 1FHNA 1AD9B 3BP4A 2HFEA 3B7UX 3HZYB 2C3HA 4EBQH 4DP2X 1E6JL 3E1ZA 3MJWA 2GTWA 3CN3A 4ENEC 5KYUA 4ZMAT 5CUSH 5F9WC 1QASA 3I75A 2RCSL 1M3JA 3PWLB 3GIVB 4KWUA 4TLUA 2OQJB 1BV8A 1NBYA 1A5FH 2DI8A 1C1EH 2FSEA 2AAVA