1L9SA

Crystal structure of the i257t variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLTGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA02
2EINB 2CJ3A 2VSMB 3DTUB 5B3SB 3S8GB 3FU7A 1NIEA 2YARA 1N70A 1PLCA 2J55A 1ZDSA 1KCBA 4E9RA 5I5MA 1KV7A 1ET5A 3AG4B 1GR7A 3T6VA 2BHFA 2Y69B 4A2FA 1BQRA 1WA2X 1RCYA 2HX7A 2QDWA 7PAZA 4GXFA 2PPFA 1KDIA 1CURA 1AACA 1ZIAA 1FA4A 4DP1X 2H5UA 2PP9A 2UX7A 3NJMA 3AG2B 2AZUA 4A66A 1NZRA 5F7AA 1MG3C 2PLTA 2P80D 4DP5X 1CC3A 5I28A 2DWSA 3WKPA 3T9WA 3NJIA 4PCYA 4X4KA 3KW7A 2YAPA 4M4RB 3UAEA 2CBPA 1IBYA 2GC4C 4P5RA 2IDSA 2XV0A 2BO0A 4G7QB 4YVUA 1AZCA 2IAAC 2WSDA 1QNIA 3N2JA 5TK4A 2PP8A 4JHUA 4QKTA 4DP9X 4E9WA 2HX8A 2J57A 4CSZA 3PAVA 1PLAA 1OE1A 2DYSB 5AKRA 4HCIA 5IY5B 1JVLA 3IBOA 1JZHA 4F2EA 1WS8A 5LDUA 2GHZA 4DP0X 3TU6A 2B3IA 2XYBA 3S8FB 1KCWA 1OV8A 2MTAA 1IUZA 2FT7A 3FT0A 2W88A 1PZAA 4HCFA 1OE3A 3JT2A 1GSKA 2UX6A 1ZIBA 2OJ1A 2Y1AA 1W6LA 2IH9A 2XUWA 1HAUA 3ABLB 2EIJB 1A4AA 3UACA 4AI7A 1GYCA 1J9TA 3OM3B 3QJSB 4KO9A 2XV3A 5I6PA 4GP5B 3FYEB 3IN0A 4HZ1A 5FC9A 2I7OA 2UXTA 4N8UA 4AX3A 5A7EA 3NJFA 2XXGA 3G5WA 3X1BA 1NINA 1B3IA 4UANA 1GS6X 3ZBMA 2I7SA 3H56A 3QJVB 1L9TA 1OCZB 1OE2A 1CYXA 4HHGA 1V54B 3SBQA 5B1BB 1J9RA 1L9QA 1AS6A 2UXFA 3PCYA 5E9NA 4DPBX 2PP7A 2XLLA 3PXLA 2BZ7A 4GY4A 4FAAB 1AS8A 2XV2A 2GC7C 1ZDQA 1GY2A 1A4CA 3NJJA 3OD3A 1MDAA 2TSBA 5AZUA 1F56A 3X1NA 3CVCA 4TXVB 5B7MA 1A65A 1CUOA 2BP8A 2YAQA 3C75A 4G71B 1ZV2A 1SDDA 3NP4A 2GI0A 4AKPA 4KOCA 3NSCA 1ET8A 1KBWA 4HCGA 2PCFA 2YXVA 2A3TA 3ZDWA 3TA4D 3X1FA 4AZUA 3TBCA 1SJMA 1ASOA 2CAKA 1W6WA 2FQDA 1KDJA 5B1JA 3WNIA 4ZK8A 3AG3B 1PF3A 3FPYA 1AZBA 2WO2B 1PCSA 1OCCB 3QPKA 4BXSV 4DP8X 4G72B 1SFHA 3FPXA 5TK2A 3FS9A 3EH5B 2IWEA 7PCYA 2E86A 5I6KA 1L9SA 1SF5A 1L9OA 3S3CB 3X1GA 4BXVA 2VN3A 1M57B 4G7SB 4Q8BA 1A4BA 3FU8A 1ADWA 3ABMB 3ASNB 2BP0A 4E9VA 1E30A 3EH4B 2TSAA 3CDZB 5D4IA 4N4YB 3AY2A 1JXGA 2AANA 3ZIYA 3EH3B 2IWKA 4YSAA 2VM4A 3NSYA 5I6LA 1QLEB 3WG7B 4BK5C 2X88A 4GYBA 1BYPA 3OMAB 5I5IA 1HAWA 2EIKB 2VW4A 4JKNA 3TBBA 1IKOP 4F2FA 1TKWA 1VLXA 2MRYA 3FU7B 2HRGA 4NAJA 1XB3A 1CYWA 4G7RB 4GP8B 4DP2X 3FQ2A 2YQBA 3CVDA 3H4FA 4DP7X 2BW5A 5PCYA 1M56B 5EHFA 4KOBA 4QLWA 4W1TA 2XWZA 2PPEA 2XX1A 1GW0A 3N55A 4WTQA 3PLYA 1AR1B 1J5DA 2IDQA 3GYRA 1AANA 1IBZA 1PZBA 2W8CA 3AZUA 3UABA 1E67A 1E65A 2IH8A 1NWOA 4BDVA 4DP4X 5F7BA 3QJUB 1NIFA 3FQYA 2I85A 1EZLA 3X1EA 3QQXA 1AZRA 1GS7A 2NRDA 2YXWA 5I6MA 3BQVA 3BVDB 3T6XA 3GXUB 5B7EA 4CSPA 3EHBB 2CALA 1J9QA 3ASOB 1IC0A 8PAZA 1TU2A 2OV0A 2XXFA 5I5JA 3GDCA 3WI9A 4P5SA 3ABGA 1BQKA 1BQ5A 2IDTA 2XU9A 4YL4A 1NPNA 3NYKA 3FYIB 2DYRB 1MZYA 3DKHA 4NB7A 4AKOA 1X9UA 1J9SA 1R1CA 1WAEA 5ANHA 3PPSA 2R7EA 1SFDA 3FSVA 3QJRB 4HALA 1T5KA 2EILB 4M3HA 2GSMB 3ERXA 4E9SA 2HZHA 2FWLB 1HFUA 1FWXA 2H3XC 2IDUA 2YAOA 4Q89A 4A2HA 3T6WA 2N0MA 3SBPA 1AZUA 2CCWA 1WA0X 1TEGA 5I6OA 4ENZA 3D12B 3V9EA 4UAHA 4E9QA 4HIPA 4YVNA 1ASPA 1AIZA 1KBVA 3NT0A 4PAZA 1EHKB 1PNDA 3NP3A 1SF3A 4YSDA 2QPDB 2UXVA 1JZEA 4JHVA 3ZX1A 1PMYA 2ZWNA 4EF3A 2JKWA 2ZONA 3OQRA 2QT6A 3PAZA 2AFNA 3U25A 5B7FA 2VM3A 1NWPA 1OCOB 4F7KA 4YSEA 1JERA 2JFCA 2BW4A 1MG2C 5AFAA 3HEIB 1YLBB 5I26A 4KO6A 4G70B 1JVOA 4KNUA 1E5YA 4WKXA 2DWTA 3ABKB 2GIMA 1JZFA 4UF7C 3AG1B 1DYZA 5B1JC 2YAFA 1AG6A 3CG8A 2J5WA 1DZ0A 3JTBA 3WKQA 2HRHA 4BWTA 1E5ZA 1GY1A 1NIDA 2PPCA 2XVBA 3QJQB 1A8ZA 3FSZA 4KNTA 4A2GA 3QJTB 4DPAX 2VW6A 1RKRA 2FQEA 1GS8A 1L9PA 2XX0A 1BXUA 3EF4A 1URIA 2UXGA 2FT8A 3AW5A 3RYMA 3NJLA 1ILSA 2AZAA 2FQGA 2FNWA 3MBWB 3HB3B 5D4HA 2ZXWB 2FTAA 1RZPA 5D4JA 4YSSA 3NSDA 4NERA 4YSCA 2BP8B 4KO7A 1BAWA 3SBRA 1PLBA 2BWIA 3NJHA 3FSAA 1SHWA 1SDDB 2HLEB 1N68A 3CVBA 3T6ZA 5B1AB 5B1KA 1NIBA 1SHXA 1BXAA 1ILUA 2PCYA 3H4HA 4YSRA 1JZIA 1ZPUA 1OOWA 3WIAA 2RACA 9PCYA 1W8EA 4KO5A 1AAJA 2BZCA 1NIAA 4YSOA 1ET7A 3UGEA 1V55B 3NJKA 1PAZA 3OMNB 2QPEB 4A2DA 4RH4A 2GBAA 3L45A 3FU9A 5I6NA 1XMEB 3IEAA 1A3ZA 1JXDA 1BXVA 1ETJA 2B08A 3WNJA 4W9ZA 4BWWA 1JZGA 1AZNA 4DPCX 2QDVA 4HHWA 4KNSA 3X2QB 2LLNA 5PAZA 1UATA 1J5CA 2DY2A 4E9YA 1PNCA 1AG0A 1RZQA 4GP4B 2BP0B 2VMJA 4L0PB 2HX9A 3KW8A 4A67A 2PPDA 3T71A 3FQ1A 4HAKA 2OCCB 1WS7A 3S3DB 3IE9A 4YSTA 4K9JA 1KYAA 2IWFA 1ID2A 2FQFA 1OCRB 1WA1X 1XB6A 2IDFA 1L9RA 2J56A 3V9CA 1AOZA 3TASA 3NJNA 4E9TA 4E9XA 2AVFA 2EIMB 3NSFA 2BWDA 2FJSA 4YSPA 4MFHA 4AKQA 1JXFA 3PAUA 4A2EA 4YSQA 6PCYA 1PY0A 1AS7A 2FT6A 1TEFA 2Q9OA 1X9RA 2PPAA 1I53A 2GB2A 3CZUB 4DP6X 1KGYE 2YAHA 4BDVB 1OF0A 2VSKB 1BYOA 1BEXA 2H47C 2YAEA 2DV6A 1NICA 1JOIA 3DIVA 2WO3B 1QHQA 3S3BB 3OMIB 1NDTA 1AQ8A 6PAZA 3CDZA 1M9WA 4A68A 1JZJA 3SQRA 3NJGA 1PZCA 3FSWA 2Q5BA 2JXMA 1NPJA 1SNRA 1XB8A 1NTDA 3UAAA 2YAMA 1MZZA 3UADA 2HXAA 2CUAA 2P80A 3MX0B 1ASQA 4FA7B 2VW7A 4BWUA 1FFTB 4YSUA 2X87A 1V10A 2ZOOA 2R7EB 3IN2A
chains in the Genus database with same CATH superfamily
5JOPD 3L3IA 4DOHB 4KTDH 2WBKA 5I1KL 1M3JA 2VZVA 4XNXH 4NQUA 1LGVA 2LFEA 3E8UH 3ARBC 3WS6A 1U8PB 4L1SA 1U4FA 5J8OA 3CX2A 1KCBA 5E1QA 1YMMB 1IIIA 5FUOH 3RL2B 1U3HD 2I69A 3UC2A 3BPLC 3OLDA 2WXLA 4J3WA 4OF7A 1F11B 3ZT7A 3MOBL 4U49A 1WIUA 4ESKA 5IJKA 2R2EB 3M17B 5F8RC 7FABH 1HZLA 3EJSA 3HLAB 5JDJA 1E9OA 1TENA 3OXSA 3KL0A 1UZ8B 4HX1B 3DX9B 4IBVA 2BC4B 2J5LB 1MHEA 1PW3A 2L04A 2G5BA 5JHBA 2FH6A 2XHNA 1UWEH 5A3ID 2UWEF 4OFIA 1CXLA 5IJKC 2BIQA 4GXUN 2X41A 5C0CA 4MD4B 4LDEB 3DGCR 5BS0D 1K5NA 1G6RA 4JM2C 3ILPA 4ACTA 1HU8A 4F2ME 3BC9A 3GSOB 3TT1H 3GQFA 1VAHA 3IGAB 1GGCL 1R24B 4K9EL 1XH0A 2YD9A 4PV8A 4LRIA 2BLFA 3EDJA 2BPBA 4OCRL 3N41B 3EOBA 1XIWC 4P04A 1XGQA 3B7RL 1EJOH 3GRBA 4OLEA 4CSZA 4W9HC 4JY4B 1M7IB 4KROD 1GAFH 2BFVL 3DRTB 3KPSB 1HQRB 5FGRA 4PWGA 3V4VL 3V7MA 2VXUL 5JO5A 2HN7A 4Z78A 2ZXGA 2D4DA 1SEQH 2KT6A 4LLMB 5DJXB 4AEHH 1XH1A 3S4SG 1TXKA 1QBLL 1DQIA 4P8QA 3DMMA 2DYPB 4NBXB 3WTVA 1GGUA 1LEGB 1OXYA 1A7NH 2A6KB 2IH9A 1I8IA 1X5XA 3P73B 4MDJA 2JCCF 3QDGE 2BXZA 3Q44A 4DVBA 1J1XH 3IF1A 3I9IA 5F3FA 2WZ6A 1L4IA 3VE0A 4AI7A 1OM3H 3DMMC 4KQ4L 1PG7H 3O4LD 1U8HB 5ETUB 4KK9C 1TTFA 3LRKA 4Y2DA 4YHIA 1XTMA 3MV7B 2ZKYA 1T4KB 3U46A 3BT0A 3G5WA 1OSZA 4A7VA 1XDTT 4M8VA 3TWCH 3WUZA 4C56D 3MGAA 3FN9A 5EH1A 5EG6C 5MEPA 3TBTA 1N3NA 2WINB 3ARSA 1IVLA 3C60D 4GAJH 4JQIL 3CVIL 4XRCA 4Y2DC 4Y4KB 1YC7A 2DTML 4MJJA 1JV5A 3C5XA 3V4PA 2AHIA 1XGUA 1AS6A 5I76B 1ADQH 2XLLA 5F1IB 1TJXA 2P8PB 4FAAB 3LV3B 4ZD3H 3QCUH 3QG6B 4WJ5B 5EBLB 4C83B 2YQ3A 1M1SA 1EJ6A 4W9DC 5CGYC 2CR0A 3HS0A 1QYGL 3UAJA 5CINL 4YX2L 2CGYA 2RFXA 3CFEA 3P4MB 3RL1A 4TQEL 4WW2B 5T3ZE 5HYQB 2YAQA 1Q9LA 2FGZA 3M8OH 2ORBH 1CE6B 2VQTA 2M1KA 3QQ9C 3L95A 4XNUH 3EGSA 3GTVA 4G71B 4IOFD 4YHMH 5FWQA 5J1AA 1VENA 4OCSH 1KC5L 3BAYA 1BX2A 3HB3C 5GGSY 3LS4L 3UAJC 3MYJB 4APXB 4GW1B 4HHAB 3UYRH 3WO4B 2WLLA 4PWJA 1MCWM 1P7QB 1RK0B 3I6LD 4LHUB 4ZFFB 5JHDD 1CFVL 5JZ7D 1HZKA 1F8TL 4TUJB 2F54A 3HHSA 3AG3B 2VE6B 4GSXA 4KY2A 3FPYA 5JPNC 2WO2B 2HG0A 5F9WB 1S7TB 3TBVB 3E6FB 4JFHE 5HDLA 2ESVD 5EU5A 2NX5D 1MH5B 2YGOA 3CC5A 4HZLA 4O4YH 5AOJA 3KDMA 2XICA 3CHRA 4PGEA 4Q9QL 1TNNA 1CG9B 2NQCA 2AQRA 2WLYA 4HT1L 2GEEA 4GW4B 5DC2A 1L9OA 5D7JA 4JN1L 5FHBH 5MHSD 2WO4A 5HHOA 1L7IL 4MNHA 1BFTA 2RBLA 4QOKA 2TSAA 3FRPB 1RIUH 4N2MA 5BXFB 3QXWA 2F7IA 5D7JC 1X4XA 3EH3B 3LHAA 4Y5YB 1NCBL 2CDEB 2IBZX 3MJ9H 3V0HA 5C0RL 2AJUL 3HC4L 1HWHB 3WG7B 4OZFH 5GGRY 1FG2A 5IQLA 3IJ8A 4LVNB 2QR0A 1TQCC 2EDYA 3LJ3A 4ZFQA 2NW2A 4HEPA 1ZK9A 1LD9B 3D85A 1MY5A 1DEEB 3N6YA 1O5PA 4HYTB 3V8CA 1FZOB 4PGJA 2H41A 4LIQH 4ODXB 4RZKA 2DM2A 4LLQB 3KR3H 1A4JA 1TJGL 1T5XB 4PRPA 4OTXL 4Z18A 2A7BA 3E6HA 1M56B 2X05A 2ZNWA 2X10A 3TZVD 5DMIL 3TCLA 4HMDA 3PLYA 2E7MA 3DVNB 2WLIB 1I3VA 2FB4H 5DMGC 1JS4A 3ROOB 2VLJB 4HKJB 5EUKB 4AV5A 5BW7A 4Z3GA 2B0SH 4Z7VB 4YBLB 3PFQA 4F15C 1FAKT 2X6AA 3UYOD 4H8WH 4MJIE 1T1WB 1P5VA 2FEEL 2ZCHH 4PVBA 3V0WH 4OV5B 2ZIDA 3CFJB 3GBLA 3BSZA 5D7IE 4WKZB 3JWOH 4HKZB 4MQTB 4GO6B 1YPZF 4M1CD 5I5JA 2K4AA 3SKOA 1BW8A 4NRXA 5B38G 5BZWA 5AOZA 1CLZH 5C3IA 1GOHA 4IJ3B 4K94L 1U8KA 2FRGP 4XXDB 4ZSOB 2H2SD 1KGUA 4X7CC 2BSSB 2WCSA 5I74B 3T0DA 2R7EA 1PEWA 5EORL 2AK1H 2QVFB 4NKIH 4R7VA 1LP9B 1TVHA 1MAML 2CUIA 3U9PL 3BN3B 2FWLB 4OUUB 5AVVB 4ANXA 5DQJA 3C5ZA 3SSGA 4A2HA 1YY9D 3L9RA 5E7BA 1ZCRA 4GUCA 2NDFA 2YRPA 4FYTA 3DHUA 4DGWC 3KYKL 2ED7A 4M7ZC 3O3AA 4D9QE 3T3ME 3GI9H 4TLUA 3DUUA 2HTKC 1S7XA 5BRZB 4PGBA 4PTTA 2WANA 1T2QH 3O6FA 3BZEB 3QXTA 2G0LA 3QSKB 2HT3C 1FIGH 1QI5A 3WLBA 1JZEA 1KIQB 1EEZB 2VDLL 3ULVH 1JV2A 4QRRD 3OQRA 5EZIL 4TULH 3AB0C 2KKQA 4XCYA 1MRCH 4ZAKB 1DJSA 3RUGF 3X14B 5IUCA 2F61A 1FGNH 4GRWB 5IB5B 1UOKA 1PY9A 1ETB1 2DI9A 3CQQA 1TZIA 1QABA 3EJQA 1N10A 5A43C 2TAAA 1QWHA 5A6LA 4XP1L 4JZOB 4KVNL 1WZKA 4XP9L 1C12A 4Y1SA 4TL5A 4BQ6A 4B5ZA 3FU0A 3GGWA 4WTWA 4X50A 3VM7A 1DCEA 4WJKB 1HZHL 2P5WB 4NQCA 1Q72H 2J1KA 4JFFE 2XTJD 4G8GB 1MFAH 4F91B 2VDML 4FFYA 4XI5D 1OALA 5EBGA 1QRND 2XVLA 4N24A 3VFUA 2X4NA 3OTTA 5F89A 2CDFA 3Q43A 1AD9A 2R23B 5AB2A 1E4KC 4K73A 2VLKA 1MIEH 3F7VA 4IMLB 3K2IA 5EUOB 4K2UH 5FKPA 1YNTF 2C7UB 2X2UA 2AK4A 5SWSE 2FTAA 3LKOB 3QFGA 1IO4C 2J6EL 3PGFH 2BOBA 3BUYA 3O6ML 4K5PA 5HI4C 5BPPA 43CAA 1ZWIA 2FO8A 3GMLB 5KVGH 2CIKA 5I30L 3CVBA 1XGRA 5EBWB 1UADC 3MODL 4AVJA 3IKCB 3QISA 1T1ZA 3EH1A 5IFAH 2DDQH 5LCVL 3RY6C 1GYVA 1UTDA 4GXUM 2N1TE 3MFFB 4FQCH 1RUQL 5JR1H 3VH8B 3LNDA 1BVLA 4FLSA 1HSAB 4ONOA 1BVZA 4MDRA 2OK0H 3TXAA 3FU9A 5GGVH 2JF1A 3BH9A 3PYCA 2AXGA 5FYKH 1P2CA 2ZKMX 1A3ZA 3LPFA 4OIBA 4CL7A 3H9SE 4YDVB 2VXVL 1CZ8H 4JREC 3S36L 4NHUA 5FX3A 3FU6A 3WNJA 1UD5A 4PG9A 4IW4C 1SMOA 5KJRH 4KNSA 4LKCA 2B8OT 2H9GA 3TBYA 3V6ZB 1H9VA 3MPCA 4GKSA 5HGGS 4MDIB 2G5BB 3UMNA 3WFHA 5C07A 2GSGA 4F57L 4I9WE 2FYVA 3HC3L 2K7QA 3BO8B 2VLRD 4PJXE 1K5NB 2OTUB 1UT9A 4GB9A 2MH4A 3S3DB 4Z7UE 1FAIL 2ZAIA 2QQKL 2WN2A 1F0LA 4N1HB 2VN5A 3NRPA 3QCVL 1FHNA 3SY6A 3P0YL 1T66C 4L29B 3VFSA 1CLVA 3TO4A 1SJEB 3VMNA 5KTEL 3SGKA 1JWUA 3AVEA 1DQMH 4NKOA 3QIBA 2O6CA 1S7VB 4UT6H 3PAUA 4X5XA 3POHA 3K91A 4HC1A 1KFAH 2Q7NA 1ADQA 1E5AA 3HN5A 3EGXB 2HMID 3IFPA 3SGKC 2GB2A 5CN2A 5DVKA 1GXEA 1U2HA 3H8NA 4DP6X 1KGWA 1BYOA 5ISZA 3FJTA 2ZOWA 2OTPA 4PWIA 3DIVA 4DVBB 3KVQA 4P2QB 4WI6A 1HWGB 1WCBB 5IW3A 5HYJB 1JPFA 2AAAA 2M2DA 1CU4L 4H20H 1AXTL 2VMEA 3UOAB 3KCWA 3QDGA 1JZJA 4LEXL 3V5DB 1KTDB 4YHIB 1XH2A 3UDWC 4L8CB 2LABA 5DTFA 5AVRB 4NP9A 3FZUC 2YD1A 3HFFA 5ENWA 4L2YA 4FA7B 2EIBA 2AC0A 4UINH 2X87A 1V10A 3PHSA 4FULA 4ERSH 4EUPA 3B37A 2KQMA 2GPZA 4JQVA 2R29H 4MMZA 2G2PA 2O61A 1NCCL 3N42F 1IARB 4RISH 5G2NA 3MUY1 3CPLA 3U82B 1X6LA 1W2KT 1A8JH 5C92A 4JANA 1LDSA 4NJ9L 1OGAA 4JQVC 4K5NA 3R7RA 3NQKA 4UM8B 1XAUA 4V1DA 2Z35B 3MNZB 1CT8A 1U58B 4ZTPL 3CFEB 4WDIA 2W9DL 2CO6B 4XPBH 4B9FA 1K4CB 5J1AB 3I6GB 4NXSA 4ZDHB 4ZMYA 1GZPB 2PXYD 3MJ9A 3NJMA 5D93B 1RUAL 4RWYL 1AO7E 4K23H 4LNRA 3GUTB 1CGSL 4OZFA 2QMJA 4DKEH 2IQAB 1UJ3A 4G1MA 1A0QL 5D9SB 3C12A 3B43A 4O9HL 2E6PA 1QUNA 2JCCB 4I3RH 2VR9A 2WXRA 3H6AA 3US1A 1BQLL 3RB7A 5HD8C 4HLJA 3V79C 4MJ4A 4PRDA 5INCB 1UJ3C 4MA8H 4U05A 4Y5XC 4AQ1B 3X11A 4AOFA 5IT2L 4G7QB 1AKPA 2VL5A 4WFGE 1G7QA 1ROCA 2B4CH 1RUMH 2K3TA 3U6XS 3N1GC 4IJTA 1AHKA 5IHHA 4GFTB 3D34A 4CILA 4DP9X 1A6WH 2FEDD 4O5LL 5DRWA 3ZY7A 2GTZB 3T2QA 3U79A 3HI1A 4L9DA 2K0RA 4LDCA 2WUBH 4F2EA 1BOGB 12E8L 4LL4A 5HHOB 1IGFH 4MNHB 3UG3A 4LOUC 4MA1C 1K6QL 1N8ZA 3D3VE 4APQD 3C6LA 2W88A 4KUCD 4P9HH 1YEHL 3ZHLA 2EDBA 3H7LA 4H8WC 1KLUA 1LDPL 3K4DA 4ZTOH 5DFAA 4KGLA 4PJDE 4URTB 1FG2B 1NLDL 1EAPB 1NGQL 3GSQB 5HHNB 5T5NF 4ANWA 4OD1L 1MI5D 1NEZB 3C6LC 3JWOC 4EN3C 2CJUH 2DBLH 1RURH 1NOFA 4RLDA 5I1IH 4OI9A 3WU1A 1OTSD 4EZLA 4P5MA 4PJGA 1PLGL 32C2A 3NEXA 2W9EL 4PRPB 4N20A 1JI1A 4ICXA 4WNSA 1J7VR 4YPGB 3F7YB 3L3GA 3R8BB 4TSBL 3X1BA 3T3MF 4TPRL 3UX9B 2ITDB 1SXSA 4UM9B 4P46C 1QASA 1Y7VA 3VM5A 1UEMA 4Y7OC 4PJEF 5LHDA 2JKSA 3ZRFC 1UXLA 1KY6A 2FL5A 4LLVB 1Q9OA 4WUUE 3QIWD 1NC4B 3PXLA 4GY4A 3HZYB 3W2DL 3NZ8A 4KITB 1BVOA 4UNIA 2WTOA 3ILEA 4R26H 1EFQA 1HEHC 1Z6JT 4YDJA 3H3BC 4YHKL 2NY2C 3M6DA 3SKOB 3MUHL 1AKJD 5E1IA 1B0GA 1XF4A 3P4LA 1SY6H 4ES9A 4NZJA 5D7IA 5I24A 3C75A 4U6TA 1BD2B 3D9AL 3P9LB 3ULVC 3BWUC 3IT8D 4NIYE 3E3QE 4YHZL 2KPWA 2GITA 4MB1A 2Z8WC 1KB5L 5D7LA 1LE5B 4V33A 1BM7A 5CHNA 3AGVA 3TA4D 3ZL4H 2ARJQ 1A1NB 3VTMA 2WMPA 3C5ZB 1VFBA 2WWMD 2I9LA 3D7PA 3L9RB 3N44F 3TONA 1EXHA 3KPQB 2CO7A 4GUQA 5E9AA 3CK0H 2MCMA 4OF5A 3Q48A 2B1OA 1SGKA 4GG8A 2A9NL 4JRXD 4R84A 3V4LA 4EI5D 2GFBB 4ZX4A 3SD2A 2VDQB 3JV6B 4HEPG 2XN1A 2VABA 5HGAA 5TF0A 2FWOA 2XG5A 1IFHH 2Z4QA 3O6FB 2Z7UA 5CUSL 5I1JL 1WAAE 1SBBA 2DLHA 4ODHH 2BRQA 4LLAA 1S3KH 4NUGH 5CO1A 4AV0A 5DLMH 5D71H 1AGBA 4UUJA 4FJ6A 3BKCL 4Q6YA 1YEEH 2D3VA 4I4WA 1U6AL 4MA7H 5DS8B 5CZVL 3BD4A 4HOMA 2BRRL 4X5QA 4NUPA 2O5ZH 4OF3A 3UZVA 3OXRB 4L37A 1RZIA 1F6AB 2DIEA 4E9VA 3ABZA 3B3IA 1INEL 3AY2A 3PDOA 5KVEE 3SGJA 4P57B 3OL2A 4YSAA 5DR5H 3VXSD 4IRJB 1Z9SA 1YPZB 4QTIL 4NQCB 1CF8L 2QGBA 1EHXA 1TLKA 2F8OA 3II2A 4EVNB 3SY0B 5SWQB 4IGBD 5KVDL 1X9LA 3Q1SH 4GLRH 2BSEA 2VW4A 4R2GB 4Y1AB 3TBBA 3L3JA 4XC1H 1UWFA 2HRGA 2WZ5A 4XX5A 1FFPB 1KTCA 4J5VA 4JFFA 3MLXH 4UT7H 4NN6B 5PCYA 5A7BA 4JPSA 1EEYB 1U8OA 2NY6C 4GQPH 5L4IA 3V7AE 4GLRI 2CPCA 5IBUB 3GC3A 2L0DA 4WGWB 2CM6A 2AQPA 2XKSA 3BUYB 1XXDC 2I07A 2N01B 3PWJB 1KGJA 4EXPX 1NCWL 2I85A 3BGMA 4QYAA 2XN9D 3HNSL 2APFA 4XBEL 3T4AB 3WNOA 4IK6A 5SWSA 4AGPA 4M4PA 1TSRA 1J9QA 4G8FA 3A21A 1D6EB 2CK2A 3DURB 2VDLB 2J21A 4H8HA 1C08B 3O2DH 3W57A 1Z9PA 3AREC 1QEWA 3ZE0F 2VR5A 3JV0A 2ZKHL 1ID5I 1T89A 4G5ZL 4W68A 2QKIC 1DJGA 1RZGA 3UJIL 1BVLB 1KWKA 2M8XA 2WYIA 4RFNC 3MX0A 1UGKA 5C0BD 2F68X 1J9SA 4UT6A 5CEYB 1Z1WA 1H8NA 4F7TB 2AXGB 4FQ2L 5FB8A 3OKDB 4LCCA 2JJWA 1QTPA 1T89C 1A66A 5FYJU 3B6SA 4NHUB 1NJ9B 3QFDA 1UD8A 2CD0A 4N25A 2H9GB 5ESVB 4KTEH 3PNWA 5JW4Q 2WYZA 1CK0H 3VXRD 4GAAA 3AT8A 3D12B 4E9QA 2R0KH 3RWEA 5F3HB 2J8OA 4PJ6A 4BSJA 3BMWA 2HSIA 2UXVA 1QLRB 5DS2A 3F84A 4HUXB 2WXGA 1QPPA 1YNTB 2JKRM 2XIIA 3RGVB 4WFED 2DD8H 1NC2D 1F2QA 4JO1L 2X42A 4Z3TA 5GS0D 5DI8B 3SYAA 5E6ID 4LAQL 2E76C 4R8WL 2H2PD 4F2MB 5I75C 1GVIA 3HEIB 3HI6L 4Z7UA 5I26A 3EADA 2R29A 1XGYL 3T4YB 3FUEA 3ZQXA 1G7IB 3B2PA 4R97B 2Q86A 3ZT6A 2OULB 1YEKH 5JUEL 5LGHH 1DO5A 5B8CA 5K9KA 2E9GA 3ATFA 4XN9A 2WOYA 5GSVB 2AXFB 2D03L 5BO1H 4FERA 3IDYC 4GBXA 1BWWA 1S7WB 5EA0H 4B60A 1P4UA 1YG9A 1CB4A 4LLWB 3C08H 3B8SA 4GQQA 1FV1A 5B8CC 1S9WB 1NIDA 2ZWLT 1ZHBB 2ZPKL 5AVSB 4WO4A 1SRDA 3SDAB 4AT6B 5HHQB 2V9QA 3DRQA 3NA9L 2WZPA 3RU8L 4GI8A 2WWNA 2YSSB 4KI5C 4DETA 5KYXB 3RYMA 1MRFL 3FMGH 3KWTA 3B9KA 3FFDA 3HRZB 3GMRB 4HIEB 4M61A 3IGFA 4MJ2A 3WE6A 3ROLB 3L4ZA 4WO4C 1Q4NX 4OLVH 2BWIA 3F58L 1SDDB 2ZWYA 3S5LG 4BQCA 4KK8C 3FQRA 4R7NB 4MD5A 3CXHJ 4N6RB 4PRIA 4YHOL 2RAMA 1MEXH 1JNHA 2OX5B 3L5JA 3MV9D 5FK9B 2AJ3A 4NZRH 5IKCB 5GS1B 2BY0A 4P23C 2P5PA 1RIHL 3FCSA 3GXPA 3M1CA 4GSQA 3WFCL 5JXAL 1E0OB 3QIUD 4JPWL 4PJHE 5J6GA 2E46A 3BFQG 2B4CC 4LF3A 4QKXB 2WAQA 2IANA 4RX4D 2YEQA 1BWMA 4PJCE 1W91A 4OLZH 1JZGA 4PJDF 3CMOL 3HKZA 4RA0C 3UJTH 3J2PA 1O7DC 3W0WE 1WZ1L 1QACA 4ENED 4JPKH 3IFNH 4NZUL 1T6BX 3U7AA 3OZLA 1JI2A 5J13C 4PBVC 1CD1B 1B88A 4G1MB 1PNCA 3KS0J 1RZQA 2L8AA 1YMHA 1U92A 4P9HC 3CXHK 3RY5A 4DUXA 3BUIA 5BV7H 1ZJBA 1UVQB 4HH9A 1PX8A 3RZCB 1AO7A 5I6XB 1IEBB 4G7VH 3DTDA 3HMXA 4AEFA 2H45A 3MA7A 1P0SE 3GT6A 1R19A 3BDXA 2HJLB 3QWOB 3K1DA 2LTQC 4PY7B 2EDQA 5EOQL 5F7DA 4FABH 3QXAA 2FO4A 3S35X 5BVPL 5I5RA 4OY9A 2Z31B 4IYKA 3QULB 2FYYB 4PRNA 4WCYL 3NSFA 3DROB 1IMHC 1MFEL 1PDKA 3N43F 1KY7A 2D7QA 4AM0A 1OAQL 2JI1A 5BRPA 1OARL 1P4LA 1X9RA 1O9VA 2AITA 2DWDA 1TITA 4NAMA 1WRFA 1I9JL 3CH1A 1TVDA 3L4XA 1CVSC 1KENL 1B4LA 2VSKB 2VR6A 2I60H 4NXKA 2CKNA 3VQ2C 3HBZA 2EABA 4F7CA 2P48B 2NXYB 3H7BA 4KHXL 43C9A 4L5FE 3GXIA 3BAEL 3BUDA 3KGSA 3U9UA 5IJBC 5AZEH 1G9NL 4JFVA 1U8CA 2W0KA 3L5XH 4P5MB 2BVPB 1MELA 3FSWA 2Y07L 1I1CA 1JGUH 3G6DL 1NTDA 3NZHH 2AQ2A 4Y19E 3VG9B 1RZFH 4PGDA 4OGQC 1LK3L 2Z91A 4OZFG 2KL6A 3I02B 4L0ZA 1ZGLA 4I13B 1JZ4A 4PS8A 1IAIL 4J3OG 2EINB 2VSMB 3CFKB 4OCWH 3S8GB 2X4UB 2ED9A 1BJ8A 4KK5C 5ICXA 1NIEA 4L4TA 1N12A 1DVYA 3BUBA 4GXVL 1BHGA 4OB5L 4QTHB 4OZGE 4YDJB 3T1FA 3PXJA 4BQBA 1B4JH 1GR7A 4MJIB 5CR8A 1B0GB 3V6FB 5L2JA 4NQEE 3SDDD 3DTXB 1JL8A 4G6JL 2QFRA 1AACA 5J3HC 1FP5A 4AQAA 3BVXA 4IIQA 3BFWA 1Y1DA 1A4KB 1TG8A 1M6OB 5AQ0A 5DQ9A 2D3LA 3MLUH 2RR3A 3C8KB 3UO1H 3VRJA 4IIQC 5I28A 3DSFL 3BVNA 3LQAH 4ZQKA 5IVXF 4P4KB 3CZJA 4PR5B 3K4AA 3DGGA 3MC0A 2YAPA 5DYFA 3O3EA 1HINL 4NQSA 1CD0A 1SQMA 4ODVH 1ND0A 3QPXL 3K2KA 2A9CA 2I5YL 2HVJA 3B7TA 1QTSA 5C6TL 1S4IA 3BIKA 1QNIA 4AENB 3D87B 3SE4C 2DL9A 2YPLA 5DO2D 5EO0A 3RPBA 3A22A 4JFPA 3T3MB 2P7TA 4F1SA 4HLEA 1H5BB 4WWOA 4EQ3A 4Z7QE 2EVIA 5DVNA 3D69B 5I1KH 1EQWA 4WFHE 3IBOA 5LWYL 3C8HA 3VRLF 4HJUA 2GHZA 4Y4KC 4PJIF 3RVUD 3QUKA 3F01A 4PRHE 3CXDH 4M93C 4DGIL 3PDOB 3K1KC 3MOBH 4JLRA 1T2XA 5LGKA 5KS9A 5T3XH 3O2DA 1W6LA 1NBZA 4PJ8D 1F41A 4MS8C 2YLHA 5FYJE 5EIIA 4X6EA 4FQJL 4WW2C 4BGDA 5FEBA 3VA6A 3GMMA 3QJSB 2XV3A 1QLEL 1ZK5A 4CN4A 3LKRB 5CGBA 1WFIA 4FXGA 2XG4A 1U8NA 1PTZA 2HJKB 1MCNA 2N3JA 4KZCA 3UP1A 3D25B 1RP8A 1KB5B 4WWKA 5E8PB 3WY1A 4E41E 3VWKA 2YJQA 3WO4C 3SKNB 3WGUB 4YDIL 1DUYB 3QJVB 1MKFA 1XCXA 4K9EH 1E5CA 1L9TA 3MFGB 4N9GB 2IPKA 3KGUA 3F7QA 2NY0D 3KYAA 3OJ2C 4HHGA 4WWKC 5EN3A 4ZNCD 4OCRH 1FNGB 2HTLC 4B9JA 5CBEB 4NKQB 2XBZA 4U3SB 5SWSB 2BFVH 4ZPVA 3GLDA 4CN1A 3RTQD 2FCBA 4LGRB 3NJJA 1O9ZA 3OD3A 5GSRA 3V4VH 2NY4D 2VXUH 1DEDA 4YNYA 5AKTA 1FZMA 1ZRUA 1BZOA 3IJ7A 5LBSH 4G82A 3O11B 2BP8A 1QBLH 1OF2B 1TTCA 4LOVA 2BSRA 3Q1EA 1XL4A 4LKXB 3Q8BA 1G1KA 3GB7A 4XGZB 5G4NA 4HA1A 3B7YA 4Y5YC 2I25N 1KFGA 4G80B 1HH9B 4Y7MA 2NYZA 1O7VA 3LKQB 2Z1KA 4LVNC 1HVXA 2OXGA 3M7OA 4LBEA 5AW0B 3KPNB 3KM2A 2F1BA 2QVTA 1HIML 3H9SB 2VDOL 5D1QE 4W93A 1HJBC 1I7TA 3SGDH 4DP8X 4NNYA 3WS3B 3UFIA 4UI2A 3IDUA 3GXDA 1NKGA 4JQIH 3ES6B 3CVIH 3P4OB 5FCSH 3GBEA 2DTMH 2IWEA 4UB0L 7PCYA 3CFQA 5F1SA 2GW5A 2DQGL 3KE0A 1SN0A 4FFZL 4L8SA 1HK6A 1M57B 3SGDI 5D1XE 1PZDA 1NMBL 4PJXB 3EH4B 5FR3A 3CZLA 3DX8B 4Z7UB 4XZUA 1QYGH 1DVFD 5CINH 4XCNB 5IW6B 4YX2H 5L8KB 3BKJH 4GI9A 4MZIA 3Q2CA 1D5BB 3BAXA 3FH5A 5MP6L 3VFGL 1V05A 3DYOA 2EO1A 1T0PB 1BYPA 1KC5H 3IDIA 4AUYA 3LS4H 4X0KB 1RLWA 1NBYA 4L9LA 4QYOA 1R5WB 1LQSR 2ED8A 1TKWA 1VLXA 4JZNA 1CFVH 1D6VL 1F8TH 1HSBB 3AU1A 3H6JA 3PG2A 1DLFL 3GLAA 3ULAB 1JE6A 5EU4B 1BZDA 4A1RA 1SLXA 3L17A 3P77B 1CQKA 4JHBA 4UCFA 3V2AR 1AANA 3MJGX 2YWZA 1E65A 2A74A 3EBIA 1WVZA 3GM0A 3QZPA 4TVSa 3MOQA 4OQTL 4Q9QH 3WL9B 4FQXB 3FT1A 1I9EA 2PO6B 4RRPA 2Y23A 1BM3L 4MNGE 1PZ2A 1GS7A 2YC1A 4HT1H 2E7LA 1ONQB 3NAAL 4LVHB 1DSWA 1D9KB 4QUOA 3EHBB 4CSPA 1OHZA 3L08A 4JN1H 4PM1A 1B0WA 4OM1L 2EACA 2HG5B 2OI9B 2YBRB 1TU2A 3QQ3B 2XXFA 4FNQA 1JNHB 4MYPA 1L7IH 3CX5J 5C08D 1T83A 3IJYB 4F9PA 2AMUA 3HNTL 1EO8H 5BV7C 5FKAB 3G04A 3G7TA 4ZOEA 2IO5A 4HEMA 5D2NE 1IAOA 1FCGA 2R9HC 4FKKA 1NCBH 3PREA 4AW7A 2IADB 1MCIA 2AJUH 3HC4H 3HNVL 4TNFA 4ZPTA 5C0RH 2QL1A 3LDBB 5J6GB 5L9DL 4NO3A 2ICES 3U0WL 4LF3B 2OMTB 1S78C 5J89A 4LSTL 4CC0A 1NMAL 4KHTL 1DQQA 4F9PC 1QVOA 4POZD 2P26A 3ULUF 5I17B 1YYLL 3ULUL 4PJHA 1ZXQA 4DTGH 4OR1A 4H4NA 3NCFB 1BAFL 2A6DB 5TE6L 1TJGH 1IEAA 1A6UL 3EBAA 4OTXH 4ENZA 5GGQL 3VVVA 1BBJA 4PJCA 5DMIH 4XVOA 1G7HA 1HC1A 1U92B 1UM5L 4DN4H 1NBCA 4EE2A 2H3KA 4GKNA 4PAZA 2O5NA 4HGWA 2EDDA 3CX5K 3PGDB 2C34A 2P5EB 1XEDA 5EV7A 5DJ2B 3AJ7A 3NH7L 3ZX1A 5I0VA 3FXIC 3RNKA 1SJVA 3HBPA 3IXAA 4LSQH 4ODUA 3F7PC 1JYVA 1DBKL 4AZ8B 2BDNH 2R8SL 1KPUA 4FG6C 3EO9L 4HK3N 4KO6A 4HS6B 3CBRA 3BEWB 5DWUL 1MCRA 2ZT9C 5IROD 1FH2A 2FEEI 2IAMD 2AV1B 3EJCA 4K94H 5B4MC 1IX2A 2I27N 3UGUA 1P4LB 3ABKB 3CUPA 3F12A 2AEOA 2Y1YA 2BERA 3A5VA 2E9WA 4PWKA 2ICEB 3TFKD 1S9XA 4JRYA 3UJJL 2PWFA 1I7UB 5EORH 3VI3F 4ALAL 1BJ1H 5BCAA 3U9PH 4CNIA 3WNPA 3D3VB 4MCMA 1HH6A 4N5UA 4HUKB 2VM9A 3F3HA 4MAYD 4JFDA 5DC9B 4ZXBD 5HDBF 43C9B 3KYKH 3KLHC 2IPTL 3QORD 2H6PB 2CU9A 4PJDB 4RGNE 4FFWC 1RZPA 3WNKA 4PJ5D 3RIFF 1HYSD 4QF1B 4AIZB 2P4AB 2VDLH 2Z91B 1YAZA 4NC1C 1HXMA 3UYPB 2R4RL 3VFOB 5JQHC 4AXWB 3LQAC 4P3DA 1JPGB 3SPCA 1DBJL 5SV3A 1YEGL 1BDYA 3UTQA 1NIAA 3QQ4A 1V55B 1EAOA 1BPLB 4XP1H 4Z76A 1PAZA 2DQIL 3EYOB 5CMAA 5BRQA 3QDMD 4XP9H 1FFNA 3PL6B 4MJ6A 4F33A 1WUZA 1EBAA 3MRMA 4HULB 4WUUB 2X7LA 4HIJB 2BNQD 1HZHH 3T65A 1A6ZA 2VB5A 3AM8A 4HLZG 2WLZA 3RFZB 4OZHE 1QA9B 2W60B 2VDMH 3CFIC 4UZGA 5J6HA 3OB0H 5SV4A 3AXLA 1F4XL 3GPSA 1DJHA 2FATL 2LT9A 3IB4A 3CDYA 4L1TA 4H0GA 4D9RE 1ZT7A 4AIXA 4NQEA 2VRQA 3ML9A 1AG0A 3MRLB 3FF8A 5H2BB 1CVRA 3M1BA 3O3DB 3KW8A 4GRMA 2OZ4L 3ZKND 4OFVA 1P5UB 3DJZA 4YIQA 4PWFA 1AHMA 5HGHB 1TQTA 4ES8A 1NGYB 2NLJB 3HE7D 2JE8A 3PAYA 3ZT5A 4NQSB 1JTPA 2EDWA 2OCCB 3O6MH 2VITB 5CM1A 4QCIB 4YL9A 4CVZB 3PGCA 4YSTA 2UWEA 4K9JA 4YHNB 3S35L 2ERJB 5MEOB 4PGCA 1OCRB 2IVFC 3BIKB 3LRGA 2G9HA 5I30H 4ZW3A 5HYEA 3SPJA 3NJNA 3QUXA 3MODH 5AB0A 1IU1A 5GRVL 5F7FA 3KHOA 5CIPH 1IM3A 2GBVA 4JHZA 2EXYC 1LILA 2NY1D 1H0DA 2VCOA 4YXHL 5C9JA 1NFKA 3MTRA 5BS0E 5KYYB 1KCUH 5KYUB 2EYTA 3B2XA 3O0LA 1MFNA 3BVUA 4K9EC 4W9JC 2CR6A 1QLFA 1O6VA 5AW1B 4M5TA 3SE8L 1ZA3B 2VXVH 4M8QA 1CICA 1FN4A 3S36H 3LH8A 1V5JA 3N1MC 5LBSA 1W0VA 4HIQA 4G8IA 1BECA 4N3TA 1BV8A 4HK3J 4FADA 5BQ7A 3DJ9A 1JN6A 3CFMA 3SPVA 2K6WA 4X6EB 5CLWA 5FF6A 4A55A 4JJ5A 4QY8A 2IJ0C 3GMMB 4HCRL 3CDZA 3HZKB 1ERNA 3IAPA 4FXGB 4MB5A 2CLRA 4JKPL 1KLFA 1GJUA 4CKQA 2C4XA 4FLRA 4F57H 1ZE3C 4A7UA 4XN7A 4RRPM 1Z9MA 1SNRA 3HC3H 5TD4A 2Q8AL 4KJYA 3IVKA 4AQEB 5BZZA 3UADA 2B9AA 3D0VA 1FAIH 5ESQA 2QQKH 4F58L 2ZOOA 3KEDA 3QCVH 2D7OA 5KYWA 2HFFB 3P0YH 3P0VL 4E41A 1YQVL 3QUYB 3O4LE 1JGIA 5KTEH 2KUTA 4AQ1C 5LNEA 4X8GA 5AAMA 2Z7YA 4AVIA 4Q14A 2A4CA 3G6JE 4IS6A 3SDXE 4N90D 4ELKA 1V7NL 1SXBA 4S1QL 2B7DT 4HISA 4KRMB 3LEYH 5DMKB 1G7MB 5GSRB 4C56E 4UDUA 2VZTA 4YNYB 5ERWB 1FZMB 4C57C 1SZNA 2QDWA 4XX1G 1MJJB 3PP3K 4KTYA 1KTBA 5A2FA 4PJIB 3N0PB 1CXIA 1AR1C 3QA3A 5GZNC 5E6YA 4J23A 2O5XH 3G3LA 2UY6B 4OD3L 5E8NA 1MW3A 3NN8A 3OKNA 4KC3B 1M3IA 1ES0A 5DD3L 3GXMA 1QR1B 2P80D 4HQQL 4ZBJA 1AXTH 2P8MA 2AJVH 3HTLX 2JIXD 3ARBD 2OSLA 4ZO9A 5T1KA 4P49A 5I1DA 4LEXH 5GGUA 2XFXB 4JAMB 2CBPA 1KGCD 2OJEB 4D9LL 2QBWA 3MNWA 3Q9QA 5JW5A 4XN5A 5EIIG 2BO0A 3T5WA 1LLAA 3FONB 1ZLWK 1KELL 4H2AA 4R4BA 5IR1A 4LHUG 4M1GL 4OV6F 1OLZA 1UB5B 5JHDE 3BUQA 4RMUA 3B9DA 4N8VB 1OP5K 2D9CA 1DL7L 1NCCH 5IY5B 5DJCA 2DLIA 1FL5B 5FGSA 5ESAB 4XP4L 4DP0X 1JGVL 2BY1A 4NJ9H 4HJ0C 2F58L 3RAJL 2ESVE 2NX5E 4X99B 4XZUB 5TF1L 3OGCB 3OBAA 1Y18A 3RIKA 1RUPL 4ZTPH 4JM2D 5AVYB 5BOZG 1ZIBA 4QT5B 1CWVA 3GRWL 4RAVA 5IMKB 1FVDB 5MHSE 2VC2L 1BLNB 5CCGE 1RUAH 4WI0B 1XIWD 1YQ2A 5DHYA 1CGSH 4Z3HA 4M5YL 2VDNH 1QO3B 3UBHA 3WDHA 1A0QH 2J2ZA 4LHJB 1TKWB 4NP4L 1OSPL 4O9HH 4HZ1A 3DIFA 4BSWB 2BFGA 3K2MC 1S7QB 3U0TA 2WXMA 5GRVK 5IOPB 1BQLH 3K74B 4N0FB 2XXGA 4UOQA 4LCYB 3FUMA 4JG0L 5C0IA 3VXOA 5IT2H 6FABH 3KYOB 1E42A 3EF7A 4JDEB 4LLDA 4ORGB 4P0DA 2A74B 5K59F 4KXBA 4FOMA 4TRPL 2YN3A 3SBQA 2EE0A 2ZUUA 1J9RA 1KIUA 3NCMA 4HD9A 1DN0B 2BVQA 4M5ZL 4O5LH 5E9NA 4OW6A 1M71A 5DJDA 2GBTA 4F5CE 4PP1C 2FZ3A 4C4BA 5AEAA 5EIVA 5IIEB 4JR9L 5HDRA 1WG3A 4CGUB 2WNGA 2ICCA 3H3KA 1VEPA 4KK9D 4X42A 1ICTA 4MNGA 4WNJA 4TNEA 1K6QH 3ARRA 1XSKA 4DHLA 3ECWA 1IAOB 4A2MA 4R9HA 1YUHB 5IQ7L 3X13A 1LDPH 5B22A 4NO3B 5IW1A 3CVHA 1E9QA 1NLDH 1NGQH 4HCGA 4KH9A 4J3XA 1G0DA 1UXMA 4Y2DD 4OD1H 3MBEB 2PCFA 2YXVA 4Y4HB 3CD4A 3K81A 4FMVA 5D2NA 4P2YA 4EMZA 1IGIL 2WQAA 4JFZH 4PJHB 4Y5VB 3CSYB 1ASOA 4JVPA 4ZUVA 3IU3B 3KD4A 1W8OA 1PLGH 3CZEA 5F21B 2W9EH 3S34L 5IWLC 2ZOKA 3FO9A 1IEAB 4JVWA 4K94C 4PW4A 3FCBA 3UZQA 4TSBH 5CGYD 5D6DA 5IFHL 4TPRH 3QPKA 3AQZA 4Y88A 4Y8AA 3WHXA 1IGTB 1B0RA 4WUKH 1FL3B 4WU5A 4MMXA 1RUKL 3Q13A 3W0WB 3MJ7B 1JPTL 2NQDA 3QQ9D 2EO7A 2YMTA 3LS5H 3KL5A 3CZFA 3AMLA 3HB3D 3Q7JA 3UAJD 1NFDF 1DANT 1RJYB 3W2DH 1FI8C 5IFJA 4R3SB 3I9AA 5J7CC 5H37A 5HJGA 1IGJA 2WXNA 5IZ7A 1CDJA 4AYFA 1P1ZB 4JHAH 4YHKH 4AK2A 5E2WL 5ACZA 2MKLC 2VN6A 3RUGA 5A2CA 4HJSA 5A16A 4RRPG 3SOTA 3G5ZB 4PBDA 4HGKC 3HZVB 4JY6A 2CRMA 1RZJL 3CBKB 1IZJA 3F5WB 1M7UA 1JGDB 3D9AH 3MRKA 4NQDD 1XBRA 2WGXA 2F54D 1GGYA 1HAWA 2YD0A 4JY5L 4MQ7A 4YHZH 3WIHA 1PSKL 1KB5H 4XBPB 3L5HA 1RV6X 3OKKB 2LLGA 2JJSC 2OMVB 3FQUA 3I6KB 5TGBA 4CNIB 3AUWB 3VSQA 3BPCA 1HH6B 2J4WL 4GP8B 4Z7OE 1NFAA 2UZYA 1KCKA 3F85A 3MGOB 2X9XA 5CGMA 2VKWA 3E8VA 4GS7B 5ABAA 4NO5B 3IDNB 2A9NH 3APMA 2XTJE 4AK1A 4NOBA 5JOEA 3QEHA 1F3JA 2OCFD 5D7JD 1S9YA 2YRLA 1ZS8A 4AYGA 2ATPA 1CDIA 2FEJA 2NW3B 3QNZB 5CUSH 4BDVA 1G9EA 2DQFB 1NBVL 3S97C 4QOKD 4HWZA 3BKCH 1BOYA 1E9PB 1U6AH 5CZVH 5HHPB 2BRRH 3IE4A 2EUVA 1E50A 5F1NB 1NCJA 1QFPA 2AAVA 1DDHB 2VQ1B 2G3NA 3NIGE 5CN1A 2Q76A 2WWOA 4Y19B 3WI9A 3MNMA 3KWUA 4ETQB 4AQ8A 1YEJL 4PJ9A 2DQ6A 2GJJA 3Q8AA 3RGVC 4CJ0A 2DYRB 4RMTA 4F33B 3MLZL 5EU3B 5CIPA 3BUPA 3ILQC 4A7GF 5DMGD 5ANHA 4PV1C 3D0LA 4QTIH 4BK4A 1CF8H 5EU6D 2EILB 5E8EA 4DO6A 4AQ8C 2V5MA 5KVDH 4NO0D 1R3HB 2CO2A 3WFZA 5J6HB 4OZGB 3VH8G 1N18A 4BKLA 2K78A 1VF5C 2ZSVB 1KCRL 1JGEB 2HFGH 1TEGA 2AJSL 3Q2NA 2K8MA 1A64A 5CF3A 4XXCA 5BVJA 3VI3B 3D06A 2G3ZA 3RVVC 3DHJA 1AD0A 4Z7WE 1ASPA 4EI6A 1SJXA 1A1OA 1IKFL 3QNYA 5D1ZB 1FNAA 1ITBB 4HUMB 3Q8FA 1JK8B 3TH4T 1MXDA 1U3HA 1U41A 5HDBB 5TJWK 3MJ8A 3TA3C 3QG7L 1NCWH 5DD6B 5B3JF 3CGTA 4TN9A 4X2UA 2F7QA 3HNSH 4PGCB 3BPOB 3TH3T 4F7EA 2X4SA 4Z7NE 1I1FA 3OX8A 4PD4J 3F7KA 4QXWA 3FHEA 3QUXB 2JVUA 4FL4B 4ZMVA 3DOSB 4I0KA 4DF9A 4YAQB 5D5ME 2X4OA 1YN6B 1S46A 4MZ3A 3QWQB 3OKMB 2VLRE 4KNUA 4XOBA 3SDXF 2ZKHH 5AYUL 4HOZA 4G5ZH 1VPOL 1DFBL 3L3KA 4G9FD 4X4ME 4C58B 2HTKD 1OZTG 3QUZB 1KBKA 4P48A 4Z7QB 5GS1C 4Q7DA 4LNVA 2V3FA 1RU9L 3FO2A 3G5YB 5B1JC 4U1HB 5BS0A 4RFOL 2HT3D 3FO0L 4ODBD 1QZ1A 3IDJB 5TQ0L 3TYFB 1CICB 1EAJA 1EA9C 4H0LC 3WMSA 3PNRB 1R5IB 3ZYIA 2XIDA 4PRHB 2E6QA 2BNRB 4DPAX 4PTUA 3SO3C 2XZQL 5FF6B 4XNQA 5CEZD 1G84A 1R5VA 2DAVA 3I85A 1E28A 2FQGA 3HC0B 3MBWB 5CAYB 2E7BA 3MROA 4PD4K 3T08A 1DN2A 2QSQA 4KJYB 2DI7A 3NSJA 3IVKB 4P4RB 1SHWA 4Z3IA 4HDIA 3HAEB 1GMEA 2F7PA 2OZNA 2YQGA 3ECUA 5DDHA 3SZKC 3WXVL 2E7DA 5KYWB 3RZCC 4HWBL 3V0JA 5I6XC 1WP6A 3LN4A 4JCMA 4LAQH 4R8WH 2BSTA 5JTWA 2BOCA 4FNPA 4UQ2A 4B9IA 5B39A 1A9BB 5L4FA 4H88L 1XGYH 1XZ0B 3IS0X 3RPKA 2Z31C 5IHBA 4NN5C 5JUEH 4NKMA 1RFDL 1RAMA 2CRYA 3O6KL 2DKUA 4K71B 3BRFA 1EEQA 2HJFA 5HI4D 4FTDA 1F97A 2D03H 1DP0A 4HAGA 4IRSB 4LVOB 2V5TA 4TTDC 1V3MA 1TSHA 4C56A 1JPST 2ZJSL 4HHWA 2G2RA 2R2CA 2LLNA 4X6BB 4B7LA 4BCZA 5PAZA 1XSIA 2DIAA 3C60A 2DWEB 1UATA 2ZPKH 3QDJD 2EADA 3OKNB 4PW9A 4HIHA 3NA9H 1J9CT 3RU8H 3TOPA 2FH8A 1I1YB 3L81A 3O8XB 2P8MB 4HWUA 1K8DB 2XXCB 4UDTA 4O2FA 3T71A 3C60C 3G6AB 1MCPL 2AJYL 5JW5B 2BIPA 1WIPA 1EMTL 3SHSA 5F72S 5BMFL 4R4BB 4B97A 2SEBA 5IR1B 4KKCC 1WA1X 4M6AA 4XAWL 1A6TA 3KYNA 3ZQ9A 4XC3L 1B4TA 4YHOH 1ODUA 2WXKA 1K8IB 5JLZA 5D1QB 4AUUA 3EYFA 1I1AB 4JFQB 4MB3A 3V6OA 4U1JB 4Q9BA 1RPKA 5ALCL 4CKVX 2CNZA 1RIHH 3WFCH 2CCVA 5JXAH 4OCYL 1PQZB 1BMGA 4JKMA 1S9VA 5JHDA 2OW6A 4GRLB 4JPWH 5KVFL 3K6SA 3ESVF 4Z0XB 2VERN 2YUZA 3D4YA 3MRCB 3V6OC 1VSCA 4FTVD 5CJ8A 5HYFA 2XA8L 5D1XB 4K7FA 2ZUSA 1EVUA 1KN4L 3EFFB 2NX5A 2YEZB 1O6SA 2XQYA 1T66D 2JJUA 3CMOH 4PB0L 1HHHB 1WZ1H 2XVKA 3S3BB 1XF5A 3BEVA 2EH8L 1TOXA 4DIXA 2OL3A 4DEWA 4LQ1A 3VWJB 3AT0A 2B59B 3EDEA 4M62L 9CGTA 1M9WA 1AE6L 4FQHB 1T7XA 1GHFL 1XZWA 3KBPA 2JI3A 3TCTA 4LQFH 4CMMA 1Z5LA 3WLWC 1VCAA 4WWNA 4M7KH 4FQQA 5C0IB 1OAXL 3VXOB 4L1BA 3EOAB 4IMKA 3LKSB 1MI5E 3GHBL 1YVLA 1YY8A 3FO1A 5EOQH 3ZKXC 4M6ML 5BVPH 2G4EA 2AABH 2QHRL 3TBWA 2XWTA 1UWYA 5INDB 5T5FA 3ZZQA 2IBZY 2R2HB 4IMKC 5ID0B 1MFEH 3A4DA 3KVDD 4PJEA 5K1VA 5I5MA 1U8IB 4XO3A 3ARQA 5I8OL 4OJYA 1OAQH 5CILL 3K5SA 1YRKA 2APSA 4KH2A 5ISZD 2A73A 4UIMB 4BZ2A 4F5CA 5I16B 5JMRA 2X9WA 3GRGA 3QR1A 7PAZA 3ZRSA 1BZ9A 1I9JH 3FZUD 1T0OA 4DGUA 3RILA 3TZVA 1H8SA 4DEPB 1HE8A 1IC4H 1JUFB 2JLLA 1J5IA 5IW1B 3CVHB 1E9QB 3INUL 3QJHA 4BEIA 3U4AA 3AG2B 3E0GA 2XQBL 3V52L 1ML0A 3BX7C 1ZMYA 2P24A 3T0EC 1J0IA 3BAEH 4I8DA 1KCSL 1G9NH 3QI9B 3WKPA 3IMBA 1SDAB 3FOMB 1JRHL 3B1TA 3LNHA 3HC2A 4A6YL 3UZQB 2Y07H 1WYJA 3NFSL 3G6DH 1AGFA 3BPNC 1QPKA 4IOSD 3T1WA 1LK3H 3LIZL 1UXWA 5JA8B 4NS0A 3BDYL 4MMXB 5CBAA 3TO2A 1YUKB 2LU3A 4NWTL 3MMEA 4ANKA 5CP3A 4E9WA 1OGAD 3IGUA 5D7KD 3CZFB 3WEOA 1CDBA 3VJ6A 4U1IB 1J1PL 1OE1A 3L2MA 1DVSA 4PWHA 1RPUA 1U3NA 4MSWB 3UBGA 3QJFB 2EUZA 2GI7A 4GXVH 4JRXE 1J18A 3RWDB 2HP4A 4TNVF 4OB5H 4ZTEA 5I2IB 4LSDA 3U0PB 4Q6KA 1IAII 3QZLA 5JORA 5KG9A 2KBGA 5DEFB 5HD8D 4PJFF 4UNUA 3GZPA 1NDMA 2H1PH 4NOFA 2NNAA 5D2LE 5F96L 4PRAB 4G6JH 4P9MH 3KLAB 3DO4A 3UTPD 5H94A 5HVHC 3QFJD 4A38A 8FABB 1S8DA 3VD0A 2VNCA 4TSCL 4MLSA 2ZSWB 1RXLA 1LK2A 3PHOA 3WY2A 4ISVA 4QRRA 3NIFF 3MGTB 5C09D 2XWXA 4YO0A 1KYDA 3WDIA 4FEIA 4WEUD 3DSFH 1KIPB 4U1LB 1IJNA 2R1WB 5A7EA 1UZ6F 15C8L 3SCMA 3VXSE 5F8QC 1HINH 1IC5L 2WCGA 4LOUD 3SE3A 5HDQL 5AAWA 1OAUL 3FUHA 3QPXH 1Y1UA 2I5YH 1FNLA 2P46B 4IM8A 5C6TH 1OCZB 3RGHA 1X7QB 2C9SA 1D5RA 1CLOH 3SCMC 4L3EA 5KZCD 3MLPA 4ZOCA 3SE3C 3B7SA 3L4VA 2ZKXA 3UIYA 5KEZA 3C6LD 4RGNB 4EN3D 4AEIH 5LWYH 4QHKJ 3O3BA 1QRNA 4FXKA 4QRPE 4YBQC 1A4CA 3ZE2E 3QCTL 1UA6L 4NPYA 2NYKA 1AHWB 3LHPL 4KQ3L 5GJSH 3CVCA 1BMWA 2VUOA 3RKDC 1KT2A 1BQHA 1RLBA 1NFDB 3DGDA 3LZNA 1F02I 4DGIH 1XMWA 1T03L 4MCZB 3DJRA 4P46D 4KKLC 1F4YL 4XPGL 3QXDA 2F53B 5TPWL 4E0RA 3RDJA 4M7JL 1ZLSL 5C71A 1ZT4B 3FQNA 5GPRA 3MRHA 3FB8B 4KK6C 1S7UB 1WFOA 4X5RA 1ZVSA 3LAFA 4O02L 1QLEH 4X9GA 4UYQA 3UTTB 1A6AB 1JVKA 1VGKB 4OZHB 2YMOA 3VSUA 2EJ1A 3VXMB 4PREB 1PF3A 5C0BE 5TDOA 2NY2D 4MBRA 1WO2A 4I1RA 4KRPB 4ODWB 4OBSA 4H8VA 1WLHA 1HDMB 4YDIH 3VG0L 1W72L 2YGQA 1YEDA 2NSMA 3ULVD 4BRVA 3FUJA 4ZUWA 1UURA 3H9HA 1MQKL 3A4AA 3JWNH 4YC2B 3WUWB 4Z7WA 3US0A 4IU3B 3VXRE 2H8PB 3LH2L 3MZGB 3V5HB 3RY4A 2WM0A 4YZFF 4NZDA 3OPUA 1D9KC 1DQLH 3OR6A 1FJ1A 2IWKA 5D7LD 3BWAB 3L3KB 2GSIA 5F88A 1P53A 4JO5A 4ZUUB 3M07A 1QWUA 3T8VA 4DPRA 5T33L 4GW5B 5DJYA 4B5EA 1T1YA 5D5MA 4WFEE 3DA0A 1QKZL 5E24E 3PHQA 4JDVA 3EYVB 1KB3A 2EIKB 1RJLB 1WBYB 4X4MA 1RZ8A 3FQXB 1E5UI 3LDBC 3M46A 3VI4F 1J05B 5HY9A 5HXMA 1MVUA 5AALA 5JDSB 5GXBB 1GZQB 1P1VA 5IB4B 2YQBA 4W6YB 4F24A 4F8LA 5EHFA 1SBSL 1WBXA 1HIMH 2VDOH 1D7FA 3GSNL 4AGNA 3ZDXF 3PWLB 1IBZA 4TNVK 3B1UA 3PUUA 5H4YA 4HOWA 4C47A 2J43A 2OCJA 3NGBB 2DQGH 1I4FA 1G7JB 4FFZH 4YEEA 3OSVA 3HN8A 1QSFA 5I15L 4LSPH 2O30A 4BA0A 2ZG1A 3CLEL 3WSQL 1NMBH 4U1KA 5F0JB 2V7HA 2V2WA 2Z6FA 1CD9B 4UQ2B 1NAML 2XU9A 5IESL 3WN5B 2H3NB 3BP6B 3FU3A 5DGQA 3FTGA 1IILE 2F18A 2NY6D 3O4LB 3VFGH 5T1DL 1K3ZA 5FYKD 1IB5A 1Q94B 4WRLA 4NRYA 4BFKA 2Y7MA 2NCMA 5DUBB 3I9GL 2OSYA 4ZI8A 5IQ9B 3ERXA 3FCUB 3G6JB 3LZFL 5JIHA 3SDXB 2OYKA 4BQ9A 5GIRB 2AEQL 3O41A 3FTXA 4X9HA 5GS0H 3VD7A 1HFUA 4A63A 4MJ5A 3W37A 4YPJA 3HCVB 1IKNA 1DLFH 2FX7L 3FUIA 4XNBA 1BFOB 4AY0A 4S1RL 2YHGA 3NK3A 3IETB 3ARED 1QD0A 3ZVVA 2E8YA 1U95B 1I3GL 1NAKL 1HHKA 2OTWB 3AAZA 1QWNA 3A67L 1J12A 2G5UA 2D4FA 4OQTH 2XN2A 4AM0Q 4QAWA 1BVKA 1BM3H 4UU9A 2XETA 3NAAH 4JFOA 3U25A 3VXQA 1HHGB 4KXCA 2VM3A 4PN6A 3RJDA 5IK3B 3FB7B 5DZLA 2VH5L 1R3JB 2BVYA 5F7KC 4ZZFA 3PF2A 2ENYA 3HNTH 2HFTA 1HI6B 3HVNA 5AD0A 3BAJA 1AQDA 3HNVH 4WENB 5HJ3A 3TNMB 4OVVA 2VL4A 3U83A 3U0WH 4EBQL 1NMAH 5ICYA 3R19A 5B39G 3VRIB 3PL6C 2XWBB 4DKAA 1Q9WB 1UGNA 4UAOB 3VNZA 1H3UA 1YYLH 3TS8A 4NM4L 3MBXL 3ULUH 2ESVB 2NX5B 3WD5L 2VW6A 2MHAB 2CMRL 4CADA 1BAFH 4NKDA 3VSTA 3O4OC 5TE6H 3W82A 4BZ1A 1A6UH 2FE0A 1HE7A 1U3JA 1E8ZA 1U8QA 3JV4A 1E27B 3QZWB 5GGQH 5FA4A 1CS6A 3FQ4A 1OAKL 1UM5H 2B16A 4QHUA 3GTTA 5KYNA 1BAWA 1JF1B 5BQDA 2Y7QB 4PCKA 3GZOA 3MRFA 1XX9C 2JK5B 3NH7H 3OPZH 4APQA 3ATDA 4RFEA 5KSVB 1PCXA 2ZNXA 4BM7A 1J88A 1P5UC 1VA9A 5IF0B 1JDDA 3PDGA 1DBKH 5AOKA 3GSWA 3CV5A 2R8SH 1G9NC 1WFNA 3EO9H 1B2WL 3P4NB 2XWTB 1VKXA 2APBA 1MI5A 3MXWH 5DWUH 4KI5D 3P02A 1OQXA 3BZFA 1C7SA 4RH4A 1JIBA 2PR9A 4F27A 3WTWA 2R1XA 2ICWJ 4WO4D 3V0EA 1NCIA 3VO0A 2WZPD 5D2LF 3TZVB 4FI6A 2H26B 4WHYG 3ZYZA 2JKXA 1JZDC 5FPIA 2G3XA 2QDVA 4KK8D 3DV4B 4Q52A 5FO8A 4RMWA 4MTMA 5TDPA 2WWKO 4UILL 1RMFL 2IQ9L 3E1ZA 3ZR6A 5DT1L 4ZMTA 1LE9B 3OJDA 4AYEC 2OAAA 3QIWA 4TUOA 2IPTH 2EICA 3OKLB 2HX9A 4DZBA 4P23D 4P05A 1QRKA 2VJ0A 2ZOLB 4PRID 5FV1L 5LN8A 3LXUX 1QSVA 2XQYG 4H0IA 4U6HB 1KPVB 3M86A 1AKJA 4XNMB 4FNUA 1I8AA 5IVXA 2IWFA 4GKLA 5KN5B 4HPOL 2R4RH 4WHCA 3VYNA 2ADGA 3K8KA 5T5NG 5L4JA 1F18A 3NCYS 5SWZE 3EIFA 5LJYH 2XA3A 4RVBA 1DBJH 1YEGH 2IAND 3UPRB 5DJ8A 1ZLWH 2DQIH 2P3YA 1PKQE 2EXSA 1RK1A 4M00A 3ZO9A 4D7BA 1K2DA 3BXNB 1Z2KA 5A2JH 2VIRB 4B0MM 1AFVH 1LO5A 1OP5H 3VCLA 2OMNA 3QC5X 5DRZA 1AYRA 2GJZA 4WNQB 1FL6B 4QHMA 1F4XH 3JWDL 1SN2A 4MX7A 2HT2C 4PLJC 3REVB 4AH2B 4DQOL 2FATH 4HUNB 4X6CF 5DSCA 2NYYC 3KXFD 3B5TA 4U6VL 3SKJL 2VLLA 3DIDA 2BS71 4CUCA 2PW2A 2BVOB 1HILB 3JSSA 2OZ4H 4JW3A 5HGDB 5IB3A 3ZDYE 2JXMA 4BFRA 2W0PA 1MZZA 1GYWA 2HXAA 4HJ1A 1UT2A 1UH3A 4B9KC 3PU7A 4JS7A 5E2UL 3S35H 2XRAL 2J8UF 2GUOB 3MRBB 4Z7OB 4NI6A 5IMMA 2IXQA 1M53A 1QSEE 1YMMD 5HPOA 3VXSA 3GI8H 1J8HA 1E3XA 2G60H 5CNHA 2XTJB 2ZYSA 3F6JA 2D7PA 4G43A 2NMSA 4NQXB 4H26B 4OBRA 4Z77A 1DANU 4Q2ZA 4DSYA 2YRZA 1EGJL 2FJUB 3NCJL 3MRJB 4P07A 4B9CA 3BWZA 1MLCA 1T5WB 1VACA 2EIEA 5FA3B 3TN0A 3ULSB 5E8DL 3RTLA 2HX7A 3P3SA 1WJ3A 1A14L 1FFOB 4RQQA 1O0VA 3SE8H 1FA4A 1N2RB 3JWNC 1CGYA 3ZK0A 3CQPA 3MSPA 2AEPL 4A7TA 4YHLL 5JA9A 2UX7A 3AQXA 5LAXA 2KHAA 3TN0C 3K6DA 2X1XR 1IGYB 1TETL 4PJFB 1A7PL 5F7AA 4KK5D 2E59A 2XN9A 2FBJL 4HCRH 4N87A 2AI0L 1FC2D 1I7RB 4MWFB 4DUWA 2OQJA 1LVEA 2ADJA 4JKPH 4QO1A 3A6CL 3MR9A 5ANME 4AJYV 4LE8A 3GSVB 4J7RA 2P28B 5L7XL 1OGTB 2WXIA 3N06B 2Q8AH 3IMVA 4BCXA 1GCFA 4DZ8A 3IFLL 2RD0A 2R69L 1S5IH 3TPUB 4WI4A 1Z66A 4C4KT 2X40A 4F58H 2IBGA 1G6VK 2V2XA 3LOWA 1CFSA 2HX8A 3P0VH 1S5HB 5J3HD 2J57A 4PLKC 5C0BA 2Z92B 1YQVH 1PLAA 2QKSA 1FNEB 3QUMA 5IMOA 2OMYB 3T09A 4W70A 3GXFA 2ZWZA 3VFNA 4Z7WB 1JZHA 2DQDL 2BY3A 2OXHA 2B20A 3S3JA 5GS3A 1WS8A 3MXVL 1NPUA 1V7NH 4S1QH 4WI9A 4FQPA 1MCFA 1OV8A 4LP8A 1RULL 4FFZA 1EANA 3MRQA 1VHPA 5CLTA 3OZKA 4RZCB 4F7PA 1TCMA 3JT2A 1U8LA 2ADIB 3VXRA 3ZU8A 4Z7NB 1KGXA 4ODSL 4MCYA 5SX4H 1FBIH 5FFLA 4AL8L 3EO1B 1BIIA 3H42L 2X4TA 1INQB 4GG6E 5FIEA 5D5MB 3MV7D 2ZCLL 3BZ4B 4OD3H 1YNKL 2VLRB 3F05A 2QMKA 3ARFA 5DD3H 5SX4I 1N59A 2CLVA 2CDGA 1D5ZA 4HQQH 4YDLB 5FO2A 1NC2A 3PFUA 4Y4KD 1E4XL 3MBEC 2YSTA 5E6IA 2YPLD 4W9CC 4NFBA 4O02B 3BCFA 4Y5VC 2COVD 5MERB 3ARFC 3ZHDA 4LLUA 2D7TL 1F4WL 2BS9A 5DRNB 5K9OA 1VESA 5DXWA 1UB6B 1H3WM 4HKBA 25C8L 1JK9A 4XNYH 5C3LD 1I85A 4MS8D 4X98A 1KTRL 2C1OB 1DQDL 1DL7H 3QYMA 1W72B 5I8CA 4OQTA 5AW8B 3VGDA 3KJ4C 3W39A 4OKVB 5CKGA 1JWMB 3FU5A 1JGVH 2J6WA 1I85C 1MDAA 3L7FB 5EOTB 2F58H 3OHXB 3RAJH 3I3DA 5HPMA 4J39A 4HK0A 5HI5C 1MJUL 5TF1H 4NNXB 1A6VL 3GFUA 2CGRL 4LHUD 3GRWH 4NPKA 2VAJA 4QRTA 4S0SD 3TL5A 2QSTA 2QZ5A 2ETWA 1HN1A 1KIRB 4QXTB 2VC2H 4WWKD 2HTLD 5C08E 1DHKA 2O5YL 4M5YH 4FS0A 4NCC1 4MJ5B 4U1NB 1OSPH 4QRQB 3ZKQD 1QFHA 3VFRB 3FOLB 4TS6A 3RWJA 1MCOL 1TEYA 2Q3AA 3MV9A 1G7LB 4JG0H 6TAAA 5HBBA 2W0FB 5AZ2L 4YGVA 1N6QH 4G72B 3VI4B 1OANA 3KEHA 4JUSA 5EOCL 5DS1A 4NDMA 1K85A 3WEMA 5E8OB 3QIUA 3QNFA 4TRPH 3VFVB 1EK3A 3GSNB 3W1ZA 3ULUC 4J6RL 5CD5D 4YLQT 4E5XB 1SF5A 2JB5L 1UQSB 1ITCA 1W0YT 4LCIL 5KSBF 4Q8BA 2R51A 4YDMA 3KPPB 3A3YB 4JR9H 4O2EB 1GA2A 2BXYA 5DRXA 4EO5A 2PXYB 1SOSA 1OGSA 1T0MA 2HRPL 4GUPA 2NY3B 1ZTXL 3KNBA 5IQNA 2Q7YB 2C8NA 4I2XE 3I75B 5E4EC 5GGTL 5I5IA 4GAGL 5CEXA 2HA1A 2FGWL 1XF2A 2YPKB 2DQCH 4X0NA 1FFQA 1IGIH 3FU7B 1HX0A 3VA2C 2QVIA 4HU8A 2Y24A 1OT1A 5ADOL 4Y2OB 2MCPL 4FZEL 2ICWB 5IJVA 3VGAC 4WTQA 1GW0A 5M95B 5ITFB 5IFHH 3LXAA 2IDQA 2KZKA 2WIMA 4DKTA 3QO0B 4IIZA 1H3PL 1RUKH 3STLA 1SOKA 4MNQE 2CNYA 1JPTH 1DVTA 1U91B 5E00A 2WVSA 3RFRA 4ALAC 5HVWA 4GINA 1E2ZA 5A6IA 4APQB 1U8MB 2KZBA 3RURA 5I6MA 3S2CA 1G5AA 4NBYB 5K39B 2PTUA 4X6DF 2DTSA 5KSAA 1T21B 3SODB 2P8LA 2YIHA 2BCKA 5LB1A 4AJVA 4HWEL 5JNYB 3EFDL 1OKEA 2CA4A 4FYRA 1SOXA 5DEZA 5J12B 3D2TA 2F74A 3QRGL 4PJ5E 5E2WH 3FNKA 3SKMA 4FX5A 1NPNA 4MLIA 3ZQWA 2J7LA 2PTTB 4XH2B 5KSAC 4NB7A 1KJ2L 3QNXA 4I1PA 5IJDC 3LEVL 5FGBA 2BMKA 3C9NB 1PAMA 4OLYL 2R1YA 2PN5A 4JY5H 2DIJA 4NRZA 2Y5TA 1PSKH 3POCA 2YAOA 1CBVL 3O0RL 1TQBB 1QR4A 3EOTH 2X70A 1R4XA 2J4WH 2N0MA 5FGBC 1IV8A 2CCWA 2HVKA 2KI6A 3QDME 3HW7A 3RNQB 3V55A 2C9PA 4GAYA 1C8PA 2NXZC 3OJDB 2BNQE 4TUOB 1RJZA 4JDTL 4JKLA 5EOCJ 3GSUA 2R9HD 1E4WH 4PP2B 1NBVH 2OZ4A 4CJ1A 1S78D 3OAYH 2UZXA 3T8XB 3IDMB 2YN5A 5K5YA 3QE5A 3FH8A 3VGEA 5JXEC 1G7PA 3HFMH 3N85L 2DPKA 2ADGB 3FB6A 4X5LA 1KXTB 5EU7E 4HPYL 1KYFA 2JKNA 4G8GD 1I8KB 5DFVC 4G3YL 3UL4A 4GT7A 5L0QB 4M4RA 1YEJH 5MEQB 4HS8L 3Q2LA 2DWTA 3TTYA 3MLZH 4H2CA 3K6IA 1XH3B 3W9DB 4GMTL 4M7LL 4D0CB 2WTRA 1H15B 3S0PA 1KXQE 2VAAA 3MO1B 4JRXB 1KTLB 2ZUWA 4EI5B 1JPEA 1RVFL 5HHMD 2J5WA 3HZMB 3FCTB 2HRHA 2GJZB 2K6YA 1EXUA 1M4KA 4KNTA 2D7MA 2B1HL 3UTSB 4K71C 4JFXA 5E5MA 3DX1A 1KCRH 3O9WA 5DSCB 4PJBE 1EZUA 4IRSC 4FG6D 2AJSH 4LVOC 5F3BB 1AQHA 5D2LB 3MLTA 2VKXA 1UYWL 1P7KB 1PFOA 2PW2B 3VMPA 3H2PA 4S1SL 2FIRT 5E99L 3WEAA 1UD3A 2V7NA 1DSYA 1IKFH 1XO8A 2OMWA 4NT6A 3O9WC 3PWUB 5B4MD 1DTUA 4DCQB 4ODTH 3QG7H 1EHLL 1CBJA 1B6DA 3L1OL 3LVEA 2GYSA 2PCYA 4PVMA 2AEIT 4YSRA 4PJ8A 2DEYX 4U6XA 4OLWL 1PZ3A 1J5OL 2BZCA 1JHTA 2GT9B 5C0AA 4IGBB 2YJLA 4GH7B 4JRYD 5DZOA 5AYUH 3VDBA 3KLHD 1VPOH 1DFBH 1WUNT 5D1QC 4FFWD 1K4DA 4V2BA 4FZ8L 5KSUB 5C97A 2CUMA 3LRHA 2XZZA 1VJSA 4WEBL 2FBRA 4QRPB 4RFOH 3FO0H 4JDZA 4RQQB 5G55A 1N8OE 3UG4A 1ZHNA 2GK0B 4GRLC 4HUUA 4ZO8A 5GRUL 4NYLA 5AOLA 4GG6F 1DO6A 3I2CH 3BW9A 2ROYA 4N90E 3GMOB 1OHQA 5D72L 2C1PA 4Y4FA 2XZQH 3DDGA 5DJZB 5IMLB 3UTZA 1DQJB 2MCG1 5I0DA 1CLYL 3ALPA 5F2FA 5HDWA 5L8JB 5D4QA 4X6CB 3TX4A 4XXWA 3RTQA 1A3RL 4Y4FC 3M88A 3L3DB 1N6UA 2Z7ZA 5DK0B 4D3CL 1YDPA 2CG9X 4LSRL 3WXVH 5DVMA 4D0BB 2DJ4A 1QQDA 2CBQA 3QWNA 4J2XA 4HH8A 1ORSB 4EZMA 4G2AA 4OD2A 5IMOB 2VDPB 1WBZB 2ZAGA 3SDCA 4L18A 5IM7B 1C16A 4QNPE 4YLBA 1DJXA 3CN0A 2J8UB 1KGCE 3N41F 4H88H 3VXUA 1CXKA 5I71B 1F1DA 1SLVA 2G0KA 1T1XB 2DLGA 1RFDH 4N8VG 3SDCC 5LXGL 4F7PB 3O6KH 2QTVA 3PWVA 5C0FB 1W9XA 5HYJD 1XCTB 2CQVA 4MCYB 4NENB 3S4SA 3UBXI 1VADB 2JMRA 2Z8SA 1C5DA 1KLGB 2O6DA 4MKTA 3TIEB 2ZJSH 3JWNG 3GLZA 2Z1PA 4JFYA 1NDTA 3GRWA 3THML 1MCSA 4DEPC 1PJ9A 2EXYD 4YHPB 3SJVA 1UT1A 4YHYB 3VDCA 2CUAA 3MACL 1MCPH 2GG1A 5A1AA 2AJYH 2XKUA 1IM3D 3I74A 3EXLA 1DVFA 4HV8A 5IOKA 3LZPA 5BMFH 1H6TA 3BAWA 3MV8A 3WTUA 4YQXL 3VFPA 4XAWH 4XC3H 2WCPA 3MNVA 5CZKA 3OVUB 4I5BA 4LLYA 2Z4TA 2DLFL 1LEKB 4Y16B 2J44A 1RI8A 4PPTA 4WI2A 5ALCH 4R7LA 1OB1B 2ZCZA 3C09B 1MFBL 4DERA 3X3GL 4YS4A 3PV6A 5DYOB 4NLHA 5JHAA 3BGFB 5KVFH 4HK0B 2Y6SC 1BQRA 3LSOB 1YJDL 2ARJB 3RVTC 5EN2A 4GXFA 2PPFA 4M6OL 2JKLA 2XA8H 1DBAL 1B6UA 1R47A 1XV8A 3CN1A 2DZEA 1ACXA 1KCVL 3LRSA 4QRTB 3TJHC 1U4EA 3BQUC 1KN4H 2Y2WA 2AXHA 4YOKA 1UJTA 4I18B 1SXNA 1EFXA 1D7CA 2EH8H 5E0QA 3VTAA 2V4LA 4DP5X 3KLQA 1XD1A 4M62H 1CFTB 4FNSA 3G08A 4FNTA 1R17A 4UV4L 3QBTB 4O51A 3PJSA 3RWJB 4GKZB 3IJEB 1ZT1B 5DGRA 4KDVA 4HSAC 2QADC 3CN3A 1OAXH 1AZCA 4WU7A 2Q6WA 1ETA1 3GHBH 3Q3GB 4QKTA 1T7VA 5E0FA 3WIFA 4M6MH 1WC7B 1AR1D 1W0WA 5GZND 3BIBX 3JYCA 2DYSB 2QHRH 4BFBD 1JVLA 1PJWA 2YA2A 3D39B 3NCBB 3O3UN 5CXPA 1LQBC 5E94B 5LDUA 4KQ0A 3FUDA 2R0WL 5T1LB 4QTFA 5I8OH 3BP5A 8CGTA 4WEMB 1IUZA 2H7WA 4JO2L 1N5AB 4H5SA 1T0MB 4YDKL 3U6RA 2WBJA 1T3FA 4HJTA 3N91A 3KPMA 3KBFA 1FGVL 3R06B 1AHWC 4QHKI 3Q6FB 2FLBT 2EIJB 5T1KD 3INUH 1GYCA 1H3VA 5EC2B 1H9DA 2XQBH 3V52H 2WBJC 5I6PA 3VFWB 3HVDA 4PG2A 4UM9D 4L8BA 1DVZA 4KAQL 2WKGA 5KWYC 3RKPA 1KCSH 4KKBC 4WI5A 4N8UA 4ZW8A 4RGMB 1JRHH 4A6YH 2XPZA 1NINA 2VMFA 3CFBB 4HJ0D 4QLRA 1PG7W 3ZTCC 5I1AA 1RZJC 2EXTA 3NFSH 1VGEL 3EJRA 3OKOA 4NQDE 2PWEA 3ZBMA 1NC4D 5MENB 1SQ2N 5AG8A 2F54E 3LIZH 2ISDA 4QRUB 5IROA 1X5ZA 3BDYH 2C9RA 2Q20A 2IAMA 3C2AH 4NWTH 2ZG2A 3OAZK 4FRWA 5CR1A 4KRPC 1B90A 3DSNB 3L7EB 3D18A 4XNAA 3K71A 5F7UA 1J1PH 2Z8VC 5FCUL 3ZKMC 5IVZB 2EC9T 4FHBD 1VFMA 4BCYA 1E6OL 3KWVA 3RWCA 5HYIA 2P8LB 3KGTA 4ZFOA 3GWJA 4IBYA 3QB7C 3K72B 1J8RA 2HWZL 2CKBB 4JPIB 5E51A 3MCYA 3SKMB 1NEPA 4D7PA 4NX0A 4FFVC 4XPTL 4ZXBA 2EIZB 4TVPL 5DJ0B 2ATKA 5C6PB 5DHDA 4QOKE 1A5FL 3QORA 4RMBA 5F96H 1ZV2A 5DEGA 5B38A 5IV2A 5GZOC 5DJAB 2GI0A 4MMYA 4MA3A 4PJ5A 4UQEA 5CP7B 5AVXB 2C3VA 3BZDA 4TSCH 4NRZB 1HXYB 5FO7B 4G6AC 5I73B 1D5XA 4LMQE 5C0GA 2P9RA 1SJMA 1FO0L 3GNML 4I9XA 4OJDH 4A7GA 2CAKA 3ESPA 4PP1D 2MEJB 1UACH 4FG2A 2Y25A 2VXQL 3ZSTA 1LP9F 2HVKB 1ZHLB 2V2TB 15C8H 1KYOJ 3PJNA 3OKEB 2EVFA 1ETZA 4I0PC 1IC5H 1Z9LA 5HDQH 4DW2L 1X5LA 4F8QA 1NFIA 5B3NA 5EU6E 1OAUH 1UENA 1BF8A 1M1XA 4FD0A 3BE1L 3VFMB 5I19H 4XBGA 3HPLA 4KMLB 4YJZL 3DX6A 2X53A 4RDQG 3SOBL 1H6EA 1ZGLP 3EH5B 3GIVA 4N85A 3MLYL 2E86A 3X1GA 1UXSB 4BXVA 3TBSA 4G7SB 3SDDB 3B5HA 1UUSA 1G7PB 3QH3A 4IU2A 1X5GA 1QP1A 5DHXB 2ZUTA 3FB6B 2XBDA 3DOIA 5ALBL 3QCTH 1UA6H 4KQ3H 4Q56A 5CWSA 3STZA 3NGBC 2H0JA 1JXGA 2JQZA 3ZIYA 3QARA 3WMPA 4JKWA 1NGZB 2PYFA 3T77A 2V3DA 3L2NA 2JKJA 3GIZL 4Y1AD 2AKRA 3RA7L 4BK5C 4XPGH 1F4YH 5SWZB 2X88A 4GYBA 5ECGA 2IH3B 5TPWH 5JPMB 3DXAD 1ZVHA 4M7JH 4Y9EA 1KYOK 1ZLSH 3WN5C 5L2KB 1PKQB 4GSDL 4I3SL 1GIGL 5ID1B 4G7RB 4JFXB 4WK2B 3FQ2A 2EDJA 3VD2A 3GXTA 4HS3A 3KPTA 3FW6A