1L9SA

Crystal structure of the i257t variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLTGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA02
1WA0X 1KDIA 4GP4B 1KBWA 3NJFA 1JZGA 3FYEB 5B1JC 4KNTA 4DP2X 2XUWA 4N8UA 1MDAA 1IBYA 2AVFA 1E67A 2LLNA 2P80A 2I7SA 1ZV2A 1ET8A 4HALA 1AZNA 1NPJA 3QJUB 1JZIA 2VW4A 1BXAA 1KCBA 3IBOA 2XXGA 4NERA 1OCCB 2P80D 1JXDA 1BAWA 5B3SB 3WNJA 4NAJA 1W6LA 4KOBA 1DYZA 3ABKB 4HAKA 1AZUA 2FJSA 1A4AA 2Q5BA 5TK4A 2HX8A 1JOIA 3S8FB 1V54B 1J9TA 3RYMA 1WAEA 1BQ5A 1JERA 1KV7A 2RACA 3NSFA 3ASOB 1R1CA 3UAEA 4AKPA 3IEAA 2J5WA 2PPAA 4YSTA 2AFNA 2B08A 4QKTA 3WI9A 1JZFA 1RCYA 1AS8A 3QJSB 5B7FA 2GSMB 4YSDA 5B7MA 2QPEB 3D12B 3TBCA 4JHVA 1BXVA 1ETJA 7PAZA 2FT6A 4BWWA 3UACA 4E9SA 2H3XC 1PF3A 5B1BB 3FSVA 4YL4A 2N0MA 2XU9A 3FPXA 3AW5A 1TEFA 4A2FA 4YSEA 3IE9A 3QQXA 4A68A 2YXWA 4PCYA 2H5UA 1J9QA 3WNIA 4G71B 2PP9A 1SDDA 1E65A 4KO9A 8PAZA 2IAAC 4E9VA 4E9QA 2IDTA 1JZEA 1ID2A 4HHGA 4DPBX 1QHQA 4DP7X 4YSRA 1AANA 2DWTA 2DYSB 1BEXA 2PCFA 3FSZA 3NJNA 1NIDA 2BO0A 2GHZA 4K9JA 3NP3A 4GY4A 3FQYA 2OJ1A 4HIPA 2HX9A 2QPDB 2JKWA 5F7AA 4A2HA 1GYCA 3TASA 4BK5C 4BXVA 3FQ1A 3SBQA 2E86A 3SBPA 2UXVA 3AG4B 2EIJB 2HRGA 3H4HA 4DP6X 5B1JA 2EIKB 1A3ZA 4UANA 1AIZA 3EF4A 4MFHA 3FU9A 1NDTA 2Y1AA 5F7BA 5B7EA 4E9WA 3JTBA 2GC7C 2MTAA 1OE3A 2PPCA 4G7RB 1CYXA 2HZHA 4A2DA 2FTAA 2BWIA 3T9WA 3NJGA 2Y69B 2DV6A 2UX6A 3NJHA 2GIMA 3C75A 5IY5B 4BDVB 1J5CA 2FQFA 4TXVB 1VLXA 1PLAA 2DWSA 3OQRA 2I7OA 3TA4D 2YAOA 3V9EA 5I28A 2AZAA 1DZ0A 3OD3A 1AG0A 4HCFA 2ZWNA 2BWDA 1A65A 3AY2A 2H47C 2BP0B 3ABMB 2IH8A 1ASOA 1KDJA 1T5KA 1AG6A 3S8GB 1E5ZA 1JVLA 1UATA 1M57B 2AZUA 3GYRA 4DP4X 5EHFA 4DP5X 2DY2A 1MG2C 2XV2A 1ZIAA 2UXTA 4A2GA 1AS7A 3NJMA 3JT2A 2VM4A 3DTUB 1TKWA 4KNSA 4M4RB 2EIMB 2NRDA 1PLCA 4BWUA 2PLTA 3S3BB 1SFDA 4DPAX 3IN2A 3ASNB 2GB2A 1JZJA 1SHWA 3CZUB 2DYRB 4F7KA 3NSCA 2PP8A 2ZOOA 1GS6X 4WKXA 2BZ7A 1BYOA 2PPEA 3BQVA 1ILUA 3FU7B 4Q89A 3OMIB 4BDVA 4DP8X 1EZLA 3S3CB 4W9ZA 1PAZA 2YAHA 2BP8B 2R7EB 3EH4B 3PCYA 2PPDA 1WA1X 2CAKA 3ABLB 1PNCA 5I6PA 3CDZA 1OE1A 1NIBA 2PPFA 2W88A 5PCYA 2VMJA 3PAUA 2TSAA 1MG3C 1SNRA 4FAAB 1ZPUA 1BYPA 1L9PA 4DP0X 4A67A 1V55B 5D4JA 4KO6A 4UAHA 7PCYA 1NPNA 2EILB 1GS7A 4G7QB 1L9SA 4BXSV 1HAWA 3WKQA 5I5JA 4HCGA 2VW7A 5LDUA 1CUOA 2UXFA 3X1GA 2HXAA 5I26A 2IDQA 3BVDB 1B3IA 4CSPA 6PAZA 4GP5B 4CSZA 1IBZA 4L0PB 4E9YA 5D4IA 3ZIYA 4ZK8A 2XXFA 1ASQA 4E9RA 3AG1B 5FC9A 2UXGA 3UADA 3ERXA 3GDCA 3NJKA 2J57A 1IUZA 1OCRB 3FT0A 3ZBMA 2XV0A 4PAZA 1JVOA 1FFTB 1SJMA 3NYKA 1ZIBA 5AKRA 4G70B 1PLBA 4AI7A 1GR7A 2HRHA 9PCYA 1OF0A 1NWOA 3QJRB 1CYWA 5ANHA 4AX3A 3FU7A 4DPCX 4UF7C 3N55A 3OM3B 1AS6A 1L9OA 3NSDA 3X1BA 3CVDA 2HLEB 1SF5A 1QNIA 4GXFA 3QJVB 3OMNB 1URIA 1TEGA 2VSKB 2YQBA 3HB3B 5AZUA 1AZBA 3IN0A 1PZBA 1OV8A 1OCZB 2JXMA 1HAUA 1I53A 3AG2B 2J55A 1JXGA 2B3IA 3SQRA 2GI0A 4G72B 4YSCA 1W6WA 2FT8A 3NJJA 1PNDA 2XV3A 1E30A 1N68A 4DP9X 1XB6A 1PCSA 1J9SA 1N70A 1OOWA 1KBVA 4YSPA 1GS8A 1NIAA 4NB7A 3EHBB 4YVNA 4P5SA 1E5YA 1RKRA 5TK2A 4ENZA 4AKQA 5B1AB 2XWZA 1AACA 3H56A 4Q8BA 1L9RA 2YAEA 3FYIB 2IH9A 1XMEB 4YSAA 3FPYA 2IDFA 1NIEA 4GP8B 3FS9A 3KW7A 5E9NA 3EH5B 1F56A 4BWTA 2FWLB 4P5RA 4WTQA 4M3HA 3X1EA 1AR1B 4KO7A 3PLYA 3ABGA 1ET7A 3GXUB 2PP7A 1PZCA 4KOCA 1J5DA 2WO2B 3FQ2A 1A8ZA 1RZPA 2BW5A 2YXVA 3SBRA 1OE2A 3T6VA 1ZDQA 4HCIA 1GW0A 2AANA 1AOZA 4DP1X 3ZX1A 2IDSA 1ADWA 3U25A 4JHUA 2I85A 1TU2A 2IWKA 3X1NA 3NJLA 3G5WA 1SF3A 2IWFA 4YSUA 1NZRA 5D4HA 4HZ1A 2JFCA 2WO3B 3TU6A 1A4CA 1EHKB 1M56B 2BP0A 2XYBA 3MX0B 3QPKA 1MZYA 4FA7B 2FQDA 4JKNA 3L45A 1IKOP 2BW4A 4G7SB 3UAAA 1J9RA 4E9TA 1NIFA 2GBAA 3UGEA 2Q9OA 3DKHA 2FQGA 2X87A 1BQRA 2WSDA 2CCWA 3NJIA 2XLLA 1AQ8A 1GSKA 2VW6A 2YAMA 2MRYA 2J56A 2BZCA 2A3TA 4F2EA 2YAFA 1BQKA 3T71A 3NSYA 4EF3A 2UX7A 1JXFA 1X9RA 1BXUA 1ZDSA 1QLEB 3V9CA 4E9XA 3NT0A 1GY2A 5I6LA 3ZDWA 4X4KA 4AZUA 3OMAB 1CURA 3QJTB 1X9UA 1SFHA 1ILSA 2QDVA 3N2JA 2QT6A 5B1KA 1YLBB 2FNWA 1PZAA 3AZUA 2OCCB 1NINA 1M9WA 3X1FA 1AAJA 2YARA 2CUAA 4A66A 2W8CA 1IC0A 2BHFA 1MZZA 3PAZA 2XX0A 2ZXWB 1KCWA 2FQEA 1XB8A 3X2QB 1NTDA 2GC4C 3S3DB 1KGYE 4HHWA 6PCYA 1L9TA 3TBBA 2CALA 2CBPA 1L9QA 4YSQA 3PAVA 2IWEA 2BP8A 3NP4A 2R7EA 1AZCA 3UABA 1RZQA 4YSOA 1KYAA 2FT7A 3CVCA 3CVBA 3H4FA 3AG3B 4KNUA 3EH3B 3FSAA 1ET5A 1A4BA 1HFUA 5I5IA 1SHXA 1GY1A 1WA2X 5I6MA 1NWPA 5I6NA 4W1TA 2CJ3A 2TSBA 4A2EA 5I6KA 1CC3A 2XVBA 2VN3A 2OV0A 1V10A 1WS8A 3WIAA 2HX7A 3FSWA 3T6WA 3WKPA 3WG7B 4GYBA 4N4YB 1WS7A 3DIVA 4YVUA 4AKOA 1ASPA 1NICA 3T6ZA 2YAPA 2X88A 3PPSA 3CG8A 5I6OA 5PAZA 3PXLA 2PCYA 2QDWA 4QLWA 4YSSA 3CDZB 1FWXA 5A7EA 3MBWB 2EINB 3QJQB 1W8EA 1XB3A 1AZRA 4RH4A 2VM3A 1JZHA 3HEIB 1PMYA 5I5MA 3T6XA 1OCOB 2VSMB 4KO5A 2IDUA 2XX1A 2YAQA 5AFAA 3FU8A 4F2FA 1FA4A 2ZONA 3KW8A 1PY0A 1SDDB
chains in the Genus database with same CATH superfamily
2ZCLH 3SKNA 5GS3A 3GSWA 1CT8B 1D5XA 1XH3A 2OA9A 1NFDF 4LCUA 5IUCA 1SEBB 3T1WA 4PJCA 1E67A 4HJGA 3C09C 3IXAA 3I9GH 4YGAB 1RP9A 3CU7A 2YFNA 3NEXA 1UOLA 5EC1B 5AAPA 2WQXA 3TJPA 2G0LA 1MF2H 4CBZA 4W9HC 1CIUA 1W6LA 2OJEA 5F71A 1DYZA 1K4CB 2C7UB 1D9KB 1LO0L 1T83C 1N19A 2DI8A 3DSFL 3MV7D 4ODSH 5I0YA 1GZHA 3T0VA 4H8WL 5T8IA 5F3BB 3EJJX 5HI5C 3UGUA 2BIIA 2PO6A 4PJ8C 4X6DE 5F0MB 1BQSA 1JJUA 3KBEA 4UQ2B 4I77H 5L88H 3AJ7A 3K74B 1WSST 4DKAA 1UH2A 2ZF8A 4O9HL 4F58H 3A6CH 2VMFA 2C9SA 2H9GB 1YEDB 2Y1ZA 3LQZA 5F1NB 5B7MA 2AJSL 3JWDC 3RX8A 1EV2E 4POUB 3TBCA 5B38B 5EDSA 3W37A 3EO9L 3RGVC 4NWTH 2F7RA 4ZOEA 3B56A 4LBEB 5AW9B 2FIKA 2KBGA 3RDTB 4KKRA 2VAAB 1T7ZA 2NXYC 3DWTA 2N1KA 2QSVA 2F19H 2LTQB 4TLUA 3GRWH 4LCIH 1FVDB 1UB5B 2NSQA 4XPAL 1JPEA 2EDWA 4R7LA 4XMTA 4XX1E 2WQWA 3JWOL 3FAXA 1RAMA 4XH2A 4YSRA 4JPIB 4ZODA 4HMCA 4JE4B 3WMQA 4AITA 4PRBB 4OF3A 4UTBH 3D39D 4CMHC 4R84A 1WYJA 4F5CE 4UDTA 1YMMB 4KNQA 1A6PA 4Y9CA 3C60B 2XVLA 3FU3A 5CCHE 1UD2A 4JCWA 4JBSA 2X4NA 1X5KA 1MFBH 4YBLC 3ZDYE 3V7AG 1RP8A 5C6WH 1UXWB 5CJQH 1NGZA 5F93C 1F11B 4KTEL 1IEAA 4PJBA 1HE8A 4HXAL 2Q2LA 4G7RB 4GRWE 4ABQA 3LIUA 4X9BA 3F7RA 3MNMA 4LARL 3VD0A 3DXAB 3IFNH 1OQOA 1XH0A 3KM1A 3RZCD 1J7VR 1KTRL 2QKSA 3DVIA 3MCG1 2UX6A 3UBXI 3AS2A 3MA9H 5LNEA 2Y2TA 4J27A 4IHOB 4BDVB 3T0EC 4HS8L 4ZMVA 3WMPA 4ZQKB 5CLWA 2YD1A 3KGUA 5DVNA 5KSUA 1M7IA 5AW0B 5D93B 5K9KB 2J7LA 2DWSA 5JIQA 5F89A 3NRQA 4G42A 4PJIE 5ALBH 4NFBA 1VADA 1BSIA 2VDKB 4HFUH 4NKOB 3BPLC 5IVZA 1IRAY 2K9FB 5D1QA 2AI0H 2QQKH 1B0RA 4MA3A 4NN6C 1CD1B 1KDJA 3L6FA 3UEZA 1E5ZA 2JTDA 4JZJC 2UUDK 4LSVL 2GTWB 3QJFA 4MZRA 1UATA 4BH8A 3I85A 1PVHA 1FZJA 3QA3A 4JR9H 3L3GB 1BZ7B 4M1CD 5KANG 4NNXB 3SZKC 1P53A 1X7TA 4GXUN 2E8ZA 4BKLA 1HOCA 3RTQB 5IJVA 2AS5M 1ONQA 2OPCA 4OIAA 1RZGB 1J05B 3NRPA 5E95B 3QO1B 4QRSB 3SD2A 2FATH 1EH9A 3MRKB 4D0BA 4PB9H 5IHUL 2V2TA 5ES4B 2G0KA 3WIHH 2LLLA 5IVXA 4Z95H 1I9IL 2QGCA 3CFCH 4XVOA 1RK7A 2ZOOA 1TJGL 4UT6L 3LZFH 4K5NA 1CN4A 1CTNA 4P2QE 2EDTA 4N86A 3SD5A 3BQVA 1I3RA 3SKJL 3VH8B 1PD1A 2P44B 4E5XG 2GSGA 4V1DD 3EH4B 3PWVB 4F7CB 1I1AA 2W9EL 1V27A 2XFXB 3VWJD 1PNCA 2D4FA 4X4XB 2CXGA 5EN3A 1UXSA 3SPVA 1YAZA 5KSBB 4LMQI 5C9JB 2WBJB 2I60L 5IJKC 3OAYK 1ZPUA 1QTSA 1V55B 1TETH 1A7BA 2VLKB 3O9WD 3ZE0F 1M2VA 3BVWA 5E4OA 2FD6H 4UV4L 1BWWA 4KK9C 2NT1A 1AO7A 3PJSB 5IREA 3SO3B 3WN6A 4TOYH 2H2PD 1ZANH 4OLZH 3MRLA 2FSEB 2O6FA 1JTOA 4FERA 4HCRH 1CT8A 2EH7L 3PP4H 4ZUTB 3FT3B 4JRXB 4EKJA 3N41F 3HNTH 2YQ2A 2B3RA 2NY3C 3DOSA 4K7PL 5AALA 3AABA 3LHAA 4GSUA 4DEPC 5IHBA 2OFQA 3GM0A 4ESKA 5EC1A 3ML8A 4FNLH 3NJKA 5EA0L 1AP2A 3K7UA 4RX4A 1OCRB 2VRKA 2Y07L 4OB5H 2VIRB 1M1SA 1TEYA 1YYML 1JHTB 2FX8L 1ZLSL 1K4CA 2C7UA 2PW2B 1D9KA 2ZCHL 2CLVB 3QW9A 2VXSL 2CHNA 3THMH 1MIML 2YK1L 4KKCC 4UQ2A 4L3EE 1FRGH 3L95B 2IH3B 2BWQA 1OGPA 1BOGB 4GKOA 2IGLA 5IEHB 4LVEA 4FFWC 5DUML 3HN8A 3H42L 4R2GB 1MI5D 3HMXA 2AJUH 1HH9B 1I53A 1NCCL 1XTMA 4ALAH 4QAMB 3D0AA 3D08A 4JO2L 4GAJH 3U1PA 1XH1A 2J55A 5GRZA 2VAAA 3HNVH 4AG4L 1XF2B 1W6WA 3NCBB 4NXKA 3NESA 1E30A 1CFNB 4N2BA 3B4NA 3SDAD 5FKAA 2CJUH 1GGCH 1KGJA 4XP5H 3V4VB 1NDGB 1TTFA 2JE8A 5J3HD 2I32A 3H54A 1WZMA 1FVDA 1UB5A 4TTGA 1CDCA 2BJML 3SQOH 4OIIH 1I8AA 3FN3A 2QZ5A 5CINL 2DRUA 3P30L 2MCG1 1ULVA 2OMYB 4CC4A 1QEWB 3GXIA 4ZFQA 3V5DB 3KVDD 4FQ1L 2WUBL 4JPIA 2LABA 2NR6C 2GQHA 2ENQA 4PRBA 1TFHA 4GSDL 4M93B 1H8LA 3VFOB 4QRUA 3NJXA 3RNKB 2XJLA 3JTTB 5D72H 3Q6FA 2IOOA 2WIMA 4XO9A 3BP7B 3QPQC 5GHWL 3SZ6A 4MD0B 1IE5A 2NY0C 2DJUA 4MAYC 5E2VH 4ZYKA 5IHZA 1HQ4B 3MGTA 4P5MA 5EDXA 5T1LB 2E8YA 3BMVA 1ZS8B 3SE6A 3BP6B 5I0WA 5KVFL 2IPKA 3KYMB 4YDIH 1E9OA 1HK6A 3DXAA 2ZSVB 5CJXA 4PRPD 3V5HB 2Y5TB 1XL6A 5T5NG 1K5WA 4L2YA 2RMNA 4UNTA 1EJ8A 3MU3A 1U3ZA 1GW0A 5C07A 1CD8A 2OQJB 3WTUA 3L5HA 1LWJA 4HWEL 3ULVC 2D3LA 1JPFA 2HLFD 2IWKA 3MUY1 2PABA 4S0SD 4UQEA 3C09B 1X5ZA 3IETB 4O02H 2Y36H 2DTMH 1C08B 1T21B 1XF1A 2JIXB 1RK0A 1CD1A 3L1EA 4Z7OB 2BNRE 3T04D 5ECGA 3AXIA 3RVTD 5CWSA 5HYJB 1EEZB 4QOKB 2E75C 3GBNL 3RVUC 4AL8L 3F84A 2GTWA 5CCGE 1P1ZB 2X87A 3CQQA 2AV1B 4L9LC 4QRRB 2IFFL 3L3GA 5E4IA 1P5UC 1BZ7A 1I85A 4PJ8B 2HT4C 3IGKA 2YZ8A 1CLYH 5TE4L 4MMYA 1SXNA 3K80A 4XWGL 3VI4F 5FCUH 2YD9A 2ORBH 5HVWA 4Y5VC 3MTRA 5T5NF 5EZOL 1HDMB 4JFOA 3QO1A 4QRSA 1XHHA 3KPOB 3MRKA 3Q8EA 3IDYC 3RGVB 5GXBB 1A7RL 1HQRB 4I7ZC 5EG6C 3X1FA 3DMMD 3CN1A 5AZ2H 4FDWA 1P6AB 3VRLF 1VGEL 2NXYB 3UYRL 2WXHA 4EMZA 5T3ZE 2UZXA 4CILA 2WQUA 3EGSA 1NPUA 2J8UE 2ZZUT 4Y19B 3PJLA 3PWVA 4F7CA 2CG9X 3KCPA 2ADGB 4YSOA 5E2TL 5BV7L 3CIAA 5J0BA 5GJSH 4YIQB 3L3HB 4X4XA 3MLUH 2FX9H 4YHMH 5LCVL 4N5UA 1RIHL 4X0KA 5KSBA 3MLSH 4Z7NE 1B4TA 2WBJA 3DX9A 3JZYA 1AC0A 3ESVF 4CMHB 2YXMA 1J0IA 1PTZA 3BRGC 1L9MA 4HPOL 4P2OA 2OV0A 2GJRA 3PHQB 4KRNA 5F9OL 3QR1A 3MXWL 1SUHA 4YBLB 4JVUA 3PJSA 1HCVA 1RUMH 1BPVA 1TZ8A 4DAGH 2AJZA 2WJ5A 2FSEA 3ABZA 5I1HH 5T1KA 1H15B 4ZUTA 1O7VA 2J1YA 4TLKA 3FT3A 4XPGL 5CCJA 1I1RA 1K8IB 3CVIL 1IQDA 2PCYA 4ZZFA 4FFVD 4NEHB 5I1CH 1HNGA 4A2LA 1KLUB 1XB3A 4FI7A 3FZUD 3T0EB 3LRGA 4KKLD 1O75A 3UDWA 3HEIB 2VIRA 2XZAL 4L29B 1JHTA 4FP8L 4OZFH 1G0DA 4LLAA 4KH2A 1XDTT 2CLVA 2FDBP 3Q1SL 2YOCA 4YS4A 5AENA 3FTWA 5A2IH 4B97A 1FF5A 4RFNC 3L5XH 3BPLB 5F70A 3H9HB 3I2CL 4JREC 4WY7H 5KBPA 5GZOD 4NN6B 2X41A 5IEHA 2PN5A 5GGRA 2WXJA 1FYTB 1XF3B 3CXHJ 1CZ8H 2IPTL 3IGFA 4JZJB 5D1XD 1HH9A 1URLA 1JZIA 2DM7A 2WWMD 1WITA 1YQVH 3IBOA 3MBED 4JW3A 3SKOB 2BXZA 2D9QB 4FEIA 1JWMA 2HVKB 1XF2A 3B1UA 3P1VA 2AQNA 3F6JA 5IMKB 1XMWA 3LPFA 3BSGA 1MNUH 3MODL 4XWOD 5DHXB 4E41D 1J8KA 2NQDA 4XODA 1YPZF 4YEEA 1VKXB 2I9LB 3OLDA 1M7XA 3G3LA 5D7EA 3RYMA 1NJ9A 3LS5H 2QKIC 4CGUB 4P07A 2B4CL 1MFCL 2YR3A 5F7DB 2PPAA 4GI6A 3V5DA 4PPTA 2AGJH 5IQNA 4XN4A 1BOYA 4Z7QE 1E4XH 4RAUA 5FYLH 5J1TC 1G7MB 5EOQH 4DTGH 2BHZA 1MWOA 5C0AB 4AIEA 3CFJB 2Q10A 2XG4B 5JW4M 1UA7A 4KXAA 5HDBE 4AUJA 1IARB 5CBAB 4WHTB 4TRPL 5F96L 2QLYA 4YE0A 4M1CC 1TVDA 4QHUB 4JO3L 5FFLA 3BP7A 2E6QA 1Z9SB 2KYIA 2R29A 4RAHA 4ONOA 3OB0H 2CHXA 5H94B 1Z5LA 5HHME 3S97C 5T1LA 5ICZB 4LNVA 2DQEH 2P5PA 2FHFA 3BP6A 5EU4B 5C08D 4UOZA 2W9LA 3KYMA 3V7MA 1PZ2A 2ZSVA 1G7JB 3V5HA 2DWTA 2Y5TA 4EBQH 3NJNA 3ZE1F 3V0VB 3ZTDC 1NGPL 4OZIF 4PJDF 5CIPB 4PG2A 2PCPB 3RB7A 4X4ME 5E8NB 3T3PE 4BK5C 2OMVB 2OQJA 3SBPA 3OKEB 2F8IA 4K94C 1TMCB 3QISA 1USZA 1JYWA 3GJEB 1A0QL 3MJ9A 1S7WA 4F9PC 1I9JL 4YN3A 1CTMA 2NY3B 5B7EA 2HVJB 2AJVH 2V17H 3DBSA 3IETA 4X7FC 3DX0A 1C08A 1T21A 1QLRB 3DIDA 4LLUB 4DEPB 1N67A 5CFHA 2WYTA 5I6XC 4EUPB 1J9CT 1OP3H 5GGVL 1TZHB 3OKNB 2GEEA 1LDSA 3G6DL 4QOKA 1U8LB 4JJ5A 2HT3D 5AAMC 1P1ZA 4F57H 1CS6A 2AV1A 3NJHA 4NQVB 1E3ZA 1YNTB 3FNKA 3SY6A 5KYXB 3L2LA 4FQJL 3L1FA 2R4SH 1IFHH 3MACL 1LILA 2KLRA 2H2PC 2BCKB 1A3QA 3GGWA 1TLMA 2AW2A 2K8QA 3ZMEA 2YAOA 3HCVA 1Z5HA 3UCRA 1COBA 1SMOA 3ARGC 4WNSA 4BCXA 3TURA 2ETWA 2NT0A 4WFHE 1HDMA 3MRFB 1QSFD 2LW3A 3KPOA 3UAJC 1WAAF 1HQRA 3QDME 4WQOA 5DJ0B 4Q58C 4JK0D 3G6JF 5DUBA 4XOAA 1E5UI 4XMZA 3IDGB 4ZUUB 3ZUNC 4F1ZA 4KWUA 1MWAA 1NC4B 4Z7AA 2DQMA 4OD1L 4MNGB 3B2VL 5F44A 1ICTA 3GYRA 1OXYA 1RZKL 4PLOB 3ZHDA 3CFUA 3DECA 4GI8A 4F24A 4LHQB 4Y19A 3JV4A 4PJGF 2KPNA 4F8NA 2GK0B 1QYGL 3LOWA 1NCNA 4XNYL 4J6RL 2NRDA 1PLCA 3L3HA 4YIQA 2D7QA 4A7GF 4Z8FH 2IV8A 4YZFF 2DN7A 5IFJB 3HW7A 2HUEA 3LRMA 1AHWC 1I7RB 1E4XI 4GO8A 4OGQC 4DKDC 3Q0HA 5E8OB 2CCVA 1ZPLA 1ND0B 3QWOA 3PHQA 3QH3B 4RMRA 3O6LL 5KJRL 3M46A 4UNIA 4J3BA 5GGTL 2YQGA 4NO0D 4DGVH 5AOMA 4XBGB 4A1RA 2NY0B 4MAYB 3VDAA 3SDAC 1ZLUK 1ZVYA 3OMIB 1SXBA 4NBZB 1S7QB 5DUPL 5GS2H 1QSEB 4H1LB 1TQBC 5J3HC 4FZEH 1XGUA 3HZYB 4HD9A 4W9ZA 1IM3B 3APMA 1B4JL 2EE0A 3LRLA 3MA7B 5EIIB 1NL0H 2VQTA 4QJ5B 3OSKA 4G2AA 1VAHA 1NIBA 2HRPH 1DSWA 4QGYA 1KLUA 1VF5C 3MLVH 2HT2D 3U9PH 3T0EA 1J5HA 4XRCB 4KHTL 4L29A 4I9WE 1YJDC 4TSCL 4URTB 4X4ZA 1CUOA 2VN5A 4DKFL 3X1GA 2VDNL 3H9HA 4JFHD 4ADGA 4X7EC 1MHHB 2NZIA 4GP5B 1XF3A 4L0PB 4JZJA 5KW9L 1V3KA 2OR7A 4HKJA 4QY8B 5J12C 5FYKU 4L9LB 3EJPA 1P5UB 5IB3B 3JYBA 1G4RA 4MDIB 4Y4FD 3UTTE 1U3JA 2YSSA 2LAAA 4M62L 3NYKA 3LN5B 4PS4L 1RSYA 2HRHA 4YE4L 5AVXB 4JM2D 2F7QA 4KX7A 2HLFC 4OF5A 4OSUH 4Y5VB 4FA6A 1S7TB 2YEVB 3NH7H 3BCFA 3FU7A 4F9LA 5CR1A 4JM4H 3QIUD 4LB8A 2KZBA 3AWFA 5F7DA 3IDYB 2DBJA 3D25B 1UUSA 3L7FB 3VG9C 2XQBH 1LEKB 1OGAA 5IW6B 1WZAA 5F7KC 1AGFB 1G7MA 5ESAA 4WI7A 4JNXA 3T65B 4IOIB 5C0AA 4XXDB 1OCZB 3CFJA 4LPCA 2XG4A 4N2NA 4LL1A 4QHNB 4WHTA 3O0RH 2B3IA 4IOSD 4X6CF 1T04A 1TYEB 3L2NA 3N44B 4H8WC 1MFEH 2FT8A 2OR8A 1RV6X 2V0AA 3AY4C 3QUMA 4KUZL 2OCFD 4PMEA 2QGBA 4KY1H 1F3JB 3GKWL 2JCCB 3MRCB 4AYBA 3SDCC 5ICZA 2OW6A 3VXUE 2OZNA 3QIBA 3T2NH 5IJKA 3MR9B 1SY6L 1HI6B 4ODXB 3ZDXB 1G7JA 2BVYA 2X6BA 2Y7NA 3R06B 3DMMC 4LOFA 1H3WM 4HJEA 2WLNA 4QI3A 4OZIB 3HC4L 4JDEA 4KI5E 4HIXL 3B9KC 3C2AH 2PCPA 3C6LD 1INDH 1SN0A 5KVEE 5E8NA 2YAEA 1NEPA 4L0ZA 3OKEA 1BF5A 4GPVA 4BZ2L 3DI3B 4MA8L 4X8JB 2ID5A 4PJ7F 2HVJA 3KW7A 4Z3HA 3RIAK 3LMJL 5DJDA 2M2DA 2EC8A 3ZMRA 1QLRA 3KXFB 4LLUA 4JG0H 1QI5A 1GPOH 1WBXA 4KDTC 1U58B 4D94A 2LE9A 4BFOA 2R69L 5JDSB 3QS3A 4WFFE 4QAWA 5HHPB 3IJ8A 5IMMB 1G0YR 4NJAL 5KN5B 1TZHA 1IC4L 2NW3B 4LP5A 1YNLH 3L1OH 2OMTA 4N8CL 5CO1A 1IBDA 4GBXD 1RZPA 2XXMB 3P11H 2E4TA 3DHPA 1MOEA 3PFQA 4KVNH 2WO4A 4NQVA 2HFFB 2DMCA 1XGQB 3A67H 2QPSA 4LBAA 3RUGF 4H20L 5D1ZD 4APQD 1H9DA 2ZUSA 2DS4A 3LY6A 1FV1B 2NOYA 4RFNB 4EIUA 5F7UA 4ZO8A 3PWUB 3DJTA 3K6NA 4RWYH 4X0NA 4JREB 1KTCA 2RQ8A 3U6XS 3QCUH 4PFEA 1CL7I 3SOTA 4NQDD 4DN3H 4EQ2A 3DX7B 4FULA 5DO2D 4XVSH 1YEKL 2JFCA 1I8LC 1KGCD 3BDXA 4TVPE 4FFVC 1IEHA 1AKJB 1V8HA 3V6BR 4ZFOL 4MZ3A 5DJ0A 3FZUC 1S3KH 2BW4A 2IQ9L 3G6JB 3IDGA 1HTYA 2APWA 3CFDB 4KKLC 5E2UH 1TITA 3TBSB 4P9HL 3UAAA 2DYPD 5E2JA 2ZX5A 4MNGA 5T33H 2EACA 5BZDB 2Y22A 3R1GL 2R0LL 4XCEB 3KEHA 2PR4L 4PSPA 5FKPB 1KBGL 5ESQB 5KYNA 1SM3H 4OVVA 2QKIB 5GJTH 3LPOA 3TV3L 5KAQG 4F2EA 1U93A 3BWUF 2EDLA 4JDTH 2VL5B 4EF3A 4MMXC 4J3UA 1CGWA 5GZOC 2ZOTA 3K6OA 2XWJB 1U8OB 4MBRA 2NR6A 5E1AB 3FCSA 3CUPA 3LIZA 3NCYP 1FNAA 1I7RA 1OD7A 1JFQH 1SBSH 2WWMC 2K78A 4RZCB 2GJ6E 4F2ME 1NCUA 5E8OA 1JDCA 1ND0A 3QH3A 3V6OC 3H2WA 5EUOE 2WZ0A 2J4WH 4K8RH 3S5LB 1SXCA 4A04A 5JYMA 1NAMH 2HWZH 3DVGB 3MRIA 4P57B 4XCFH 2NYZA 4MAYA 1J86A 1T6VN 1KB5L 4HHWA 1PLGH 4NHCL 6PCYA 1S7QA 4H1LA 3BLPX 1AD0B 3PS6A 4JCMA 4XPTL 5D2LE 3UC0H 2NY4C 3NSXA 3BT2L 3F7PC 5EIIA 4JHAL 2IPUK 1CDBA 1NCGA 3KWTA 2C9XA 5LAPA 5LVEA 3QEGL 2H8PB 1UYWL 1HFUA 4IDJH 4FQPA 5I5IA 2Z93B 2W0PA 3ALPA 3QCTH 1IAIL 4UU9B 3NZHL 3DNKA 4XRCA 1EJ6A 3I3BA 4A2EA 3SJVD 1JWUB 4IQHA 5KAQF 5I8KL 3ISRA 2HX7A 4FE9A 4QWWD 4U6HB 4X8GA 3RQ3A 2XSKA 4JO1H 4V1DB 4L5FH 4WI3A 3VFMB 3WEBA 3QWNA 5T3ZL 4YDVA 2FWSA 5FV1L 4HJ0D 2XKNB 3GLDA 4GO9A 1IGML 3T6ZA 4HUNB 3GBML 1SJXA 5I6XB 3FRUB 3FQNA 4PJEE 3P2TA 5C0FB 2F2HA 3FOLB 4JO8A 1GIGL 2ICES 4W68A 4QLWA 4QY8A 4NPJA 4BE6A 4TUUA 4XPHH 4DQAA 1P5UA 1XD0A 4XO4A 3QUGA 3U46B 3UEQA 1OPGH 3ARGB 1YPZA 5TJWK 1N4XH 2JKXA 2R1XB 1BDYA 1P2CB 1S7TA 2N0KA 2A9NL 4GMSL 4J1UB 4O2FB 4AM0Q 3BZEB 1J1OL 4Z7WE 1G0XA 3EBIA 4N5ED 3D25A 1VSCA 1S78D 4X50A 1LEKA 5IW6A 4PLKD 4HH9A 3TCXA 3P4NB 3OJVC 1KENH 1UD3A 4UILH 3T65A 4DGIL 4IOIA 4XXDA 2EDBA 2D8KA 2BLFA 2HT3C 5F9WC 4QHNA 1OWRM 1XGYL 3MV7A 1OCCB 4S1QL 4X6CB 3CBKB 4EIZC 4XC3H 2DMBA 3BWAB 1I3GH 1CLZH 2R29H 4K71C 1IGJA 3UTPD 2R56H 1I1YB 2E7HA 1F3JA 2JCCA 3MRCA 2ZG3A 5GGQH 2DIEA 2WYZA 4N2AA 3ZYIA 2UV3A 4N6RA 5L4JA 1Z9LA 1A7PL 3NSFA 1QUPA 5E7FA 3LN9A 4ZUVA 1AHWB 3AWGA 3BAKA 5GIRB 4GRLD 1C1EH 2PYEB 4DGYH 1NCBL 5AOJA 4OZIA 4GFTB 5B7FA 4PJDA 4TUKH 2WNGA 4XP1H 2AXWA 4IGBD 1ETJA 4M5ZH 4N0YL 3KL0A 2Y4SA 4FNTA 4DN4L 5TDPB 3SDAB 4ZFFB 2EEAA 2SEBB 5I30H 1JZ3A 1TQBB 3Q43A 4GQRA 3Q2WA 4ADIA 1BAGA 3KLQA 1IAOA 2ZX8A 5ACZB 2ITCA 1YYLL 3OGOE 2X0WA 5TF1L 3S3SA 3FO0L 1J9QA 1E2ZA 1U58A 3HA0A 4B53A 1DQMH 2EUZA 5JDSA 5HHPA 4U4BA 4DNLA 5I19L 3D39A 1FUNA 4V33A 1U4FA 3FF7A 5EZLB 2NW3A 2I24N 4XE5B 3QDGE 1WWCA 1QHQA 1N59B 3U48A 2ZAIA 4XNAA 1E6OH 2J5LC 3Q05A 4N9OB 2HFFA 1XGQA 3QFDB 1P6WA 1E4WH 2WTRB 3NP3A 4K9JA 3RUGB 4P2QD 1FV1A 1GYCA 2VDPH 3O2DL 1LP9F 2HN7B 4MJ6B 4KTYA 4YNYB 3PWUA 3SDYL 4LSDA 4WWKD 3H3PH 5EOCJ 1KCVL 4TSBH 5BS0E 5D7IB 4NJ9L 1NDTA 1W2KT 3DX7A 3PJNA 3QPXL 2WNXA 2BSDA 4Y5YC 4JFEE 5GRXG 5IBTL 4PRPB 1R5IB 5BQDA 3RZCA 5D70H 1JNNL 2Z31C 4ABUA 4CU6A 5KN5A 2AMGA 5J12B 2ZP0T 4LPYA 2P5WE 2IGTA 4W4NA 2HT2C 1RULL 1NCIA 3G6JA 3WFHB 1MWAH 3CFDA 3TBSA 1JWSA 4OJYA 3LYRA 2J1XA 3OR7B 3H0TB 4M6OH 1E50A 4R97C 3DSNB 5BZDA 3C75A 4GKZB 4HBCL 5CUSL 4N3TA 5FKPA 5H2BB 2IV9A 3RX5A 4XMUA 3WJMB 4L8DA 2NY5H 3BKMH 4OZGE 4PJGA 1PLAA 2QKIA 2F1AA 4B7LA 2C8NA 3VG9B 2YZ1A 1TU2B 3BFOA 5BO1L 4KQ0A 2FYYB 2HJKB 2XWJA 1U8OA 1JZ2A 5DHDA 4U6XB 4MAZA 5E1AA 4HPYH 2AJYL 3S35X 4R4ND 1XCXA 1IEBB 2DI9A 3BEVB 1QFOA 4H26B 4RZCA 4IDLA 3AB0C 4PREB 2IXQB 3STLB 5BZXA 3S8GB 1MJUL 2OJZL 2ZP9A 3GXMA 5AWNH 3S5LA 3OPZL 4Y4FC 5FHAL 3DVGA 1F42A 3VXQA 1T4WA 4ONFL 3T0XA 3Q8AA 2D4DA 4LSPH 1AD0A 4JM2C 2DD8L 2MEJB 3B1TA 3SDCB 1XSJA 5CZXD 4A7VA 5A2JH 4L3ED 3NCJH 2ZXAA 4X4YB 3TT3H 2CE6A 1TTAA 1M3IA 4LSRH 3DMMB 4AVKA 1OZUA 3KR3L 3B9KB 3HUJE 1SFDA 2FBOJ 2Z4TA 4UU9A 4QPEA 5T5FL 5L8LB 4IKLA 4PUBL 1H0DA 3EIFA 4NRXB 5DRWB 4WO0A 1JK8B 4H8VA 4ORZC 3DUHA 3FTYA 1GA2A 3NSCA 3ZIMA 4NT6B 4P46D 4ZSOE 4F9PA 3WELA 4MB3A 4M5TA 4V1DA 5FYJH 3VFMA 4BSWA 3MV9E 3D87B 3SDDD 3VWJA 5DJAB 1B3JA 3IRCA 4C56D 1TTBA 2XKNA 4N20A 1KJ2A 1RERA 5DMGC 2C9QA 5IROD 1DDHA 2Y23A 5LUMA 1BV8A 5DD5H 5FOBB 3FRUA 3BWSA 5GGSB 4GQ9L 1X5YA 5DFVD 1TF4A 3WN5C 2MOQA 3MLYL 2XZQH 1SVBA 3FK3A 3W38A 2WXNA 3EH1A 2QR0B 3O9WA 3CFNA 3O2VL 4QO1A 2IAND 5E6RB 2BOBB 1KTDA 4TPRL 4RETB 4QMEA 3VFGH 3DJSA 4J3VA 1RUKH 4OZHB 2A77H 4PJ5E 5CS7A 2DJ4A 5I1JL 3S3JA 3F6LA 1VJSA 2EILB 1GJWA 1JZ4A 3BUQA 3EYSL 1JTTA 4U05A 4XMWA 4FGMA 1Q38A 1VENA 5CU5A 5IVNA 1BYNA 4XBPB 3HI1A 1CQYA 2PMZA 4TMPA 3BZEA 3UAJA 4PS7A 4AQ8C 4AW7A 3FO2B 3T5WA 1X3DA 2BERA 2LVCA 3MOAH 3NCXA 5C0IB 2UWEF 4E9YA 3WE6B 1C5CH 4ODVL 3CVHH 3WFBL 3ZT6A 4GBXC 1ADQA 4E9RA 4ONGL 4CMMB 3KLAA 2EICA 5E00B 3S35H 4X6CA 4FKHA 5IHLB 3RL2B 3QUMH 3GMLB 1EAQA 3TH2T 5C86A 5D1ZC 4FFZL 4APQC 2GTZB 3EFDL 4QT5A 5LBSA 2NSMA 4MMXB 1GR7A 3V0EA 1IGCL 3IFOB 4ECNA 4HETA 3RVXD 4ELME 3D4ZA 3EOAB 3QQ3B 1Q90A 3QUKB 5I82A 2O93L 1MI5A 4DPCX 1T7YA 2ZKHL 2DQJL 1I3VA 1TTRA 1AI1L 1AHWA 3EXJA 1A5FH 3L3DB 4NZUH 1IQWL 1RPQA 1XSIA 1LQSR 2J72A 4GXFA 5GIRA 3RBSA 2BNRD 1CCZA 1IGIL 2JJWA 3LKRA 5KANI 4KZDH 2W92A 4PVLA 1HHIB 1HAUA 3BYTA 1BBDH 1HH6B 2FCBA 3PDOB 5TDPA 3SDAA 2SEBA 2BOCA 4FFYH 2CQVA 5AZEH 5DUJA 1ZLWH 3ASWA 4U49A 1GAFL 2B15A 5ACZA 3HAEG 2NY4B 4HX1A 4MD4B 5E94B 2B4CC 1ZHNB 4AV5A 1YZZA 3T09A 1J9SA 1HZKA 1R24B 3B2UC 3LVEA 5EZLA 1T6BX 4O58H 1N10A 2ICWA 2IH1A 1N59A 3OZ9H 4OI9A 2EDKA 3PE9A 2RQEA 4U3SB 1L7TL 3QFDA 5F1IA 3RUGA 1YECH 2J6EL 1X5IA 2VR9A 5T3ZD 4MJ6A 2WBKA 4PMFA 5CR8A 4YNYA 1F58H 3BD4A 1CXEA 1YEGH 2EXYD 4NZ8A 3IMWA 4RVBA 4AJYV 4YSAA 2DM3A 1KBBA 1NSNH 1XR8B 4RFEA 5C08B 5KTEH 1I7TA 5E9NA 5DMYA 4R90L 3I9IA 3C8KB 2VLRE 4PRPA 3U4EB 1U21A 4X6EB 5F3FA 3NFPA 2GSIB 1ORQB 3C6SB 3ABGA 4F8LA 1A6TB 3GXUB 2PP7A 3WFHA 3TV8A 3TEWA 4XI5D 4HWUA 3OR7A 1OTTC 2W38A 5CKGA 3ZSTA 5KZCB 1L5GB 3KZ8A 4OV6F 4GKZA 5H2BA 4J3OD 3BI9X 3G5VB 2DTSA 3WJMA 3VGAC 4YHOH 1G5GA 5C0RH 4UTAA 2NYKA 4BFIB 4JVPA 3VDCA 3PGCB 1D7CA 4HJ0C 2XPGB 3FT4B 1TXKA 4YXHL 3U25A 3LNGA 1EWHA 1TU2A 3G7TA 1DL7H 1D5IL 3QNZB 1C9SA 2FYYA 2F74B 5TTRA 5EU3A 5IKCA 4LOEA 3OBAA 2CMRH 5D4HA 3W57A 4XNMB 4XZ4A 5F9WB 4H26A 1UD4A 2Q7AA 2EVIA 4MX7B 4PREA 3QPKA 3NABH 1RJZA 2ZYHA 2F1EA 3LHPH 4WGKA 1SBBA 2C9RA 3AY4A 1J9RA 1LQBC 5SWSE 4K71B 3BDYH 3D2TA 3CN4A 4NGHH 3K5SA 5DQ9B 1BQRA 3RWIB 2F54E 2WSDA 1N6QH 5F7MC 5DJZB 12E8L 2ITFA 1FG9C 2DM4A 1O6TA 5DQDL 1DVUA 2BIHA 4IBYA 3SYQA 5CKAA 4I48B 1QSFB 2YAFA 1CQKA 5ADOL 5L9DL 4AQEB 1JNJA 1R3IL 1S78C 3FB8B 4P05A 3DMMA 1FJ1B 5ADPL 5GS1A 4KZEH 1X9UA 1P84J 3DHUA 3WFEH 4LIQL 2QDVA 3CHPA 2KMWA 4HC1A 3VXNB 1NCHA 3CDGA 4TVPL 5HTSA 2ZYIA 4JZOA 4NP9A 4NRXA 1Z3RA 5DRWA 1RZKC 5JW5A 2FB4L 1NLDH 3BKYH 3FRPG 1HILB 1BXXA 1EGJL 4NT6A 3V5KB 1KCWA 2H6OA 3V0WH 2XY1A 1MRDL 4WUKH 3BE1L 1DDTA 1AR1D 1WFUA 3TBBA 2CALA 3EG9B 4HHAA 4KDTA 1JMXA 5FOBA 5DHVB 3AACA 1QABA 5GGSA 4YK4C 2X09A 2F8OA 4YLQT 1XH2A 1B9KA 1RIUL 2QQQA 1F2XK 2QR0A 2CXKA 4GRLC 5FB8B 2J5LB 5J9PB 4XX1G 1OAQH 3BC9A 1WCBA 3FJTA 2AHIA 4MS6A 2Q7YB 4OZHA 1WPCA 3ARBD 4NO0B 1OHQA 2ERJC 4IGBC 4D3CL 2XVBA 2GABA 4HGMA 4MQXD 1H6FA 3FSWA 4X6DF 5TGBB 3NTCH 4XBPA 5GGRY 2FL5B 4M6NL 4PJCE 1MJ7L 2EUWA 4Y5YB 1FC2D 1I8LA 1NICA 4KBPA 2Z31B 3D2UB 4M43H 3BJLA 1JPTL 3WFDL 5DXWA 2W9DL 3WE6A 1OT1A 1G1KA 3IJEB 2IQAB 4R97B 4JY5L 5DLLA 3QRGH 1VCAA 3LH9A 2DQTH 4ZMNA 4MD5A 2PCXA 5E03A 1NCWL 3IDXH 4M29A 3F7VB 2P28B 3Q1EA 1IT9H 2A7BA 2FZ3A 1S4IA 4HMDA 3BUIA 4MMXA 3RWCA 3IFOA 1QHOA 5C7ZA 5GZOA 1CBVL 4KK8D 3EOAA 3WDIA 4ELDA 3QQ3A 1LO3H 3QUKA 4WEMB 1UWXH 1LE9B 5D1XA 1XFPA 2BIQA 3AB0B 3MBEA 3UJIL 4YWGH 4XBEH 1UUNA 3V6OA 4PBXA 4GW4A 4BYHA 5ALCH 4Y4FB 2YMXL 2XTJE 4E41A 3PAYA 1JXDA 3QZWG 4JM2B 1MCWM 3RIAF 3T0DA 3FH8A 1U8CB 4OCWL 3V55A 4UINH 3ZDYF 2FLMA 2ED9A 2V3DA 1VRSA 1A2YA 5HD8C 4MD4A 1ZHNA 3CLFL 5F0LB 4PH8A 4K3EL 1MAMH 4GRWF 4WFHD 1R24A 4NM4L 4QRBA 3QHTC 3NQIA 3LRSB 4UT6A 4ZTPL 3ECQA 4RQQB 4NKIH 2VITA 1E5BA 5IQOA 3IFPB 1G4MA 3QDMD 1K9TA 1U8KA 4POZD 2MQGA 4ICWA 1W91A 2CIKA 2ZWYA 4U3SA 3BVNB 1N0XH 2OP4H 2D31B 8FABB 1SHSA 4AC2A 5EWIL 3WO4C 1LP9A 1ZA6B 4JFYB 3BWZA 1PF3A 4LOUC 3T0WA 1W0WB 4UZGA 4PJIF 2YPLE 2J1KA 5CZXC 2WQ8A 4GT7A 1ZHLA 3QJHA 5C08A 3KLHD 2CLZB 5K69A 3WN5B 3ULUL 4G1EB 4ZW5A 2Y6SC 2MCPH 3C8KA 3U4EA 3S8WA 1Q4NX 3NK4A 3RVWC 5HGGS 2VSDA 2GSIA 4L4VE 3IJ7A 3DARA 1A6TA 1FFOB 3ZKMD 1DUZA 3QEQD 1ID2A 3TFBA 2QMJA 1TOXA 5KVDE 2NTFB 3KLSA 3VFNB 1L5GA 1M4KA 3Q2VA 3FT1A 3PXJA 2BO0A 3AITA 4P46C 5IB1B 1FNEB 2ALWA 2D7TL 3G5VA 4BFJA 1KELL 2DM2A 5KYWB 3SDDC 2VZ1A 3SBQA 2JMRA 1UM5H 2AEQL 3FT4A 2CSPA 4WGVB 1TKWB 1KCSH 2FJGA 3MRRB 1NGYB 4UANA 2DQIH 5IROC 1ZGLM 1SJEB 3B7TA 3QNZA 4QRFA 1A6VL 1TTGA 3OAZK 4E9WA 2WN3A 5DFVC 4OF7A 1UB6B 4LSUH 3VFVA 4GBXB 4WU5B 4CNIB 4D9QE 5D5MB 4OR1A 3HBPA 5HVHC 3PU7A 1VZIA 2ZKMX 3VD5A 2HZHA 4GXUM 4RGOH 3UTZB 2EIDA 3NFNB 2UZPA 5D1ZB 4APQB 4EI5C 3IGAB 3CMGA 1VEMA 4QYOB 3ZT7A 1BM3L 3BPOC 4PJHE 3VCLB 5HBBA 4HGKC 4TXVB 4I9WD 1VLXA 4IEFA 5BZWB 1W9XA 3IT8D 1QSFA 2X1OA 2DQHH 2I7OA 3JVGC 3BKCL 3TA4D 3SBWC 5A2CA 4AEEA 4AQEA 3DHMA 4UYPA 2Q2EB 3IDUA 3FB8A 3FO9B 1FJ1A 1S7UB 1I8MA 3GSVB 1FNGB 2XWEA 2YKLH 4HLEA 1ETZA 1O6SB 2DYPB 4GUPB 3EJZC 4LNRA 3ATEA 3H7BB 1AG6A 3LKNB 3NA4A 4X9FA 1NFKA 3VU1A 3V5KA 3VXPB 3OLIA 3UTTD 2A4ZA 3VB9A 3MCYA 3O3DB 4ZO7A 2NLJA 1KJ2H 3D4YA 2B1AL 2WOYA 2Y7SA 3EG9A 2DY2A 5DZNA 2J6WA 3BXNB 3IKKA 4HT1H 4A7QA 1YNKH 2G60H 5DHVA 4LCWE 2RAMA 4B95C 4IRSC 5ECJE 1TSRA 3KPRB 5I66B 3VW3H 3KD4A 4XNZC 4YHLH 5FB8A 5J9PA 3WAKA 4WV1C 3W11D 2B5IC 5A1AA 1I1CA 2Q7YA 3FF8A 4NO0A 1M7DB 3K2UL 4EDWH 4Z0XB 3K8KA 1VFMA 1JZJA 4L8SC 5I73C 4MAUH 4NLHA 3VD7A 1UCBH 4HUWB 4KDWA 1U41A 5TGBA 1BYOA 1S9VB 2PPEA 4KKAD 2AK4B 5I2IA 4Y5YA 3MLWL 3ISYA 5J57B 2E9BA 3GNML 5C1MB 4MKTA 2YAHA 4TNVF 1PJ9A 3VXUD 1MVYA 2NNCA 4FJZA 3N1QC 4FQIH 2VDLL 2J20A 3B8YA 2MOVA 2F68X 1ADQH 5E8DH 3IJEA 3SJVB 2IQAA 2VLJD 2ROYA 3GK8H 2R23B 1TR7A 1TNNA 2TSAA 3ZU8A 2C9PA 1BIIB 3VGAB 2W91A 3JZ7A 4RISH 7PCYA 3BZ5A 4YZWA 3LN4B 1W72H 3ECWA 3NACH 2DKUA 3HKZA 3M86A 5FHBL 3VFSB 2W95A 5H37G 3QORD 5JHLL 4N24A 1CU4L 1KIPA 4RFOH 1LE9A 3DTXB 5K9QG 5E5MB 5ESVB 1Q9WA 4WJG3 1OARL 1ZTXE 4NN7C 2G5RA 4PGZA 4FMVA 2IG2H 4JGNA 3ZIYA 4NQTA 3UJJH 1UGKA 4Y4FA 1ASQA 4XI5C 5CM1A 4CL7A 1UQSB 1UWEH 1P4IL 2J57A 1OGSA 4JM2A 2IBGA 3RI5K 4YUEL 1L7IL 4Y7MA 4G1MA 3QEUB 1RUQL 1RQ5A 1OSEA 2R0ZL 3QIUA 1TIUA 4PI2A 3RY4A 3CDCA 1XXDC 4GAYB 2H32A 1FNLA 2UUDH 3HN5A 4DJMA 2H0JA 5TDOB 3W56A 5CEZH 3TT1H 3N55A 1JHLH 4RQQA 3BN3B 4B6ZA 4TVPD 1IC7H 4MXQD 3K91A 1QBML 1YMME 2WBXA 3A47A 1FLRL 2L0DA 4IOSA 3NA9L 5DWUL 1Z7JA 5AOIA 3BVNA 1I9RL 3VFWB 2Z8VC 1P7KA 3UMTA 2YD6A 4AE1A 3CSBA 2X6CA 1QLEL 5BUGA 4XPBH 4JFYA 4K2UL 4PTUB 5SWZD 5LCVA 5F72S 1RVFH 3FQRB 3D8MA 1XGPA 3BAEH 5GRWA 5F88B 1K6QH 4XMPH 2CLZA 4YK4B 1VFAA 3RPIB 3WN5A 3QQNA 5HGHB 3VD4A 2KLSA 1ZSHA 2NY6D 3DXAE 4GRLB 4WI0B 3EDFA 4B9GA 1IJNA 4TL4A 3AUWB 5DT1H 2QTEA 5MHSE 3C6LA 1OAYH 4EJ1C 1O6VA 2HP4A 2ERJB 4IGBB 4JHWH 5E5UB 2H1XA 3L3JB 2NTFA 2BSED 1WDAA 3HAEA 1RMFL 3VFNA 4I3SH 2I5YL 4D8PB 2O1AA 4LPWA 3VM5A 6FABH 4UTAH 1SYVB 1BAFL 3HR6A 1UD6A 2BX5A 1AVAA 1HZHH 3OGCB 4J3OG 4ZUWB 4AQ8A 4NI3A 2HKHL 4QF1A 3FPYA 1ES0B 3TIDA 1SJEA 4MZIA 3H3BC 4XOCA 5FO9A 3U1SL 4WJKB 3S34L 1Z0MA 5E2WL 4GBXA 1BX2B 1FFRA 4WU5A 5D5MA 3KPTA 3PLYA 1EAOA 3OXRB 5FA3A 1T7XA 5IT2L 5D1ZA 3NFNA 4APQA 2VGLM 3JV5A 1K3IA 3K5RA 4QYOA 3DETC 2VDNB 2BVOB 3P0YH 2J8UF 3GXTA 4DQOL 3V9FA 4NQDA 4YFLF 4NM8H 1WD9A 2AJSH 3O3EB 4OLWL 1ESOA 4X2UA 3C5JB 5BZWA 4HUKB 3SYAA 5LBVA 5F6HI 3A6OA 3GTNA 1DVFD 3MFFB 3FO9A 4Z7NF 2F53B 2A6JB 4HC1H 4ATTA 2H6PB 2NCMA 2DYPA 4KZCA 4GUPA 2L8AA 3JV0A 1TZGL 1AQDB 3O4LE 3P3UA 5DJCA 2QVKA 4Q4EA 3LKNA 2K1MA 4J3OF 1P7QD 3CZNA 5SX5K 1IBBA 1NIFA 3MJ7B 2YHGA 4EXKA 4F27A 3VFRA 3DKHA 3JWOH 1E2VA 3O3DA 4Q7DA 2NYYD 2ARJQ 2XLLA 1DQVA 2NX5B 4KK8C 2YAMA 4NS0A 2BZCA 4TNGA 2XPZA 2VDRH 3ESNA 3BP5A 5DZJA 3UMNA 2ZX6A 2TAAA 5C3LD 5HHOD 5C0ND 4XN9A 1ZDSA 3ZQ9A 5I66A 4E9XA 2W0LA 2EQDA 2VLKE 1SVZA 2ICWI 1Y7VA 3GIZL 4W9JC 4MVBD 1SFHA 1WFMA 2OZ4L 4HK3J 1M7DA 3FDWA 3TO4C 3WO4B 3MC0A 3FTZA 4AQ1A 1YA5A 4PD4K 4HUWA 4X6DA 2CO2A 2YBGA 1S9VA 2DW5A 2PUQT 4JRXE 4LARH 1KGYE 3JSSA 3ULUD 4W9LC 4UT7H 2DEYX 4LF3B 4FFTA 2JI1A 4LQFH 4HS8H 2CKBL 3FRPA 1YN7A 3N1MC 4MCMA 1G5AA 3SJVA 3PUUA 4K7PX 3E2HC 3WUWB 1E7UA 3BZ4A 4N68A 4P46B 3ARSA 5H4ZA 3D18A 1BIIA 2J12B 1WFTA 2TSBA 3EJTA 3SDDB 4C56B 1MCQA 1V10A 4NQQA 4L0YA 1A6WL 3LEVH 1PAMA 3VFSA 1JBJA 3P9MB 3HHSB 3KLHC 2ZTBA 3D06A 4YVUA 4U1HA 5DMIL 3PGFH 5ESVA 4Z7QF 2C4FT 2IANB 5HVHB 3AU1B 2XTLA 1U8PB 3WKYA 3V0DA 5D2NC 3ZKMC 1QASA 4EI5B 1UM6L 1SLWA 4RBPK 4F5CA 3MNVB 5HDBF 4KJYA 3BPOB 1KIUA 5IR1B 1UQSA 3BLBA 5GRUL 4AXWA 4NRZB 1E7VA 1MEXL 5HPMB 1O9WA 3QEUA 4NXSA 2OMBA 1ZCRA 5I5MA 5IHUH 2GEQA 4W9FC 5E1IA 2VSMB 1SQMA 2Q3AA 1I9IH 2X42A 5B22A 1IGYB 4DK6A 5BS0D 2MSPA 1GS8A 5TDOA 2EDNA 3RVVD 3BAIA 2YN3A 4JFED 4P3DA 1KDIA 2RA1A 1XCTA 3FHAA 3HMWL 1DJGA 4GP4B 2GT9A 5LG1A 4B96A 3MRJB 3VACA 3MOBL 2AQQA 2AVFA 1CDGA 4K23L 3X12B 1C5BH 2NY2D 3KVQA 2P5WD 4Z3GA 2F18A 2I7SA 3VFWA 4TUJB 3T3PF 1TCMA 1SQ2N 2IGFL 2K7QA 3R4RA 5E7BA 3O41B 5LAXB 4AV4A 4ODUB 4PTUA 1FIGH 4UZSA 3HI5L 5F6HJ 3FQRA 4GG6B 4PJIA 3ATAA 4ODWB 3DX1A 3MV8D 5F88A 2A0LC 5D7SL 4I89A 5HGHA 4IRSB 1VPOH 4HLZH 4Q9QL 1RIVL 1LK2A 4XNZB 4GRLA 1F2QA 4WI0A 5JNYB 1V54B 4P23C 1WAEA 4WV1B 4IM8A 1OALA 2B5IB 2QV2A 4HWNA 2K6YA 4S1DD 5ACLA 4XB3A 4IGBA 4JN1L 3L3JA 2V6HA 4L8SB 1KB5B 4Q0XH 4R83A 1MCCA 1S9WB 2IC2A 2EH7H 4JVWA 4DVBB 5I1AA 5I73B 4D8PA 3D5OF 4KQ4L 1QTYT 2QPEB 3W9DB 3EXLA 4I8DA 4OM1H 3EDEA 3MKGA 5IHWA 1SYVA 4K7PH 2JK5B 2JB5H 1TVBA 4Q9BA 2Y7QB 4F91B 3OGCA 4LQ1A 2N0MA 1TEFA 2ICWJ 1SDYA 1JDDA 4Z7OE 1M6OB 2B8OT 2BY2A 2Y07H 4WHDA 1BX2A 4QOKE 4FADA 5E6SB 5HYJE 4U2YA 3HG1D 2ZCHH 1M05B 2BSSB 1JGEB 1E65A 2AQSA 2VXSH 1ETB1 3HE7D 1MIMH 3OXRA 2WZAA 2YK1H 2DJSA 4QRRE 3S98A 4P2QA 4PYGA 1DBML 3V52H 2CH8A 2Y3NA 3NFSL 1AKPA 2HG5B 2AJXH 5D7JD 4WWKA 2BVOA 2GFBB 1MCOH 2Y7MA 4A63A 4FJYA 5DUMH 5HGBB 3S36L 3H42H 4CDHA 3MV9D 3O3EA 2XQYG 3C5JA 1IBGH 1S46A 2HRGA 3GJFK 5JOPE 1NCCH 3HR5B 3U7YH 2ZXEB 4DVRL 1KSRA 4HXBH 1KLGA 3VG0H 1AIZA 3X13B 3PRZA 3MFFA 4NN7B 5C6TL 4AG4H 4HWZB 2A6JA 1U3YA 2H6PA 5CGYD 2YO3A 1JYVA 5LGHL 1KYFA 2C34A 1AQDA 1NKGA 2X9ZA 4ABWA 5FW7A 2P7TB 4H25B 4WNJA 3ELAT 3GTTA 1BFVL 4PJ5D 3MJ7A 1LDPL 1V3MA 5ITBH 5J13C 2X70B 5KYYB 4U1JB 4A7SA 5KVDL 5FPIA 5AVZB 1IKNC 5IESL 3C5XA 1JNHB 2R0KH 3W9EB 3QORC 4B27A 5DHVH 1I8IA 4AC4A 2OI9C 2IIJA 5IG7B 4IRZL 2ZAGA 5LO7A 3EJCA 4GLRH 4JPVL 3U2SB 5CP7B 4L3FA 1R3JB 1J12A 4LL9A 3AY2A 1VESA 5DHEA 3CE1A 2H47C 4KVCL 5EO1A 1FDLL 3ABMB 4MHHG 2ENPA 4M1DL 1CE1L 1AXTH 1JVLA 4MJ5A 1BF2A 4BGLA 3AMLA 1UACL 4KROD 5KVFH 4BSVB 4L3EA 3UZEC 1QQDB 1SY6A 4UM9D 4LF3A 5GS0L 3QR2A 3AS0A 2OSWA 4AT6A 3Q2CA 4KJWD 4Y1AB 3ZZSA 1RL1A 4XNDA 3T0EE 1G9MH 5ABAA 2VXTL 2Z7UA 2G4EA 4P5TC 3RIFK 3WUWA 1KYDA 1AJ7H 4BZ2A 4P46A 5DD0H 4NAMA 35C8L 3SDDA 5IJCC 1OAKH 2CNZA 4C56A 3MJ6A 4NWUH 1CR9H 3BP4B 5IROA 1CI5A 2BZ7A 4PV9A 2LT9A 1ZMYA 2R69A 4QXTA 5K1VA 2A38A 3CZSA 1IFGA 3P9MA 3OX8A 3WTSA 1ILUA 4MBOA 3GSNL 4BSJA 1IU1A 1R5WB 3ULAB 4G9DB 1FYTE 4UOW0 3GBNH 5D7HA 4BH7B 3DROB 1LVEA 2NY6C 4AL8H 2IANA 1H3TA 2QADD 2AXGB 2IFFH 4RGNC 4EI5A 1A25A 3MNVA 5TE4H 2O5NA 5DYOB 1FNFA 4JQIL 4MCZB 1RZFL 2VMJA 3RFRA 2KDGA 5IR1A 3BISA 1P0SE 2OW7A 5FK9A 2XXCB 2E5EA 4QXUH 3SKMA 1MG3C 4NRZA 2FHCA 1ZHBB 5HPMA 1EO5A 2H4EA 3AAZB 5FCSH 3S96A 1GKEA 1MQKL 1L9SA 1MW2A 1A7RH 1INEL 2H32H 3IK2A 4ZFOA 5DI8B 2KT6A 4XP4L 3HJ0A 4GEIA 1KEMH 3K4DA 4I13B 2OSLB 3GHPA 4X6BA 3GTVA 3UYRH 2VLRD 5C0AE 4X9YA 2DQUL 4ZW8A 4PJAE 3X12A 4Z0BL 3BX7C 4KI5F 4XT1C 3STBA 1E27A 5D4IA 4AYDC 2FBRA 4B9IA 3HFML 1GYVA 4TUJA 4YHPB 1LYQA 3K3QA 5BV7H 3GUTB 2B2XL 3F3HA 3VXME 1RIHH 2CGRL 4JHZA 5CSGA 3CAFA 1OOAA 1U8HB 2EXWD 4AMWA 3ZKXC 4M1GH 1G9NL 4OGXL 4ZMWA 1DLFL 1OF0A 2NDFA 1Z66A 1HINL 2AABH 3EYVB 3UPAA 1J10A 2BNRA 3KJ6L 4TUOB 4WV1A 1OB1B 3OM3B 3NSDA 4KKQA 4GLRI 3X1BA 3FC8A 3TO4B 3HAEH 4L8SA 2V37A 1KB5A 4DVBA 1S9WA 2SODB 3SE8L 3BW9A 2GUOB 3QG7L 3W9DA 1JRHL 3HPLB 2DLFL 1CDYA 2JK5A 3P3YA 2EKSB 1JXGA 2F54D 2NYYC 2Y7QA 3RU8H 5A3ID 5A7EA 5C7XL 3B5TA 2Z1PA 3GBDA 4FYTA 4NOBA 2YD2A 1LGVA 1XGZA 1HXYB 1M6OA 4LFHD 3RAJL 1PCSA 4DERA 5KVGH 3OKKB 2W60A 3O4OC 2V5YA 3E1F1 3QDMB 1Z32X 2XWTB 2EYRB 3E2HB 1M05A 2BSSA 1EMTL 1JGEA 1OK0A 1QD0A 4GO6B 3FKUS 3QDHA 3TWCL 4MVBC 4Q97A 2WAHA 1X7QB 4YVNA 1ZLUH 4D2NA 3IYLW 1X5HA 3GO1H 3HC3H 3TH3T 2HG5A 3DO7A 3I2CH 3MJGX 1ZK5A 4MWFA 4UIMA 5L7XL 2GFBA 3VD9A 2J8UA 2PETA 4HKXB 4JZNB 3E6HB 1F4HA 2IPTH 5AW5B 4Z76B 1DBAL 3ULUC 2X2JA 4WTZA 3L3OA 3MXVL 1R0AL 4A39A 1EBPA 3QFGA 5EH1A 3AT8A 1ODAA 3BGFC 3F58H 5D2NB 3LKQB 2C26A 2OKMA 3QEQB 3U0WL 2Q3ZA 15C8L 4OGYH 3W39B 4Z3EA 3FMGH 5A16A 1U6AH 4MNGE 2Q20A 3NDZE 2P7TA 5EUOF 5I1LB 4H25A 1UGNA 4PB0L 4TSAL 4Y5XC 3GZOA 5KYYA 2X70A 4LESA 4U1JA 5DDHB 3VGEA 1MFCH 5J89A 2LV4A 1JD9A 3C08L 4RMBA 3GUFA 2HG0A 2VCOA 2DPKA 3W9EA 1JNHA 5D2LF 1HEZB 2OK0L 2EEXA 1FGNH 5HJBA 2C4XA 1U91B 1ADWA 4MJJA 4JHUA 4DUVA 4G11A 4QRPB 2VNCA 5DS8B 3LRKA 3NJLA 4P3WA 4TRPH 2WK2A 5F96H 4K3HA 1R3JA 4PRDA 1GXEA 4BCYA 1NZRA 4L1HA 3KGSA 3NVQA 4PP2A 4KV5E 4G8EB 3ARDD 4N0RA 3UIYA 4PJ6A 4H0LC 1Z1WA 2Y2WA 1QSEE 4G7SB 2JNZA 2E4FA 3KPSD 4N2DA 4OIBA 2VR6A 4LMQE 4BSVA 4WVRA 4Q74A 4YBQD 1F0LA 4G43B 1XGRB 4EVNA 1HSAB 4UQCA 5DEFB 1C7TA 3SGKC 1KXVC 3GD1C 2C9VA 2WQSA 4P23B 4PJEF 1KEGH 3US9A 3SOBL 5HYSA 4E42B 1NBCA 3BUPA 3ETSA 4XNQA 3U7WL 2BPBA 1HWHB 3MQIA 5EZPA 5EMYA 4ES8A 1F41A 3EYQD 1WC7B 3ULVE 4IBZA 3UBHA 4OF6A 3SE4C 4P8QA 2QQLL 3K8MA 1WO2A 2YARA 1EDYA 2XTJD 5DFAA 2BHFA 1GYUA 4ZMXA 4XP6L 1HXMA 3BP4A 4KK5C 1E6JL 1P6FA 5GGVH 4KHXH 4EN3D 5LG6A 4LRIC 5DZ9A 3VFUB 4Z7WF 3F00A 1R5WA 1ZT7A 2HUHA 4G9DA 2V8LA 4XO5A 3COOA 4F7EA 2X4QB 2DLTA 3IWUA 4R96B 2VE6B 4NQCB 1FAIH 3GHEH 1JPSL 4IBQA 3ARBA 4S1DC 4FZ8L 3O2DA 4NUGL 3PY9A 4D7BA 3JQOB 4MCZA 3RI5F 1HCZA 4KPHL 1F45A 2EDQA 1A14L 3NN8B 5I71C 1SHXA 1BG1A 2ESVD 5HI4D 3FUDA 5LKNA 3D0VB 4XNXL 4MYPA 5I6KA 4ANVA 3O2WL 4ZW6A 1CTOA 3MLZL 4PBVC 4QJ3B 5DI8A 2XV6B 2YPLD 4OQ1A 4GRWH 1PDKB 1DBKH 2E7BA 4YR6B 4GIOA 5L0QC 4AKOA 2OSLA 4PG9B 1XXFC 5D7LE 5FUOL 2VLJB 2OS7A 1AGCB 3IM1A 1EDQA 2I27N 4L3AA 4L4VD 3HE7C 3FBQA 4X4MA 3I6LD 3HHMA 5J13B 2CPUA 4YHPA 4ZX3A 1OF2A 1QYGH 3OHXA 4PJ9D 3POHA 1B0IA 2BIOA 2MWCA 4I3GA 2JCCE 4LE8A 4TNWK 3QORB 2JF1A 1U8HA 2UYLB 5BRZD 3REWB 1OPOA 1WV7T 2P42B 4PGDA 3VGDA 3C5ZC 4CU7A 2OI9B 3T6XA 3WOVA 5IBLD 4XVUC 3P2DA 3WFCH 3ZDXE 3EYVA 3IFLL 1IGFL 4B5ZA 4ONHA 1Q94B 5FF6B 1B4RA 4TUOA 4NUJB 2LU7A 2ZE0A 4XN2A 4DKTA 5CGYC 7CGTA 3D30A 5B1JC 1JUFB 4D9QD 5DUPH 3CNKA 4MB4A 5T3XE 3H1ZA 2ZOWA 1CFVH 1GGIL 3N40P 5MEQB 3A4AA 2GUOA 4RRPG 3GM8A 5IQMA 1B4JH 4B41A 5DTFB 1AR2A 4DOHB 4OM0H 3BKJL 2B20A 4U1LB 3BCDA 2EKSA 4IU2B 2AXHA 3G08A 3VVWA 4UTCA 3V4VL 1HL9A 5GS0D 3KXFE 1A8JH 4R4BB 4NRYB 2A9AA 2F6AA 5JQIB 3ZRCC 1A6AB 4KHTH 1TQCB 5T5FA 4G6JL 1A4AA 3EDKA 3NZ8A 3QDMA 2YD4A 4AEHL 2EYRA 4P5TB 2EE9A 2Z0BA 4H2CA 1JERA 4BQBA 1WZ1L 3B83A 3FB7B 1X7QA 4TSCH 2JJUA 1F4YL 2Y7LA 4OIFA 4DKFH 5SWQB 2VDNH 4HJ1A 1DVYA 1X5JA 5SWZB 4K15A 4P3CL 1PG7L 1MPAL 3QQDA 4HKXA 4OKVB 4XP9L 4KROC 1BVNP 2ATKB 4JZNA 3MBXL 4K3JL 4OZGF 1TO4A 3MRDB 3MUZ1 4QTFA 7PAZA 1CFSA 5DD3L 4Z76A 1NM9A 1JZ8A 4C4UA 2ZUUA 4AIOA 1YQ2A 2NY6B 4IBSA 4HDIB 2ZYRA 3WHXA 4GAGH 5EF3A 4KJWC 4A2FA 3QQXA 5D2NA 4RGNB 2WLZA 2EEFA 1DSYA 1F3DJ 2YD7A 3QEQA 4LCWD 1GH7A 5FR3A 3HI6H 2EYSA 2BCMA 3D1MC 4XHJD 3LKPB 2WXKA 4HEPG 4XTRC 3SY0B 1ETA1 8PAZA 1DE4A 5EUOB 1JZEA 4N25A 5FM5M 1WT5A 2NNFA 1KJMB 4ADJA 1UWGL 5FOJA 3FSZA 5DDHA 1IAMA 2A99A 1JF1B 2GHZA 2CDEA 1KZYA 1UZ8B 3E80A 1HEZA 1SYSB 5TDNB 4BXVA 1ZVNA 3FQ1A 4MZ2A 2UXVA 2W65B 1S2EA 4S2SA 1HHGB 5DQJB 2OXHB 3US0A 3HUJF 4KUZH 3DOHA 4OLYL 5AW3B 4RX4D 3PV6B 4FFZA 3OJMB 1T2QL 3VXRB 2HJLA 4NNYB 2J8HA 5BOJA 1AGEB 4G8EA 5JYLA 3CH1B 3W1ZA 3QJZA 3VI3B 5F7LB 1FFQA 1WFNA 2VR7A 3D09A 4GKNB 4RNRB 3ZKXB 2VERA 2QELA 5BOZG 1XGRA 3IJHB 1HSAA 2VXUH 2F0CA 3P3SA 4W6WB 5DEFA 5B4MC 4IBUA 4HZLB 2G4GA 4YHYC 1J5CA 4E9LA 1MVUA 2P8LB 1RUAL 1NEUA 3HC4H 3I75B 5CEYB 4HIXH 2XICA 4ZD3L 3U4AA 4UBDD 4E42A 3V9EA 1DANU 1TPXC 5E8PB 3BESR 1CVRA 3BFWA 5AVQB 1GC1L 1WFOA 3RDTD 3MNWA 1P7QB 5GSVA 5EO0B 1WC7A 2WXOA 4NSKB 5G2NA 1S5IH 2DWDB 3UTTA 4V1DE 4U1NA 3TIEA 2P52A 4L9DA 3C5SB 3L16A 3L9BA 2R69H 1FZOA 4RAVB 4D9RE 2EXWC 4NJAH 3AMKA 1T5WB 1A22B 3KYKH 4OAWB 2AZUA 5CEXB 2EDOA 1ED3B 5HHOB 4DP4X 1TSHA 2VN4A 4YHKL 3IB4A 4OCRH 3UL4A 2VE6A 2XTSA 4M5SA 4NIKB 2CKNA 1DEDA 2UXTA 3D52A 5DD6B 4A2GA 3BRDA 4H20H 2VM4A 4KNSA 5DZVA 1XAUA 2J6EA 3OJDA 4IMKC 4M4RB 3S3BB 1ZTMA 1YEFH 1CFQB 1YMMD 4UWQB 5D6DC 3C60D 4OJFL 3NN8A 3F62A 3OTTA 4OT1L 3RZWA 4JJOA 3FCUB 1DQDL 2A1WL 3D0VA 3FFDA 5HHXL 2Q8AL 3QSKB 2GB2A 1UD8A 4S1RL 3MMEA 3S37L 2PWDA 1FZKB 1GS6X 2CGZA 4ELMF 4XXWC 3NCWA 2MFNA 4FG2A 3VXUA 1PDKA 2XI9A 1DTUA 1QKZL 2VRAA 2ED8A 3BGFB 3QHFL 1QRND 4P9HH 1R46A 4PG9A 3KM2A 4Z3JA 5IGXH 4ISVB 1PSKH 2HH0L 4P48A 2VLJA 1HKFA 4F7PB 1DHKA 3PCYA 3GPEA 3MREB 1LK3L 3LKOB 5J6HB 1F4AA 3MRPB 3SGDH 5MHSD 2NNRA 3POCA 4NNPL 5F3HB 2WXGA 4Y5XB 3WIIH 5H37H 1OE1A 3TV3H 5IQ9B 3U9WA 2C3VB 2BXYA 1HHKA 5JPMC 1NGQH 4KI1A 1N3NA 3QORA 1T0OA 2L7EA 4GKSB 3REWA 4PJXF 1ZEAL 2Z35A 1KTJA 2YPKB 3ARPA 1BVLA 3QYCA 4K9EL 1BMWA 1OW0C 1ZV5A 2OULB 1MCHA 1SJHB 4J2XA 4JE0A 1QNZL 2ATPB 1Q94A 4ZOCA 2JB6B 2PYEE 4NO2A 4XVTL 3VYNA 3G5ZB 1GYAA 1T89C 1G1OA 1U8JB 1B3IA 3MRMB 4Z18A 5B1CA 5E1QA 3Q8BA 1AFVH 4KK6C 5MEQA 1IC1A 3MYZA 2XXFA 1HVXA 5C3TA 1PFOA 3WY4A 2J88L 3BT2H 3UG5A 4D0DB 3CN3A 4TV3A 3UADA 4IU2A 2XZCL 4CN4A 3RTQD 4ICXA 3LVTA 3VXOB 1UYWH 5BS0B 2F58L 4R4BA 1B6UA 4NRYA 2E6JA 1J1PH 4FG0A 1DFXA 4OCNC 3CFKB 5ILTL 3CSTA 2XNAB 3EO1A 3M88A 4V2BA 3SE9L 3V4PH 4NIYE 3L4XA 4G6KL 4LFHG 3HVNA 3QNXA 1SF5A 5T3ZH 4KRMB 2E74C 1G6VK 5FYJU 3PPEA 1O9VA 1L0QA 3O4LD 5SWZA 1ZLEA 4LASH 2ZKYA 1IGMH 1IM9B 3ARDC 1E3FA 4U6TA 5AB2A 3QZPA 4AM0B 3FT2B 4MCNA 5HGAA 3MV8B 2ATKA 5D7IE 1MIEL 3MRDA 4MQSB 4YQXL 4YBQC 1DJSA 2WXRA 3H53A 2CK0H 4LDLB 1N6UA 4G72B 3RL1A 2VDOL 1A1MB 4BFEA 5F0PB 4PRPE 4PGJA 4WW2F 1PNDA 4O4YL 4XAWL 2V5RA 2DOCA 4LSQL 3ZLQC 2VMEA 4ZX6A 2IBZX 2YGOA 4FRWA 1U95A 2GUYA 3KWXA 1A3LH 3MRGB 1N70A 2BSRB 2YUXA 3HBGA 1B0GA 5F1KC 2BSEA 2BFVL 4AMKL 5JMOC 2DWEB 2VLKD 3LKPA 5I71B 1MCLA 5FUCC 5E8EB 4J3OH 3SY0A 1KJ3L 1NIAA 4OBSA 2WLMA 1EO8L 5EUOA 1JF6A 2A9NH 2R2BB 2VSCA 5BMFH 1GMIA 1J1OH 1KG0A 2PTVA 2WLIB 1R4XA 2EADA 2XVKA 2FBJL 4ENZA 1JF1A 2E76C 2VZOA 3NJVA 3LX9A 4Z7VB 5D2LA 1XF4B 3ARFC 5TDNA 5L0QB 4JRXD 4EN3C 3TYGH 1YC7A 2P9RA 4DGIH 3UO8B 2VDLB 2W65A 2XN1A 3RILA 4MJ4A 1HHGA 2WOBA 3HG1B 4MMZA 1XGYH 1UZ6E 1HL8A 4P2AA 2OXHA 2BHUA 1QBAA 5CZVL 4MA7L 3HE7B 2EDMA 5EF2A 1KTLB 2WJ7A 3GMMA 1XGTA 1YY8B 3WJJA 1F56A 4BWTA 3UX9B 4PVNA 1O7DC 4QEGA 1MFDL 5D7JB 4M3HA 3SGDI 5A6MA 4ZSOB 4L4TE 3VI3A 2BNUB 4U4IA 3E6FA 4GKNA 2EC9T 3MV9B 4RNRA 1XBRA 3C5ZB 3CPLA 5K9QI 3QE5A 5E6YA 3IJHA 3T6VA 5I1EL 4HZLA 4ACTA 3GI9H 1DVFA 1ERNA 3BGMB 2C1OB 4FYRA 4OLXH 2ZUXA 2NUTB 1ZLVK 4L23A 2ADYA 4I1PA 3PWJB 2HKAA 2JI3A 5CLZA 5FUZH 5E8PA 3M7FB 1R47A 3V0IA 1MF2L 4YSUA 1P7QA 5AW2B 4HZ1A 1MCKA 2DWDA 4ODSL 4PJ9C 1RU9L 3MX0B 2R51A 3M07A 3C5SA 5TF1H 3FO0H 3T2OA 3HNSH 5L88L 4A7TA 3K4AA 2FYVA 1M2OA 3NPSC 3X3GL 3L48A 1RZ8B 4RAVA 4WU7B 43CAB 3GSOA 5I19H 3QBTB 1T5WA 3OLEA 4PJCF 3CZFA 1DUYB 4F58L 2APFA 2WWKT 4OAWA 4UMGA 3A6CL 4Z7WA 5CEXA 5HHOA 5IIEB 3WTXA 3KEDA 3L4YA 3NJIA 4XCNB 1YUHA 1Y18B 5DD6A 4BM7A 2FWOA 3Q2NA 4LKXA 4NWTL 1K4DA 4OUOA 3PNWB 4KZ0A 1B90A 1NGXB 3AS3A 3O2DH 3BD5A 1QLEB 4OZHE 1BCIA 1V7ML 1TJHH 4X4KA 3UROR 3E7JA 3WIFA 4EI6A 2OXGA 4MNQB 3APFA 4KXCA 4KROB 5F9AC 3EO0B 3QPXH 2WC7A 2JQZA 5TH2B 3GRWL 4UM9B 4LCIL 4YFLI 4ZXBC 1H5BC 1LO4H 3B9EA 3L3KB 1KPUA 4NENA 4J39A 1NMBL 1WIOA 4F7PA 1KGUA 4HBCH 2DKMA 1U3NA 3B37A 3LKOA 3MRPA 2WZPD 1HIMH 5DHMC 2PXYC 5F3HA 4LK4A 3L4UA 4HIIB 4UM8B 4Y5XA 1CXIA 1MW3A 3ZZ1A 5JIPA 1ET5A 5IQ9A 3DX6B 3SE3C 1MFBL 2C3VA 2VERN 4HJJL 4ERSH 3VYOA 1M42A 1NWPA 3ULVL 2CUHA 5CJQL 4FQ2L 1ID5I 1QSVA 2AJYH 2PW1B 4LP8A 4XGZB 5TFSL 2WCGA 1A7OH 4KGJA 3T6WA 1SJVA 3VJ6B 3SEPA 1XT5A 2QADB 1SJHA 3Q5OA 2ZCKL 2ATPA 2JIXD 3IFNL 2OJZH 3OPZH 5FHAH 3V6OE 3G04B 3H55A 5DLMH 5HYJD 1U8JA 3KMDA 1PKQB 4G8FB 3AGVA 2Y0SA 2KDYA 2DD8H 5DVOA 5FGBA 4X5QA 1H8OA 4QRRD 5EO9B 5HI5D 4KH9A 4YSSA 4Z78A 3ZR6A 4PJ8D 2EINB 4MB5A 1MVFA 5DEGB 1E4KC 4DUXA 4ORGB 3JT0A 5ALBL 2OL3A 3SGKA 1UEMA 4YHYB 1E5CA 3VXOA 4HFUL 5BS0A 3KR3H 2XYCA 1WWAX 2AI0L 2K6WA 1FG2A 2QQKL 2X4OA 4JFEA 5JOPD 3KLKA 4KO5A 4PUBH 1GZPA 1TPXB 2XNAA 4XN8A 3QRLA 3RGVD 5F7WC 3U7AA 5C09B 4ZMYA 5T1MB 4M5YH 1SDDB 2OJ1A 1HEHC 2B16A 2P5WA 4HUVB 1Q9KB 3EGXB 2XZZA 5IOKA 3KDMB 3D3VE 1EHLL 2CO7B 4M03A 4X9IA 2LLNA 1XR9B 3TCLA 3U9UB 3SN6N 2YA2A 4K5PA 3FT2A 3GJFB 3MV8A 5KBNC 4OZGA 2LVEA 1A7QH 2VTFA 3DLQR 3MLYH 1G9NC 4LEXH 1A6UL 1A1MA 3F7LA 4TPRH 4TULH 4PB9L 2C3XA 1AZVA 3WIHL 5JOFB 1E8WA 1F1GA 3F12B 2BSRA 3D34A 3LPPA 3EDJA 4RRPA 3ZHKA 1ACYH 3U2IA 1T3FB 5DURD 3EYSH 4ZMQA 2DWEA 3C6EA 2YA0A 3LZFL 4JL2A 1I4FB 5E8EA 3VXSD 3LH2H 3RKPA 1H3UA 5SV4A 2ILLA 4HUXA 1UVQB 1J0KA 4PJHF 2F54B 2VABA 5T3XL 1KIRA 2V33A 4YSDA 2FR4B 4J3WA 2X44D 3GLAA 3T8XA 2PTTA 3PP3H 2CKBB 4ODVH 3A3YB 2AAVA 2YS4A 2H3XC 4ONGH 2Y25A 2YN5A 3HS0A 3HG1A 2XU9A 1ODUA 3FPXA 5F97E 3NIFE 4YSEA 3HUJA 3HE7A 2ZX9A 3RFZA 3MNZB 4L3CA 3EFDH 1YY8A 2DQGH 3O6KH 2FD6L 2VZVA 5D7JA 3BZDA 1DJXA 5JPMB 1JZ7A 1KYOJ 3CX5J 4ZSOA 4TOYL 4E9QA 1ZANL 5JHLA 4DPBX 4DP7X 4UQDA 3MV9A 2CBQA 4HCRL 5J11C 3PP4L 2DQJH 1AI1H 3P0VL 3HNTL 1R75A 2P49B 4X7SH 4A2HA 1IGIH 2Z8RA 3BGMA 3IKCA 4F7TB 4ZRGA 3OC8A 2R1WA 3FT9A 1FYTD 3RTLA 3VFPB 5B1JA 4HLJA 4FNLL 1WTGT 4EQ3A 3EJUA 2CHZA 4MFHA 2Y1AA 2UZYB 1MRCL 2EO9A 3FQTB 4OB5L 1GAFH 1NFAA 5B38G 3Q6GL 4PJ5A 1KTKE 3ZTJH 4IIZA 3MX0A 3AXLB 3QAQA 4I5BB 2P8MB 5FA4B 4IKKA 4HUCA 2QVIA 5B8CC 5IB2A 4WU7A 2Y69B 5C0JB 6TAAA 1MFUA 1RFDH 1JCKA 1OQXA 4M61A 3GSUB 4XN7A 4DK3A 3T2QA 1MFAH 4EPSA 3OZLA 3IF1B 2AJUL 2OTWB 1P4BL 2K4AA 4IK7A 2NY7H 3OQRA 3CBJB 4ALAL 5MP6L 3PNWA 2MIZA 4GAJL 1JZDC 1NGXA 1DZ0A 4NQEB 4ZTOH 4WK2B 4ANWA 4N0CC 4QNPE 3Q7JA 5AUMA 3ARDB 1MAJA 3KPSB 4HA1A 4WI2A 2X4RA 1HX0A 1GGCL 2CJUL 3Q3GA 3EO0A 3P73B 4XP5L 2RFXB 5CILH 4R90H 1T5KA 4FABL 1EQWA 4KDVA 2X10A 4UM9A 2W81C 2M83A 3VXMD 4ELMA 5I1DA 3SQOL 1MXGA 3L3KA 4NYLA 4OIIL 2J8OA 1OL0A 4PCTA 3QI9C 1DO6A 2OMUA 4QRTB 4ZX5A 3APCA 4M48L 3PGDB 3NCYS 3QRFM 1D6EB 3BH4A 3B7RL 3MCKB 2ZJSL 5AYUH 2QSCH 4LO9A 1S9XB 5KVEH 1F6FB 3MI6A 3A4FA 5D72L 3R18A 3DX6A 2WINB 4YXHH 3FB6A 3QXAA 4KKPA 4K94L 1D5BB 3ARFB 5E2VL 1QLFB 1XZ0B 4EN3B 2PW1A 3ASNB 2JELH 2YRBA 3M7OA 4LGPB 1KB9J 4ZMPA 4HULB 3K72B 2D0FA 1A64A 3I6KB 4MSWB 5AG8A 2F08A 4HKZB 5FDWA 1LE5A 4LLQA 1MRFH 3DRQB 4MCYB 2X2HA 5I1KL 1PKQA 2R7EB 3U4KA 2CDFA 12E8H 2FIRT 1OLLA 2PPDA