1L9SA

Crystal structure of the i257t variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLTGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9sA02
2YQBA 5I5JA 3NJHA 3QJUB 4FAAB 5AZUA 1L9PA 4DP8X 2X87A 4QLWA 1V54B 3FS9A 5TK2A 1GS6X 3TASA 1OE3A 2YAFA 3PCYA 1GY2A 2VW7A 4GP4B 2J5WA 4WTQA 2XWZA 4BXSV 2XV2A 3H56A 3UADA 2DYSB 2HLEB 2YAMA 2J56A 3CG8A 1RCYA 2IWKA 5D4JA 2H3XC 2FNWA 3X1NA 4YSEA 6PCYA 5AKRA 3QQXA 1AS7A 2I85A 5I6PA 2WSDA 3WIAA 1JZEA 3QJSB 1JZHA 2I7OA 1AZUA 2XLLA 2PP8A 5E9NA 3T6WA 2HRHA 5B1AB 5B1JA 3CDZB 1GS8A 1SJMA 2XV3A 1TU2A 1AIZA 2N0MA 2VM3A 2TSAA 3NJNA 2GB2A 3X1BA 2VW4A 4HCIA 3CZUB 3NSYA 3IE9A 3OD3A 4PAZA 2PPAA 3FT0A 3T6XA 3FYIB 3TU6A 3HEIB 3NJMA 3AZUA 4A2FA 4A66A 4G7RB 1I53A 3OMAB 4KNTA 1ILSA 1BYOA 4A68A 1XB6A 3DKHA 1RZQA 1UATA 2VN3A 3NJFA 5IY5B 3WKPA 1PNDA 1A65A 2FT7A 1BQ5A 2JFCA 4BK5C 2XX0A 4K9JA 3BQVA 2VSKB 3EHBB 4GP8B 4BDVB 2EIMB 4A2DA 3UGEA 3FU9A 3X1FA 3NSCA 1L9QA 2XVBA 3IBOA 3SBRA 3PXLA 4YSQA 1TEGA 4P5SA 1OCOB 5I6OA 2NRDA 2CALA 4WKXA 1L9SA 1ETJA 1JZFA 1BYPA 2RACA 1PY0A 3T6VA 4N4YB 4YSSA 2R7EA 1ZDSA 1AANA 4W9ZA 4F2FA 1EZLA 1OCZB 1HAWA 4E9XA 4KNSA 2VW6A 4Q8BA 3T6ZA 1ET8A 3NJLA 3NSDA 3NP4A 1JVOA 1MG2C 2DWSA 2OCCB 2X88A 4P5RA 4YSOA 4GY4A 1RKRA 3WI9A 3PAZA 1E67A 2JKWA 3TBCA 3CVCA 2OV0A 3OQRA 5D4HA 2DV6A 4E9TA 1NIFA 2UX7A 4FA7B 1QHQA 1AOZA 1KBWA 4BWTA 1GW0A 1KDIA 4GYBA 3FU8A 1JZJA 3PAUA 5TK4A 1AS8A 2FQFA 2UXTA 2IWEA 3NJGA 4YSCA 2BZ7A 4HCGA 2BWDA 2ZXWB 3QPKA 2BP8B 1VLXA 4HCFA 1AZBA 3U25A 2GC4C 2BW5A 4KO9A 3UABA 4DPCX 4QKTA 2PP7A 4AKOA 2A3TA 1MG3C 2QPEB 1OOWA 3ASNB 1PAZA 5EHFA 4DP9X 3FQ1A 4YSUA 7PAZA 5I6MA 4YSDA 3ERXA 1OCCB 1OF0A 1ZIAA 1V55B 1BXUA 4CSZA 2FJSA 4UANA 1ID2A 1KBVA 3EF4A 4HHWA 4CSPA 1NINA 1KDJA 2XYBA 3ZIYA 3CVBA 4EF3A 3FSVA 3NYKA 5I6KA 2EIKB 1SHXA 2UX6A 3L45A 1GSKA 4BWUA 1PZBA 2YAEA 1CC3A 1V10A 1MDAA 3AG2B 3N2JA 4E9VA 2FWLB 2PCFA 1FA4A 2YXVA 1SFDA 1GYCA 3DIVA 2WO2B 3EH5B 2GI0A 4GP5B 1CUOA 2VMJA 1A4AA 2W8CA 5I28A 4E9QA 4RH4A 2YARA 1JZGA 1E30A 2DWTA 2YAHA 2YXWA 7PCYA 3OMIB 2CBPA 2BP0A 3JTBA 1AZRA 1NTDA 6PAZA 5I6NA 4NAJA 1W8EA 4N8UA 3D12B 1CYWA 4A2HA 4E9RA 4F2EA 1AR1B 1GS7A 1RZPA 4X4KA 2AZAA 2DY2A 5B7MA 1AG0A 3ABGA 4DPAX 2XV0A 1DYZA 1BEXA 2TSBA 2MTAA 4A67A 4PCYA 1OCRB 4UF7C 4GXFA 3ZBMA 1AS6A 4YL4A 4L0PB 3TBBA 3ZX1A 1E5ZA 1MZYA 4AZUA 2IH9A 4F7KA 1JXFA 1J9QA 1F56A 1WA0X 4G72B 1WA2X 2QDVA 1J5CA 5A7EA 1R1CA 1IBZA 3ZDWA 1ASOA 3NP3A 5B7FA 4UAHA 3V9EA 2J57A 3WG7B 2QT6A 1NWOA 2UXFA 1EHKB 2QPDB 4HIPA 2LLNA 3GDCA 1A3ZA 3HB3B 2GHZA 3PLYA 2QDWA 2YAOA 3ABLB 1AG6A 1PLBA 3UACA 1JZIA 4ZK8A 1AACA 4DP4X 2E86A 1FFTB 1SF3A 3OMNB 4G71B 1JERA 4YSAA 1X9UA 5B1JC 1WS8A 1AZNA 1XB3A 1AQ8A 2VSMB 4KO5A 3WNJA 4G70B 3PAVA 3TA4D 3T9WA 3PPSA 2HX8A 1JXDA 3FYEB 1KGYE 1BXAA 1NDTA 1W6WA 5D4IA 5B1KA 3KW8A 4TXVB 5PAZA 2OJ1A 9PCYA 1ASPA 2FT6A 1PNCA 2AZUA 4DP7X 1PZAA 3FQ2A 2HX9A 4DP0X 3X1GA 1KCBA 1CURA 3AG1B 4E9WA 3FSWA 1JOIA 2DYRB 3C75A 3H4HA 1PLCA 2XUWA 4MFHA 3ABKB 2Q5BA 2YAPA 1E65A 3EH3B 1PZCA 4KO7A 5I26A 3CDZA 3GXUB 5I5IA 4AI7A 1PF3A 2WO3B 3RYMA 1NICA 3IN2A 1WAEA 4G7SB 5PCYA 3UAEA 2H47C 4Q89A 1IUZA 4G7QB 1NWPA 3NSFA 1A8ZA 3NJJA 4JKNA 1NIAA 2IWFA 2AVFA 1XB8A 2VM4A 4M3HA 4A2GA 8PAZA 5LDUA 3ABMB 1ASQA 2J55A 4YVUA 3BVDB 1GR7A 1TKWA 2XXFA 1W6LA 1BAWA 4M4RB 3IEAA 4YSPA 1NIBA 3NJIA 4KO6A 2I7SA 5F7AA 1M57B 1M9WA 2UXVA 3QJVB 1QNIA 1SDDB 1L9OA 2H5UA 2PP9A 1ADWA 1NIEA 1DZ0A 3FQYA 1PLAA 4KNUA 3NJKA 1ILUA 1J9RA 2ZONA 2PPFA 4DP1X 1L9RA 1WA1X 1KCWA 2CAKA 2HX7A 2BZCA 1M56B 3UAAA 3EH4B 3FSAA 3G5WA 4ENZA 2GC7C 2HRGA 4KOBA 1NPNA 1L9TA 2MRYA 3X2QB 3NT0A 3S3BB 2IH8A 1E5YA 1MZZA 3IN0A 2Q9OA 1BQRA 1HAUA 2CCWA 5B3SB 2BWIA 1OE2A 3FU7B 4HHGA 4JHUA 1YLBB 3S8GB 3AW5A 2FQDA 1ZIBA 2P80D 4HZ1A 1NZRA 2CJ3A 3KW7A 2Y1AA 3FPYA 2XX1A 1AAJA 2BO0A 5B1BB 1JXGA 2ZOOA 2BHFA 3AG3B 4NB7A 1B3IA 2GSMB 3MX0B 4A2EA 1IKOP 2FT8A 2XXGA 3N55A 3CVDA 2IDQA 4AKQA 1GY1A 1OE1A 4HAKA 2YAQA 1XMEB 4DP5X 2CUAA 2UXGA 3JT2A 4YSTA 1PMYA 4BXVA 3SBQA 1QLEB 2B08A 4DP6X 2BP0B 1A4CA 1J9SA 3ASOB 3QJRB 2PCYA 2JXMA 5I6LA 1NIDA 5AFAA 4JHVA 1WS7A 2IAAC 1IBYA 1PCSA 1SF5A 2FQEA 1ZPUA 3V9CA 1ET5A 1KV7A 4E9SA 5I5MA 4DPBX 3T71A 4DP2X 1J5DA 2BW4A 1ZV2A 2PLTA 3S8FB 1ET7A 5ANHA 1HFUA 2ZWNA 4YVNA 3S3CB 2EILB 3AY2A 2IDFA 2W88A 1T5KA 5FC9A 2BP8A 1BXVA 1IC0A 2GBAA 2Y69B 2EIJB 5F7BA 1FWXA 2IDSA 1URIA 4E9YA 3GYRA 1SNRA 2IDTA 4HALA 1TEFA 3FU7A 2PPEA 1OV8A 2FTAA 3DTUB 3OM3B 1KYAA 2GIMA 2FQGA 3X1EA 4AX3A 1A4BA 2HZHA 1J9TA 3WKQA 1ZDQA 3SBPA 2HXAA 2EINB 4AKPA 4KOCA 2IDUA 1BQKA 2PPCA 3FPXA 3QJQB 4W1TA 1X9RA 3AG4B 4BWWA 2PPDA 3SQRA 1SHWA 3FSZA 4YSRA 1JVLA 2P80A 1CYXA 1SDDA 1AZCA 2B3IA 3MBWB 2R7EB 2XU9A 3QJTB 3WNIA 3H4FA 5B7EA 3S3DB 1N70A 2AFNA 2AANA 1N68A 4NERA 1NPJA 1SFHA 4BDVA
chains in the Genus database with same CATH superfamily
1ACYH 3GIZL 5HYFA 3B7YA 2E0PA 3DYPA 1KZQA 3VXRD 1IEAB 3IMTA 1DQTA 1YNTB 2R0WL 3L5JA 2WWOA 1QPKA 5IMOA 2XV2A 4G9FE 5D1ZB 4C8XA 1CLCA 4G8FB 2GTWA 4X4YA 3MGOB 5T3XL 1OTSD 5LWYL 1BMGA 4YZFE 5JR1L 4AYSA 2ZT9C 3ETSA 5FYLE 1UEYA 1T7WA 3UCRA 2UVFA 4Z7VA 3UTSD 1C12B 2XIBA 4HJGB 4ZPVA 2A1WH 4NRXA 3NGBB 5E03A 2VO8A 4AOFA 5I1DB 1T1YA 4MA7H 3DV4B 4Q9CA 1E28B 4TN9A 3QIWA 2XG5A 3DHJA 4JGNA 2H1PH 5DRXB 4NO0B 4XN5A 3V0GA 5BO0D 2B59A 2XN2A 1S78C 3EO1B 3MCG1 3EJRA 1IB5A 2CBTA 3NRFA 3SDXB 4ABVA 1MI5B 3WFBH 4G7RB 3HC3L 5DMKA 4ZMQA 3MRPA 2PO6B 1PZ5A 3F85A 2WQWA 4Y4FD 5EBWA 3MQIA 1FPTH 4BK4A 1HQRA 4LLMA 3E2HC 2XWBA 4XCCL 4LLQA 1QSEB 4NQED 4XWGL 4O9HL 1WIUA 4TQ8A 1W0VB 1NC2D 1BGXH 1JD9A 1MJ7L 1YEHL 1G1CA 1AGCA 3SBRA 5EBGA 2Y06L 1N12A 4LEXL 2ADIA 2H32A 4U05A 1DBAL 4G43A 1IFHL 1RUAH 3ILQD 4ZO6A 2R4RH 2EUWA 4XB8A 2W1NA 4NKMB 1CE1H 3F6JA 4YSSA 4LCWA 2R7EA 4CJ0A 4KGJA 4OZGB 2WXIA 4WO4D 1J9CT 2JJVA 3ULUF 2HRPH 2YMXL 3V7AE 1F90L 1UD3A 2XN9B 1DUZB 4KNSA 5DFTA 4B50A 4P23B 1EJFA 2FIRT 3NCFB 4C56E 3WEAA 4YC2B 1N0LA 5IJBC 1JDAA 4XMKL 4QXVA 2WLIA 3CFUA 3HC2A 3K5SA 4P2RA 4YMPA 5C92A 3OQRA 5IHUL 4EBQL 2IPKA 3QXVA 4ZX5A 5DJ2A 5H35A 4WCYL 1RY7B 2NR6D 4TNVK 2X4OB 5DJYB 3NPZB 3ZQWA 4KZCA 4G8FA 4DUWA 2FQFA 5JQHC 4PREA 5H4ZA 1NEPA 3NCJL 3MLSL 4OB5H 3QDME 1I3VA 2BZ7A 4ZDHA 2AERT 2UZIH 4HCGA 4PW3A 1JNNL 3QZWA 1BV8A 4Y4KB 2VSCA 4S1DD 2HA1A 4CC0A 5A2JH 2EH7H 1UJ3A 1EK3A 4H0IA 4LHUA 4PIRF 4S1RL 1SHSA 5IM7B 3UABA 3ULUC 4KY2A 1AXIB 2A3TA 3CZLA 3I02A 5IFJA 4Y1AA 5EHFA 2WN2A 3WAJA 3S7GA 4F91B 1PZ2A 1QSFA 4X4ME 3GZPA 2YD5A 3TYGL 5C8JB 2QPFA 1QWHA 4U7KA 3T8XB 4U1NA 3S88L 4XXWC 2ICWI 1MLCA 4MDIB 3VNYA 2IADA 5IB4B 2FD6H 5J8OA 1LDSA 1PX4A 4DN4L 1TDQA 1SHXA 1TLKA 4XPAH 1TJHH 1V27A 3H7LA 3ROOB 4XX1G 3ULUE 2Y6SC 3RWJB 4NIYE 3HC4L 4ODTH 2I5YL 1EJ8A 1UB5B 3SDCD 2DLEA 1YEJH 4Z7WB 2E6JA 1SBSH 1KIUB 1U6AH 5AYTA 1NFAA 2NY4B 1YMMD 4GXUN 4L1DA 4YDZA 3GSQA 4R5XA 3HMXH 1ROWA 5FYJE 1N0XH 2WYZA 5CD5C 2AK4E 4JFXA 5F96L 3MLRH 3OMIB 4PLJD 4FTVB 5EU4A 1AZRA 1NTDA 4BYHA 5CLTA 4NAJA 2OSXA 1X5XA 1GIGL 1U8MA 4LOEA 1UXSA 5C6TH 3OR6A 5HY9B 3P9LA 1QFOA 2CRMA 3DHMA 4XB7A 4HVBA 3GSVA 3W82A 4WGVB 3TURA 2A2QT 4GRWB 2IBGA 4MJ4A 1F3DJ 4DPAX 2VZ3A 3H85A 4HPHA 5E1AA 4ZW3A 4ODSH 2AXJA 2YPLD 5GGTH 3RAJH 3LMJL 3VU2A 2NY4C 3DGGB 1YYMH 3BD4A 1FAKT 1A7OL 1L7TH 2V3DA 2A5UA 1XZWA 1O6VA 2BOLA 4A39A 4F7KA 3CC5B 3TTSA 1BVNT 4AH2B 1YHPA 3EJQA 3FOLA 4GSQA 3M7OA 4K3EL 3UPCA 1W15A 3DROA 1DJYA 1B4LA 5K9KB 5A7EA 4DKFL 4AE0A 4U1SA 4FQXA 1R3JA 4LRNL 3ATFA 1KY7A 2WCSA 5BMFH 3L4ZA 4LVEA 3L3OB 1D5MB 3RVTD 1OD9A 4ZNCD 1E42A 1RZ7H 4OI9A 2L7QA 43CAA 3A4FA 4HLZH 1ODUA 3GHEL 3MACH 4OZFB 3U0TB 4PB0L 3NABL 4G9FA 1LL1A 4RGMB 4PS4H 2WXJA 3AWFA 1EBAA 3TBYA 4B53A 1J0YA 2ZUSA 1NDGA 4DH2A 3BVNA 3PP4H 3QISA 4M4RA 1JCKA 3CBKB 3P4LA 5EOTA 4DZBA 1ERNA 1M1XA 5LB1A 4FTVE 1MCCA 2VQ4A 4L8BA 4U31A 4GQ9L 1NBVH 4G6FB 2CMRL 3R06B 1EVTC 2KMWA 4E2OA 2XVLA 1A6UL 2FNBA 3LS4H 4KJPD 3BWAA 1DQJB 3MUJA 5J6HA 1S8DB 3GBNL 1HHGA 2DQUH 5JW4R 1MIEL 5FYLL 3QNYA 3LXUX 4ZZFA 4ZUVB 1ASPA 1EXUA 4CVZB 5AVRB 4AJWA 4N5UA 4XMLL 2HFEA 1DBKL 1S5IL 4GH7B 3ZRFC 4S2SA 4ODUB 4JRYE 5LN4A 2E75C 2P47B 1KN4L 3OPZH 4JQXC 2IDCA 4QAWA 5CIPH 3DK2A 4NC1E 2FJHB 1THCA 5AALA 2ADJA 1EXUB 3KDPB 5CLXA 1AQKL 3O9WA 1TO5A 1BJ1J 3GSUA 2VLRD 1HK6A 1VADA 4NQSB 4M6NH 2H47C 4QOKA 4X9BA 3NJJA 4OJYA 1NGZA 4BFGA 5G4MA 2EDLA 1UWEL 4NI3A 3CFKA 4X7FC 4NQVA 4YGVA 2GIXA 2KL6A 3QJFB 1HT6A 4ODBD 3BP4B 1SXBA 2I60H 1OF2A 3HI5H 5EZIH 5HGBA 1LO0H 4E0RB 1MOEA 4H40A 4ZAKB 4Z7WF 2OZNA 1KEMH 3H55A 4J2XA 3IGFA 3TBVB 1NCAH 3BVTA 3CQFA 2A73A 3SDCA 4PJFB 2HLFC 1EAJA 3S3JA 5JHBA 1SJEA 5KSVB 3N40F 3OAZK 4GRLA 4PS8A 4OD2B 2DF3A 3GS0A 1QSED 2XOTA 3L7EB 1GYUA 4HFWB 3EDEA 2HVKA 3VXSD 5BZDA 1CBVL 3SBWC 1N2RA 4LCCC 4HG4J 5JOFB 4ENZA 1JRHI 1A7NL 2QPUA 2VC2L 5EC2A 4QXUH 2NDGA 5BO1H 5DJAB 3KR3H 5SX4I 3AABA 1D7FA 2MKWA 5IW1A 5K1VA 5D7LE 1Q9KB 5B1CA 1F4YL 2EDMA 1H5BC 5FF6A 2CR0A 2FECI 4C83B 3WNPA 3Q8EA 1HQ4B 3AQXA 1UTDA 1AGDB 4XHQA 3ZTNL 5I1LB 2W92A 1HJCA 2BIMA 3LDBC 3RWIB 3FRUB 1OSPL 1TR7A 2AKRA 3VXNA 4P5KA 4QYAA 4Z6AT 1RK7A 1L0YA 4U3SA 3GLEA 4NZRL 2NY5L 4X6FA 3NA9L 5DUBA 2DQ6A 4G5ZL 5D6DA 5M7QA 2F2HA 2R27A 1IBHA 2CLZA 4IIQB 3ATBA 3EYVB 3RVWD 2YA2A 3N5AA 4ZI8A 3LZPA 4PJBA 2UY7B 2XZAH 1FNGA 1BM7A 2HLAA 5D7IA 4PHXA 3QI9B 3TA3B 2APWA 1U8LB 1GW6A 3K4AA 2XICA 5KUKA 3U1PA 5AWNL 4M5ZH 3DHPA 5IHWA 4XR8C 4Y16B 4KQ3L 1RSYA 4P5MB 4QHKI 3S2AA 3ROLA 5KYWA 1HKLL 5D1QE 5HP5A 1A7RH 1XEDA 1RUPH 4YXKH 2I25N 1OTUC 3QHTC 4W6XB 4PGBB 3X3FH 3B6SA 1UXLA 3GMPA 3O3AA 4GAJL 2NW3A 3IGAB 3VQMA 3QEUA 3GPSA 5ACLA 5A6IA 4N28A 5I6XC 4FF9A 3O3UN 2VXTL 4R2GC 3ZIMA 5ISZE 4KTEH 4OIFA 1YY9D 3D3VA 2IDFA 3TO2B 2ODIA 3QIBB 1QHPA 2ARJB 3UO8B 1IGML 1CK0L 1E4WH 2IXQA 5CD3A 3ZL1A 3MRNA 2IDSA 3P30L 1F42A 1BLNB 3HG1A 4K7FA 1Z9LA 4OF5A 5ANMB 4UINH 5F1NB 3SD5A 2DEYX 1MLCB 3HZ3A 1N7ML 4MDIA 4JPKH 2KS0A 4R4FH 4YPGA 1XBRA 2XZQH 3QGVA 1QR4A 4YIQB 5AVTB 1JWMA 5GS0L 5I1KL 2NYYD 4DEPC 2YZ8A 1NKOA 2ARJA 2KLSA 3D2UD 3G6JF 4HETA 4E41B 3W38A 2IPTH 5IMKA 1MF2L 3QIWD 2QVKA 4N2HA 4XN1A 5CCHE 4AG4L 2ICES 5I74B 4PJXB 4AKPA 1IMHC 4KOCA 4G8GA 2IDUA 3H6AA 5BV7L 4X8CA 4ZYKA 1I1YB 2G30A 2NYZA 2AK1H 1PKQA 4M1DH 2UZYB 5HHME 3IJ8A 2VWEC 1PSKL 2YRPA 2AJSL 5KSAD 3EYVA 3OB0K 2QMJA 3F04A 1F0LA 3QJTB 3H4FA 5CJQH 5DC2A 3REVA 1WCBB 5B7EA 4W9DC 4JFEE 3W9EA 3UXFA 1HILA 3B2VL 1BIIA 3C2AL 3PDDA 4E68A 2G3NA 4PJFE 5SWQA 3ISYA 1ETZA 1V54B 3B9VA 5F7KC 5KW9H 5EEYA 2BSEA 2V6HA 3U6XS 2JB5L 1KLFA 3H53A 3D08A 2NXZC 1JJUA 1QZNA 3KCPA 2F15A 4Y7OC 1UHVA 4KBPA 3UADA 4AEHH 2YEQA 3L9RB 4F93B 3ZHNA 2FNWA 1U8HB 1JIBA 3MV8E 3NCCB 1DLFH 3FBKA 5AKRA 2CKBB 5IMLB 3TESA 5FLVA 5FUCC 2BNRA 3AB0B 2DTMH 2YR3A 1UWXK 4M93C 3SJVE 1XD0A 4UDTB 1DJHA 1N3NA 1ZVSA 2AITA 4KUZL 3VGHA 5DK2A 3LQMA 1DQLL 2X2YA 5CS7A 3T04D 2X4SB 2QKSA 1K8DA 2N0MA 4M1CD 2BX5A 3AMKA 3VSUA 2GB2A 1ZT1A 4Q9QH 2WVUA 2LU4A 3MCLL 3N41B 4OBSA 1NUFA 1PDKB 4I2XE 1T22A 2X38A 2RJMA 4A66A 5HGHA 3IE4A 2K7PA 3G5ZA 1XWVA 4J8RB 5AZEH 3ATDA 2EEAA 2EZ0D 3K6DA 4KMTL 1RIVH 2MFNA 1I9EA 1ZLSL 2CD0A 5GSRA 5HYSG 1FIGL 4YPGB 3OJVC 1ZHBB 3OLDA 4XPTL 3LPWA 2RIKA 2H6PB 3OHMB 2HTLD 1JDCA 2BDNH 4K9JA 1K3ZA 2R1YA 4I5BA 4MD4A 2WUBL 5H4YA 2D9QB 1MCSA 4OM0L 3SYOA 3QQ9D 3P4OB 4YSQA 3FUMA 4NCC2 1TEGA 3REVB 5I6OA 1ND0B 3ZL4H 5HVHC 4WKXA 1P0SE 1PZ3A 1CLZL 3EO9L 4LQFH 1JZFA 3QAZC 3LZOA 4JO3H 3CHSA 4WO0A 4ZMAT 3QZBA 1WD8A 5JXED 4N4YB 5FM5O 1PVHA 5TPWL 4BM7A 2F8OA 1OCZB 1D7CA 1Z9MA 4PJAB 4LNRB 4APQD 1IFRA 2D0FA 4B9ZA 3RTQC 4X5WA 1WLHA 1SXZA 1VPOH 2FX8H 2X40A 4UTAH 3TBCA 3O9WB 1U92B 2R15A 3JUZA 2GAZB 2BM3A 1IAOA 2Y6SD 2FJHA 3N42B 5SWSE 5F7EH 4JO2H 1NAMA 4GMSL 1NMAH 1AGFB 4PJHE 2A9AA 4XP6H 3B5TA 1QWNA 1INDH 3Q3GA 4PJDF 1OAUL 4V1DE 3V6FB 5F3BA 2XWXA 1VZGA 4FFVD 3R19A 4KUZH 4NKOB 3P02A 3KBHE 1J87A 4ES8A 4KKAC 1AY1L 1P4UA 3LN9A 1JFQH 3QFGA 2UYLA 3QEGH 1AR1C 4LSSL 3CVHB 3N0AA 5D70H 3MPCA 3TBWB 2BRRH 1AHKA 4GMSH 4H5SA 3O9WC 1FFNA 3KVPA 1TJHL 2YMTA 4F1ZA 1ZIAA 1V55B 2CO6B 1UYWH 1NUNB 5KOMC 5L4JA 1ITCA 4JAMA 3HOGA 4PD4K 4N2GA 1WO2A 3FCTB 3T1FB 4NO5A 4WKZB 3BN9D 3PWPE 1A6WH 4FFZA 3WHXA 1TQCC 5A2CA 3M6DA 2ZNWA 3CHQA 4YHIA 1FUNA 1OHQA 3TYGH 4FLOA 4ZTOH 3BD5A 2W0FA 5EC2B 1KJ3L 1U8CA 3NPSC 3BPOB 5DD0H 4TSBH 3SDDB 4X7TB 1J8KA 2H2PD 4QRPB 4YHPA 2HLAB 2PCFA 1P5UC 4UYQA 1GZHC 1XCQB 3GK8L 1RPQA 2WO2B 5CEZH 2Y07H 1E5BA 4UT6H 1P4IH 1ZJBA 5I1GL 4MS8C 5E2VL 1U41A 5KUMA 4F8LA 4Y16D 3SKOA 4OJFH 5E08L 4XP1L 4E9QA 4MMYA 4IIQC 1EAPB 4B0MM 1IGTB 1YDPB 4I3RL 4ZMXA 3ZRCC 3VDBA 2HWZH 3FK3A 1EEZA 1H15A 1AKJA 1MRDH 2BJML 3I6GB 3OKEB 5I8CB 4X6CE 1Y1DA 4P5KB 1J8HD 4MNQE 4OLUL 3KYMB 5IFJB 5E6ID 4BQ9A 1AD0A 1FGVL 2ZOLA 1JYVA 2DY2A 3NFPA 3VGEA 4B9PA 3A23A 4F7TA 4KKBC 2WXGA 4JFDE 4HPYH 1KCUH 1HH6A 2AXGA 5I1AB 2KUTA 3KWXA 4PCYA 3B9KA 3QCTL 3D69B 1FZKB 3QIUD 3U4KA 2Q7YA 4L0PB 2O5YH 1E5ZA 2CJSA 1ZGLB 1QMUA 3CDCA 3WN5A 1LEGA 3RWJA 4EOWL 4OTXH 5E99L 3JTTA 3BP5B 3IJYB 3QNFA 4ZDHB 4D0DB 2E4FA 2WBJD 3U4EA 5JXAH 1WYJA 2H0FA 3TCTA 4B3VA 2PKDA 3K0WA 1NLBL 3INUL 3QWRA 3LQZA 1HOCB 3C09C 1FNGB 3V4VH 1ZGLP 4HIIA 2VLKE 4TMPA 2VTFA 2OAAA 1E9PB 3KVDD 4HV8B 2QTEA 2CO3A 1X9QA 1EZSA 1MFCH 1ZE3H 4HJ1A 3GDCA 4P5TC 4HZLA 4Z7OE 3HB3B 2GHZA 3MFFB 3VXMD 3TYFA 1DQVA 1Q9LB 3TWCL 4CNIB 1OGAA 1RZKL 4WHYH 5EMYA 3L3JB 4LPTA 1N67A 3KL3A 2E86A 2OTUA 4V2CB 1BM3L 3EDDA 4LLYB 2ZWKA 3GXMA 3PU7A 3DX6A 3VRLF 2VDOL 3HE6C 3SJVA 4QTHB 3QHZH 4KO5A 3O4LD 4ELMA 3RFZA 2EZ0C 4Y9BA 2JCWA 2ZXEB 3FQNB 3D7PA 1OAJA 3TWCH 1FFOA 4XBEH 4JFDD 2BSDA 2DYPA 1I9JL 3VXPB 4K3DL 1T1WA 1R3LA 2A83A 3U4AA 4L9LA 1G7PA 3MRBA 3IMRA 3ZMNA 2YHGA 2C26A 3FQ2A 5D2LE 2FX7H 3B43A 3HR5A 5DI8B 3V4PB 2HUHA 3VNZA 4XPGL 3KYOB 1YPZB 2C1PA 1BFVH 3D6GA 1PZCA 4LL1A 5I26A 4FNRA 3HE6B 4HLJA 3VXQB 5IMMA 2Z0UA 4UB0L 1CF8H 3D39B 1DZBA 3RYMA 1UA6L 4G3YH 5T3ZE 4R4NC 2P1YA 4X9FA 3BMVA 4ORGA 1JNHB 5FHBH 4OAWA 4ZNEE 3MJ9L 4X80H 2PYEB 5LAXB 2ZKYA 4AXWA 1UFUA 1II4E 4N2IA 2VLKA 1ZLVK 2X6UA 4L48A 1E50A 1PIFA 5HI5C 1CI3M 1F6LL 8PAZA 4HIHA 1KN2H 1QBLL 1RZ8B 2WQSA 2GUYA 5F3HA 1ZGLM 2PTUA 4JZJB 3PWPD 5FO9B 4WFHD 1P7QB 4XT1C 1BAWA 4P99A 5MEOA 5ECGA 1F1AA 3GKWH 5E8EB 4BEIA 5CKGA 5DD1L 4HWBL 4JDTL 4NQEA 3S34H 4PJ8C 2EXWD 4AQZA 4I88A 1QFWI 1F6FB 3L4VA 1TOXA 1VESA 2NY2C 1YYML 2YSSB 4N2DA 1RZ8A 3CZGA 4Z0BL 5GRUL 3SDAD 1JCVA 3F58H 1LO0L 4FQXB 5DS8B 4XMPH 1P7HL 4V1DD 2HKAA 4EZMA 3L7FB 3T0ED 4DOHE 4KDTA 4OLWL 3VXUD 3HVNA 4TTGA 4Y2LA 1CXKA 4XRCB 5EC1B 5AW7B 3X2QB 3KPPA 1RZGB 3NCEB 2CMRH 4PV9A 3PGDA 1E5YA 4EVNA 1ZA6A 3D25B 5C0BB 3PGFL 1ZTXL 4ONFH 2YC1B 3KWTA 3K8LA 4DVRH 2NX5A 5JA9A 1CGTA 1I8AA 4J27A 4L3EA 3TNNA 5IJDC 4FXTA 3AFLA 5AVQB 5DC4B 5I8KH 1E28A 5E2TH 2OMXA 3DVNA 4ODTL 4WJKB 2BS9A 3AS0A 3IKKA 1NDMA 4HK0A 12E8H 4DJMA 4N22A 1MNNA 4UOW1 3PWLB 1XGRB 4UQIM 4I18B 1HXYB 4IU2A 4PWJA 4AUUA 5KSBA 4OQ1A 2EXYD 3VYPA 1E6OH 5IMOB 4DGIL 1CS6A 4Z7AA 3O4LA 5I2IA 1LE9B 2FEEI 3JT2A 3Q2VA 2VZ1A 3QZOA 1Q9OB 3Q6GL 2ENQA 4IKLA 2FGWH 3BAWA 4GW5A 4OLYL 5DHVH 5E8OA 1SXAA 4OY9A 1A1OB 1RFDL 4FQ2L 4O5LL 1NIDA 3AGWA 3GD1C 1G7MB 4JFQB 3TONA 1C5BH 4P2AA 1IAIH 5SV4A 1K5NA 3A6BH 4LBAA 2YOAA 4YFDB 2I60L 1EBPA 3HI5L 3EYSH 1ONQA 2FYYB 4JKKA 4XH2B 4DPBX 5JYLA 1S9VB 25C8L 2E74C 3WJMA 3BZEB 1CDHA 1OP4A 5T33H 3BKCL 3L9YA 3GDBA 3SO5A 3BT2L 4F9LA 4QRPA 4YHPB 4FNTA 5JPMA 3KAAA 4K55A 2Z7WA 1FJ1A 1ZHLB 1ZSDB 4X6DA 3UZVA 1K5WA 4NNPL 2W88A 3H42L 5L6YH 4EIUA 2BP3A 3KZ8A 2WM0A 5CHNA 3U48A 4F57H 5F9WC 1COBA 1URIA 2VDKH 3EHBD 2V7HA 3AGVA 2PYFB 1QBAA 2CLZB 4IIQA 1TQBC 3ZE1E 5D72H 1CCZA 1LTXA 4ZAKC 4Y8DC 3TIEB 1KN4H 3OPZL 2VDQH 3GS7A 1AD0B 2ZOLB 4GINA 2ZAHA 2F53E 4PV9B 1V7ML 4MJ6B 3RZCC 1QEWA 4MNHA 2QV2A 4KZDL 3IDMA 3VQ2C 1IEBA 3VWKC 1EEYB 1KGJA 3JYBA 2WMPB 4W9HC 1DUZA 3EHBC 4GLRI 4MJIA 1OO2A 2KZWA 2ZE0A 3K6OA 2CBQA 5ESAB 5SWSB 2Z31C 4EUPG 2BNRE 3EDKA 4NKMA 1CYXA 3HG4A 5GS0D 2IG2H 3DBSA 4XN8A 5D7EA 2AQPA 4E0RA 4JO3L 1I9IL 1QLRB 3JV0A 3MLYL 3S3DB 5AZ2L 4JG5A 3E7JA 4AUYA 1G4MA 2AANA 3WFEL 1R5VA 2XV6B 4PLKC 1NBYB 1KTJA 1LXMA 3IDGA 3QDAA 3QJFA 4ZUUB 4FMFA 3PHSA 4PYGA 2X87A 4FFYA 3CWGA 5HJDA 1G7HA 4FXGA 1MFEH 3AREB 2Z7UA 1TT6A 3S37L 3SGDH 3L3JA 2RHEA 4PGDB 1A6TB 3CBJB 3FN9A 3NUKA 5I8OH 2ZXQA 2D9CA 3QYNA 2EP6A 1CFNA 5DMIL 3T5WA 2JF1A 1MWOA 1UKTA 4N25A 3BAYA 3JWDC 3MV8A 3QQXA 5E8NB 2IEPA 2LU7A 1EV2E 4N24A 3UZQA 2HVJB 5IFAL 3BQUA 5GIRB 5J56B 4I9WD 3VD5A 5DZLA 4AL8L 1CQKA 2WLYA 5C9JB 5DHEA 5DURD 4ETQB 1M7IA 1NFIB 5FGCB 4A6YB 1KB9K 1RZKC 1S7WA 2B1AL 2XXMB 2ZF9A 2PUQT 1CG9B 1DVFD 3C6LB 1AIZA 1JVKA 5HTSA 4ZFQA 2Y36H 3X1BA 3BGFC 3ULUD 5ISZD 3FTGA 2B8OT 1XGYL 4IRSA 3UTQB 2NY6B 3HAEB 2EUVA 2PPAA 2YPKA 4XAKE 3QPXH 5AW4B 3VI3E 3TU6A 2HVJA 3HEIB 3LQAC 3CLFL 3LX9A 4HZLB 1JPFA 4PJCB 5JDSA 3TT3L 1VEOA 1SUHA 2OXHA 3W2DH 3KJ4C 2NR6C 1S7SA 3Q1SH 1QP1A 3FUFA 1K2DA 3UH8A 4NWTH 5J12C 4XNQB 3X13B 2EE9A 1XXDC 3GSWA 4O58H 5CILL 1GHFH 3HN5A 4CGTA 2F7QA 3WUWG 2VXTH 3WKPA 4PLOB 3WNNA 2X89D 4CAGA 3QZMA 4MAUH 3SJVB 7FABL 1D6VH 4R2GD 2UZXB 4Y16C 4NKDB 4X9IA 1CN4A 5ESQB 1E4WL 3FU9A 3LRKA 1HL4A 4CGUB 4DGIH 2XKSA 1S7XA 1L9QA 1FFOB 1I3GH 1PG7L 1RPKA 2PWDA 2FSEB 3O6MH 4NSKA 5T3XH 3MOQA 1QLRA 1TCMA 4RFEB 4OIAA 2QQLL 1BHGA 1QASA 4AITA 1KJVB 5IWLC 1IGYB 5TQ2L 5E8EA 4L37A 4JGJA 4UQCA 3QJOA 4ENED 4NN7C 3MO1B 2PYED 4PRAB 2EO9A 3LHAA 5F1SA 3B5HA 1X9LA 2OXGB 3GPEA 2I07A 3UTZB 2VQ1B 1RHHA 4OCNC 3KPLA 3MJWA 1NDGB 4X6DE 4BUQA 1EJOH 3OSKA 2EH8H 2IQ9H 2MNUA 3QUMB 2DD8L 5DK3A 3C5ZA 1JYXA 4AJYV 1QSVA 3G5ZB 1A6AB 5I30H 3VRIB 1NCWH 2VRAA 1T89A 1IGFH 3A6OA 4POZD 3Q9PA 4KK6C 4PJEB 3D39A 3OLGA 2EKJA 2Z4QB 5CGTA 5HDBB 4FA7B 3HC0B 3FQXA 4CN4A 4MS6A 5I5RA 1EHLL 3DETC 3MYJB 3L3OA 4OF3A 3GBDA 1D5IH 4AMWA 1A6TA 4ZFZB 3D9AL 4NUGH 4G5AA 4PJXE 4XP9H 5EUOA 5BUAA 3VXSE 3NESA 4UINL 5HYSB 5ICYB 1KPVB 4NZUL 1QSEE 5HHVH 5DRNB 5KBNC 3GUTA 1S5HA 1KTKE 4UDTA 4KHXH 3BAEL 2IANE 1O0VA 1VJSA 2EDRA 3P9WB 5DD6A 1C1EH 1KCRH 3BEWB 4AKOA 3GEWB 3UDWC 3FW6A 2QPEB 4UI2A 1BZ9B 5TTRA 2NUPA 2NXZB 3BP6A 4JFFD 4TOYL 2Z35A 3WDIA 1ZS2A 1G7QB 4BH7A 5AKSA 1TG8A 3AITA 5CEXA 1MCOH 4MMXC 2H32H 4NO3B 2BSBA 3MV9D 3TJHD 4IMLA 4LVOB 3Q06A 3KLQA 4A6YL 3BKYL 3W9EB 4QRSA 4DAGL 5AKTA 1NCAL 4AMKH 2J8UF 3EIFA 3MV9A 3IS0X 4AMXA 3TBSB 3CAFA 3HBQA 4GAAA 1DBAH 2CLRA 3FRPB 4L4JA 3UJIH 5HHQA 4UQ3B 5EBLB 3LTVA 4NQDE 4JFQA 1JK9B 1BJ8A 4IJ3C 2VERN 3IAQA 2V3FA 3M1BB 4F37F 3IDJA 2BP0A 1IM3D 2X1XR 1I1CA 3O3DB 4X5PA 1LJMA 5E5LA 1DTUA 3F7LA 3RE0A 1D5ZB 4OD2A 2Y0SA 2AZAA 2RQEA 3MV7B 1A2YA 4G6ML 1WBYB 3ABGA 5BNXD 4JAMB 3D0VB 1D7BA 2FUQA 1A66A 2MTAA 1WPCA 3EZ8A 4GXFA 3N85H 4UF7C 5TDOB 5HHXL 2D3NA 3PWLA 2FLRT 4Q7DA 1UCBH 4POZC 3H2PA 5J1AB 1J9QA 2NTFB 1F3RB 4P0DA 4GFTB 3U7WL 1QUPA 3Q3GB 3ZDWA 4BELD 4YDLB 5E6RB 5EUOB 4ZMPA 4UAHA 4G6FD 5DQDL 4M4PA 1UT1A 4MMYB 5FCUL 4AYDC 4NBXB 4JGMA 4XPTH 1H3GA 1EHKB 4JFYA 5FLUA 1TTCA 3VD9A 4EIBA 2EEBA 3D4ZA 5CJOL 4U1MA 4Z7UE 1NLBH 3INUH 3DTXA 4DOHB 1F3JA 1VKXB 1AVAA 4PRHA 4UBDC 5IZ7A 2CIIB 3LEYH 4XBGA 1RZJH 1A6UH 1JZIA 1JHTB 3FTZA 4HMEA 4ELDA 5C71A 2ESVE 1LO4H 2P5WA 2OKMA 4YSAA 3L5XL 5DSCB 4LVHC 4JDEA 4LEOA 3P77A 4IEFA 4UTBL 2BY1A 1RUKL 4U2ZA 5TQ2H 4HPOL 3HI1B 3V5DB 2A74B 2R2EB 1C5CL 1V7NL 4P2OB 1JXDA 3ARED 3GNML 3N1QC 1NDTA 1K6QL 4PU2A 2X4TB 4WUKH 4XAWL 3JT0A 4UDUB 4FFVC 3S8WA 1XGPB 3SN6N 4QRRD 1FZMA 4MA3A 3LN4B 4JO4H 4NHCH 5BQ7B 4CBPA 1RUQH 4N2EA 3SQBA 3EG9A 4OV5A 5T1LD 5IB5A 3RWIA 3RWGB 1KCLA 1WIPA 3JV6A 3W39A 2QJDA 4HFUH 4FXGC 1T0PB 4S0TD 1HC1A 2BHUA 3RVUD 1C08B 3FFOA 2BVYA 3O3EA 1XR8A 4FQCL 3PIQA 1JHKL 1A9BA 1DL7L 5EU3A 1P7KA 2CPUA 4JM2F 1E0OB 3VH8B 4I18C 3MOBH 3KYNA 1E4KC 1K9TA 2FRGP 4PJCE 5I5IA 5IBLD 3LKQA 4PG9B 5ERWB 2ZPKL 4WTZA 1P4IL 1RHFA 3KJ6H 3KD4A 2BC4B 1CGYA 2Z7YA 2YPKB 3NSFA 4JRYB 3B9KB 5CU9A 3CZEA 1H5BB 5DQ9B 3NFSH 4JKNA 1NIAA 1JUFA 1W91A 4OT1H 2DMCA 5CKAA 2N7SA 3PIQB 3GSNB 3DX6B 5IHUH 5KVDE 2DQIL 2FEEL 2JI2A 3FUHA 4QIRA 3VXSB 1DDHA 1E43A 3SDDC 3CN3A 4L1BA 2OR9H 1XGUA 3CXDL 1TZHB 1NBYA 3QIBA 5BRPA 1J10A 4XC3H 2AJYH 4PJ8B 1LMIA 5F7AA 1IAIL 2JV6A 3FQWA 4F3FB 1HCFX 3P0VH 4JJOA 1MCDA 4YDKL 1QNIA 3IGAA 1NCBL 4WENB 3V10A 4RRPM 4X6EA 4NPJA 2PP9A 1ADWA 4UMGA 4JE0A 2ZWSA 1N5YH 1UWFA 5IVXF 2IAMB 2GVYA 3KDMB 1S9YA 1SXNA 3U9UA 4LHQB 4JO8A 1IRAY 5BUGA 1Z66A 5IEHB 1UFGA 1HILB 3A0OA 3O6LH 2PCFB 3AS1A 1J05A 4J3BA 5CN1A 4AVKA 1VGKB 3KL5A 2DQGL 1M05B 4GW1B 3QQ9C 5DQJB 5EIIB 3T0BA 1UWXH 3CFEB 3TGXA 1JPSH 5I71B 2BNRB 1BPVA 2GTZB 3MJ9A 5L2KD 2CCWA 3ZE0F 2FD6L 5B3SB 1QLFB 3V7MA 4FQLH 2NY3B 2XA8L 2E9GA 1GGCL 5AOLA 3RA7L 1SUJA 1M6OA 2IPUK 1ZVSB 3MA7A 2BO0A 2HH0H 3O0RL 3WMPA 2DM2A 2X4NB 4O02H 5BS0E 3HC4H 3LN4A 4OV5B 4DFHA 1WUNT 4KK5C 4OZ4A 1WD9A 2C3VB 2IH1B 4YHOH 5IROA 3WE6A 3FCSA 5GSVB 2AGJL 4H8WC 3ZSTA 2AV1B 1IV8A 3BN9C 2F54E 3LV3A 1UKSA 2VH5L 3C5JA 4KZEH 1UKQA 2CUAA 1QSFB 4PWHA 2UXGA 3E80A 3UBXI 5I0WA 5JLZB 2VN6A 3GNMH 2AAVA 3BEWA 3V4LA 3ECBB 3RVVC 1C8PA 1P53A 1UB5A 5I0YA 4N0CC 1KCVL 3SCMD 2Z9TA 3DBXB 3ZQ9A 2VR9A 1AR1D 2MTPA 3CIAA 3T65B 2V9TA 2PCYA 5I6LA 5L9DL 3BZ4B 4BFOA 3RGVC 3U0WL 4ABWA 3D2TA 3ZDXF 5HHPB 3MYJA 5GRVK 5KVGE 5T3XE 4QDGA 5I0DA 2IGTA 3V7AG 3ZE0E 3BPCA 1SLVA 4FQ2H 5DLMH 2P46B 1ADQA 3RKPA 2JIXA 4LOFA 4NQTA 3L1EA 5E8PA 1VGKA 1CDYA 1N7MH 3ECVA 3HMWL 1RUKH 4IOSD 3TA3D 1V5JA 2UY7A 5GJSL 1HOEA 2ESVD 3VCLB 2CIKB 4MZ3A 1QSFE 5ITFB 1FWXA 3KDMA 1G5AA 1WTLA 2IOOA 4PJHF 4OKVA 4E9YA 5DRNA 2R1WA 2E7LC 5IVXE 5I2IB 4KZDH 2D3VA 1TEFA 1AGFA 1HHIB 2I27N 1WBXB 3H3PH 1N59B 4ZXBD 2V2WA 3PGDB 5K93A 3T1WA 4ONFL 1J0HA 4FCAA 4JHBA 2FHBA 1CGSL 1TTGA 4NZDA 3HHMA 1DQML 2ZOWA 1N4XH 5FS5A 2CHDA 4OSUL 4APQB 2VXSH 3MAWA 2ADYA 1XF3B 4J2QA 3VD4A 4TVPE 1T66D 3QUZD 3DRQB 5JQ6H 4HKJB 5FYJU 4WV1B 1N6UA 3O8XA 4YHML 1BGXL 3WEOA 4PJAA 5ALBL 2P8PA 4FA6A 1S9XB 4NQCE 2EUZA 1PYWB 2WQ8A 3TJPA 5AAMA 1AXTH 4LZKA 5C0CB 5BZZA 1CD1A 4TUOA 1ADQL 3V2AR 1JGEB 1GH7A 2A9NH 5J0BA 1ZMYA 4IRJA 2Y7NA 3QSKB 3D4GA 3WE6B 2XG4B 2QPSA 4HUVB 1NPJA 1SQ2N 4UT7L 5KG9B 2UUDK 2F1BA 3BXNB 4M8RA 4JDVB 2RGSA 4QLWA 1OWWA 1SMOA 4NCC1 3TASA 1O7DE 3ZTJG 1TZGH 3IDNB 1GY2A 4R8WH 3TBVA 1PS3A 1P84J 3EO0B 4QT5B 2QGEA 1B2WH 4UNUA 4ETQA 2FO1A 3PHQA 4XN2A 4AVIA 3HLKA 1X7SA 2QFRA 1G87A 1X5MA 1CXFA 5F9JB 3NCMA 4PR5B 4R4ND 5DT1H 2C9UA 2C34A 2R0ZL 3HRPA 3WGUB 3HI1A 4P46A 1FN4B 5HHOA 1YSOA 5BRZB 3SDXA 3GBMH 1KN2L 4GO8A 5C0GB 1RJCA 5C97A 2GEQA 3QDGB 2BSSB 1GKOA 2QZQA 3BGFB 1F97A 4RISL 2YOCA 2X9YA 1S3KL 1Q9KA 1IM3B 5IBTL 1OSZA 5KTEH 2HPTA 4EXKA 3MV9E 4P2OC 1Z5YD 4P46B 4R4FL 3K6IA 4BKTC 5IB5B 1JN6A 3QNYB 4X0NA 4NP9A 5JOPE 3JWNC 5CGBA 1ILSA 1BYOA 2WXQA 1XB6A 1NC4A 4XMPL 4Z77A 5G5DA 3WXVL 4XBPB 2BLFA 2VLJD 3P77B 2ZCLL 3CFNA 3QDMB 1QEWB 4MNHB 2O5ZH 5GRZA 1U3HC 3BQVA 1YECL 1CD0A 4LSPH 5LNGA 4AT6A 5LNEA 1SZNA 1XCTB 3HCVA 4QLRA 2OMZA 4UQ2B 4H0GA 4KZ0A 3QAQA 2VB5A 3SZKC 2J21A 2OZ4H 4CJ1A 3TL5A 3LKOB 4FXKA 5A6MA 4J7RA 5INCA 3T6VA 1MKFA 5ABZA 2OMWB 5HGAB 5CEZE 3QWRD 5DDHA 3BZDA 1HNFA 3GS4A 3QCVL 4NBYB 4W4OA 5F9OH 5HI3D 5ICZA 3D2UB 3FHAA 1T1XB 3BH9A 2D2CC 3L6FA 2KZ1B 3QQ4B 4XVJH 4TNFA 4XMWA 3G08B 5JIQA 4ZJ9A 1FH5L 1PX3A 1SQMA 4B7LA 4GXVL 3OKLA 3O3BA 3IRZA 4G6JH 4NGHL 5ADOL 4KI5D 2I32A 3L48A 1S9VA 2C9VA 4IS6A 2Z8RA 4GKSB 2ZCHL 2D7TL 2Y2YA 4XVOA 1YQVL 1HS6A 4LF3A 4HUXB 4K71C 3ZKSD 5HDQL 2Y5TB 3PGCA 2IWEA 1CFTA 2AQTA 2LVEA 2GI7A 4FZ8H 2KDYA 2Y7MA 4M5SA 4HAFA 4Q4IA 2GCYA 4G8EB 4HJUA 4RX4A 2ODHA 5GRYA 1AZBA 3BN3B 1IAKA 4WVRA 2VL5A 5CMAB 2VLJA 2VL4A 1UWEH 4B96A 3SPVB 5HHOE 5DRZB 4A6YH 1NOAA 4Y2DA 4I89A 3QRGL 5FDWB 1A7QL 3D39E 5CFAA 5L2KB 1KGCE 3ILPA 1S9WB 2Y6TE 4H26B 5E6UB 3NQKA 2WVSA 4ODVL 1T80A 1W8NA 5MEPB 4EKXA 1W8OA 2B4CL 2EIKB 4X6CB 4OGXH 3L4WA 4ALAH 1R5VB 3LRGA 3NZSA 3OB8A 2YPVH 4H88H 3BPOC 4N8CL 5D2NA 2Y36L 4I13B 1ADQH 2ZIDA 3BDBA 5D7IF 3MFGB 2BOBB 4H8HA 5D7JB 4XX1E 2J43A 4ZX3A 4I9WE 4W9JC 5LGHL 4JFSA 4OM0H 1KUMA 2FAUA 3O4OB 4G9DA 2J1ZA 2IPKB 3KJ4B 1TVBB 1E2VA 5C08D 1IGYA 3HB3C 1Q72H 2CBPA 4JFEA 1CD8A 4X0KA 2WJ7A 1OM9A 4MXQC 1D3CA 4P06A 5D2NB 1MCLA 3L7FA 3FT4A 3G9AB 3ZE1F 1JGVH 1W8EA 5IROC 3D12B 3CC5A 4KMQA 5D70L 1RHHB 5E4OA 5GGSA 2BS71 4YHIB 1JZ8A 1QTYT 4BHUI 1M6OB 3H8NA 3LKRB 4JK0D 2GK2A 5JZ7D 3RPIA 1G7LB 3F7YA 3O6ML 3GRWH 3FCSB 3FMGH 3U79A 3WBDA 5AEAA 1A7BA 1MAKA 3DYMA 3HNVL 3WJLC 1FYTB 2YO3A 4OFYD 4OQTL 3T4AB 3TVMD 3SDAB 2QQNH 2XWCA 2W9DH 4UNIA 4F8PA 5JIDA 1AD9A 3S48A 1RUAL 1FG9C 3FHEA 4JRLA 4MCZA 5DJ2B 5LCVA 2Q8AH 2DKMA 3QZNA 4D8PA 3EJTA 3T4YA 1LYQA 4FC3E 4HYTB 3QI9C 4E42A 4ZS6D 2VDKB 1J5HA 1ZHKA 3CU7A 5FO7B 3CX5K 3TV8A 1CFTB 4S10A 3FTUA 4YHNB 5DJYA 2NNCA 2WW8A 2D4DA 5E2VH 4TRPL 3SGDI 3A21A 5GISH 1IL1A 3RWDB 1VFBA 4HIPA 2LLNA 2QR0B 2XKNA 4JLRB 5AL0A 1FFRA 5F93C 2AI0L 2Q3AA 3EFFB 4S1SL 5FUOH 1NCIA 1NL0L 1DQJA 1JS4A 2XC8A 3O6LL 3ZTJH 2VAAA 3A6BL 2VQUA 5CAYB 5A6LA 2X7LB 1G1KA 3T0VA 1WC7A 4GG8A 5SWZD 3QRFM 1BOGB 2YA1A 2H6PA 2YPVL 5IVXA 5I15H 2QHRH 4LEBA 3D34A 1XB3A 3ULVD 1CFMA 4N6RB 2GK0A 5AOJA 5DHVB 4GNKB 1QRNA 1KYOJ 5LGKA 2EADA 2JJTA 1A1NA 1KGYE 4LSDA 4ERSH 3FU6A 2B9BA 1IJ9A 1TTAA 2DD8H 4HJ0D 4OGQC 3G6AB 4XNUL 2FJFB 5GZOC 1WFIA 3DETD 1FDLH 1WFJA 2A6DB 3X1GA 4OF8A 4XODA 2PXYD 4YHOL 1M2VA 5C3LD 4KO7A 4KH2A 1IIIA 2PNDA 3DROB 1TFPA 5EZJB 5KEZA 4FYQA 5F7NC 2Q3XA 3ZE2F 4BBWA 2VXVL 4ODSL 5CSZB 4FQQA 4NUJB 2HRPL 5GPRA 2X4RA 4C4KT 2OR9L 4V2BA 1I1FA 1SEQL 2XG5B 3L17A 3D48R 2LTQB 3WL9B 2NY1B 1D9KA 5GZOD 1EDHA 4M7ZB 1YN6A 4JM4L 5D5MB 2R0LH 5C0FA 4GUQA 4G8GE 3LH9A 3GIVB 3LH8A 2AJZA 4A7TA 1X6LA 3FTSA 4J3OD 4TM9A 2ZUVA 3OKKB 2VNCA 4JPQA 3RPKA 3RFRA 4HXBH 4O4YL 3V55A 2OMTA 1JZ3A 1PZ5B 3RY5A 2XZZA 3QJVB 4UV4L 1NOFA 1FRGL 3HS0C 2QGDA 1SDDB 4K5NA 2X4PB 2DQFB 2V5YA 1G9EA 3CBRA 5C0CD 4Y4FC 2DQDL 3Q2WA 4M5YH 4HCRL 3GMQA 3EJYC 2Q2EB 3IFLL 1JZ6A 3JTSA 3C5SA 2BZCA 5KANG 3FULA 5D2LA 1MWAA 5J13B 4ZMYA 2DQCL 1J0JA 2GEEA 2MRYA 2XBTA 1MH5A 5HHMB 4KI5F 3ALXA 5ICXB 4DGWC 5GJTH 2XY1A 4TUJB 2NXYB 4KRMB 1IFHH 3L2LA 3C6LA 4G5ZH 3MRGB 3VXTA 5DSCA 2EDQA 1QNZL 1MFBL 4WFHE 2JJWA 2VSDA 2X28A 3HI6H 4RAUB 1U3NA 5K9QI 3LH2L 3AU1A 1UCBL 2WZ5A 5EO0A 4LCCB 2CGYA 4M02A 4MAYD 4YDJB 4UM9B 3U6RA 3BCDA 1DQQB 5JZ7C 3IYLW 3CX2A 3TTYA 5KVDH 2IDQA 4HPOH 4G6KL 3UTTE 3WSQL 5F89B 4W4OC 1IKNA 1ESOA 2Y7QA 4HAKA 4WI9A 2DPKA 1DFBH 1T21B 1XCWA 2Z31A 1U8NB 1PD1A 1FFNB 2AEPH 3SPVA 5T3ZD 2XIIA 5E9DD 3JWNH 2B1HL 4TVSa 1HKLH 4W68A 2PWEA 3B2VH 3NOIA 4OGAC 1MIMH 5E0QA 3P2BA 5GGSY 1A4CA 5ISZB 3E3QE 4UCFA 2QSQA 2HG0A 2OMYA 4BFEA 2H0JA 3GMNB 1EEUA 3CUPA 1P6AB 1A6PA 2MOQA 1P4BH 1I7TA 4HIXH 4U7SA 2E56A 5CUSL 5D9SA 4JN1L 3L16A 3TPUA 3GF8A 3I75B 1IM9D 4AVHA 5DVLA 4OZGA 3MO1A 2C3GA 2QSCL 3WIHH 5B8CA 4WW2A 2V9RA 3OC5A 3RZCD 1FE8L 1W2KT 4NFDA 1A4JA 4M61A 2BY0A 4JDZA 1SPDA 3FL7A 3V5HB 2Q0ZX 3X14A 2ITCB 4FJZA 1NCWL 4RBPH 3GSNH 5GHWL 3AY2A 2HJKB 5A3ID 5KVFH 1GZHA 3GTVA 3SDYL 2ZXAA 1AYOA 5DJ6B 4ISVB 3BE1L 4LCUB 4RMSA 5CP3A 4ATTA 5I1LA 3W5MA 3BFQG 2ENPA 4ODWB 1FORH 3D69A 1J1XL 4L05A 2EDWA 5D7KD 1BF5A 1CO1A 2GCYB 4G8EA 3ARUA 1KY6A 2V5MA 1AQDA 1WRFA 1S9WA 2P24A 4MCNA 4JANA 2JKSA 3R18A 5KBMA 3TT1H 1Y0LA 4TUJA 3RIFK 3ZUCA 2JLLA 3WXVH 1GCFA 1M4KA 1GGIL 1OAYH 2EE2A 1MHHB 3IDXH 4HUWB 4JFPB 3V0WL 1C7TA 2IFFL 2W5PA 5D2NC 1A4BA 1Q0YL 1Z9SB 3MRDB 5MEQA 4WO4B 2VLKD 2WXNA 2H9GA 1BEYH 4MXVE 2HXAA 4JPWL 3MRKB 1OGTB 2XN9D 3S37X 1ICTA 1SGKA 3IJSB 3GC3A 4ZG1A 1INEL 2ATPA 3A4EA 4W1TA 2BNQA 4KI5C 2PPDA 1SHWA 2IBZY 3QUYB 4J39A 3WNIA 4AQ1B 4F3FA 3H7BB 3E1ZA 4ENEC 5I6XB 4ELME 4DN3L 4UUJA 2R0KH 4CMMA 4NERA 2W94A 1TQUA 4Y5XB 1X5LA 2DWDA 2PABA 4U1KA 1G9HA 1N6QH 1DANT 2YAFA 1J8HE 4MWFA 2ZKXA 3B9EA 2HLEB 4U7MA 1TYRA 4R4BA 5CINH 3QBTB 4WEEA 2FATH 2NW2A 2NZIA 4ZSOB 5KS9A 3HZMA 2CDGB 4G8IA 3ZY7A 2AQNA 3CFMA 3LNHA 1Z9PA 3T77A 3GSNL 4W6YB 5GHWH 3VXQA 5IMMB 1U93A 5JNYA 1A8JH 3IGLA 1JGDB 1NPUA 1Y6NR 3VMOA 5D7SH 2FJUB 2W95A 1GPOL 2NX5B 4O02B 2B0SL 2V7NB 1NGPH 1JPTH 2X1OA 3HBPA 4LSTL 4NUQA 5IFHL 1Z6JT 5I1HL 3QXWA 4MDJA 4HJJH 2V37A 4K15A 2P44B 2VERA 2OX5B 4Y19D 4TQIA 1YECH 3H54A 4U4IA 3RB5A 4TLTA 1WZ1H 4LPWA 4JY6A 4AC4A 3WO4C 1JGDA 1EERB 2HJFB 2A7BA 3AQYA 3NJFA 1JF1B 3HG5A 1Q0YH 3EJUA 3UZEA 4CRPA 4WI2A 2UY6A 1G94A 3T3PF 3BVNB 4O2CA 4M03A 2EIMB 4E41A 3RKDD 1LILA 3LAFA 1DFBL 2BS8A 4P9MH 1GSMA 1MCKA 3STLA 4D8OA 4X8GA 1YEJL 3H7BA 1PD0A 1YNLH 4HC1L 4A2MA 3Q2LA 4Z3EA 5FYKD 3LSOA 1KLGB 3GXFA 5KJRH 2CGRL 4XGZB 3IRCA 5K1JA 2BNQB 1HEHC 5D6CB 2APXA 2BVEA 5DLLA 2C9RA 4YUEH 5EWIH 2DMHA 4YGAB 2HFGH 4KQ4L 2UZYA 1PYWA 2OCCB 3DURB 5DMJB 1OAKL 4JZOA 4Z5RB 2P28B 4R0LC 3MXWH 5E8OB 3ARFB 3VM5A 3W5NA 5EIVA 5KYUA 2BHZA 3W1ZA 1I9RH 5I9QB 5CFHA 2RA1A 1F8TL 3BAKA 4X42A 5IB3A 3D18B 1KCRL 1HZLA 3RX9A 1AS8A 1UA7A 1CXEA 4PGCA 4R7XA 1HWGB 3CQQA 1OP5K 5DMGD 4ZW7A 3K0YA 2OMUB 3MJ7A 3M1CA 3IVKB 4O5LH 5C0JA 4X6DF 5J7CC 3IFNL 3LEVH 3FN0L 3DMMC 2E9IA 2F58L 3ASNB 3DVNB 1I1AB 1QACA 2DLFH 1W0WA 2Q3ZA 5CSGA 1N18A 2KBGA 5CBEA 5BCAA 1JMXA 4HJTA 1OCCB 2GY7B 4CSZA 2PYFA 3L1OH 1DEEA 5SX4H 1R33A 4WFED 5DVPA 4MYPA 4YWGH 4KK9C 2XYBA 4GKZB 1I4FA 3P4MB 2NSMA 1ZEAL 1KWGA 3MLTB 2GSIA 1KBGL 1SBSL 5AW6B 1XL6A 4OU3A 1BDYA 2MOGA 32C2A 4KY1L 1CTMA 4JFUA 1V10A 3LZFH 2C4FU 4EKJA 4HJEA 3ZTCC 2R2BB 4Y1TA 1Y6KR 4CU6A 1WGOA 4MZ2A 5TQ0H 3SOBH 2JJSC 2ICWA 3MNWB 1AZZC 1HWHB 1ZEAH 3MRHA 2P7TB 4Y19B 2W8CA 2A4EA 3NCWA 1KT2A 3LEXA 5FOBA 2WANA 1I7TB 3BIKA 5MP6H 2OTPA 3RU8L 1U92A 3MV8D 4JHAH 5CWSB 1BAFL 4D3CH 2YXWA 4FXKB 5CCJA 1MAMH 7PCYA 3FNKA 3C8KA 3FO1A 2QMKA 1ND0A 3MREA 1GJIA 1LQBC 3L5HA 4B95C 1N2RB 3MRCA 5CP7B 3CZFB 3DIFB 4AT6B 3ETBF 4GRMB 5FA4A 4JPVL 4JQIL 3X11B 1T1XA 2OLDA 5KJ4A 1AH1A 3M8OH 2CHNA 4YZFF 2PF6A 4YX2H 2AKRB 1CDBA 3ARXA 3DUHA 3K2KA 4FNLH 4HWUA 4WU7B 1JZ4A 3VW3H 1A7PH 3OC8A 5HD8C 3ZUNC 3V6OE 3GTTA 3ZBMA 3CN0A 4N87A 3FQRB 4WDIA 1F8TH 1UUSA 3TBBA 3IMBA 2ORBH 5CJXC 5DZPA 5L2JB 1CLZH 2GAZA 4AM0Q 5I1CH 5M94B 5HHMD 2IVFC 1J11A 4FZEL 1DDHB 1QFPA 3EJCA 2JKXA 3TEUA 3Q01A 3HN8A 3O3BB 1V3JA 2G75A 4KXZI 3VWKD 1NFDE 4XBPA 4HKBA 4S1SH 1E6JL 4TQEH 5FUOL 1GOGA 1HQ4A 3I6SA 4C4BA 1MW1A 1TU2B 2WOBA 4WW2C 2HFGL 4N9GA 2E9WA 2NY0B 3OXRB 1JDDA 2FSDA 4JVUA 1VFAA 1NANH 4P5MA 1XGQB 4KJPC 1FIGH 4AYMC 2X53A 5FDWA 2ZYHA 4WFGE 1JRHL 4HS8L 1O6SB 3HE7D 3P0YH 3ARBA 1IBGH 1OTTD 3PLYA 1KTRL 3B9KC 1EO7A 1X4YA 3CVHA 3TBWA 1C5CH 1J05B 1V7NH 4ZK8A 1AACA 1DVZA 5JHLA 5DDHB 4WNQA 2VKWA 4AMKL 4FCHA 3UJJH 4LDEB 1LD9A 4AQAA 5F9WB 1JF5A 2NCEA 4XHJD 3PAVA 3BLPX 2Z1KA 3PPSA 5IIEA 3AT9A 5DMKB 5KVEL 1TQBB 2CRIA 4JBSA 1ORQA 2MHAB 1JG9A 3F6IA 2ADIB 2H32B 4MB3A 1FH5H 5IESH 2ZKHL 2EICA 2H8PB 5CEYB 2ARJQ 5CCKL 2HMIC 4UZUA 2X9ZA 1OP3K 2KLRA 4TSAL 1KCBA 4MAYC 3MRQB 3EXJA 1CURA 5IR1A 4YHNA 5E94B 4BZ2H 5DQDH 4H8UA 4M7KH 4A7UA 1M7IB 1BOYA 1TZAA 1I9RL 3F7KA 4RA3A 3OJMB 4LSUL 1K2DB 3CLWA 1FBIH 3CSYA 1OSYA 4PG2A 1HHKA 1UVQB 1T1ZA 3QEQD 4JG1H 43C9B 5CM1A 4G6MH 4IJTA 3DGDA 4G8AC 1MFAL 3E1F1 3QZPA 1LEKB 2WBWB 4APXA 4F2ME 1CLYL 4NP4H 3CVHL 1N5AB 2WXHA 1ZLWH 1ZT1B 5ETUB 3VFSA 3N85L 3ZTDC 5T1LB 1RP8A 4YDNA 2JCCA 2IWFA 5JXEC 4HUUB 4E5XA 2PO6D 2A1WL 4M3HA 3HNTH 4F7TB 3QE5A 4EUPA 5F6HI 2VIRA 1MCRA 3BVDB 3D3VE 4U1KB 1T7ZA 1KWKA 4DUXA 3QUMH 1PFCA 5JO5A 1NIBA 3DSFH 2CDEB 4Y2DD 5DFWH 2B4CC 1HHGB 1T4KA 4AE1A 4BGDA 1TJGH 3UL4A 4H7VA 3VDAA 4S0HA 4ELMB 5HHOD 2XNAB 2E47A 1RU9L 4JHZA 4RMTA 4YBLC 1U91B 2H5UA 5E7BA 1QW9A 1YEDB 1E9PA 2HT3C 3D30A 4P3DA 1E4HA 2VIRB 5SWQB 1VFAB 4KVNH 2YRLA 4F37K 3VE0A 3DSFL 3HE7C 2XVKA 5CBAB 3QUKA 3HR6A 1B0RA 1NEZG 5IV2B 1G0XA 1R5IB 1FG2A 2XTJE 4ZMWA 3IJHA 2ZX7A 5I23A 1L9TA 1HNGA 1RJYB 4J6IA 2IH8A 4OUUA 2HWZL 3IFPB 3OKDA 3IN0A 4IU3B 4KK6D 4KFMA 4B5EA 3LH2H 2CLRB 2H1PL 3B2DC 3F7YB 1OAYL 2XCMC 4HHGA 2BNQD 1RULH 1JGUH 4XN9A 3WSQH 5IVXB 4P23D 4ZOCA 2ZKWA 3WS3B 1HEZB 1JXGA 4J3OC 4PTTB 5CJ8A 1RH8A 4WK4B 4EZKA 3SGJA 4I0PC 1BFVL 1NGYA 5AW5B 4W9KC 3BHBB 5J9PB 3TBTB 3CFCL 3MZTA 4LLWB 3ARYA 2RTTA 2XFXA 4B6ZA 3F01A 5AOIA 1BMZA 4ZMTA 4IW4C 3WD5L 2Z64C 3RWDA 3GKZA 1QA9B 3WUWA 5KVEH 3ECWA 3GIZH 3I3EA 2C9PA 4KGLA 2GSGB 4TULL 1QTSA 3ULVC 3VFWB 2OL3L 1AO7D 5C07E 2MCG1 4ZQKB 1LK2B 4NZ8A 1U8KA 4IBQA 4XP4H 3VTMA 2IAAC 1T03L 5M95B 1RVFL 4HJ0C 2FQEA 4Z95L 3US1A 3ZT5A 3MLTA 5SV3A 3WUWB 4DETA 3O6KL 5CEXB 1ES0B 3H0TA 4XMTA 4OZFH 3S8FB 5DC0A 4JKPL 4FQ1L 5K9KA 1OARL 2DS4A 2KYIA 4L29A 2NY1C 1SBBA 3HE6D 1D2PA 3AU1B 4KVNL 2EVIA 2ZSWA 5J3HC 2XQBL 4U3SB 1EZVX 4P46D 1IIKA 2NSQA 2IIJA 1CL7H 2Y7SA 2EIJB 4PQXA 1LE5B 2OMXB 3L3DB 4KMLB 5DGQA 3NH7L 5I8EA 4NUPA 1U8NA 4HALA 3IDIA 5DD5H 4HUXA 1KPUB 4IBZA 3IAGC 2DL2A 4XNZB 4GKSA 3HHSA 4UILL 4WTZG 4KRLB 4NWTL 5D71H 2EKSB 1KYAA 2YD3A 3MTRA 3X11A 1UADC 3PP3H 4PTTA 4RGMC 2APBA 3K72B 1AXTL 3N1GC 1EUUA 2FWOB 4ADIA 2WY3B 3QQ3B 4F9LC 5JPMC 3U9WA 1OLLA 3FPXA 5D7LB 3NTCH 1PBYA 3F65A 4PUBH 5FOBB 5KOVC 4BWWA 2AGJH 5JHAA 3FSZA 3VXMB 2ALWA 4M7JH 3FTXA 1U8QA 3J27A 4IRZL 3LKQB 2GJPA 4NJAH 1I1AD 1LLAA 2FDBP 2XQ0A 1JP5A 4PRID 4QHKJ 2VAJA 2YGOA 3MCKB 4XCEA 1JD7A 3B8YA 2OI9B 5KAQF 4GSRA 1HHHA 1LMKA 4K3JH 5FECB 1U9KA 4MCMA 2PCXA 4N2LA 3VG0H 4ODXB 2X4UA 3QXAA 2R0ZH 4QO1B 5E6IA 1T5WB 4YAQB 2WKOF 4XI5D 5DWUH 3P4NA 1U21A 3KE0A 1LDPL 1A14L 1DE4A 2BMKA 4LF3B 1KF9B 3MCKA 2RD0A 3ARBC 4P3CH 5HPMA 4XVTL 3K6NA 2RMNA 1EA9C 3V5DA 1YMME 2YBRA 2Q2LA 5AVUB 4WWKB 4TUOB 3FRUA 3VXNB 3TT3H 3CFKB 3BX7C 2ATAA 1X5IA 2AV7A 1FFQA 1OAUH 4KKLD 4CA4A 1KBBA 2TAAA 3WJJA 1AHWB 2F58H 1IFGA 1TU2A 4ZS7H 4N0FB 2EAEA 1NQBA 4OQTH 5DCCA 1JZDC 4LSSH 2WQVA 3Q5YA 5IOKA 4YDLC 2BC4A 3PF2A 1KEML 2LT9A 1T1WB 2A83B 3KYKH 2A73B 3HZYA 4AV0A 2CPCA 1F4HA 4XMXA 5F6HJ 3RL2B 5I66B 1FZMB 2VR4A 3L1FA 3SE9H 3VFUB 3VMNA 1NOLA 4CMHB 3ZO9A 5DJZB 1X3DA 3KPSD 2J8OA 4OSUH 2K9FB 4WU5B 4JREC 2N1KA 3QP3A 1QVOB 1F6AB 4LU5L 1A65A 4RQQA 1LD9B 3BKCH 3BVVA 4AQAB 3WENA 2H9GB 4HQQH 4R7NA 4NRXB 3VWJD 1LEIB 2JCCB 3SQOH 4J6RH 1S7UB 3RZWA 4OLVH 5GS2D 1AI1H 4PI0A 1RIUH 2VR6A 1VFMA 1UM4H 1SOKA 1HN1A 2WTOA 1HKFA 3A3YB 2XA8H 1QBMH 5IT2L 5JO5B 2P8LA 3FT1A 1CMOA 5J6SA 5I15L 43CAB 5AB2A 3IMUA 5DVNA 4D9RE 1BVKA 3H3BC 2XZCL 3UG3A 3ULVH 2VW6A 4FFZL 4KK9D 1AI1L 4JO4L 1A7PL 3ZDXE 2ZYRA 3GJEA 1JWUA 2JI3A 5KN5B 4D8PB 1MIEH 2X41A 5FYLH 3OMZA 1E6OL 4LPCA 3DBXA 3T0AA 2EDJA 2Y3AA 5LNDA 4K94C 4YUEL 5B8CB 1U58A 3EGSA 3GZOA 2X0VA 2AJSH 1XAUA 3BT2H 2P26A 3GXTA 2QQNL 3I3BA 1UQSA 2QL1A 1OTUD 5TDPA 5LXGL 3QB7C 2IO5A 2Z35B 4H8PA 2COQA 1JF6A 2WBKA 3DVFA 3PWNA 3E6HA 2XQYG 1ZHKB 2XTJB 3JWOH 2BP8B 2VDML 2AQRA 2CA3A 4MJJA 4OZ4B 4Z1PA 4HCFA 1NEUA 4ODWA 2VN5A 3BPNC 1NC2A 2AXFB 2W91A 3MA7B 3AY4A 3V4PH 1RZ7L 2VR7A 1T20B 2ZCKL 1B0GA 4NX0A 1J1PL 4Z23A 2AEQL 5C2BH 5KBPA 1T3FB 2SEBA 1IKFL 2FR4B 2D4FA 2A38A 1CJYA 1A5FL 2BIOA 4NM8H 4EF3A 1MPAH 3NDZE 4XXCA 2HMID 2AJVL 5EOCJ 1E3FA 4NYLA 4P3CL 4BHUA 2DWYA 1T5XA 1BQHA 4U1SB 4ZYKB 5KJ7E 2WXFA 3M1BA 2WLIB 4IHOA 4JG0H 1N5YL 1MDAA 2L4OA 4FQHB 3ECBA 5CBAA 3GM8A 3FB7A 4ZOBA 3UC2A 2XZQL 4RAHA 1TTRA 3WNLA 4FKKA 2CCLA 1HX0A 1AQMA 2BK8A 2X4OA 1Q9OA 5I0VA 5IFHH 1E9QB 4NUMA 1YO4A 4RH4A 5ID0A 1HCZA 1MLBA 4PJ5B 4Y2DB 4KNQA 2AQQA 4ZQKA 5EUKB 3T8XA 3VRLE 1SXSA 1EWHA 3OJDA 4P2QB 4KC3B 4RFEA 2WZPA 3WIFB 5I6NA 5D5MF 3W9DB 4D0CB 1KTDA 1RUML 1WF5A 4L4TE 2EE0A 3V4VB 2BCKB 3DX8A 3VYOA 1EJOL 2JQAA 5JIMA 5B7MA 3OWRA 3JZYA 4J5VA 4AYFA 1KELL 5D1ZC 2J1WA 4GIOA 3HRZB 4EOWH 4L37B 3FCTA 3T1FA 1CT8B 1GMEA 3MV7D 3DVGB 5BZWA 6FABH 4PRIE 1OCRB 1BZ9A 3APNA 5IW1B 1NGYB 4AGOA 2DBLH 1FAIH 5DZOA 3ARGD 1CGXA 1EQWA 1MZYA 2CGRH 3UP6A 4RGND 4HLEA 2ATKB 2YEZB 3V8OA 4GKNB 2RAMA 4K0OA 5F71A 2NZ1A 3ZHLA 5AAPA 3ARFA 3QUZC 4GAJH 4LCWD 4Q4EA 3NP3A 4WK0B 1JZ7A 1NGWA 2YN5A 3F05A 4HD5A 2CKBH 1XSIA 4B9JA 1CK0H 2EO7A 3JTSB 3FQXB 1UA3A 2BFGA 4W9IC 1TFHA 4M6AA 1B4JH 1OK0A 5C0AA 3CPLB 4FDWA 3BDYH 1ZT4B 4BSWB 5ANME 4OFIA 4AY0A 1IE5A 4FA8A 3JV5A 2Y72A 1M71B 3LSOB 5LUMA 2ZSVA 2NY5C 1HZHH 1OAZL 1PLBA 2R1YB 3PWVA 4I5BB 4JFFA 3DJRA 1GYWA 4BQ6A 1FFTB 1OSEA 3ISWA 4BZ1L 1MRCH 4KHTH 3RHWF 2ENJA 4GRWF 5FYJH 1M7DB 2Y25A 4FEIA 4HDIA 1L6PA 2VSMB 4TVPL 1DEEB 3PGFH 4GIAA 4OZHE 5E5MB 4I1NB 5TE4H 1BW8A 1BXAA 1EO5A 3QUXA 1EAOA 3B7UX 5B1KA 3ATEA 4YDVB 3WLWD 4PSRA 3VA2C 4MSWB 5K39B 3CX5J 4LIQE 4FRWA 1ED3A 4L4TD 4YDIH 2OYKA 1RERA 4GW4B 4MAYB 1KFAL 1TITA 1UENA 2B2XH 4L0YA 4JZOB 4Z5RA 5I30L 2Q76B 4NPKA 1Q4NX 3CVHH 3KXFB 4FE9A 4IGBC 5GS0H 1NCHA 3QEQB 1AGEB 1CE1L 1LGVA 3A22A 4IDLA 4H0HB 5F1OB 2EIZA 3PDGA 5JQ6L 1NC4D 1E2ZA 1PF3A 1TJXA 3MOAL 4YR6A 5I73C 5AVSB 4X9HA 4K3GA 1EPFA 1WAEA 1PEWA 2ED8A 3EBIA 4F15B 2DQEH 4FN0A 4Q89A 2EIDA 5FKAA 3CFQA 1VA9A 1NWPA 1E3ZA 2DBLL 5LKNA 3IF1A 5IB1A 4L1SA 1G7IA 3E9UA 5E6IB 2EIBA 5HI5D 1C12A 1WICA 3JVFC 2XVGA 4DO6A 1Q0XH 4GXVH 1L7IL 2FJFA 2J8HA 4I77L 2ATKA 2ITEA 1B9ZA 1ULVA 2JKNA 2VLLB 1ORQB 2MHAA 3O6KH 4UM8B 2E27H 2YD0A 3BWAB 3P3SA 4EZJA 3EGXA 1QBBA 2BMKB 4NRZB 1OAQH 1AQDB 3QDJD 2ADJB 2IF7A 5EOCL 4JM0A 3P4NB 1W0VA 2PR9A 5EG6C 5KSAB 1R4XA 3LB6C 4KNUA 4XMLH 4IKKA 2HG5A 1ILUA 2K70A 2PPFA 2V5TA 3SKMB 3A67L 2CAKA 4JW3A 2R9HD 4TNEA 3GEFA 4KKNA 4Z78A 1F3JB 1M7UA 3CC1A 3GMOB 4IRSD 2VMDA 3JV6B 3W39B 4P5TA 1CF1A 1H8OA 4ORGB 1CWVA 3NEOA 1FGNH 3MRRB 3E6FB 3ZKNC 2K3TA 4UQ9A 2K8QA 4CKQA 2ATPB 3AAZA 1BQRA 2HKFH 3QQDB 1BF8A 4NFCA 2EIEA 4ZS6C 1VZIA 5HVWA 1WAAA 4RZCB 3KW7A 2Y1AA 5D93B 3DX3A 1VACB 3LXBA 4NDMA 5L2JA 1XH1A 3C9NA 4RWYH 3VFGH 5CEZL 4MSWA 5K39A 2O5NA 4CDGC 2FECL 1QTPA 5L4IA 4D9RD 3Q1EA 4G42B 1TUPA 4A2EA 2WXLA 1O9VA 1WWCA 2HFTA 4UV4H 2EUXA 3QVAA 4HBCH 5GGVY 4ZXBA 3NCYP 5ESVB 3WFEH 2OJEB 1CD9B 2VITA 4XCFH 2RCSH 1CICA 1NMAL 1U8PB 1XSOA 3FT3A 1DVUA 1WTGT 4WJ5B 1G9MH 1CDIA 3WCYA 3EFDH 4BXVA 1BAGA 4Y0GA 2J4WH 1IGIL 2DKSA 2OR8A 4HKBB 2C4XA 2WYHA 1EO8H 3KLLA 5FW6A 2GABA 4XOEA 3CH1B 3PV7A 3K71B 4LPXA 1DLHA 4YFEA 5JHDA 1A9EB 5CGMA 4W9CC 5F1IB 1WBZA 4P4KC 4KFZC 3MNZA 5INDA 4ETYA 1QYGL 3AS2A 4QRPD 5EV7A 5IUCA 4L9LC 4XAKD 3LRMA 1X5KA 5DS1A 2A9DA 2WK2A 2XKUA 2E5EA 4FQHA 4Q6YA 1HFUA 3NJVA 3QUXD 4JFZH 5D72L 3S3CB 4OV6F 1E4XH 4Y5XC 2NX5E 1FL6A 4PP2A 2DTSA 4FNPA 4IU2B 5F9DC 5IBUB 1NC2B 4DVBB 4FLQA 2R39A 1IC0A 5GS1C 3QO0B 5A16A 3FTYA 3QDHA 3KPSA 4IBVA 3SD2A 4ONHA 4PM1A 1KXQE 3Q8AA 4YQXH 5D55A 3F2LA 3RGVB 2WLMA 1GL4B 2G60L 2WWMC 2NUPB 3GSQB 2XWDA 1UOWA 3HAEH 3K4DA 1OV8A 4WFGD 3LKRA 1T3FA 4AYFB 1V05A 1ZLSH 4OUUB 1HXMB 2GIMA 2BSTB 3D07A 3LIZL 4JCWA 3H9SB 4ONGH 3TNMA 2HZHA 2EYSA 4UIMB 2CZNA 4GW1A 3PDOB 4OIBA 4MB1A 3VD3A 3F3HA 2XPGA 4JY4A 3UEZA 3RWEA 4Q9RH 3X14B 4OLVL 3B3IA 4ZFZA 4WEUD 4G1MA 2PPCA 2DQUL 2XQYA 5E2WH 3FJTA 3QJQB 1U95B 3VI3F 1QLFA 5IVZA 5K33A 4G6KH 4HJIA 4HWEH 4H8WL 1I7UA 3MRBB 2R83A 2L3BA 1JPSL 3ARWA 3CFTA 4KRNA 1Y6MR 3QR1A 3VG9C 1Z5HA 5F44A 5EU6D 1DVXA 5F7LB 3QYMA 3I3DA 4QYOA 1N68A 4HK3J 4J4PD 1X44A 2C1PB 2V17H 4ZNEA 5T1JA 3NZUA 4KX9A 5I5JA 4XC3L 4F1SA 1SLXA 2Y9RT 3QJUB 2WP3T 5AZUA 5LBGA 3HW7A 2F53D 3FT3B 3D2UA 5C0GA 2OMUA 1D6EB 1XEUA 3QFDA 3V0HA 5F3HB 1NCBH 3J2PA 4MA7L 4O2FB 3PWVB 3VFNB 3H56A 3KBPA 5IQNA 3V79C 1NSNH 1R3KB 1PGRB 2J56A 1DQLH 1RCYA 2ZSVB 3O2VL 3PXJA 4YSEA 2R51A 1JPEA 2Q87A 4MASA 2WKOA 3ZSSA 3MNVA 4M9PA 2WSDA 3WIAA 3QJSB 4X4MA 2I24N 4CKVX 4HK0B 3QUGA 4FX5A 3V5KA 1M7DA 5E9NA 4UOZA 4IBUA 3EOTL 8FABA 1MHEB 1W9XA 4Q58C 4UT9A 1YUHB 2XV3A 1I3RB 2VDQB 2AK1L 3SE4A 3WDHA 4JKMA 4FNUA 4AIXA 2FEJA 1I8LC 3RUGF 2FH8A 2NQDA 2I26N 2XWRA 4PW4A 1HYRC 1OZTG 2X9XA 1ZA6B 3QO1A 2I69A 3P40A 3FYIB 4AYID 1OW0A 4GRWH 3LVTA 4AYEC 1MJ8L 3SQOL 3FB5B 2WUBH 4ACPA 4LESA 3KWWA 4NRYA 2Q76A 1I3RA 2MQ3A 4WQOA 3BO8A 1EVUA 5C07D 4OGXL 4FXGB 1SEBB 1FHGA 3IU4L 2A9MH 5BVPL 1BQSA 1AMYA 1CXLA 2VDPH 1XCXA 4GO6B 5EPMB 3RI5K 1RUQL 4UV7H 2VSKB 4N0UE 5IB1B 3BUYB 4LO9A 4JDVA 1HH9A 3MV8B 3LN5B 4XVJL 2ED6A 3THML 1E27A 4FFYH 5IMLA 4YHYC 3WY4A 5KS9F 5CZXD 2GYSA 1L9NA 1BYPA 1XGQA 4NAQA 4Z7OB 2I9TA 3FHQA 3PHQB 3CDGB 1RV6X 3KVQA 2B16A 4R97C 1U8QB 1U95A 3P1VA 5HYEA 4H13C 3FCBA 2EC9U 3IB4A 1EZLA 2B1OA 2XN0A 2EYTA 2WZPD 1MCBA 2LLGA 1HTYA 2Y06H 4LEXH 3NJLA 5D7LA 2P8MA 2R0KL 2DWSA 3HN3A 4L3ED 4XNUH 2X88A 3QZWG 3I6KB 2H26A 3R0MA 1Q1JH 1RKRA 1KC5L 3PAZA 5IB2A 5IG7A 4L1HA 4R0LB 4F8QA 3W0WE 4AIZB 2AK4A 3L9EA 1YZZA 2X1PA 2JE8A 3GWJA 1TZIB 3FQRA 3T3ME 5EOQL 2NQCA 5TF1L 1C1EL 3IM1A 3AXHA 3ZHKA 5K9QG 3HLAB 4V1DA 5FYKE 3LEVL 2JWYA 4B9CA 5TE6L 1R0AL 2XSKA 1XSKA 4PJAF 3T0EE 3GRBA 1NGXB 2J2ZB 1HINL 3N0PB 4JM2A 4PWKA 3W0WB 1S3RA 4IGBA 3ZJAA 3ZYOA 4Y4HB 3F62A 4KITB 4X6DB 5GGTA 3MA9L 3BPNB 5EOQH 2CO7B 3AXIA 5AOMA 4ALAL 4RDQG 2SODB 4QPEA 4W9LC 1DJZA 4UU9A 3NG5A 4TSCL 4JKPH 4M8QB 3NK4A 3POCA 1P84K 4A63A 3T3PE 1LWHA 4HHWA 1ZSHA 1NINA 4MQXC 4DKEL 1MQ8A 4TNWF 3FSVA 5T1DH 2GUOA 3N9GH 3HUJB 5LWYH 4KQ4H 2ZCKH 3CUPB 3WEXA 1KB5A 4C47A 3V0EA 1DO5A 1Z3RA 4KX7A 2YAEA 4MRBA 4PP1C 2MPVA 3B4NA 3D3VB 3JWNG 3H3KA 1QFWM 3QORA 3L5XH 1TPXB 3UBXG 1U8IA 4ZXBC 1REIA 3VD2A 2DL9A 2XRAL 1GKEA 2YJLA 2F5AH 2LLLA 2ZX8A 1NAMB 3HG3A 4JFWA 4WI5A 2ZOTA 5T1DL 4L5FL 1I31A 4QGYA 4X7EC 4I48A 4K3DH 3WFZA 1A9EA 4Y2DC 3LXAA 4MA1C 1G7LA 5J4MA 3IMSA 4NXKA 5E00A 2N01B 4Y16A 1KV3A 3VI3B 1MY7A 3QORB 2H45A 4PCKA 4Z3IA 5CILH 1TTBA 1KFAH 2B2XL 4S11A 1VGEL 5E1HB 2AXFA 1S7UA 4FHBD 4TTDC 4IRSC 3FH8A 4LDOB 3VE0B 2WTPA 1RZPA 1I8UA 2AJXH 1F2QA 4YLBA 2XHNA 4GQPH 5DT1L 2V5SA 4RFNB 3CN4A 2AJ3B 3FFDB 4V1DB 3TH2T 1M9SA