4L1LA

Rat pkc c2 domain bound to cd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cd(2+) as a ca(2+) surrogate in protein-membrane interactions: isostructural but not isofunctional.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein kinase C alpha type
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4l1lA00
2K8MA 4XZ4A 3KWTA 3T8MA 3TL5A 1UOWA 2CJTA 2CHZA 2LHAA 3DPDA 2CJSA 5JHAA 3L9BA 3L54A 3QJZA 4KZ0A 4L2YA 4NS0A 4IQHA 2EP6A 2K3HA 1YRKA 1DJWA 3QR0A 3FBKA 3HIZA 4HLEA 4QJ5B 4A55A 1CJYA 1QASA 4V11A 2A5UA 3L13A 3LJ3A 4ANWA 4BFRA 4XX5A 4L1BA 1E8YA 3ML8A 1E8WA 3S2AA 5H4ZA 3MJWA 2BWQA 5CCGE 2WXMA 2FJUB 5G2NA 3F01A 2QZ5A 4ANUA 4Y1TA 4KITB 1W15A 2ENJA 3N5AA 2WXRA 4DNLA 3ENEA 4FJYA 2A4ZA 3SD5A 4HVBA 3GPEA 1BDYA 4KZCA 1BYNA 2WXNA 4GB9A 4NPJA 3W57A 1HE8A 4ICXA 2WXOA 4WWOA 2DMGA 1K5WA 2WXHA 2ISDA 2D8KA 3APCA 3IBEA 2WXLA 3L16A 5T8IA 2NQ3A 1DJIA 4QJ3B 4WEEA 2N1TE 3KWUA 4DK5A 4EZJA 1RH8A 2WXQA 4F93B 2WXGA 3PYCA 1DQVA 3PREA 2X38A 4AOFA 3F05A 3W56A 3ZW3A 4GNKB 4EZLA 1UOVA 1DJGA 3L4CA 1RSYA 2Z0UA 4MJJA 2NSQA 4FHKA 4L23A 2WXFA 1TJMA 2FK9A 3ZIMA 4NPKA 4PS3A 5CCJA 4F91B 2WXPA 4FULA 2K4AA 3B7YA 5JHBA 1E7UA 4LDCA 3HN8A 3HHMA 3NZUA 1GMIA 1DJXA 1V27A 4FLHA 2YOAA 2NCEA 4F1SA 1RLWA 2CM6A 2JQZA 3OAWA 4JPSA 4EZKA 5CCHE 3F00A 4FJZA 2WXJA 1A25A 1WFJA 2KI6A 1DJHA 2R83A 3FDWA 3ML9A 3F04A 1UGKA 1QATA 5G55A 4J6IA 4NP9A 5EDSA 4OVVA 1E8ZA 2ZKMX 2DMHA 2B3RA 1BCIA 2CHXA 4XE0A 2ENPA 4WAFA 3CSFA 4WWNA 4FA6A 3OHMB 3NSJA 3R7RA 4FHJA 4QJ4B 1E8XA 2Q0ZX 3IM1A 4G11A 4BGDA 3RPBA 3QARA 4QAMB 3NZSA 3P2BA 1TJXA 3RDJA 2V4LA 2YRBA 3TJPA 3PRZA 4PS7A 1WFMA 4ANVA 2ENQA 4F92B 4URKA 4ICWA 2CHDA 3APDA 4AJWA 3QR1A 4LCVA 3PFQA 3L08A 3TWYA 1E7VA 1DSYA 2WXKA 5KJ7E 3QAQA 1DJZA 3M7FB 5H4YA 1DJYA 2QZQA 3QK0A 4WWPA 3JZYA 4ANXA 4L1LA 4FADA 3PS6A 3DBSA 4TS6A 3R7QA 4PS8A 3CSTA 2CM5A 2K45A 4IHBA 2RD0A 4Y1SA 2Y3AA 1E90A 1W16A 3APFA 4LT7A 2CHWA 2Q3XA 4TV3A 4OVUA 3L17A 2WXIA 4TUUA 3ZVVA 2UZPA
chains in the Genus database with same CATH superfamily
2QLVB 1CXEA 3CLWA 3D50A 3RVTD 3ZKMD 2C9XA 4PGCB 4NFDA 3IMVA 4LCUA 4HCRH 3INOA 4HC1L 5HGAB 1AXTH 5KANI 3QR0A 1XV8A 3KPRA 2VZUA 3C09C 3MO1A 4AKPA 2OQJA 2H7WA 1WZ1L 4HJIA 2OYPA 5D7IA 2ZSWB 1RU9H 1YYCA 4EUPA 5CCGE 3MLXL 2VSCA 5GGUB 3C08L 4XNXH 5FO8B 5FXCH 1MEXH 2XTJB 5HHOE 1M2VA 3EBAA 3B2XA 3MO1B 3Q1EA 1GGTA 3QHFH 4N5EC 4ZSOE 2CD0A 2FWUA 4KAQH 4A2DA 2ATKA 1C8QA 3VJ6B 2CIIB 3HAEA 4JKWA 4MQXD 4DUXA 1UXWA 2CH8A 3KE0A 4IKKA 3S5ZA 4AEFA 3OZLA 3ECQA 2D8KA 4CNIB 5INDB 3GSOB 3SE8L 1BZEA 3CTTA 2PXYC 4Y2LA 4DZBA 5JHMA 2I25N 4OT1L 5DWPA 3SO3C 4MB1A 1AIFA 2KDYA 1VGEH 3MTXA 1ZS8B 4N2BA 1CFSA 4W9CC 4MNGB 4HD9A 4JG5A 4DWHA 1O6TA 2YUZA 3FYIB 2NY4B 1HCFX 1AHWC 1TFHA 3RAJH 2VLKB 2E0PA 1UKTA 2UZIH 3BN3B 4WWID 3VG9B 3ZIMA 5HHMD 1OF2A 1OB0A 3GSOA 4CJ0A 4DZBB 2WLNA 2HMID 5IWLC 2LLLA 4MNGA 4N2KA 3TPKA 3X14B 2L4OA 1M53A 3KHOA 3TH3T 3AU0A 2WXJA 4K2UL 3AM8A 5IIEB 4MHHG 4JFDB 5B1JC 5ITFA 1NCBH 4KHTH 1IE5A 3P4OA 3RI5K 3ZJAA 4KK6D 4IRSB 3IU3B 2EIDA 3LH2H 2EYRA 1AI1H 1JPSL 3T4AA 4NZTH 3KPRE 1KB5B 1TTBA 4QHUA 3ZT5A 4Y9EA 3K80A 4IHOB 1HQ4A 3QDMD 4OJYA 5I1KH 4JB9L 2ERJB 2O1AA 5DUBB 6FABL 1A7PL 3EO9H 3U7AA 1JGVL 3EOTH 1FAIH 2DJMA 5H4YA 1DJYA 3P3RA 2R0LL 4KKLC 5EN3A 4NX0A 3ECUA 3JWDL 4O58L 1L0QA 3M8OH 5MENA 1QSED 2F8IA 4QWWC 1EHLH 5LQBL 3AXIA 3H85A 4X4MA 2CLZB 3L5XH 4HK3N 1VF5C 1KSRA 2XN2A 5HHQA 5I0XA 3MJ7B 4N2OA 1T2JA 3GMQA 2KMWA 5FCUL 1AR1C 2ZF9A 1FFNB 3ZMNA 4RMUA 1BW8A 4AIXA 5LCVL 4BBWA 1MLCA 3LH2L 5HHXH 1SFHA 4RH4A 5ICZB 4BZ1L 3V4LA 1SOKA 5HHQB 4X5XA 4RNRB 1VSCA 5K9KA 1UD3A 5KBPA 1PCSA 4XX5A 4QHPA 4LSVL 4P2RE 4IBUA 1ZHNB 4UQ9A 2A9CA 5H4ZA 2I9TA 1AZCA 1C7SA 2R2BA 3JV4B 2QTEA 5FYJE 4HT1L 5JW5B 2YKLH 3N1FC 3QR2A 1G6RH 4D8OA 4HCFA 2N01B 3QUHA 3HNSH 4X5XB 3X11A 1I1YA 3JV0A 3JWOH 4OKDA 2YMOA 5AW5B 3VFPA 1QEWA 3SBRA 3GS7A 1WFIA 3INUL 3LKRA 3HC3L 2ISDA 3U46A 1SF5A 5J13B 3V4PL 1CFTB 1DLHB 3BZFA 3E38A 4IGBB 1K8IA 5B4MC 2YPLE 2L3BA 5AOJA 4IU2A 2I60H 1KTCA 3CC1A 2BHUA 3QIUA 3WIFB 4AM0A 4JHZA 1SDDA 1GZHA 1NGYA 2IFFH 3OF6D 5IVXB 1OGAA 4Z1PA 4HKJA 1XHHA 4N2FA 3OJMB 1CXIA 3FO0L 2D9CA 4KXBA 3MLXH 3G6AA 1S9YB 1W72A 3D8MA 2IVFC 1YDPA 5MHSD 5I18L 1HXKA 3N1GC 2B0SH 4ERSH 5ACZA 1KYDA 5JHDD 3LKQB 2AI0L 5MEQA 2DQCL 3M46A 3B37A 2BY1A 4TOYL 3OZKA 2VERN 3UTZB 4X2UA 2X70B 3GDBA 4PWKA 5E6YA 4AYBA 1WS8A 2CO7A 2OL3L 1MRCL 2BRQA 4PJFE 1F8TH 4JZOB 3BQUC 3Q2VA 4Z7NE 1JYWA 2EXYC 1PNCA 4P2RA 1G7JA 1JI1A 2WNWA 3UJIH 4YSSA 3LVEA 3K0WA 3QDGE 1A3ZA 2PETA 2I9LB 3FCSB 3DV4B 3IRZA 4WCYL 4KKZA 4M7KH 1IO4C 3GBLA 4M00A 1HINH 3LD8C 1XMEB 3B2UC 4I0CC 1RUQH 5LB1A 1MKFA 4JFED 4JRYD 4XC1H 3CHPA 4IOFC 3GLDA 4HMEA 2QGEA 1WA0X 4APQB 4QHKJ 3LIZL 4LSPL 5T3ZD 2IQAB 3MUUA 1AGFB 5EU5A 1XTMA 1HNFA 3FH8A 1JGUH 4CBZA 4X0KA 3D25A 5KN5B 1A7QH 1JZ2A 2XWBB 1LO2L 5KOVC 1MREL 3MBEC 4ZMOA 5I18H 3GIZL 4X98B 2CUAA 1AO7B 1HOCA 3I9PA 4XOBA 4BFJA 1AGCB 1NDTA 2J72A 2EKSA 3C60A 3HPJA 5E2TH 3FBKA 4GEIA 4M1DH 1LEIB 4ACPA 1EEZA 4OM0H 2NZ9C 1UG9A 3EHBB 5F0JB 2ZCHH 5D9SA 3IGLA 3Q01A 1CD0A 3QCTL 2IFFL 1NGQH 3VD4A 4XCCH 1F6FB 2QL1A 4ZUUA 2DM2A 4Q6IB 4AT6A 5D2NE 1U9KA 3ULVD 3EW3B 1LP9F 2KZKA 1TR7A 3AY4C 4N20A 1MCPH 2QSCL 1I1AD 1U8JB 5D9SB 4XP1L 2H26B 1Y7VA 4N6RB 4D7PA 4ENED 3VH8G 2XQBL 1EK3A 3EJUA 4DK3A 4F9LC 1BXVA 4Q6IA 3EO0B 5LAXB 4WSKA 3D6GA 3JWOL 4X42A 4PUBL 4ELKA 1AOZA 3ZE1E 2GIMA 1FO0L 4BSWB 3QDGA 3OSKA 2Y2WA 1RSYA 1I9IL 2YKLL 4HT1H 2EDYA 5I30L 1G9EA 5KVFE 4Z5RA 3RZWA 1ODUA 5CJQH 4LCWA 3DJTA 4N2DA 3OAYH 3BMWA 2DQIH 3QQ4B 4O5LH 3CXDL 4RGNB 2HKHL 3ZO9A 1TCMA 2G5BA 1HCZA 4DEUA 5IQ7H 2GJ6B 3MV7E 1WUZA 5GRJL 2VLRA 2X4UB 2VLJA 4X5WA 5FGCE 5I15L 1BZ9A 4PJ7B 4MMZA 3FPXA 5FCUH 3B2DC 2X42A 1NM4A 4TXVB 1HYRC 3AT9A 5E5MA 4BWUA 3WY3A 2ITEA 4OZFH 3RY5A 4G7YH 5FO9A 4Z7WA 5HHPA 5EEXA 2RFXB 4W4OA 4FA6A 3BVNB 2AK4D 4TLKA 2V17H 3GMLA 2ADJB 5BQ7A 1D7DA 3M8OL 1WBYA 4MMZB 1BVNT 3ARDA 4V1DB 2R0LH 1AXIB 4DAGH 2AGJH 3TN0A 1IILE 4A7UA 5BV7B 5HHPB 1W8EA 3EOYG 2P1YA 4YSTA 3DIVA 4NQSA 1MFAH 1S9XA 3ESNA 2V9RA 3WUWA 1D5XB 3P9LB 4O02H 4CC4A 4Q6YA 4Y5XA 1D5IL 1ZVHA 4XNMA 4IDJL 4GBXD 1C5BH 5K39B 5I0DA 4GI9A 4N6QA 4LSSH 3STZA 4RDQF 4TL5A 1W72L 4UTBL 1EAPB 1CBVL 3MOQA 3TC9A 4V2BA 1DQQB 3ARQA 4O2FB 4DKEL 3WTSA 5H37A 3QZWB 4M9OA 4U6VL 5IHUH 3A21A 1TPXB 4RQQB 2F18A 3G5XA 3OZ9L 3QCVL 4J3VA 1J1XL 1PD1A 2J73A 3LXUX 2BM3A 1HJCA 3GLAA 4MQSB 4XB8A 1PLBA 4JM4L 2R1XB 4DUWA 4KDWA 2UZIL 4OZIB 2JF1A 3MV7A 3O2WL 3GWJA 4YPJA 4AJ0A 3MXVH 5CZXD 1PQZB 3DX0A 3E8UH 1BP3B 1C08B 1REIA 1H3VA 1MXGA 3LRGA 4PJ8A 4NO2A 4RDBA 4W1TA 1E3XA 1L6PA 3SE8H 4ZFZB 2R69A 1F6AA 2ID5A 4XNAA 3SDDD 2UZYB 4XPAL 5F7BA 2QSQA 3VD2A 5HYJA 1BWMA 1GZPA 4QRPA 4G83A 4KO7A 5CGYC 3GS4A 1VEMA 2CKBA 1E65A 4XRCA 2XYCA 2C5DC 2H0FA 4GAYB 3TO2A 5D93C 4ZFZA 2C1OB 3CC5A 1I75A 5CD3A 3KXFA 4JFZL 1YNLH 1JZIA 3C5XA 5K59E 1QZNA 2F53A 4UZSA 5KOMC 2VCOA 1MVUA 3DECA 1O9WA 3CDZA 2WZ0A 5BRPA 1LM8V 3HE6D 2DD8L 3KPQA 3FONB 3RQ3A 3NPZB 4HUUA 5DGQA 3CC5B 5D7EA 3AWEA 2ITDA 3QJTB 4PRHA 2EXYD 4U1NA 5FC9A 4R83A 3CZNA 1JV2A 2C1PA 4FFZA 5BV7H 1TTGA 3FO9B 1NGZA 3MKGA 3VM5A 3VQLA 3GT6A 4EXPX 1SHXA 2EIKB 5EDXA 4HXAH 5GZOD 4P2QB 2QQNL 4HUUB 1D6VH 1IEBB 1TTFA 2DJ4A 3KZ8A 1U8LB 3FFDA 4U1NB 5CP7B 3OLGA 2NY5C 1Z9NA 1L9NA 3MV9D 2DAVA 1ADQL 3T0AA 4E41A 3LPOA 4LF3B 5KSVB 1U8NB 2VWEC 3K6DA 2YJQA 2GCYA 4LB8A 2GT9B 2GSMB 3C87A 4NN6C 2UWEF 2FJHB 5GGVH 3TOPA 3MLYL 1RXLA 3IDYC 1KOAA 4QMEA 1G9MC 1T6BX 3UYPA 4E41B 4MCNA 4Q74A 1M9SA 1HZLA 3BIAX 3SOBL 3BUTA 1RLBA 3WHE1 4IKIA 1BFVH 3C9NB 1OAQL 4WI2A 3TH4T 7FABL 1WE5A 1HSBA 4E9VA 1CT8B 5D8JL 4UTAL 1DVTA 1MQKH 4GIAA 2XIBA 1N5YL 3NSCA 1NDGB 2JCCF 5AVTB 2VMDA 5HYEA 1A7NH 1U3HB 4NZ8A 2E8YA 4UT9L 5I1DB 2DB8A 1ZE3C 2O5NA 2MKLC 1AZZC 4W9IC 1GIGH 1FL6A 2FD6L 3DMMA 1ZLUH 3TXAA 4OGAD 3NACH 5EBWA 2X2JA 1P6AB 2BRRH 4J4PD 5FB8B 4Z7QE 4S11A 2F53E 2GAZB 2NLJA 1RZ7L 2WYHA 3MRGA 3O3UN 3MZTA 2YC1B 5I1DA 2A9MH 2B1OA 3NIFE 4XH2B 1MIMH 5F6IB 2CR6A 4O2EB 2HJKB 1OM3L 3UADA 3VXTA 5H35A 4Y4HB 1XSJA 1PY0A 1R3JA 4WO0A 4Z7UA 4ZMXA 2GHWB 5KSBE 3B9AA 4ESKA 2EZ0C 2QHRL 3VFUA 4ALAH 4FG2A 1KDIA 3MC0A 5KUKA 4FXKA 2F8XC 1W0WB 2MCAA 1U8KA 3H2WA 2CJUL 1P53A 5ALCH 3DJ9A 2O6DA 4ZMQA 4HH9B 1ZK5A 4Q9BA 3W1ZA 5I17A 3LEYH 5I6PA 3RYMA 3TN0C 4CW1A 2ODIA 4JCWA 2E9BA 2XWRA 1XB3A 4L8SB 4M43H 4J7RA 1JGLH 2ZUTA 3E7JA 3DHPA 4GLRI 3ABKB 4CBPA 1FZOA 4GQPH 1HWHB 1KY7A 1YY9D 3O45A 4NFCA 1WVZA 3TT3L 3SBWA 3L7EB 4RA3A 2DJUA 4EBQL 3NFSH 4HH9A 4FTVD 5D1QE 4DERA 4F91B 3LZFH 3UGXA 4FEMA 1N19A 4HS6A 4B9GA 2O6FA 4L8SA 5EOCJ 2DL9A 1P4LB 1HOEA 2AEOA 4ZOEA 1IGFL 4YFLF 3A6BH 5ELIA 2FWOA 4TMPA 5CJXC 2XX1A 3S96A 2VWEE 4C83A 1FHGA 2BJMH 4MDJB 3C6LB 3M88A 1U92B 4QRAA 1XGTB 1DR9A 3GMPA 4PRPE 1D7BA 2O6EA 2WYIA 5FDYA 4FE9A 3K2KA 2QPFA 1II4E 5HI5D 3PGCB 4XE0A 3M86A 1PEZA 3FT4B 4N0FB 2R1WA 1VFBB 1O75A 1RJCA 3POCA 3QISA 1S7QA 5JXED 2L7JA 4HKZA 1V8HA 4PJEA 4YNYB 5DJYA 2YSTA 3HAEH 3S35L 1CFNB 3UTTB 3OXSB 3ZL4L 1T0NA 1L7TL 1AD0A 2UZXB 3Q3GB 3MRHA 2WZPA 1KPUA 5C0CA 1L9OA 1ASQA 4ODHH 4U7MA 4WI6A 4FNUA 4PJ9C 4AQ8C 5J8OA 3VYPA 5MI0B 4I1RA 3QEHB 3JWDC 4Y16A 2IANE 1J1PH 1F45A 3QZLA 4Z7UE 3O6KH 3MYJA 4GRWF 4L1LA 4JO1H 2BIQA 3OXSA 3J27A 4MJ5A 5GS2D 1OE1A 5ICXB 1DL7H 1OTSD 3EBIA 3UAEA 1KCVL 1R0AL 1LK3L 4KRPB 1J8RA 5IK3B 4M6ML 1R9FA 2H4EA 3BD4A 3NCEB 4LIQH 3M1CA 4X7EC 3V0VB 1NDMB 4HWZB 2KBGA 4KMTL 4N3UA 2CJSA 3T3ME 3QUYB 2GJ6D 3AGWA 1DANT 1RZKH 3DNKA 4IKLA 1FSKB 4AGOA 4K8RD 4N5ED 2A4CA 4GS7B 5J1AA 3NMEA 5DDHA 3U0TA 2ZD0A 4CN4A 1UEMA 4LSQL 1K4CB 3WGVB 1AC6A 4PJXA 4J3OC 5JO5B 3IAGC 4QHLB 5FCSH 4XAWH 3OKMA 1MAMH 3TT1L 3MBEB 2BSSA 1D7FA 1JTTA 1QSEE 3VXME 3TZVC 2ENYA 3EGSB 4PJCA 4GAGL 1AZBA 3U0TB 2J8UF 3I9AA 4JM2C 4G82A 1BYOA 4X80H 1SN2A 4NHUB 2BOBA 1KCKA 3B5TA 3FTUA 1ZKAA 2FATL 4MXQC 4S1DD 4OW6A 4DH2A 3P9MA 2ZP8A 1TQVA 5IMOB 4Y2DA 3AM8C 3EXJA 4PGDB 1ML0A 4AOFA 4OIBA 3HG3A 3VH8B 4A66A 4MNQA 5FO7B 4B7LA 3K72A 4QHKI 4PRNB 4N9GB 3D52A 4H1LG 1D6EA 1KLFA 4HXBL 1PZAA 5HYQA 1S9WB 2APSA 1I3UA 2H6PA 2ZOKA 4GBXC 2PCPA 4XZUA 2UXFA 2A0LD 3ILQC 2XV2A 5F1IA 3MREB 2FEDC 2EO9A 2YGOA 1KDJA 3MRFB 1PTZA 4PRNA 1S78C 2WD0A 3PF2A 3MROB 1NGPH 4G6ML 4YLQT 1M3IA 5EF0A 2OW6A 3CN4A 4TUJA 3EYSL 5FV2A 3N1MC 3DK2A 1IM3D 5DFVC 4YR6A 4G9FA 2W91A 2OP4L 2Z3FA 2IQ9L 1I9EA 1KYAA 1Q9OB 1QOKA 5C92A 3RUGF 2E7LC 2QQLH 4N28A 1D9KC 3OGOE 4MD5B 4OLXH 3FTYA 4LEEA 3VGAB 1FG9C 3MLZL 3GMMB 3SGJC 3BGFC 3F7PC 3DK0A 1TEYA 4GRMB 5DC4B 1L9TA 3AU1A 1MI5B 4QTFA 3TWCL 1CK0L 1MW0A 3BPLC 1AS7A 4X7SL 1S46A 3SDDB 4HULB 1DBML 3MLVH 2D0HA 3KWXA 2NUPB 5HJ3B 4Q9CA 5JOEA 3BWUF 1X5IA 3G04B 4GH7B 4OGZA 3RIAK 1QG3A 1UD2A 1OCWH 1J5OH 1DQLL 4J5VA 4HFUL 5AW4B 3R7QA 4EI5D 2K45A 4P59L 2P8MA 3WE6B 3AT8A 3QW9A 1CICD 2LFEA 2CXGA 3L2MA 3ZU8A 3C5SB 3KEHA 3IAQA 4ZFFA 4PJHE 1MH5A 1BJ1H 1TKWB 1MFEL 3ZTDC 2D3NA 3CNKA 3KS0J 4ZXBB 4HBCL 3TIDB 1Z0MA 5DCCA 4NERA 1JE6A 4HZLA 4N87A 3ZL2A 4EN3D 5ERWA 1NCUA 3N0PB 1T3FB 4M1GL 1XGPA 1NAMB 5CWSA 1GY2A 3EFOA 3MUGB 1QFUL 4XP5L 1BAFH 2Y7NA 3HPLA 3ZK0A 4BA8A 2XY2A 3LPPA 3MJGX 4CVXB 2R59A 2SODB 5I1CH 2X2IA 4FQXC 1I53A 5IFHH 1HI6B 2ICES 5TPWH 2V2TA 1AIFB 4PRDB 1FI8C 2OJ1A 2Q8BL 4G9FE 5F7FA 3WD5H 4AE1A 1A7BA 1HHIB 3O9WB 2K3TA 4WWOA 1ZLVK 4ZFQA 1PZDA 5I5MA 4NUPA 2EDXA 1QPXA 4JY5H 4LNRA 4ISVB 5GSVA 4M02A 2IH1A 2J88L 3LRSB 3W37A 1A1MB 3G6DL 4P9HC 1MRFL 5D55A 4P5SA 4B9IA 1KXQE 2N0MA 2F58L 4GS7C 4YLCA 1CCZA 2Q7AA 2EC9T 1JGDB 1CYWA 2WBJD 4NGHL 4YSCA 2B16A 3KPRD 3IJYB 4U0RC 5SWSA 4UIMB 4IRSA 1F3DH 2BP8A 1KN2H 1OPOA 5I16B 2FL5B 2Q2LA 2X7LA 2D0GA 3QUKA 3BVDB 3HG1A 2UWEB 3B7SA 3RZCB 3QUML 5K9OB 3KCWA 2PKDA 4R7LA 2XLLA 2RA1A 4ZPTB 4CU8A 1UD6A 2CGRH 4MA1C 3RY6A 1ZA3B 3KMDA 5BQDA 1OTUD 4UIMA 4AMWA 1YHPA 3BVUA 2AAVA 2YD2A 1E43A 5FM4A 5IVXE 1OP3H 4AYSA 1N6UA 5AL8A 4LVHC 1KJVA 2NNRA 1U91B 1UJ3A 5C09E 1GZQA 3IETB 3QC5X 2PO6C 3VI3B 2WM0A 9PCYA 1A6TA 5MEPA 2XCMC 4UMSA 4XHQA 1FNAA 1G6RA 4ZSOA 2WZ5A 2OA9A 3V6OC 3GMQB 1DQJA 1T03H 5F9WC 4RFNC 1FFPA 1I8UA 3QJFA 4G72B 3T2LA 5L6YL 3WE1A 1G1CA 1TQTA 5KVGL 4OU3A 4PS8A 3J7HA 3F7KA 4CU7A 1KCUH 3UTPE 1TNMA 1T4WA 2XDHA 3CZFB 1GAFL 3VD5A 3I6GB 3KLAB 4FFVD 4R84A 4PP2A 25C8H 5ALBL 1T7VA 1WC7A 1YMME 1FN4A 3JV4A 2N0KA 4I0PC 1HH6B 3UG3A 5E70A 1N2RA 3FQ1A 4HF5L 2AQTA 4CRPA 5ID1B 2IPKA 2Z31B 3QDMB 4JG9A 2VDNB 3SN6N 4JFQA 1T5XB 4WJ5A 1JAEA 4P46D 2MKWA 3UG4A 2FBJL 5ID0A 3S8WA 5D4QA 2DQHL 3U46B 4X7CC 5ID1A 3S48A 2BWIA 1WITA 5GGSB 2O5XH 1K2DB 3BISA 3ETSA 4UT6L 1KN4H 4P5KB 1S9VB 4H0IA 3SDAB 4KV5F 5DO8A 5I6OA 4G59C 5J56B 4PVBA 2IWGA 3EOBA 2VXTH 3GSWB 3QZNA 1MNUL 4KNSA 4RLDA 5IVXA 1G1OA 1TO4A 2TRYA 2VXSH 1J48A 2IDUA 4JPKH 1TU2B 4XN5A 4UI2A 3SDAA 4UOZA 4PJ6A 3N43F 4QAWA 2EYSA 2QSTA 2NPLX 3EOBB 3GSWA 4GW4B 4H2CA 5K93A 1TJMA 2OXGB 2AS5M 5CCJA 1R5IA 2YXWA 3VXRD 5DQ9B 2GSGB 3D85D 1JWSA 2ZAGA 5MEQB 5IB5B 3X12B 5MENE 5HYSB 3SYAA 2EYSB 3OTTA 3W9EA 2WLKA 2H47C 4IEFB 4U1HB 4YSQA 4XP4H 3VFOA 1FNHA 1UH2A 4JKPL 2VSDA 5C0DB 4L1DA 3U83A 3MRMA 4HF5H 5D2NC 3WEBA 1DCEA 2DEWX 3QDHA 3OQ3B 4WHDA 4FFYL 1J5DA 2C9UA 4HX1A 2KDGA 4TULL 4U4BA 1PEWA 2B15A 4GO8A 2OSLB 4TVPH 5T5NF 1BG9A 3MOAL 4FXGA 3QPXL 4GSDH 2WLIA 4MDIA 1FA4A 5AKRA 2ADYA 1IJ9A 1T03L 2KERA 3L3DA 4A2HA 1C5CL 4WEBL 4ELME 2V7NA 4WGVB 3GBDA 4XOCA 1HC1A 2Z7ZA 4CA4A 4O00A 3KBHE 4GUQA 1IGIL 4ODXB 3QDJA 2K70A 2F7RA 1KCSL 4MXWL 2EKSB 1QBLH 3HPJB 3ZZQA 1AG6A 3L3DB 4IOSD 2QPSA 4AJVA 1RUPH 3DVNB 3ALPA 3FSWA 5FYKE 2OL3A 3QFDB 4QO1A 1KBWA 2X88A 5I73C 3NIDF 2JI2A 2FJGB 2XIIA 2BCKA 2ZG1A 4HFWB 2NZIA 4X7TA 5L88H 1LWJA 2CPCA 4HMCA 4A55A 2ZICA 4YAQB 4M6NH 3U2IA 1N68A 3DYPA 4P9MH 1F90H 2G4GA 2VITA 3FCBA 3FQNB 4OF0A 5C07B 4F7MA 1KN2L 2XPYA 3HNVL 2CK0L 3AXLB 3V5DA 5I6XC 3F01A 3PGDA 1JOIA 3HG5A 1JFQL 4ZS7H 3RGVC 1OHQA 4PJIE 3IDXH 4URTB 3QG7L 4NGHH 5A3IC 1YEHL 2A1WH 32C2A 5J9PB 5AVRB 5DMGD 1FL3B 3ZHKA 2PYEA 1XF4B 4L18A 4EIUA 4JFPB 4MCMA 3P77A 2NQ3A 3RL2A 2J8UE 2PO6A 3RX7A 4N25A 1VFMA 3WDHA 3X17A 5K1NA 4P2OB 5FLUA 3QP3A 3MRJA 2H1XA 3E6HA 3H9HB 3TBBA 4JFFA 5IKCB 2FT7A 3PL6D 2EH8L 1VCBC 1YJDH 4PJFB 3GTNA 1HEZB 3GM8A 4C4BA 5I71B 1KCBA 1S7XB 4AYID 1J9TA 1CLCA 3QXVA 5JDJA 2D7OA 2EADA 3FO2A 5CEZL 4AC2A 4H1LB 4UQ3B 2UY7B 2P8LB 3L81A 1OCRB 4LRNH 2CWRA 1IBHA 3QT2A 3FFCE 4ZI8A 4G7RB 1QEXA 3G7TA 1HEZA 5KVDE 3EF7A 3M6DA 5FOJA 1OGTA 5I1IL 3GTTA 4XO9A 3CU1A 3FO2B 1CL7H 4HPHA 5IGXL 2DQMA 3D2TA 3C6SA 3BDBA 1PLGL 5SX4I 5JQ6L 2Q1EA 4H0GA 2WLZA 1OGTB 4YX2L 2HTKC 4HJ1A 3SPIA 3VDBA 2CNZA 3P9LA 1HE7A 4GO9A 2A6JB 1NAMH 4MMZC 1DEEB 4DKAA 3WLBA 1Q9KB 1WFOA 2DW5A 3Q2WA 3LQAH 1YEJH 2Q3AA 5IMLA 3S4SA 1M2VB 2JV6A 2ZZUT 3N06B 3OMAB 4MMXA 3L7FB 3DMMC 1OKEA 1F58L 3O3DB 1SY6H 3WIAA 4OI7A 3MKKA 1OHZA 2HG5A 4UV7L 2HVBA 3MLVL 2ZIDA 1U93B 5C8JB 1Q9KA 2VLKD 1B0GB 1U36A 5JOFA 4MD4B 2VXVL 3NZ8A 4MMXB 5AQ0A 1FNGB 3AWGA 4U3XA 1CFSB 5B39G 2Y7QA 4I18B 3PWVA 3KJ6H 1BQ5A 4FFWD 2H6OA 2ZXGA 5C8JA 4W93A 1EVUA 3LKSA 3K6SB 4YHLL 4FXTA 5BXFA 3FU6A 3BZEA 4WKZB 2ATPA 2AEWA 4P4RB 4QD2E 3ZHDA 1NGPL 2DWEB 3DIFB 4IBLT 4WHYH 5GRZA 3ZE1B 3TBTB 2CO6A 2JKWA 3IGUA 1SUJA 1S7VA 3UG5A 3U4KA 5BVPL 4BINA 1E27B 5LXGH 4F8NA 5HYJB 1GZPB 4QRPB 4B97A 5T1LA 4JFDA 3WY1A 3OJDA 4HVBA 2DIJA 2WXNA 1DVFA 2LU4A 3IB4A 3ZR5A 4D8PB 1T89C 4FG0A 2RH0A 1E5AA 3T4AB 4Y19E 3GXNA 1KB5A 1OSZA 4YFDB 5T5FH 4KI1A 2F53B 4NI3A 1H5BC 3FJTA 4HJUA 1F00I 1K6QL 1OT1A 3LYRA 4H8UA 3U9UB 4B9FA 4HIEA 1GR7A 4YL4A 5DHEA 5AZUA 3VXMD 5EIVA 3LMJH 2C9QA 1U8IB 2R29H 5KZCB 4F15C 4XMVA 3DX8B 4JFYB 1M7XA 1VEOA 3JWNH 4HUWB 2XFXA 3L2LA 3GS0A 3ZZLA 2PR4H 5LBSA 1IEBA 3HBZA 5D4HA 2VZ1A 3DXAE 1XT5A 5FO2A 3DX8A 2HZHA 5AVQB 3EKCA 1N6QH 4OIIL 5KBMA 2YFNA 4Q0XL 5EO9A 2YMXL 3WY2A 3C5ZB 1NFDF 1I7ZA 1XDTT 2A74C 3D51A 4LMQI 3KL0A 2FJHA 1P4BH 4DGIL 2K7PA 2AKRB 2WWNA 4XWOD 5C09D 1N8ZA 4Z3IA 4OD2A 3WS6C 2J43A 1A6VL 1M57B 1I3RA 2YLKA 3P4MB 3QJVB 1TG8A 4RIRB 4Q97A 3SE4A 5LLIC 2JK5A 3CXHJ 5D1ZB 4EDWH 2XX0A 1G9NL 1E4KC 3KYAA 2FEJA 3D0LB 1QWNA 1X9RA 5D7JB 2NY3C 5C08D 2DWTA 3DX7A 4NBYB 3O41B 3VGFA 2HN7B 1TLKA 2XI9A 2K78A 3DVFA 5HHNB 1EDHA 1J9QA 1X4ZA 1J1PL 4KJPD 1O6VA 2Y6SC 3T6WA 2NNCA 1E4HA 3VXUA 1CGVA 1V55B 4LO9A 1R3HA 1V3MA 3VB8A 4GXVL 1FL6B 3WIIL 3O2DH 3RJOA 1MVFA 5FFOA 5DWUH 4MDRA 2GAZA 2NLJB 3CFBB 3MRGB 2B59A 4I5BB 4S1RL 3S5LG 3ULVE 4ZOCA 1AJ7L 1EFQA 1QPKA 1UCBL 3IGAB 3O6LH 2JH2A 3ABLB 5TD4A 2ZP0T 2OR9H 2WY3B 1MNNA 1RP9A 2VJ8A 1C1EL 4JM2A 4UM9A 3BWZA 1T4KB 4NRYA 2JI1A 4DHLA 4Z7UB 4ZMLA 1TQCB 2BJML 2J7LA 3SY0A 4JG1L 1RURH 1KIRA 2XN0A 3MRIA 2BIMA 4MJHA 9CGTA 4I0PB 2RTTA 4J28A 3GSRA 3VE0B 1AXSB 1ID5I 3QQXA 5D7IB 3ENEA 5B3JE 3LKQA 1VRSA 2P24B 2XSKA 3IPEA 2DS4A 2JB5H 2NNXA 2Y36L 4IJ3B 2A77L 3O45B 3OPZL 1K5WA 1IBDA 3BESR 4IIQA 4RGOH 3WIHL 1HQRB 4ZJ9A 3PDDA 2N1TE 2J44A 2C9VA 3IRCA 4DTGL 5IVZB 3ESMA 2QHLA 4P2QE 4O02A 3N1PC 1QR1A 4MJJA 1R34A 3AQXA 1TVDA 4R7DB 1KENH 2EIBA 5I74C 4IIQB 4B5EA 1EAQA 1Q0EA 1FPTL 5GGRB 4RAVA 2P5PA 2DH2A 4FL4C 5J4MA 5DEGB 4WDIB 2G9HA 4F1SA 4ETQB 2B2XH 1EANA 3BUYA 3DYMA 4I2XA 4DOHB 5IB2B 2GBTA 2OW7A 4GXUM 4M5ZL 1IIIA 4LLMB 3VAEA 4W4NA 4KUCF 3WLWC 1LGVA 1QATA 2GW5A 3F3HA 3BN9D 4PJ9A 3ZPDA 2QADC 3E6FA 3T6XA 3V6OE 3CK0L 1VAHA 2AQQA 1AO7A 2BNRA 4Y5VA 3GTVA 5G5DA 1AGCA 1OE3A 5J6SA 1TZHA 2XNAB 3R7RA 5IIEA 4AUJA 3AAZA 3RJDA 4IU3B 43CAB 5IQNA 2AEIT 3P4OB 5ECJE 1NBZB 3UYRL 3KGRA 5IW1B 4FNTA 2FH8A 1KIQB 1H5BB 1BM3H 3V4VB 2XPZA 4P5TD 4ZUUB 3O6MH 2D9QB 3D2UA 5EFIB 3GHBL 4P07A 4HU8A 4ANXA 1MDAA 1TMCB 2ILLA 1CQYA 1T80A 3QRLA 4KRPC 4TSBL 2KPNA 4QXUH 4NP4H 2NRDA 3V4VA 1KIUB 1NMCC 5C0BD 2XG4B 5DYOB 5D1XC 4BFBD 1RMFH 4TQ8A 1WWCA 2CUHA 2VDQH 4Q4EA 3MGTA 5EUOE 4Z77A 1FZKA 2CDEA 4PJXB 4KZ0A 3VSTA 1IAIH 1VA9A 1D6VL 1HDMA 1PW3A 2MNUA 3VACA 1J5HA 2XXMB 3C5ZC 3OR7B 5AYQA 2XG4A 4X50A 2FGZA 1GXEA 5BV7L 3FZUC 1EQWA 3MNZB 5F9JB 4M7JH 4RRPM 2D7TH 5IM7B 1KGJA 1UJ3C 3BD3A 4LGSB 4PJ5A 4P5RA 1IEAA 1AKJD 3OR7A 5AAMC 4AGLA 3VUAA 1N64H 3V5HA 4PJ7A 1XMWA 2DTML 1AP2B 2B1AH 3P30L 4P4KC 4HUKB 3KLHC 3OAUH 3PNWB 5DA0B 1NANI 1YAIA 4WW2F 4OIAA 1D6EB 1KLFB 4YLBA 1JZEA 1QVOB 2ADJA 5BQ7B 5I6XB 2YFOA 1LO3L 2HH0H 1CFVL 2DTMH 1N64L 2R2HB 4PJHA 5DTFA 5DS8A 4YEFA 3EDJA 2UUDK 2OS7A 1F2XK 3TEXA 2OJEB 4XVSL 3B2UD 4BQ6A 2YXVA 4TUJB 1T7ZA 2X05A 4I4WA 4WSGA 1OY3B 4TRPH 1PZSA 4YSDA 5DUMH 3U7WL 1I8IA 1N0LB 1Q9OA 1NMBH 1NM9A 1M05A 3PWUA 3SGJA 4RISH 4ABUA 4JDEB 5DMJB 2HA1A 1AGBA 2YS4A 1EAPA 2VMJA 1FBIL 1Z9PA 2X09A 1TF4A 1YY8B 3WXWH 3KW7A 3OZ9H 3QCVH 4O2FA 4AGNA 5EUOA 1ZEAH 2VQUA 2MOVA 1CFQA 1BZOA 2G60H 5KS9A 3OBAA 4LGPB 2F68X 4HG4K 1SVZA 4F8OA 4KZEH 3F6JA 3QORD 5CBAA 1AGBB 1G9ML 2FLRT 4Y9BA 4NQCA 4JFXB 4LP5A 4OV6F 1BFOA 4NRZA 1W72H 3RIFK 4KPHH 4XNQA 1FG2B 2Q76A 3HEIB 3T3MB 3QZBA 1NFIB 1S7SA 4IDJH 4WV1C 1GMEA 2R0KH 2ETWA 5F0PB 4O02L 1BIHA 1YEWA 3ARPA 3OJVC 1P5VB 4DVBB 5B1KA 4CJ1A 1BZ7A 4UZUA 3UYRH 1BFOB 1L5GA 3MJ8A 4R26H 3REVA 4P2RB 1H19A 2Q76B 4OZ4A 3D48R 2ZUQC 2YD0A 3MRLA 3HRPA 3W82A 2OI9B 3U2SB 2H1PL 2I9LA 1MCSA 3FCSA 1UASA 2HSIA 4N2CA 3U9PL 4FLRA 4N1EA 5I8OL 4JQXA 1AQ8A 4V1DE 1E0OB 4P3CL 1Z9MA 5D70H 1CLVA 2FQGA 1ZT7B 2VN7A 2EDJA 3FU7B 2DMKA 1A14H 4TUKH 2CAKA 4G9FD 4MZ3A 2CRZA 1QSFB 1Z2KA 2B2XL 5SWZA 2J20A 2J6WA 3AG2B 2HKFL 4NQTA 4OQTL 1PZUB 3GJFK 1MVUB 3QB7C 4PG2C 5IFAH 4L1BA 4HPYH 4HQQH 5GRJH 1FPTH 3ZQ9A 3FQTA 3X1FA 3O9WA 1RUKL 2PCFA 4FQ1H 4XN2A 4BXSV 2HKHH 5EU4B 1T83C 4ZX4A 3WDIA 2BNQE 2IG2H 5TF1H 3FO9A 2Z64C 3DROA 4HLZH 3C5JA 1QRKA 4FS0A 4GG6E 4MJIE 2AXGA 4C58B 1CDJA 1MCCA 5FM5M 1AR1D 2COVD 2DQUH 5J57B 4Z76B 1AKPA 2Y36H 2XKNA 4EKXA 4N0UE 4PS4L 3FRPA 5HDWA 2XQBH 1QQDA 1U8JA 1NMCB 5KANG 1EXUB 1NOAA 3QS2A 4LDEB 4KI5D 5I16A 2X7LB 1I9RH 4QY8A 2P5ED 1COBA 1BOGA 3P3YA 1MCPL 4FYRA 5AVZB 1O7DE 5AB1A 2X2YA 3HCVB 4R3SB 4WNSA 1DFBL 4KJWD 4PCKA 1ZVSB 1V27A 4IK7A 1XL4A 3RZCC 5L2KA 1DJSA 1VCAA 1DQMH 4KVCL 5ESQB 3QDGB 1C1EH 1YN7B 3H2QA 4GI6A 1TUPA 1ZOXA 2N7SA 4ALAC 2DL2A 3F64A 3O2DA 4MFHA 1BQHA 2X4OA 5SX4H 3PJSA 4QF1B 1KJVB 3F04A 5E2TL 3MRRA 1F4AA 1TENA 3TNNB 5C3IA 5JPNB 1ZK9A 4MWFB 1CGWA 5ESQA 5CLYA 3ARRA 1A6TB 5BOPA 4Z95H 3UMNA 2JELL 1DE4B 2VLJB 1MCNA 3UZQB 5FECB 4QTHA 3GQFA 1UGNA 2VL5B 2JE8A 4PLJC 3ISYA 3SKOA 4LHUD 3TNNA 1QRNB 4TQPA 2Q86B 4OTXL 1G1KA 2HMIC 5EEZA 3QEUA 4MVBC 3MNVB 2PNDA 1Z9SB 4Y4HA 1FJ1A 4FQHB 2Z4QB 1B9ZA 1WBYB 2V6HA 5KS9F 5C3TA 3UGUA 4WCYH 5FUCC 1AQHA 3PXLA 2PABA 4JY4A 1SBSL 2EC9U 3L9RA 1CGYA 3T65B 5C9JB 1DHKA 4ATTA 5BOJA 1NUDA 4LCYB 2F5AH 4XE5B 3U9WA 4BFKA 4EI6B 2PXYD 4WFGE 1A0QL 3BAEL 5DSCA 2X4NA 5KTEH 2K8MA 3OLEA 4DQOL 4OCXH 1KGXA 2WANA 3QJZA 5A16B 3RNQB 1D5RA 3T65A 1QNZH 5L4MA 4LCYA 1NICA 2IGTA 3AVEA 1OAXH 2PR4L 3LN5B 1N12A 4BQBA 1CJYA 4PGEB 1FIGL 1T5WB 1Z5LA 3WAJA 4WU7B 3QZWA 4UOW0 1ILUA 5FAAA 1YMHB 4MAUH 5FUZL 3G5XB 2BSEA 3UBXI 5H94A 1SEBA 5ANME 1GRWA 4M93B 3VA2C 4YHOH 5I1JH 4ELMA 5BPPA 1K6QH 3T08A 2XZZA 2XTJC 1O7DC 5J6GA 3RVUC 3ARFB 4DUVA 3EGDA 2F8OA 3ZO0A 5ENWA 3Q9QA 4PJ7F 2GJ6E 3MV7B 1ILSA 4XGZA 2NY1B 3EZJB 3KPTA 1VFBA 3V0FA 3NP4A 3WTUA 4AZ8B 4P99A 4OLEA 4ZTPL 2DPKA 2X38A 3HC3H 4FC3E 4GNKB 2NY2D 4W9EC 5LXGL 3GZPA 2IOIA 4XGZB 5CAYB 3BP6A 5EZIL 3MXWL 3U30C 2WXPA 4BZYA 2C9AA 5CN3A 4E9YA 1U8MB 4JUSA 3BE1H 4OQTA 5F7KC 3TH2T 3MI6A 3P0YL 4B96A 2WBJC 5DT1H 4XN9A 4M3JA 1DJHA 2LGNA 3QSKB 4JFEE 1ITBB 2F08A 5G55A 2OSLA 1N59B 3HZKA 3QRGH 2J3SA 4ZMPA 2E8ZA 1NKRA 4NWUL 4UAOB 1QBAA 3QULB 2VLRD 3TFKC 5C0JA 1KPVB 2Z34A 3IKKA 1NPNA 2X4RB 2J8UA 3K8KA 4Y5VC 3VTMA 5GXBB 3F7RA 4L4TE 1SY6L 1K4CA 1V3KA 3L5XL 4PJCF 4ODSH 5HHVH 1AFVH 4B0MM 1V05A 1FE8H 1HAWA 4Z7VF 3LQAL 2Y4SA 3ZUCA 1S9KC 1YNTA 3QFJE 5DK0B 1LDPH 2BP3A 4IRJC 2DKMA 4S1QL 3HG0A 3QEQB 5DHDA 4PJBA 4L29A 1NLBL 1NFAA 3D4GA 5AW6B 2J5LB 4J39A 1NEZB 1A8JH 2HT3C 1ET5A 4BUHA 3B43A 2DQJH 2J1YA 2D3LA 2WKGA 3DIDA 4LBEA 4U1LB 1HZKA 2Y3AA 1P7KB 1WLHA 5E6ZA 3QQ9C 1HU8A 2AJVL 5T1MB 5D1ZI 1JPSH 3DKHA 3BPOB 2EQDA 3G5VB 1JS4A 5I26A 1UZGA 2OLDA 4FLSA 4CU6A 1WAEA 4UQ2A 3DOIA 1UWXH 4WQOA 4D94A 5A7BA 4HWEH 3B5HA 3DWTA 3VMOA 2H6PB 4GRWB 2VKWA 4XZUB 4E9TA 4EI5C 3GMRA 1LO0H 3MX0B 5T1MA 4K2UH 4JFWA 4AK1A 1JZ6A 32C2B 5J9PA 3Q06A 2PYEB 3KPSD 3C8DA 1H0DB 5HGHB 1IBYA 1A9BA 3HI5L 3ZTNH 4MD0A 1SXZA 5FB8A 1LMKA 2XWJB 4C8XA 1QI3A 3MV8E 4TNEA 5K33A 1AS8A 2OV0A 5F96H 4XBGB 4JFFB 1QO3A 3QJUB 4C56D 4AKQA 1XF3A 3OKNB 1JHTB 1FHNA 1EERB 4YK4B 5BNXD 1VGEL 4OT1H 1K4DA 2EO1A 1KGCD 3KWUA 2YBRA 4WTZA 4ZBJA 3BWAA 4HETA 4NQUA 4XWGH 1W91A 3GUTB 1H3GA 3VFUB 1LLAA 1JFQH 3SDDA 5KVMC 1PLCA 3V4PA 1PAMA 3R0NA 5I19L 2FB4L 5I66B 5C0IB 1SBBA 1S7TA 3BXNB 4TNWF 3HN8A 1L0PA 1UB6A 3K1DA 2P26A 3S37H 2EIMB 1IQWH 5AB9A 2P8MB 1RU9L 3OMIB 3OKOA 3NFPA 4E68A 4K7FB 2LT9A 4UNTA 3QXDA 5F1KC 1IL1A 2J6EL 5E9AA 1P2CA 1LWRA 3L45A 2FO8A 4HCRL 1ES0B 4ODUA 3T4AC 4BE6A 2B3RA 4UQBA 1RZJC 1IGIH 2Y9RT 3OLDA 4JFUA 3X2QB 1O0VA 3ZDZE 1T3FA 2Q0ZX 1QKZL 1TJHH 3TNMA 3BKYL 5LGHH 1WZMA 1P2CB 3AREC 1C5CH 2LTQC 2NR6A 2A2QT 2ZOTA 5E2UH 2MCPL 1KBGL 2A9AA 2WP3T 1ORQA 4X6EA 4AXWA 1IM9B 5TDNB 1LDSA 2RB8A 3QPXH 2K9FB 2X89A 2A6IB 5KJ7E 1Z5YD 5D2NA 5IT2H 5FGSA 5C2UB 3DC0A 5E00A 5GHWL 2BFGA 4IW4C 4TULH 3WMQA 5AWNL 2FX9H 2HTLD 4Z3JA 5IOPB 4XPFH 3U4BL 1WRFA 4UT7H 3T0DA 1ORQB 3HOGA 3NRQA 2CHWA 3WUZA 2BOCA 3FQXB 1P0SE 4ZNCD 2HRLA 2X2HA 3F7QA 2Y5TB 1Y18B 2E47A 1SVBA 1CXHA 1YECL 1NCIA 1F3RB 2DRUA 4DTGH 4IRJA 5E7BA 2X6VA 4N0YL 4M5SA 2UXTA 1JGDA 1NBYB 4LCWD 3EIFA 4MCYA 2R4SH 2XTJD 5EU7E 5CP3H 2ODHA 3P0GB 5D7SL 1DBBL 4WFED 1EAOA 4GG8A 4XCNB 2RQ8A 2UWEA 5EC2A 4AEEA 3CN0A 4L0PB 5IQMA 4X6DB 5D7LB 4QRQA 4XMKL 2XV6B 2HWZL 2W07A 2ZG2A 1XGYL 3EYUL 3K0YA 2APBA 2VXSL 4NQEB 1LD9B 2R0ZL 5F7WC 2QT6A 2HUEA 4Z7WE 1WCQA 3LXBA 7PAZA 2ZQKA 2TRHA 3N44F 2ZOLB 1QTYT 3MV01 1RH8A 5KVDL 1F18A 4UT6H 1GZQB 3IETA 1N5AB 4F5CA 3ARBD 4PMFA 1EBAA 4NQEA 1HQ4B 2HX7A 3H6AA 4XXCA 2IAAC 1RHHB 4NT6A 1LE5B 4OIFA 3N9GH 4M3HA 2FBJH 2GJJA 4R4FH 4NPKA 3B5GA 3B56A 1M56B 3HBQA 4YOKA 3KYKH 4KI5F 1ZJAA 4Y2DB 5F71A 1N5AA 1FVDB 1FFPB 1IMHC 3U36A 3GI9L 1SN5A 2CM6A 5F70A 5E23A 2B9BA 2QJDA 1RHHA 2DV6A 2Z8VC 1Y6MR 2CLZA 4KTYA 4NT6B 1LE5A 1WIUA 2R4SL 3KPPA 3T0EC 5FW8A 5ALBH 3A24A 1NCJA 3VGEA 2Y23A 5IF0B 3V52L 4LOEA 1FN4B 1KCUL 2OMBA 3ASWA 5T33L 2WIMA 3BGFB 3DX7B 3FQYA 1QPPA 1XR8B 5HGDA 3KPPB 3RDTD 4NXKA 4LKCA 1NGXA 2J1WA 3I6SA 2R39A 4RNRA 5K9KB 5SV3A 4F20A 3V5KA 3GRWL 2QBWA 2QGBA 3U4BH 2ADIA 3K81A 4A1RA 4YS4A 4H20L 4DFHA 1DJZA 1QZ1A 4ZFOA 4K3GA 4WEMB 4IGBD 1MG2C 4GMTH 1KTLB 2JB6A 3QZPA 3V5KB 1MRDH 1GC1L 1MI5A 2FNBA 3D18B 1X5AA 2F1BA 5C0CD 4NKMA 4AGMA 3FF7A 4Y1SA 2OYLA 2NUPA 5HJ3A 4Z8FH 4N0CD 5HYJE 5I6NA 3BKYH 5DZJA 1BEYL 1OZUA 3D18A 5GPRA 4GKSB 5AOMA 2A73B 2VDRL 3VI3E 3BDYH 5E2WH 4MB5A 3VYOA 2EP6A 4QI3A 1HZHL 1UM5H 3BSGA 3LAFA 1NFDB 2OBGA 3UL4A 2IPUG 4I0PA 2E4FA 1GYCA 2XWDA 2YEZB 3W81A 1WFTA 5DQ9A 3GIVA 1BQHG 2ADFH 2WPGA 5JYMA 4ZFFB 3BRGC 5IB5A 1E8WA 1EDYA 5DZNA 1IQWL 1S9YA 1I7RB 1MCFA 1TQCC 4YHIA 4JJ5A 4F33B 3MQIA 5ERWB 3HE7D 3QH3A 2I85A 2CCWA 4UBDD 2IO5A 3K1KC 5GGTL 3NCWA 1KBPA 1SRDA 1O6SB 3WFCH 4AYEC 5AVXB 5GGUA 5FO8A 1FDLL 3CFTA 4KQ4H 1I7RA 1NCAL 4JJ5B 1HL4A 3T5WA 3LS5L 4JZOA 5FHAH 4ONFL 3TJHD 4DK5A 1RZFL 3K2UL 4KVPA 4PV8B 4XC3L 3X3GL 3EJSA 1HHIA 1AIZA 4XOAA 2MHAA 4L9LC 5BVJA 3IVKA 3DO3A 3WTVA 2Y7MA 1E3FA 2PF6A 3TO4D 4X9YA 5DHYA 3VI4E 1MI5E 1JWUA 3BKMH 4IGBC 4J8RA 1K8DA 1W0VB 5JIIA 1NQBA 4EQ3A 2JJWA 4LLYB 5D6CA 3BKJL 3RHWK 2HVJB 1EEYA 3HLAB 1EJOL 2NY0C 2VXUH 5I1HH 4JO2L 3VD1A 2G3NA 4HWEL 1JWUB 1E8ZA 4PHXA 2KH2B 2BVTA 2C9RA 2XBZA 5A3ID 2WVVA 3NEEA 1E4XL 3QORC 4U2ZA 3S3DB 2EDNA 1JZDC 1OCWL 1ZA6A 2UY6B 3WTTA 2VITB 4ZW8A 4A7TA 5DLLA 1PIFA 4XBMA 3GJFB 3BZ5A 3ZTCC 2HLFD 1HX0A 4CC0A 4OGXL 4GKNA 1ZPUA 3TWCH 2V8LA 4LZKA 4N9OB 4Z77B 3MGTB 4BK5C 1FZKB 4RMVA 2WTOA 3HVNA 3G9VA 4KKRA 1FCGA 1FYTA 4YSRA 1JK9A 5FUOL 5FYJH 4NKOA 5T1KB 3U6XA 3EYSH 1UOWA 2AJYH 3MRJB 4F58H 3H9HA 3VX1A 5IM7A 1SXCA 1F4YL 4NZUL 3EYVA 4NZRL 1Q0XL 4X8CA 1URIA 3LB6C 4NQCE 1ETJA 2EIEA 3MJ7A 4LFHG 4PG9A 5GISH 4FNQA 2J2ZB 4LARL 4NKOB 1EJ8A 2UYLA 1R1CA 4NBZB 4NKDA 4B41A 5JHLL 4FOMA 3UROR 1IAMA 1JF1B 3UJTL 5B7FA 2BY0A 2VIRA 1WH0A 4KITB 5ESAB 1RIUH 1MVYA 5M7QA 5F8QC 5A2BA 1BDYA 2ZCKH 3B2VH 4KK8C 4AGQA 3VFTA 5GIRB 1EA9C 5CEZD 1UA6H 4IBVA 5F3FA 5AVYB 3MJ9H 5ID0B 4XPGH 3SB3A 1E67A 2WXHA 5EBGA 3H3PL 1RZPA 3VXQB 3NJKA 5EG6C 1W6WA 3G5ZB 1IFHH 1SM3L 4JPIB 4MJ2A 2WXGA 1SLWA 4Q6IC 3PREA 3BPNB 3VFTB 4R7XA 4XVOA 4LCCC 4LVNB 4NN5B 4M7LT 1HL9A 4FQIL 1YLBB 3IDUA 1MAML 3TT1H 4Z7NF 3DSNB 4IRZL 4JRFA 5J11C 1UATA 35C8H 3ULUF 4M8QA 3VFMA 1OWRM 5SWZE 5AYUH 3NG5A 5I1JL 3I9GL 2FSEA 1TU2A 3RTLA 3GRGA 3BVTA 1BPVA 4MKTA 3VDAA 4QRRE 4XI5D 1IKFH 5D5MF 4AKOA 3KYOA 2A4EA 1U42A 4ZW3A 3QIUB 3WIFA 4K5MA 4AM0B 4BELD 2EDHA 1UM4H 1CGSH 1UZ8A 2BNQA 1OGAB 1R5IB 3RDTC 1FNGA 1A1NA 1R19A 1XZWA 2GSGA 1JWSB 4LXFA 2VR9A 4NLHA 4FNLH 3UBHA 1S7SB 3O8XD 2B9AA 4XVJH 1E4WH 4QJ4B 1D2OA 1AY1H 4M6OL 1IGCH 2XOTA 2PPDA 4KFMA 1MFNA 1RK1A 2AW2A 4P4RA 3RWGA 1JNHA 2IADA 4OZ4B 4OLYH 4PJXE 1KF9B 3RVWD 2C3GA 4F92B 4Y0GA 1O7SA 2X70A 2XG5A 3KGUA 1FIEA 3BW9B 4F27A 4BHUA 1MCIA 2ARJB 2ZX9A 4WO4C 3BP5B 2VN4A 1XR9A 1JZGA 1GSKA 1N0XH 4OTXH 4MDIB 1M1XA 4FFVC 3TBWA 3DPBB 1IM3B 3AXHA 3BKCH 4ODTH 5D93B 1QSFA 4LSRH 3BP5A 4UDUB 1JERA 5JYLA 3DYOA 4PJGA 2Y25A 5F9AC 1RP8A 3BIBX 3FT0A 4EO5A 1OWWA 1YG9A 2DLTA 1M1XB 1U8IA 4G5AA 3PE9A 4UUJB 1CU4H 3D34A 4FQ2H 1P1ZA 3QZMA 4MJID 4G8FA 2CGYA 4RSVA 2AK1H 3D25B 5KYUA 4NQDD 4P46C 3NFSL 4X98A 1U4FA 4R97B 3UXFA 4CDGC 1A3LH 4KVCH 3UAJC 4NWTL 5D5ME 1DFBH 3C60B 1A2YB 5DJXB 3H4FA 1NGZB 1UACL 3GYRA 2X4PB 4XNZB 5IVNA 4LQFH 3R18A 1SEQL 3QFJD 3DHJA 3BSZH 2C9PA 4UU9B 5CLTA 3HMXL 1QACA 1EHKB 3FFDB 5CP7A 3ZYOA 4QY8B 4K7PY 1JN6A 3CHOA 4AM0Q 4I3GA 3V0WL 1A2YA 4RESB 2ALWA 4NEHB 3NUKA 2FHCA 4JFOA 1ZVSA 3PUCA 3NCCB 2DQUL 1FL3A 4S1SH 2HTLC 5L2KB 2WTRA 3GSQA 3GBNL 5EBMB 3G3LA 3ULVH 2FK9A 4WLCA 5FYLE 4IOFD 1B2WH 1P6WA 3LXAA 1XGRB 4P2OA 4HHWA 1YYML 1GKOA 4EI5A 4PFEA 2X6BA 1FORL 3F00A 3RX5A 1A25A 5JA9A 4PLNC 3C2SA 1ZTXH 5DRXA 4UT9H 3QYNA 6PAZA 4JDVA 4JS7A 3SCMC 4OGYH 3MV9B 4H1LA 4JPWH 5IHLB 2AV1B 3ECVA 5HTSA 4PW4A 2R0WL 4ZNEE 4OF8A 4JFHE 3AROA 5ETUB 4G1EB 4NO5A 3CVDA 1T4KA 4NRYB 1EAJA 1OK0A 5I8OH 4M1CD 2Z4QA 3RPBA 5C0AD 1SLUA 3E9TA 4OFVA 4ZFOL 3BH4A 1P4IH 4NQED 3VQ1C 1OW0C 2EE2A 2PUQT 4YL9A 4AQ1B 5B1JA 2CG9X 1AE6H 2HJKA 5GGVL 4R7NA 2RFXA 3US1A 5KG9B 3TS8A 1TJIH 4AVIA 3BFWA 4X5RA 4LSTL 4WWKD 5DHVH 5E1QA 2X4NB 4DP7X 1VDGA 3VWJD 2P24A 2RGSA 2X1PA 5C07E 3TN0B 3DSFL 4HHAB 5A2FA 2IWEA 4AQ1A 5DI8B 1L7IL 5C70A 2WUBL 5EU7C 4I48B 3MUHL 5I17B 1BVKB 3MOBH 1XAUA 1CE1H 1IBFA 1JZJA 2R9HC 1T5WA 1G9HA 2KLTA 3F2LA 1OLZA 3GLZA 4O02B 5IV2A 5L9DL 1A6ZB 5F7UA 4V2CB 1YMHA 1ZEAL 5T1DH 5G4MA 4AC4A 1SEBB 1QRND 2JKXA 3A6OA 3LY6A 3O3EB 3WN5B 1NAKH 1X5HA 2Y2YA 3JTSA 2W9EH 1S5IH 1I85A 2OMVB 2ZXAA 2B39A 3M1BB 1J9CT 3Q5TA 4HISA 4RISL 5ENWB 3U79A 1NMBL 4ZOAA 5DD0L 5IB2A 2J8OA 4KOCA 3HG1E 3K4AA 3MODL 3OQRA 3RA7H 4TRPL 4AZUA 1VFUA 3L2NA 1WGOA 3LEXA 3MACL 3ZR6A 4EN3C 5E24E 3JTSB 4J3TA 4XVSH 1IUZA 3SDXB 2WVTA 4P5TB 1RZJL 1E27A 2KPWA 1TZHB 1PCXA 1A5FH 1FC2D 1Z9LA 2XNAA 4F8PA 3GZKA 4C4KT 3DRQA 3EF4A 1NCGA 3RX8A 3ZE2E 2BW4A 2LV4A 3ARGD 1S78D 4F15B 4NO2B 1UKSA 3O4LB 4H13C 1KELL 2DKUA 3T0EE 3VFNB 1T0NB 1F1GA 3E8UL 1AD0B 3LHAA 1F6AB 5D4JA 3RA7L 4D9RE 1RPUA 4MBRA 3V4UL 2B4CL 3MUJA 4P5TA 4JE0A 4EEEA 1UM6H 4L4TD 4BFNA 4N2GA 3GUFA 5ABAA 3D2UB 5EFIA 2E6QA 5FOBB 4I3SH 2W9EL 3EYQD 2HJFB 4XCYB 5D7IE 2CBQA 4JFTA 2CKBB 5H37H 3MYZA 5EZLA 5TDPB 2B08A 3GRBA 5JPMA 3QUYD 1BIIA 5CLZA 3SEPA 1WFJA 3ARFD 2Q8AH 2CZNA 3TCLA 1SXSA 4AK2A 3GXFA 3A4AA 1U95B 2XFXB 2LW3A 3RTQC 1DFXA 4WHCA 5GZND 3W0WB 2CDEB 5IQ9B 5EV7A 3S5LA 4K7PX 1UT2A 4C47A 1JV2B 3MCLH 5CUSL 5IUCA 2NY2B 3QXTA 1YUHB 4AX3A 5DDHB 3ZTJG 5HSFA 1F02I 4ZS6D 1BLIA 4LK4A 1TJIL 2X9XA 4TSBH 4PJ5B 3S5LB 2VMEA 1VZHA 2OPCA 4OD2B 2KZ1B 4A2EA 2AGJL 1G7MB 3EGSA 4PJCB 5F97E 4JL2A 3QK0A 5GS0H 4HJJH 4YBHA 2YGVA 1E2WA 1LJMA 4KROD 3RFZB 2GT9A 3BPCA 2HJLB 3MGOA 5PCYA 3PNWA 4LDOB 1DTUA 2IH3B 2R0WH 3HN5A 1DVXA 4QXGL 5CBEB 3ZDZB 3D30A 1VESA 3PABB 1OTTD 3UZEA 1KXHA 3BPCB 5I15H 3W38A 2HJLA 4UWQB 5F1NB 3PQYD 2IV8A 1MWAL 4TTDC 3NCYS 1RIHL 1A9BB 2GBAA 1YYMH 4LOFA 1S7UB 3QG6B 3OKDA 2OK0H 3ARWA 1A47A 1Z9OA 2WC7A 3PXJA 3BUPA 1H8NA 4L37A 4OSUL 4EQ2A 4ODVL 3LTVA 2Q6WB 1H9DA 3ZDYB 3RPIA 3JXAA 3N04A 3DVGA 1JPTL 5AW0B 1XB8A 3NJLA 1JHKH 3PUUA 3UP6A 2L7UA 2XRAH 4FHBD 4FQCH 3RWCB 2F5BL 1OF0A 2Y22A 1DDHA 3AG3B 4W9DC 2CK2A 1R5WB 1SEQH 5F6HI 1ZMYA 3L5HA 4CN6A 5KAQF 3PGFH 3PV6B 3TV3L 3VM7A 3WIHH 1JNJA 4GRMA 1ETZA 3RTQD 4UYPA 2BVPB 4G8IA 1IZKA 2FH6A 4NO0A 2P52A 3NK4A 4XCCL 2Y07L 4GMSL 3M07A 4JPVH 3NSYA 4U2YA 3VI4F 4ZAKC 4CW1B 5DJDA 4PJBE 5IVZA 4WVRA 3DTXA 4LU5H 1I8LA 1RERA 3MRLB 4EZKA 1CU4L 2JCCA 4FQ2L 4Z3EA 4JEGB 4EN3B 2J4WH 4GQZA 4AGPA 3GIZH 1OP4A 3VXSD 4IBQA 4GIOA 5GGRA 3TA4D 1JGUL 1QLRA 4DP0X 4LSPH 1Q1PA 5AALA 5JW4Q 3CQFA 2CLVA 2BDNH 1J87A 4I2XB 5F9OH 2ZWSA 3TIDA 3JV6A 1TZGH 2CU9A 2R69L 5TE7L 1UCBH 4XC1L 4GRLC 2CA3A 4U1KB 1IV8A 1XGTA 3MVSA 1UA3A 2Z8SA 4UANA 4PD4K 5DWUL 4XNDA 1JSYA 2YN3A 3O6FA 3PIQA 3QJHB 5DEFB 1ZLSL 3G08A 3O2DL 1ZIBA 3LS4H 1T0MA 4K5LA 2DOCA 5E95B 2BNRB 3CHQA 4G42B 3FT4A 1OCOB 4N0FA 4PMEA 5G5DB 1A4BA 2NDGA 4WJG3 5HYFA 3Q48A 1MZZA 3BVVA 4YZFE 4L05A 5DZVA 3VQMA 3C5JB 3QUYC 4K5PA 5IW1A 3VG9C 1MRCH 3UX9B 3FB6B 4G42A 2P5EB 5HDQL 2KHAA 4JR9L 4D3CL 4IJ3C 4FNLL 4LNRB 1IAOA 3N6YA 4HGWB 4X0NA 4FFZL 2B0SL 2EDFA 4AIZB 3T6ZA 1QBBA 4RZCB 4S0HA 3VMNA 2WQSA 1IKFL 1KXTB 3HE7C 3QIBB 4HV8B 5IK3A 4CC4C 1XH3B 5IW6B 4PRPD 1P5UA 1NCDH 2VZTA 1WBXB 2VDKL 4HUMB 4YIQB 3NJMA 2AVGA 1QSZA 5C0BE 1J8HB 3QUMA 4PG2A 2JCCE 1OOAA 3HB3B 4PTUB 3GXMA 1AD9A 3TJEL 3MRKB 4YDJA 2I60L 4ZPTA 2G2PA 2VZVA 5JIQA 3GPEA 4XHJD 4HIPA 3QXAA 2X89D 5J11B 4OLUL 2JTDA 1XQ4A 1KYFA 3UPRB 3IE4A 1FLRH 1IEAB 4K9EC 2G2NA 2QADB 3D39D 5SWQB 4HEME 5IBUG 1WEJH 3UZQA 4PLKC 2WZ6A 4YHYB 5FECA 1PX4A 3S2CA 1R3KA 4RWYL 5E5UB 3SKOB 2HRGA 3U36B 1Y0LB 2Q2EB 3VI3A 3ZDWA 3KDMA 4GQRA 5MEOB 3T2NL 3BIKB 4X6DF 3D3VB 3MNVA 3SQRA 2YKKA 1QVOA 4WUUE 5JHLH 4MSWA 4LAQH 2D03H 3NDZE 4LSVH 4YHZH 3VFWB 1IC1A 1QYGL 2FT8A 5IMOA 5IF0A 4O9HL 2NY7L 2NCEA 4YO0B 4DP8X 3HA0A 5B1AB 1OE2A 3GKWH 4XPBH 4FRWA 1UWXK 5MEOA 4BWTA 3NH7L 1T1ZB 3N85L 1HESA 1S9WA 3CZFA 4MSWB 4IRSD 3GJFH 5FYJL 4I4WB 1GPOH 4YHLH 3SDDC 5A6MA 2HFGL 3F83A 4MTMA 1OAUL 2ESVD 1H3PL 4NUGL 5K1VA 3SCMA 4P4KA 1MJUH 1X44A 3BRDA 3K71B 1PAZA 1RUAH 2IPKB 2YAHA 1EHLL 3QDMA 3MRQB 4R6UA 1I4FA 4KQ3H 4R4BB 5ABZA 3M7OA 5ISZE 1S3KL 2R15A 1Q90A 1DO6A 5I8EB 3BN9C 2J12B 5EUOB 3ERXA 4R0LB 2AITA 1UB5B 4Q9RL 4WU7A 2VR5A 4GUCA 4MMYA 4ABWA 5KS9B 2BVUA 2V9QA 4G8GD 2F1AA 4FQXD 4P4KB 5E9DB 4QXTB 3TF7C 4OV5A 1KJ2B 4JFDE 1K2DA 2QZQA 4HEPG 3II3A 4JHAL 3CVHH 1HYSC 4DW2L 4X7FC 2ZP9A 1BREA 2CSPA 2HP4A 3FQWA 4P5MB 3B1UA 4ZZKA 2VLJE 4OV5B 5CLWA 2I5YH 2NXZC 5EN2B 4E36A 1A4AA 1BOYA 1CI3M 3OAYK 3X1EA 2BS9A 4KHTL 1EJOH 3GMOB 3TEUA 3TBYB 2NXYB 1E9QB 2VXQL 4NS0A 1KEGL 3ASOB 2AJ3A 2DQFB 3ZE2F 5DQDL 5H2BA 4OD1H 4QRSB 4HIQA 3BKML 6CGTA 4U6HB 1IVLA 5KYXB 2BZ7A 5I1IH 4K3DL 4KVNH 2O93L 4POZC 4U49A 5HDRA 4Y4FA 2Y7LA 4H7VA 5F1OB 4L5FL 1N3NB 4ZXBA 1ZCRA 2XVGA 4N8VB 4N68A 1HTYA 1WG3A 5I28A 4UV4H 2WWKO 2XWTB 3K2UH 2C7UA 3D06A 3NJFA 1NCCL 2AANA 1IGMH 2EH8H 4HS8H 3FQTB 4Y19D 5BRZD 1HN1A 1LP9A 5B8CA 1YZZA 1Z1WA 1FV1A 1FNFA 3WLWD 4CVXA 4QOKE 3IVKB 2EAEA 1S2EA 5D1XD 5A1AA 1Z7JA 1T20A 1OANA 3OF6A 3VGDA 5C0GB 4JGNA 1S8DA 5KYNA 3QHFL 1XH1A 3W56A 5C08A 4HGMA 4J8RB 1IU1A 1W0VA 5L4IA 4XNXL 1I7TA 4KV5E 1INEH 1MFBH 3S34L 4ZMTA 3CHXA 2OMTB 2IH1B 4P5TC 5E2JA 3ZRFC 1RK0A 2FEDD 3IMRA 5C0GA 1FAKT 2VM3A 3NEXA 1EWHA 4FLHA 3UTSB 1S8DB 2J57A 1EXUA 3LSOB 3PQYB 3IFOA 3WOVA 4EF3A 2XN9D 1X4YA 3IBOA 2HPTA 1BOGB 4L4JA 4PV9A 1OP9A 3OGCA 5F7EL 2NY3D 2ZG3A 1RK0B 1JIBA 3NN8A 3L9EA 4ZW6A 3EBHA 4HIHA 4BKLA 4OVVA 3W2DL 3IFOB 3TURA 5IFJA 5LGJB 1YN7A 1PX8A 4MS8C 3RWFB 4HSCX 1RUPL 1GC1H 3SJVE 3UFIA 2PP7A 2EDDA 3GMRB 1ULVA 1XGUB 1OL0A 4OI9A 5AZEL 4OZFB 4A6YH 4OFYA 1CLOL 1WV7T 3WKQA 4X5PA 4Q4IA 1ONQB 4H20H 3IDNB 5IFJB 1XGQB 1NBCA 2X4SB 5EZOL 2MQ3A 3H4HA 4KXZH 1E7VA 4JRYA 1QFHA 1MCHA 3IMBA 2BS8A 1R3IL 3NA9L 4LOVA 4W9JC 1XF4A 3VFGH 5EUKB 4C56A 3ESOA 4PY8I 1XSOA 5I8KL 5MEPB 5EU3B 5T33H 2VZSA 2F1EA 2O5ZH 5I0YA 3DUHA 4PJHF 2A9NL 4PRIA 3BZ4A 4ZSOB 5HGGS 3EJYC 1VENA 1XZ0B 2J2ZA 4N1HB 4JZJB 2FX8H 4NM4H 3QNFA 2CHZA 1EO7A 2AK4E 4OZGB 4HAKA 2Y6TE 4S1DC 4B53A 5EU3A 3BMVA 1LE9A 3ZT6A 3J8F7 4JZJA 4HCIA 1W0YT 5GIRA 1F42A 3PAVA 3P40A 5L4JA 4UILH 2EH7H 3ULVF 4LMQE 3SDCD 3CH1B 2VLKE 3GXPA 3JWNE 4X8XA 3GINA 4J3OD 1LE9B 3KS0H 2Z7WA 4XMPL 5HI3D 3VI4B 3L1OL 1TVHA 1Z5LB 3OXRA 2XT1B 4HA1A 1KC5H 2BNRD 1AO7D 4HCGA 4ZO6A 1U4EA 3QXUA 1P9MA 5AW7B 2W0KA 1ZTXE 1GGCH 1CLZH 5H94B 5BUGA 1NEPA 2PCYA 1HKLH 5C6PB 4JO3L 4TNWK 4G8EB 3FQRA 5KSAC 5KJRL 4QPEA 2HWZH 1S9VA 3S7GA 1XL6A 1CZ8H 3OXRB 1DEEA 1GGYA 2IBBA 4MQ7A 5DD3H 1B0RA 2Y3NA 3Q44A 5D5MB 1UZ8B 4HPOL 1KCRH 3HJEA 4IBZA 2O5XL 1AKJB 4JO4H 5EC1B 1KV7A 1OXYA 3AS0A 4NC1E 4B95C 4Z7AA 3TO4C 4X6CA 3WEOA 2PCXA 2ZKWA 1AHMA 1B0GA 3BQUD 1FYTE 1HHGA 1CQKA 3H9SA 3VG0L 4WV1A 1GW0A 5EBLB 5DRNB 5HPOA 2UX6A 5KSBA 5A43C 1NC2B 1UD8A 2AK4A 1HWGB 3TBSB 1BVLA 1BZDA 2W81C 3EH3B 1L6XA 4M4RB 4DO5A 2YA0A 1QLEH 2WVSA 3ARSA 5T3ZL 4EIBA 2OTWA 4LLWA 2QMJA 1HHGB 5BXFB 4OAWB 4BXVA 4P2AA 1C12B 4NUMA 5GHWH 1HEHC 4LLAA 2WLHA 5E6IB 5EOQL 1OAJA 4MKMA 3RDJA 1A02N 3HZKB 5DJ6B 4YC2C 2K4WA 1YEEL 1NZRA 2P42B 3BT2H 4AYMC 2AEQH 4J3OG 3T0XA 4FGMA 3WFDH 1EHXA 2H8PB 3WFEH 1F5WA 3FOLA 4PJ7E 3B1TA 4GO6B 3ZYIA 1I8KB 3OJDB 4L4VD 1XGZA 4E9WA 3BJ91 1LK2B 1DVFB 5EEWA 5DJ6A 2AXFA 4KH9A 5IB3B 2E7MA 3A4DA 4Y2DC 1P1ZB 3GRWA 4LT7A 4FQPA 2GTQA 3FOLB 4YFEA 4FQJL 1RUMH 4HUXA 3CSYA 3RVVD 2BNQD 4JN1H 3P02A 4X4YA 3V4VL 1UHVA 3K2IA 4KHXL 2AXFB 4UOJA 1P7KA 1RJLB 3HZ3A 5D7HA 1DVUA 3VD7A 3P11H 4W6YB 4PTTB 1LMIA 3VD0A 2QMKA 2OR7A 4BRVA 2LABA 3QI9C 1F0LA 2X1XR 2EZ0D 4QRRA 1BXAA 3O3AB 5DVNA 1QHQA 5TTRA 2BSTA 3MRBA 1HHJA 5E94B 3DTDA 2VO8A 1I82A 4GQ9L 4WI5A 4O2CA 1NIEA 5CU5A 5EU6A 3VU2A 4GRLD 3V0JA 1DCLA 1ZHBB 2ZUUA 2ZPKL 4P2CG 4JFOB 3BFOA 1B4RA 4IBWA 4JM2F 3O3AA 3Q8EA 2GQHA 2VDNH 2WTRB 3GSQB 5E4EC 5DVPA 1LHZA 1H6FA 3L16A 5DXWA 1F3DJ 4JZJC 2HKAA 5FWQA 3O0LA 4RIRA 2F7PA 3LRMA 4JY5L 3LZOA 1DQVA 2VSMB 4BM7A 4K3HA 4JJOA 3V6FB 4XBGA 4ORGA 3NTCL 2CDGB 4RFEA 3EO1B 3T6VA 2H2PD 2CNYA 4FQQA 2VH5H 3U0PB 3MA9H 4G5ZL 3FQ4A 2F0CA 4E5XB 3GHEH 3BEWA 1AMYA 1LNUB 1ID2A 1JRHH 3C60D 1DVQA 2CLRB 2CQVA 2QV4A 4JMNA 3BYYA 3ATFA 1BAFL 2AV1A 3EUDA 5HXMA 3BAJA 4QNPF 5ETUA 4DVRH 4G1EA 4NO5B 3QFJB 3KBPA 2WIIA 4P9HH 4KKCD 3P0VH 3PWPB 3QUZD 2TSAA 4YE4H 4E9RA 5JTWA 3BEWB 2ICCA 5C86A 1TJGL 4RSYA 3SYOA 1DBAH 5DMGC 4HBCH 2CR3A 4MGXA 5F21B 4MZIA 2PYFA 3K74B 1MJ8L 4F7KA 1NFDA 3RGVD 3OPUA 1NWOA 2XQYG 5DD6A 3B7UX 3WS6A 5GZOC 4YXKL 2Z7YA 2YGPA 5E4IA 5TFSH 2VERA 4URKA 2H41A 3APDA 2B7DT 5IEKB 1QUNB 1PIGA 3I2CH 1AFVL 3RY6C 4KTEH 4GRWE 4HWNA 3GSRB 3TNMB 1JWMB 1MHHA 1Q72H 3L3GB 4I88A 5E6SB 3DARA 5MP6L 4YK4C 3RX9A 1RK7A 2F19L 6PCYA 2EDEA 4M61B 5LNDA 5IMLB 4NWUH 4QHMB 4Y7MA 5DRWA 1QUNA 3D05A 4OF5A 4QUOA 3S3BB 4LAJH 4CMMA 5D2NB 3TO4B 3CLFL 2LQRA 4U3SB 2ALAA 2BFVL 4U3HA 3ARBC 1UT9A 3RU8H 2VLJD 5CCKH 3NJVA 3HS0B 4M61A 2XN9B 4FI8A 3MRNB 3NZHH 4I7ZC 3NZ8B 4HLEA 4MNHA 2HT2D 3TO4A 4MXVE 4U3SA 5BZXA 5KZCD 1JG9A 1XIWC 4QGTA 1J9RA 4WDIA 4MA8H 4XVTL 2RHEA 2V7HB 5IROA 3MJWA 5CSBA 3ARXA 2AAAA 5DO2D 3UJJL 3FF8A 1RHFA 3BQVA 4LLYA 4HIXH 3LRLA 1YVLA 3OKEB 4X9IA 1EEYB 1XXFC 4MZRA 4J3UA 2IDSA 2VH5L 4GB9A 4WI7A 3SGKA 3VRLF 2ZXBA 4CKQA 2WB1A 4EN2A 4IMLB 4NUJB 2FR4B 2V5MA 1MJ7H 3VVVA 4GFXA 3OM3B 4HD5A 3T3MF 5T8IA 4F2ME 5FOBA 3ISRA 4QRQB 3RWJB 4GW5B 2Z31D 4GAJH 4IJTA 4LPYA 2XWZA 4X80L 5FUZH 4MAUL 1PFCA 4X6BB 1OAZL 2YAEA 4X4ZA 1FH5L 3PJNA 3T2PA 2JFCA 3BGMB 2CBMA 2YRZA 4AV5A 1I3VA 1U95A 5EWIL 2EEXA 4AQZA 5K9QG 4ZUWA 4HOZA 4KO5A 2AZUA 2LR4A 3DHUA 2R1YB 4YBQD 2E59A 3ESVF 3QI9B 3RVXC 3AADB 5HHOA 2W92A 3GEFA 4QR7A 4DQOH 4JNXA 1IAII 1MJJB 3CDGB 3PP4H 3BDXA 5T1KA 1EDQA 1FVDA 1FFNA 3BAEH 4PWEA 4ZO9A 1GZHC 5J3HC 3H1ZA 4KHXH 5FPIA 2APXA 1B0IA 3QI9A 2H5UA 2DYPB 3LVTA 3T0WA 3JTTA 3WTWA 1XF2B 4HJ0D 4K55A 4LIQL 5E7FA 3IFPB 4TSCL 1U2YA 1G94A 1R0AH 1IEHA 3MRDB 1G7LA 1NC4D 4FEIA 5GJSL 4M48H 1KLGA 2VIRB 1Q8MA 2JIXD 5CBEA 3P4MA 1JI2A 2O6CA 3CBRA 5ANMA 3VA6A 1UWEH 5GJSH 1QABA 5CN2A 2NXYC 3M7FB 4Q56A 3J07A 4DESA 1AACA 4TL4A 2I24N 4GP8B 4TSCH 5GGVY 3QPQD 3FOMB 4ODHL 1TZIA 2F54E 5DFWH 1YEEH 1NA8A 2XYBA 1H15A 1L7TH 3PP3H 3LKRB 3HE6A 4OZIF 3VXQA 4BA0A 5FYKU 3OC5A 2LU3A 4AE0A 1CFTA 1DLHA 4K5OA 5A2IH 3PP4L 2J1XA 3AS3A 3T0EA 4DZ8A 4J2XA 3L54A 3EDEA 3IMUA 2FWSA 4HKBB 3TTYA 1JCKA 4BSVA 1DJWA 4PJ8C 5DQJB 1DQML 4OB5L 5ADPL 3BAWA 3F62A 1CDGA 2FSEB 1KFAL 4Y89A 1MG3C 4LLQA 3O4LE 3T0EB 2Y69B 1WWBX 4QYOB 4AMKL 1BEXA 1J8KA 4IRJD 1M05B 3PWUB 4UIKL 1OAZH 5IMKB 1IGFH 1EFXB 1MCBA 3BH9A 2Z35A 5J1SC 2JWYA 4Q7DA 4JGUA 3LZFL 2A4ZA 5HVWA 1P7QD 2LU7A 4HPOH 4G7VH 2BVPA 1ED3B 5F6HJ 4BZ2A 2H0JA 5KSUB 3FU5A 3PHQB 1RVFL 2NX5B 3HI1A 5IMKA 2EVHA 2Z7UA 2YAPA 1JGLL 2IPUK 3VE0A 2AQSA 5K69A 1IGTB 2BX5A 1HKLL 4BH8A 3BUIA 4P2RD 1M9WA 1GGCL 2W60A 3RWGB 2FHFA 3W0WE 2IG2L 1O6SA 5FYJD 4QKTA 2NX5A 3HI1B 2XG5B 3DV4A 2ARJA 4DVBA 2VLME 3FN0H 3MJ8B 5F7MC 1L5GB 5JHDA 5D4IA 2P80D 3QHZH 4OQTH 1RFDH 4U05A 5BVJB 3JV6B 4APQA 1GHFL 1AZNA 4E9LA 3T2OA 1PG7W 2E86A 4BSJA 4R97C 3PHSA 1JPFA 2D7PA 3NACL 1JV5B 5F1SA 3U9PH 2YZ8A 4DO6A 1ODAA 2YLHA 5K5YA 2VQ1B 1JZHA 2H0EA 5KBNC 5B7MA 5IREA 4I18C 3VTAA 1CPUA 1G7PA 2F19H 2FO4A 1PS3A 3UBFA 1VKXB 2NZ1A 1JV5A 2BOLA 2EVFA 3E6FB 4ANVA 1KNOB 3RKDC 3T1WA 1XD0A 3BUDA 4ICWA 2CHDA 1H3UA 3V0GA 1XD1A 5FDWA 5D96B 5JHLA 1OT2A 1PBYA 2DF3A 4G6JL 4XNYL 1Z32X 2EJ1A 3MV8A 4BK8A 1KTKE 2JJUA 2X4TB 5L8LB 4AIZA 4FTVA 4E42A 3QA3B 3PS6A 5B3JF 4KZEL 1MDTA 4J6RH 1KIQA 4CL7A 4Y9CA 3KW8A 4BKTC 1PSKL 2IAMA 2FYYB 3U0WH 2ED7A 1E2ZA 4U1JA 4X9GA 3LPWA 3JWNC 4G43B 3P0VL 5IVXF 3VSUA 4RZKA 2Z4TA 4P9HL 3V0EA 4DT2A 3QDGD 5I1LA 3QUMB 4DVRL 4XXWA 4FNRA 4S2SB 3W2DH 3IF1A 3D07A 4OQ1A 5E9DE 4B60A 1NBVL 3VNYA 3WGUB 5ISZA 2QELA 4G43A 1XGRA 3UC0L 2FO1A 5EA0L 4AIEA 3LNGA 2V5TA 4EI5B 2ESVE 4OCSL 3AY2A 3UPRA 2HX8A 4L3EA 4UQAA 5D71H 4DEPB 4LRIA 3R8QA 1RZ8A 5JPNC 1VACB 4NBXB 4YHNA 1C5DA 1MFBL 3S34H 5F9JA 5BV7C 3C8KA 4N8CL 5IEHB 1XIWD 3EH5B 4W4OC 4X9FA 1P5UC 4FZEH 3TU6A 2HLAA 3QDJE 3Q5YA 4XR8C 1V3LA 2F7OA 2GEEA 4DP6X 1J0IA 2NYKA 3BVNA 3OAUL 5CEXA 1VACA 4X5QA 4RMWA 3VFWA 2CBTA 3ARDB 2X0WA 2VL5A 2ZPKH 5IEHA 4E0RA 1R46A 5DUPL 3HR5B 4UDTA 2O72A 2JKNA 5GRYA 1DQDL 2Q86A 4IK6A 2E56A 3ILQD 2XZQH 3QEUB 4K9EL 1Z9SA 3G5ZA 2QVIA 3EFFB 3KPMB 3MXVL 1JGIA 1FLTX 1GMIA 4JG0L 4V1DD 2JKRM 3P11L 1MAKA 43C9A 3FTSA 4G8AC 1F1AA 4JUTA 5C9JA 3VXOA 4M8QB 3VFMB 2YAMA 2XZAL 2YARA 4QKXB 1J1XH 1RMFL 5I8EA 4H88H 4R90L 3KBEA 3FUNA 4OD1L 4GLRH 2W5PA 4GAAA 3IRPX 2QVTA 4U6VH 2VXQH 5DFVD 5IHUL 1KEGH 4KU1A 4QXUL 1UENA 4JDEA 4QOKA 5E9DA 3DGCR 4H8PA 1KJMA 5HI5C 1CBVH 4FP8L 4JLRA 1BHGA 5I76B 3QARA 5KYWB 4XB7A 2G5RA 4X4KA 3NIFF 1GGIL 3UTSE 4R7VA 4DKFH 4NO3B 3WFDL 3MV7D 5EO1B 3FQWB 3ZHFA 1BM3L 4W81A 3OWRA 4RAUA 4P48A 4DW2H 2B5IC 3MLTA 1PY4A 1QWUA 1PQZA 3JVFC 3MRCB 3QWRD 1PG7H 4FI7A 4KY1H 4NQCB 4R0LC 4DPCX 5I76A 5KYWA 1K5NA 1N70A 1RK1B 2H3KA 5J6GB 1ADQA 4HWBH 2GC4C 4APXB 2WNXA 2PXYB 4L48A 5AOLA 3S3PA 2WZAA</