4L1LA

Rat pkc c2 domain bound to cd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C alpha type
publication title Cd(2+) as a ca(2+) surrogate in protein-membrane interactions: isostructural but not isofunctional.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4l1lA00
1DSYA 2WXPA 3B7YA 5KJ7E 1RSYA 2LHAA 4GB9A 2CHZA 3ZW3A 2JQZA 3L08A 1UGKA 4WWPA 3W56A 4HVBA 2WXOA 4FJYA 4FULA 2K4AA 1QASA 4ANWA 1DJXA 2CJTA 3OHMB 2B3RA 2UZPA 3APDA 3FDWA 5EDSA 1E8XA 3L54A 4NPKA 2Q0ZX 1E8YA 1RH8A 2CM5A 2WXRA 4WWOA 4F1SA 3FBKA 3L16A 3ML8A 4TV3A 1V27A 4BGDA 4OVVA 4TS6A 2QZQA 4PS7A 3L4CA 1BCIA 1HE8A 5H4YA 1K5WA 4AOFA 3HN8A 2D8KA 2K8MA 3QR0A 3T8MA 2ENJA 4L2YA 4G11A 2V4LA 3NSJA 2CHWA 4FHJA 4NS0A 4KZ0A 4ICXA 3LJ3A 3GPEA 4F93B 1DJIA 4Y1SA 2WXJA 3QAQA 2WXHA 1GMIA 4QJ4B 4QJ5B 3IM1A 3OAWA 3M7FB 4OVUA 3RDJA 2ZKMX 2K45A 1DJYA 1CJYA 1YRKA 2Q3XA 3ENEA 4IHBA 4QAMB 2A4ZA 3W57A 4KITB 4NPJA 4EZLA 1WFJA 4FADA 3PREA 5T8IA 3HHMA 4IQHA 1BYNA 4ANXA 4PS8A 1UOWA 3R7RA 2N1TE 3QK0A 4FJZA 2WXMA 4DK5A 4LDCA 5G55A 4FA6A 1UOVA 3F01A 2KI6A 3L9BA 3N5AA 4EZKA 3SD5A 1E7VA 4ICWA 3L13A 4PS3A 1A25A 4Y1TA 3PS6A 2EP6A 3TJPA 5JHAA 3PYCA 4V11A 2R83A 1DJGA 4DNLA 1E90A 2NQ3A 3JZYA 1DJZA 3APFA 2FJUB 3QJZA 4WWNA 3KWUA 3NZUA 5CCJA 3F04A 1WFMA 3P2BA 4LCVA 2CHXA 1DQVA 4BFRA 1TJMA 2ENPA 2X38A 4XE0A 2ISDA 3KWTA 3L17A 4JPSA 1DJWA 3MJWA 2NCEA 3PRZA 2FK9A 2WXQA 3APCA 4L1BA 2WXFA 4MJJA 1BDYA 3R7QA 3HIZA 2CM6A 2Y3AA 4GNKB 4TUUA 3ZIMA 4AJWA 3CSFA 3F00A 3CSTA 2K3HA 4L1LA 2RD0A 2NSQA 4XX5A 4NP9A 4J6IA 5JHBA 3F05A 5CCGE 4EZJA 3TWYA 2CJSA 1E8ZA 4FLHA 1E8WA 2WXNA 1QATA 2A5UA 2BWQA 2WXLA 3NZSA 4KZCA 1DJHA 4HLEA 3ML9A 3ZVVA 3S2AA 2ENQA 3IBEA 2DMHA 1RLWA 3TL5A 2DMGA 2QZ5A 4ANUA 2WXIA 4ANVA 4LT7A 4F91B 2YRBA 4WAFA 1W16A 4XZ4A 3RPBA 5CCHE 4L23A 2WXKA 4A55A 3QR1A 2CHDA 4FHKA 2YOAA 5G2NA 1W15A 2WXGA 4URKA 3QARA 3PFQA 1TJXA 4QJ3B 3DBSA 4F92B 3DPDA 2Z0UA 5H4ZA 4WEEA 1E7UA
chains in the Genus database with same CATH superfamily
1TQWA 5KJ7E 3LAFA 1WH0A 2O5XL 1JGVL 3OZ9L 4P3DB 4P5TA 1G7QB 1N68A 3QUMA 3W56A 4UV4H 4PJFF 3ZMEA 3B3IA 1K8IA 2I60H 1O9WA 3FQTB 3FSWA 2FJSA 3VFPA 4FFZA 1OGTA 5E2VL 3ML8A 3I9AA 2XWRA 4V1DB 2BW5A 3L4WA 4LVHB 1CT8A 1XGTB 2D7TL 1S8DB 5F9AC 3D39B 1M1XA 1UCBH 1XDTT 1XSOA 4DP6X 2IOOA 2R2EA 4MNQE 1OD7A 3BPNC 3BCDA 5J6GA 4N8PA 2NT1A 1R6VA 2NY1D 4IEFA 2V9TA 4L3AA 3MRFA 1KV7A 4YLCA 2VN7A 5DC2A 4QRRE 5B3JE 3APNA 4A7TA 3RDJA 2FJHA 1PDKA 1U21A 4OD2A 4PRIE 4NO3B 4HCRL 1F42A 2AANA 3HE6A 3TZVA 2EYSB 3ECWA 2Z31B 2FDBP 4FFVD 3O45A 2N56A 5IROC 2Q8BH 4LCUA 1E4WH 1IZJA 4N8VG 1KBVA 2HKAA 1JGEA 3UO1L 3MV7D 2AEPL 4KROD 5GGSY 3T0EA 5FLVA 1LD9B 2R0WL 1HINL 4PBXA 2FATL 4Y1TA 1LE5A 5DUJA 1D5ZB 1EAPB 5CLYA 2JKSA 3SE9L 3HS0C 1XMEB 4MSWA 3PHOB 3O2WL 1CTOA 2B0SL 4Y9FA 1R3KA 1AZNA 1NTDA 5CSZA 2FJFB 3QUMH 4DKEH 4YSSA 3US1A 1XGQB 4OCXH 5AD0A 4XCCL 3QNYB 3AT0A 3CCHA 3R7QA 2AMGA 5JPMA 3VWKC 3TJEL 1L9NA 2CM6A 5IB3B 1S3KL 1XGUA 2FWLB 1TQBC 1UA3A 2VDKL 4GSQA 4IMLB 4UTBA 4UINH 4N1HB 3WNNA 5C0CB 2E74C 3GC3A 4OI7A 5I23A 1SHMA 3RG1C 1KCWA 4KZCA 1ZT1A 4P5MB 3KPMB 4OQTL 3OLGA 1MRFH 4TF4A 4G8GD 1CLZH 4QRPB 5EU7C 1XIWC 3RPIB 2IH3A 1ET8A 3CSYB 4I1RA 1HFUA 3VSUA 4DGWC 5LVEA 1T89C 3LNFA 1EIBA 1IVTA 2AITA 1Q8MA 2CBMA 4YSRA 3CFDB 4PCSA 5MHSD 5J3HD 2WZAA 4CU7A 3FSOA 5KZCB 4HZAA 5AW2B 4TQEH 4JM2B 5DRXB 4XGZA 5ECJE 1EO7A 2XFXB 1I3GH 3OAUL 4XXWC 4HDIA 3V55A 1TJXA 2DEXX 4DP8X 1UT1A 2XICA 5CCKL 3FT2B 1B4JL 1GKEA 3IS1X 1BBJB 3BT2H 1GS7A 1SXNA 2F8IA 4XMLH 5CUSH 5T1LD 1BSIA 4X80L 4XNXH 1RIVH 1UGKA 4F7PA 2CKBA 4AITA 1F11A 1ADQL 5DCCA 2FQFA 4FMKA 5E8DH 2CQVA 4JHZA 4YE0A 1PY9A 5IV2A 2J4WH 4NC1E 5AB9A 1T1WA 1OCZB 4JQVA 1HXYA 2AQTA 4ZS7H 1ZV9A 1P7HL 1ACYL 3B43A 4XT1C 4TTDD 1MWAA 2DJSA 1EDQA 2CBTA 3M17B 4MTMA 3HAEG 3QB7C 1FL3B 3DX6B 2MQGA 3CZGA 4JRYD 5B8CB 4RMVA 3SGKC 4XE5B 2NY3C 3RUGA 5INDA 2OA9A 2ZOWA 1MQKL 1DJYA 5B39A 1DBAH 2JIXB 4BD4A 5C2BL 4FQXA 2Y06H 1YEKH 1TYEB 2YA2A 1C12A 3DMMB 2XU9A 2ZXDA 1IAII 4QRRA 5E95B 3FUJA 4LEBA 5C07E 4EZKA 2ATKB 4GT7A 4PRIA 3MLXL 4RETB 4RNRA 1XAKA 1CQYA 1IC0A 1I3UA 5D9SB 2VQ1B 2NNCA 3KXFD 3MLUH 1UENA 3DVNA 4WCYH 5KVFE 4E42B 1S7XA 2Y7QB 4LCCB 4NO0D 4F3FA 3LXUX 3IFPA 3CDGA 3O3AA 4JRLA 4LCVA 4FFWD 2ZUVA 1DBML 3P30H 2EXYD 2VSDA 1LK2A 2R1XA 3MTRA 3U9WA 4TL4A 3O8XC 4ZAKB 2JKWA 2IDFA 4EI0A 5FUZH 2EH8H 5DF0A 3LZQA 2EVFA 1OAXL 1KIUA 2XA3A 3T3PF 3II1A 1BMWA 4BUGA 3APMA 3PNWB 3F3HA 4Q9QH 4UUJA 4YXHH 2VWEC 1XB6A 2VUYA 1NMCC 4AK2A 4JFZL 2BDNL 4NYLA 4UOW0 1PIFA 2DQTL 1XTMA 1DUYB 2E6QA 4PP1D 3L4ZA 4I18C 1D9KA 2VLKA 3VA6A 4GS7C 2C3VB 2YK1H 5HYEA 4XHJC 2QGBA 2UYLA 2BOBB 3CN1A 5AYQA 4DO6A 1I7RB 4QLWA 4DVRL 2IAMB 3EHBB 4NN5C 3AZUA 3MRBA 4Y5XC 1UGNA 32C2A 1OB1A 2PP7A 1DVSA 4KVPA 4UBDD 5AVYB 4TSAL 2A1WH 3S37X 4OY9A 3PWJA 1SJEA 4JGMA 5ISZD 3AGVA 5KJRH 4HHAB 4YEEA 4JRXE 4ONFL 1ID2A 1GGCH 1SXCA 4HMCA 1K3IA 4WK2B 4I89A 4Z7QE 2X4SB 3O11B 3OZLA 3GSNL 4KRLB 5C86A 4PJ7A 1BD2E 1JPEA 1IGTA 4WHDA 4F1SA 4TV3A 2H1LM 2A38A 4M93C 4MA1B 3GJEA 3IJSB 2VDRH 1CGVA 3D52A 1RZKL 3O6MH 5BZWA 2QKIC 5KSBA 2FX8H 4YDZA 1RJLA 2P1YA 5B1JC 5IVNA 5C0ND 2WO4A 2GVYA 1MFEH 4FHJA 4KXCA 1QLRA 3GIZL 3GHPA 5C0AD 3WJLC 3ZXAC 2R9HC 4DN3L 1DFXA 3LKRA 1A3LL 3Q5OA 3LZFL 4HT1H 4JFPA 3L3DA 5I0ZA 4PYGA 3B5HA 2D31B 1PD0A 4WV1B 4XN1A 5DZPA 1L9OA 3P4NA 1XV8A 5CIPH 1G4RA 4ADIA 5EFIB 1AQMA 4JJ5B 4XO8A 1KBGL 5DA0B 1S5IH 2JK5A 2ERJB 2RFXB 5I0VA 1DZ0A 4N3UA 5E1IA 1JUFB 1EEYA 2E8YA 1H0DA 4U1IA 3BZEA 1QFUL 5FYJH 5I6KA 3DV6B 1RCYA 1VZIA 5T3XE 4PWJA 1SHSA 5FW8A 4GMTH 4N1EA 4E68A 5AWNH 2IPKA 4F7EA 3EYUH 4P4KB 2BVEA 1INEH 1ASQA 1J1PL 1W72B 3NA4A 4POYA 2X41A 4HIEB 5LGJA 1YYML 3NQKA 2YAEA 1OXYA 5KBLA 4RMBA 5C07A 5IFHH 1ZTXH 2GY5A 2PWEA 1CU4L 1XZ0A 3B2UD 1TMCB 1HZHL 4DUWA 2G75A 1Q0XL 4LLMB 4G9DB 1KN4H 5F2FA 3VW3H 1J8SA 4R5VA 4YHOH 3WNKA 1UD3A 2O6EA 2Y7MA 2GBUA 4J6IA 4AM0Q 1U0QA 3QEGL 5DU7A 3JWNE 3O6FB 4OZFB 1FFRA 2WZ5A 3WUWG 4KVNH 1OCWL 4NZUH 4CC0A 1W0WB 3SPHA 2CIKA 4NNXA 4RMTA 1AH1A 1AACA 3WEXB 4WAFA 5HPOA 1Y7VA 1DEEA 2PPAA 2GHWB 3IE4A 1S7RB 2GW5A 4LSUH 4X8XA 5HGAB 2BCKA 1IC5L 4ZXBA 5JQ6L 5JOEA 1JGLH 2CO2A 3IS0X 4FQ2H 1AJ7H 3TEZA 5KS9E 1LP9E 2L0DA 1UA7A 1GYWA 2FVNA 3UFIA 3GXNA 4ZMQA 3CUPA 4M7ZB 4X5PA 5GGTA 5DK0A 1Z9NA 1BZ7A 1ZV5A 4KY2A 1ZJBA 1P5UA 3I85A 1SY6A 4XCNB 3H0TA 3OKLA 3ILPA 2BZDA 1OK8A 4TUJA 3ZTDC 1H5BA 2JV6A 3RNKB 3E6HA 4JRXA 4L4VD 5K9KA 5JA9A 4W9CC 2ADJA 3UX9B 1A9EB 1IT9L 4ZTOL 4CMHB 2WJ5A 3MACH 4CKQA 4G3YH 2LABA 1R3LB 1JHKL 4GINA 2V9QA 1BD2A 4JQIA 1JNJA 4QT5A 3SKUD 5CEYA 3TBWB 4XO9A 3O9WC 4LAQH 4Y4FD 1D2OA 1HYSD 5IM7B 2G0LA 2O5ZL 4PJCB 3L4XA 5IBUB 2A4ZA 2HRLA 1E0OB 3JV6A 3QVAA 3ZE2B 4JLRB 1KG0B 4A7UA 5IQMA 5L9DL 1ERNA 1X5JA 2X89D 4FYTA 4K3HA 3L4VA 1R3IL 5GS1C 4ANXA 1OB0A 3D69A 4PRHA 4X4XA 4RAUB 2ZZUT 4NN7C 4XP4L 2YKLH 5F1KC 4NO5B 1NIEA 3F01A 3OLDA 2D7MA 1MKFA 4B53A 3I9IA 1YQVL 3ES6A 3NH7L 1I9RH 4DQAA 3FULA 3BRFA 5DQ9B 4A37A 1XR9B 1DJZA 1KELL 4TNWK 4HC1H 3VJ6A 1AXIB 4NZTH 2OCCB 1EHLH 2JTDA 2NY7H 3E9UA 4NCDA 4BZ2A 2ROXA 4OV6F 1ED3A 1I9EA 4HIIB 1SY6H 2V5TA 2OMTA 2ZKYA 3B9VA 2UZIH 4HW6A 4EXPX 4R7NA 3EH4B 3MLTB 2HN7B 4M8QB 4BFFA 4X9FA 2EVIA 2ZKWA 3RVUD 5E4AA 3HI5L 3CSTA 3LKOA 1BWMA 3RPKA 4U6TA 5L2JB 5DD1H 4N0RA 4QHUA 3VRIA 3LZNA 2CJSA 1Y0LA 3GSQB 3SCMA 4HLEA 4FF9A 1T83A 3V9FA 1ZK9A 1YEEL 2DM4A 3RZWA 4GW4B 5IGXH 2K6YA 2X87A 4X0KB 3THMH 4PJAE 1AXSA 1OAQL 2EEDA 2VDOB 5F9JB 4HKXA 5E6YA 4NUJA 4MA3B 1SDDB 1AR1D 1BP3B 2EZ0D 3P77A 4PGBB 5CSGA 3BE1L 4AEHH 2YOAA 1H6FA 4S1SL 5TPWL 4P59L 4MAYD 1NINA 3VFTB 5F3HA 1I3VA 1N7ML 4AVKA 1CXIA 3GEWB 5E8PA 3DUUA 3V52L 3EGXA 2AEQL 2WVTA 4YGAB 3MRQA 3QZBA 3HRZC 3NJNA 3TV8A 3QUYB 4QXGH 4QWWD 1HHGA 3FDWA 2R9HD 3MQIA 4BZ2H 1LP9A 4W4OC 2BNRD 2PPFA 5DJ8A 3OHXC 1Z5LB 3BVTA 2IDUA 1C5CL 4Y16B 3CFJA 5T3XH 1V54B 3BWZA 4CSTA 1JHTA 4HGMA 2ZXEB 3EYOB 3QIBB 4A2GA 5SV4A 3F12A 1LEGA 2NOYA 1CXKA 3DPBA 5DFAA 1CGXA 1KB9K 2XY2A 1RUQL 3B9AA 3S35H 5HI4D 1G9NL 5C8JA 2XN9D 1MJ8H 3TONA 2VABA 1CLOL 2JKXA 5F7EH 5C08D 5LUMA 5EZLB 2X1WL 3RL2A 3N40F 1MDAA 2FE0A 4GRLC 3C5SA 3IGAB 4W9GC 3D4CA 3WJMA 4PRPB 1XF5B 5AVRB 3KWWA 3B5TA 4P2RA 3B2XA 3SDCD 1XX9C 1OAKL 2H8PB 2LTQC 4OTXH 2XHNA 3HLAA 4LSPL 1G6RB 3KPRA 3SJVB 4IW4C 3DUSA 1IAIH 2C1PA 1QSEB 1XGYL 1YECH 5E4OA 5B4MD 1P1ZB 5KWYC 2P80A 1WPCA 1DO5A 3KLDA 4BDVB 4DESA 2VLJE 3KPQB 3RJOA 3HA0A 4U1GC 2VAAB 3TBYB 1UJ3A 1CBJA 4WUUD 4YMPA 3HFMH 4GQ9H 1KZQA 2A6JB 4ZQKB 1ZGLB 4U6HA 4W9LC 4CW1B 1BLIA 2E27H 4XMPH 2YQ3A 4OUOA 1AD0B 3UERA 1AZUA 4AIEA 2VDPL 2WXQA 1U8OB 2AK1H 2FWSA 5D1ZI 3ASWA 5E0FA 1IGFH 1AQKL 3S96B 1IGCH 1OOWA 4WVRA 4OFVA 4RAVB 1NUGA 4DJMA 1F4WL 1QTSA 5AEAA 4PJ5D 5DMIH 1MAJA 5CEZH 1SMAA 4B60A 2PCFB 3KHOA 1YJDL 5I9QB 1ZT7A 4B27A 4W9KC 5FA4A 3TEYA 2WLZA 4APQA 2I85A 4PGEA 3VXMB 5C0FA 5HXMA 4K5NA 3NDZE 4EQ2A 4WFGD 4D0DB 4X7TB 2IMMA 1FYTB 2VAJA 4IOFD 4MCNA 4L9LB 5DFVC 4QTHA 1UUSA 2FHBA 2X40A 4PJAA 2NZ9D 1ODUA 2YD6A 4AYGA 5I1HL 1N8ZA 1WA2X 2OMUB 5IMKA 3MRPB 2EDLA 5KANI 2IEPA 3UJJH 3KW7A 2Q7YB 2FO8A 2WD0A 1QSFE 3FHAA 2WNGA 4KI5D 3U36B 5DVNA 1JZ5A 3REWA 5EULV 2DIAA 2Z3FA 2XLLA 4NQED 4L29B 3EXJA 1P7QA 1QHPA 3SBWC 5JMRA 2AP2A 1IGMH 2CU9A 1U6AH 3I3DA 4B0MB 4ES9A 4XCYA 3ZRFC 2LU3A 4BH8A 5EO9A 2F54D 1NEZA 1FIGH 2CR0A 2EIKB 2GTQA 2PXYC 3AG4B 3EO9L 4RBPH 3WO3B 4GUQA 1KTLB 3VFVA 1QRNE 4ELMB 4HXAL 5J1SC 3QCUL 4LSRH 3Q1EA 4D9RE 5BVJB 1GGUA 2CA3A 1QFWM 1I3RB 2CJUH 1S46A 3BPCA 3CZFB 2C9UA 3CSBA 4KRMB 2QVMA 4HEME 1EGJA 2Y5TA 4UM9A 4XP6H 5A2AA 1MJJA 1OO2A 1S4IA 2DLIA 4YZWA 3ZMNA 1E28A 1DQJA 3K2KA 3VFMB 3GMPA 1R5VA 2JXMA 4AH2A 4PJ8D 3BKML 1W6WA 4FLQA 1FNSL 4QRQA 3HMXH 5HDBE 5IEKA 5MEOA 3BVUA 3MOBH 2W0FA 2Y9RT 2XZCL 3BUTA 2O30A 2NX5E 4QYOB 1CE1H 3LQZB 1AP2B 4Y1AB 3WNJA 4I87A 2BZCA 4K7FA 4NBYB 4Y2OB 3OLEA 4BIKA 4R4ND 5AQ0A 2JB5H 3BUQA 3DHPA 2GBTA 4OLVL 3E7JA 2N3JA 2VDKB 1L5GB 1IGYA 3OKMA 2CHXA 4XPTH 3DA0A 5MP6L 3O41B 4XPFL 4RX4A 4DCQA 1T1XA 4O58H 3LS4H 4J27A 4F57L 1XXDC 3QNZA 3BHBB 2OSLA 3JYBA 1UQSA 2VLJA 2AK4E 1QFOA 2DWDA 2YFOA 4JO1L 1J5IA 4AG4H 3MCLL 1T1YB 3GWJA 4FE9A 5EZPA 3FU0A 3IDNB 5ETUA 3H55A 4Z7IA 5J6HA 2XIDA 5IFJB 1MHHB 4XP9L 5F7KC 2B1AH 2Y36L 3K4ZA 3UDWC 2ZOUA 5HHPA 4HQQH 1ACXA 1ZIBA 1F4XH 4OU3A 3QQ3A 4CADA 4NQXB 2FR4A 4KDTA 3MZTA 3WUZA 1NZRA 1PZAA 2HKHL 3GSUA 5JPNB 3CK0H 4ONHB 4TQIA 1S7WA 2VH5H 4OFPA 2EEXA 2IWEA 5GRUL 3ZT5A 1CGSH 1SLWA 1WCBA 2F74B 1I9JL 4M8VA 4LLUB 3QWRD 4PJ9B 3NZ8B 2VZTA 3V4UH 2QADB 4YHKL 1AQDA 4PSRA 2V3DA 4LDEB 3L54A 3V4PA 3CIQA 3IKCB 2AFNA 3O3EB 1B6DA 2NXYB 5H4YA 5HI3C 2QLVB 4JFFB 4KRPB 5DT1H 1DQQA 1PIGA 2V7NB 4QO1A 4Z5RB 1QSFA 3PHSA 4XBMA 2ZCLL 2CDEB 5C0BB 5JTWA 3PDDA 5EUOE 1IILE 4PGDA 1J9RA 3OXSB 4PV8A 2ITFA 5EA0L 2OMXA 2OXGA 4PBVC 2DL9A 1FDLL 4QF1B 3QQ4B 3PQYE 3GD1C 1OTSC 1HDMB 1QRNA 3JYCA 5HDRA 2JKNA 3HHMA 1Q9KA 1G9ML 4HUNB 3FOLB 1BA9A 1PZ3A 3JV0A 1R4XA 5J9PB 3C5ZA 2A6IA 4HD9A 4HEMA 2A77H 4P3CL 5L8LB 1QFWL 2XTJE 5I19L 3VSVA 2XQBH 1XL4A 3IN2A 1JF1A 2MPAH 3WTVA 3H2WA 5HP5A 4KKRA 2Y24A 2GSIB 2BY3A 3QDJD 3K71B 1YMMD 5BS0B 4XVTL 1A22B 5FM4A 2X38A 3CHXA 1S9KC 2NX5A 1CFMA 4JPSA 4U3CA 3DSNA 5C0JB 4GEIA 5DQJA 1FJ1B 1H9VA 3UBXA 3LKQB 1T7VA 4JPWL 4ODVH 2VN6A 5JORB 2HG5A 5C0DA 4YHPA 2IDCA 3GI9L 2FX9H 4BFNA 3CG8A 1O7DC 4X6FA 2J12B 2GG1A 5GGRY 1B0GA 4P48A 4XXCA 1KYDA 1OP3K 2X0VA 5EOTA 3VG0L 4MVBC 2HH0L 1L7TL 3D25A 4BH7B 1KPVA 1DJHA 4MBRA 4D7BA 1PVHA 3G5VA 2AK4A 2BP0B 5AG8A 2DQUH 3ILQC 2YXMA 3MBXH 3UO8B 4AE0A 2BVPA 4LLVB 4RGNC 4Y8DC 5B39G 3T65A 2NR6A 4RQQA 4WNJA 5GIRB 1F2QA 4PRBB 2ADGB 5JHDB 3FO1B 4J28A 3FCGA 1ZY9A 2BIPA 5E6SB 3NN8A 4YLBA 3CC1A 4AGQA 1IM3D 2HFTA 2X4QA 4IJ3C 4JY4B 5AYTA 5JYLA 4JFEE 3FUDA 2XNAB 4M6AA 2KC0A 2NNAA 4G43A 1BWWA 2PP9A 1IB5A 1JZJA 2PXYD 3BGAA 2OI9C 5EPMA 4ZMYA 3PE9A 6PAZA 4YC2C 1SVZA 4FNSA 6CGTA 1X5IA 1SJHB 1N12A 3L5XH 4TUOB 4S0SD 4TULL 5HHOA 5EDSA 2DQHL 4TLUA 3D18B 1CG9A 2VDMH 5EU4B 4JW3A 1A6WL 4P4RA 5D1ZA 4F7MA 2QQNH 4X9IA 3C9NB 1KLFB 3HG2A 4I0PB 3DVGB 3ABZA 3LMJH 2AXGB 2XPYA 3SB3A 1FH5L 2YPLD 4PCKA 2YC1A 4HP5A 4ZBJA 3QS2A 3E3QC 3HE7B 1NC4B 3LJ3A 5DJ6A 4X5XB 3VXSE 1TENA 1BOYA 3TNNB 4K8RD 2WYTA 5DRNA 3UYRH 1T80A 2X4PA 3V7MA 3JSSA 2CGRH 3MV9B 3A3YB 2P8LA 1CZ8L 4QAMB 2BSED 4DH2A 5IP4A 2UY6A 4JG1H 5EUOA 1HZKA 1T5XB 3BPLC 2C8NA 1DTUA 1QA9A 3QIWD 4Q6IB 5I8KL 3R7RA 1QNZH 2BVUA 1FL5A 2YUXA 3KBHE 5INCA 3SYOA 3WY2A 3QEHB 5H8DA 2YMXH 2J8HA 2BWDA 3LNIA 3MV8D 3U9UA 4ENZA 3CDYA 4ZFGL 2EP6A 4OT1L 1RPUA 1S7UB 2XV3A 4UAOB 4WNSA 3U48A 1KGYE 4H88L 1MI5E 2NTFA 4C54A 4KXDA 4FQHB 3QW9A 4XBPB 3GTVA 1QQDA 5CO1A 1DBJL 5J13B 3DXAB 1F3JB 3OKOA 3AGWA 1NIBA 4RWYH 4RGOH 1J8RA 1GY2A 4WNQA 5DZAA 4X2UA 5CWSB 5DI8A 3UGUA 3MUUA 4H8PA 4NJAL 1F6FB 1IM9D 4A39A 3FMGL 1V7NH 4QI3A 1AYRA 4OFYA 2IGFL 3IJEB 1T1ZA 3QJOA 1L0XA 4Y2DB 2PYEB 1L9TA 2IG2L 4ENED 1OM9A 1DL7H 1SEQH 1J5OH 1BFSA 5I71C 4UDUB 1SM3L 1UVQB 1XL6A 3WXWH 4WFEE 1W16A 5C97A 3T1FB 3MCKA 4AL8L 4NO2B 5G5DB 4G72B 1GS6X 3CFEB 5IR1A 2Z93B 4EKXA 3T71A 2OL3A 1Q94A 3QUGA 4OZHB 2A74B 2IDSA 1NGWB 2Y6SC 3LN9A 4PJGE 3L95A 2FJGB 2NNFA 2P8PA 5HI3D 3RVWD 1K9TA 3JTSB 4ABQA 5I16B 4MX7A 1JZFA 1TVHA 3OV6A 4N0YH 3QUZA 4FP8H 5FK9A 4ZW3A 4TRPL 1WUZA 3ZW3A 2D7QA 3FN9A 4U2ZA 2ZOKA 1QNIA 3PJSA 4IOSA 3FQWA 4HEPG 1JGVH 3OZ9H 3OC5A 2R4RL 2OX5B 3EFFA 3N0AA 4P5TD 5DJYB 3WELA 4K55A 2EDRA 4U05A 1TEGA 2K1MA 3L7FA 4OGQC 5F96L 3M46A 4JFEA 1NFDB 3WY4A 3V0IA 5E2VH 1G7HA 4XPGL 3FUFA 1OTSD 3I84A 3MRFB 4FCHA 2F1AA 1IJNA 1N64L 1Q9OA 2D7TH 3EADA 4HMDA 4WKZA 3TURA 1EHKB 4KZ0A 4YVNA 2F1EA 2VQTA 1MJ7L 1TVBA 2DS4A 2QR0B 2WWNA 1P4IL 4GYBA 1CURA 2G2RA 2J1KA 2VN4A 3PGFL 4JPKL 3VRJA 3W39B 4OQTA 3T4AB 1KMGA 1F4HA 4BQBA 1UH3A 4QRSA 3AG1B 5C0RL 3BFOA 4FYRA 2AI0L 1JGEB 3VXPA 4U49A 4HCRH 3IXTA 1XT5A 3P0YH 4GXUM 4OF8A 3TZVD 1JJUA 4IQHA 5D1XE 4GAGL 1GJWA 4FL4B 1BPLB 1I85A 4P46B 3VXSA 4MSWB 3ZR5A 2RIKA 2WWMD 3BMWA 3ARSA 2IPUG 5MEPA 1FH2A 1M6UA 5CSZB 1YEDA 2AEPH 4PJBA 1AQHA 3T0ED 3Q2CA 1KGWA 2R0WH 3NOIA 2FATH 1ASPA 1RZIA 5AD0B 1JSYA 5FFOA 3SE9H 4MASA 4RLDA 4XAKD 2DQCL 1CFSA 4AYDC 4MVBD 1F4YH 3O2WH 2B0SH 4Y2LA 3VXUE 1DQVA 3JXAA 4QRTA 2ZXCA 1N26A 3IDUA 4NM4L 2L7QA 5HJ3A 4DN4H 3DX7A 4YJZL 2K0RA 3KCPA 3WIHL 1MI5A 3HCVA 3TJEH 1S3KH 2VDKH 3KNBA 1F0LA 1TO4A 5KYUA 3W9DB 3RWGB 2R56L 1J10A 2G4GA 3U0WH 3AQXA 5GSVA 2CH8A 2Z64C 4IBZA 4JKWA 4KUZL 1AZBA 1QZ1A 2WC7A 5IIEA 1DJSA 3CJJA 4NHCL 3CC5B 2CNYA 3OKYA 1IJ9A 4X5LA 3V7AE 5BZDB 3RX7A 4CNIA 3GM0A 5EG6C 3S3PA 2VDNL 4GG8A 1Z9SA 2WVVB 3VD1A 3QPXL 2LU4A 2QPUA 5DK2A 5AOMA 2C1OA 1JRHL 3EJUA 4XN7A 3OAUH 5DFTA 1SPDA 3EOBA 1KC5L 1K5NB 4ZS6D 5DFWH 5BRZE 1B4JH 4WDIA 4YHML 2DIEA 4X80H 4NKIL 1E67A 2IALA 1N3NB 3RZCB 3D33A 1Q1JL 4PJGA 3UBGA 1ADQH 1RH8A 5I6MA 3QQDB 1RULL 1FNFA 3M8OL 4YXLL 2WLLA 3DOSB 1SMOA 3EFDL 2F5BL 3N1QC 1KEGL 1KUMA 2XV6B 1OT2A 2BY1A 4N28A 4Z7WE 2Z31C 5CM1A 4H8VA 3RUGB 3I6KA 3F64A 1WBZA 4ZUSA 3QNXA 3QO0B 3UPCA 2VXQA 2MTPA 2VXSL 4Y4KA 3EXLA 1AKJA 1W0VB 2EDDA 3QORA 4HK0A 1UASA 3QZLA 3ZRSA 3UAJC 1A6TA 2JI1A 3TO4B 1E27A 3OXRA 2VZ1A 3HPJA 3QZWA 4ZZFA 5M95B 4ZUVB 1AHWB 5FO7B 2BRRL 3BDYL 4G8IA 4XVSL 7PCYA 1U8QA 1PKQE 4HIJA 4KMLB 1BXAA 4HOMA 1WTLA 3JWNG 3Q5TA 4MNQD 3SBRA 5EF0A 1LK3L 2G5RA 4FQXD 5BUGA 3PF2A 3RVXC 2UUDH 4JDVB 4L1DA 1SBBA 4ZTPH 4M5SA 5F1IB 4QRRD 2G5BB 3TWCL 4PRID 3MLXH 2VDPB 2CO7B 3F7VA 2X4TB 4QY8A 3Q2LA 4LIQE 5D1XA 2GT9B 3WFBL 1LK2B 5FYJU 2VO5A 1GS8A 1MQ8A 2ARJB 2YBRA 4MZ2A 1WFOA 2IWKA 2IBZX 4YSPA 3O3BB 3GSNA 3K6SA 1XCWA 5DHYA 1KIUB 2ICCA 4GW1A 2IQAA 2D9QB 3GXUB 1JGUL 4J3TA 1DBMH 5FOJA 2IV9A 1ZVYA 3ZMRA 4KDVA 2M8XA 5ITFB 1UWGH 2YLKA 3QWNA 3PHAA 2OR7A 3VDCA 4OGXL 1OAXH 5CJOL 2VLKB 4JM2C 2EKSA 4PV9A 3WKPA 2EYRB 4IKIA 5B21A 2Y6SD 5I76A 3SGEI 1FNHA 2PNDA 3LEYL 3U7YL 3VD5A 3S3JA 3ZZ1A 4JFZH 2YRPA 3TL5A 3U6XS 5F9DC 4J8QA 2DQTH 3WEAA 3T8XB 5FC9A 3VWJA 3LHAA 1ZLUH 2B77A 2OR8A 4DVRH 2WYZA 3NFPA 5HD8D 2B20A 3G9AB 1G5GA 5ALBL 2B4CL 5JOPE 4XVUD 1YN6A 2F53E 5FYJD 1JWMB 2J71A 2J72A 4TSAH 2WUBL 3ABMB 1O5DT 4PJ7B 4W6XB 1NBVL 3U4EB 1IGTB 3MLSL 4OM0L 4KV5E 1ITBB 2XWTA 1TSHA 4ONFH 5GRVL 3HG0A 3FTUA 3KPPA 4KKLC 5J5EA 1BM3H 1UD2A 2J57A 1ZVNA 3OHMB 1Y1DA 3LEVL 4OGYL 5KSBB 4YHYB 3M86A 2FNBA 5B8CC 1MCDA 3GSNH 3UAEA 2ICEB 2VB5A 2AHIA 1FHNA 4PQXA 5BRZA 1RIUL 2IANE 3MGOA 4FD0A 3IJHA 2J2ZA 1RZKH 3OSKA 1MPAH 4JY6A 3INUL 3PWVA 4PVBA 5CJQL 1BVKB 2X53A 3CFKA 3DMMC 5FA3A 5IVOA 1DJIA 3GIZH 5TE7L 4F7TB 4LQFL 1GMIA 1ETZA 5ACMA 4DN3H 3WAKA 2YZ1A 5FS5A 4BWWA 4P9ML 4W4NA 3QJTB 4AENA 2OFQA 4K7PX 4Z7WA 1CDJA 3LZFH 1P5VA 5E0QA 4OJAA 3P0GB 1EJOL 3LRSB 1DDTA 4LCCC 4IBUA 5JIIA 1MCKA 2BHUA 1EFQA 3ARFA 5DZLA 5FM8A 2DV6A 2DOCA 4F7EB 1KBGH 4K3EL 5IUSA 4LNVA 1VSCA 4RRPM 3GJFA 5AKRA 5DC4B 3ME0A 1QFUH 3S36L 4ZAKC 3OKEB 4AE1A 1QKZH 1F00I 1NGZB 1XZ0B 4AYID 2YAFA 2CO6A 3QJZA 3WHE0 2R1WA 3NSDA 3GS0A 1FRGL 3C09B 1IGIL 1YYMH 3CFCL 4QCIB 5TE6L 5C07D 4KI1A 3SE3A 1HZHH 2KBGA 3WNIA 1F56A 1Q0XH 3RL1B 5KSUA 5HDWA 5FHAH 3T09A 1JPTL 2IAMC 1AG0A 4GRMA 4BQ8A 5M7QA 3EHBC 2WJ7A 1BXXA 2EE3A 1FZOA 2DM7A 3VRLE 3BAXA 2QVIA 1DEEB 2WBJA 3QEGH 3QH3B 2XVGA 1WUNT 3UTSE 1OCWH 4UU9A 5K5YA 2V2TA 2NY5C 2HYMA 4OLZL 3C5JB 5DVKA 1BZOA 3D39D 2OTWA 2DAVA 2WGNB 3MNDA 1J0YA 3BSHA 4G82A 2BSDA 2BCMA 3BQVA 1UM6L 3C87A 3M6DA 3RB7A 1BYOA 2KPWA 1J9CT 5GZNC 2B7DT 1CIDA 4L0ZA 5JQ6H 3H9SB 1QHQA 4ZXBD 2NY0D 4PIRF 4MA1C 3TA3A 3QXTA 2XACC 1X7QB 2OQJA 2GK0A 1WGVA 3H0TB 5E2WL 2CCVA 4O5LL 1HHKA 1H5BB 1P84K 4UDTA 3E6HB 1TTRA 1GYVA 3V8OA 4GQPH 3SHSA 3D0VA 4DAGL 2VMJA 5E94B 3RI5F 1M6OA 1XH0A 2C4FT 3VQLA 1FLTX 1E6JL 3E9TA 4X4YA 4QT5B 5CEYB 4WV1C 2JCCE 4K9EH 4ZTOH 5HDOA 4HS3A 2YXVA 1WZ1H 1YUHA 1S7VB 2ERJC 4BA8A 1QAWA 1JHKH 5E8EA 1ITCA 1VADB 4GBXB 3TESA 2W8CA 2P48B 5KVDL 5C6PB 4B9IA 1BXVA 2IANA 5I0DA 3KGUA 4CBPA 2EADA 4PRHB 4IHBA 1LO2L 3MRCA 5BMFL 2O5ZH 3G5ZA 4P4KC 4FADA 3HJ0A 1E9PB 1M7IA 1DLFH 1AGFA 3LB6C 4OCWL 1JNNH 2IWFA 1SXZA 3QZNA 5L9DH 3FUIA 5TF1L 1CLVA 1R3IH 3AG3B 4QRPD 4XP4H 2V7HA 5L8KB 2XWZA 4HUXA 1QFWI 1YQVH 5MENA 4POZD 4DZBA 3ZLQC 5AL8A 1AR2A 3NIGB 4P2AA 4GAYB 3GTNA 1ZHNA 4JM2D 2GABA 1KELH 4X50A 1KWKA 4TVPL 1K4CB 3O6FC 4M43L 4Q56A 1A9BB 2DEYX 3FQ4A 1ZD6A 3MNZA 5IHZA 1A7RL 1U8JA 3GSWB 2L7EA 4WO4B 3D2UB 1Y0LB 1ILSA 2Y3AA 5T3XD 4WO0A 1I8AA 3SCMB 1A4JA 4PLOB 2CLZA 2HJLA 4M8RA 1PSKL 1KTCA 1G5AA 2ADIA 4QHNA 3HI5H 3DOHA 5KAQG 4CVXA 3HKZA 1AHKA 1T03L 2D4DA 2EUVA 2BSRB 2WXLA 1NFIA 2AQQA 1JE6A 1IBGL 4NUJB 3GIVA 1QI3A 4BCXA 1YEEH 1Z3GL 4UQ2A 4HPHA 3MRNA 5I1IL 4M7ZC 4GG6B 3JBG7 4XBEL 3B56A 1TQTA 3LN5B 4G80B 1GGTA 1SOSA 3UTSA 2YGPA 3F7PC 1U9KA 3BE1H 4FTDA 3Q13A 4S1SH 2N59A 2LOEA 4WEEA 1CFVL 1H3TA 3OKKA 3LKNA 4PI2A 1BV8A 4LDLB 1N7MH 5DJ8B 4CMHC 1WEJH 5CGTA 4BZ1H 3V52H 1EXUA 1C1EL 2AEQH 5EBWB 3CFJB 4KK6C 4U1KA 5H37A 4BWTA 2P5WA 5DR5L 4Q58C 1RIHL 3N2JA 4QTIL 2NT0A 1KCVL 4KQ3L 1MCRA 3TC9A 3ATAA 2MTAA 2OS7A 3RWCB 1QO3B 1MFDH 4X4ZA 5E5MA 4QRUB 1MREH 1C5CH 4KBPA 3Q6FB 3RU8L 3IGKA 4WW2F 5I28A 4QXWA 1MHPL 4MD5A 1O7VA 3IDMB 5CHNA 1R0AL 1MW3A 2G3XA 4ICXA 4NZRH 4NRYB 3GPEA 3UJTL 5E4EB 3C60A 1RUQH 3QYNA 3QQ9D 3CPLB 4F24A 1G9NH 3TNMB 4P2RB 1DANU 5A1AA 1CLOH 1XF3A 5EBLB 2PW2A 4KJWD 5F7BA 4BSVA 2JCCA 3KPRB 3SPIA 1UJTA 2C1PB 1HS6A 1IBFA 4NENA 2BIQA 3MNMA 5SWSE 3NRFA 4XCFL 4Q9BA 5C0EA 4IRSA 1D5MA 1OAKH 3CQFA 4EN3B 2VN5A 4LSPH 3TF4A 4ADJA 1ZKAA 3MYJB 1E2VA 1XGYH 1SHXA 4LOVA 2ARWA 2P80D 3D8MA 3RLSA 3O4LE 5ALCL 3CQQA 3NTCL 3VGGA 1HNFA 5T1JA 4AMXA 3BOVA 4NM8L 2X9WA 3APCA 5CR8A 1NCNA 1ZLWH 2VDPH 1C08B 2O5NA 4LASL 1G9EA 2OSXA 2YGQA 4FGMA 1AQKH 1KPRA 3VH8B 2BERA 1DE4B 1WBXA 3OR6B 5F72S 2ZAIA 4UQCA 3T2QA 2KH2B 4H44C 4RMWA 3U2IA 4RFEA 5IBLD 1F4WH 3H3KA 4AT6B 2WXNA 3QZPA 4TOYL 5GS2H 4WFFD 4R4FH 2XN1A 4RA3A 3MUHL 4UQ9A 3CNKA 1YJDH 2AGJL 3VFSA 5ERWA 4F15B 3S4SB 1PJ9A 4F91B 4APQD 1TNNA 2W59A 4UTCA 2EUXA 4A2LA 1KT2B 3ETBJ 4ZRGA 1T2QH 2I69A 2IQ9L 3QUYC 1TEYA 3VXTB 3NEOA 5DDHA 3FTGA 1MVYA 1RQ5A 3GDBA 3PXLA 1KGJA 1HAWA 4FABL 1JERA 3EYFB 4XWOC 4Z77A 2KYIA 4Y16C 4AMWA 1YSOA 1E7UA 3TYGL 5FAAA 3L5JA 3MREB 1G9HA 2ZSWB 5EV7A 3SYAA 3KBEA 5I1HH 4UOW1 5DEJA 5KANG 5T5FL 3QIBC 1MIEL 4C83A 4DT2A 3GPSA 5CXPA 4EXKA 4IRJB 3VXOB 1NEPA 4JGUA 2NMSA 3F84A 1HCFX 5EO9B 4JBSA 1AXTL 1NEZB 1Y1UA 4JZJA 2Q2LA 4GP4B 4I1NB 5FYKE 5SWQA 5JNYB 2I24N 1A6PA 2LE9A 5KSAB 3NABL 3MCYA 1F6AB 4HF5L 4CVZB 3TEWA 1NKGA 2L3BA 1P7QD 4BFBD 3S3SA 4W1TA 4WK4B 2ALAA 2JWYA 3BPCB 5DUML 5CINL 1A6AA 3EO9H 3VMOA 1U8LB 4HS6A 2Y5TB 3JV4B 2YD4A 2I9LA 1L4IA 4HXAH 4OCYL 1DQJB 3QCUH 4I0KA 4X99B 1GZHA 1R5VB 1SJVA 2BVTA 5I5MA 5AUMA 1KXQE 2YN3A 4HIXL 3GMRB 5B1KA 2BS71 4AC4A 1QSZA 1U8MA 3UPRA 2VSMB 2GSGB 1FNLA 1EPFA 4ILDA 4NHUA 1HOCA 3CLWA 4K7FB 4IGBA 3MRJA 1UXSB 3BKMH 2WIMA 1RURL 1HEZB 3KPNB 1KJVA 1FNSH 3HRPA 2ITDA 4L05A 1S9XA 4NGHL 4OF5A 5EO0A 5EZJB 1DUZB 4MZIA 4J8RA 2XZCH 3LV3A 1HILA 1NBYA 3UROR 1OARL 1IGJA 1MHEB 4A6YL 3BKJL 4KX7A 1T1XB 1YYLL 5I0WA 1OSYA 4NXKA 2PCPA 3WL9B 5A7EA 4NQUA 3HC4L 3ZDXE 3EJYC 3EZJB 5SWSA 4ZX3A 5A6IA 5JXEA 2ZWLT 2FEDC 3HBQA 3IAPA 3L17A 3ZDWA 4DOHB 5I9QC 2AV7B 1FQ9C 5MP6H 3KL3A 3GLAA 4GXFA 4XPFH 4RX4D 3NIFE 3V5KA 4F57H 4KJQC 4PGCA 4OV5B 1XO8A 2VLJD 3O4LA 2ED9A 2RD0A 4DP2X 4JO1H 5EC2A 3MCLH 4CADB 1BF2A 1M2OA 1OIOA 4L9LC 1OOAA 4HIHB 2Y22A 1LM8V 2LVCA 3ZKSD 4XP9H 4ZMTA 2Y36H 1ZDSA 5EF3A 4S11A 2Z6FA 1AVAA 2NNXA 2VR4A 3UL4A 1YY8A 2GJZA 3ECUA 3NUKA 2XIIA 4RSYA 5DVMA 1LILA 4K2UL 1OV8A 3PCYA 2C9SA 1SYSB 2GUOA 2ID5A 2EIMB 3DETC 3ZE2F 3LN4A 1JRHI 1T6WA 1TXKA 1SXSA 4EZLA 4J3WA 5H4ZA 1FG9C 2WV3A 7FABL 5GRUH 2DQEL 5IOPB 2DQMA 4B95C 3G6DL 3HPLB 4EI5A 5FCUH 1CXHA 2HLFD 3ZTEA 5T1KD 1ZT4A 2PR4H 1DQQB 3D6GA 4ELDA 2G9HB 4YHKH 1Y18B 3X11B 3BLBA 1QUNA 1WA0X 4HKBB 4OVVA 3KG5A 3TBTA 3J27A 3GI8H 4N2CA 3HBZA 1VCAA 4L0PB 9PCYA 5KAQF 4PWHA 4N6RB 4UB0L 2G0KA 2UY7A 3MRKB 3V6ZA 3NIDE 1QSFD 2ZCLH 3M07A 3L3HB 4OCSL 5F44A 3STZA 1J05A 3N91A 5EA0H 4TMPA 3W0WE 2BNQB 2AKRA 4F9LA 1J1OL 1R47A 1X5XA 4CMMA 1FDLH 1K8DA 2WBXA 1RPQA 4ZPTA 3BN3B 1SFDA 1ZHBA 2AJXL 5DWUH 1X4YA 2WQUA 5I15L 5F3BB 1G9MH 2GIMA 1DDHA 4Z0XB 3BQUA 3R0MA 4P49A 1KXQA 4WHTA 4TL5A 4E9LA 4NQDE 1PMYA 3RWHA 3C5ZD 1JNLL 1A64A 1NIDA 3ETTA 2DBJA 3CHPA 4P3CH 2HMID 1QFWH 3BKYL 3II3A 4IHOA 5DQJB 3RA7L 3ZHLA 4ZO6A 1MNUH 1CE6B 1QLFA 2HG5B 4OFDA 4W70A 1EMTH 1E65A 3WS6C 2QPDB 4NXSA 5DLML 4P23D 3KLHC 2Q76A 1FZJA 3SDXB 1B0GB 4XVTH 1QPPA 2LAAA 4I4WA 2NX5D 4NQCB 1WBYB 4UT7L 3C6EA 4OIBA 1A14L 5IMLA 3FC8A 4JPWH 3RP1A 3D25B 3LTVA 3BIKA 1UWFA 2IPUK 4XWGL 1T3FB 3GI9H 1I1YB 2AJZA 4N2MA 4O51A 4YUEH 3DKHA 1A1MB 5D1QE 5JPNC 4NP9A 1CXFA 1E2ZA 1CBVH 3CPUA 3VG0H 4JQXC 4MS8D 2ZKXA 3M1OA 2B3IA 3ABKB 2F6AA 3O2DL 4M7JL 1N59A 3QZWG 3FU3A 4BFIA 5D93B 3KPLB 3TU6A 2AK4D 5E6IA 1BZ8A 5CGMA 3JT0A 3AACA 1SHWA 4WJKB 3UTQA 4PJ9C 3EDJA 4R83A 1MCWW 4G7VL 4G9FE 2QADC 3MNWA 3N43B 3TEUA 2E3VA 4FG2A 5ABAA 3WE6B 4I7ZC 2W60A 1M7UA 3B6SA 4K94L 1XGZA 1PL3A 3SKNB 3KVDD 1OGAB 2P42B 3B9KA 3BZFA 4U6VL 4HSQA 2NXYC 1KLGB 4FKEA 4AEEA 2DDQL 5HHOB 4KRPC 4MBOA 2VTFA 2JKTM 1J5DA 1CG9B 1BBDH 2ZOLA 3UTPE 2E4TA 3EJTA 5HHME 4Q4EA 1HWGB 3EJCA 4A7GA 1VGEL 1VFBB 2R27A 2NRDA 4TQHA 3STBA 5AOKA 1HH6B 4QPEA 1E5YA 4B5EA 4FAAB 5I1KL 5AZUA 1TZOA 2DQHH 5AAWC 3QUXA 2YUWA 3H9HA 2YC1B 2O1AA 2X1XR 1A6WH 1CFTB 4ZD3H 5D1ZD 3BGMB 1ZRUA 3KLSA 4ORGB 1I8LC 3Q43A 1HL5A 3QDME 2WNWA 4AQEA 4JFXA 3GK8L 4A67A 1FH5H 2OR9H 4M3JA 4G6AC 2Y6TE 3UZVB 4JR9L 2H47C 4TN9A 4KVCH 2QQKL 2F7QA 5FKPA 1E5AA 1UWXH 2UY6B 4U6YA 3SDDA 1JWSA 1CD1B 4QJ4B 3RHWK 1FL5B 2ZONA 2HVJB 3T1WA 4QXTB 4AY0A 3LH2H 3EJYD 3H6JA 1SDYA 3F5WA 4OLEA 5JW3H 1PG7X 4HJGB 5I8KH 4MCYB 3DO7B 4G6JL 2QPEB 3AQYA 5CZXD 2E9WA 1R75A 1X6NA 4BA0A 3VFUA 4U0RC 1V8HA 4JMNA 3V7AG 1QQDB 1EANA 3PQYD 4PVNA 2DLGA 1L0QA 4ZFGH 1SN0A 3CXDL 1RUPL 5C6WH 1KXTB 4KI5F 4H1LB 4IBWA 2H0FA 3CLFL 2EYTB 4H88H 3BUDA 4L4TE 4PS4L 5I26A 4E41B 1JXJA 1AZZC 3ZKXB 1IEAB 4HIPA 3FQXB 4NQDA 2WXFA 1ZHLB 3B37A 5KG9B 3WXVL 2NW3A 3VFWB 1PLBA 1T1ZB 2XTJD 5BPPA 4D2NA 1LJMA 2B1OA 4ANKA 1HSBA 2A6KB 4NJAH 1BG1A 1NQBA 5GS0C 4YNYB 4G7SB 4PCYA 2HX7A 3FMGH 4GRWE 5L7XL 3QULA 3K2IA 1JNHA 2QVFB 2IGFH 1NFAA 4OFYD 4L8SB 3RKDC 5IQLA 1Z9PA 3BT0A 4KXAA 2IG2H 2VQUA 5IR1B 4UV7H 1ACZA 3BW9B 2OL3B 4ELMF 1JYWA 1SM3H 1LEKB 2CKNA 5D1QA 3TFKD 4Z3IA 5ACZA 4WEMB 3L95B 2X28A 5FGCB 5I1EL 3GXPA 4AL8H 1OPOA 2HTKD 1UXMA 3RWIA 3ZE0E 4K4KA 4FQ1L 1WWWX 2P3YA 5D6CA 4ZQTA 1AIFA 3VD4A 1HXKA 2XWBB 3ESOA 1FVDB 4RCAA 4I0PC 3VXQB 3DV4B 4H4NA 4DP4X 3L7FB 3QFDB 5IHUL 4TTGA 4G9FA 3WFZA 2NUTA 5EEVA 3QUZD 3WFCL 4FNTA 2Z8VC 1DVUA 1JIBA 3FRPA 3HE7C 1JXGA 3BI9X 3VCLB 1UT2A 2EDEA 4XB8A 1BW8A 1CICB 1D6VL 1EV2E 4YGVB 4OCMC 4GFTB 4W93A 1TQSA 5F96H 4JFED 3G5WA 2GI0A 2JJUA 3PU7A 4U1LB 5F97E 4WSGA 3DYPA 2OMZA 1TVBB 2ZP8A 3WIHA 4FI8A 4Z7NB 4TNGA 4XPGH 3UMTA 2VZSA 2Y2WA 3FOMB 1TTAA 2HVKA 3FO0H 3IFOB 4Q6IC 4AIZB 1N64H 1NPNA 4I77L 3RRQA 4KXBA 4B9YA 3VXPB 1XSJA 4X5WB 5TGBB 1MJ7H 3V6FA 2P8MA 3HTLX 1P4IH 5L4MA 3PGFH 3IM1A 4JPKH 1JV2A 3GMNA 2RMNA 4LGSB 4W9FC 3K8KA 5C0RH 4UAOC 1NCUA 2CLRB 2AI0H 2BP3A 3F62A 4MMZB 3IRZA 4G6ML 3D51A 4WEBL 4PJBB 3QEQE 1ZLSH 1HKFA 5T3ZL 4M7LL 4RBPK 5DRWA 1UCTA 3PWPE 4JHWL 3HG1B 5J13C 2OTUB 2RCSL 1FC1A 1TG8A 3CVIL 3FO9B 3VXSD 5IT2L 1CFSB 3B8YA 1NDGB 2C7UA 2CSPA 2WKLA 3E1ZA 2WP3O 3FO2A 4S0TD 1CFQB 3K6OA 1LQSR 1I1AA 3NVQA 1CDHA 4QRTB 5CEXB 1PZCA 5AZEL 3M45A 3LH8A 2H7WA 3AM8A 4Y19B 5KSVB 3P3RA 3ALWA 2DQCH 3RX5A 8CGTA 4KH9A 2MQ3A 3AB0B 5LO7A 2G3ZA 4YDJA 5AB0A 5BQ7B 2MNUA 4Y2DC 4WGWB 3AT9A 5EC1A 4AM0A 4OSUL 5KYUB 1MW0A 1IQWL 4RGMB 1H3PL 3ARBD 1Q4NX 3J07A 2P49B 3VM5A 4NM4H 1CF8L 4QAWA 4IIQB 2X44D 3OKDA 3EO1A 3N04A 1WGOA 5CJ8A 3WIHH 1PFOA 1FORL 1MI5D 3G6JE 4L4TA 3RVVC 4WF7A 4DUXA 4CU8A 2WQWA 3NK4A 5HJBA 3NSFA 1TJIL 4LBEA 3PPEA 1I7UB 2R56H 1G7PB 2PKDA 2A74C 4CNIB 3B2MA 1TR7A 2F58L 5EORL 1VCBC 3GBLA 5IKCB 1RAMA 2Y1YA 1DN0B 4KRPD 4NHCH 3D85A 5DK2B 2WZPA 2EC8A 4KQ0A 4UANA 1HK6A 1RP8A 4A63A 5KOVC 4FFYL 4FQJL 4YO0A 3K6IA 2NLJA 5I1AA 3CBKB 4K9EC 4P3WA 4A1RA 4Q4IA 1T4KB 4Y5VA 5G4OA 1MOEA 2XQ0A 1MRDL 2DMCA 3BP7B 4WDIB 3UADA 4ISVA 3QPXH 5TQ0L 4RMSA 4F92B 2HT2D 1JRHH 5FGBC 2X10A 2IALB 1MVFA 4M1CD 2P7TB 4WFED 1FAKT 3VD9A 5CAYB 1INQB 2DIBA 2RH0A 4G6AD 3PABA 4YHMH 2ZQKA 4MB3A 3REVA 4AMKH 3KBFA 2GAZB 3RFZB 5JMOC 4NKIH 5I74B 3T4AC 1V27A 1WBZB 1QR1A 4JHVA 1DFBL 2KQNA 1HX0A 1FZMA 3M8OH 4YXLH 2LLLA 3ROOB 1EFXB 3EFDH 4YHNA 2F5BH 2PPCA 1ZJAA 1D7FA 5HHNB 1GC1C 3SGDH 1MHCA 3OXRB 3GGWB 5AB2A 4KHTL 1E2WA 4FL4C 4DGIL 1KYOK 4FQCH 4P46C 2Z7YA 4G8IB 1ZCRA 4Y4KD 4HWBA 5F9WB 3S5LB 1AKJD 3A0OA 4EUPB 3QORD 5IJDC 1GW0A 1N18A 5K93A 3F7YA 3V4VL 1HEJC 3CHSA 2H32H 4PJHE 1R1CA 5C09E 4F9PC 2BRRH 2X0UA 3C6LD 4XVSH 1N6UA 4RDQF 3V0AC 2CRZA 2I07A 4GRWH 5K9OB 2CDGA 1UD6A 2UXVA 1LK3H 4LDCA 2W38A 1UOVA 1B0IA 3BX7C 4ACTA 1EO5A 2F68X 1GGIL 5HI5C 3CFUA 3FCTA 1B9KA 2HFGL 4YDIH 4OD3H 3K6SB 3TWCH 3QEQA 3V0JA 4Y7MA 1ORQB 3B9DA 3PWPA 4M8UA 4X8CA 5D1XD 2Q8AL 3P2BA 4MXVF 3ZDYB 4N2DA 1TQUA 2APFA 3ZYJA 5D7EA 3LNEA 3PAZA 1YAZA 3L9RA 3ZKMC 2ESVE 3IDIA 2Z4TA 3L3GA 3HNSL 4I1PA 4ABWA 5L0QB 1A4BA 2C7FA 3WIIL 1JGUH 4JFYB 2IPTL 4PJFE 2CPUA 3GSVA 2GSMB 3R8QA 1N0XL 2QGEA 3FU6A 5E23A 4PJIE 1S7SA 3POCA 2PYFA 3ZN6A 2PPDA 2AV1A 1L3WA 3VXUD 1U2YA 1A2YB 4ZDHA 5CJOH 4YR6B 2H41A 4BKLB 3VD2A 1AS6A 2UZXA 4LCWB 2PWDA 3SQOH 2VZUA 2FIKB 3LEYH 3VX0A 4D9LL 1JPSH 3T3PB 5EU6E 3G6JA 3PDOB 4UILL 4GKNA 3HR5B 1UC6A 4LNRB 3L1OH 1MCLA 3DIFA 2KZKA 3VWJD 1IZKA 1XCTB 3GZQA 5E5UB 1EERB 3RZCC 1BQLH 4PREA 5B7EA 1KCUL 3G7TA 3NCMA 4TVPE 3NJVA 5FDWA 3MUGB 4YQXL 2Z0UA 5ALBH 1OKEA 2B4CH 3A4AA 3QDGB 1G9NC 3MV7E 1HHHB 3H4HA 2JI2A 3KS0H 2WUBH 3MLSH 4FJYA 3MGOB 3LS5L 2O61A 3IJHB 4EMZA 1X6LA 2QGCA 4W9HC 4GY4A 3TPKA 3LEVH 2F7RA 3ARGB 1GYCA 4XOAA 1EWHA 3TO4C 3U0TA 4PR5B 5CFAA 1JVKA 1ZPLA 2HX8A 4WENB 3VFGL 1AHWC 2X70A 1EVTC 3QJFA 1RIUH 5IQNA 3EYVA 5BRZD 3ESPA 1X5KA 1J1XL 1REIA 5B3NA 4R2GD 2WZ6A 3IGFA 1IKFL 4AW4A 1FFPB 3INUH 4JL1A 5FKAA 2ZYRA 1PCXA 4NOFA 3UEZA 2YPKA 1UXWA 2WTOA 4QJ5B 3S7GA 4YPGA 4HKJB 5TE7H 4LQFH 4U31A 1ZMYA 4K3JH 3GTTA 5I5IA 2VLME 4P9MH 3NAAL 4LEOA 4ZFFB 3EDDA 1ML0A 3ARED 3WMQA 5JLZA 4A6YB 2XKUA 1UOWA 1NC2B 4ZUUB 3UEQA 2AQRA 3ARFD 1FG2A 2CO6B 4YHIA 5CILL 4K3EH 4CGTA 2NYZA 2ZAGA 4PJHA 3T2PA 5C09A 3S36H 2AXFA 5IY5B 5EU3A 4OZHF 1QWHA 5E9DE 4R8WH 1KN2L 1WHOA 1FNAA 2NW2A 5PAZA 1P69B 3UC0L 5ENWA 1FRGH 3R4RA 1ZLVH 1XH3A 4DGYL 1IGIH 1QACA 3OQRA 3CFCH 4GRMB 1IKNA 1JZDC 2V5MA 3NSCA 1FFQA 2MHAA 5TE6H 4HUMB 2XXGA 3OMZA 4UT9L 4NIYE 4EDWL 4H0LC 3NYKA 5AOZA 3AY2A 5DJZA 1IU1A 4ZO7A 3IU3A 5IJKA 1MY7A 1NFDF 2K78A 4JNXA 5PCYA 1JPTH 2WY3B 2J56A 4LBAA 1OGPA 2ESVA 2I60L 4XH2B 1EAQA 1QWNA 1OF2B 2WBJD 4PJFA 2VSCA 3MJ9H 3KPSB 5HY9A 4ZSOB 3UZEC 2D7NA 1UWEL 4PJIA 2FNWA 1LNUA 1JDDA 4OLZH 1TSRA 1Y07A 1F6LL 1ICTA 1S9VB 3FUEA 1KIPA 1UCBL 2YEZB 4AQAB 4YXKL 1U8HB 3K5RA 3Q8AA 4UM8B 1UM6H 2D3NA 1EEZA 2OMYB 4K15A 4YHYC 4M61B 5GGSA 5JDJA 1WT5A 1HJCA 4K5LA 1BVNT 1CFNB 2ICEC 5C9JB 3K74B 3IWVA 3QUKA 2GIYA 4Z7VB 2BMKB 5EU6A 3TA3D 1EDHA 2YGVA 3WI9A 1AGEA 1OCOB 1KLUB 2AXJA 5E2WH 4O5LH 4NWTH 1BYPA 5I0XA 1PLCA 4P46D 1NAML 2Q8BL 4F58L 5JIDA 1ES0A 3A4DA 5HGDB 1YAIA 5FB8A 1G94A 1CR9L 2WLKA 1T0NA 5JOPD 2F53D 2EE6A 3K8LA 3MV7A 4TS6A 4MXQC 3G9VA 4OF7A 3VD7A 1E6JH 1EQWA 2XZQH 5AOLA 3O3DB 4E2OA 2WQVA 2A83B 3HNVL 4GP8B 3F58L 3FQNA 3RVTD 5CKGA 2F18A 3G5ZB 5EH1A 3EUDA 1MSPA 5HVHB 4MJHA 4P2OB 5KVDH 4OCXL 5D4JA 4Z7OB 2IAND 2VCOA 5G4NA 4FG0A 4KKNA 2JF1A 1LO2H 4UIKL 5BMFH 1UM5L 2N0KA 4UINL 1I75A 2ENSA 3CZJA 4KJPC 3C09C 4HUXB 4U7MA 2X05A 4HOZA 5MENB 4OCWH 2YQGA 4UQIM 4XP5L 1GA2A 4RISH 4WTWA 5IG7A 2OLDA 5TF1H 1J0HA 4NRXA 4KXZI 5C0IA 2BJML 2XC8A 3VFOA 2OZ4H 1THCA 3JWDH 4G8GA 1CLZL 4X9BA 4K5MA 3DJRA 1N5AA 3QDHA 1JZEA 4HUWA 3PUCA 5CBEA 1CD9B 2VRAA 4M9OA 1A4JB 2CLZB 3CXFA 4TVPH 4JB9H 4XNYH 4J4PA 4M43H 4XTRC 1FO0L 2WIIB 3BPOB 2OMVA 1N6QH 3U9PH 3FT4A 2LAGB 3QPQD 1RZQA 5E9DA 1ZWIB 2WMPB 2IOMA 4UZSA 5T1LA 4YBQD 1PSKH 5ICZA 1DCEA 3LPPA 1QVOA 2AABH 3AMKA 3RGVB 4ZFOA 5HPMB 1T03H 2AC0A 4MA8H 5SX5H 4O2CA 1KJ2L 1XWVA 3GMLA 2ENQA 3R4DA 3RUGF 4UTAL 2VL5B 1IBGH 3V6OC 4I13B 1JYVA 1A7NL 1BIIA 2YRBA 2R4SL 1Z3GH 3LCYA 3MJ7A 2GY7B 3BSZL 5J06A 5I1IH 1H5BC 2HJKB 1AD9B 4XBEH 4MQ7A 3GDCA 2NY2B 1OCCB 4YFLF 2P5WB 3TN0B 3RWJA 3OKNB 1GSMA 4LPCA 1ONQB 5E00A 1CFVH 4FI7A 3BO8A 3FS9A 3EO0B 2GEEA 3QI9B 4OFKA 1BGXH 2ORBL 4QHMA 5B1AB 1DBAL 5E5MB 3G5YB 1C1EH 5DD6A 4QOKE 5HVGB 5K9QI 5L2KE 4GBXC 4U1JB 5DR5H 2OULB 1RIHH 1QW9A 1ZPUA 3VXRB 5IW6A 4MNHA 1KCVH 3KYMB 1TZIB 5EU7E 2B8OT 3C60B 3MFFA 2PUQT 5E5LA 5EIIA 3HHRB 3MLUL 1M71A 2AQSA 4JFQA 1DQMH 1MHPH 3FQ2A 4C58B 4DVBB 1R0AH 3MA9L 2YXFA 1Q0YH 2E7HA 3LH9A 5GS2D 3T77A 5IJBC 2K70A 3LRMA 3TVMA 1T0PB 1R33A 4JDTH 2VUKA 4KHXH 3FU5A 5A16A 3GS7A 5IHBA 1IC1A 1WFJA 4QXUH 5CZVH 5LGYA 5D6DC 2EH8L 4DKDC 2AF2A 3D4ZA 1W80A 4TM9A 3OC8A 3QXDA 5E51A 4WU7B 1IQDA 4E0RB 1HC1A 3ARDB 1SF5A 3L5IA 5G55A 4Q9QL 3OZKA 4XCFH 3S0PA 4IRSD 3DI3B 4F8NA 4WO4C 4JFDB 3SCMC 2X3BA 1MFBH 1S9WB 4KTDH 2VL4A 4NKMA 2WZ0A 4M4PA 5T5FA 2BVQB 3JTTB 3RJDA 3SPJA 5J1TC 2XXFA 2VLLA 5FOBB 4PIBA 2J6EA 2I32A 5ALCH 1TJMA 1RPKA 4DGVL 4PJ7F 4QD2E 4FNRA 2LR4A 4UQBA 5MI0B 3NTCH 4ETQA 1WBXB 3FFCE 3GXFA 4E9RA 4MLSA 1NCOA 5E8NA 4NM8H 2VZ3A 1LYQA 4YX2L 2UUDK 3HIZA 4N2FA 2ILLA 4WU5A 4H13C 5KSBF 3MMEB 4LASH 2UX7A 2P43B 5KJRL 3U4AA 2H26A 1C9SA 1GGCL 4TKWA 5KYXA 3JWOH 4LEEA 2DJMA 4Q2ZA 3HZVB 4RFOL 1RL1A 3MR9B 2K9FB 1P6WA 2H2PD 2YAMA 5GSRB 3J7HA 2HT3D 3BGFB 1NGYB 4JRFA 3DK2A 2AGJH 3P1VA 2VIRB 4B9ZA 2VDRL 3O6ML 4X8JB 4XO5A 2WINB 1M2VA 5IROA 4OFQA 2FX8L 2V3FA 1P7BA 3OMAB 3TIDB 2XFGB 2J44A 1ORSA 2IQ9H 2QSQA 3KM1A 3LSOB 3SYCA 5J57B 1MFEL 3KYOB 4DWHA 3S4SG 5C0AA 1N10A 3V0VB 4FABH 3G08A 2A9BA 1SRDA 4YIQA 3QRLA 4PRAA 2EINB 5IVXB 3V0WL 3QFJB 1XTLA 3TYGH 5CFHA 4M48L 3HS0A 4NFCA 4RZKA 1CPUA 4R7XA 1U2CA 5ADPL 3NSYA 2XYBA 3G04A 3APDA 4KU1A 2QGDA 2ZD0A 4WWKD 1ZLUK 3SGJA 4KKAD 1JCKA 4YLQT 5E4EC 3U82B 1MLCA 4NERA 1AXTH 1XH1A 2RGSA 1FE8L 2VWEE 1P4UA 3CDZA 3ZE1E 3SE4C 1U91A 2FH6A 3DTXA 3NABH 5EU5B 1MEXL 4HF5H 5ESQB 3VWKA 4KDWA 1BZQK 3QJUB 1SUHA 2VISB 3EJPA 3AW5A 2HVBA 1U58B 2V4LA 4GMTL 5AUMB 2GI7A 3AXLA 1HVXA 1I7TA 1GPOH 5L2KA 5CINH 1INEL 1IAKA 4DP0X 4OZ4A 4KUCF 5LLIC 4FNUA 1OHZA 2CNZA 3WLWD 4R7DB 4EN3C 5ICXB 4OCYH 1DQLL 1ZTXL 4G42B 4RWHA 4Y0GA 3HUJB 1PCSA 4MD4A 1DVFB 2WO3B 1XIWA 5D7LB 5AW8B 3EFOA 3OTTA 4HIXH 5FO8B 2ALWA 1T89A 1KN4L 2BFGA 5JW4M 2QV4A 4HJUA 3VW3L 1FC2D 3F6LA 4LPXA 3S9DB 4AJVA 4UAHA 1IGJB 3TF7C 2WGXA 4H8WH 2N4IA 4X6EB 4XMUA 1N2RA 1OW0C 4IGBD 3BDXA 1HSAB 4XXWA 1RURH 4NGHH 4KVNL 3IYLW 1AKPA 3PYCA 5DEGA 4O4YL 4W9DC 1XZWA 1I8MA 1NM9A 1YEGL 2YZ8A 4A6YH 1CDUA 3BKJH 1YYLH 3FRPG 5ESAB 4G8EB 2JNZA 4H7VA 1U2HA 1Q9LA 3HC4H 3L5WA 5I8CA 1H3GA 4FFTA 5SWSD 5JXED 5A6LA 1PAMA 5CLXA 3PWLA 3CMOL 1HIML 1YEIL 2R0KH 3I02A 4F15C 5A43C 1U41A 4GQQA 4CU6A 4FTVB 5I8OL 3FPYA 3J2PA 5IB2A 1MZYA 1NJ9B 3AUVA 3V9EA 3RIFK 2P4AB 3HW7A 4IU3B 1LO5B 5TDPA 3O4LD 4HGWB 1TJGL 1TT6A 3ZX1A 1MUJA 1A7QH 2XRAH 3FFCA 1BVLB 1W9XA 3WHE1 4ODWB 3GMOA 1UOKA 4NNPL 4EQ3A 5FO9A 3SGKA 2SEBB 3QRBA 1J9QA 4GOSA 4NC0B 1FFOA 5HYJB 4GSXA 5EO1B 1BX2B 2GUOB 4L4VA 4L3CA 5KN5A 1WFNA 3LN4B 5DVPA 4IRJC 1P6AB 3KLAA 1CI3M 5IMOB 4AGPA 4DF9A 4WJ5B 4FMFA 1CDYA 1NDMB 1TKWA 3PWUB 5KSAC 2WTRA 4HWZA 4XN4A 4PGJA 3IWUA 2HSIA 1ESOA 7FABH 1OM3L 2DQEH 1EHNA 2GFBA 3SOBL 3TBTB 3BN9D 4EI5D 2I9TA 3GHEL 5DGQA 4MJ6B 5LCVL 1FVCB 3ISRA 4ZUWA 1KIQA 3DRTB 5L88L 1DQDL 1GGBL 1T5KA 3ZU8A 3PHQA 2J8UB 3NIGF 4D94A 3T4YB 4JFVA 2PCYA 3ASNB 3NCXA 3O8XA 4HUUA 2DW5A 1FL6B 4IOIB 2AJSH 4H26B 4OIFA 2CUIA 3I75A 3TV3L 4UB0H 1HU8A 4OH2A 1EHLL 2NY7L 3MO1A 4K23L 4L5FE 3PL6B 5D96B 2YEQA 4OCSH 4KO9A 1ZHBB 1NAKL 3D2UD 1VACB 3R06B 4CC4C 3FB6A 1NCJA 4PS8A 1RVFL 3MXVL 3W57A 4I18A 4WI0A 1XF4A 2D2CC 2YJLA 2CIIB 3EDFA 1LHZA 4O2EA 3ROLB 3N9GL 2F8OA 4Y5XA 5J1AA 1O6SA 3NEEA 2C4XA 5HGBA 5I15H 4J3XA 1HXMA 3K6NA 2CHNA 3C8HA 2Q6WB 3DGCR 2BP8B 5DHDA 4KXZH 5DMYA 1FZJB 4Q9CA 2R83A 5IGXL 3EOAB 3THML 1JNLH 4I4WB 3JZYA 4F7KA 4I2XE 4UIMB 3BKYH 2XV0A 4G1MA 4LPVA 3RA7H 4BBWA 4EN2A 4XRCB 3ZHNA 4KZDL 3BIKB 3NGBB 25C8L 3GKZA 2FZ3A 5DLMH 2AJZB 3U6RA 2LU7A 5SV3A 1IEHA 3QZOA 2KUTA 1U3HB 1AZVA 2UWEA 5GGUB 5C9KA 1BZ9A 4KMQA 5IQ9B 4NKDB 4ZOEA 2D03L 4NT6B 1H8OA 2WBKA 3QO1A 1IL1A 5BNXD 5JDSB 1G1KA 3D3VE 5T3ZE 3NZSA 5AVUB 3WJLA 4HFWB 1XHHA 4M4RA 3O2DH 2BNRA 1U8KB 4M7JH 1K72A 1TLMA 5AKSA 3U46B 3V0EA 4ANUA 1UZ8A 4KNUA 1LQBC 1SEBB 5E6ID 1VPOH 1D6EB 3UCQA 1N0LB 3PGCA 5FECA 2RTTA 5DJDA 3GBDA 4G7VH 1KBKA 4HBCH 3IE9A 2M83A 3JTBA 3VGDA 3PFQA 4K94H 3BYTA 1IIIA 3B9KD 4U6VH 1M56B 2DDQH 4EI6A 4OJCA 5AG9A 3H9HB 4X6DB 4HKZA 1JZ8A 5DHVA 1BAGA 3X1GA 1G1CA 4LRNL 4LF3B 4DPRA 3OGOE 1E5UI 1ZXKA 3UTTE 3MRMA 1J8HB 3BRGC 3OJVC 4PRNA 1JGIA 2Z92B 3O81A 5I1KH 1A4KB 4KKBD 4QHKJ 1N9PA 2WQXA 3CH8A 3QUXD 4OCNC 1FLRL 1PJWA 3NJFA 1JWSB 2EEBA 2CHWA 3BMVA 1TFPA 1RZ8B 3GK8H 4TPRL 1B3JA 3HZMA 2XG4A 4OZGA 3GNML 2PF6A 2CK0L 2QQKH 4AEFA 2DICA 4N68A 5BOPA 4FS0A 3TBSA 4Y4HB 3SDDD 3VI3B 1DEDA 3A21A 1R17A 1HQRB 2FT7A 1BEYL 4UNTA 3ULUH 4I3GA 1F4AA 2HFFA 2OJEB 5EEZA 2AAAA 3SKMB 1I4FA 1MXDA 2DWEB 2OJZL 4WW1A 4JE0A 1AANA 1V3JA 1KXVC 5CEZL 1J18A 3EGDA 3NMEA 4NDMB 3CXHJ 4JDEB 4PJAF 5F7NC 4G6JH 4X5RA 3RE0A 3QCTH 3H8NA 3VG9B 2X4UB 4QHKI 3W0WD 1S78C 1KCSL 2EEFA 2QDVA 2X6UA 3GS4A 3QA3B 4XMWA 2C4FU 4OM1L 4HAKA 4MXWL 3CXDH 5J6SA 1QPKA 5DHVH 3ZJAA 3CLFH 2NR6C 1RI8A 4TNVK 3KWTA 1Z2KA 5I8EA 5E08L 1II4E 1HSBB 4P5SA 4ZPVB 5E2JA 3AMLA 5JW5A 4L3EE 5D93C 4LLQA 5GRYA 4D0BB 1MVUA 3CN0A 4NQDD 1UB6A 2D0GA 2B4CC 2WLJA 3PFUA 3WXVH 4AJWA 2VW6A 3L3IA 4HJJL 2AVFA 4APXA 5IMMB 2P5EB 3WBDA 3UJJL 3KR3L 1IEBB 5L7XH 5LKNA 5D7IA 3O9WA 4NSKB 5E56A 4NQEA 1U4EA 4E5XB 4FRWA 2NY5L 3QXUA 1AO7E 1H15B 2ZWKA 2B59B 5CU5A 1ZLWK 3T6VA 2WHVA 4PBWD 1U6AL 3LXBA 3OGCA 4OKDA 5GRXG 2NY4B 4DETA 2EO9A 2XPGB 4XMZA 3QWOA 5D1QD 4D0CB 2WXKA 3S37L 4M1DH 5I1EH 4Q9RL 2UZYA 2BP5M 3FU7B 3F7RA 4HX1A 5KYYB 1XCQB 4JFHE 3WENA 2RALA 2CJUL 2D9CA 3WUWA 3KCWA 1ZA6B 4GB9A 4W9JC 4U1HA 5IHUH 2JTYA 3V10A 1A1NB 2G60L 1TPXB 1EBAA 5I2IB 1TQCB 3WFCH 1JI2A 2V2WB 3GB7A 1KCRH 2HVKB 3H3PL 5GJSL 5HHQB 2E7CA 3QDJE 4XMTA 1SLVA 3DX9B 4R0LB 3ULVC 2I26N 1YYCA 4DZ8A 4FXGB 2FQGA 5DEZA 2DLFL 1EAJA 5FXCH 2WANA 1CE1L 3FQRA 2FQDA 1NPUA 5BO1L 2CO1A 2ZUQB 1AC0A 2TRHA 5HHMD 2BNUA 1KPUA 3W9EA 1X4ZA 1I8KB 1H3VA 2ZKHL 4HJSA 1MH5A 1I53A 2BPBA 1M9SA 4HAGA 4I77H 2J73A 4XPTL 4OLUH 2ZSVB 1JPFB 1IAMA 2FAUA 2IBGA 3K6DA 1R9FA 4FQPA 4ESKA 5B38G 3BUPA 4TLTA 1UYWH 2DYPB 1UUNA 3GMMA 3RY6C 3QDMD 1JV5B 4OJYA 5H2BB 5GPRA 5ES4B 1W72L 4FFYA 3DARA 4HOXA 4G6MH 2EXWC 4WEBH 3AU1B 2IH1A 5ILTH 1KJMB 5J0BA 3ZKXC 2JJWA 4LLDA 2F8VA 4JHWH 3P3TA 3SD5A 3CVIH 5BXFA 1U36A 3PWNA 5IT2H 1EZVY 4DGUA 1NCGA 5ICYA 4H5SA 1I1AD 4C56B 1X5FA 1H9DA 4DUVA 1HN1A 1BFOB 3BEVA 5AZEH 3FQUB 4X42A 3HRZA 4XBGB 5HDQL 3MKGA 3KL5A 5CU9A 3IVKB 4JX0A 3D06A 1NUDA 1TCRB 1QD0A 2ICES 4L8SC 4W4OA 1WWAX 3MXWL 1WD8A 4OSUH 3OHXA 1D5XA 3DJSA 1IQWH 1A7BA 1JXDA 1H3PH 3FFDB 4WLCA 5F7MC 5DA4A 3T2OA 1CF8H 2DYRB 3H56A 1BQUA 1FORH 2V37A 5HYQA 2ED7A 1O5PA 3Q2NA 4JKKA 3GXMA 3UBFA 2YMOA 5C92A 1TJIH 5E1GA 1WAAE 4L3EA 5K39A 1YC7A 3SE6A 1Z5HA 4YO0B 3LEXA 3S2AA 4PJXB 1OTTC 2NY6D 5FDYA 2F58H 5F0JB 5CNHA 2AMUA 2XN0A 2Y25A 3FN0L 4MD0A 5DS2A 2W94A 3RBGA 5K59F 4RIRA 5DXWA 3D85D 2WZPD 2TAAA 4GRLA 3MRLB 5F88B 5E24E 3TEXA 4FQJH 1BLNA 1NBZB 2EDMA 3KLKA 5LBGA 1J5HA 2X1OA 4F20A 6FABH 1CICC 5AALA 1MRDH 4ODUA 1ZSDA 2H0EA 3HZKB 4V2BA 3SEPA 3UYPA 1AO7A 1EK3A 2UVFA 5TQ0H 4EIBA 4YEFA 1RZGB 1GZPA 2APSA 1UACH 4LRIC 2ZX8A 4Q6YA 1KFAH 3X14B 3QNFA 4M62L 4M5YL 3MV8E 4PP2A 4Z9KB 5FUCC 3U2SB 5DJ2A 2ZTBA 2ARJQ 5D5MB 4KOCA 4Z78A 4LHUA 3NFNB 3L1FA 5HHXL 1R5IB 1A02N 3QRGL 1YQ2A 5IW1B 1I85C 3WN5B 3LZOA 6TAAA 1IKOP 4AYMC 4F1ZA 1DFBH 5GGRA 1GY1A 1IC7L 1B9ZA 2GHZA 1T5WB 4MMZC 2DKUA 3SDXF 3JWDC 4B9KC 1G7MB 5JOFB 2R8SL 3V5HB 1EEUA 1TQVA 3RWEB 3M1CA 1Q9WA 2D2OA 3EGSB 5I1GL 4KHTH 4DGIH 3QDJA 1YMMA 1SOXA 3FONA 3RYMA 3DROA 4LPTA 3DURB 4KK5D 4YAQB 2Y5QA 4Z7UB 1UEMA 3CFQA 2Y0SA 5G4MA 1AOZA 3MBEB 5FF6A 4ODVL 1S78D 4AZ8A 4PMFA 3V4VH 3WLBB 2R15A 4PRDB 3A4FA 4PY7A 4JZNB 3GUTA 3AB0C 5DJ0B 4YWGL 3AAZA 4FDWA 4FXKB 4G1EA 4CSPA 1HL9A 3L9BA 1NM4A 4RGMC 4K3DL 4FI6A 1X5MA 3MGTA 4IBYA 2XWCA 4WUKH 4Y2NA 4C59B 3N43F 4IIQC 1GGIH 1ZDQA 2BXYA 3BYYA 2HFGH 3P0VH 5A40E 2PWHA 2C3WA 2ZYSA 3D1MC 4J3OF 4B5ZA 4I48B 3NDYE 3QEQD 4HG4J 1CK0L 3GSVB 1FZKB 1P6FA 3PWPD 4XMKH 5FO2A 2Q8AH 1RD6A 3V0GA 1S7SB 5SWZB 4WWID 4HCIA 5DK3A 3IF1A 4KK9D 3U4KA 5D70H 4HJEA 4ZDHB 1THAA 4GUPB 3HNSH 3VTMA 1KTDB 2VDOL 5EIIG 2DI7A 1FWXA 2AW2A 2PXYA 4P2QE 1F3DJ 2A0LC 4IU2B 2Y3NA 2YSTA 4X83A 1W0YT 2E7DA 4LVNB 1JPGA 5CD3A 2NPLX 1NLDL 3L5XL 3MRHA 3P4MA 4HLJA 3HC0B 4PYHA 4B96A 3P9LB 1T20B 3H3BC 4GO9A 4G6FB 1WLHA 1WG3A 4WHYG 1LE9A 2O6DA 5CLTA 1B90A 1FV1A 3RTQB 4WI8A 4PLKC 2F7IA 4LSTH 2NYYC 2CALA 4PREB 4ZX5A 4D9LH 5BV7B 5D7JD 5IHLB 3N1MC 5IJVB 4GT0A 5D72L 5LHDA 4UILH 2QTEA 3KGRA 3UGXA 3ULVF 2FYYA 4U6XB 4FG4A 4JVPA 1WAAA 3RFZC 1DQTA 4HJ0C 1W15A 2VJ8A 2H6UA 4M3HA 4U1MA 5EBMA 5I74C 1JZ3A 1A66A 4QJ3B 3L9YA 3WTXA 2OYKA 4NKQB 1KCUH 1JTPA 4IS6B 4YQXH 2JQAA 2WLIB 3AUWB 4KJYB 4OUUA 4KKZA 4N2GA 1SVBA 3U0TB 3BJLA 1O7DE 2R2BA 2K4AA 4N90E 1RJYA 4JG1L 5LBSA 3WFHB 4MJIE 1QHOA 4NPKA 4OBRA 4EPSA 3LS5H 4ZNCD 5F9WC 1QNZL 2Y72A 3EJQA 4GMSL 4U1SB 3N6YA 1CVSC 2XSKA 3MV8A 4PWFA 4N9GA 3SYQA 5ID1A 4U4BA 2ZX9A 5MEQB 4G11A 2NXZD 3VFGH 3MRRA 4RGNE 1J1XH 1C5DB 3AFLA 3ERXA 3SY0A 4LEOB 1G6RL 4H0IA 1LLAA 5EMYA 4A2FA 4LPYA 5DQDL 1BJ1J 2HFEB 1YC8A 5LNDA 1FGVL 3UDWA 4BKTC 3HC3L 4KKQA 3NA9L 2WSKA 5CMAA 2A6DA 4RWYL 4RGOL 1WHPA 3HHSB 4YHIB 3RB5A 3STLA 3TBVA 2QEJA 5T33L 4JDZA 2FEJA 5TH2A 4D8OA 5E1AA 4RFNB 1C8PA 5I5RA 5EU3B 3JWOC 3PGDB 3DIDA 4NEHB 5H94A 4IDJL 1UWXK 1IBYA 5CILH 5L0QC 1XF2A 1X7SA 2GCYB 5JHAA 5EF1A 4GI8A 4X9HA 3KL0A 2OAAA 5JR1H 2XT1B 4KKCD 5HJDA 1D3CA 1RMFH 3BWUF 1UH2A 4PCTA 4KRNA 1XD1A 4WWNA 5EEXA 1BFVL 3TT1L 3WO4B 4U1NA 4HUVA 3MBWB 3VNZA 1KN2H 1S7QB 1CGYA 1U8PB 4PJDB 5DHXB 3UC0H 1BVOA 3E3QE 1B4RA 4M6OL 4LOUC 2EICA 4DGYH 1OAZH 5D2NB 4NPYB 1U8IB 5ANME 3PAYA 2VXUL 2PTTB 3BXNB 3IPFA 4UT9H 5DTFA 1MLBA 4F8LA 1EJ8A 4TXVB 4EDWH 5JO5A 2R51A 1OANA 2B2XL 3V5DB 1T0MB 1WC7A 4XNQA 2PCXA 1CICD 3LRHA 5IW3A 4Z7NF 4KY1L 3BCFA 2VYRE 3TJHD 3RIAF 2VR8A 2ESVD 1KIPB 1MIML 5IVZA 3L3KA 2HWZL 4PTTB 5I1CH 1ECZA 4DTGL 4P2QA 1UWEH 4PWKA 4UQ3B 2NY1B 2NQCA 4LLYB 2PO6D 5TTRA 1TZGH 1BEXA 1I8IA 1IAOB 1WJ3A 3LOWA 4KNSA 1GVIA 2VDQB 4YXKH 4AJYV 1RK1B 3E6FA 4E9VA 3ARGC 4WSJA 4HWNA 3SIKA 4PJBF 3CBRA 4TSCL 1P4LB 2FCBA 3MROB 1JD9A 3IB4A 5EU6D 4OGAD 3WSQL 2DQFA 3ARWA 1T0NB 4FQQA 4KROB 3NJHA 3BEWA 1LO4H 1S7TA 3P0YL 1KIRB 3ESVF 3FB8A 3QIUB 1NAMH 1J5CA 5ESVA 4F58H 2BSSB 4H8WC 2J1YA 4WWOA 5DURD 5TQ2L 4AYFB 3FCSB 3ARVA 4TVPD 2ZUWA 1FO0A 2Z91B 3OX8A 1CR9H 1ZS8A 5D4IA 4MB4A 4HBQA 3NCCB 2P45B 4TQPA 4U0QB 4BSWA 1E9QA 1H3XA 3BVNA 3DIVA 4Y19D 4BFOA 2HRPL 4JFWA 5I5JA 4X6CE 3CZNA 1KB5B 2AJUL 5DUBB 5K33A 2X4OA 3EG9A 1F4YL 3B8SA 3HNVH 3F58H 4X7EC 3CZSA 3B7UX 2FECL 5HJGA 2X6VA 5AL0A 4DN4L 2ETWA 4OAWA 5HVFB 2B1HL 3DECA 4NPJA 5LN4A 5A3IC 5C0IB 3VFOB 4D8PB 5AKVA 4OLXL 3OMNB 2PW1B 4G8GB 4N0UE 4UIKH 1UM5H 4ZUTB 3L7EA 1ZS2A 2APWA 3P11L 3WIFA 5JQIB 2W65B 4XP5H 3U0WL 2JB6B