4L1LA

Rat pkc c2 domain bound to cd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein kinase C alpha type
publication title Cd(2+) as a ca(2+) surrogate in protein-membrane interactions: isostructural but not isofunctional.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4l1lA00
5EDSA 3PRZA 5T8IA 4L2YA 4AOFA 1BYNA 4V11A 2CHXA 5CCJA 2RD0A 2ISDA 1RSYA 3ZVVA 3F05A 4JPSA 5KJ7E 2ENQA 1QASA 2WXQA 4G11A 1DSYA 1UOWA 1V27A 2CHWA 3APFA 3ML8A 3SD5A 3M7FB 4QJ4B 4TS6A 3IM1A 3FDWA 1UOVA 3HHMA 2QZQA 3FBKA 3LJ3A 4HVBA 4J6IA 1QATA 4FJZA 3PREA 2KI6A 2V4LA 4EZJA 4Y1TA 2WXMA 5JHBA 3OAWA 2FK9A 4XZ4A 4URKA 4F93B 1E8WA 2R83A 1E7VA 3JZYA 4WWPA 2K3HA 1TJXA 2Y3AA 3MJWA 4NPKA 5G55A 1WFJA 3L13A 1YRKA 2WXPA 4KZCA 2EP6A 5CCHE 3R7QA 4AJWA 3ZIMA 3RPBA 4EZLA 2K8MA 2WXGA 3QK0A 2DMHA 3HN8A 1UGKA 2Q3XA 2BWQA 1WFMA 4EZKA 4BFRA 1RLWA 4TV3A 4FULA 1GMIA 1DJXA 4WAFA 3APCA 3TWYA 4BGDA 1HE8A 3L16A 2D8KA 4LDCA 4WWNA 4FADA 4FHKA 1K5WA 2Q0ZX 3NZUA 4GB9A 2CJTA 2YOAA 3OHMB 3ML9A 1TJMA 2CM5A 3DPDA 4NPJA 2CM6A 3QAQA 3L9BA 4F91B 4LCVA 2YRBA 2UZPA 2K45A 4DNLA 1DJWA 4L1LA 4MJJA 3L4CA 4KITB 4L1BA 3ZW3A 3IBEA 3CSFA 4OVVA 3F00A 2NCEA 4DK5A 1DJIA 1W16A 4WEEA 3DBSA 2WXJA 3B7YA 4XX5A 4PS8A 3W57A 3QR1A 3R7RA 5JHAA 2CJSA 4WWOA 1W15A 5G2NA 4FA6A 1DJHA 2A5UA 3CSTA 4OVUA 4ANVA 3W56A 1RH8A 2CHDA 1BCIA 3QARA 4IHBA 3NSJA 1E7UA 4XE0A 3TL5A 3L08A 4GNKB 2WXIA 1A25A 3L17A 4PS3A 4TUUA 2DMGA 2K4AA 2JQZA 1DJYA 5H4ZA 2FJUB 2Z0UA 4NS0A 3PS6A 3GPEA 4PS7A 2QZ5A 2ENPA 3ENEA 2WXHA 4QAMB 3T8MA 2B3RA 3F01A 4A55A 4QJ5B 1E8XA 1CJYA 4F92B 2A4ZA 4F1SA 3QJZA 1E8YA 3TJPA 4ANUA 4QJ3B 3N5AA 4IQHA 1E8ZA 2NQ3A 4LT7A 4FLHA 2WXLA 4HLEA 3PYCA 4Y1SA 3APDA 2ZKMX 3PFQA 2WXNA 4FHJA 4ANWA 3F04A 2ENJA 2LHAA 4FJYA 4ICXA 5CCGE 2WXRA 1DQVA 4L23A 1E90A 1BDYA 5H4YA 3HIZA 3QR0A 3KWTA 3L54A 3RDJA 1DJGA 4NP9A 2WXFA 4ANXA 4ICWA 3NZSA 2WXKA 3P2BA 2X38A 4KZ0A 3S2AA 1DJZA 2WXOA 2N1TE 2NSQA 2CHZA 3KWUA
chains in the Genus database with same CATH superfamily
2WYHA 1KCBA 1ZK5A 2JJVA 1J87A 4CNIB 5MEOA 4WI0B 3MAWA 4AGQA 4YSRA 1M6UA 1BBJA 2VDRL 1JNLL 3SD5A 1WBZB 3BP5B 3UTSD 3U1QA 4H8WL 3LDBC 5FEBA 4NM4L 3TT1L 4EE2A 1OT4A 1JGDA 1D5XB 3FK3A 3NCXA 4PGDB 3RZCD 4H88H 1OGAE 3M1OA 4UM8B 2C26A 3BHBA 4GKZA 3DYPA 3MNWB 5DJ0A 3SCMB 2ZUXA 1YRKA 5JHMA 4BQ9A 1WFNA 4NRYB 3C5ZB 3FU7B 2HT3D 2BOLA 3X3FL 1CF8H 4YSEA 4ADJA 2AEPL 3PV6A 3S3PA 5D2NE 3IJYA 5F6IC 1KBKA 3ZO0A 1UH3A 1FAIL 2ADGB 3VNZA 4XWGL 1IU1A 2ADFH 2LW3A 4Q52A 5DD6B 5F96L 4E2OA 1KJVB 5CSGA 1DVSA 3GSQA 4D3CL 3DOIA 1PIGA 1SGKA 3TJHD 4WUUE 5CJ8A 6PAZA 3NIDE 5E8OA 3FH7A 2NY6B 2XA8H 3EYVA 3EYSH 3OKEB 4P46D 3WNJA 2VXUL 1MCNA 1OO2A 1S5IL 3X14B 5I1CL 4Z7IA 4M7KL 1AO7A 4XC1H 1WAEA 1LWRA 3CH1A 2G2RA 4JQXA 3BUIA 3RB5A 3FUEA 4D0DB 4RFOL 1ML0A 1A6VH 1WAAA 4Q97A 3L3OA 4OJEH 3I50H 4WHCA 4NKOA 4PREB 5SX5H 3TCLB 1YMMA 5A6MA 5BVJB 1OGTA 2PTVA 2X5PA 4H0IA 4HIEB 1VZGA 1KGUA 4ONGH 4A2LA 1NFDB 3HN3A 4WHTB 2YJLA 5C0AD 1CG9A 3F12A 3QJOA 4M6NL 2F1EA 5CLTA 1HIMH 3F85A 1SDYA 5MHSD 3ARBC 3EH1A 2LAAA 5J5EA 5CP7A 4MJHA 4AE0A 4KJWC 3FQTA 1IARB 4JO4H 3TBSA 3ZT7A 5IQNA 5JHDA 2FEEI 1HH9B 3WMPA 2NW2B 3UTTE 3V9FA 4HUXA 2C1PB 5HY9B 4HLJA 4KFMA 3U6XS 3EJRA 4KI5F 4MHHG 3RGBA 2XETA 3HBQA 4P2QA 1U8LA 2VCOA 3G5WA 1SF3A 1FHNA 2P7TB 3DIDA 4FLSA 1FNAA 4ADGA 2ICCA 1G1YA 1LM8V 2VL5A 4FQ2L 4JFTA 1HI6A 5KYNA 5JOFB 1ZGLM 1ZT7B 4OCMC 3S3BB 3TV3L 2CO7A 1TQVA 4IRJB 1WA1X 4H1LB 1M6OA 3CFDB 2WO2B 2ZAIA 3B2PA 1EAOA 2J8HA 3FFOA 5GGVH 2Q76A 1WA2X 4AQEA 1UD8A 3ESOA 4ZZFA 5BV7H 1GGIL 4I7ZC 5DJDB 1NC2D 1CDBA 1KJ2L 3K2MC 1NIAA 2MRYA 3WJLA 5CINL 3IU4L 4X9GA 2CKNA 4N6RA 3MCG1 4I5BB 2SEBB 5HGBB 4E0RA 2YSTA 2A9NL 3OMZA 4GP8B 4QRRD 4TRPL 4HMEA 3SPVB 4PJCE 3BFOA 3MJWA 2OTWA 3C60C 2NLJB 1G9NH 4OZIE 5JW4N 4HCRA 3B8SA 4TNFA 1UKTA 1BAFL 3F5WA 1RZGA 4EI5D 4L4VE 3JSSA 4L4TE 1NCAL 2WZ6A 5DURB 1IEAA 1IKOP 2B1OA 1ASOA 2BX5A 3V10A 1HILA 2GI0A 3O6KL 4NZJA 2AF2A 3QGVA 3EO9L 3V5DA 1G7PB 5HHXH 2RQ8A 1T7XA 4RBPH 4Z3TA 3UTPD 3AY2A 4XCEB 1O7VA 1YEIH 3HVNA 3L2LA 4XMPH 2Y1VA 1YECL 1XSIA 2VLRB 3ZDZB 3KG5A 2YLHA 4GRLB 4I4WA 4Z7VB 4HZLA 1PX8A 4BRVA 4RIRB 4MMZC 1U33A 4FNLL 3QDMB 3OJMB 5A1AA 2FZ3B 2GHZA 5KSBE 1SDDA 2F9BT 4LHUG 4PGZA 5L6YL 3SQBA 1F4WH 1XAKA 1YNKH 1CFBA 2DMCA 2E9IA 3NAAL 3VWJC 2R0LL 2ZPKL 3QJVB 4OLXL 1XGYH 3VGAB 3BZEA 1YUHB 5C07B 3NCWA 4IKIA 1I9RH 2EO1A 1E27A 4UM9D 5I18H 4AW4A 4UQ2B 4KOCA 1CGSL 2DQHL 1MHPH 1V10A 1KXTA 4G3YH 4YXHL 2VOTA 3G6AA 3OF6D 3NFNA 5IHBA 5KYWB 1T5XB 4RAUA 4YR6B 3HOGA 1D5MB 5LAXB 3TWCL 4ZMPA 3LHAA 1T0MB 4MJ6B 1IQDA 1YPZA 3HMWH 4IIQB 3S3DB 2APBA 4QDGA 3MRLA 3VFWA 4JO1H 1MWAA 2H45A 5IGXH 3CDZA 4IBWA 4LT7A 1YN7B 3MBXH 5FGBC 1ET7A 1JL8A 5EZLA 1KWKA 2ZX6A 3NGBC 4MLSA 4OCXL 2V2XA 3VCLA 1JF1A 2E5EA 4K7FA 4WVRA 3VRJB 3WS6A 2VDLB 5C0RL 1BFOA 5D7LE 1SYVA 4G6MH 5EBWA 2CE6A 2IDTA 2L3BA 3AAZB 4XPGH 4TUOB 5DU7A 5FHBH 4L3AA 5KVGE 5EG6C 2ICWI 1HHGB 1GW6A 4P4KA 4QEGA 1ACYH 4PFEA 3GJFH 3HHSB 2E7LA 5HHNB 4QRUA 1H3PL 1JHTB 2WXQA 1X5AA 3CVHL 4LPYA 3QNYB 4KK9D 4XCFH 5E5RB 1ZLVH 4F7KA 4FXTA 2UYLB 5AW3B 4OCNC 5I9QB 3P0YL 2GTQA 4A6YA 3SKMA 2AV7A 4AW7A 3PQYB 1LEIB 3GTVA 3HFMH 3MA9L 2AHIA 4RCAA 4BK5C 5F7DA 2X87A 4FZ8L 4FYRA 3V8OA 1J9QA 1I3GL 1WGOA 5IOPA 5FOJA 1USZA 5CHNB 2H1XA 3DIFA 3TBYB 3C87A 1YY9D 1WVZA 3GS0A 2WTRA 3SPCA 3ZL4H 3ZL1A 2ZSVB 4JHWL 4Q56A 1ZA6B 3LPFA 4YGVB 1QFUH 3L3GB 2GTWA 3BAKA 2BP8A 3ML9A 3GDBA 4RGOL 5E1AA 3VQ1C 1FZJA 1BYOA 5HYIA 4IKJA 3QDGE 2KT6A 1R5IA 1BZDA 4EI0A 2VLLB 3Q13A 1CD8A 1OCRB 3FHQA 3BKYL 2R2EA 1TFHA 4XMXA 4MDIA 2B5IB 5IVXB 2BWIA 3OD3A 4DF9A 5AAPA 3MUUA 3FTGB 2R0KL 3CFNA 1NLBH 4JRFA 4EN3B 2W0FB 1U95A 3RU8L 3MUGA 4HOMA 5FF6B 4R5XA 3RVVD 1XGQA 3VAEA 4QXVA 3R8BB 3NIDF 2IG2H 1KACB 4M1CD 4HWEL 2AV1B 1Z5HA 4HWBH 2V17L 4W70A 3RL2B 2OXGB 4L3FA 3QPQC 1PZ5A 1YVLA 5AVWB 3MRBB 5EEYA 4PRIA 5E4OA 3MSPA 1IVTA 1JNNH 1GOGA 5HJ3B 4ZJ9A 1OF2B 1F6AA 3PGFH 1U41A 4PQXA 3ISWA 1K2DB 2ADJB 5AAWC 4PJ7B 3VWKA 3RVTC 5F6HI 2EC9T 4GI8A 4YQXH 4Z7UB 3RWEB 5EZJB 2BRQA 2CNYA 2CNZA 3O0RH 3D4GA 3HC4L 4NO2A 3RVXD 4Q9QH 1Q9LA 4MQTB 1CBVL 5E6IC 2CWRA 4HH9A 1F4XH 1KB5B 2L7EA 4G43A 1OARH 2HTLD 3OM3B 4WF7A 2E8YA 3H7BA 1A7NH 4PJ9B 2ZOKA 3DX9A 4I2XA 3MV8B 3QNFA 4OSUL 1E4XH 4M62L 2M83A 2EEFA 4BZ2A 2WKGA 1MJ7L 1YEEL 3MRNB 1XCQA 4RMRA 4BCXA 5JA8B 1EMTL 3L4YA 4KX9A 1RIVL 5JPMB 4CVUA 4A04A 1RURL 3B7TA 2Z9TA 5GS3A 5GGSY 4ATWA 4MS8D 3QC5X 4BCYA 3PHOB 4EVNA 3LEXA 3VD9A 1G6RL 5TE7L 3S5LG 1EK3A 1HHJA 5DF0A 5DUPL 2GK2A 4IK7A 2OAAA 1GZQB 1OOAA 4QR7A 1UWFA 5BZWB 4QHKJ 5F89A 5HGAA 4NIYE 2VT0A 2BHYA 4FLQA 1TZHB 3BPLB 4AVIA 2XUWA 3DX1A 3FT3B 3GLEA 1IM3D 3T04D 1IE5A 4V33A 4BDVB 4Y89A 1J1PL 5GGUA 1OAZH 2VXTL 5DUBB 2NNRA 3W3BA 3WNMA 2UXGA 1WT5C 3C08L 4RZCA 2EIEA 3V52H 1NOAA 5IBUB 5FM4A 3PG2A 4WWNA 4AGOA 1NAKH 1AR2A 1KOAA 1BQKA 3SBRA 1EDHA 4TULL 2YRZA 2WHVA 5C0BD 1KN4H 1SYSA 2RFXA 3KYAA 1W80A 3OHXA 5F9JA 3D18B 3RIFF 3Q8BA 5IV2B 1EZSA 2Y7MA 4OZIF 3I9GL 2ZX9A 4PJBB 4XODA 5DHVB 2VISB 1HYRC 5F9WB 1N68A 1M7IA 4JRYD 2Y4SA 1S3KH 1TFPA 3P9LA 4FQQA 1D9KB 1IC5H 2R4SH 3ARFC 1SFDA 4K7PL 3WFDL 5IJCC 4U33A 1Q1JL 4JN2A 3WBDA 4C58B 4RMBA 1UM5L 5DZVA 3HN5A 4NERA 1VPOL 3N41F 1ICTA 1U8QB 4APQD 5J89A 2BSEA 4UYQA 2GJZB 5DQDH 2PR4L 1XH3B 3KPMA 5EC1B 4Z0XA 3LKSB 1N5YH 1NGWA 4MVBC 3TBVA 3US9A 3NSJA 4JG5A 3QT2A 1S9WB 1AIZA 5TDOA 2AEWA 4X8JA 4ZW6A 4FTVE 4OF3A 3QYCA 3TF4A 3BKJH 5KSBF 2Z31C 4FFZA 3O4OC 1N2RB 2OJEB 5I1EL 3NPSB 3OZLA 3QCVH 3ENEA 2CRZA 3BJ91 2VUYA 1NGQH 2IH1A 3IDXL 3QQ9D 4S0SD 5SWZA 3WEOA 3ZU8A 1T3FB 1NSNL 2NDGA 3BOVA 4XWOC 1ZGLB 2XACC 1CF1A 3S35H 3VFUA 1JYNA 4NRZA 2Z1PA 3W82A 1E3XA 1ZHKB 2W91A 4TLSA 5DI8B 5SWQA 4BHUI 2HRLA 1AGDA 3D69B 2ZNXA 1ZTXH 3W37A 4ICWA 5AW5B 4EO5A 3FYEB 4QCIA 4L48A 2XKSA 3WFHB 5D6CA 2Q3AA 2X6UA 5FW6A 1OTSC 2P47B 1CD1A 4R7LA 1HSBA 1T21B 2DQJH 2C3HA 5ID0A 5DS1A 2AK4E 2CLVB 5H94B 4KK5C 3KVPA 3U6RB 3QUMH 4LGRB 3FN0L 3C2SA 4TPRL 2X6BA 1DE4B 4U1GB 1ZK9A 1FJ1A 3WN5B 5E00B 4LFHG 4YSUA 2XXFA 4HCFA 3VFOB 3T4AC 3VD0A 3BH9B 3KDMB 5D93C 2IOMA 4XP1H 2CMRL 4NPKA 5FHAL 4L8SA 3LIZH 3A23A 4BUGA 3RGVC 3MBEC 1WIOA 2WWNA 1DQMH 3HPJB 2BSTB 4HS8H 2HFEA 4GQZA 4E9YA 4UT9A 2P5EA 3BDXA 2XWTA 3GGWB 1TKWB 3ATEA 3C9NB 1A4JA 2F5BL 4AMKH 3SJVB 1OSPH 2YMOA 3SPIA 5AW9B 1BHGA 4UIMA 3SYQA 4I0PD 3SN6N 1TJIH 3AT0A 2Q0ZX 4N26A 4Y19D 4G6FD 3T2QA 3KPPA 5E5MA 4ZUUA 1ZLUK 1HINH 4Q4EA 3S35X 4LOVA 4D9RD 1P2CB 2JB6A 2BJMH 4RZKA 2HN7A 4M8VA 4PRPB 2ZCKL 2Y6SD 4YHPA 5CN1A 4OQTH 4OJAA 4F1ZA 3PWUB 4YAQB 1JV2B 4ZXBA 1J9TA 3PE9A 1QRND 3SKJH 1BVLB 3B7YA 3K81A 3SSGA 5EBMA 2X4TA 1RZ7L 1NANH 1WC7B 3BLPX 4HLZH 4JK0D 3CSTA 3F7PC 2F58L 2G5BA 1IKFH 2UWEA 4M48H 3FZUD 4OVUA 2QVKA 3MRRA 3TFKC 4ZW5A 3QARA 1DANT 1ACCA 1I7ZB 5AVYB 5BOPA 4HIIA 2E3VA 3BLBA 2R56H 2WXIA 1A25A 3BI9X 3G6JE 3QYMA 3HKFA 4ZTOL 3VM7A 3L95A 3RL1A 3I75B 1HWGB 5TDPA 4Y16C 1B3JA 3RUGB 5D70L 4UDTA 5L0QC 4PB0H 4H0HB 3CUPB 1OK0A 2G2NA 1F90H 4YOKA 2V5TA 2A6KA 4WLCA 1P0SE 3JV4A 1T04A 3FAWA 3QCTL 4UBDD 2F1AA 2FBRA 2J4WH 4M9OA 2R2BB 2DZEA 1C16B 5K93A 4PN6A 3C6LA 4S2SA 1E43A 1A4KB 4QGTA 3TZVB 2X9YA 4R5VA 3CC5B 2NY3B 4JO8A 4OZGB 5GZOA 3CZKA 5BQDA 2X2IA 5DTFA 3G5ZA 4MNQB 4JFFA 5KVEL 4PS4H 1HT6A 3SDXA 5IVZB 1U8HB 3QEGL 2R1XA 2HB0A 4HAKA 3RI5F 4B5EA 3FJTA 3LV3B 2CHXA 2XN2A 5JMRA 5TDNB 4F58H 5GGSA 2KERA 3UZEA 1M71A 3KW8A 3Q8AA 1JF5A 4A2MA 5IG7B 2O6PA 1E4KC 1LD9A 1PLBA 3X1GA 5C09D 3LJ3A 1C5DB 2VIRB 3UG3A 4NBZB 1L6PA 4X80H 4RAHA 4IBQA 4F7PA 3B6SA 2F74A 4WFGD 2QPFA 2DBLH 4Y5XB 1XIWD 4NLHA 4IBZA 1UD5A 5IIEB 1KGIA 4HK0A 2FHCA 4HFWB 3IU3B 2E74C 3HUJF 1BZ7B 5FX3A 2EIBA 2IO5A 1LVEA 5HI5D 2VXVH 1A7QH 3VI4B 5ISZD 5ICYB 2WUCL 4DZ8A 3VXUE 4XHJC 1YEFH 1UYWH 3BX7C 2Y06L 1AHWA 2HKFL 2HLEB 5FUZH 5D4IA 3RTQA 2AJXH 5FOBB 4ZSOA 3KYOB 3A67H 1UXMA 1R3LB 3W9EA 2ODIA 2IBZY 3JVGC 2YAHA 3O6FC 5KVDH 2E75C 4B0MM 3JUYA 5HHVH 4KVCH 1F3DJ 4XZUB 5DS8B 2W65A 4IGBD 1S7RB 4YDJB 4LSTL 4JFEB 3R4DA 1YAZA 1GKOA 3NZ8A 1BPLB 4YHNA 3D6GA 1CI3M 3BMWA 5KVFE 5D4QA 4A39A 3JTTB 4L8DB 3SOTA 1U8CA 3TBCA 4U1NA 3HC0A 1GGBH 2X1WL 2G30A 2XQBL 4P2RE 5CEZH 4CVZB 2R8SL 3AB0C 4PLKD 2J88L 4LVEA 2X4OB 4N1EA 2GITA 1EXGA 4RGND 1FNSL 4IQHA 3HS9A 1JD7A 2XPZA 4P9HH 5DJZB 1PX4A 4NFCA 4OD1L 5IVNA 1VGEL 5HYJE 4A37A 4U6XA 3UEQA 1JUFB 3EO1B 4XP6L 1XXFC 2VLJD 2O6CA 4K3JL 3RPIB 3Q9PA 5MEQA 3LN5A 1RUKL 4OJFH 2P8MA 1B88A 2XN0A 4HJUA 5H2BB 4U3SB 5T3XL 5BZDB 4PVLA 3MODL 3P77A 5FM8A 1VADA 1TU2A 2MNWA 4GPVA 1QKZL 1TO4A 5SWSE 4YSQA 3FPXA 3LQZA 1A14H 2IDQA 3V4PL 3US0A 3RDTA 3KYMA 1KTBA 3GNML 2ZONA 4Q6IC 4XN4A 2ENQA 2OW6A 2RACA 2CZNA 3BP7A 3ZLQC 4HKBB 4KK8C 3ZDYB 5BOJA 4HUKB 1FYTE 4ZW7A 3UAEA 3K5SA 2X7LA 3GK8L 3IVKA 3LEYL 2WWKO 4QHLA 5TJWK 5LGKA 1FL3B 2YGQA 1Y6NR 4G59C 3SDAB 3SBWA 2UY6B 2X4PA 4X4YA 3KJ4B 4JDVA 5HGDB 1J8HB 1RZIA 3JWOL 1JDAA 2NY4B 5I5RA 1HSAA 4EZKA 4U6TA 1BD2E 1QPKA 2VO8A 5DVNA 5IW6A 3T3ME 4RFNB 5ITBH 5K1JA 4M43L 1TT6A 3A6CH 4K9JA 3ZN6A 5I1DB 5MP6L 4KJQD 5K33A 1MFEL 4ODVL 1KJ3H 2ORBL 1H9VA 4LHQB 1TTRA 4AG4L 3UADA 1O6SB 3ES6A 5T1MA 3P9MA 3ZKMC 3E7JA 2ZAHA 4K5MA 4BCZA 4DTGH 3OWRA 4B7IA 4XHQA 1VFAB 1REIA 2EDRA 4I85A 4DKEH 5CEZD 4RESB 4OCSH 1XGPB 1L9SA 2PXYA 3L4ZA 1F8TL 1NFDE 4KUCD 3GJEB 3DTXB 4AZ8B 3WIIL 2YPLB 3VI3E 3WIHH 4JG0L 1H6TA 2Z7UA 3ULUD 2CDGA 2O30A 4Z9KB 2Q20A 4K8RH 3QDJD 2P5WA 3G5XA 4HFUL 5K39A 3JWNE 5F9DC 1D2PA 1PYWB 3VU1A 2DICA 1NGZB 4POZC 5CSBA 3WAJA 1FV1A 3BH4A 1JFQL 2IAMD 2CDFB 4JKPL 1E7UA 2QQLL 2BNQA 3GZPA 2YGOA 1INDL 5DK2A 3S37H 4LL4A 1I8KB 1SDAB 1DYZA 4TVSa 5E9AA 5KS9A 2BP3A 3GMLB 4CC4A 4HIJB 1RZ8A 4PY7A 4PS7A 3PPEA 3KM2A 1L3WA 2FAUA 2V7HA 2EIZB 2HLFC 4BZYA 4JAMB 4XP9H 3ARWA 4Y1AA 2OMWB 3KJ6H 3OJDA 4PTUB 2GHWB 3T4YA 4PCKA 3ZTCC 4W9IC 4UCFA 1MCQA 2LQRA 5JXAH 3BKML 1KPUB 3G6JF 1S9YB 4RETB 4U1HA 1BZ9A 1NIFA 4IW4C 3QQ3B 1CBJA 4J28A 1NA8A 4PRNA 4X4ME 4XBGA 4GSDH 2ZUQB 2BW4A 1A7OL 2KKQA 3K6IA 2WB7A 1KIPA 3CWGA 4J4PA 4LEXL 2ZG3A 2BH0A 4L37A 3H0TB 2H26A 4LIQE 2XQYK 4P07A 5I26A 1LEKA 3VD7A 4XTRD 2HP4A 2EJ1A 2G75A 4Z23A 5CZVL 3NIFB 2FH6A 1L7IH 4JY5L 2FNBA 3SDCD 1E9OB 4JM2B 3CX2A 3AUVA 1HEZB 4QF1B 2CO6A 4IBUA 4Y1TA 1OGAA 2FGWH 3ARDD 1NCWL 1L4IA 1GS6X 3C5XA 4JPKL 4XOBA 5KOMC 3SOBL 5BW7C 3MOBH 5C0IA 3ESPA 4F7MA 1TJGL 2Y0SA 4JZNB 4NGHL 3S37X 3Q5TA 1ZSDB 4HQQH 5D1QB 4K8RD 3J2PA 4UZSA 5D2NA 5E1IA 4ZUTB 2J57A 1FE8L 1IL1A 2EZ0C 3MRGB 2D7TL 1AYRA 2OCJA 3MV9B 4J3WA 3ZDZE 4D94A 1DQDL 4UDUA 4Z7VE 4OLWH 1T4KA 1X44A 4XN1A 1YG9A 2AQPA 3KDPB 3QDME 3NCJH 5F9AC 4BSWA 2HJLB 3D52A 4PJFF 1WK0A 4IJ3C 4S1SL 1U8IB 4F57H 3OHMB 4PG2C 1P4IH 3S8GB 4ODTL 1LXMA 2RQEA 2ZJSH 3VGDA 3QCUL 4Z95L 1IAKB 2QR0B 1HNGA 3NACL 5IHUL 4MRBA 2DPKA 4GXVH 4NP4H 3UBHA 4YBHA 2IH9A 1UCTA 5CWSA 3CXHK 5AZEL 4G8GE 1NKOA 3US1A 1PJ9A 4MHHI 2YN3A 1G9HA 1JI2A 1CFSB 3QAZB 3QPXL 3COOA 4N0CC 3V0GA 4OAWA 3EGXB 4XT1C 4DZBB 5IROD 4PJ8B 1HL9A 2RALA 1AY1H 1DR9A 4KO5A 4MYWB 2NSXA 3NJGA 5T5FA 5I5IA 3BLKA 4AIOA 5I1JH 4ZFZB 1VGKB 3CE1A 4LRIC 2HG5A 3DX7A 4GW1B 2WBXA 3QUKA 4WNQB 5FYLE 3U9UB 4CN1A 1AR1C 3MXVH 5EIIA 4APXB 3UTTA 5E1HB 3DV6B 4CN4A 4Y9CA 5DFVC 3SGEH 3DVIA 1XF5B 2P3YA 1CXEA 4NQCD 4PWEA 1OPGH 2EEDA 1S7QA 4XVUD 5EZIH 2W38A 1D5ZA 3IJHA 5BO1L 4UT7H 5I66B 2G9HA 3A4AA 2X3BA 1JZ2A 3EOBB 1BZQK 2PYEB 4Z7AA 3ZE0F 2Z7YA 2XPGA 3HE6D 2RGSA 3B5TA 3EBAA 5JZ7D 2NY7L 3PJSB 2EIMB 5J57B 1IGFL 5HHOB 4YXKL 3D4CA 3H54A 4WO4D 4YDMA 3RURA 2CPCA 1AQKL 3NA9L 4AVHA 1MFAH 3BUYA 2IH3A 5BV7B 3QORD 3N55A 3ARBA 3T8XA 4FJ6A 2VXSL 1KXVC 3FQ2A 3UZVB 5EOCH 1A6PA 1AJ7H 2BOCA 2CJUL 2NZ9C 4QWWD 2A6JA 3VFNB 4L2LA 1P84K 5IR1A 1CU4H 2YAEA 4EKJA 4Y8DC 3CFCH 3T0ED 4J2QA 3NJXA 1P5VA 4HCRH 4WHYG 1A6TB 4JR9L 1S7XB 1BOGB 1RUPH 1V3LA 4URKA 5FECB 3IFLH 2OSLA 4PJCA 1N6QH 2WUBL 4JPIB 1XL4A 1U6AL 1DO6A 3OGOE 3WI9A 2EVJA 1UTDA 5I6LA 1AOZA 1UG9A 1KCRH 5FA3A 4XNDA 4L4VA 2X4UA 3IDNB 3M8OL 2OR9L 4L4TA 1A5FL 1A3ZA 2QQNH 2EXYC 5FCUL 1UXLA 3WUWB 1YMHB 1VCBC 1TJHL 4NAMA 4TV3A 4W81A 2Q87A 1RXLA 1MFMA 3REVA 1MIEH 2VR7A 3HG1D 5A2BA 1YEHL 1ZANL 2P8LB 4HWZB 3BFWA 3CZGA 4GS7C 5DO2D 5EDXA 8FABB 4P5KA 3DUUA 2IANB 2DYPD 2A9DA 4NFDA 4QRSA 1NAML 3T3MF 4GKSA 2X70B 5D1XC 4R3SB 4Y2DB 3BGFB 1TVHB 4B0MB 2Q86B 1U3HC 4PVNA 5KSBA 1TIUA 2BXZA 3II3A 1IEBB 1VB9A 1MVUA 2WLHA 3C60A 4RISH 4G1MB 3EUUA 4OD2B 4QXUL 3UYPA 1TVBA 2WYTA 1QYGH 5DC2A 2R29A 1NBZA 3TO4D 3L4TA 1OM3L 3VSUA 2WLJA 2ZWKA 4XH2B 2QHRL 4XNAA 4Z3EA 5GGTL 4FMFA 2ICWJ 3JT2A 5IHZA 2BVOA 4KHXH 2PPAA 5DLLA 5CCKH 4LHUD 1KGJA 4W9ZA 3DROA 3UCRA 5C7XL 4G8EA 1NFDF 2YK1L 4Z7UE 2XWZA 3HR6A 3BE1H 3RWIA 3UTZB 3D85D 1MWAH 3A4EA 4M1GH 1G7IB 1JXFA 1MCRA 5JQ6H 3MLSH 3O2VL 5BS0B 3GPEA 3VI3F 3FCUB 4NQED 3BPLC 4NOBA 3OKOA 3K91A 1JYXA 3AQYA 3FUFA 3O81A 3C5JB 1A4BA 2ED6A 3G04A 5D1XE 2CBTA 5IMOA 4DGVH 3DO7B 3MV8E 2VDNL 2NCMA 4MMZA 4X9HA 4XMWA 1MLBA 3DMMD 1YEJL 2H2PC 3VWJA 5D7LA 1P7QB 3QIBC 1FC1A 5DA0B 3GI9H 4F7CA 2HT2D 2CO3A 5KSUA 4EBQL 1COBA 1WGVA 5FM5O 2XVKA 5GIRB 1ZT1A 2BIMA 2ED7A 3R8QA 1KTLB 5BMFH 5K9QG 4KBPA 1LGVA 1L9RA 1AG6A 3GJFB 2VDML 5HD8C 3ASOB 4YPJA 3B3IA 3MUY1 4A6YH 2AI0L 2NXZB 4N0RA 1EXUA 3GBLA 1V27A 1JVKA 1O0VA 1IM9A 1EV2E 3ZSSA 4DKFL 2FR4A 4LVHC 4LSQH 5D7SL 3KPRA 4G6JL 2EVHA 3BVNB 4R0LC 4I9WD 4Z7OE 5E6YA 3MOQA 3UBXA 2X4RB 2NXYB 3OR7A 1OB0A 2V4LA 2GFBB 3FONB 4AC2A 2X28A 4E42A 3HE7D 4NRXB 5FGBA 4E41B 4ERSL 5K59E 5I6XC 3VFTA 3AU1B 4XMTA 3KWVA 2YEZB 4PRHE 5CN2A 2GY7B 3QJSB 3BP4B 5BPPA 2XXCB 2B9AA 1R0AH 2K8MA 1YQVH 3BH8B 3NPSC 1GS7A 4V2BA 2APFA 4OIIH 1WFMA 2P48B 2DD8L 2QADD 3PDOA 3VXMD 4AMWA 4NQDE 2IPUK 4CGTA 4H8QA 4B9PA 4WW1A 4HG4J 4P3DA 3UAJC 4DSYA 2P49B 1DL7L 1MJJA 1RU9H 1KSRA 1QFWI 1N7MH 2RR3A 4NDMA 4X9FA 5DJAB 2MQGA 2NY0C 1AANA 1FN4A 4UOZA 1J0KA 32C2A 1DJWA 4WJ5B 5G5DB 2ODHA 4HUWA 3ZDZF 1SNRA 2MTPA 4RA3A 4BK5A 3AQXA 4JKWA 4Z7VF 3W39B 2EUZA 3DKHA 1QA9B 4FQCH 2D2CC 1YNLH 1IQWH 1S4IA 3MLYL 4DGIH 1UEMA 2Z91B 3LQMA 1MFCL 3OAZK 4F8PA 1BMZA 3EYFB 4Q2ZA 3KXFB 1HAUA 2AERT 1QSEB 4JDEB 1JWMB 3RA7H 3T71A 3GO1H 1G7QA 1GPOL 3GMQB 3VYNA 5IB2B 1FFRA 4U1GC 4P4RA 5EPMA 3T3PB 2OL3L 5J13C 4LSRH 3D87B 5AD0B 3FOMA 1BVKA 3BD5A 3BVUA 4ELMB 5DXWA 3LD8C 5TK2A 2XA3A 5CP3A 3BAWA 3D39A 2CR0A 1QEXA 4POUB 5D2LB 3OX8B 1XF3A 1JVOA 1IGMH 1R3IL 4F8OA 5FYJD 2FLMA 4Z76A 3M07A 1I1AD 3M7OA 2Y2WA 3DARA 4DKTA 1HHIA 4X6FA 5L88L 1DDHB 2XKNB 4LE8A 5F9OH 5M7QA 3KBPA 3U36B 1MAKA 2B16A 2Y23A 4LLQA 4NX0A 4BZ2H 5I73B 4BRJA 4RGMB 1E6OL 3B37A 1O7SA 3QH3B 2B1HH 4IRSB 1LDSA 4F8NA 1J5DA 2BCKA 1R3HA 1WH0A 2NR6D 2VDPH 2WMPA 3OLIA 4MD5A 4BH8B 2G2PA 4K3GA 2B2XL 2MCPL 2WP3O 4NKIL 2GUOB 1PDKA 4DO6A 1V7NH 2NTFA 1EERB 4OTXL 3MMEB 2CO1A 1KC5L 2WBJD 2GY5A 3GMRB 1U8OB 2KC0A 3E2HC 2J8UB 1J7VR 1GY1A 4K23L 5AAWA 1FNGA 3SBPA 2G4GA 4YFLF 1E3FA 2VGLM 1P4LB 2FATH 3NJHA 3SJVE 1HH6B 2WNWA 2OMTA 1J9RA 4V1DB 5E6IA 2UZYA 3UC2A 3Q5YA 2EP6A 4HUVA 2MJWA 3PHQA 5I1LA 2O93L 1ES0A 2J7LA 4GMTH 8CGTA 1C9SA 4QXWA 1MFBH 1UFGA 4TYUA 4Q9CA 1RLWA 3I9IA 1X7QA 4LVNB 2LE9A 2GEQA 4HMDA 1ZOXA 4MMXC 4LLAA 1I9IL 4O51B 5INCA 4Y4HB 1THCA 2EUWA 1HL8A 2ITDB 4XNMA 1CGWA 4RFEA 2K9FB 1S3RA 5MERB 5ACZB 4DETA 3G08A 3QWOB 1KLFB 4XMKH 5IUSA 2IALB 3LQAC 1D6EA 1NINA 1SLUA 1DJIA 3QEHB 3MLWL 4YE4H 2G60H 4P5TC 2YHGA 3T0BA 4Y4KD 5IVXF 3AMLA 5B7FA 5LWYL 4P99A 4OM0L 4R4ND 4F15C 2YPVL 3O6ML 3NPZB 3ARED 3HG2A 1VA9A 3P0VH 2GI7A 1P7KA 5A2KH 4FFZH 3RWDA 3CDGB 1AD0A 3KPQA 1OQXA 1WT5A 2DWSA 1IFHL 1LK2B 2FQDA 4GMSH 4FFVC 3QIUB 4FTVA 4PGBA 3U0WH 5JORA 2IQAB 5KVMC 3V0DA 1GAFH 1XSJA 1B0RB 1KG0B 1NLDL 4JRXB 2A6IA 3ZDXE 3QFGA 4XN8A 2YD6A 1Z9OA 3C75A 2CCWA 4M7ZB 2PP8A 2VH5H 3BVDB 3MJ7B 3ARFA 1SOKA 2AQQA 1F02I 3PWJB 1Q0XL 5BUAA 3MZGB 1E3ZA 4PJ7F 4XBMA 3L4VA 5LBVA 2BSCA 2IADB 4Z7UF 4N85A 4L3CA 4X5WB 4LDOB 4JZOA 2QDWA 4HX1B 1KIRA 3SDDD 1S9VB 5C92A 1NEZA 1E42A 3GEFA 5KN5B 4LCWE 5J9PB 3VFMA 2D7OA 2X12A 1QNZH 5DHYA 5E51A 3CFQA 1MCFA 4I8DA 5T33H 1FG2A 2Z31A 1JF6A 1WCBB 3OL2A 2HTKC 2AK4A 2Z4QA 4H88L 4JKNA 1AI1H 4PJEB 2EVGA 3QUMB 1U2CA 4H40A 5F0MB 4M1DH 4MDJB 5D4HA 1J1XH 1MI5D 3VGHA 1JCVA 2JXMB 1CF8L 5IMKA 1CR9H 1URLA 5I1HH 2VQ1B 1I3VA 2Q6WB 4UT9H 3NABH 2CKBA 3LHPH 4QXTA 2ZUTA 2FGZA 3J07A 5DD3H 2WXPA 2ADFL 3UABA 3DDFA 1HN1A 2Z93B 5J4MA 5DWUL 1WD8A 5AL0A 2ALAA 2PW1A 4KY1L 3T77B 4LCIL 3WSQH 1HJCA 3BQUB 4S1QH 2GSIA 3RWJA 1G94A 3RIAK 2F7PA 4A2HA 4FULA 1TETL 4LFHD 2IPKB 4KXDA 4Z7OF 4H0GA 4JFPB 4GAYA 3LRGA 2XWBA 4HC1A 5DGQA 1GCFA 4LOUD 2DWEB 4XC1L 5K59F 4MX7A 3FW6A 3CFJA 3TT3L 2QL1A 2GJPA 1NEZG 1A6VL 1A1NB 1TJMA 3ATDA 4FG2A 4BQ6A 4JFDD 4F3FB 3MJ9A 5IFJB 2KS0A 4HZ1A 2R27A 5I75C 3RY5A 1KBGL 3BWUF 1UJ3C 2YA1A 2WLZA 3PIQB 3W11C 4PJBF 3T4AA 3CMOH 3AS2A 3TLRA 2W9EL 4GQ9H 4FYQA 4YBQC 3KPLA 4LDLB 3RGVA 3MBEA 3T0AA 5GRJH 1NFIB 1QLRB 3O8XB 5HDLA 4PD4J 3B9AA 5B1KA 4HYTB 5C9KA 5CEXB 1I3UA 1G7MA 2H7WA 1X5MA 1XEDA 4WTQA 1HXMA 3P4NA 5GS0D 2R69H 3GHEL 1CICB 3K6OA 5I19H 1FCCA 3I6LE 1WEJH 3ZE2E 3ZTJH 2DH3A 4JQVC 2VZSA 3VH8B 3PNRB 4IMLB 3WKPA 5LGHH 1NCBL 4IOFC 2TSBA 4P23D 5I0WA 2OYLA 4LPUA 1VACA 2WKOF 2ERJC 2XBTA 1O6VA 1CDGA 2C3GA 3I3DA 2NY1B 4FHJA 5KG9B 1AKJB 1E90A 1T7ZA 3BIKA 4HIHA 1JVLA 5GGVL 1N5AA 4M7LH 3U2SA 1W8EA 2D7NA 1R17A 4XO5A 3ZDYE 2Q2LA 2ATKB 3FSOA 1DVFD 3F6LA 5ESAA 3K6SA 5AKRA 7PAZA 1MH5A 3N0PB 3PL6C 5B3JF 4FQXD 3LXUX 1X3DA 2OTUB 2OTPA 1BFVH 5T3ZD 1MW2A 1J8HE 2X4NB 4E9TA 4U3HA 2ZX5A 1JWSA 3CVIH 3W1ZA 4LGPB 2YGVA 4Y16A 4Y2OB 1CLVA 5DQJB 5E23A 3Q01A 4HPHA 1BWMA 4OKVB 5FXCH 3E6FB 3HHMA 4QRTB 1G9NL 2BP0A 2BY3A 4UNIA 5B4MC 1ASPA 2IMNA 3LNFA 1FNFA 1N59B 3H4HA 4PW9A 1GIGH 3VXSD 2YO3A 5GRYA 1UVQA 1DVXA 4MJ5A 3RWGB 3AACA 2N0KA 4H8WC 3HR5B 4Y88A 4NJ9L 5HHME 3FB7A 3QHFH 2CBPA 4UTAL 1X5YA 3O3AB 2BWQA 4B41A 2MTAA 2CLZB 4FKHA 4NNPH 2Z35B 2CGYA 4PCYA 4QYAA 1UOKA 1BYPA 2E9GA 3VXNB 3QEQE 3TA3D 4WFEE 4G1EA 1YEKH 3F3HA 4GW4B 4QUOA 1YN6A 4P5MA 3OAYH 4OI9A 4ODXA 5CLYA 1E4KA 1F4WL 1SMAA 5ALCH 2HT4C 4ZQKA 5E5UB 1IMHC 4NQSA 4L1BA 1F58H 1I9RL 1R46A 2TRHA 1BVOA 2AJZB 4N5UA 1X4XA 2DQUH 2YPKB 5I18L 4KQ4L 3S0PA 2FIKA 1JZ4A 1MHPL 1SLXA 4BV1A 4N1HB 4ZMTA 3T0XA 1XR9B 2WLLA 3KPSD 4JM2C 4UV7H 1J5OH 5EF0A 1ZKAA 3LKNA 2DWDA 4BFEA 3GMOB 1M57B 3FF7A 2BS71 4UILH 6PCYA 4JO1L 5IGXL 2WLIA 2XC8A 5LCVL 3IS1X 2AAAA 4P2RA 1LP9B 3MBXL 4UF7C 4RSYA 4CUCA 1I8UA 2ENPA 3ARGC 5HYQB 1FLTX 2PPEA 4AQAB 4F33B 1GZPA 3T6VA 1QPXA 1ZIBA 2WOBA 3RWCB 5C0CE 3RUGF 4GSXA 4QJ3B 5IT2H 3EXLA 4L3EB 4LEBA 2GPZA 2UVEA 3EFOA 2AS5M 3ZMEA 1XGTB 3JVGA 3O6FA 5HYJA 2R23A 3VXTA 3F04A 3QZWA 4ZMAT 2DLIA 4XPGL 2DTML 2XZCH 3POCA 4GY4A 4P05A 5F7HA 5I8OH 1HKLH 1JGLH 2YMXL 1DJGA 3WJMA 2DIAA 3IF1A 1SFHA 5IKCB 5DD1L 4ANXA 3NZSA 1ACYL 3V7MA 3TP4A 1U8PA 1CURA 1K4DB 3SODB 5JW3H 2N1TE 4LDEB 1FZOB 4QPEA 1OWWA 2H8PA 4XCFL 2WWKT 5SWSA 2WWMD 5T8IA 4V11A 3AG1B 2F15A 3LEVH 2MFNA 1PU0A 2O6FA 3DI2B 1I1FB 3HFML 1OAKH 2FECI 1G0DA 3VFRA 2EYSB 4B3EA 1FYTA 1KULA 3MRCB 3MV11 5KSVB 5DJXB 1JZ5A 1X5LA 5T1KD 3ZKXC 2ARJA 5HDQH 3PREA 5IEKB 5D1ZC 3BC9A 1U8KB 3OXSB 2PMZA 3OAWA 4M8RA 5TE6H 5C0JA 1CK0H 3UO1H 3ZL4L 3GRGA 3G3LA 1USQA 1BD2A 3JYBA 5FKAB 2X0WA 1ORSB 1QFHA 1J0HA 2CPUA 2Z8RA 5CMAA 3WE6B 4F7TB 4YNYA 4XOCA 1OLZA 2B8OT 2GBTA 2C9VA 3E1ZA 3MO1A 5FCSH 5PCYA 1T89C 2IXQA 1N3NB 3L7FA 4C56E 3D3VB 3S96B 5TQ0L 1X6LA 4LRNH 1U36A 3FQXA 2FO1A 3LX9A 4KV5E 3LKQA 4W9JC 1ZWIB 2N0MA 4Q6IA 4I88A 5I15L 5LLIC 1FL5B 2QV2A 4PJAA 2ESVB 2X6MA 1J0YA 4NZUL 3DGDA 43C9B 1NLBL 1ZA3A 1RJCA 3FCSB 3MRQB 3BP6A 1BXUA 2B9BA 2IG2L 3G6DH 4K3DH 5A2IH 3VSVA 2B15A 3VI3A 2EE6A 4MQXC 2WXJA 3GSRB 3Q05A 1J5HA 2O5NA 4K3HA 1NOLA 1JK9B 1ZS8B 1M3JA 1BXXA 1PF3A 2W60A 4JKLA 1RZJC 4ANVA 3D30A 1UQSB 2C1PA 1OP5H 3WO4B 1JNNL 3GSVA 2CSPA 9CGTA 1IGCH 2IFFH 5GQBA 1DBAH 5EWIH 2E86A 3I02A 4TM9A 3QO0A 4CSZA 1MEXH 4BKTC 2JI1A 4ZAKC 3TPUA 4KTDL 5JOFA 4YQXL 2CRMA 1RK1B 1RJYA 3O0RL 3W5MA 4NNXB 1EO8L 2XTJD 3FFCB 1IGYB 3Q7JA 4IRZA 2LLGA 2ZOOA 4A2FA 1HHHB 2MOVA 1CLYL 2WVVB 4CMMB 5J8OA 1OARL 4JFQB 3GEWB 2X10A 3U79A 3PWPB 4JEGB 1I4FB 3B1UA 4RNRA 3T2OA 5CD3B 3W38A 1A7NL 5LGJB 2F7RA 4IS6B 4QNPE 3WS3B 3FH5A 4IEFA 4F8QA 2VLKB 5GSRB 3K8KA 2HUHA 1E4XL 1TZIA 5MEOB 3TVMD 2HFFA 3ZE2F 4X4MA 3HC2A 4OR1A 4W9HC 2Z8VC 1BBJB 1E4WH 3UJIH 4I5BA 5HGBA 5I17A 3DETD 4A2DA 5I24A 2XTLA 5IBTH 3TNMA 1VEMA 1TQWA 5L2KD 1JGDB 3FQUA 2MPVA 4DP4X 1X9QA 1UWXK 3TM6A 3ERXA 3JWNG 1HJBC 3ZVVA 4LCCC 5CLXA 3T1WA 5FWQA 4YUEH 2CHWA 3BHBB 1JXJA 1P9MC 5DJ0B 2GJ6E 2ZKYA 2AP2A 2QZQA 3ZDYF 4G8FA 3PV6B 4JVUA 1TR7A 2CLRA 3IJYB 3CHSA 3V0EA 2AK1L 4PWHA 2IPUG 5EN2A 3X1BA 6FABH 1OAZL 5A2LH 3RILA 2ZCLH 4R7DA 1LO5A 2PO6C 2RTTA 2VR6A 4H1LG 2HZHA 3GSQB 2F7QA 2ZNWA 3RJQB 3S6CA 5I0VA 1JPTH 2R9HD 5E8OB 3IFOA 3X1FA 3ZHKA 3FU8A 1EUUA 3EYVB 5FGRA 2BW5A 4H44C 4N2NA 1KN4L 3DGGA 2K8QA 4QHNA 5E9DA 5H37A 5E08L 4G72B 4XAKD 5C9JA 2X40A 1ZHNA 2GYSA 4YSTA 1AO7B 4PB9H 2IAAC 2G2RB 4DVBB 3FQYA 4RMTA 2R4SL 3L3OB 2HVBA 4NPJA 4E36A 1IV8A 5IB3A 3LCYA 4NKOB 2D03H 3AG2B 1YMMB 3JV6A 4MBOA 1OGTB 5CJQH 3KLHC 1LILA 4M56A 2A74C 1OHQA 1ETJA 5DQDL 4RQQA 3NVQA 4G8GA 5AKSA 3MROA 1CG9B 3F12B 3MGTA 3B43A 3BUQA 1AP2A 1ORQA 3R7RA 2BNUA 5BW7A 5T5FH 2NXZC 2EECA 4P06A 4WWOA 5CP7B 4H25A 3CJJA 1DZ0A 3FQTB 2FUTA 4KX7A 4WHYH 4WU5A 3TBSB 5BS0E 1C7TA 1VZIA 3BPCA 3ALWA 5JHDB 2FNWA 1NCGA 2D3NA 2BIOA 3DOHA 1MLCA 4HUXB 3KS0H 5EU6D 4PPTA 1CUOA 1ET5A 1K72A 1NGQL 3ETBF 4P2QB 1U8LB 3TGXA 4QTIH 2F54A 5F7WC 2R59A 3I9PA 3IDJA 2I25N 4PG2A 4QMEA 3S35L 3P30L 2FE0A 2VL5B 2IH8A 3VRJA 1MPAL 3ABLB 5H37G 2CO7B 4I18C 4HBCH 3ZUCA 2CXKA 1M6OB 4QT5A 1YA5A 1OCWH 4JM4H 3KHOA 1FO0A 3D2UD 1TYJA 6CGTA 4WFHE 3TEZA 4YHOH 3RBSA 2YZ1A 1EHLH 3VG9B 2Q76B 2EXWC 4WTWA 4AQEB 2AJUH 3FTXA 3QEUA 3BEVA 1BIHA 3Q8CA 2VW6A 5C0DA 1QR4A 2DQJL 5EH1A 2IBZX 2CCLA 5EOCJ 4KZ0A 4WUUD 3Q5OA 4BFJA 4LOEA 4OKDA 5IMMA 3HB3C 4N6RB 1SXZA 2E46A 5GSVA 1CGYA 4E0RB 4LRIA 5CUSL 5AVUB 5HI4C 3O4LA 4WY7H 4JY4A 3RJOA 4PJ5B 4QTFA 2NUPA 3A0OA 2OTWB 4XP1L 3BCFA 3F5WB 1RZGB 3LIZL 3QI9D 4JM2F 1DQML 4KTEH 1SHSA 2V5SA 2VKXA 4HS8L 1IEAB 4HHWA 2JE8A 4W6XB 3JTBA 1FH5H 3N9GH 1HILB 1OSPL 5DZAA 3QVAA 3UTQA 1QABA 3LB6D 3V5DB 3KCPB 4N2OA 3L3JA 1TJIL 5CZXC 4JS7A 4UT6A 4F7EA 3ZZQA 3FTUA 2O61A 3Q3GA 2QSCH 4I4WB 4HZLB 1TEFA 1KXVA 3MLRL 4QD2E 1UT1A 4JL2A 4GFXA 4FNPA 4NN7B 4OQTL 3B7RL 1SDDB 5AL8A 4M02A 3SQBB 3SO3B 4UINH 3BZEB 4U1JA 1U21A 5F3HA 3CXFA 1E27B 2DQFA 4M61A 2R29H 5AOMA 1JERA 3ILQD 3CSFA 1QSEE 5KBKA 3QUXD 4N1CA 1IKFL 4FQPA 4X9YA 1X6NA 1KXTB 1NMCB 2YD5A 2CUHA 3G6AB 4PHZA 2WO4A 3DXAE 4KV5F 4RAUB 3DX6A 2VMEA 2Z65C 1FRGL 1FP5A 1IQDB 1YPZB 1KGCE 2KL6A 3B56A 3JZ7A 3TL5A 3MRLB 4NUQA 3P4OA 4PB0L 5E7FA 3VFWB 1ECYA 2Y2YA 1MWAB 2JELH 3JUZA 3GBDA 2OMBA 1W6LA 3CDZB 3GQFA 1F90L 4QAWA 1CVSC 3QUGA 4HAFA 5CD5D 5I6OA 2EDKA 3RFRA 1WZAA 4IU2A 4EAEA 2W0KA 5EZLB 1P7HL 1MFUA 2J4WL 4U6YA 2V2XB 3VCLB 1JF1B 3O11A 4OF0A 4WHDA 4K7FB 1MN4A 1G9ML 5D1XA 1BFOB 3MV8A 3QBTB 1SYVB 1U3HA 5EBWB 3BEWA 4MJIE 3JV0A 4NT6A 4MB4A 1ADQA 1K3ZA 3QZMA 4KROC 4PSPA 5KBDA 4FJYA 1T66D 5FR3A 2Q7YA 4HALA 4PS4L 1NZRA 2R7EA 4Y5VC 5H4YA 5KVGH 1RIUH 4P4KB 4UWQB 1JRHH 4LPXA 2H1LM 1Z9LA 1ZPLA 1DEDA 4QRUB 5SX5K 3LN4A 4N2KA 2XIBA 2IWFA 3MRPA 4A6YB 4PJHE 3SKMB 2AV7B 5KJ7E 4PWFA 5F7DB 5IB5A 1PIFA 4KXZI 1SXNA 3FS9A 4GINA 2DBLL 5IOPB 1DHKA 1RHFA 5ICZA 5CKAA 3DIFB 2JTYA 4DP5X 5FYKD 4U0RB 3HNVH 1H6UA 3FRPB 4HPOH 2WTRB 3BIBX 4OZFA 1LNUA 2K6ZA 3ATFA 4RMSA 3DOSA 4O5LH 4PRHA 4KFZC 4JGNA 1XF2A 4J3OF 2J44A 2WCSA 2VXVL 1KNOA 1A7QL 1QAWA 2GTWB 2JKTM 3QIBA 1Q4NX 2EDWA 3LVEA 1UYWL 2WBKA 4NQDA 5E1AB 1TZOA 4PRAA 4WAFA 4JGMA 4M7ZC 2GJJA 1P6WA 1R5IB 4EIUA 1Z0NA 2PWHA 2AJXL 3EJQA 4G7RB 4KKAD 4G9FD 4FADA 5D96C 2R2EB 3A67L 3AY4C 2DQMA 4MA7L 4MDIB 1IAIH 3LNIA 3RBGA 4Z8FH 1A7PH 4YBLB 5C08D 3WKNA 3X11A 1U8QA 4CU6A 5GZND 5KVDL 1IVLA 1D3CA 2XICA 1U95B 3B9KC 3MUGB 4R0LA 5HHVL 3KEHA 1XGQB 5GRXG 3RKPA 5JO5A 3C12A 1HNFA 4MA8L 4HEME 2WVSA 2YEQA 1KIUA 1WISA 4B9GA 4K4KA 1PZ5B 4IBLT 4Y9GA 3QULA 4CBZA 4HIXH 5KYUA 1PGRB 4PRIB 4X0KA 3A6OA 1GGBL 3BN9D 2YOCA 2XG5A 4NJAL 4PWGA 2WKOA 5KW9H 1F6AB 5IBUG 5CEZL 4RLDA 3LNDA 2ZXQA 4GRWH 3V5HA 4Z3GA 2X2UA 3QNZA 5ILTH 3VWKB 3WEXA 4UAOB 2G9KA 4TUUA 3UAJA 3T0DA 4CA4A 1IAII 2VDQL 2ILLA 5E2TH 2IOIA 1H3XA 1Q9LB 2NYYC 4HH9B 1UCBH 2AKRA 4BINA 2F53A 4Y7OC 4G43B 5DQ9A 4LZKA 1JG9A 1A3RH 1E8XA 1KF9B 1OSZA 3H7BB 1LK3H 3EOTH 4TVPD 4OFVA 3DWTA 4RBPK 2ZOKB 3DX9B 2NDFA 3CK0L 4A2GA 1JP5A 2E27H 4OJFL 3BJLA 4E9RA 5J12B 3BD4A 4M6OH 1R1CA 1JSYA 3RHWF 2WP3T 2WYZA 4BKLA 1XCQB 2C1OA 3OSVA 1RHHA 2PCXA 5A6IA 5DWPA 5IBLC 4PJEE 4WFFE 2WZPA 5IB4A 2VDPB 4NEHB 3KL0A 5CS7A 1G4RA 2WXOA 1JPFA 4ACPA 4L9LC 5GISL 1KCVH 1NCUA 1U42A 3BPNC 3EG9A 4QHUA 3LEXB 3WL9A 1WITA 4EVNB 4M7LT 5CCJA 3QDGD 4NO0A 5AZ2H 1HHJB 3KDMA 3OV6A 3RQ3A 3WTUA 2FWUA 2VDOH 3LRLA 3CV5A 3NSFA 5DGRA 4H8PA 1YYCA 5F89B 2GVYA 5HGAB 1UFUA 4NCC2 3BYYA 3H42H 3H9YA 4JFHD 1F3JA 4QRPE 4R96A 4HK3N 4L4JA 1X4YA 4L1TA 3TV8A 4Y2NA 5ITBL 4MAYD 5GGUB 4HSAC 4RZCB 1I7UA 4PIBA 2BNRE 5SV4A 3Q9QA 1MJUL 1KJ3L 3GRWA 5GS2H 1UM6H 1XAUA 3OB0H 5DHEA 2ETWA 1UZ8A 1SYSB 2RFXB 3OHXB 4AGLA 5F9JB 1FYHB 1AGFA 5AVQB 1OOWA 2PWFA 3KL3A 4DWHA 1M7IB 1BM3H 3LN9A 3P9LB 2DRUA 4OCSL 1KGYE 1K5WA 1S7WA 2YAPA 5B1AB 3VYPA 3KR3H 2F19H 4I89A 3ULSA 4JN2B 1BGXH 1MHEA 4LMQI 5AW6B 1WC7A 5KVEE 3L9BA 3D8MA 1J11A 3WIHL 2Y9RT 1QI5A 2NX5A 5E4AA 4Y0GA 2VDKH 2C9QA 3UDWA 3GJFK 3V4VH 4K8RL 3KPMB 4DKAA 4Z0XB 3WD5H 3FQWA 1I7ZA 1IEHA 3CZUB 1NGWB 4PY8I 1Q8MA 1ZRUA 1ILUA 3VXRE 3TBVB 5HHQA 1ZLVK 1T2XA 4YK4B 3SE9H 4FLOA 4U1MA 2H0FA 1UADC 4X8JB 4Z3JA 4J3BA 1FFPA 4UQ3A 1V54B 3NRQA 3IJ8A 5F1KC 3CUPA 3B4NA 4MMXA 1KBVA 2IH1B 5SWZB 2VC2H 4HGWA 1ZY9A 3IKKA 2Z92A 2BFVL 3PDDA 1INQA 5ETUA 1A7RL 1K8IA 1QSVA 3TX4A 3VFUB 4G6KH 2WC7A 4NRZB 3Q1EA 4UOW0 1L9QA 2I5YL 3L81A 4X98A 4PTTA 2D2OA 3MREA 4TQPA 3GMPA 4PW4A 5ADPH 2ID5A 4HSCX 4U1IA 5SWQB 4A55A 1JBJA 1AGDB 4ELMF 5D71H 3MA7A 4BSJA 4RX4A 3QJHA 5D2LF 4QCIB 2QPDB 3FB8A 1W72A 1KY6A 2C9SA 2JQAA 4GSDL 4OW6A 2OA9A 4P5TA 1G7JA 4QXGH 5D6CB 4GI9A 4YPGA 1ETA1 1CD1B 1CDYA 1HSBB 5BCAA 5BOZG 5JR1L 3O9WD 4HG4K 3F7YB 5A3ID 1SJEA 1PLGH 4LCWA 3DECA 5ID0B 2W92A 2F08A 3HNSH 2CHNA 5AVTB 4DFIA 5MI0B 1ZV9A 43CAA 1BF2A 3OC8A 2RD0A 1MAML 1T1YA 2BK8A 1FJ1B 2D7QA 4X5LA 1M4KA 1T83C 3IWUA 4FXLA 4ZUVA 1CWVA 4OLYL 4B9KC 2FGWL 3L1OH 2RB8A 2BERA 2GIMA 2CKBH 4L8SB 3AJ7A 1GJUA 2BLFA 3EH5B 1NOFA 4JJHA 2EIDA 1J0ZA 2XWRA 3MOBL 4WJKB 4BZ1L 1F4YL 2HFEB 1T2QH 2P5EB 5J6SA 5T1LD 4HQQL 2XWTB 4GIAA 3QZLA 1A4JB 5IESH 1B6DA 4FQJL 1RI8A 4PVMA 2Q8BH 4CMHC 4UIMB 4OLWL 4YHZH 5KSAC 2BVPB 2PW2A 1H3WM 1W2KT 3M1CA 3NCJL 1B4LA 3O41A 2BVUA 4HC1H 2PN5A 3U82B 3KPPB 2XDHA 2WLNA 5E5MB 4ZUUB 4F57L 5H35B 2JB6B 2ZJSL 3JWOC 4G7SB 1JWUA 2HN7B 3FH8A 4F24A 1GS8A 3S7GA 4YHPB 2OJZH 4FHKA 1D5IH 4ZXBB 1Y07A 2UUDH 3FO0H 3IGUA 2OK0H 2CM6A 3NCYS 1LDPH 5EBMB 5FAAA 3TYGH 2X4TB 2UZPA 1F4HA 1JZFA 2BIHA 5AEAA 3WIAA 5HYSA 3HI6H 2G5BB 2UWEB 3T2LA 1BM7A 3MRRB 1YNTF 4L8DA 1SBBA 2DM2A 3V4UH 1AY1L 2ZKHH 5I1JL 2CJSA 1XMWA 3LRKA 2D4FA 4H13C 5DD0H 3L95B 3RL1B 1LP9E 4HF5H 4WTXA 5IWLC 4QYOA 5TDPB 1R47A 1FBIH 4QO1A 4A63A 4UDTB 4WWKD 4YSSA 1IGJA 3X17A 4NAQA 1NIBA 4XE5B 1BXAA 2W81C 2AJSL 2A6KB 2LV4A 2DQDH 2MPAL 3JV4B 3FU9A 5JW5A 1T04B 1E5ZA 4OCYL 1OPGL 5EZIL 2D7PA 1Q90A 4OV6F 1MJ8H 1OLLA 3LTVA 4FXKC 4GKLA 1T7WA 2OM5A 4RMUA 3C6LB 2DAVA 4S2SB 2WQUA 4OF6A 3H2WA 3RPIA 4QJ5B 1IBYA 2M8XA 2C4FT 1UJ3A 3FN3A 3NJJA 3MZTA 1ZEAH 5DTFB 5J1AA 4U49A 3G5ZB 4JFFB 4KRPC 3OB8A 1F6LL 3J7HA 3SDXB 2R1XB 1MFAL 4XO8A 2X3CA 3VGBA 3GF8A 2CGZA 4TN9A 3STLA 1PZDA 5GGSB 4H8UA 5EOCL 3SGDH 4A7TA 2FQFA 3TURA 1M71B 1AJ7L 1T20A 5EU4A 4YXLH 2IWGA 4JFZL 1FL3A 1Q94A 3APNA 3V2AR 1XXDC 1LD9B 5JOPD 3CFCL 3INOA 2P46B 5KJRH 1TZAA 3FU6A 4YDLC 2ISDA 3QIWC 4GQQA 4U7SA 4HCRL 4JQVA 2VSKB 4ZS6D 5LVEA 4F7PB 3B6SB 1QASA 2F74B 1RUPL 2XY1A 2LU4A 1RULH 3IFLL 4DESA 5J11C 1N6QL 3M7FB 1HWWA 4AGMA 4EIZC 4HK0B 4PLNC 5GJSH 3ZHNA 3JXAA 1K9TA 2VXQA 4FJZA 4PJEF 3CSGA 1ZHLA 1AZZC 1YJDC 3R4RA 3D3VE 2QQNL 4M9PA 2PCPA 3BZ5A 1RFDH 5AG8A 2DQEH 4E9XA 1XCTA 2A38A 2F6AA 5C6TH 1MIEL 4N24A 1ETB1 4DZ8B 4A2EA 3L1FA 1AHWB 1JDCA 1I1YA 3QUYC 4DQAA 3PL6A 5EU3A 3ARYA 3RTQB 4R83A 5JA9A 2MEJB 4LF3A 4GP5B 4ZSOB 3QEQA 4KY2A 3OBAA 4FNTA 3W9EB 2W0PA 3IDMA 4GBXC 4YX2H 3MRMA 3WKYA 5HPMA 2FCBA 4R97C 4UV4H 3QFJE 3BESR 2W65B 5DMGC 1IBDA 5I1GH 3SE4C 1QYGL 3TJEH 2CDFA 4UQDA 1SEBA 3NZ8B 1BREA 2FO8A 4YHNB 3DHUA 3EJUA 3QW9A 2J12B 4NOFA 3UROR 2J21A 1AFVH 1V8HA 1XGZA 1PEZA 4FCAA 5KVFH 3U30C 5DJCA 1U8CB 3WCYA 5CCKL 4U1NB 3HC0B 2VM4A 3RJDA 1BF5A 3LKOA 2ZCHH 3BE1L 2K7PA 5DYOA 1JI1A 4M1GL 3FFCE 3PGDA 3QHZH 3MLSL 4B6ZA 4JAMA 3BO8A 3ZK0A 3MV7D 3ZGIA 2D7MA 3M88A 2AQ3A 2JKRM 1OTUD 2ATAA 2GITB 3ARUA 4DGVL 2D3JA 1AE6L 1FPTH 3RVUD 1D5BA 5ANMA 5CSZA 4QKXB 1YZZA 4HJ1A 1BVZA 4KKRA 4U6XB 1DBJH 1UH4A 4UMGA 1QR1A 5C0CA 1PS3A 3CPUA 3TJPA 5KZCB 5MEQB 3LN5B 5EEWA 2P8MB 2EE2A 2APWA 2QVIA 3T0WA 2KZKA 3N43B 5JQIB 4ZUSA 3GI9L 3P77B 2A1WH 5EO1B 2DQIH 1VADB 1TU2B 4TL5A 3K2IA 3QXWA 4DW2H 3UJJH 4M5YL 5BMFL 3L54A 1O5PA 2E59A 3LQZB 3CN2A 3RDTB 4IOSD 3KYMB 4LSPH 3IXAA 4MQSB 4JM2A 5CGYD 3EYUH 3S3SA 4KZDH 5A2JH 1LQSR 1ZTMA 2FD6L 3VXUD 5E6UB 2VQUA 1MHCA 2X7LB 4Y4FC 2KLRA 4LSQL 4QHLB 2BDNH 3D5OF 2Y1ZA 4HEPA 2GEEA 4LCUB 5LAPA 4FCHA 1QSFA 2X4PB 4FFWD 4X4YB 2H1PL 2BHFA 4NLAA 4JDVB 3AXHA 1HCYA 1ASQA 1KN2H 2HSIA 1RZIB 5BRQA 5CBEA 3TN0C 3ARGA 1PL3A 4DHLA 2DM3A 1HSAB 3CSBA 4CRPA 2J3SA 4KO9A 5IW6B 5ESVA 3BAIA 4X6CE 1QATA 5FC9A 2PABA 3CFUA 5TTRA 1MQ8A 1R0AL 1YQVL 3VD3A 4OIIL 4JQIA 1HZHH 4EDXA 2NY2D 4YC2B 4P2OC 4NI6A 4LEOA 1FVCA 3ME0A 4X5RA 1CFMA 2N59A 4OGAC 1OHZA 1CFNA 4XNUH 4AGPA 3D48R 3ES6B 4LPCA 3P9MB 5T1MB 2EABA 3LY6A 1CZ8H 1RU9L 4S1DC 5I8KH 4YGAB 2QR0A 3CVDA 5DEGA 4C56A 1N7ML 3K2UH 4H20L 2PXYB 1N6VA 4U6VH 3CHQA 4D9LH 1ED3A 1UT9A 4HGMA 1XCWA 1IAIM 1CGXA 2VUOA 3V6ZA 2Z3FA 4YIQB 3DJTA 2CDGB 1S7VA 1RL1A 3UPRA 3Q2NA 2P5WB 3G5XB 4X0NA 5K39B 1IQWL 4DGIL 5D1ZA 3VD4A 4BUHA 3JWNH 5DMIH 4BBWA 2W9DH 1FV1B 4IKNA 1KJ2A 4Z0BH 1IUZA 1AMYA 1PY4A 2BNQB 3T2NH 3RA7L 3GO1L 5DK2B 5I8CA 3LH2L 2EYTA 4NHUB 1G84A 5AVSB 3U9UA 4UTBA 5KS9B 4LSRL 3BYTA 1DUYA 1QLFB 1TQCC 1RZ8B 4PY7B 3ZL2A 1T89A 2J6EL 2JKSA 4W68A 3SCMD 3VD2A 3KLSA 4P59H 4IRZH 5FYJU 4Y1AB 1U3ZA 3C5ZD 3OJDB 3KGTA 3T4YB 3U7WL 1QVOA 1U3JA 3H9SE 1EHNA 3HS0C 5D7JC 1NFAA 4GIPD 5IY5B 1KPVA 1MCIA 1DBMH 2W07A 2HFTA 5F9OL 4U1HB 5ANHA 5JUEL 1BZ9B 1LP9F 2JVUA 3VD5A 4BZ2L 1ZE3C 1CLOL 3N5AA 3RAJH 1ROCA 4L1DA 4PRNB 2AJ3A 3WG7B 1PCSA 3FULA 4Q89A 2NY6D 5B1CA 4C4KO 3ULVC 2ED8A 1I9JH 3FT1A 3F7VA 1KIPB 4NWTH 2WJ7A 4L37B 1DQLH 3VFNA 2VN7A 3D08A 1LO3H 5I71C 2XG4A 2H26B 4PJ5E 4ZODA 1LEKB 3RYMA 1V7NL 3SO3C 4LIQH 2G75B 1NBCA 2FRGP 3NT0A 1AKPA 4K7PY 2CBOA 1TSHA 1KCUL 2CO6B 1MZZA 3O3EA 1MCBA 5DD5H 5FECA 3WY4A 5ERWA 4ZAKA 3F8UB 4PYGA 1OGAB 1NM9A 1MQKH 5TFSH 1F1AA 5IVOA 3MNDA 2ZXEB 3CN3A 2GJ6A 4MAUL 2DIBA 2QT6A 5C0IB 3ZMRA 2X9WA 4F7MB 1L6ZA 2EUVA 1MRFL 5D2NB 4UYPA 5C1MB 1IL1B 4I13B 3X1EA 4WTZG 1MFBL 3VXPA 5G4MA 4NUPA 4UDUB 4PJXA 3ULVE 2X88A 3GDCA 1T4KB 4G80A 4FNUA 1A66A 1TQTA 5H37H 5A16A 3X3GL 1SN0A 4GT0A 4CGUB 4D0CA 3NIDB 3IAQA 2EDTA 2C9UA 3KHQA 3LS5H 4N90D 4PJDE 3PDGA 2ICEC 2J5LC 3LDBB 1GGCH 4G5ZH 3VFPA 5J56B 1OAXH 2H5UA 1MCHA 1N8OE 2FIRT 4IRJD 2FEDD 4XMKL 4CKQA 4LCCA 3SB3A 5CWSB 3S88H 4XX1E 1MDTA 1P9MA 2VITA 1R24A 1B2WL 4YE4L 2G60L 1FIEA 4XH2A 1IAOA 3G5VA 4J3OG 1XB6A 3VYOA 2J25A 3L4CA 5FA4A 3IGLA 5AW4B 5DMKA 5HJDA 4OAWB 1AGEA 1YPZE 3F00A 5F6IB 2E7MA 3AS0A 1CXFA 4GT7A 4FFZL 1WTLA 4JLRB 4R2GC 3KYKL 1GYUA 3IPBA 4FS0A 3FBQA 1DQIA 3KS0J 3WUWG 2HG5B 5ABZA 1T2JA 3DX7B 1OWRM 3QUKB 4XPHH 1GAFL 3W56A 5EIIB 1YYLH 5FYLH 3UTTB 2VDLH 4GJTB 3NEOA 5K9JH 1IC0A 4YDIH 1S7QB 8PAZA 3Q44A 1D5ZB 3K74B 3PS6A 4MWFA 2IMMA 5DURD 2G9HB 4RDQF 1BA9A 4WEBH 5C70A 5AQ0A 1A21A 3Q6GH 4QOKB 4DP8X 1V55B 2XPGB 3RY4A 2O5ZH 4XMLL 5K9KA 1NQBA 2A74A 4DN4L 5FPIA 4TTDD 1B9KA 1IKNC 3DV4A 3BDBA 4DP2X 5GS0L 3BUYB 2IH3B 5HVHC 1QNZL 1H3GA 2F7OA 2VLRD 3ARBB 3T8XB 1BMWA 2AGJH 4GRLD 5F2FA 4K5LA 1I85C 1NMBH 1T0OA 4AM0A 2C9RA 2XN9E 2BOCB 3BDYH 1PZAA 1T22A 3OPZL 2A6JB 3QDMD 4NYLA 2WXKA 5IR1B 1FVEA 4PJIA 2XQYA 3L4WA 3ROLA 4MZRA 4M1DL 5AOKA 1B4JH 1P5VB 3B83A 5C07D 4AMXA 3DIVA 4MSWA 3AU1A 3ISYA 3B2UC 2OSLB 2YEZA 4KK6D 1CR9L 1W91A 4PJCB 5I1HL 3BP4A 3APFA 2VABA 4O9HH 4JG9A 4PV8A 3LHPL 3EH3B 5DMYA 5GRVL 3BH8A 4FQLH 5DD3L 4A68A 4I18A 5FA3B 4L4VB 2H9GA 2X4UB 3QUZC 5D55A 1YAIA 4L4TB 4PBDA 4E9QA 4F27A 4YFLI 1XBDA 3H4FA 3L3KA 4S1QL 4MYPA 3UGUA 4UT6H 1X5IA 2ZAGA 4TMPA 4AJWA 3QQ4B 4PP1D 2BPBA 2NQDA 4L5FE 3REVB 5T3ZL 1JXDA 3SQOH 5BRZD 4KNUA 3PAYA 2VR4A 2Y7QA 2ZXBA 4P5KB 3C8KA 1GHFH 2HX8A 3DUUB 4UUJA 3ZYIA 2JFCA 4QRSB 4GKSB 5L8JB 1OZTG 2VM9A 4G7VH 5KSBB 4OBSA 2C9XA 1MVUB 3C60B 4AV5A 3NEXA 3CMOL 4QGYA 1WAAF 3UYPB 1TVBB 3H7LA 4LCVA 4MJ2A 4GQ9L 4BXVA 1JS4A 5FUCC 1NBZB 3DVGA 2CR3A 1T1WA 2R0ZH 3QWRD 5T3XD 1RZFH 3R0MA 4JDEA 4XCYA 3RZCC 1ET8A 2XT1B 2F5AH 4M00A 5IHZB 2BVOB 2K6YA 3ABKB 2ALWA 3WO3B 3DXAA 3DROB 4G8EB 2FX9H 2HT3C 2R69L 4FOMA 1UB6A 3PQYD 5C71A 1MKFA 3F6JA 3OKOB 1J8RA 4RWYL 3IKCA 3G04B 4HKJA 3ECVA 5IMOB 3RVWD 3UMTA 4MMZB 3TJHC 3K1KC 1MLBB 2XKNA 1Q9OA 2Y5QA 3EFFA 2PWEA 4FFYA 2V9UA 2VZ1A 4P46C 1ADQH 3VWJB 5KBNC 1MWOA 5FUCE 12E8L 5D7LB 3RGHA 4LBEA 4LLWA 3H9ZA 4M7LL 4TUJA 2Q8AL 4X8CA 4MJIA 1ERNA 4F7CB 4DK6A 4JDTH 5DZNA 5KSUB 2K1MA 2M26A 1BZOA 1ZT1B 2VZUA 1DDTA 3HVDA 3FAXA 3WNPA 3FSWA 1K4CA 3B3IB 2WW8A 1BFVL 3NN8A 2EDYA 3JV5A 4NSKA 1IM9B 3EF4A 3MACH 5B1JC 2FR4B 3KPRB 1O6TA 2VTFA 2YBGA 3PRZA 4EN3D 1CMOA 3UBXB 1AS6A 4HXBH 4PJHA 2LU5A 3OR7B 4E42B 1F56A 4YK4C 1GIGL 2BY0A 1AXTL 1UOWA 3NGBB 4WW2C 4YVUA 3VFTB 4OZFH 4XO9A 3MYJB 5DRXA 1WZ1L 2OMUA 2DQTH 5DHDA 3VB8A 1DO5A 3MYZA 2VW7A 5EB9A 3PDOB 4WCYH 1FFOA 2XZAH 1MFVA 5KAQF 1J1OH 4NNPL 5T5NF 1V3JA 4Y5VA 1CYGA 4WW1B 4P3DB 1MJJB 3TFBA 1YEKL 4EXPX 1U93A 1YNTA 5C0AE 1EJOH 2VAJA 4NDMB 4DQOH 4QHKI 5C0ND 1B6UA 4W4NA 32C2B 3IJEA 2B3IA 5ALCL 3N42B 2CGRL 4HUWB 1DUZB 4PJ9D 1F58L 3MV8D 3FTVA 1Y1UA 3ULVF 2DQUL 3X2QB 5DLMH 3CHPA 4P9MH 4OFYA 4WEUD 4HWNA 1Z3RA 1UACH 1B4TA 1FVDA 3FPYA 1EFXA 4NQQA 3TYFA 4Q2ZB 1EXHA 3K71A 1LK2A 1T0PB 4PJDF 2GKIA 3DBSA 2B39A 1J5OL 1G7QB 4MD0A 2CIIA 4E9SA 1MG3C 5GPRA 5EPMB 3KM1A 4EI5C 3GBNH 3ZZ1A 4C57C 1BVKB 1GKEA 5AVZB 1BCIA 4A7VA 4LL9A 5BUPA 1NWOA 3D39B 1OTTD 1X5FA 4GRWB 3ZSTA 1XF3B 2FECL 1P6FA 1YPZF 2B20A 1OP4A 2JQZA 2QTEA 2Z0UA 3AY4A 3O3DB 4ZOBA 4Z76B 5IT2L 1MCWM 1HHIB 4X6FB 5LNDA 4K55A 3F7LA 3B9KA 4LLQB 1EPFA 5A2AA 1BVNP 1NBQA 5I8OL 1NGYA 4AKOA 4QHMA 2ZXDA 4N0UA 4XOEA 4LKCA 1JXKA 3MLUH 3CZFA 5E94A 2OSXA 2A0LD 2BCKB 1R3HB 2WMPB 3DSFH 4MD5B 1PDKB 1WCBA 3ZQWA 2NTFB 1HTYA 3LEVL 1D9KD 2P52A 4WI3A 4GW5A 4XBEH 5HD8D 4CW1A 2LOEA 3GZQA 3HZVA 3TNNA 4AL8L 1FNGB 2PTTB 2CRYA 3MUZ1 5I5JA 1N0XH 3DX3A 5HDQL 5L4IA 1V3MA 2OMTB 5TE6L 1HCVA 3UTPE 2VERN 5E6IB 1CK0L 1N12A 1NDMA 2UZYB 3PWVA 4HW6A 3UO1L 4PY8J 4QRPA 3T77A 1HOCA 1WLHA 3PHQB 4HUVB 4OFIA 5I1LB 1I3RA 1ES0B 3HA0A 2OR8A 4PYHA 2KI6A 4I3RL 1NC4A 5J3HD 5BZXA 1X7QB 2HRPH 2BNRA 3R19A 1CC3A 2IDUA 3MLTA 5HYFA 5SX4H 5INCB 1JOIA 1T6WA 2JIXA 2DH2A 4TKWA 3QHTC 3NZHH 4XNMB 1MFDL 4HAGA 1D7FA 4JANA 4L9LA 4XCCL 4X83A 1SVZA 3G08B 2UXTA 2UWEE 2C7FA 2YFOA 3VXQA 3O2WH 1J8KA 1OE1A 1D6EB 4DGWC 3GINA 2X1OA 4YN3A 4DIXA 1LJMA 3G6DL 3EJJX 4KK9C 2VZVA 4XP5H 3GHPA 2VDKB 3IAPA 5CEXA 3V0VA 3GKWL 3BUTA 1P7KB 3VXRA 3RWDB 3WHE0 4DN3H 1AD0B 3KPQB 4I48A 5IF0A 3IMVA 4C4UA 3V7AE 4M5ZH 1I1RA 4PGBB 3IDIA 4FTVB 1IGCL 2IFFL 5DR5H 4MCZB 1DBAL 1AZNA 3FFDA 5SX4I 5JORB 1DBKH 1WG3A 1OANA 1MEXL 4DKDC 4OV5A 3B5HA 1YY9C 3BKCH 1DFBH 2A6IB 5LNGA 4W9FC 2N01B 3M86A 3KPTA 3PHAA 5C0GA 2KMWA 3OLDA 1FQ9C 5D8JH 2WLKA 3ARFB 2FQEA 1JZ7A 3SDXE 1N19A 1KYDA 4TXVB 4DPRA 2WQ8A 1OT1A 1AKJA 5FDWB 2G3ZA 4FFTA 2FBOJ 3SJVD 4KKBD 4Q74A 4JFWA 4JO3H 3G9VA 4L3CB 4JREB 4XVJH 5F88A 1R4XA 4JZOB 3S2CA 1KIRB 4OD3H 1AGBA 1NEZB 4LSDA 2WXLA 3VFMB 2V2WA 1R5VA 4HLZG 3FL7A 4MXQD 1E4WL 2Y5TB 5DHYB 3TXAA 5AWNH 4PRPD 4HXAH 3RVVC 4MZIA 3FQNA 1FG2B 3POHA 1CD0A 2Z31B 3FNKA 5DK3A 3O4OB 2AK4B 2Z4QB 1TF4A 3F84A 4M1CC 5E2UL 4IDJH 3SO5A 3GSWA 3BZ4A 5KYYA 1ZHBA 2IQ9L 4EOWL 3FO1A 2WIMA 3BVVA 4DVRL 1A6WL 5I1AA 5IMKB 3IGFA 5CU5A 1INEL 2WAHA 4WJG3 3VH8G 4K3EH 3VGFA 4LPWA 4NHCH 5E56A 2CKBB 3ML8A 4NO3A 1G5GA 4QXTB 4UAHA 2WQVA 3UC0H 3C09C 2ZCLL 2WZ5A 2WPGA 4XPBL 2PW1B 5EUOE 4ZO7A 1JPTL 2GSIB 1RK7A 4LSUH 3RWJB 4JCLA 1T6BX 3RVXC 3H85A 1Q0YH 3MOAH 2HTLC 4GAYB 5D9SA 2XWBB 5BO0D 4PB9L 3L9RA 4MX7B 3CFJB 4KRNA 3AWFA 3ZJAA 4BSWB 1NWPA 3AS1A 3GXPA 4U05A 4YDKH 3DJSA 3NSXA 4W93A 5JLZA 3KWWA 1SJXA 1OB1A 1Z6JT 2E6JA 5G4OA 1E9QA 3TZVD 3BVWA 2RAMA 3F62A 1T83A 2NY3D 5LXVA 5CF3A 3T4AB 2VQ4A 4MNQD 5D93B 2Y36H 4FAAB 4L0YA 2MSPA 3QAQA 3ORJA 5E95B 3KPLB 4MS8C 3RGVB 3MBEB 5T5FL 3V4PA 3LKRA 1G7MB 2ZWSA 2YA2A 5IP4A 3P4NB 1RK0A 4W6YB 1I82A 5ACLA 5KSAA 4F5CE 2I60H 3LOWA 4OLZL 4FFVD 4UB0L 3R0NA 4HOWA 1BX2A 3V6OC 1BFTA 5LQBH 4N28A 1SXAA 4AC4A 3OLGA 1AZVA 3IJ7A 3JWDL 1LL1A 3SPJA 3B2VH 3NCEB 3QG6A 1DCEA 3MKKA 4HT1H 1M7DA 2FYYA 5H4ZA 1VACB 2A4CA 1HHKA 4Q7DA 5EBGA 1J12A 2Y7NA 1OCWL 4JM4L 1Z66A 3KE0A 4K5NA 2DEYX 3T8MA 2N7BA 3BIKB 4HIHB 4YHOL 1EHLL 3GIZL 1N5AB 3B1TA 4O2EA 3SYAA 5KTEL 3GTTA 4B50A 3U2SB 2AJUL 4OGZA 3K6SB 2BVQA 5K1VA 1MH5B 5JIPA 3JQOB 1VJSA 5CJBA 1E65A 3KEDA 2WXRA 3CHRA 2YSSA 4APQC 2V9TA 2MQ0A 3ECQA 3OLEA 4X7TA 5IWLA 1JWSB 1U92B 4Y16B 1W0WA 3V6OE 5L0QB 1X5KA 4OH2A 1BLNA 1LO0H 1ZXQA 2BP0B 1T7YA 2VL4A 3ARQA 5F7BA 4JFED 4N5ED 25C8H 5ADOH 3QS3A 4LAQL 4LPVA 4XXWC 1UVQB 4FXKA 3U2IA 4MJ5B 3RWFA 2GIXA 4KO7A 1EFQA 3GHBL 2R15A 1WO2A 3I2CH 1FH5L 3FT4A 2A9BA 1O7DC 4D7BA 1RP9A 3FB7B 4V2CB 3WNKA 1XDTT 4GLRI 2CO2A 4B9CA 2WV3A 1KB9K 3Q1SL 4KPHL 1DBBH 3ZBMA 4NCDA 4DPAX 4G1EB 5HI3D 3DK0A 5IHWA 1YN6B 3BSZA 1W0YT 4P5MB 5H8DA 4ODXB 3TASA 1C7SA 1GMIA 3HZYA 1I75A 1AYOA 4ALAL 3V0WL 4UINL 1JPSH 1SVBA 4NQSB 3NG5A 3QIWA 2H6PA 3H9HA 5E8PA 3D9AL 3N44B 1H0DA 2BNQE 2FUQA 2JI3A 4R8WH 2FIKB 2DQ6A 5B3SB 5EBLA 1W8OA 3QFJA 3VX1A 2NUTA 1JNLH 3VUAA 4N86A 5KS9E 3C8HA 2AFNA 1Y0LA 4H8WH 4M4PA 4AUJA 2WLLB 2P28B 1WA0X 3ET9F 4NIKB 5F71A 3LS4H 3TEUA 3W5NA 4ZG1A 5JPNC 4K94L 2DWDB 3ROOA 4HS3B 2UWEF 1AACA 1ZAGA 1CTNA 2FDBP 2H0EA 5G2NA 3SDAD 2J8OA 2JELL 2VLME 2WLIB 1KV7A 3NTCL 4LLUA 3LZPA 3X3FH 4B7LA 4NNXA 4P2RB 3SE8L 1IGYA 3QUYA 5DT1L 1J8HD 5GRVK 4JE4B 2NY4D 4B97A 1PVHA 1GZPB 1FAIH 2DWTA 1LE9A 4I0PC 2JKJA 1KGXA 3CXDL 1HX0A 4N2GA 3UL4A 2R0WH 3WFCH 3VFSA 4D3CH 4NS0A 4XCNA 5J0BA 3EFOB 4GBXA 5LDUA 3AABA 3O6FB 5HYJB 2R23B 3VXTB 3QZWB 3OZ9H 1YSOA 2Q7AA 2Y6SC 4U2ZA 4YVNA 2VXUH 2DLTA 3SE4A 3WJMB 3IF1B 5KVGL 1RIUL 5FDYA 1IGTA 1U8PB 4JZJC 1YQ2A 4DUWA 2F8OA 2EILB 4P49A 4QRFA 2AMUA 2H8PB 5SWSB 4LCYA 1WQVT 3VMOA 2LVCA 2YXVA 3SDXF 4M93C 4U2YA 3FZUC 4J7RA 3HW7A 4IYKA 3VFRB 5I2IA 4BWUA 1MOEA 1FYTB 2YPLD 2CHZA 4RDQG 3AB0B 4Z7WA 4JRWA 5FYKU 3DHMA 4TVPL 2ARJB 4NN6B 3HC3H 5C0JB 4Y19E 2DTSA 2V8MA 3HNVL 5B4MD 1PY9A 2D3VA 5ABAA 3WIFA 3ARSA 4HPOL 3FUNA 3H3PL 1DSFL 4JQIH 4D9RE 5FKPA 1BD2B 4ZFFA 1A6AA 2ZZUT 4JFYA 5AOZA 5TE4H 3T3MB 4X7DC 2ZG1A 4X6CA 4PH8A 5CMAB 4EZJA 4YNYB 4UBDC 4EEEA 3MO1B 1QRNE 1KUMA 1U4EA 2IXQB 3L7FB 2W8CA 2AXFA 4MKTA 4DEPC 3BVXA 5DEFA 3FQXB 4FQ2H 5HDRA 1Q0EA 4ES9A 3E6HB 3LKQB 4MZ2A 5EC2A 1G5AA 4Q6IB 3WLBA 2ZP0T 2JK5A 2YD3A 3VG0L 1IAIL 4G7YL 4PJAB 5LDSA 1H8NA 1N0LA 1A7PL 1V5JA 2DMBA 3CLFL