4L1LA

Rat pkc c2 domain bound to cd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
b'TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C alpha type
publication title Cd(2+) as a ca(2+) surrogate in protein-membrane interactions: isostructural but not isofunctional.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4l1lA00
2YRBA 1E8YA 3ML8A 3W56A 3APFA 5CCHE 1DQVA 2FK9A 4L1LA 2R83A 1RLWA 3FDWA 1DJGA 2WXGA 4TS6A 3QJZA 3PYCA 3TJPA 5H4ZA 2RD0A 2DMGA 2WXLA 3L9BA 3GPEA 3L16A 2JQZA 4JPSA 3L4CA 4FLHA 3ZW3A 4Y1SA 2DMHA 3DBSA 4L23A 1QASA 3P2BA 1K5WA 4WWNA 4NPKA 4OVVA 2CM5A 1DJZA 2Y3AA 4FHJA 4LDCA 4XZ4A 3IM1A 3NSJA 4NPJA 3TWYA 5G55A 4F91B 4F93B 2N1TE 1UOVA 2D8KA 4PS3A 3HN8A 1RSYA 3QR0A 4FJYA 4KZCA 4G11A 2K4AA 3R7RA 4MJJA 1DJWA 4ANWA 4IHBA 4L2YA 4L1BA 2LHAA 4NP9A 5G2NA 3SD5A 4HLEA 3W57A 1DJHA 4FHKA 2BWQA 3F01A 4J6IA 1BDYA 4HVBA 2CHDA 3TL5A 4AOFA 2QZ5A 3ENEA 4WWPA 3FBKA 4EZLA 4TUUA 5CCGE 3T8MA 2NQ3A 2K45A 2WXQA 2WXNA 3MJWA 3F05A 4WAFA 4EZKA 3RDJA 2ENJA 2UZPA 2WXPA 3L54A 3KWTA 1BYNA 2WXJA 4WEEA 4FJZA 4URKA 3NZUA 1WFMA 1W15A 4PS8A 4A55A 2WXMA 3QR1A 2Z0UA 3PS6A 4KZ0A 2WXRA 3IBEA 3ML9A 4EZJA 3QAQA 3HHMA 2WXKA 4V11A 3OAWA 1TJXA 1DSYA 4IQHA 3PFQA 4KITB 2YOAA 2CJTA 1E7UA 4QAMB 4F92B 4FADA 2X38A 2A4ZA 3CSTA 4PS7A 3APCA 4BFRA 2CJSA 3M7FB 4LCVA 1UGKA 2A5UA 2WXIA 3L17A 3PREA 5H4YA 3OHMB 3KWUA 1DJYA 2WXOA 3B7YA 4ANUA 2ISDA 4DK5A 2K3HA 3L08A 2B3RA 3PRZA 3ZIMA 2WXFA 3F00A 4DNLA 4TV3A 1CJYA 1GMIA 2CHWA 3L13A 4FA6A 2KI6A 1TJMA 5KJ7E 1BCIA 4ANVA 4GNKB 1V27A 1DJIA 1RH8A 1WFJA 2CHZA 1E8ZA 3NZSA 4Y1TA 5JHAA 4OVUA 3APDA 2ZKMX 4NS0A 1W16A 2CHXA 3JZYA 4WWOA 2EP6A 3CSFA 3QK0A 4GB9A 2QZQA 1A25A 1E8XA 3DPDA 1DJXA 1QATA 3F04A 3N5AA 4QJ4B 3R7QA 1E90A 2WXHA 1HE8A 2FJUB 2Q3XA 3HIZA 1YRKA 4F1SA 2NCEA 4BGDA 4LT7A 5T8IA 4FULA 5JHBA 2V4LA 2NSQA 2K8MA 1E8WA 2CM6A 3RPBA 4ANXA 5CCJA 3QARA 1E7VA 2ENQA 3S2AA 2ENPA 4QJ3B 3LJ3A 5EDSA 4XX5A 4ICXA 1UOWA 4QJ5B 3ZVVA 4AJWA 4ICWA 4XE0A 2Q0ZX
chains in the Genus database with same CATH superfamily
1JF5A 4HJJL 1MFVA 5FC9A 4RNRB 5GGRA 2JQAA 1FVEB 35C8L 5C0AE 5IHLB 4FXGA 3QJXA 4LGPB 1OZUA 2BRRH 4RH4A 3LZPA 2HTLC 4TVUA 4K9EH 1JXFA 4ZX5A 1R5WB 3P02A 1NGZB 5I76B 3OKOA 3VXSD 3EYOB 1ZV5A 4JO3H 4XP5L 4JGNA 4RQQA 2VDOB 1MAML 2W94A 3WUWB 4N0FB 5D96B 1JPTH 1EJ6A 1D5ZB 1KG0B 1FHNA 2EDRA 1OKEA 1CICA 2AJVH 4OLVL 3RDTC 4KXAA 1WA0X 4I88A 5E24E 1XWVA 4LSRH 3BVDB 3JWNE 2D73A 12E8L 3QJTB 4X9HA 4N8PA 4BK8A 1ILUA 1KV3A 1YNTF 3IJSB 3D12B 4KFMA 1IAMA 4MNQE 5IK3A 4ZYKB 5CM1A 3U2IA 5F72S 2APBA 2AERT 2AI0H 1XT5A 5EOTB 4YDIH 3QA3B 3TBSA 2FIRT 3CHPA 5I30H 1MFCL 1JWMA 3WE6B 3TA3B 4BWUA 4RESB 4FXLA 5DRXA 1A6WH 2SEBB 4XMLH 2EAEA 5MEOB 1EVTC 2XV6B 1HOCB 4FTVD 4Y1AB 4DH2A 1HAUA 4LVEA 4RZKA 4HGMA 2F61A 1ZV9A 3CFDA 5CF3A 3KPNB 1PKQE 4V33A 5FF6A 3B9AA 3ELQA 3ULVL 1ESOA 1AQKL 3MOAL 5D2LF 1GC1H 3S3BB 2X4OB 3CC1A 3QDGD 5CN3A 2FWSA 4HJSA 1VCAA 1UH4A 5D7JD 5IQ9A 5TK4A 3CU1A 4J8RB 3MR9B 3TJEL 5C86A 4TXVB 1QSEA 3QS3A 2VM4A 3V4VL 2WK2A 1U58A 4HPYH 4UTAL 4KNTA 5L2KD 1KDIA 4MD4A 2V8MA 1ZSDA 3CZEA 2XJLA 1JI2A 3QQ9D 1XF3A 3MRCB 4Q0XH 4W70A 1A4JA 4MWFB 4XN9A 1ZLVK 5IQ7H 3EJRA 4HIEA 4JKNA 1CXIA 3L45A 1FYTB 2E76C 4AVHA 4ZFOL 2XYCA 5LAXB 1DL7L 1HE7A 5DJZA 4ELME 2ENQA 4ZUVB 4YNYB 3DJZA 4BINA 3RY4A 4RISH 1WPCA 3UCQA 3U4BH 1FYHB 1YMMB 3DV6A 3LXAA 3H3PL 4QJ5B 5IESH 1EV2E 3LZRA 2YWZA 5IFJA 2FLRT 2XKUA 2IV9A 4QHUA 3TJPA 2H3XC 3RGVB 4AIZA 2DQUH 4KJWD 1UT2A 5C0BB 2B1HL 1A7QH 3FYEB 1L7TL 1J5OH 1XCWA 3B6SA 4G1EB 4F2MA 2QR0A 4IGBA 1LP9B 4WUKH 3K6IA 4MDIA 5G5DB 4PJBA 3QFJE 5BS0D 5D5MF 4LIQL 43CAB 2O5NA 4M02A 1U8JA 3ZT6A 5IQOA 4PY7A 3MRIB 3S5LA 5IJVA 4K3DL 4TL5A 3WHE0 4XMKH 3RX8A 1NFAA 4OBRA 2O6PA 4F8OA 1X4ZA 4Q9CA 5I6LA 4QIRA 4GKNA 5CLZA 5TE7L 2A77L 1HESA 4B96A 3JUZA 2BWIA 4N8VA 3C8DA 4P46D 4S1QH 1KBGH 4NQEE 2N7BA 1OIOA 4KK9D 2G3MA 5E6SB 2GUOB 4NOBA 5FYJU 2NTFB 2YEVB 3QIWC 4UUJA 5IFAH 1UT1A 4NX0A 3ZTEA 2H26A 5MI0C 2AEQH 4PJAB 1DLHA 2C9VA 3GKWL 3OHXC 2W65B 3ZL4L 3KD4A 4MAUH 1JD7A 1QUNA 3MV8A 3WUWG 5GXBB 4B7LA 4KZDL 4PJGE 1G9ML 1DEEB 3ZHDA 1H3WM 3HZKA 4M7LL 5JLZA 2HUHA 4IHOA 5A1AA 2X0UA 3TV8A 3ULUL 4OB5L 1MW1A 3RX9A 3I9GH 4HXAL 3NJHA 5DWUL 2GT9B 3FSZA 3OBAA 3VG0H 2ZKWA 1SF3A 4BELD 2F68X 3FO9B 4OV6F 3FHAA 3FQRB 1H5BA 2NY6B 4ZMOA 2E6JA 4JFDA 1DQLH 4MCYB 1DSWA 3WTTA 4YFLI 4ZMNA 2XG5A 3SIKA 1K5NA 2WQVA 3CSFA 1W72B 4NSKB 5E99L 2NCMA 1Z2KA 3VSUA 2XC8A 2LTQC 2AV1A 3QORA 4Z0XB 3ZL1A 3PQYE 5AOZA 1NCBL 3RZWA 3SPVB 1M2OA 3L3JA 1A1NB 4XVSH 3II2A 4PLKD 1QABA 2Z7UA 2J6WA 2JKJA 2BW4A 1VFAB 3GBNH 5AWNL 4OGQC 4XXWA 1KCSH 5FGSA 5C08E 2JLLA 5JDSB 2YPLA 1F18A 4GG6E 4PB0H 2LFGA 1NFDE 1BD2E 4QRQB 2DMKA 3JV4A 5CINH 1GGTA 2OSLA 2XQ0A 1DJSA 4V1DE 2ZXDA 2GC4C 1MRFL 5D4HA 1MJUH 4L29A 5DFTA 3CV5A 1TEGA 1UD3A 5E8PB 3GINA 3Q2NA 4FQQB 4P3DA 4LPVA 5DUML 4HCFA 3WHE1 3UX9B 1H8SA 2HT2C 2Q87A 1G9NL 5KS9B 4UMGA 1TTFA 2VOTA 5DD1H 2Z34A 1HL9A 5DUBA 4LLMB 3TYFB 2OMZA 4PW3A 4LVOC 4AKOA 5HDRA 5E6UB 4NQDA 3MRHA 5G2NA 3QE5A 2LLLA 4PJ8A 2NXZC 1KB9J 4ODTL 3ARGC 4L3FA 1DJHA 2BIMA 1ULVA 2LT9A 5CJQH 3S96A 2F8XC 1AY1L 2K6YA 2NR6A 3FRPA 1NCAH 3LRSA 4XNAA 5KBPA 4G8AC 1ZT4A 1DFBH 1IZJA 15C8H 1EHKB 4YL9A 2J72A 4P3CL 1KIPB 1U3HB 5C0JA 3NZ8B 2CKNA 2C9SA 3Q05A 1RPUA 4GT7A 1F5WA 3S36X 3PE9A 3T2PA 3U48A 3ZX1A 2OJEA 5J3HD 2FEJA 1SLVA 3EJTA 4QWWD 5HDBB 1MCSA 5M94B 3GMMB 5DA4A 1QLRA 2F5AH 4O2EA 1KCWA 1FL6B 4AYMC 4M7JH 4E41A 1AS6A 1O7DE 3H9SB 4GKZA 4IU3B 4UNUA 3EBHA 3MJ8A 1OWWA 4F7PB 2A5UA 1TNMA 4N90E 4TQPA 3MRNB 2NY4B 2OPCA 4U1KA 1V3MA 4HOZA 3O45B 3M88A 4PRPB 4ZRGA 2Y2YA 4JRXD 3PNWB 5DJYB 1AO7A 2BRQA 1P6AB 5T1LA 4AENA 2IAMC 5D1QD 3RVXC 3GMPB 1KXHA 1JNJA 1E5YA 1SUJA 3N1QC 3IDMB 3LPWA 4NUPA 5EOQH 3UTTE 3F7PC 3ARDC 4KOBA 3OM3B 1J0JA 3PWNA 1FVDB 4DUWA 2AJYH 2CDFA 1HTYA 1UJ3A 4A2EA 1IVLA 1RUMH 3EZJB 4H1LA 4LCIH 4U7MA 2EC8A 3WS6C 4X8JA 4NENA 5E9DA 3SZ6A 4PJDF 2ARJA 5F1NA 2AGJH 4C57C 4DHLA 3DX1A 1LO0H 4A39A 5B1JA 4KI5F 3LHAA 4GXVL 1IT9L 3EFOA 3GQFA 1XMWA 4KK5C 3AG3B 4KRLB 3HG0A 2Q10A 2UZYA 3CDCA 3O3EA 4YEEA 1FBIH 4PR5A 2HMIC 3FB7A 1VACB 4KTEH 3T6QC 4BSVB 2Z31B 4P2CG 3B2XA 2CLVA 1XAUA 3VFNB 4FN0A 2FL5B 1HWWA 1RPKA 2E7LC 3OJDB 4EMZA 3HPJB 2VDQB 2ZICA 3DNKA 2PR4H 4N9GA 5DS1A 1I9JL 5TPWH 2FWLB 3TV3H 4NPYA 3T04D 3EHBD 4WY7L 1KPUB 2WBJC 5C0AA 2GSIB 2EXYD 1R24B 5EUOB 3GSOA 4O5LH 3WNKA 4PJXF 3TO4B 1C7SA 5CZXC 4P2QD 4PRAA 4XBPB 1VGEH 4HK3J 4X0KB 4ZQKA 3SY6A 3IAPA 4XN5A 2GG1A 4MJ5A 4JM2A 1UM6H 3UTSD 1URLA 3JV5A 4NCC2 4F15C 2A74C 2ITDA 2Y07H 1OTTC 5DXWA 3GPSA 2XV2A 2IWGA 3O2WH 3BQUD 1AE6L 1JZHA 2OJ1A 4R96B 3ZL2A 1A6TA 2FJFB 2UYLA 2YD3A 1AQDA 1E9OB 5BJTA 1TU2B 2GUYA 2MEJB 3FTVA 4OM1H 3J8F7 4H88L 4CBPA 1BFSA 3C5ZD 3ML9A 2VWEE 5BUAA 3WNMA 3AUVA 4MNQA 4X8GA 3BRFA 1U92B 2DQHL 2YUZA 5H2BA 3GXFA 3FFOA 3O3AB 5D1XA 2X4QA 4IRJC 2IH3B 2OLDA 1VIWA 2CIIB 2DEWX 5C0IB 1F1DA 5M95B 4L1DA 3NGBC 4XX1G 1Z5LB 4BZ1H 1G7HB 1AIZA 1XO8A 1KDJA 1IBBA 3MRJA 4NFBA 4OLUL 4QGYA 4G43A 4PPTA 3P2DA 3HMXA 1DQMH 5FIEA 1KC5H 5DO2C 1TJMA 1BM3H 4OCSL 3UOAB 3V6FA 5IB5A 4KKBC 2PNDA 2BSSB 3OAZK 3AC0A 2CCVA 1XVSA 1PKQA 2WW8A 1ZVSA 1UA6L 4G8IB 5JORA 4CN1A 2Z7YA 2E27L 2HLAA 3ZDXE 5IVXB 2X4TA 3N0PB 1RIHL 1PQZA 2WSKA 3KHOA 1P1ZB 4JO4H 1N6QH 4AC4A 1SJEB 3OKDA 5IB2A 1QI5A 4KNSA 1AGBA 4MD5B 4OCYH 2CRYA 3OZKA 4K7PL 3KL3A 1FV1B 1PSKH 3VFWB 1CBVH 2F08A 4K73A 3FCBA 1E28B 4MA1B 1ZA6A 5B7EA 1PCSA 1SDDA 1LXMA 3VXRB 5HPMA 2J1YA 2RR3A 2GAZB 4TULL 4QCIB 4CMMB 1JHTB 2J1ZA 5DJ6A 1F4XH 3BKJH 5B38A 3WBDA 4M1GH 2F1EA 4LCCC 5CD3B 2UZIH 1JF1A 3V0JA 1N5AA 2A9NL 4ELMA 3S6CA 1RZKH 3QPQC 3ZKQD 1CICD 3KPMA 3QT2A 4E0RA 2H2SC 2VTFA 3ME0B 4HJ0D 4WWNA 2UXTA 3FPXA 4BWWA 3VDBA 4KC3B 3W2DH 4FHJA 5HJDA 1E4XL 4DPAX 3ARSA 4QOKD 4WO4B 3IDIB 4LAQH 4OUOA 1A14H 2XVGA 5KUKA 3GRWH 5KVDH 2A6KB 1T7ZA 5ID0A 3TT3L 4ALAL 4AMKL 1E9QB 1NOAA 2HAZA 1OAKL 4G6FD 4O02H 2F8IA 5CP7B 1F6LL 4YUEH 1JNLH 1MW3A 4NNYB 1OQOA 1NAML 3QFJA 3TNMA 1GC1C 3LQAL 4FNRA 2EIMB 3IE9A 3B8SA 1P4IH 43C9A 5JQIB 2XU9A 4FQ1L 4FQHB 5I73B 4FMVA 1CQKA 2H1LM 2GSGA 2R0KH 3PP4H 4N0RA 3HHMA 5ENWA 5EEVA 2BY3A 3BKCL 4NQEA 1KFGA 4ZX3A 3MV9B 3K6SB 2ICEA 1L9QA 1XIWC 3V52H 4DAGH 4ODSL 4RMSA 1Q72H 1QFHA 4KKCC 5T1DH 2F15A 3L1GA 5A2AA 1BVKB 3OAYK 3P0YL 5ADOL 3W82A 4Y7OC 3UCRA 2CO6B 1BW8A 4MDRA 4X6DF 5DSCB 2XRAL 3OJ2C 5JW5B 4YQXH 2B2XH 4PD4J 3N41F 1TYJA 1QPKA 3ZPDA 1WIUA 3BYTA 2HG0A 3FB5B 4CNIA 5EF2A 4PJGA 5KJ7E 4K7FB 3FB6A 1DE4A 5I1IL 3VCLA 2BWDA 1I75A 1IEHA 2NNFA 2Q20A 4JFXB 4OAWA 3N42F 4YDLB 4GEIA 3FT3A 1X5LA 3FQNB 4S1SH 1XF1A 2W81C 4GRLC 4OGXH 3DOIA 3BCFA 4XVTH 1TLKA 4Y7MA 2V5YA 4JY5L 4X4MA 4IKIA 2WBXA 3MX0A 4MDJA 4X4YB 2IDFA 1MJ7L 3RU8L 4A7UA 3BAEH 4H8WL 3D30A 4G7YH 5GSRA 1EVUA 3FONA 4DO4A 4KK8D 1KTDA 1Q0YL 5D6CB 4OV5A 2YARA 4L4TE 3OR6B 5I17A 3GS7A 5MENE 1PJWA 1MHPH 4JQIH 2D9CA 4LPTA 1JZ3A 3PQYA 4TUKH 2WLYA 1ORSB 4PWGA 2BSRA 3W9EA 5BV7B 2WO4A 1RPQA 4IBYA 1MRDH 5A43C 3BEWA 3EBIA 5GHWL 3KMDA 3CBJB 1S5IL 5CJXA 5IMKB 4M93C 4IJTA 4GO6B 5IMMB 3L16A 1YYLL 4NRXA 5C08A 4JPKL 5HYQB 1JZ5A 4B6ZA 4GG6A 1NFDA 1HN1A 1NINA 5KVFH 1UB6B 4XN7A 1KPVA 4V1DA 3AB0B 3KLHD 4TUJA 3MV7D 3SY0A 4RFNC 3VXSB 5F44A 5LXGH 1D7BA 3KBFA 3ZIYA 3ZR6A 5DJ0A 2YQBA 2VN3A 5B21A 3V0GA 2EDOA 1IJ9A 4AZ8A 4L18A 5E1GA 2KH2B 4KX7A 4MKTA 4FQJH 3D1MC 1X6LA 4X4XB 3GI9H 3UO8B 2Y06L 4AIXA 3GSRA 1VFBB 1WIOA 1WUNT 1X5GA 3EAKA 3TN0B 3VU1A 1MREH 3ZMNA 4EZKA 5DHEA 3EJPA 1HSAA 1HKLH 1QSVA 1KB5A 1AHWC 1X5JA 2P48B 3MBED 3VTTA 3O3DB 3TONA 1HEHC 5BVJA 3M1CA 3CVIH 3LZNA 4XXCC 3U0PA 1NUDA 1I7ZA 5LO7A 2ZAHA 3VFPA 2F8OA 1I7TA 4YHKL 2DQIL 4YX2L 3Q1SL 1BQLH 5A2CA 4DVRL 2VC2L 1CLOL 2FX7L 1KULA 2HJFA 3LXCA 3R8QA 3VA2C 5I2IA 2IGTA 2WXIA 1F3JB 4KXCA 4PV9B 3OHMB 3VYOA 4M6OH 3MUY1 3V5KA 4NQCE 1DUYA 1P53A 1SOKA 3BP6A 3GGWA 3GMOB 2OW7A 4RMWA 4Z7UE 1K2DA 3RA7H 3IFOA 1KCKA 5GGVY 4UOW1 4QRRE 4AGMA 4I48B 4KROD 1AZCA 2F0CA 2DQFB 4NT6A 5HI5D 3LZFH 4MRBA 3UGUA 4JFUA 5CSGA 3D9AH 1E6JH 2Q9OA 3PWUB 3SGKC 3BXNA 2ZF8A 3HBPA 4KO6A 1CDJA 3OMIB 1A6ZA 5ITBH 1NKRA 2VXQA 4JO5A 5D7JB 2OMVB 1A9EA 1Y7VA 3NPZB 4KMTH 3TBTA 2DQMA 4QLWA 4C8XA 1FFTB 5I6PA 4ZXBD 4RWYH 1L3NA 1NEZA 4PG2C 1EEUA 2Y6SC 2AKRB 2BIOA 2ATKA 4LEOA 3NJIA 5FO7B 3RILA 3QNXB 1D7DA 3ZKNC 3UJIL 2P8MB 4JN2B 4N2BA 4XCCH 2KPWA 3QO0A 3UTTA 4JG5A 3HS9A 3A6OA 4LL9A 2IGLA 4BKSC 4F1ZA 1TQWA 5DUJA 1MFMA 3U25A 3GIVB 4WTZG 4ZZKA 1O7VA 3HZYA 4Y1SA 3TBCA 2WLIB 1HEZB 4UT9H 2CRIA 3B2PA 1VZHA 1X4YA 3CFKB 4ZG1A 3BP4B 5I1DB 2XG4B 1B2YA 2W0LA 3MRKB 1U41A 3ZSSA 4JHAH 3FF8A 1UB5A 2JI3A 4B9PA 4FLHA 1FAIH 1HHHA 2B16A 2WKGA 4NQDD 3N40P 4ZFFB 3ARPA 2N56A 4H7VA 1QLEB 3SPGA 1MCWW 4KX9A 1MN4A 4UIKH 2BS71 3TA4D 2OTPA 3SE3C 4WUUB 2NR6D 2VN4A 1FNSH 3OV6A 4F27A 2D3LA 1RSYA 1AR1D 1S7VB 3FFCE 4XPBL 3ZUCA 2IFFL 3WXWL 1DJWA 3MSPA 3IRCA 3NMEA 5BS0B 3ZTNH 3BHBB 1QHQA 4PJEB 1P2CA 1AHMA 3BZEA 2H47C 5AEAA 1OANA 5F0PB 5JPMA 3QJFB 4G9DA 5EMYA 4B60A 1XZ0A 2WTPA 3P77A 4HFUH 1JERA 3MJWA 3FN9A 2EE9A 4E41D 2JCWA 2EECA 2OXGB 2P47B 2VW4A 2CLRB 4K2UH 4ZNEE 5KVGL 1X9QA 1G0XA 3GI8H 4P46B 5F6HI 4CSPA 4PVMA 4F7CB 3DO7B 5IEHB 3GTVA 4FZEL 4IYKA 3RJDA 1B3IA 2F5BL 5FAAA 2XQYA 4ODBD 4BSWB 1TJXA 1DSYA 2GEQA 1U6AH 5CZVL 4KGLA 3L81A 1G0DA 1SQMA 3EG9A 4CC1A 2BK8A 4K8RD 4LSVL 4FQLL 3O2DA 4YEFA 4XNMA 4HIJA 3NIFF 1LTXA 3TF4A 5CU9A 4XRCB 3ETBF 4CADB 5E8EA 2F19H 3LPOA 3S36L 4Q8BA 4G3YH 5IB3A 1GVIA 2BIQA 3L08A 2DZEA 2WWNA 4CVZA 1OHQA 3ATFA 4TNWF 4TVPL 5GQBA 2ZONA 3VXNA 3MBWA 3OAZH 1SJXA 5K1JA 1E2WA 2TRYA 2V7HB 2YPVL 2ZWYA 2NY1D 4CC4C 4OTXL 4PG9A 2AXJA 1BZ8A 1UKTA 3OF6D 1HNYA 4B9CA 5E9DD 4DN3L 1HYSD 1J12A 2H0FA 3P69A 1VGKA 3NCXA 3ARUA 4D7PA 2BZCA 4IIQC 3QQ9C 3N5AA 1ZE3H 1RZPA 1FGVL 1S9YB 3REVA 2ZJSL 4LPCA 3UMNA 2IQ9L 3BPNB 3P40A 4XMPL 3UZVB 1W0VB 2CJ3A 2Q7AA 3QIUD 2DTSA 3LRGA 1MG2C 4R7VA 1T03L 1NGQH 4U6HA 4FXTA 3S9DB 4W9FC 3GLZA 3P4MA 5AZ2L 5EU5B 5TE6H 1FFOA 3WFEL 2AQ1A 5JYLA 5DZAA 2XETA 5SWZE 1CG9B 3DGCR 4KJWC 5DZLA 3TVMD 4O02B 3UTZA 3GIZL 1X4XA 1U8KA 3MRGA 2AEPL 2V2XA 1ZANH 3ABLB 3NFSL 4R8WH 3QXDA 5EEXA 1UKQA 1EIBA 1K5WA 4ONFL 3QQ4B 4OVVA 1CURA 4K5LA 4JM2D 3CDZA 3QUML 4XCNA 1C5DB 1O9ZA 1UFGA 1GA2A 4GBXB 1OD9A 1MHCA 5FOBB 3DTUB 4F9LC 5J57B 4IKJA 3IXTB 2X9WA 3W81A 4XMUA 4ODVH 4KKAD 4ODWB 2EO7A 3L3HA 1Q90A 4KVCL 3L3DA 5D7LB 5CP3H 3T0VA 1E9PA 1DBJH 4MYPA 4EDWH 1T1XB 2DM2A 3U9PH 4B9GA 1GPOL 4JREC 2ZCKH 3CLFH 4WWPA 2VR3A 4MX7B 3EOAA 2K45A 3PU7A 1NCUA 3VFVB 4MMZB 4APQA 2ORBH 1S9VB 5K9JL 1PNDA 1TETH 3BP7A 4QEGA 3O6FB 1KEGL 1D5IH 4DUXA 3DXAB 2DQ6A 3GSQA 4LU5H 5I8OL 2ZXWB 4IOIB 3DA0A 3WOVA 1JHLL 5E00A 2VQ1A 4IS6A 2D3JA 1QFWL 5HHVL 1JL8A 3HW7A 5CIPH 1IKFH 1X5IA 3OAYH 1O6SB 4GINA 4UZGA 4BFOA 4C55A 4N6RB 4K3GA 3P54A 1CL7H 3CC5A 5PCYA 2WWKO 3Q06A 1GJIA 1RJLA 3D18B 2XZQH 4YHNB 3KAAA 5DQDL 3LMJL 4BKLB 4I0CC 5GRYA 1SYSB 2YK1H 3W39A 4EKJA 3IMVA 3LKQB 1PY4A 2YBRA 4JRFA 1U8HB 5DVNA 5EV7A 5DJ8A 4PSPA 2CO7B 5D1QB 2I5YL 5F7EL 4G7QB 1II4E 3CUPA 3NTCL 5INCB 2PPDA 1S8DA 2BDNH 2BH0A 3RZCA 1JPSH 1X5XA 5CJOH 1WD9A 2O4EA 4EF3A 1M9WA 1ROCA 3LIZH 3IYLW 3UABA 1YLBB 2UWEE 4BGDA 2NYYD 1JGEA 1R3HA 3BWAB 5EOCH 1AS7A 3QNFA 2AABL 5AZUA 1XX9C 2EDMA 4DZBA 2IJ0C 2PP8A 2AQSA 1J1OL 4JFFE 2PMZA 2NSMA 4M6NL 1JTTA 1OP3H 2E7DA 5GIRB 1FIGL 5ALBH 5LBGA 2FSEA 3VX1A 5FDYA 1OCRB 5DHYA 1MEXL 4L3CA 5C07E 3LKOB 3PYCA 5F89B 4EQ3A 4L4TA 2ZCLH 3JTBA 1D6EA 5MENA 4J23A 2IALA 2OA9A 3CSYA 3WEMA 3V9EA 1ZHBA 4MXWH 4XN1A 2V5SA 2WHVA 5J7CC 1KACB 2P5WE 4HHGA 1SJMA 3A47A 1UH2A 4GYBA 4J3SA 1ORQA 2XWCA 1FGNL 2XN2A 2XPZA 5EDXA 2DWSA 1F3RB 4FE9A 5F7UA 3KW7A 3VD0A 5KSBE 3U46A 3EHBB 4RFEB 3S3SA 1R9FA 3IGUA 3QEHB 3WJMB 2C7FA 1GZQB 2BC4A 3N1PC 3MJ6A 1MCPL 3TBBA 2FNWA 3EH3B 2C1PB 2A73B 5F9WC 1WT5C 4P2QB 3BKML 2RALA 2DOCA 4ZBJA 2BFVH 3ZE1F 3GSNA 4OIAA 5K9KB 1ZEAH 4G6MH 1HL4A 3C6LA 2VZ3A 5C7ZA 1YNKH 1NGXA 3QUXA 2G2RB 1X5ZA 2CRZA 5FO9A 2ZOTA 3POCA 2AAAA 4HSCX 5T1KA 3IBEA 2ZWZA 1BQRA 4S2SA 3WN5C 3BW9B 4IMLB 5HDBF 3ARFD 3VTMA 2GITB 3D7PA 4F7MA 3C5ZB 3FMGH 3NIGF 4L4JA 1GGCL 1OCWH 1AKPA 1HQ4A 3LIUA 2Y1AA 2EYRA 3S3JA 5JHDD 2R56L 4GXFA 1XH1A 3OKMB 4ZFGH 4BH8A 2IDSA 1S7UB 2YGNA 1EQWA 2VN7A 3OKLB 4DN4H 5KVMC 4HJEA 3QJSB 4Y16C 4KJQC 2DM4A 3LN5A 4JZNB 4IJ3C 4YHMH 4HPOH 3C08H 1R46A 3FO2B 4PP2B 2JKRM 1NFKA 4R26L 2JB5H 2PW1B 1G7IA 2VERA 2B77A 4KMQA 2V9TA 1PFOA 1MLCB 3H4FA 4OU3A 1M05A 1JWSA 1W6LA 4WI2A 4Z76B 2OJZH 1KIQB 4HCRL 4NQCA 4Z7UA 3IJ7A 4KK6D 1J5DA 1YEKH 4J4PC 5DURD 3UTPE 4QRRA 3IU3B 1OGTA 1T20A 3CFUA 1R0AH 3Q2CA 3VFRB 4K8RH 5J11C 5J89A 2ZCHL 4RDBA 3DMMC 4YE4L 1IGIL 2APSA 3MXVH 1AFVH 2JH2A 3SDCB 5JIPA 3NIDE 3SGEH 5GSVB 1D9KA 1E7VA 1O9VA 4U7KA 5D1ZA 1AQHA 1TQBC 3INUH 3NJJA 4P57A 4H5SB 3VXUE 5I75B 4E9XA 4WI6A 4C4KO 1BWWA 1GAFL 2ARWA 1BD2D 2IPKA 1JVKA 1SOSA 4H1LH 1GSKA 2J5WA 5F9JA 3V7AE 4L3EA 1OSPL 4WGWB 1Q9OA 2J8UF 4PWHA 2YPKA 4RCAA 1KIUA 2W60B 3LQMA 3SE4A 4MZ3A 1ONQA 3STLB 1NH6A 4G9FD 3X12B 1G4RA 1ZT7B 3V0HA 5E6YA 1SY6L 2FX8H 1RUKL 1TZIA 2G9KA 2EXYC 4HXBL 4HT1L 1WK0A 3K2MC 1V3LA 3GHEH 4NO5B 4B27A 4XNXL 4P9HC 3UZEA 4Z7NF 3E0GA 2OTWB 4PTTB 2OL3A 2W9EL 5C7XL 5FGBA 4QOKB 3T65B 2DJUA 3D4CA 2YEZB 1U8PB 3CFCL 5D8JL 3VFGH 2D7QA 1C9SA 4A2LA 3MRDB 3QIBA 4LCYB 3UJJL 5ICXB 4DGVL 1IBGL 4I3RH 3RPKA 1QEWB 1HSBB 2ICWB 3MREB 3FFCA 3C6SB 1NUGA 1FL3A 3Q13A 3X3GL 5MP6H 5BRZD 3ZT7A 1FDLL 3QWOA 4MJ6B 4PS8A 4PBWD 4OD3H 1S5HA 3K0WA 1CE1L 2Y7MA 1DP0A 1A7RL 3PJSA 3KPPB 3KPOB 2HVJB 3WTVA 1FH5L 1BFOA 1JNNH 3GBMH 3D25A 4GS7C 2CE6A 4ZNEA 5I19H 1JVOA 4PP1D 5HGDB 1O0VA 2F7RA 4WU7B 5F6IB 3X2QB 2HG5A 1S7XA 3L1OL 4NAQA 1IAOB 3T2LA 2EVHA 2P7TB 2TRHA 3QRGL 4NZRL 3RNQB 1INDH 3FK3A 4MSWA 4KY2A 5CKGA 1JDCA 1IMHC 1MZZA 5T3ZD 4EIGB 4R97C 2CK0L 5J56B 1CJYA 1X7SA 3MLSH 1AG0A 2YPVA 3RY6C 5C2BH 1QSZA 4B3VA 4Q6IA 4L0ZA 2L0DA 2J88L 5C0GA 5DS2A 3LKNB 2HP4A 4X6FB 2Y7NA 4LOVA 4NI6A 3BDYL 4RGNE 2DI7A 1Z0MA 4ELDA 1I1FA 4JQVC 1DBMH 1H9VA 5GS1B 1OGAB 1FO0L 3HLAA 2FYVA 2QQNL 2A38A 1XAKA 3NP4A 1RMFH 2E6PA 2BMKA 4TNVF 2DW5A 4UT7H 2O5XH 1KZQA 3KLLA 4FXGC 1EEZA 3AQDA 3A4EA 3Q5TA 1UCTA 3GZOA 1QP1A 1X3DA 2WBWB 1R3IH 5F1IA 3S88H 1LK3L 4DVBA 2HX8A 5AD0B 5IIEA 4YN3A 3WENA 5SV4A 2HH0L 4JKPH 1OCCB 2K6WA 3NRFA 2LE9A 2OFQA 4FQXD 2WWMD 2ZX6A 3QDME 5EZOH 3UBGA 3U4EB 5GJTH 4WV1A 4AUYA 2FJGA 2R59A 4X8CA 2I27N 3QZMA 2AK1L 2FHBA 2JWYA 3FU3A 4BFNA 1CICC 2UVFA 1FZOA 1VB9A 1UYWL 5B3JF 1FC2D 1A6AB 2Y1ZA 3QUMA 4HJ0C 5DD3L 1V55B 3W0WE 4BXVA 3S3DB 2RIKA 1H15A 5SWZA 4G1MB 1OAXL 1FIEA 3W9DA 3NDYE 1KJMA 5GISL 4PGEB 1XH0A 3S97C 4JFYA 2D8KA 5ESQA 2NZIA 3B8YA 3W11C 3FRUB 4GSQA 3FN3A 2J6EL 2YKLL 5E5MB 5B1AB 4BFIB 4N22A 3MV7B 2VDML 1HH6B 5HHMD 1GOGA 4BJLA 5KSVB 1L6ZA 5IKCB 1PU0A 4UDTA 4DO5A 1A1MB 3H2QA 3T5WA 1FLTX 3WELA 4WAFA 4BUQA 4Y9BA 3N1FC 2ADIA 2F1AA 2JTYA 3VJ6B 2AQQA 3P30L 3EXJA 1P84J 2NZ1A 2Y7SA 2PCPA 4JGMA 1AD0B 3U6RB 1EX0A 2J4WH 1AQMA 1JGUL 3IDGA 3MBEB 4HC1A 2X5PA 4X7TA 4A6YH 4BH7B 2DH2A 1IKNA 1WTLA 1CGYA 3M86A 1MW0A 1DZBA 1OEZW 3G6AA 3I3DA 3K5SA 3S34L 4GO9A 1T21B 2MH4A 2B1AL 5FYKE 1X9UA 5EEWA 4NKDB 1OCOB 3HJ0A 1F02I 3DUSA 5HJ3A 1FFPA 3QJHB 4XP9L 5GGVL 4GRWF 3KPTA 4LQFL 3QQDA 4ERSH 5I1GH 2Y5TB 1MRCL 5TFSL 2WGNB 3NVQA 4R90H 3GZKA 4F9PA 1UXSB 1NGYA 2J20A 2K1MA 2MCPH 5GRJH 1IAIL 1T1WB 3EO9L 1M3IA 1Y0LB 1TQUA 2VL5A 3OB0K 4Z78B 4N0CD 2D7TL 3R0MA 4WCYH 1AD9A 4WDIB 3VFOB 3GO1H 3ILDA 1RK0B 4YIQA 3WN6A 2ZXEB 1XV8A 1WLHA 5GRVL 4JDEA 4UZSA 2EIEA 4ZXBB 2N4IA 3T1FB 5FLUA 1IGFL 3MGTA 2B08A 4YHLL 2YJLA 3KDMB 2ZUYA 5FYLE 1IKOP 1TXKA 4DOHE 5D7IF 1TQTA 5D4IA 2UWEA 3PWPA 1I1YA 2ICWI 1SQ2N 3E2HC 2E9IA 3RIAF 3UPAA 4IGBC 5DFWH 1AGEA 2CXKA 3FNKA 1A3RH 2PXYB 4XP4H 5MI0B 4WI9A 3I6GA 3UTQA 1D5RA 3RUGB 4JFFA 4UQDA 1IL1B 4X5QA 2PYFA 1AMYA 3BGAA 4JB9H 1ZTMA 3NA9L 3VQMA 5IG7A 2YD4A 3OG6B 4HCIA 1MQKL 2ZYIA 2XWDA 2R29A 4CDHA 3NH7H 3UMTA 1QRNE 4IEFA 1XCQB 3BPLC 2Y3AA 4GAGH 5C07A 2B59A 1NUFA 1AGFA 5EFIB 1IFHL 2D03L 4RGOL 3MOBL 4IM8A 4ZSOB 4G80B 2VGLM 3I02A 1RZIA 2DDQL 2NNRA 3IFNH 2R1XB 5HD8D 3HEIB 1SOXA 2PCFB 4WU5B 1TLMA 4ZFQA 2GFBA 2P5WA 3VI4B 4APQD 4BHUA 3GS0A 5KZCD 4MJHA 4Y2DA 2YD9A 3MLWL 1T7YA 1FWXA 2V8LA 1AR1B 4CVUA 1N26A 2XQBH 1VEMA 4KRPC 2UY7A 4B5EA 1MLBB 5KSBA 5DEJA 3DX9A 1T0MB 5LCVL 3F05A 3FCTB 4GT0A 4K3EH 1E67A 4PJ9D 4BQ8A 4HIHB 3BMVA 3X14B 1WAAF 2WXMA 3NSCA 3VRJA 3MCG1 5FB8B 4U3HA 4EQ2A 1OZTG 3LRMA 4U1IB 4W9ZA 4DP7X 5I24A 1RKRA 3TFKD 1KTLA 1RK1B 2DWEA 1ZXQA 3LHPL 2EH7H 3C5XA 1WA1X 1SBSH 3SN6N 4QLRA 1WD8A 5EIIB 3DV4B 5JIHA 4TPRH 1YEIH 1UM4H 4FFVD 4Z7QB 1HEJC 4TUOA 1HK6A 1FFNA 3I6KB 1QEXA 4NUGL 2YAFA 5I66B 2B20A 3V6ZA 5A2KH 4KROC 3KR3L 3CFJA 1LEKA 3F00A 4HG4K 1KY7A 5I0VA 5LLIC 3IS0X 1AZUA 1K4CA 5L8LB 3VA6A 1XH3A 1CU4L 3FOMA 2AXHA 4XXWC 4CU6A 4MTMA 2EDFA 4PJXE 1NMCB 1QATA 4LLYA 2OAAA 4KKQA 1Z3GH 2NY2C 5IB4A 2OR9H 3A6CH 3FFDB 3ARGB 3KW8A 5ACMA 4CU8A 3E80A 4H26B 1YN6B 5T3ZH 4LARH 2VXQH 4L4TD 3MO1A 4Z5RA 5MEND 3A4DA 3QYCA 5IHWA 1EHXA 1GZPA 2K70A 3F58L 1JBJA 2GTZA 5BPPA 4I0PD 1CL7I 2EDBA 3GJFA 5IW1A 5GGQL 1SRDA 3UIZA 1DSFL 4NFDA 4L0YA 3V0VA 1B3JA 4MJ2A 1X5MA 4ZO8A 4XNQB 4KJPD 3VXUA 3TIDA 2IANE 3N50A 5C0DB 4NQVB 4MASA 4PJ8C 3LY6A 4OFIA 4ZAKA 4XPFL 1A8ZA 2QHRH 5IMLA 1UZ6F 2NR6C 1NCCH 1S7WA 1CDBA 5GGSY 5F7WC 4NO2B 1DCLA 4URTB 3AMKA 1IM9A 4K94H 3OMAB 4OLYL 2X70A 3HG1B 4FNLH 3C09B 4YSRA 5E23A 1CPUA 4NN7C 4N2HA 4HU8A 2BVQA 3F84A 2Q6WB 3DTDA 4RMRA 3TNNA 2Z0BA 1N5YL 5T1KD 4OZGB 4PJEF 3WKPA 2FWOB 1AGCA 4IDJL 4HQQL 4ZOBA 4MNGB 1BXXA 3LSOA 1BQSA 1N59A 5E4EC 1XH2A 2YLHA 1GS6X 4MQ7A 5F7DB 3IN0A 2ADFL 1BLNA 2W59A 4LEEA 4MNHB 1ZTXL 2XFGB 3HBQA 8PAZA 4Z3TA 2E5EA 4ZOCA 5BZDB 4LP5A 3FSWA 1F00I 3DTXB 5IROA 4I89A 5F2FA 2G5BB 2A4CA 2ZXBA 3G5ZA 4QXUL 2FO4A 4AG4L 2X9YA 1DYZA 4ZDHA 3VB9A 2ATPB 4DW2L 4FADA 4RLDA 2WQUA 4LLVB 1INQB 4YBLB 1IM3D 1RZ8B 2R23B 3IDYC 4MD0A 3KLAA 3B2VL 3C2SA 3LDBB 4UV4H 4Z23A 2D7NA 2I26N 2YXMA 1X5KA 1E43A 3WXVL 5C92A 2NY5C 4APXB 4FFZH 4QRRD 5K9QI 1ASOA 4R4BA 4ZTOH 1Q9LA 5FKPB 5A2BA 2EKSB 1W2KT 3L2MA 2AEIT 2Y69B 3DHUA 3PL6A 2YAMA 1UJ3C 2NY1C 2OSYA 2RH0A 1G7QB 4OVUA 3BRGC 5L9DH 1ZJAA 5CEZL 4ZO7A 1HYSC 2CKBA 3T2NH 2BS8A 1D9KD 1UASA 3KPRB 5AVXB 3TIEA 5B1JC 1NLDH 3DPDA 4Z7OB 3IPBA 2AV7A 2B9BA 5FFOA 1RY7B 1HH9A 2WO3B 3MKGA 3CDFA 3O6ML 3QIUC 4P4RA 5IFHL 4OGYL 1LL1A 4LPWA 5EIIG 2QGEA 5DMYA 5B1KA 3VO0A 5E4IA 4JY4A 4LSPL 5KYUA 1L6PA 3FCSB 4WI0A 3E7JA 3TT1H 4PRHE 4C83B 3QEUA 1G7JB 5FPIA 1HVXA 1LO3H 2PO6B 1PDKA 1OSEA 2VLRD 2GJ6B 1OV8A 2LU4A 1UWGH 3M07A 5DC4B 4OIIH 4MQXC 2RD0A 3F7QA 3VD3A 1JFQL 2P43B 2QADD 4PY8I 4QTHA 2KLSA 3QEQD 4ECNA 4P07A 4QXTB 3GHBH 3PHQA 3QDMA 3UBXA 5I1HL 4JM2C 2NW2A 1DLFH 2XWBB 2DBJA 1WWAX 3HZVA 4JFPB 4PUBH 1IQWL 3QULB 4XPAL 1J8SA 3E3QE 1V5JA 1YUHA 2HFFA 1FG2A 3TCLA 1JK9B 3WFHA 5EPMB 5J9PB 2FJHA 2ARJQ 1DVFA 5HBBA 3CLEH 4KJYA 1GS8A 3KYMB 3W0WA 4A6YB 3JWNC 2O61A 1M1XB 2O5YL 2P24A 3QG6B 3MRLB 2VW6A 5FA4B 4K23L 3S48A 4YDJB 3SGEI 4POZD 1B4JH 3B3IB 4KH2A 3TTYA 2E4FA 1U3NA 5JUEH 1FQ9C 3FB8A 4LSSL 2VJXA 2UZPA 1P7QD 2PW2A 1Y6NR 1GL4B 2NY3B 5AFAA 3FT4A 1ITCA 5CBAA 4V11A 4BV1A 4X80H 3RX7A 2A9ML 3VSVA 3HPLB 3I50H 1ZCRA 3RWIB 5DDHB 5EO1A 3VD4A 1QBMH 3ARFB 3GXPA 4HWEL 2EXWD 5DI8A 1N7MH 5JHDB 5IP4A 5B3SB 2X2UA 4XBMA 4UINH 3FQ2A 3NZHH 5I0WA 2NXYC 4OZHE 2I9LB 4ZS7L 5CHNA 5ALCL 1F90H 1S7QA 3CN2A 3R4RA 5CLXA 4OZIF 3NEOA 1JIBA 3ARYA 3BSZH 4U6VL 2MSPA 1XGPB 3KBPA 3KS0J 4KMLB 5JIQA 2K78A 2FDBP 4HBCL 1HYRC 1A6VL 3E6HB 3RWDB 2NYYC 3HC0B 4DTGL 5DURB 3BN3B 1LO4L 4UB0H 5IB1A 2VLJE 3IGAB 4TQHA 4KRNA 1CLYL 1XTMA 1LK2A 4Z7VE 1LE9B 2OMWA 3HTLX 5HY9A 4NCDA 5JW4Q 4L8DA 4OFPA 4WFGE 6TAAA 3LEYL 3MRBB 1V3KA 3N2JA 1MJ8L 3JTTA 2ZOKB 3EJZC 3VX0A 3SDXB 3P4LA 3ZZQA 5DS8B 3QWRD 4HEPG 3C8KB 5CJBA 3CFBB 2X2JA 3OAUL 5AAMA 4HH9B 2DD8L 1MCHA 2IBGA 4TM9A 5AKTA 2HKAA 3KPLB 3ZW3A 2I60L 2WCSA 2DLTA 3P2BA 3EYQC 2X42A 2R69L 2XWTB 2GEEA 4OUUB 4PREA 3T3PF 2V3FA 1UXLA 3PAUA 3UGEA 4XZ4A 2FD6L 4BQBA 3G08A 2YZ8A 4G9FB 3VGFA 4EZMA 3FS9A 2BY1A 2WQWA 1CN4A 4FYTA 1EUTA 3UYPB 1R3LA 5TE4H 4AM0A 4L2YA 4AGLA 3SKOB 5DZOA 5KBDA 4GMSL 4FYRA 1MVFA 1QRNA 2V7NB 5CEXB 3ZDYF 4HWZA 4RMUA 1NJ9A 1OF2A 2OMXA 3F01A 2X4RA 3WMQA 2XLLA 2AMUA 1W0WA 2HVBA 2FBRA 2ICEC 2OI9C 3QBTB 3E8UH 4LBEA 4A37A 1KBPA 5EUKA 5MEQA 2BVOB 1YJDL 2KHAA 2CRMA 2CO3A 1MFDL 5L0QC 3KXFD 4NO0A 4OJCA 1PZDA 1U2YA 1EZSA 3F7VA 4RFOL 2C9XA 3RNKB 1KJ2H 2OMBA 3FQWB 1TYRA 5F9AC 2HFEB 4JRWA 5JOFB 4JGUA 3HNVL 3VI3F 1ECYA 3C2AH 1D5MB 4MB4A 4ZI8A 1TO4A 2X05A 2ZG2A 4ZPTA 3TFBA 5J13C 1JZFA 4QXWA 2WY3B 1JXDA 3H0TB 1B2WH 1Q1JH 1SYVA 2H32B 1F8TL 4JFWA 2MKWA 1SEQH 3CHQA 4ZMLA 3HOGA 3OGOE 3N43B 4NHUA 4M8QA 1TJHL 4M7KL 4Q2ZB 3NAAL 2CHZA 4YDVA 3CQFA 1GYCA 3VWKD 4Y5VA 4FFWD 1JUFB 4FG4A 2B15A 4AYGA 3AY4A 3RFZA 1MKFA 5KSAB 1TENA 3ZKMD 4PV8B 2GK0B 3IGLA 3WY4A 2A6IA 2ZPKL 1YMHB 4JFOB 1M7XA 2QVIA 4YHZL 1Z7JA 2QV4A 4LFHD 1TSHA 3GMRA 3GBDA 5DFAA 2BIHA 1EDYA 1U42A 5LGHH 3MNWB 3KJ6L 5F3HA 4LB8A 5CJXC 1MWAL 3UXFA 1U8CA 1I8KB 4JFFD 4L0PB 1NC2A 3J7HA 2N0MA 4NKMB 4PJXA 3CX2A 4ETYA 3LQZA 3MLYL 1CFVH 3CFNA 1HI6A 2XOTA 3ARBA 4ZNCD 1JGIA 4QKTA 2AJZB 1ZIBA 1GW0A 4LSTL 5FFGA 2QLYA 2VDPL 3DSFL 4FQXB 5ITFA 4P5MB 3SOBL 3KYOB 1MHHA 1HCZA 1BX2A 4Y2DD 3HBZA 3SCMA 5FA3A 3IAQA 4M3HA 4N0YL 3BAKA 3NIFE 5TQ2H 1I1AD 4BQ9A 4UIMB 4KUCD 2H6UA 3LPPA 1QI3A 1EO8H 2EYSA 2XWRA 5DQJB 2IANA 3CAFA 3WL9A 2I7SA 2MNJB 4NP9A 5AYUL 4EN3D 5E1IA 1HHJB 3KNBB 3M1BA 3UZQB 5AENA 1C5BL 1NC4A 2DKMA 2I07A 5HHMB 3LH9A 3V4PL 2VABB 5AUMA 3LH2H 4YXLH 4X5WB 3EFFB 1GW6A 1MNUH 1MXDA 4NGHL 3ZU8A 5T5FL 4O51A 2WOBA 4P4KD 3NCFB 1KF9B 3D3VB 1FVCB 4JJHA 4UT6A 2YMXH 1NDMA 3HJEA 4H8PA 5CR1A 2GVYA 1G6RL 3IKCB 3DYMA 2J25A 2YOAA 4JPVH 1O7DC 4M4PA 1FYTE 4NRYA 2G0LA 3QP3A 2X2YA 1CF8H 5HYJD 3ARVA 1A1OB 4QHPA 5JPNB 2X7LA 5K9OB 5EZJB 1YMME 1M6OA 3L3KB 4RMBA 5A3IC 1EGJH 1K6QH 4PEEA 4R7NB 3OD3A 1LDSA 1RUQH 2XN9D 4HX1A 4N85A 1JDAA 1OE3A 3MC0A 2GJRA 3KWWA 3V4UH 5C0BE 1FZMB 4UDUA 1A3LL 4B7IA 1W9XA 5ES4B 3MRPB 5D7KE 4WKZA 3B5GA 3A6BL 2YRZA 1AXSA 4XMZA 2X4NA 5T1MA 1I7RA 1LP9E 5EC2B 3SQBA 1HNGA 1DBKH 4QXGH 3H42H 4W93A 1BXUA 5J12C 4Y4FD 3O4OC 4LNRB 3HE7A 3MXWL 2DBLH 4XB7A 1XGQB 3WNLA 1ZVNA 2HVKA 2P8PB 3AAZA 5IBLD 1CGXA 3MFFA 4WWKB 3HC2A 5IV2B 5AZEL 5EH1A 5I6XB 1BAFL 5HYSB 4P59H 2V2WA 2WLMA 1B0GB 2KS0A 1HHIB 3FO0L 3ZYZA 5EDSA 1ZOXA 1M7IB 4KKPA 3VXUD 2X3CA 2WWMC 4L8SB 2QSCL 4XMTA 2IH1B 5E70A 2HJLB 4HUXA 4ZAKD 4U1HB 5IGXL 1R5IB 1YCSA 5JW4N 3Q43A 4U3SA 1BOGA 5CD5C 5JW3L 2XACC 3SBWA 4PJAE 2IGFH 4X2UA 3L4CA 1JVLA 5KJRH 5F0MB 3RYMA 1E5AA 3FSAA 3QWQB 1BG9A 4PRHA 1TZGL 2UXGA 3EYVA 3ZSTA 2N1KA 2P5EA 3ECBA 4GAJH 3W5MA 5JPMC 4N20A 5G55A 4JFSA 2DYPD 3QPXL 5DHMC 3SJVB 1HZKA 4Q9QL 3H6JA 3IVKA 1XDTT 4X6CB 2GSMB 4PGDB 5HVHB 1T04A 4GKSA 1WP6A 3VGAB 3LRLA 2VISA 3ATBA 3B9VA 3B7UX 2V33A 1KXTA 4NI3A 4P5KA 5KZCB 2QZ5A 1XF2B 2VMFA 3CQPA 2VXVL 5FHBL 3HZMA 2QBWA 3IDXL 2BNUB 1DO5A 3V0EA 5D72H 1RXLA 1NBVL 2VWEC 5CGYD 5L7XL 4PJ9B 3PUUA 5BO1L 1A2YA 5HHQB 4X6BB 3IDNA 1CDUA 4KITB 1JP5A 1UWXK 4HJGB 5LNGA 2XVKA 3ZT5A 1SN0A 3LKSA 3MNZA 2CNYA 5B22A 2KZ1B 3AXIA 3FQ4A 4UOJA 5I0YA 4FMFA 3RPIB 3PL6D 1I9IH 3EBAA 4XPGH 2AXGA 3MBXH 5J1TC 1ILSA 2D3NA 1G7MB 2D2OA 3SKJL 2CO1A 1KCUL 3DSNB 3WV0A 2VZSA 4YH6A 4N2MA 5IW6A 1XF5B 3QHFL 4DIXA 4AVJA 3FUJA 3I75A 4FHBD 1RH8A 3S7GA 4U2YA 3QUZB 1DBBH 1FZKA 2Y7LA 3EGSB 3D50A 3HR5A 4PYGA 3O41B 5DTFA 3OLIA 1MFNA 4G42B 2AK4B 1KFAH 4ORGB 1QTYT 3CFIC 3WEOA 4RGND 2DM3A 1YEFH 4OZHA 3R7QA 4K3JH 4PI2A 4PJFB 5FDWB 2OX5A 2YD6A 4I77L 4XX1E 4YE0A 3H9HA 3KCPB 3IT8D 4GKOA 5D9SB 2DEYX 4WNQA 5D4QA 4D8PA 3TURA 1SVZA 2HN7B 3QUHA 1MWOA 3F62A 5FOJA 4YBQD 3U2SA 3G5VB 5TDOA 1KJ3L 4XPHH 2EYTB 3O6KH 1QHOA 1LNUB 2WUBL 3MNVB 3QDMD 1J9RA 4NRZB 2VLJA 2RA1A 4PWJA 1B4TA 2CHNA 2GKIA 2VDLL 4M4RB 3WIHA 4I0PB 3L9BA 1BVLB 1UWYA 5DC9B 4Z7VA 1CFQA 4TRPH 4YC2C 1H0DB 5BZZA 2E3VA 1QFUL 1MHEB 2WP3T 2AITA 3QFDB 2JIXD 5HDBE 3C60A 4YDZA 5AVRB 2GBUA 4ZUWA 3IMBA 1R3KB 1N6VA 3SKNA 3MLXL 2FT6A 3GMQA 4JL1A 1MUJB 2EIZA 3H9SE 4Q9BA 4XNYL 1LO2L 5GRXG 4U6XA 4FJ6A 3O2VL 5HD8C 5H94A 4JANB 3R7RA 3BGFB 4M5YH 4P48A 5FGRA 4APQC 4AYEC 1KJ2B 6CGTA 3EZ8A 5HYSG 5D6DA 4PRPE 2XIDA 4G7VH 4WI7A 1BIIB 2IWFA 5TK2A 3O6LH 4OLWH 4GI9A 1UOKA 3LPGA 4MFHA 4PJCB 3EYFB 2WVSA 2L7JA 2BSCA 3CZLA 3F7YA 5EU3B 2YUVA 2FAUA 3LN9A 3K71A 2WYTA 4TSBL 3FPYA 5DMJB 3KGRA 5E5RB 4UV7H 1F4YL 3ARZA 3GSUA 5I1JH 2BS9A 2CWRA 3DVGA 4JEGB 1HXYA 5ISZB 3AREB 1FNLA 4DQOL 2XA8L 2G2PA 4XBEH 5FUCE 4H4NA 4JZOB 3MJ9H 1QPXA 1JZJA 2Z1PA 2WVUA 4FFVC 1N64L 2F53D 2JTDA 5FYKD 4XB8A 4LVNC 4XC3L 3ABMB 1JZ2A 2IH8A 4GUPB 1JNHA 1MFAH 1IM3B 4XN8A 3RZCC 5CBEA 1RVFH 2ZX8A 1X5HA 4DETA 3MCYA 4OF7A 2J8UE 4E5XB 3FTUA 3FO1A 5FECA 2VXUH 1QNIA 3ZE0B 2HX7A 2DTML 1JRHL 3HRZA 3MNDA 1NCDL 2H45A 4P23A 3MODH 2Y5QA 1FVEA 1GKOA 2MOQA 2AJVL 5EUOE 3LS4L 2EDTA 2IVFC 2MHAB 2NY7L 1UZ8B 3D09A 4FULA 1MWAA 1R5WA 1NGZA 2WLHA 1YHPA 5I76A 2JJWA 1H6UA 1BVZA 5CAYB 5B3NA 2E9GA 4AIEA 4HMDA 3WUWA 3S8WA 1BGXL 4WHDA 4N0FA 1D5ZA 3A0OA 1KG0A 2FX9H 3IK2A 3QI9B 3SDDB 2AI0L 4KPHL 2VN6A 2EQDA 4J6RL 4GFXA 1SDAB 3F6LA 2WXGA 3K2IA 3MA9L 1TVHB 2DKUA 4CU7A 5KW9L 3GRBA 4HD5A 4KJPC 4XMLL 1FH2A 1OK8A 4HOXA 2VLRB 3IJSA 3NPSB 3ZHFA 1ZLUH 2P42B 1QRND 1UQSB 1OW0A 4KKLD 2QADB 2CM5A 5EOTA 3ZJAA 4UM8B 3IM1A 3QEQB 3QA3A 4QHMB 5FUZL 2P52A 4KRMB 1XGYL 1YNLH 4IOSA 5H35B 5DO8A 1F56A 5B8CB 1KIRB 3WE6A 3PIQB 3TA3A 5KVEE 2VRAA 3C6LC 2B14A 4YSOA 4Y4KD 2SEBA 1OLLA 4ZPVB 3OZ9L 1NM4A 1GC1L 5MEOA 3QUXC 4CVWA 4JM2F 1VEPA 1G5AA 4NO0D 5DK0B 1HOCA 5ACZA 1EZLA 1JXGA 1RFDL 4ILDA 4X5XB 4LGRB 2NQDA 5AVWB 3PWLA 3BZ5A 5T5FA 1F6AB 2COQA 3KPNA 1C16B 4QKXB 4WK2B 4HPYL 1NLBH 2EIDA 2XTJD 4DKAA 4URKA 2IMNA 4I2XB 1G6RA 2X4OA 5IVXE 1P7QB 3WDHA 5IQ7L 1RZGB 1URZA 1S7TB 4CDGC 4HUWA 4LPUA 4J8RA 4KNQA 1RZFH 4ES9A 2BY2A 1HWHB 4AEIH 3MLVH 1UCBH 2UV3A 4OCWH 3FTGB 3U4BL 8FABB 4ACPA 1HX0A 1OP4A 1VRSA 2E56A 4WFFE 4F20A 1DJYA 1P1VA 1VAHA 3P3SA 4H8VA 4ZJ9A 3V8OA 3VXRE 3MRCA 5IESL 4MWFA 3P11H 4XP1L 3ZHKA 1N0XL 2V2TB 4NWUH 3V95A 2PPAA 1FYTA 1DQDH 5LAXA 2GK2A 3SPHA 3MU3A 3OJMB 3VFMB 1FSKC 3K46A 1V27A 2MMXA 1A7PL 4ZUVA 4YNYA 3KVDD 2QSTA 1YMMA 1RZJH 1D9KC 1S4IA 5D1ZC 2QZQA 2Q8AL 1EBPA 3QZWG 3LEXB 5BQ7B 4JRYB 4NN5B 4WSJA 5I0XA 4L5FL 3RGVA 1I1RA 5DRZB 3TBVB 1Q9KB 5B39B 4G5AA 1ZT1B 4XMKL 5AW9B 5C0BA 3T4AB 2X2IA 4KHTH 4XO5A 1MFUA 5IEKB 4OFVA 3QARA 4G1EA 4HEMA 1U4EA 4BXSV 3TEZA 1LP9A 4J3OC 3L3OB 3BOVA 3TPKA 4S1QL 5G5DA 1KBGL 1A9VA 1MDAA 3O0RH 2DQTH 3ULUD 3SE4C 4MXQC 2OR7A 1JPGB 4PBVC 43CAA 4AXWB 5LGYA 1T5XB 3MRIA 1GYVA 2R2EB 3O11B 2R27A 2AEQL 4E5XG 2I24N 1BQUA 5KUMA 2F6AA 4WHTB 3UZEC 1IBYA 1YY9C 3JQOB 2YN5A 4MAUL 1P6FA 4QTIL 4XO9A 5FGBC 2H8PB 3QCTL 3MV9E 4EDXB 3MKKA 1ZGLB 1BOYA 5CILH 1EANA 2GUOA 3QIBC 2NTFA 4WEMB 1JCKA 2OMTB 3CCHB 5LBSH 4F91B 1U33A 3QJOA 2VN5A 1WFUA 4PS3A 4LLDB 4PJAA 2XBZA 1UTDA 4E42B 3PXLA 2W65A 4WEBH 4AQEB 1HT6A 5F96H 3NCCB 4FFYH 1I8UA 4POZC 5TJWK 4KKRA 2CGZA 1OOWA 3ENEA 4QHLB 5F9OH 1DQLL 4FABL 1GTFA 4MA7L 1DEEA 4NJAH 3Q9QA 4P9MH 1IE5A 3QYMA 4G8EA 4KQ0A 4K71C 2DQCH 2GT9A 3I9IA 4JJ5B 2WXRA 1HJBC 2LU7A 1DUZB 1TKWB 1UWXH 1YEJL 3FQRA 3KXFB 4PJ5B 1MY5A 4MCYA 4FI7A 3FUFA 2A4ZA 5DT1L 1D5BB 3QDAA 1OPGL 2W92A 3GBNL 3WIFB 3QCVH 2IAMA 3G5WA 4Q6IC 1W72A 1WZMA 3OKOB 2PR9A 4M6ML 1F0LA 2EXWC 4NSKA 2ERJC 4AQ1B 2Q7YB 1LM8V 3LX9A 1RHFA 2NLJB 4Z0XA 4NFCA 3WE1A 3SPVA 1FL5B 4C4UA 2HLEB 1QMUA 4PJGF 1AZVA 35C8H 1MJUL 3OWRA 2K0RA 2FHCA 2CA4A 3PXJA 1VFAA 5B7FA 3ASOB 2ZKMX 5JDSA 4GW4B 4W9LC 2ZOWA 1BJ1J 3Q44A 1MAMH 4QRQA 3VWKB 3BFWA 4PQXA 4YHYB 1NPUA 1INEL 4F24A 3VXSE 2DQDL 1U21A 4OLVH 5FYKH 5E8PA 4WV1C 4FQQA 4YR6B 2VR6A 3V9FA 2WLLB 5GZND 4R3SA 3HHSB 4NQTA 5E95B 5F70A 3QPKA 12E8H 1HHGB 2EC9T 3LCYA 2C3WA 2NDGA 1BEYL 1DFBL 4LLMA 3TYFA 1GCYA 2VDRL 3U36B 3U7WL 4PRHD 3DYPA 4M5ZH 3RTLA 5GGTA 3KZ8A 2KUTA 2R15A 5F6HJ 2V5RA 1MFCH 3JYBA 5HYFA 3BLKA 4GG6F 1NFDF 2XPGB 2XZZA 3LD8B 4GQRA 4A7QA 3F12B 4JHWL 1AAJA 4FGMA 4F7EB 1UOLA 4LSQL 1KIPA 1U3HA 3NZ8A 5KBNC 1WITA 5AOMA 4M7ZC 2QVKA 5D71H 4G11A 1I8AA 1SGKA 3R8BB 3RB5A 1I1AB 1T0PB 1LMKA 3GMMA 4WFED 4HKJB 1NCOA 3MOAH 1AQKH 1FL6A 2J3SA 2EVFA 1I8IA 4PBDA 1GSMA 4NBYB 3H9SA 4WW2B 1RCYA 2KLTA 3TJEH 2VSKB 4EN3B 1IKNC 5DJZB 3ROOB 2VDNB 4F7PA 3V4VH 1V7ML 1OCZB 3CIQA 3O45A 4UTAH 2F7PA 4P5TB 4PRPA 3ZO9A 5C0FB 3PNWA 3TASA 3VFSB 3IJYA 3GMPA 4P4KB 2YGOA 2CA3A 2WJ5A 2WGXA 1R75A 1DL7H 1E30A 4F9PC 2PYED 3QISA 4W4OA 4UNTA 5IM7B 4JKMA 5FM5M 2X3BA 3WS3B 4F2MB 1FVDA 2QR0B 3SDAD 3T8XB 5GZOA 3UGXA 3H3PH 4MAYD 4GUOA 1ADQL 3QXWA 5ESAB 5HYJB 1B9KA 3KYNB 4RVBA 4IBSA 2AAVA 1ZHLB 3BH8B 3D5OF 1BQHB 4Y9EA 1A7NH 2PR4L 4MYWB 5TPWL 2XN9B 3BPLB 4AK2A 5KWYC 4QRTB 1UZ6E 1PIGA 4P2OD 1EEQA 2K4WA 5K1NA 5AVVB 4JE0A 1VACA 2J8UA 4CW1B 4HGWB 1MIEL 4WUUE 3U7YH 4BSVA 2NCEA 4ABWA 4K3DH 2C7UB 2GIMA 2J1KA 4UUJB 4HF5L 3VFNA 1ZLWK 2FL5A 1GGBL 4PCYA 3HPJA 4TF4A 5BS0E 1UM6L 1DLHB 2A77H 3GSWB 4GPVA 4Y4FB 5AOLA 2CCWA 4PJEE 4AKPA 4DFIA 1CFNB 1T7XA 5JO5B 1PEWA 4I5BB 1K4DB 2GSIA 1QUNB 1R24A 5EUOA 4ZW7A 4AJWA 4PMFA 3FUEA 3WO3B 1RJYB 2YRBA 5DYOB 3TO4A 1Q4NX 3VXOB 2C9PA 2RB8A 4FA8A 4MLIA 3S5YA 4XBPA 4YK4B 4X0KA 3WO4C 2OZNA 3GPEA 5ECGA 3DJ9A 3MTXA 1OARH 3GKWH 4JW3A 3ZL4H 5I23A 1CFBA 4Y2DC 4R96A 2CGRH 2ZUUA 4WIQA 1ZVYA 4KZDH 2FJFA 2C9RA 2NMSA 4N68A 4A66A 1H5BB 1G9MH 1R3JB 1TU2A 2QSQA 3PV6B 5E9AA 3HKFA 4BZ1L 4M7LH 3OGCB 1T5WB 4A7SA 2ESVA 3N0AA 4LSUL 3ULUH 2FSDA 1T66C 2DYPB 1AXIB 1JTOA 1U92A 2GBVA 3DHPA 4JMNA 1YQVL 4LFHG 2AV1B 1IGCL 3QORB 2MQGA 5DWUH 1BM3L 3O3AA 2IH3A 3MCLH 1UATA 3L48A 5C0IA 2CH8A 3R0NA 2O30A 4R4FL 1Z5LA 1R47A 1JXJA 1G7HA 3LXBA 1M42A 1EHLH 1C12B 4XGZA 3L2LA 5IJDC 5AW7B 4F57L 4XBGB 3DK2A 1SXCA 5E99H 1TQCC 3BESR 4A2HA 4JO4L 4N1CA 2NY2B 2OSLB 4GP5B 3WY3A 1G9EA 1PSKL 3HHRB 1CBVL 4G8IA 3NJXA 2DQGH 4NQSB 5JXEA 5AWNH 1CVRA 5CXPA 5DZVA 4U1SA 2UZXB 3VWJB 3ES6B 3PDOA 4HWNA 1P1ZA 3AVEA 4B0MM 4W9EC 3ZKSD 4U4BA 1I3VA 1J5IA 4M1GL 1SJEA 4QF1A 1OAJA 2ZUQC 4PJIB 4E9RA 1YEHL 4MD5A 3FZUC 1JE6A 1QW8A 3VU2A 5KVDE 1FV1A 2KKQA 4ADIA 3VFWA 4ENED 5EZLB 1XZWA 4NERA 2WCPA 5DUMH 4RDQG 3UG3A 1UWEH 3VXRA 3CX5K 3WEXB 4QCIA 4CMMA 1J7VR 1G9NH 3S96B 1TF4A 4FLOA 5CD3A 4DERA 3IKKA 4LAQL 4QJ4B 3IE4A 3IMUA 2Z8WC 4N8CL 5C0JB 4DO6A 3GRWL 1JN6B 5IBLC 1YEWA 1P69B 4ODTH 3ME0A 1N0LB 2E7HA 5D7LE 5TD4A 2ZT9C 5CGTA 1IC7L 5ACLA 2WNGA 4WO4A 3IDIA 4A38A 3BUYB 1GJUA 4P3CH 1F4AA 4ZAKC 2A6KA 3VG9C 2M26A 2DQEH 3H9ZA 1E9QA 2J8HA 1PMYA 4HZAA 3NRQA 5CP7A 3NCEB 1BQHG 4HMCA 5KJ4A 4F2EA 3DXAE 1I9EA 1WICA 4NNYA 3L4YA 4I9WE 3MV11 1N18A 3CVHL 3WG7B 2I9TB 1DTUA 2Y36H 4Z7IA 3UROR 5T1LB 4MBRA 3VD5A 4I1NB 4Y1AD 1RZ7L 2JIXB 4XO8A 1IGML 4KY1L 5K59E 2F1BA 2OXHB 2Z64C 4U1GB 4CN6A 2AHIA 4YQXL 2B2XL 3CXFA 2OMYB 4QHNB 1J0HA 3MV9A 1IQDB 3K6SA 4KAQH 3BVWA 5I0DA 3WTWA 1XGUB 5C0CD 2LQRA 5IROC 1BVKA 4TUUA 3ZQXA 2NTSP 4ZFZB 4L1HA 1IGYB 1GS7A 2ZD0A 3AWEA 3CDGB 3OKKB 3UBFA 2CO6A 4N2IA 2X12A 3ILPB 4J12A 4S1SL 4XN2A 4WTZA 5AB2A 5DSCA 4OGXL 5JW5A 1T7VA 5D1QE 4XVTL 1HINL 5DEFB 1ET7A 1F1GA 2BSEA 3RHWK 3RVTC 5JHLH 4HFWB 3FB5A 4LESA 2CQVA 2WXKA 1TTRA 3BIBX 3KS0H 5ECJE 4B9IA 4K7FA 2F54D 3FT1A 2DQJL 2UZYB 3TO2B 3BAEL 4NBZB 4OBSA 3GBLA 2DJMA 3FB7B 4PVNA 3REWB 3GC3A 1U8MB 4JFXA 3D0VB 2CLVB 5C1MB 3FQNA 2BSDA 4KDVA 1E5UI 3PL6C 5E94B 4JQIL 4HSQA 4N9GB 5KVFE 3NABL 5SX5K 4GXVH 1P4UA 5EHFA 3SGKA 1IZKA 1JV5B 1AC0A 4DK5A 4ATWA 4X4YA 2XNAB 1TJGH 4PCTA 2WV3A 1MRDL 2EIKB 3OL2A 2F53B 4FFTA 3L4TA 4MJ4A 1A21A 2Q2LA 3X1FA 5IHZB 4RX4A 1BCIA 5D6CA 1NPJA 4HHAA 4JO2H 1NQBA 32C2B 3OR6A 2F18A 2Q2EB 3C75A 4ZQKB 1Z1WA 4L48A 5C0BD 4BRJA 4YGVB 3Q2LA 5IOKA 2Z8VC 2WQSA 2X4PB 4F80A 2QPFA 1KGYE 3OSKA 1ORSA 3CPLB 4RGNC 4LGSB 2YA1A 2HT4D 1CFTB 2H6PB 1N4XL 4WY7H 4F8QA 5IREA 1IVTA 3US9A 5E7FA 2WINA 1U93B 5IMKA 4X98B 1BZEA 3ESMA 2UYLB 4LT7A 2OSWA 5IMMA 2EO1A 3KG5A 1QX1A 3HI5L 4PJFF 2O6EA 3VVWA 4AE0A 4FQJL 4GRMB 1MJJB 4P2QE 3WIIL 4TLUA 5EN2B 4EOWH 3BQVA 4PGBB 3VXSA 4LPXA 1AE6H 5D2NB 1U8NB 2QKIB 5D1XB 1HKLL 2LOEA 3LS5L 3QQXA 2EVJA 3SE3A 1VADB 3CVIL 4WZ9A 3V0WH 5KANG 4MA3B 4X4XA 1U91B 2B4CH 1P7BA 2XFXB 4LP8A 5AW0B 4P9HL 4JDZB 2FIKB 1VFBA 2GHZA 3VMOA 2DQHH 1O5PA 3TN0A 2X0WA 1WAAA 4R5TA 4GP4B 1ASPA 3V4VB 3CVDA 3ROLB 3O3DA 5SWSB 4M6OL 4Y4HD 1KB3A 1WQVT 2Y7QA 4XNDA 4QYAA 1NMAH 4OLUH 3RA7L 3H56A 5H37G 3FUKA 1JGVH 3AS3A 2VLLB 1VLXA 4ZFOB 1RP9A 4OCSH 4Y4KB 4G59C 4NN6B 4EZLA 5KANI 2YR3A 3D9AL 2XTLA 2BIIA 1QO3B 5BW7A 1BPVA 2NY6D 4DGIH 2BZDA 5IOPB 1BXVA 3ECWA 1OAYL 3WFZA 2E27H 4KMTL 4OQTL 4A7GA 1WG3A 5L4FA 1J48A 3B1UA 4I48A 1E27B 1RIHH 2JB6B 4YHOL 1FHGA 1VF5C 2BX5A 2DQFA 2WQRA 5J0BA 3OLDA 2XTJB 5AVZB 1LD9B 4NZ8A 3PWUA 4HIXL 3L5WA 4K7PH 5SX4H 2ZZUT 3K5RA 1MDTA 3V0DA 3BH4A 5D7JA 1E50A 2OMVA 2EDLA 4L2LA 3PREA 3F65A 4C4BA 4OY9A 5TQ0L 2A6DB 4UT9L 2LGNA 2AKRA 4OJEH 3IF1B 5FO7A 3QNXA 5ANHA 1USZA 5KBMA 2P8MA 4JN2A 1NEPA 4OZ4B 4JHAL 4EI6B 2V0AA 1UD6A 1FNEB 3ETTA 3GIVA 3GEFA 2N3JA 4WTXA 2WLIA 1HEZA 4UIKL 4OIBA 3ZRFC 4RA3A 1E4XH 2MKLC 3BH9B 3CFKA 3RI5F 3JWDC 2WKOA 5D4JA 4UOZA 2XG4A 3SPJA 1OSZB 1WWWX 2Q3XA 4LK4A 5CJ8A 5I1DA 3TOPA 1A5FL 3DETD 4BCZA 1OT4A 2JE8A 2VZOA 4Y9GA 3WNNA 2XWEA 4ALAH 2UVEA 4AMKH 4QOKE 4ZFFA 4PW9A 1OAKH 5AAMC 1KGCE 5AOIA 4RZCB 2DWDB 1TFPA 5IMOB 1NAMH 2RBLA 3OVUB 4WUUA 3CSGA 4HFUL 4QGTA 5T33L 4RBPH 1A6UL 4YMPA 3LQAH 4K2UL 1F4HA 1HL8A 3IU4L 1S7VA 4N2OA 3GI8L 4FKEA 1KNOB 3OJVC 3RL2B 1CFSB 4MKMA 4CMHC 4FQ1H 1RSFA 5DZ9A 2PTVA 5BS0A 3BHBA 2DWXA 1Z9LA 3B2DC 2Z8RA 4PJEA 2VXSL 3VNYA 1KXVA 4FCHA 1NDGB 2JMRA 4TVSa 3BKCH 1N68A 3TPUB 3QJFA 3ZN6A 3FU7A 7CGTA 1AZBA 3MACL 4KKLC 1B0WA 2ZKYA 1P0SE 2F7QA 5E2JA 2OXGA 4BZ1A 2CLRA 2R0LL 3Q2WA 5EO9A 3H9SD 1YECH 4P46A 1UC6A 5C0EB 2A1WH 5ADOH 3DO7A 1IFRA 3LEVL 4HLJA 5IEHA 1AJ7H 1CXEA 4DPCX 3EOTL 4XNBA 2DRUA 2NY4D 3CD4A 3N3EA 4BSWA 3WJJA 1N10A 4PM1A 3G9VA 4PRPD 3EADA 1KN4L 4JVWA 1L3WA 3QZLA 2J5LC 5HHNB 4MBOA 3CE1A 5JOPE 2V9QA 4XRCA 4U1JB 4CADA 3L54A 3T0AA 1KT2B 2X2HA 3D8MA 3ULSB 1TOXA 1OOAA 5LG1A 1Z9PA 5EF0A 4XPTL 4JY5H 5LQBH 1OGAE 2X9XA 5GZOD 1F97A 1MJ7H 2V7HA 3RU8H 4ATTA 4ENZA 4H8WH 4O58L 5EBMB 1Q0YH 4G8FB 4JDVA 4NRXB 2H1PL 2LVCA 1EERB 4AM0Q 2OTUB 1K3IA 5EU7E 1NGQL 2VYRE 3N9GL 5FCUL 3QRBA 3RFZC 3AY4C 5T3XL 4PJ6A 4DEPB 1BPLB 5FGCB 2OCFD 4V1DB 1PNCA 4TUJB 3VFTB 4G6KL 5GHWH 3UZVA 1W0VA 4HULB 3BUPA 1PPIA 3QEGH 2Z31D 3HN5A 1SPDA 1YYLH 1ZANL 2YFNA 1B6DA 1ZV2A 4JFZL 4R8WL 3IBOA 4AZ8B 1X9LA 3GSVB 4XZUA 4YXKL 4BEIA 5AKVA 4YDKH 1D7CA 5EU5A 4U31A 1M1SA 3MFGB 2B5IB 3D52A 4O02A 2D0GA 3TO4D 3ARBC 3FSOA 4MVBD 1TEYA 5GGUB 3LPFA 1O7SA 5AW5B 3P3UA 3MV7E 4XAWL 3DPBB 1DBJL 1WYJA 3QQ4A 3CMOL 3DVIA 4EDWL 4M03A 5T5NG 1I7TB 3CLFL 4D9LL 1KTJA 4XC1L 4TSAL 5IF0B 5I9QB 4GBXA 3S37X 3WD5L 5FOBA 1GYUA 4KTYA 3SCMC 5DVOA 1EH9A 4P0DA 3IXTA 2LLGA 1D5IL 3QNYB 4ODWA 2DMGA 5D7LA 4Y19D 3HE6B 4JKKA 4G71B 4N0UB 5CZRA 1HZHL 5IJCC 1K2DB 1T1XA 3IFOB 3V0FA 1OL0A 3T0DA 1TDQA 4YHKH 4YX2H 4MX7A 3Q1SH 4D0CB 1WTGT 2VC2H 1CLOH 2FX7H 3VFVA 4MMZA 3TZVB 1S9VA 3VQLA 2XVLA 5F93C 2J55A 3O6FA 4XOAA 3WKML 5DD5H 2XZQL 3DXAA 1DVSA 3NEEA 1SHWA 4IOIA 3ILQC 1KJVB 3KJ4C 1I3GL 2YFOA 2WPGA 2ZIDA 2CMRH 1O6SA 4OQ1A 2WZ5A 2QL1A 3D08A 4GMTH 4NKIL 5L6YL 3N85L 5CCGE 2A0LD 4N6RA 4XCEB 3X11B 3D18A 4YHNA 1KGIA 4TMPA 2IAAC 2WYZA 3SEPA 4BKLA 3R18A 3QFGA 4EJ1C 2F58L 3LKQA 2MCG1 1U8HA 3B7RL 4AGNA 5F7AA 1DBAH 3CWGA 1AGDB 3UJIH 4JQIA 4OLZL 3SGJC 4DP8X 2CO7A 5D1QA 4KFZC 4PBXA 5INCA 1P7HL 2C4FT 1KCBA 5C2UB 4X7SL 4D9QE 4RMTA 1SXZA 3LNDA 1S46A 4NC2B 4WFFD 3CBRA 2PYEB 3CFMA 4KO9A 4NQQA 4UILL 3BWAA 1ID5I 3V8CA 2AS5M 1ZKAA 2KI6A 3SDAB 4JFEB 1BZQK 4MAYB 3RUGE 4AL8H 5AAWA 3BP5B 1MFBH 3HE7C 4KUZL 3QUGA 4MXWL 3HI1B 4UU9B 4E9VA 1P2CB 3PJLA 1M71B 3O3UN 4NXKA 2G3XA 5GIRA 4I18B 1IRAY 1C5CL 4FG0A 4W1TA 4ZUSB 2JCCB 4CJ0A 5JYMA 1TCRB 4WSGA 2RFXB 3D34A 3E38A 3LKOA 5F89A 2APFA 2FJUB 4I4WB 4RSVA 4ZSOE 2NX5D 4OF3A 4P2OB 2IFFH 3WXWH 3MI6A 3MRQA 1ADWA 2E59A 3GEWB 3VI4E 3G04B 2HTKD 1BAGA 2XVBA 4OF8A 5EOCJ 3ZUNC 1JV2B 5I74B 4N2LA 3SBWC 4XX5A 1CGTA 2UWEF 1AHKA 1SFDA 4HSAC 3EG9B 2W0PA 4KDWA 5DGQA 4RFEA 3JV0A 2MOGA 4NDMB 3WJMA 4AQZA 1GZQA 4QRBA 4ZS6D 4FL4C 2C1PA 4NC1E 5HHXL 2A73A 1TR7A 1PF3A 4JX0A 2F5BH 1A8JH 4P2QA 1XGTB 3L1EA 1GY1A 3NK4A 3VXNB 4B53A 5CZVH 4S1DD 3MV9D 4BFKA 5K9KA 3QNZB 4Y5XB 1Y07A 4LDCA 3OLEA 1OAZL 2HKFL 2A99A 2G2RA 3E3QC 1NCWH 4DN4L 1A6PA 3BQUA 4Z7QE 4R84A 3S36H 3U82B 2Z35B 3C08L 4YSTA 2CZNA 4IMLA 2NYKA 2GITA 2JB5L 5E08L 3C5ZA 4KUCF 1K85A 1WAPA 3KEHA 4QO1B 5KSBF 3ETBJ 5AW1B 1EHNA 5KEZA 3OKMA 3BE1L 3L3GB 5IQMA 1S7UA 1Q0EA 3OKLA 4AZUA 3DBXB 2W9DH 1XCTA 4RDQF 4DFHA 3COOA 4JZNA 2G0KA 4DN3H 3RBGA 3U79A 5ID1B 3H2PA 1IGJB 2QQLL 3FO2A 4K8RL 4PP2A 3L7FB 4PRIB 5EWIL 1LWRA 2PW1A 3GK8L 3GHPA 1MLCA 4RAVB 4Z76A 4XMPH 1KIQA 1PZ3A 2ZOUA 5FW6A 2DL2A 2IF7A 3ZE2B 4LCUB 4Q9RH 4IW4C 1U8KB 2NY5L 3FN0L 4OT1L 3LZLA 4UT9A 5E9NA 3IU3A 1L9OA 3PWVB 1T03H 3VFRA 2W80C 1OY3B 1TVDA 2DIJA 2VH5H 2WTRB 4KKNA 4QRUB 2NW3B 2XN1A 4LRNL 5AZ2H 5JIDA 1SXSA 2CHWA 3VTAA 4H20L 1XB3A 3SDCA 3WFDL 5GSVA 3CXDL 1PG7W 3F64A 1JS4A 4HWBA 5IT2L 2AEPH 5EBGA 3NFSH 2E7CA 3G6JB 1NAMB 1Z9NA 2Z7ZA 3A24A 4ONFH 1TFHA 2FX8L 3QK0A 1I3RB 2K9UA 3F04A 2B4CC 5D7EA 5KYXB 2ED8A 2HFGL 3TESA 4FLSA 4X9YA 4AT6B 1M7UA 3EGXB 3QS2A 3UG4A 2W60A 3VFGL 3STLA 3X12A 1ZT7A 5FXCH 4WTWA 1L9NA 1G87A 1QBLH 1PS3A 3U4KA 1GPOH 5AOJA 3FT2A 4OZGE 3C60C 4HETA 4LDEB 4NO5A 3L9RB 1AOZA 1F42A 4X9IA 2OTWA 3NIDF 3OC5A 3P4NB 4MNGE 4PTTA 4XNZC 1BM7A 3WU1A 3TN0D 4NBXB 3O8XB 4BA0A 1TNNA 2ZSWB 3K2UL 4OD3L 2VDQH 2YEZA 4QOKA 1KEGH 1U8PA 5I8OH 2EEXA 4LCYA 2O6DA 4OH2A 5ICXA 4H0HB 1JHLH 1JNNL 4QR7A 1HSBA 3W39B 3U30B 2ICWA 5HHVH 5D6DC 4W9DC 3MREA 5LJYH 3C6SA 1WV7T 5C3IA 1YJDC 4MJ6A 1INDL 3GJEA 4Z95H 2OCCB 1UKSA 5DQDH 2GTWA 3KPOA 3KPPA 3LMJH 1CGSL 2HVJA 4AH2B 1HOEA 4YSDA 3QW9A 2A83B 2G75B 1ACCA 4PJHB 4XI5D 3F83A 1QTPA 3MGOB 3MLSL 4FYQA 5HGDA 1CLVA 4WU7A 5I8EB 4BYHA 4QT5B 2P7TA 1HU8A 3RNQA 3AW5A 1ZY9A 5C0CB 2R4SH 4Z77B 5F7EH 2FEDD 2Z65C 3VAEA 3HMXL 1U30A 3DYOA 1J88A 1CO1A 4Z7OE 3BPOC 4KQ4L 4TOYL 4AGPA 3DURA 2QPSA 2O5XL 5KVEH 3LKNA 1AXTH 4X6FA 1J1OH 5GRVK 2F54B 1R3IL 1KYOK 2EH8L 4UQ3A 3WMSA 1OAQL 5DZPA 3TH3T 1NIDA 5GS1A 3HRZC 1OGAA 2W0FB 1FIGH 4M1CC 4P23C 4FG6D 4O4YH 4MJID 4U33A 3B4NA 3T8VA 2GJ6E 2BVUA 3N91A 1EAQA 4Z6AT 5SWQB 1BBJB 1ZGLM 2BNRB 1BJ8A 4L8BB 2OR8A 4JFHE 1WZLA 3U4EA 4U1NB 1DANU 1FGNH 3QXVA 4WKXA 3V5HB 5IUSA 4ZW5A 5D96C 2DF3A 2XWZA 4WUUD 3ALXA 5IHUH 2L3BA 5CP3A 3S3CB 1NGXB 3BC9A 4KTGA 4JFTA 2NDFA 3WEBA 1A6AA 2E7BA 2K8MA 1MCPH 4BK5A 1XSKA 5A40E 2WWOA 5SX4I 1MI5D 3BKMH 3MMEB 2VC2B 2KPNA 4G1MA 1MIML 5I71C 3SQOL 3ARRA 3UTOA 3EJJX 5IVOA 5JZ7D 2FCBA 4HUMB 3FRUA 1OW0C 1FLRL 5E5MA 4BFIA 3BZFB 3MV7A 1HH6A 2PABA 2AXFB 2WXLA 4KQ3L 4WSKA 4ZMVA 3DKHA 4F5CE 3TA3C 3TTSA 1CD0A 5CIPA 2AJSL 3QC6X 5FW8A 5KSVA 4MCZB 3TCTA 5IKCA 3AADB 3TGXA 4Z7WB 1GGCH 1CYGA 1UM5H 4GSUA 3VJ6A 2JQMA 1U36A 2A6JB 2R56H 4O9HL 1XXDC 2VMJA 3BUIA 3FBQA 4NQCB 4BCXA 1E4XI 1TTCA 2OM5A 3B9KD 2WLJA 1DQJB 3EFDH 1AD0A 2DS4A 3U6RA 2FEEL 4FMKA 2WD0A 3MBEA 4BH7A 5JHDE 1T20B 4YSUA 3FHEA 1XSOA 1T4KB 4Y4HB 4F2FA 4R26H 1YYML 3II1A 3T77B 2CBOA 1H3XA 4GI6A 5TDPB 3FBKA 1T21A 5GRJL 1B4RA 2O93L 2NQ3A 4A2MA 1MFEH 1T6WA 1L0QA 4NKDA 2VLMD 3HRPA 3LIZA 1L0PA 2WZPD 3K80A 3DX4A 3QJHA 2DICA 4P06A 3SBRA 2Y5TA 1BJ1H 1JWUB 1QA9B 1XSIA 2ZCHH 5C09B 4YE4H 2I25N 4OIFA 5EORL 2EDXA 1W6WA