1U91B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide analog endkw-[dap]-s (cyclic)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u91B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u91B01
1L6ZA 4U05A 2VL5A 1NC2D 4K3DH 3F7YB 5B22A 5IOPA 1CDBA 5TE4L 4GXUM 3TJHD 5IWLA 5TE6L 2GTZA 4OF7A 5D1XC 5DQ9A 3OG6B 3CD4A 1UEYA 1KLFA 5ALCH 3QUYD 2JB6B 5KVGH 4F15C 2WIIB 4NSKB 2C1OA 4D0CB 1IM9B 4LHUA 3D2UD 3QUXB 1HEZB 4EOWL 5A2LH 3R1GL 3C60D 1JZ7A 1U8PB 5I19L 4X4YB 1HH6B 1BZ9A 1T80A 5C07B 3WS3B 3NFSL 5HHVL 5HDLA 4GKSB 2YD9A 3QFJE 2Z0BA 2PXYA 4NKMA 4Y5YC 4P5KA 1U3HB 3ARFB 4S1QL 1HINL 1R0AL 2ESVE 5BJTB 4OSUL 5IGXH 4PS4L 3UJTH 4NZRL 1MFDH 3ARDA 4M03A 3UAJC 1BQSA 4DVRL 3QH3B 1D9KC 3FQUB 3DNKA 3TNMA 5GRUH 3U0WH 2AJUH 1CFVL 2VZSA 3TBVA 4TTDC 1I9JH 4ZFZB 5D9SA 4ZFOL 4MJIB 2RFXA 4PGEB 2X4OB 2AEIT 4G7VL 4LPCA 4XNZC 3FONA 2Z92B 4HAGA 3STZA 1W8NA 1KFAL 1DTUA 1ITCA 1XF4A 4JRXE 3MV8A 4TSBH 3K4DA 3BZ4A 3EDDA 4UIMB 5T33H 3PWUB 2Y23A 4NNYA 2C7UB 3CXHK 4JGUA 2Y07L 3NIDE 4XCCH 2QV2A 1OT1A 4GRLA 4LEXH 1J88A 3KXFE 4HCRH 2P43B 4PRPA 3GSWB 3L3IA 3SKNB 1WGOA 3RJQB 2HJKA 3BDYH 3MFGB 4LBEB 2IG2H 1QLEH 3NPSC 5C0GB 1IKNA 2G9HB 1IGYB 4NQSB 8FABB 5L8LB 1T89C 3THMH 1JF1A 4PTUB 4XVSH 3RY6A 5HY9A 1DVFA 1Q0YL 1JYNA 4KQ3L 4W4OA 1DUYA 1QPXA 3MLTB 5JO5B 5J12B 2X7LB 4Z7VE 1L4IA 5ID1B 3HMWL 3VGBA 3ME0A 1E4WH 5LG1A 4ONHB 1X6NA 4JFPA 3LY6A 4AEHH 2A77H 1RUPH 4Y5XB 4GQPH 5IT2H 5IG7B 5GGRB 3WLWC 4Z7WA 4K8RC 3O8XC 1FVCB 1HIMH 4PTTB 1CD0A 4R7NA 4RMRA 2XICA 4LRNH 1CYGA 3QO0B 1ZE3C 4PG9B 2XQYG 1QFWM 4PJ9C 1NCNA 1U93A 3C8DA 4YQXH 3TVMB 4JZJA 2QADB 1T0PB 4V2BA 4AL8H 4K7FA 4OCWL 3FTGB 1SJEB 3NABL 4NM8L 3RUGE 4JVUA 3TN0C 4S2SA 4X9GA 2P46B 4ZFOA 1D9KD 3GB7B 1HNFA 5IM7B 4L4TE 4PB0H 1HNGA 1K3IA 3R8QA 1QFHA 3PQYD 3DX7B 4AT6A 1O0VA 3BKCH 2BSRA 5CILH 5DMKA 3UTPD 1II4E 2KZ1B 1LK2A 5F7UA 4IRSC 1AKJD 1T20B 4C56B 4DZBB 5DK2B 3SDDD 1FFPB 1T22A 5C2UB 2VITB 2SEBB 4O4YH 3A0OA 4LCYA 3RVVC 3AM8A 3MCKA 3PGFL 2AV7B 2Q6WA 1KSRA 5LVEA 3TZVA 1W0YT 4OCXL 3SN6N 4FHBD 3MOAL 4AJ0A 2Y5EA 1OPGL 2YC1A 1HYSC 3MGOA 5FA4A 3T0ED 2YD2A 3CVHL 1B4JL 3PJSB 2VAJA 2VLMD 2QR0B 5KZCD 5T1KA 5BW7A 1FPTL 3GSNB 5JUEL 1AHWB 4U0RB 5I1GH 5FECB 4N8VA 2DQUL 4JFZL 4LFHD 4ODXB 2UWEF 4M5ZL 3SBWA 5BVJB 4WI4A 3KHOA 5DA0B 1NFIA 3X14A 3RHWK 1XGYL 1F45A 2W0KA 3SGKA 2CXKA 3LH2H 3FOLA 3BVNA 1C7SA 4PJGA 3O8XD 2AJVH 3E6HB 5I73C 3I2CL 5CEYB 3KDMB 4JQVA 1K8DB 4D3CH 3I84A 2UVEA 3JUZA 2VZOA 3QNZA 4S1RH 1M7DA 4JKWA 5DHVB 2P8MA 3HUJF 3E6FB 3X3GL 4KFZC 1I3RA 1NCWL 2R2BA 3EYOA 3TN0D 1WFNA 5IF0B 3VD4A 5GRYA 1RK0B 4FFYH 4H25A 3QXDA 3SGJC 4I4WB 3W5NA 5J3HC 2JTDA 5EOQL 4G80A 2AXJA 1OGAD 3L3DB 3QHFL 3QUKB 4I2XB 4NBYB 1A1OA 3UROR 4PJ7B 4PJ8C 4P23A 4M1DL 5E2VL 1IEAA 4MQXC 1NGZB 3LD8C 3GSQB 2DQHL 4IRSD 4PY8I 1WIOA 3LKRA 3G04B 1BVLA 3TM6A 1TPXB 4O51B 5HGAB 2R2EB 3MZTA 1H3TA 4XC3L 3VXSD 4CMMB 3QEUB 3VFTB 2CSPA 5DRZA 4MA3A 4UINH 2WUBL 3RVVD 4Y19E 3LQAL 3CVHA 3EDJA 3VD9A 4IMKC 1H5BA 3V0VB 1FIGL 1N5YL 1LD9B 3QG6A 1JNHB 4WHYH 4YR6B 5MEPB 1HYSD 1KTDA 5JQ6L 3G5ZA 1C16A 3CLEH 4N0UB 5C0EB 1DQDH 5FUZL 1BMGA 2WP3O 5D6DC 1MRFH 1U8OB 4GS7C 3VWJA 2RQ8A 1FYTB 4YHIA 3U4BL 1AIFB 2HKHH 3I6GA 4NOFA 4BFIA 5A2JH 3PV6B 1F4AA 2X70B 2V5RA 3BYTA 1UKQA 3BWAB 5FKPA 2V5TA 4S1SL 4GRWF 1J0ZA 4Z6AT 1QYGH 2VJXA 5C6WH 3CU1A 2HTKC 3ZL4L 2VLJE 4O02H 5BQ7B 5BVPL 1C5BH 1T2XA 2QSCL 3IAPA 3JZ7A 3T77A 2FO4B 4LDEB 4DGVL 4OM1L 1QSEB 2HVKA 4AIZB 3H9YA 3QPQD 3EYFB 2R29L 3MRFB 4OGZA 4FOMA 4DWHA 1I8LC 4JDZA 4LHJB 4FQLL 5E6YA 1J1XH 2N1KA 1Q94B 1A7RL 3HMXL 4WGVB 2CLRB 1ZT1B 1A6ZA 2BSSB 2HJFB 3MQIA 4WHYG 5HYFA 4BH8B 3UO1H 4RBPH 4LLUA 3MRRA 3OAUH 3ZDZE 2XA8H 4RISH 4X98A 3S35H 1YA5A 1RHHB 3VFMA 5HDOA 2DQFB 3WXWL 1CFSB 3IJSB 4LLYB 3CIQA 2V9RA 2JJTA 2CDGA 5JORA 3IF1A 5E7BA 1OTTD 5TQ2H 4R96A 5JDJA 5J3HD 3W39B 5BV7H 2ZWLT 1NUNB 3AROA 1KBGH 5E56A 2V7HB 2BZDA 5DHYA 1KLGA 4PRHA 5I1CH 4X5XB 3ARGD 2D03H 4PJAF 3Q5OA 3K8MA 1WIUA 5D72L 1AC6A 3U46A 3UYRL 3GO1L 1NC2A 1LO3H 2AXHA 3CFKB 5JHDE 1JGLH 3MLYL 1FGVH 2XV6B 1KYOK 3KS0J 2XRAL 3OJDB 4HKJB 3O0RL 1EEYA 4PGZA 1J0HA 1EPFA 3QUYA 3JTTA 4ZUUA 4JZOA 1EAJA 1YMHB 3WKNA 1FQ9C 1J1OL 3D2UA 3L3GA 1MY5A 2EDNA 3WUZA 2VUYA 3KJ4C 3RVTD 4YHPA 1ODAA 2BY2A 4PREA 4NNXA 2R23A 3EYUL 3D9AL 3C60A 4KGJA 3O3EA 1FDLL 4HQQH 3B83A 3MREB 4BFBD 1NBVL 1S7RB 5E4IA 1A4KA 4PB9H 3STBA 4Z7UE 1K2DA 2FJGB 4O9HL 5CMAA 2CPCA 4G5ZH 4DW2H 3WN5A 2ZPKL 4M5YH 1VGKB 2PR4H 3BSZH 4DAGL 2P8LA 1MJUH 1G1YA 3LIZL 3PNWB 1AFVH 5LKNA 1CXFA 2Y9RT 3M8OH 4JFFE 4N1CA 2XQBL 4LSUL 1NAML 3FJTA 2AXGB 1OAUL 4XVUC 5ANMA 1L7TH 3P11H 4M7ZB 4PUBH 1YJDC 3HE7B 5I0DA 3HMXA 4N5EC 4FRWA 1BQLH 1TFHA 3GMMA 4P59H 4YDLB 2J8UF 4NUGH 5C8JB 3S97C 5D71L 2DIJA 1QKZH 4OFPA 4RGNE 5C6TH 3P9LB 3WO3B 4IOSD 7FABL 3IU3A 3UTTB 4CMHB 4LKCB 1TVHB 1Y18A 4XMPL 3D39D 1MEXH 3VD7A 3SE3A 1CU4H 1T2QL 5GGVH 3MNZB 3LS5L 2JK5B 2FIKB 2DICA 35C8L 3HI1A 2VXUL 3VXOA 2R56H 5GJSH 2DQDH 2AW2A 5CSZB 5IMMB 1AD9A 3QXUA 4OV6F 1KXTB 3TBTB 2ITCB 4N0CC 4X80L 5D7IE 1QFWL 5I8CA 2VLLA 1I1FA 4NQDB 4TPRL 3MRQB 1R3JB 3HI5H 5F97E 4G6KH 2MCPH 2Z8RA 4MX7A 4YXHL 1X5XA 3MACL 2BY1A 2XACC 3BYYA 3KPSB 5CIPH 2GJ6D 2VR4A 5FCSH 1OQOA 4NIKB 2DMBA 1YYLH 3RZCD 43CAB 3R06A 2A9NH 4HS3A 3O11A 1BBDL 4QRQA 3TCXA 3P0VL 3IKCA 2XY2A 4LKXB 4KZEH 3L95A 4D0DB 1XEDA 3WS6A 2BFVH 3EYVA 1NC4B 3WKMH 5I18L 1N6QH 3GKZA 4RZCA 5LBSL 5F3HA 5DUPL 4FQQB 3RNQB 5E2JA 5IR1B 2HFEA 3MNVB 4O58H 2NXYB 3WL9B 4JM2C 3MRIB 1CGTA 1NAMA 3GFUA 2D0HA 1Q0XH 2FCBA 5IV2B 3G5XB 2Q86A 2R1WA 4M62H 4NFBA 4ZYKA 4K9EC 2EKSA 1CIUA 3QDGE 3BRFA 1LQSR 1A5FH 3PG2A 2NYYC 2ARJB 4Q97A 4XH2A 4F3FA 5T3ZH 3I85A 2IGFL 2A6JB 5FIEA 1D9KA 1P7QD 4I9WE 4OM0L 2DN7A 3FAWA 4ZPVB 1HILA 1TVDA 4N5ED 1VFMA 3PQYA 2X1PA 5ALBL 2NY4C 4MNQD 3LZFL 3RVWD 2VZTA 2WV3A 3BPNB 3EOYG 2R8SL 4L29B 1DFBL 4I0PD 2VXTL 5FGSA 5IESH 2I07B 3VMNA 1AKJA 2X4PB 3O6FB 3IVKB 3SDDA 2X4RA 2DJ4A 5EWIH 4TVSa 3FCTA 1XH3B 2OI9C 4JPWH 5CLWA 2BY3A 5L8KB 3EFDL 4KPHL 5J0BA 2VDNL 2IQ9L 5EPMA 2XKNB 4HZLA 1XMWA 3MLSL 3QJHB 4YZFE 4F7EA 1BM3L 3FMGH 2CMRL 3BP5B 1S3KL 4N0CD 3T2PA 4QHMB 3CX5J 3QA3A 3T0EA 1HHKA 5GIRB 2EEBA 3K8LA 1JGDB 3H0TA 3G6JB 3STLA 4X6CA 4NN7C 5EOCL 2BNRB 5FUOL 5D7JC 1R5VA 1TZGL 2MQ3A 4JM4H 1A22B 3BP4A 1GGCH 4POZC 4ALAH 3SGDI 1FGNH 1HCFX 4ZFGL 2DM4A 1FIEA 3GSUA 4GG6B 1LNUB 5B38A 2W91A 5F1SA 2JJWA 4LSPL 1N3NB 3MRCB 5DJAB 3UYPA 5HHPB 1KPUB 1SYVA 2FD6L 1AQDB 2MMXA 4WUKL 4ZAKC 3VCLA 2W9DL 3BPLB 5KS9F 1CF8H 2FBOJ 1QFOA 3EZJB 1F3JA 3PWLB 3FT4A 1QNZH 2FIRT 4FNLL 2GHWB 1PSKL 4XP6L 4JM2D 5D93B 3PGCA 5I1KL 2ADJA 3O8XA 3V6OC 4HIIB 4YX2H 1P5UA 1JPSL 4J3WA 1NUGA 1BFVH 3UBXI 4NHUB 3SDXE 4NO2A 3TO2A 4TNWK 5KSAC 1T3FA 4KK9D 3G9VA 5DJYA 5FO9B 1LVEA 1WVZA 2MHAB 3TN0A 1CICD 3BPCA 4LK4A 2UYLA 2DD8H 4DUVA 1RUQL 5JLZA 4J1UB 4K94C 1VACA 1I8IB 5IBUG 3ULUE 1H3PL 2ITDB 1OGAA 2R39A 5C0IA 3T4AA 1HXYA 4M7KL 4YBLC 4OB5H 4OZFA 4MB3A 3HPJA 4H1LH 5GS3A 3ARYA 3TH4T 2NY2D 3TCLA 2BNQD 1Q9KB 5E94B 5KSBA 5I66A 3P0YH 5EFIB 4KDTA 4GAGL 1FNAA 4ZODA 4UILH 3VXSA 2CUMA 1U92B 2VXQL 5FHAL 2Z91B 3MOBH 1QO3A 4ZUSB 3H3PH 4OLVH 3CGTA 4HUVA 3N1PC 1KCRH 1HQRA 2PW1B 3G6DL 3U7AA 5SWZB 1D5MB 1ETZB 3KR3H 5JIKA 1MHHB 3GI8H 1FE8H 5DD3H 5C3LD 4L3CA 4XXCC 1OLZA 4PJ7E 5D7JD 3SPVB 3ULVF 5ITFA 3HRZB 1JZ6A 4POZD 4JCLA 2Z9TA 4OUUB 5FDWB 4G9DA 1R24A 4NQED 4E5XA 3SGEH 2J2ZA 3ECBB 4NFCA 1MQ8A 4H1LG 4HGWA 1DBJH 5CINL 1A7NL 4ZAKD 3IFLL 3MUGB 1NCTA 4EVNA 1WEJL 2AK4D 1N5AA 2R0KL 5E08L 1BGXH 4N0UE 4RFEB 3TT3L 4TSCL 4DEPB 1RPQA 5I8KL 1EERB 5JDSA 5KSAD 3GIZH 3C08L 3DX9B 2G75B 5IK3B 3VXTB 4F57L 4OT1H 3P4MA 1F5WA 3MV7D 2DQGL 4JJHA 4NO0D 3QWOA 5F89A 4KUZL 1ZGLP 5JXAH 4I77L 4Y2DC 3IDJA 2OSLB 1LO2L 3INUL 1MJ8H 3SCMC 4WFFD 1SMOA 3DVNA 2AQ2A 4Q0XH 4BZ2L 4Z8FH 3H7BB 1IL1A 3IT8D 5HDQL 4AZ8A 3RPIA 3GMNB 1AE6L 4GKNB 1T4KB 4Q9RL 3G5YB 5CZXD 1QQDB 1QSEE 4QTHB 3ARGA 3VXQB 3MRDB 2IMMA 1FLRH 3OKMB 1RIUL 2J8UA 2VC2L 1G84A 4JQIH 3WIHL 1KTLA 1MCPL 3LDBC 4ZMAT 4MB5A 1YEDB 2R2HB 4GJTB 2BVOB 4CJ0A 5HVHC 1U8LB 1GC1H 2BVPB 1CDUA 3FB8B 1GGBH 2ICWB 3DUUA 5EIIB 5L2KE 1ERNA 5EO1B 1EJOL 4IMKA 4OZGE 3HAEH 1RVFL 1JNJA 2LVEA 2WUCH 4WEBL 4N1HB 2VR5A 3QEHB 5DD6A 2YMXH 2QLVB 3NA9H 5DFTA 5BRZB 2D3VA 3DIFB 3TLRA 5CEZE 4U6YA 2HFFB 2X4QA 2VQ1B 3FAXA 3H9HB 3VH8B 2EO1A 2V5YA 5I74C 3VFOB 2I24N 2CUHA 5C0CE 4R2GC 5J6HB 2NQCA 5HYJD 4FQCL 2JCCB 3MRPB 5T5FH 2PYFA 4LSVL 3BHBA 4JY5H 3ZKMD 3RIAK 5E8EB 5F7WC 1J87A 3JV0A 3EUUA 5DA4A 2ZSWA 5GS0D 2W9EH 5ITBH 4MYWB 2A6DA 2VDMH 3IETB 2EIDA 2EZ0C 1FC2D 2C3XA 2IFFH 1J0IA 3V0WL 5IB1B 1I85C 5IMKA 1KCSL 2ICEA 1I8LA 5FO8A 1EHXA 1UWEL 2FH6A 4YC2B 3KYOA 5IEHB 4P2OB 1INDH 3BE1L 4JFDE 4EN3B 1B9ZA 4FZ8H 3D39A 4PJIF 5EBGA 3NCYS 1JWSB 3VD5A 3VXMD 5T1LD 1EO5A 2CLVB 4KXZI 1T03L 1IGIH 4H26A 4Y2DD 4U1HA 3QPXH 4X7FC 3IGAB 3SCMD 5IQ9A 4KAQH 3WIHA 4JFOA 3P40A 3EOTH 1A8JH 3TEUA 3GK8H 4XAKE 5C0FB 3MBED 3KG5A 5ETUA 4P46C 1T1XB 1QA9B 3X13A 4AYFA 3BEWA 5CUSL 4M6OH 2ZOKB 3KHQA 5IFHH 3WFBL 4KVCH 4JHAL 4KVNH 1RJYB 1UJTA 2DWEA 3PHQB 2OMBA 1C5DB 2GJ6A 2L7JA 1CDHA 1UT9A 3RZCA 5FYLE 4LHUG 2MPAL 3ARXA 4ZTOL 1FRGL 1MFNA 4D8PB 1XF3B 2V17H 4UZGA 1F6AB 3BISA 2CK0L 1CFQB 1PY4A 1RURH 2X4SB 3DPBA 1MCIA 2YRLA 4MS8C 5ICYB 1TTGA 4PP1C 3RGVA 3MLUL 4N5UA 2EH7L 5IHBA 1TJGL 2ENSA 4HFWA 1I7UB 2G5BB 3MJ8A 3M45A 3LN5A 5EBMA 1LP9F 5TE4H 5FYJU 3DVGA 4PY8J 1RIVL 3MGTB 3HCVB 3LPGA 1DQJB 3VJ6B 3TYFA 3I02A 1MFEL 3RWIA 1JWUA 4MA7L 4RNRA 3U7WL 4CNIB 2CJUL 4MWFB 1P7QA 4XPAL 3R1GH 1MPAL 5I19H 2EZ0D 3OKDB 2B1HH 2BOCB 2ZUYA 3SQOL 3NFSH 5HHVH 5DJZA 4MNQA 5CAYB 4QXUL 5T3ZE 5IFAH 4OLWL 4I0PA 2ZCLL 1ZT7B 4S1QH 1U91A 1HINH 4V2CB 3V6FA 2A0LC 4OSUH 2AJSH 4PS4H 1I1AB 1ZEAH 5E4EC 2IH1B 5ESQA 2FJHA 4DVRH 4GLRI 3PDOA 3UTSB 3M17B 3O4OC 1NFDF 4OD3H 5IEKB 3TPUB 3V52L 1D5XA 1NDGB 1CFVH 1G6RL 3BFOA 2XTJE 4PJCF 4MXWL 5D5MA 4A6YL 1UB5A 5EO9B 3HZKA 4PRBA 4MXVF 4G7VH 4ZUWA 1WFOA 4P46D 2ZJSL 3DHMA 4LCCC 2PCPA 5A1AA 4HUXB 3LV3A 4KI1A 3V79C 3OX8A 1KFAH 4XNQB 1SQ2N 2A6IA 3JV5A 1RUML 3ARVA 2WANA 3KS0H 5CEXA 3FO1B 3DO7A 4EI5B 2XYCA 2Y07H 1R3LB 4X8JA 4Z78B 4R0LA 3CC5B 4MS8D 4XCNA 1CLZL 1WWBX 2BXYA 4PP1D 4HLZH 4R3SB 4EJ1C 1LEGA 3TC9A 4PJ5E 3Q1SL 4QRPB 4MSWA 3E2HC 1KT2B 1DUZA 3VGEA 2IPUG 4JM2A 3Q3GA 4GXUN 2ENYA 2I9TB 4Z7NE 1TZIB 4MZ2A 5HHOD 3MRHA 1Q0YH 4KQ3H 1RIHL 4N8CL 2W38A 1U58A 3FFDA 5GRWA 4Y4HB 1C8PA 1MCEA 3L9RB 2VN4A 3AXLA 3HMWH 4WJ5B 5I2IB 1D5IL 3R0MA 2LU3A 1CICA 1F4XL 2PKDA 5BXFB 3OF6D 3HRPA 4JVWA 5DVLA 4L3ED 1FCCA 4MDIA 4YXKL 1QOKA 2VDQH 5DRWB 4OJFL 4ZXBB 4HDIA 1I8MB 4Z95L 4AMKL 5ICXA 1GZPA 2A0LD 2BNQA 4OCWH 2OL3H 4NM8H 3RWGB 5MERB 4A6YA 1A2YA 4LPWA 3ZE0E 3NFPA 4X6DF 3BP7A 2DM3A 2H8PB 3QXTA 5DUBB 5F1IA 4LLWB 1SM3L 4X4ME 1VKXB 1DLHA 3CH1B 3BGMA 3VE0B 2DL9A 3FOMA 4P5MB 5D7JA 1NAKL 2DLTA 4H5SB 3QEGL 1JWMA 3T0DA 3PGFH 1EHLL 4U33A 4PGDA 4NQEA 1SVZA 4QWWC 3O6KL 4LLQA 5E8PB 4OCXH 3MOAH 2P44B 5HHQB 3QQ4B 1OPGH 1IAII 3FQTA 5T3XD 4ZAKA 2BC4A 4E41D 4KJPD 3B5GA 1S78D 2CR6A 1FNGA 1WF5A 1B4JH 3D85B 3CFDB 2AK4A 2WQRA 1HSAB 3E0GA 4QHUA 4FQXC 1CN4A 4X7TB 5GS0L 1M05B 5ESAB 5DDHA 4RAVA 4B50A 1FPTH 1U8JB 4XBEL 4Q6IC 5JUEH 1MCRA 2A1WL 2BVTA 3RTQB 4OFIA 2DQUH 1LE5A 5TDOB 1T21A 4JFZH 2F54B 4NPYB 5KSAA 4M5ZH 5CD3B 5DQDL 1G7PB 3IXTB 4KROC 3MV7A 1W72L 4NO0A 5IB4B 4UV4L 1HDMB 1CLCA 5SX5K 1XGYH 1NFKA 3WHXB 2XWBA 1B0RB 3QXWA 3QQ9C 1A7OL 3GIVA 4YFLI 5C09B 3QHZL 2AXFA 2YD1A 5FYKL 3I2CH 1MWAL 3GJEA 2RBLA 4KI5E 2NR6C 3BRGC 4GT7A 1LO0L 4JDVB 3X3GH 5KN5A 1GL4B 2XNAA 1NCWH 1FZKA 2EDHA 5JW3L 1XF2B 1JV5A 2CKBL 4ORGA 3VXUD 5J06A 1OVZA 1HHJA 4GW5A 4W6WB 1IM3B 1QSFD 1ZANL 2VDKL 4PJHF 2L0DA 1Y6MR 2B1AL 5HGDB 4DUWA 3ROLA 1U0QA 3QHFH 2XWTB 3DBXA 2J8HA 2CXGA 1R3IL 5F8QC 3N9GH 3P9MA 3KLAB 2XXMB 3S34L 4ELMA 4Y5VC 2DQHH 2V2XB 4HJ0C 1FV1B 2E27L 1A3RL 3MRJB 5JXED 3KYNB 1AY1L 3V4VL 1U36A 4NUJA 4XC3H 5JOPE 4U6VL 4X6EA 1S5HB 4APQB 2WUBH 4GSDL 5HYJA 4I18B 3LQAH 1CXKA 3IU4L 4K07A 1FIGH 4QWWD 2DQCL 5IVOA 3QNYB 4JRXD 3PP4L 3I6KB 4CU6A 5JQ6H 5IHZA 5FUZH 3WNKA 4ORZC 2EYRA 1XGTB 1ZHKB 1OOAA 3WFHA 2IAMB 1C12A 4FQXD 3U4BH 1W72A 4RA0C 5A3ID 1LEIA 5BRZE 1TZHA 5F9OL 4S1SH 4UTBL 2CUIA 5E70A 1ES0B 3ZL4H 5CBAA 2ICWI 4KROD 2QSCH 1UVQB 3DTXB 3VXMA 4LMQE 4YWGL 5T1LA 4DGVH 4OM1H 1FZMB 4Q58C 2OMNA 4Y2DA 3SCMA 3P77A 2R29H 1INEL 1INQA 3EDKA 3LKQA 3QQ9D 3CPLA 4FQLH 1S9YA 4OLZL 3MBEA 2CKBA 2QQLL 1A7RH 3HMXH 5HPOA 2FR4B 5CZKA 3BKJL 1TMCB 1MCJA 4PG2C 2NR6D 1OF2B 1EGJL 4XVTL 5L88L 4W70A 1YEFL 2DQTL 3QCTL 3VI3F 3WXWH 4Y4FB 1BWMA 2IPTL 2GTWA 3K81A 4WW1A 4OZIB 1NBZB 1CT8A 1V8HA 4P2CG 2BVQB 3QI9D 5F7YC 4MAYD 2J12B 3KPRB 1OD9A 1PKOA 2VSDA 3WDIA 2YXFA 4UAOC 2YBRA 2M1KA 4WI7A 5D72H 2WWKT 4K3EH 3GO1H 4L4TD 4RX4D 3MLYH 3U9UA 3PWNA 3WIFA 3TFKC 1JZ3A 2B2XH 2CRYA 3O0RH 3LQZA 3RWDB 3OR7A 3H9ZA 3PABA 4F7TA 3V5DB 3OKYA 4CADB 1J1OH 1B0WA 1BVZA 1TLKA 1F58L 4XCFL 5IFJB 3BIBX 3MRMB 4QF1B 4X7EC 2GT9A 3EYUH 3D9AH 5D96C 5C0JA 1FDLH 3TH3T 1A6PA 1NBVH 4YDVA 4HUWB 1I3UA 4O9HH 4O2FA 3EGSB 1I85A 5MI0C 3V6ZB 2ZPKH 4JFEB 4RGMB 3LEXA 1YPZF 4HV8A 4DAGH 4D94A 3EKCA 1JYXA 1X4XA 2BOBA 4P3CH 2XQBH 3HZVA 4AQOA 4LSUH 1CZ8L 3KLSA 1NAMH 1JF6A 3EOBB 2GAZB 2UWEB 4YXLL 3HS0A 1FL5A 3MFFA 5AZ2L 1KJ2B 5AEAA 1OAUH 1NQBA 1PLGL 3DLQR 3NIFF 1MI5B 4P9HC 1FLTX 3D0VB 1Q9OA 1YN7B 2DM2A 1OAKL 3IJHA 4L9DA 4Z7WE 3RL1B 1UA6L 3WO4C 5M94B 5D71H 3KPQA 1EGJA 2Q7YA 4LVNB 4TOYL 4R7DA 5HJ3B 5DEGA 2RAMA 4G3YL 4X9HA 3BQUD 5LAXB 7FABH 3QUMB 4P46A 1QBAA 4XMPH 5ACZA 2ICES 4EQ2A 1T2QH 3ALXA 1ONQB 3LS5H 1NBYB 2FWOA 1EEQA 1JF5A 2R0LL 2OR7A 5TH2B 2VXUH 1S7XB 4WW2C 3UMTA 3VI4E 4CN6A 5FAAA 5JW4Q 1VFBB 3EO0A 4L8SB 5GISL 4D9LL 3B9AA 4HAFA 3A6CL 4X80H 1QFWH 1P7KA 1U8KA 1XF5B 4TPRH 1AO7D 4UBDC 5DD1L 1X3DA 5MENB 3MACH 2FL5B 3QIWC 4HLJA 2VDLH 4P4RB 3BGFC 5GXBB 5T3XL 2K7QA 4KH2A 4M6ML 3U36B 4DFIA 2EYTA 1S7WB 5HHOA 1A6AA 1BBDH 2Z35A 3P0VH 4HWNA 1B0GA 2DI8A 2O61A 3MRLA 5I18H 5DURD 1Z9OA 4XI5C 5DUPH 3OF6A 5CBEA 1CBVL 4L3EA 1XFPA 2NXZB 3GBLA 1I7TA 4JRYD 3SKOA 4PD4J 4Y19D 4O2EA 2ZSVB 5F1KC 2QSVA 3UTZA 4HK0A 4DKAA 2ZNXA 1VFAA 5EBLB 4KTYA 3UPAA 2GFBB 3B2UD 2ADIB 2HT2C 1QHOA 5TQ0L 4OI9A 2YUZA 1KJVA 1FFNA 3ZDYE 2IGFH 1LO5B 3OTTA 1NANI 1IC7L 4G8IA 1J0YA 4M61B 3RL2A 4OM0H 1A1MA 1HHGB 1WCBA 1Z0NA 4ODWB 1KN2L 4XPHL 3SJVB 1S9WA 5ALBH 5TDPA 3O6ML 5SX5H 1M71A 2R8SH 5SWQA 5GGSY 3B8SA 4G42A 5F88A 2VXTH 4UOW0 5DD5L 3GEWB 4IS6A 5GS1C 4LNRB 4TUJA 2AGJL 4GRWH 1J8HB 4JGJA 4LCCA 2KBGA 2MOVA 3S37L 3DO3A 2Z31B 1KPRA 4B7LA 5HGBB 3SY0A 4RGNC 4OZFH 3WCYA 4PY7A 1F2XK 1BLNB 5J9PA 3EFDH 4KPHH 2VDNH 2IQ9H 4NC1E 2VLRD 4PJBE 1TJHL 3GSRB 4PJFF 5E6IC 2X4TA 3U6RB 1BM3H 3VGAC 2CMRH 5FKAA 2B39A 5KSUB 1S3KH 3IFOA 3IXAB 4PRNA 4BSJA 4E41A 3QQ3A 4PJAB 2NZIA 4TTGA 5EOCH 3PP3K 5FUOH 5FV1L 2GY7B 5KJRL 1QEWB 1TZGH 5I8EA 2CLZB 3W82A 1QRNB 4PR5B 5I1DB 4JO4H 4U3CA 2AS5M 3PF2A 3AU1B 3RWCA 1G7QA 4JB9L 4LSPH 5H37H 2FD6H 2C3VB 4WUKH 4XP5L 4JY6A 3B6SA 2W9DH 4XI5D 1S7TA 3OGCB 5I75B 1BQHA 4F7MA 3FQWB 4FNLH 4LPVA 1PSKH 4XP6H 3T2QA 5HD8D 1U95A 1YNKL 3AREB 2EC9U 5C0RL 1A9EB 1U3JA 1VCAA 3VRLF 4QYOB 3OKEB 4L1HA 2WM0A 4MA1B 1T0MB 2F58L 1FFOA 3MNWB 3TH2T 4ETYA 1EO8L 3VXUA 3HZMA 2R4SL 1ZKAA 1RUQH 1QSFA 2EDYA 2VDOL 3VD3A 1T1ZA 1JTOA 3MUY1 1JVKA 1WBXA 1PYWA 4JFFD 1EUUA 4YE4L 1MIEL 3SDAB 1X4YA 3D0LA 4M48L 3K2MC 1KGCD 1RY7B 3T0BA 1FORL 1Q72H 3C6LB 5A2KH 2G60H 2APFA 3FO9A 2NY0B 3U0PB 4MJ5A 5C09E 4GBXC 5C9JB 5JXEA 4NO3A 4QXTA 2ERJC 5DI8B 1YUHA 1UC6A 3TO4B 4GAGH 3MLVL 4QRSA 2VXQH 5FHAH 1H3VA 1TCMA 1C7TA 1AR1C 1GGIL 5IVZA 4BSWA 1KIQA 4ZFFA 3OBAA 4NN5B 5C07D 5KVFL 1R5WA 4IRJB 4H0IA 1E27A 3G6DH 4JN2B 4YBHA 4JRXA 3LSOA 1U3HD 2VDRL 2W59A 4JKMA 3CCHB 1JPTL 4XX1G 4ZUTB 3TIEB 4YDJB 4LEOA 4FQXA 3OB0K 4JREC 3BT2L 5KOMC 1IQWH 3WFEL 4ZDHA 5CGTA 1OL0A 4LLVA 5CFHA 1DEDA 2RCSL 1BF2A 1JIBA 2H2PC 3S4SA 5CINH 1A7NH 2NTFB 3IFLH 4MJID 4WO4C 1FNEB 3S36L 4Y1AB 5D1ZB 5C7XL 5E5RB 5ISZB 1WEJH 3BZFA 5IB2B 2C3WA 3VXRE 2R0KH 5E08H 5J89A 2CRZA 2AQ3A 4Z7VA 5F7MC 4PJDF 3TT3H 5E2TL 4TSCH 5E00B 5FA3A 1UENA 5I8KH 2X44D 3B9KB 4WUUB 3C08H 4JY4B 4F57H 1A9BA 4EQ3A 5ANME 5FFLA 2DQGH 1WBZB 4HXBL 4U6XA 1YEHL 3OMZA 1S7QB 1LO2H 3IDXL 1ZS8A 3INUH 3AAZB 3ARPA 1IE5A 5J4MA 3QI9A 3QDGD 2P5EE 1X5KA 4MAYA 4BZ2H 4U6HA 4HHAB 5HDQH 1AE6H 3NZHL 4Q9RH 4PBXA 3O41A 4GRMB 3RUGA 3DXAB 3ESUF 4YPGA 4U0RC 2DLGA 1RIUH 1ZTXL 2VC2H 3WIHH 1MCPH 1IBGL 2AJ3A 2VO5A 2FEEI 4RX4A 1KB9J 3ULUC 4Q2ZA 5C0AB 1KCUL 1BJMA 1H15A 3RNKB 5H35A 3FB5B 3ZTJH 1Y0LA 3EJZC 3EYQC 3NPZB 3AMLA 1QRKA 1AR1D 1RVFH 4YHYB 1I9EA 4MMZC 1J5OL 3OG4B 4WEBH 4PD4K 4JLRB 2KKQA 2H3NA 3TVMD 5JPNA 1QPPA 2F9BT 4RMSA 4E42A 4X83A 2QADD 3CDGA 1L7IL 3QDHA 2VRAA 3F5WA 2HVJA 2VXSH 3FQRB 2A6KB 4KRPB 4R26L 1CGUA 3ARUA 5DK3A 3GHEH 3GZKA 4FQCH 4K3HA 2EEDA 4LSVH 3D1MC 4ISVB 3P73A 4XGZB 5IJKC 2YZ8A 5E1AA 1S7VA 3VFUB 5KS9B 3V0WH 3ALWA 4OZHF 2NNAB 3O9WC 4V1DB 4C56D 3ZTJG 1KCSH 3C6SA 5F7HA 5K59F 4HIEA 4MD4A 4FFZL 2DOCA 1AGFA 3W5MA 1LK3L 4TNVK 3BQUA 1F8TL 1RHFA 1GOHA 2NX5B 3BPOB 4P9HL 5GGQL 3L6FB 3RWFB 2DWDA 5KBNC 2X42A 4HH9A 3FFCB 1MJJA 1GGUA 1O5DT 4YLQT 1V3KA 1DN0A 1HKFA 5J6GA 4PGCA 1T03H 3PQYE 1ZHLA 4MZ3A 3L5XH 3F7QA 1HSBA 2OLDA 1IILE 4A2MA 3UTPE 5LGJA 1IGJB 4HUUB 4EDWL 3E8UL 3MX0A 3QDMB 1X7QA 4UU9A 1AO7A 1QLRB 1GCFA 2BHYA 3FQXA 3WFBH 3DUSA 4WY7L 2W65B 4LARL 1NGYB 3L3OA 3ULUD 3LRSB 4AEEA 2MPAH 4ZTOH 1FRGH 3RBGA 4L8DA 3HUJE 1NLBL 1DL7L 1U8IB 1XR8A 2EE3A 3EYQD 3LQMA 2EICA 3ZHLA 1FVEB 1CG9B 1YQ2A 4OAWA 2X4UB 4EEEA 5BV7C 2FJFA 3T0EE 1I1YA 2WSKA 1BZ7A 3MLUH 1JUFB 2FLRT 3KPLA 4XCYB 2P1YA 2B5IC 1TJGH 2XPGA 5F7LB 4E0RB 5A16B 2VLME 5JOFB 4JRYA 1QD0A 5IVXB 4Y19A 2V9TA 5IQ7L 3SEPA 4TUKL 4U1MB 3ZE1F 2OZ4L 12E8L 3PP3H 4JEGB 4KKBD 1RIVH 3V4UL 4LDLB 3DHJA 3SE8L 1PG7L 4K23L 4NQCE 2PYEB 3WV0A 3W9DB 4G6JL 1NUFA 1MFEH 1TVBA 4EBQL 5JR1L 4HS6A 4MA7H 3U7WH 2CJUH 2Z93A 2PW2B 1FJ1B 5ERWA 4XPAH 3CUPB 5CP3A 1MPAH 1I7ZB 3RQ3A 1G7LB 5I1LA 3M1BA 3QCUL 4WWKB 4Q6YA 2I9LA 1FL6B 1ZWIA 3SQOH 1AC0A 1C08A 1HZHH 3W0WB 3WMSA 3O9WD 4C4KO 4QXUH 5KAQF 4JR9L 3QZWA 4OLWH 2ZCLH 4O2CB 2BY0A 2GSIA 5FGCB 1EIBA 2J4WL 1KB5B 1SVCP 1SEBB 1Z9LA 3T1WA 1A4JB 1EAPB 1XGUA 4HX1B 1MHCB 3VFRA 4L8BA 3WLBA 4JPKL 5DMIL 4J4PC 4UDTA 3V52H 4GRWE 1G6RH 2D9CA 4WW2A 4CAGA 2A38A 5DR5L 2VLRA 2NY1B 4YHNA 3QIUC 1MFDL 2J5LC 4A6YH 3L3HA 2C26A 4JRWA 5DYOB 1FYTD 3SJVE 5B3JF 2ZJSH 4GUPB 4IOIA 3L5JA 5KSBE 3MSPA 5T1DL 1EEZA 2XI9A 1BZ9B 3MRBB 3VXSE 1ZT4A 1XGPB 3PHOA 1KNOA 4DVBA 1RUMH 3MCLL 3TBYA 4LP5A 3QHTC 5F9WC 3OWEA 3DV6B 1J8HE 2PXYB 2RGSA 3AS2A 1DLFL 1QSED 4YDLC 1RJLB 3C5JA 3BD3A 1PKQA 1CD8A 3N85L 3L5WB 3R4DA 2FYYB 4YO0A 3S3SA 2AJXL 1CLZH 3QDJB 1A3QA 4R4ND 1YYML 2OZ4A 1XT5A 3DX6A 1DANT 2DIAA 4LAQL 5KG9A 4ODTL 4OQTL 3BMWA 3Q1SH 5HYQA 2NZ9D 4LVHB 4C54A 1GRWA 1JHTB 2R4RL 3RJDA 1JZ5A 2XWJB 2V7NA 4YHOL 3G08B 4PJAE 5KTEL 4DKEL 1RIHH 5D9SB 2OQJA 4NN6B 4N8CH 3OB0H 1GAFL 3ZYIA 4CBPA 4I0CC 3HR5B 1D5IH 4QXGL 4Z7UA 1F4XH 1WWCA 3IYLW 4S0SD 5CEZD 1V7NL 3STZB 2L4OA 3THML 4ZSOB 2R0WL 4G6FB 1XF4B 3L3JB 5C0CD 4JFFA 4YXKH 1ZHNB 3JV6A 1MH5B 4XX1E 4OJFH 4R8WL 4N90D 2JJVA 4JG1L 1LGVA 4PJEF 1KB9K 3VG9C 4Z95H 1ZA3B 2NY5L 3Q6GL 4ZNEE 2JB6A 4PJIB 2WIIA 4NSKA 4X7DC 4D0CA 3C09C 2O93L 4QRUB 1NMCB 2HJKB 4WENB 1ZGLB 4DN3L 1P4LB 4JPIB 1HEZA 3I6LD 4F9PA 4IIQC 3ARQA 1N0LA 2MKWA 1MCFA 1U8PA 4KMQA 5MHSE 1HH6A 4WU7A 1JF1B 1WSST 3BI9X 3C2SA 5HY9B 5JMRA 4JFDD 4KZDL 5C07A 1SM3H 3WS3A 1DVFB 4GKSA 3MO1B 3BP6B 3O4LE 1I3GL 1U3HA 3QXAA 5DC9B 2J8UE 3JBG7 5BJTA 3IDUA 3V5HB 3ORJA 4PB0L 3N06B 2XTJC 1T1WB 3QH3A 3BKCL 5DWUL 3QEGH 1JHLL 3FQUA 3CFBB 3MLXL 3HE7D 1AD0A 3QUZC 5D7IA 3CDCA 2C5DC 3O6KH 1BD2B 3QB7C 7CGTA 3HFML 4ZFZA 3QWQB 4QLRA 4JZJB 1X5ZA 4MJIA 4U3HA 2B20A 4O4YL 3TA3C 3AS3A 4PGEA 2X4OA 5FYLD 1TNNA 5F70A 2IANB 2HFGL 2IF7A 3A6BL 4JN1L 4S2SB 3ZE2F 2AI0L 1NGWA 4BQBA 3WJJC 4P2QB 1KIPA 1LP9B 1AP2A 4YH6A 5GS0H 1UWGL 2RR3A 1HWHB 4XBEH 1YEIL 1VGEL 2A1WH 3KYAA 4FZEL 4UIMA 2BSRB 3PWUA 4CKVX 5DMKB 1D5ZA 2C7UA 3RX7A 5DQDH 1OSZB 1UM5L 1W72H 1SMAA 4UV4H 5DVOA 1PX3A 1T22B 1WZ1L 4NQDD 2FRGP 2R0ZL 4I3RL 5D2NB 5GSRA 5DTFA 4P48A 4G43A 5EU5B 4OGYL 4LBEA 1A7OH 3MCKB 4GKOA 1G0YR 3QHZH 2Q6WB 3UPCA 5FYKH 3DI3B 1MWAH 5FUCE 4JQXA 3KPNB 4NQSA 3ZT5A 8FABA 4PTUA 1W2KT 4MNGB 3WIIL 1LO0H 2QEJA 5TF1L 1QR1A 1MVUB 1R3KA 2YC1B 5FA4B 3MLTA 2CKBH 3OJVC 2FZ3A 5ID1A 2ED8A 3GSNL 3MCG1 2Q8AL 4YJZL 3PL6C 1NC4D 4ONHA 5T3ZD 1RAMA 1ZANH 2VDKH 4WUUE 4UNTA 4S1RL 2WBKA 4Y5XA 4BELD 2B1AH 2KPNA 1CD1B 5IG7A 3ULUL 4JPVL 4K71B 3TV3L 2NXYD 4NRXB 2E9BA 5GGRA 4HFUL 2YA0A 5DZLA 4Z0XB 4N8VB 3RI5F 2XXCB 2GJJA 1FVCA 3CFJA 1R3IH 4NBXB 1ACYL 3QO0A 3S34H 1GJIA 1WZMA 4OF6A 1KELL 3TVMA 3H6JA 4UB0L 2CQVA 2E27H 2BVEA 5DSCB 5C92A 3RWHA 1AY1H 2EXYC 3V4VH 5CKAA 2XTJD 4PRDA 3DUHA 5C2BH 3KNBB 3BVNB 4U6VH 2Q3ZA 4GSDH 4IJ3B 1J18A 4LLAA 3QUZD 1HYRC 1A7PL 3IU4H 3QT2A 5AAWA 2DQCH 3VFNB 1CVRA 3UTQB 4Y16C 4CU8A 3HHRB 4Y0GA 3PP4H 5FK9B 1FSKB 2HN7B 3B2VL 4C56A 3O6FD 1F4WL 4KK8C 5IW3A 4DZBA 4P4KB 1FFPA 2YK1H 3QXDB 4KU1A 1JJUA 2KL6A 4WDIB 4X9IA 2VITA 2SEBA 4OFYD 5ID0B 2J8OA 2AV7A 5CJBA 5D6CA 5F9OH 4PJ5D 3H9SB 4PLOB 4YWGH 1P4IL 4L4VB 4GO6B 2XY1A 2V2WB 2BNRD 3PJSA 3SDXA 1INEH 4NKQB 5I17A 1C5CL 3RDTC 5EZIL 3NGBB 4OLZH 3CVHB 2QQLH 5DK0B 1H5BB 1XIWB 3GSNA 4RMTA 2ZNWA 3BKJH 3U4EB 2ORBL 3QG6B 1AHWA 1TQBC 3O3AA 5FECA 1EGJH 3DRTB 5EUOF 1ED3A 3KPPB 4XVTH 5L88H 5LGHL 1YEFH 2NX5E 2DQTH 3QCTH 3I75A 4LOUD 4CVWA 4X6DB 5DMYA 4KI5C 4HUNB 3L7FB 2LABA 4YHIB 4D9RE 1PW3A 5D5ME 1RFDL 3I6GB 3UO1L 5DRNB 4X9BA 4PP2B 3S35L 3E6HA 4XCEB 1M6OB 4FMKA 2NY3C 5CEYA 1FH5L 1K8DA 1HWGB 4EKXA 2PO6C 1VB9A 3GRWL 5DHVA 2X1OA 3E6FA 5BV7L 1BVKB 2HVKB 5DEFB 3QIBC 5HI3C 4WU5B 3BIAX 2M8XA 5IF0A 4JDZB 3G6JF 4I4WA 2VN7A 1F58H 3L3DA 4XCFH 2J88L 1A02N 3SGEI 4I2XA 1JGLL 4PJ7A 1FGVL 4Y16D 3MRRB 3IB4A 1D6EB 4CVXB 2HT4C 1WK0A 2AAVA 2IADB 4XP4H 5DD0L 1NGZA 3GSQA 2UZXB 3VFMB 3O9WA 2AEPL 3KYKL 3NACL 4KK8D 1NGXB 2CDGB 5JW4M 4O51A 5CGYC 5HGAA 2R2EA 5CEZL 4X6BB 4CMMA 1IGCL 3CH8A 5DUML 2PTVA 3VFTA 2VIRA 1CZ8H 5BZWB 1EXUB 3V6BR 4PRHB 1CTOA 4YXLH 5AZ2H 3ULVE 3V0VA 4MCZA 4K7PL 1KN4L 1LD9A 1NGPL 1JNHA 3JXAA 2P8PB 3U46B 1I9IL 4DTGL 4YR6A 1N2RB 5B39B 1OAKH 4N0UA 5F7KC 3MJGX 5C0EA 3P4OB 1FP5A 5T1MA 4NT6A 2ZUWA 4G8FA 1EEYB 1MHEA 4B0MM 1CE6B 4TOYH 2AEQH 4M43L 4A2LA 1J05A 1U8OA 4G3YH 3HPLA 5FDYA 1FYTA 3D2UB 5B4MC 3PV6A 3HNSL 3UP1A 2X70A 3BWAA 1N64L 1N6VA 4K3JL 4PREB 5E6ZA 3C60B 4WGWB 3O3EB 4BH7B 5BQ7A 3L1OL 2R0LH 1K2DB 1Z6JT 2ADGA 4OIIL 2FO4A 5KSVA 3MZGB 4KI5D 1QSEA 2P8LB 4AIZA 4NQTA 3ARDC 3GRWA 1NJ9A 4PJXF 3WNLA 5GGVL 5GISH 4D9LH 2A9ML 3A6CH 4BYHA 5DD1H 4EXKA 2CLRA 1ZT1A 4Y2OA 2BSSA 1LEKB 2HJFA 2PO6D 4BH8A 1ULVA 1TQCB 4PLJD 5T3XH 2R2CA 1XAUA 1A1NB 1O7VA 4CU7A 1UB6B 1U8MB 1GOGA 3IJYB 4YFLF 5FYLL 1E4KA 3D25B 1CFSA 3IJSA 4LLYA 3W9EA 3F6IA 2OJZL 4ZS6C 4TQEL 1HHIA 5IW6B 1MUJA 3MRKA 3W39A 1NGQL 1CLYH 5CWSA 2VLKE 4X5XA 5JOPD 1X5JA 2HT4D 5ENWB 5C0CA 2JF1A 3HI1B 5HHNB 2DKUA 1CBVH 2P49B 4YPJA 3CFKA 4QGTA 4GRLC 4HGKC 1WTLA 5CGYD 2GI7A 1W8OA 2BFVL 3BH9A 1AD9B 2HLAB 4Q7DA 2HAZA 4OFKA 2H6PB 5IW1B 4CGTA 2AVGA 3OJDA 4HKJA 3BZEB 2LVCA 3CSBA 2VDPL 1R6VA 5I8CB 2VLLB 3MV7E 5TQ0H 2P24B 3O3UN 1IKNC 1YMHA 2Q8BL 1Q0XL 2BVUA 3S3JA 3U0TB 1P5VA 3RY6C 4WFFE 1KN2H 4W4OC 4XPHH 3RY4A 2YD8A 4FXGB 5D1XB 1S7RA 3NIDF 1JPFB 4JFDA 3O6MH 5BRZD 3R06B 4LHUD 3O11B 3T0WA 4PYHA 3IKCB 5DD5H 4F15B 5TGBA 2BCKB 3L95B 2BNUB 2AGJH 4ELKB 3RAJL 3QULA 1KIRB 2C4XA 3S37H 3FQNA 5F3HB 2OCFD 1FFRA 4MAUL 1X5LA 4RMUA 2YD5A 1LE9B 1JTPA 2B8OT 3HE7A 3UYOD 3WDJA 4RFNC 4DKDC 1TJHH 3V5KB 2EKSB 3RIFF 4Y5YB 2AK1L 4HK3J 3U1SL 3J8F7 4PLKC 6CGTA 4MJ6A 4P2OD 4BQ9A 4F3FB 4LKCA 1TVHA 1B2WL 1AXTL 1I1AC 4EN3D 4U7MA 5KJRH 5L0QC 5BS0B 5EZJB 1HILB 4C4KT 3MNZA 4YBQD 2JK5A 1ZVYA 4W4NA 5CIPA 4F9LC 2EIBA 2F53B 4RAUB 4G8GE 5F96L 3CZFA 4OKVB 4JB9H 5IMMA 3EHBC 4R6UA 3BH8A 4XP5H 3TBTA 1QFPA 4LSQL 4XNZB 2ITCA 1CTNA 4M4RA 4NQDA 3DGGB 3GJFH 1R3JA 3MRGB 3TZVC 2D0GA 3HC3L 5K9QG 4L5FL 1D3CA 1Q9WA 1YNKH 3EOAA 5EPMB 2YUWA 4F7CB 5HYSB 1IFHL 4HZLB 4NP4L 5C0RH 3ZT7A 4PV8B 3OXSB 43CAA 2IANE 4ZD3L 3B9EA 3K46A 5AWNL 1LP9E 4EI5C 2F58H 1OB1B 2OXHA 3VXME 3BKYL 4OF8A 3STLB 5FYKE 3GUTA 1EO8H 3FT2B 3V2AR 5JPMA 1NC4A 4GG8B 1XZ0B 2R4SH 4OCSL 1BFOB 1MELA 3NPSB 2IWGA 4KJQD 4LCWB 2VDOH 4Y4KC 5DMGD 1NKRA 3ALPA 3RNQA 1T7YA 3MNVA 2X9XA 2Y1VA 1MIEH 2FHBA 4YE4H 3WL9A 5DVMA 1CCZA 1KTKE 4M48H 4QEGA 5GGTL 3G5XA 3SBWC 5B38B 5I16A 5IV2A 4KKCC 1FORH 3OAZK 4KKAC 2DD8L 3VCLB 5INDA 1F97A 4Y4HC 4DOHB 5L8JB 1OTUC 1F3JB 4HD9A 3MLVH 3PWVB 2A6JA 4AEFA 2VR9A 5GZOC 2KZWA 2PNDA 3PGCB 3O8XB 4ZPVA 5C0NC 4YHLL 1GGIH 5KVFH 1NFDE 4EUPB 1LDPH 4PJ9B 3F62A 3ZYJA 1IQDB 5SWSB 4ZXBC 4L29A 1T3FB 2X10A 3U2SB 1ZV5A 1A47A 4UILL 2VDRH 2XQYK 2BSTA 2I07A 5D7SH 1IC1A 1JPTH 4PJCE 4RWHA 5CSGA 3O6FA 1I1AD 1YY9C 2WBJB 4NC1C 2UYLB 3WJJA 2V9QA 3G6AB 5MEQB 1AGDB 2O5YL 4Q9BA 5IROA 3MA7B 3UTSD 3VDBA 4P23C 3WFEH 1A7BA 4OFYA 1OGAB 1XH3A 3T4AB 2ADFL 1HXYB 4Z0BL 1JCKA 3WNPA 5DXWA 2XKNA 2RCSH 2MTPA 3EHBD 4IRSB 3TCLB 2EIEA 1OP5K 3BP5A 3S36H 1Q38A 1JGDA 4GKZB 3G6JA 5F7NC 1ND0A 1ZK9A 2YD7A 2BNRA 2WNGA 1DBJL 5K9OB 1FBIH 3CXHJ 4QHKI 5LJYH 1RJZB 4HUVB 5E2TH 3IRPX 4I0KA 4GG6A 3U9PL 1LNUA 4PLNC 1UXWA 5B8CB 4EI5D 1FG2A 1N3NA 3MRCA 5DJAA 5HHPA 1KPUA 2BHUA 1AQDA 3MLWL 3VWJC 4HXBH 4NJ9L 1NDMB 1YEHH 3Q5TA 5T1KD 5IB3A 4LLMA 5GGTA 3ROOB 3IDXH 3S8WA 4ERSL 1KG0B 4Y4KD 5T5NF 3PWLA 4Y8DC 4I3SL 3PDGA 3H9SE 4L4VE 4TRPL 3ARSA 4NGHL 2HJLB 4KQ4L 4RAHA 1MCWM 4UQ3B 4FTVB 1UWXK 1ZTXH 5IMLB 1IBGH 3FRPG 1A3LL 2COQA 4Y4HD 1KCUH 4RQQA 1OTUD 5H94B 4HKBA 2MHAA 2P5WB 5GZOD 4HT1L 5EIQA 3PWJB 3DETD 4J1UA 5I73B 1G9MC 4HG4K 4JG0H 2ITDA 1U8NB 4OCMC 4Y16A 1J5OH 4ZXBD 2YEZA 3KPOB 3P4MB 5ELIA 4RSVA 1U9KA 1L7IH 3IDJB 5E94A 5LQBL 3GMLB 5HHOE 3BX7C 4R26H 4TUOB 3X17A 4XHJD 1BEYL 1U92A 4F37K 3GMOB 3U79A 3EDFA 3GSVB 3NTCL 3NA9L 2DQEH 2Z91A 4PJ8B 4QCIB 5I9QB 1N4XL 1EBPA 2MFNA 3LD8B 3TJHC 1D6VH 1YDPB 1KTLB 1TTFA 4XWGL 4XXDA 2PW1A 1DQQB 2IPKB 3S88L 2C3HA 3QUYC 4UUJB 1T5XB 5D7LE 4OGAC 2CIIB 1KCKA 1K6QH 5ABDE 1LK3H 3QRGL 1F8TH 5CP3H 5GGQH 1D5BA 2E8YA 2RJMA 2DKMA 3LKPB 3OPZL 5HHMB 2EDRA 4OUUA 3FRUB 3VGDA 1MF2L 5FDWA 3HA0A 3NA4A 3T65B 2AKRB 3WN5C 1F11B 5CJQL 3MUGA 4U6YB 2YWZA 4GS7B 1A6WH 4FZ8L 5HDBF 3D85D 4AK1A 4HKXB 5A43C 5LXGL 1RUAL 5I71C 4EDWH 1DBAL 1OP9A 1G0XA 3E8UH 3MYZA 3ARWA 5K9KB 4KHTL 4U7KA 4RFEA 4HUMB 3RTQD 4WY7H 2PO6A 2XIDA 2HKFL 4LARH 1ZAGA 2F54D 3HZYB 3VXTA 2G75A 1ACZA 3GK8L 4AQ1B 1M4KA 2HWZL 3G5VB 3MUHL 1DL7H 1NLBH 5E2WL 2A74A 3BZDA 5FO8B 2OSLA 3FL7A 1XCTB 2Z8WC 5IFHL 3KYOB 3SE3C 1PQZA 4KVCL 3EFFB 5DJCB 3H7BA 1JNNL 5C09D 3EJYD 3GMNA 3D39B 4GKNA 1T4KA 4M93B 3G5YA 2VERN 4PJHE 3QZWG 4UQ2B 4QTHA 1BIIB 3F6LA 3ZSTA 3MRDA 4OKDA 1RURL 5IQ7H 1NEZB 4NZDA 1R5IA 1YEDA 4TUKH 5MEOA 2OZ4H 5KW9L 4U1HB 12E8H 4ZO6A 1U8LA 4TYUA 5CZVL 2BVPA 3FB8A 4Y4FC 3BUYB 3V4UH 1UXSB 1JGUL 4JFOB 1PG7H 4K23H 1KXQE 3JV4B 2YD3A 1F90L 2C4FU 1NCCL 1Y6KR 4G6JH 5ETUB 2IBBA 5GGSB 4EBQH 3X13B 5JR1H 3BDBA 5EO1A 1VEOA 1CFNB 2DWEB 2GJ6B 5FF6B 4KMTH 3QCUH 5JMOC 3QEHA 1PDKA 2QHLA 5BOZG 5BRZA 4OGAD 1F2QA 3DIFA 4JR9H 4HK3N 3MTRA 4U0QB 5EN2B 3WS6C 1KTRL 3H9HA 1OWRM 4BFGA 2J4WH 4PJDB 4NKDB 4JKPL 1MCOH 5J6HA 3C5ZC 2MCG1 1UCTA 2B1HL 2JCCA 3AY4A 3KJ4B 5AD0B 1WC7B 1QFUL 3HC0A 3VXUE 5E8EA 1RI8A 4M1GL 5IFAL 3SE4C 1QSFE 4JPKH 3LMJL 4RBPK 5DMIH 4LP4A 5F7DB 3IETA 2NTSP 3VXRD 1MFBL 3C8KA 5DR5H 5GJTL 2AJSL 1ZEAL 3AS1A 3CVIL 2IAMD 3MV9B 4MQTB 4OD3L 2CGRL 2ZG1A 3RWJB 2FLBT 2IALB 5IEHA 4P2OA 4EN3A 1P7QB 3OAZH 5T1DH 5SV3A 2GSGB 4NQVB 5KOVC 2P5ED 3BXNB 3MCLH 1NEZG 5DJZB 4MNQB 2YHGA 3J7HA 2X6MA 3WHE1 1DLFH 1Z0MA 1KC5L 1M7IB 1U91B 4I3GA 1UACL 2LV4A 1MAKA 3SDDC 3N85H 4YIQB 3N1GC 3V6FB 1DQLL 1P84J 4RCAA 3T4YA 4S11A 4EIGB 3HNVL 2AJXH 3DURB 1YYMH 3ILPB 4N9GA 2X05A 2FJHB 4LAQH 1J1PL 1T1XA 4QXWA 4ODTH 4OQTH 4KUCF 4LVOC 4PYGA 2R4RH 1RJYA 4Z5RB 3OXRB 3PHQA 3ULSB 4YHOH 4M7LT 5D4QA 5KTEH 3T0EC 4DKEH 4Y4FD 3QAZB 1XF3A 1T6VN 3TBSB 1GAFH 4PRBB 5BS0E 2H32A 3SKJH 3PGDB 1CFQA 4F2MB 2WWMD 3KPRD 2W0LA 4QXGH 2DTSA 1FG9C 3LV3B 4J12A 4AH2B 5ICYA 4ESKA 1V7NH 2R0WH 4C57C 1N0XL 4OZHB 2VZ1A 3OJMB 3AVEA 5E8DL 5ACMA 1KYOJ 1OP5H 1I7UA 1UH4A 2G5BA 3BMVA 1HK6A 5EORL 2R1YB 3Q6FB 4R8WH 1JPGA 4JG1H 1HXMA 1IEBB 1VADA 3MGTA 4WWID 1QHPA 2NY5H 3Q6GH 1DQJA 3HG1B 5EU3B 3VJ6A 2VKXA 3C5ZD 3KPMB 1YPZE 5DJ2B 1LEGB 4WI6A 4MSWB 4DN3H 4CNIA 2VDQL 1DUZB 5C3TA 3FB6B 3Q3GB 1TITA 2DM7A 3JTSA 3OKDA 5C0BB 2GYSA 4KZDH 4J6RL 2NXZC 3TJEL 3FN9A 2D4FA 2OL3L 1K8IB 1I7RB 4AENB 1CXIA 1U58B 4JFED 1PFCA 4LCWE 3FO2A 5EG6C 2F19L 1I3GH 1ZT7A 4YNYB 1CDJA 1AXSB 4OZIF 3IAQA 1QFWI 2E7LC 2GKIA 1GXEA 1I1AA 5C0DB 1MRDL 2DLHA 3P0GB 2IH1A 3IDYC 4I13B 4OLXL 1CWVA 1UWXH 3UTSA 5DWUH 4EDXB 3M17A 1JHLH 2VABB 5L7XL 4NZJA 1YMME 3MLXH 1OP3K 4MDIB 4F9LA 2NY4B 4M3KB 5EU6B 3SO3C 3TPUA 3E3QE 2LTQB 2I60L 1WWAX 3ZHKA 3UBXB 3HFMH 4KDTC 3MR9B 2BVYA 1K5NB 5EO9A 2HFGH 3A6BH 2FHCA 4JN1H 2AI0H 1EO7A 4HUXA 4Z76B 2OI9B 3BP7B 4H88L 1UWGH 2ED9A 3LRGA 4XNQA 3DYMA 2FGWL 1G7MA 5F1IB 3SKUD 1YEIH 1VGEH 1IZKA 4YGVB 3FO1A 2WIMA 1G7IA 4FZEH 3CMOL 1WZKA 4OV5B 1X5HA 4EI5A 1YEGH 1UM5H 1R3LA 5C08E 3CAFA 4Z78A 4NN7B 5C71A 5D7JB 4IMLB 3GDBA 1WZ1H 2R0ZH 4I3RH 1QTYT 4Y4KA 4HPYL 4OGYH 4NQCD 5MEND 1QVOA 4BZYA 4UOJA 3K80A 3PWPE 4NHCH 4PGDB 4NQEB 2I9TA 2KQNA 1IAOA 3WIIH 5TF1H 2AJYL 3FQTB 3QPQC 4ZAKB 1Z3GL 2DB8A 1WJ3A 4P99A 4S10A 3K74B 4Y4HA 3L9RA 3VFGH 2JJUA 4WJ5A 2OL3A 3GSNH 1TJIL 2Q8AH 2E7BA 1UM4L 4QY8B 5DZOA 1CFTB 4G7YL 1OAXL 4RAVB 5BXFA 3U30C 5I75C 5DGQA 4H0HB 4BQ6A 3ULUH 2FNBA 4JPVH 3TV3H 2NXZD 4HFUH 25C8L 2XKUA 1LE5B 1T21B 2VISA 1AO7E 5DRWA 1ACYH 4R90L 4ZXBA 1OAZL 4YHKL 5EA0L 1KELH 4OD2B 1OTTC 4UB0H 4MA1C 1G9ML 4QT5A 5H2BA 1DR9A 4KKLC 4QGYA 1A6TB 2XWBB 4PJBA 4LRIA 3RWGA 2E6PA 5MERA 5A40E 3ARGC 3N9GL 2JJSC 5DHVH 4WTWA 2B0SL 5BO1H 1QSVA 1A7PH 3SJVD 5DUBA 4YBLB 1F3RB 4LLWA 5GSVB 3LS4L 4GXVL 1VKXA 3BKML 1YEEL 2P5WE 3CH1A 4PJFE 4IDJL 4JRYE 4ORGB 3VE0A 1S9XA 3B2VH 1J8HD 3LEYH 4GW5B 1F4WH 4L4JA 4P5MA 4KMLB 3U48A 3RVTC 5KAQG 4H5SA 3T0XA 3ROLB 2EE6A 1XR9B 4UT7H 4LCUB 5D2LF 4HEME 1MSPA 1SJVA 5E8PA 1FCGA 5HHQA 3QQ4A 2P47B 2F5AL 1P4IH 2WMPA 3OKKA 4MB4A 4P57B 1AGEB 2APBA 4ONGL 4OZGF 5JNYA 3D85A 3CFDA 3CFCL 3S35X 1V3JA 4H20L 1C5CH 3K8KA 5HYJB 4X7TA 3ET9F 4XMKL 1M05A 5EZIH 5ESAA 3DARA 3I3DA 1ZVHA 5JIPA 1G7JB 1U8JA 3EZ8A 1QRND 4PJEB 5C86A 2ORBH 4JHBA 3RTQA 2CDFB 5TDOA 5I1EH 5J13C 2C1PA 3MV01 5LGHH 2F54A 4FG6C 5CD5D 1SJHB 2YZ1A 1N7ML 5CD3A 1G7PA 2EYRB 1JP5A 5IB4A 4WHTB 2W0FB 4N0FB 2VLRE 3CFEB 3VW3L 1C12B 5FUCC 1KV3A 1P84K 15C8L 3WHXA 2CH8A 1W72B 2YUXA 1RFDH 2QQQA 1JGEA 4L9LC 2YPKB 5C09A 1TZHB 3MV11 3QNXB 1FH5H 3ARED 1VPOL 5CBAB 5KVEL 4JDVA 1EFQA 3GRWH 4YEEA 3B9KC 3V9FA 4KKLD 5IMOB 2Y25A 5MHSD 3VA2C 5F71A 1XF2A 2IBZY 3P77B 4UV7L 3ES6B 1PZ5B 1INQB 3LKQB 1E28B 3O4LD 1PKQE 4K7PX 4OI7A 3D18A 3WFDL 4K3EL 3OHXB 5HGDA 3GI9L 3SDAD 4XNUH 2J88H 4OBSA 2XWTA 1CGSL 3RZCC 3D3VB 2VTFA 3LDBB 2I25N 4PIRF 2B2XL 3C6LD 5DD0H 4FQHB 5HVHB 2XFXB 2V2XA 3RU8H 2AEPH 2E7MA 3KYKH 3NACH 4WW1B 3MRJA 3KYNA 2YSSA 1T0NB 5CEZH 2DYPB 3RGVC 5FEBA 1IGCH 2HG5B 5DUMH 1S5HA 4QRRB 5B3NA 5DMJB 2HH0L 1HKLL 4I18A 3VGFA 1H8OA 4K7PH 1KN4H 5J1AB 4F7PB 1NGPH 3IFPA 1E6OH 1I9IH 4DTGH 3VXRA 4FABL 3QNYA 5DJ0B 4P3CL 3UX9B 3I6KA 4D9QE 3DMMC 2VSCA 3IDMB 5I74B 2VH5L 5EU4A 1XGTA 1ZHKA 4R2GB 4M43H 1KGCE 1WCQA 2ZP0T 4GFTB 4D2NA 2IAMA 3GSXB 3DJ9A 5EDXA 4KRPC 3ARTA 1IAMA 4NYLB 4CW1B 3S9DB 4KTEL 4OCNC 4YUEL 2UZYB 3HNSH 2QKIB 5JW5B 1L6XA 1N64H 4K3JH 5F1OB 4QHKJ 3LHPL 3RVWC 2OTWA 2EDLA 4FG6D 2P5EA 2MNUA 2DMCA 2NY7L 4I0PC 3L1OH 1A0QL 3H2WA 1UVQA 4O2FB 4OIIH 1MHPH 5C07E 5D1ZD 3NBNA 5ISZD 2BOBB 3HZVB 2YPLB 2A9MH 1NSNL 1OSPH 1VERA 2BMKB 3D48R 5FOBA 4LSRL 3MFFB 2CDEB 2FR4A 1EZVY 4BKLB 1OF2A 1DDHB 3V0AC 3B9KD 3VFWB 2F8VA 4J8RB 4WUUD 4OLUL 4XPGL 4W6YB 4X6FB 3QUML 5FYLH 2Q7YB 4Y4FA 2ZUXA 4BFEA 4LNVA 2OJZH 4TQEH 1NBZA 3RHWF 2BVQA 4M1CC 5IJVA 1UZ8A 3X12B 1OP3H 4P46B 1NGQH 3KPRA 2VDLL 1JZ4A 4MJIE 5ACZB 1J86A 5D1QC 4WI2A 2OBGA 1KCVL 2IQAA 1IGML 2OK0L 5IIEB 5JW4N 2VE6A 4R0LC 1MCBA 5C0AD 3BWUC 3ILQC 1WTGT 3HI6L 3RGVD 3Q5YA 3QO1B 4FP8L 3RWDA 2VDPH 3C5ZA 4FQ2L 3RY5A 3JWOL 3V5DA 4JCMA 2Q8BH 4CADA 1VEMA 3BDXA 5IFJA 1A14L 1OGTB 1CL7L 4KDWA 4YK4C 3SE4A 4R4FL 3MROB 1VHPA 2V2TA 5DJ6A 1OW0C 3H8NA 3B5HA 3DMMD 4KK9C 1P69B 2D0FA 4I48A 4HUWA 2F74B 1S8DB 4JFEA 3ULVC 2D7QA 1CICC 3VFPB 4DZ8B 4KRPD 3HNTH 4OZHE 5D7KE 2O61B 3MRLB 3RAJH 3DI2B 5K59E 4JFXA 1EEUA 1FVDB 5EUOB 2XOTA 3EOBA 1DEEB 2UWEA 4MAUH 3PXJA 3ESVF 1JI1A 5HI4C 1AJ7L 3QFDA 3D0VA 2NY2C 3UTZB 1YN7A 2PUQT 3RL1A 1VFAB 2AK1H 5L9DL 1V3LA 2IBZX 1ZHBB 1UKTA 2JIXB 5HJ3A 2VZUA 5I1AB 5E4EB 3U1SH 2NX5D 5LAXA 4MQ7B 5C0BE 1KJVB 3QUMA 5FB8B 1B2WH 3VXPB 1AXTH 3O4OB 3FFCD 3HUJA 4G8IB 1QR4A 2GUOA 4RIRA 4D9RD 1ONQA 4LIQL 1S9WB 4XNMB 1NBYA 2CK2A 1S7XA 3D69B 2E3VA 4M7JL 5F96H 4RMWA 4IS6B 4M1CD 1VFBA 4RGOL 5EOTB 4LCCB 2GK0B 4LSQH 3CSYA 5D1QD 3QDMD 1XF5A 4C56E 4JO4L 1NLDL 2CIKA 4NQCA 3HC3H 2C3GA 5MENA 3ZZ1A 4L5FH 4P4RA 1IFHH 5F6IC 3ILQD 4NP4H 3U36A 3NN8B 2F8XC 4GAJL 3IFNH 4ZD3H 3VFSA 3WUWB 4RFOL 5AWNH 4PRNB 1VENA 3ZE1E 1EVTC 3BKYH 1BHGA 1RULL 2AV1A 3LKOB 3E2HB 4OCSH 2OP4L 5I8EB 4UDUA 1P1ZB 1CD9B 3BRDA 5CP7B 1YNTB 2IPUK 2ZSVA 4OFDA 5GGTH 3ZYZA 3ULVD 4QTIH 4ZUVB 1A7QL 4MHHI 1RZJH 2P48B 2GFBA 3B6SB 5JZ7D 2PYED 2E7LA 2ADIA 5E9DB 1MLBA 1X9QA 5CZXC 4HMCA 5I30L 2AEWA 2EIZB 1EZVX 1T7XA 5I76A 1Q72L 1U95B 1GGTA 5HI4D 2G60L 1HHGA 4WWKD 4YHLH 4ODWA 3SJVA 4NRYA 1ZVSA 4PJXB 3ZO0A 4LASL 3ZKXC 4U1LB 3DOSA 1ORQB 1KUMA 1J8HA 3MRNA 1H3GA 3HZMB 3QFJB 1R3HA 3UPRA 5DS8A 2Z31A 4XBPB 2BXZA 5I6XC 3HB3D 1T1ZB 2J1KA 2O5YH 5HGBA 1PYWB 2ESVB 3LEVH 1L0XA 2ADFH 4Z0BH 1BLNA 3D0LB 2DQJL 2BRRL 3GSRA 3T3PE 3U6RA 2NY1D 4I2XE 2X9YA 5IVXF 1QSZA 1N8ZB 3FO9B 2CR3A 5KSUA 2XN9B 5DC4B 1SY6L 1FC1A 2YN3A 1IQWL 1JHKL 1YUHB 5K33A 4PJAA 4G6ML 2ZUUA 3ZKMC 4NBZB 1K9TA 1QEWA 2W92A 1LWRA 4P3DA 4KJYB 2ATKB 2CLZA 4X8XA 5GS0C 4X99B 4BSWB 1QRNA 4PR5A 4ZFFB 5I1DA 1YZZA 4NC0B 1S9KC 1C1EL 2VLKD 1E27B 3U9PH 3LSOB 4AM0A 2YR3A 3MLWH 4NJ9H 1UH2A 4U1KA 3QDJD 5K9JL 4FQXB 4U1IA 3UZVB 1EJ6A 3OGCA 4ERSH 5HXMA 3NIGF 4Q6IB 3MXVL 3KXFB 4I3SH 4QHNB 5E8NA 4ZNEA 4M9PA 1FYTE 4TRPH 4E9LA 4BUHA 4NGHH 3TF7C 2I5YL 3AREA 4KQ4H 3L3KB 4HF5L 4QYOA 4KROB 3MA9L 1EHNA 4GMTL 1OD7A 1A3LH 3ZMRA 3MNWA 4PJEE 3HE6B 1Z5LB 3BZFB 3MBEC 3RVUD 4HT1H 3O4LA 2JJSA 3IS0X 2VQUA 4G6FD 4H8WC 3MJ7B 2VXVL 3VFVB 3LN9A 3SDAA 4F80A 5FA3B 4TVPL 4QO1A 3C6LA 3QRFM 3B5TA 3AGVA 2VOTA 1MQKL 3REWB 5I1HL 3U0PA 5C9JA 2BJML 4P2YA 4JFYA 5LQBH 1T66C 5IP4A 5DI8A 3QCVL 2DTML 3P4NB 2QJDA 3BW9B 3O45B 1BEYH 1SY6A 4HWBL 4NRZA 4JANB 5DFVD 3UC0L 3NTCH 3RUGB 1N4XH 4GAYB 2DI9A 4Y5VB 5F9JB 4IRJA 1JK8B 1U42A 3T3MF 2AJ3B 4XWGH 2VXSL 4L4TB 4JN2A 1W0VB 4Q2ZB 3S88H 5H35B 3GHEL 3CCHA 4CN4A 3TIEA 1QBML 4PRIB 4YDJA 4G8GD 4N90E 1GZQB 1J7VR 4LSTL 3QRGH 1ZA6B 1HOCA 2A73A 3CLFL 4X4ZA 1J10A 3OPZH 3IAGC 1OTSD 1MF2H 4ZTPL 1GSMA 1BD2D 1EFXB 1B6DA 2H3NB 1HQ4B 2H9GB 5JPNB 3I6LE 5CJQH 4UI2A 3FN3A 3CDGB 2HMIC 4IM8A 5MP6L 5EH1A 4ETQA 1E6JL 2HVJB 5D1ZA 2IAND 2KQMA 5ISZA 2GITB 5LXGH 1RUAH 3ELAT 4JDTL 4L9LA 1DBAH 5CJOL 4ZPTB 5DLML 3BUTA 1G9NC 5FYKD 1E4XL 2ZOLA 4KHTH 4ACPA 3L5IA 5E1AB 1FN4B 2HKFH 3L5XL 1F13A 2XG4A 5DF0A 3B9KA 1ZLWH 4WUUA 2ZUQC 5DJXA 4JY4A 1I1CA 5F93C 4ENED 5HI5D 1WBZA 3O2DL 2HWZH 3O6LH 2FECL 4MD4B 1IVLA 1S7QA 5E2WH 3T1FB 2NY6C 4GAFB 3C5SA 2P45B 3GMRB 4HHAA 2WP3T 1JNNH 4FQ1L 4HH9B 2UZIH 1MJJB 1X6LA 5ILTL 1UQSA 3UTTE 1XIWC 4GRMA 3DXAA 3VH8G 4Z7WF 2XZQH 4HWBA 4AG4L 2YPLE 4PGCB 4XMLH 5EC1A 4TNWF 4QRTB 5C0AA 5KW9H 1T66D 5CZVH 3RNKA 3FB5A 1HSBB 4IEFB 4NOBA 2D7OA 1JGUH 2WLZA 1UKSA 1F90H 5INCA 3V7MA 5EOCJ 1K4CB 4U1JA 1NCCH 5AG8A 5EBWB 1IAKB 4UAOB 4J3XA 2WBWB 1S7SB 3DV4B 4NCDA 4ZO9A 1MCWW 4NQDE 2E9JA 4DFHA 2MSPA 3MMEB 3VI4F 2H32H 4JLRA 3NOIA 1TETH 1FL3B 3DMMA 4W6XB 1KPVB 2D7MA 3KPSE 1J11A 4OAWB 3FQRA 2A6KA 4JKPH 2JKXA 4FMFA 1I1YB 3SDCC 1HZHL 1QFUH 4ISVA 4XGZA 5D96B 2XPGB 3ULVL 4M1GH 3LMJH 3X11A 3VFUA 4Y19B 2DLIA 1CDYA 2B4CL 5KS9A 2HMID 5HVGB 4LF3B 1MFBH 5GJTH 1CXEA 3GBML 2OS7A 5FYJL 2MQ0A 3CVIH 4B5EA 4P4KD 3RWEA 1BJ8A 5EIVA 2CGRH 3VRIB 2NX5A 5ECJE 1TVBB 3O2DA 3L6FA 3RWFA 3F7VB 2APVA 3FFCA 1LO4L 4XRCB 2YRZA 5I1LB 3NCYP 3F12B 5DGRA 2OJEB 5BOPA 3S5LB 3H9SD 3WO4B 1KB5L 3EO1B 4L4VD 4NKOB 1XGQA 1KC5H 2NY6D 3VGGA 2VLJB 1UACH 3TIDA 3JUYA 3ZDYF 1DQLH 3HNVH 1FO0B 4HUUA 4L8CB 4MD0B 5DRXA 5HGGS 5D1QA 1J1PH 1XIWD 3QDMA 1QLRA 3ARBC 3VFRB 4PJGF 4L8BB 3WLBB 2ID5A 2W65A 1NGYA 1HH9B 1PEZA 2IBGA 4WW2B 4LCIL 2X1XR 1DE4B 4Y89A 3LRSA 4KJPC 1S78C 3GSOB 1U8IA 2FEDD 43C9B 3TBWB 3CFIC 1FVEA 1CG9A 4EI6B 1UH3A 1GGYA 4HIXL 2OTUA 3QIWB 4MQSB 3G6JE 3AB0C 3BGFB 1JUFA 1N0XH 4XCYA 5EULV 2BNRE 1P6AB 5E8DH 1OW0A 5A16A 5JOFA 5EORH 4WNQB 3ZHDA 2X40A 4U1MA 1RZIB 3C5JB 4HGMA 1VFOA 2ZCKL 4GG6E 4P5TC 2PYEA 4U1SB 5J7CC 3W9DA 5JHDB 3SDCD 5KG9B 5SX4H 5D7LD 3T8XA 2PW2A 1RZKL 5FGBA 1MJ7L 3CUPA 1I7ZA 1G7LA 4WWKA 5ESVB 1T83A 1FL6A 4J6RH 4KK6D 4PPTA 1FZJB 1G6RA 3TJEH 3WEXB 3DVFA 5AUMB 3N1FC 4R97C 2F19H 3DECA 4O2CA 3DX8B 4MMXC 1KB5A 3LKNA 4FQPA 4I5BA 3UZEA 3NCFB 4MJ2A 4XP1L 1IZJA 1MRDH 4ZS7H 4OLXH 2W60B 5J56B 3RIAF 1MHCA 1X4ZA 4JFFB 5L7XH 3FKUS 3JV6B 3DSFL 5DJ8B 5E9DE 4CVZB 2I60H 5JXEC 3F8UB 5GS1B 4TSAL 2I27N 1EH9A 4U3XA 1KJMB 4FQJH 1JRHL 3MXWL 5DYOA 5HVWA 4GUPA 3ARBD 4PJXE 4RGNB 1BFTA 2WLYA 1V7ML 2HLFC 1L9NA 1CE1L 4H88H 5KVDL 4BQCA 2FGWH 3BOVA 3MRBA 5IBTL 2PN5A 1XGPA 4WU7B 3QXVA 2CRMA 5E6IB 3SE9L 3VGAB 3DV6A 1UCBL 3IDIA 2VLKA 3CMOH 3KJ6L 1RJLA 3QXAB 3O3DB 3OJ2C 3MC0A 3L5WA 2FYYA 3MUJA 1S7UB 3BIKA 5SWZE 2AABL 5A3IC 3QDJA 3A6OA 1LDSA 4HPYH 4OIAA 1U8QA 1AD0B 2XN9E 5D7IB 1JHTA 4ZQKA 4X0KB 5E99L 2XWJA 3KLHD 3G08A 1X5FA 2AJYH 1AQKL 1Z3GH 5E2UL 4P5TD 5FM5O 1OWWA 3HR5A 5M7QA 3B8YA 1TJIH 1NGWB 1UM4H 2E5EA 1KIPB 4HXAL 1AP2B 1EA9C 4G7YH 4ZSOA 1OAXH 2MKLC 2WW8A 4MDJB 4IDLA 3L3JA 1TXKA 5K9QI 25C8H 1ZHNA 3KAAA 3T0AA 1D5ZB 1MH5A 4R90H 3Q2CA 1ADQL 1OAZH 4YHKH 5EA0H 5ADPL 4H8WL 3KWWA 1G9MH 3QI9C 5E5MB 1ZA3A 4YFDB 4MAYC 2Q3AA 4PJIA 5GSRB 4XC1L 1TDQA 5DTFB 3QDGB 4G43B 3W2DL 4QRUA 5I1IL 1ZGLA 1P4LA 2DQIL 4JPIA 4OFVA 1U6AL 1RZ8B 1NL0L 5J11C 2B0SH 3IDGA 1H8SA 1ORSB 4KHXL 5D1XD 2N7AA 3MLPA 3LS4H 4GXVH 2F5BL 1QR1B 2JLLA 3BKMH 3OKOB 1R3KB 1YEEH 2R1XB 3MO1A 3BP6A 5C2BL 4GBXB 3TP4A 2ERJB 4IDJH 4U31A 2FZ3B 4R4BA 1MAML 4X5LA 3V5HA 2XTLA 3E3QC 2ARJQ 4G8GA 2HLFD 3QEQB 1U8HB 1GHFL 1P2CB 1QG3A 1XGRB 1T1WA 1TTUA 4JFQA 4HKZA 1ZMYA 3ARZA 3CFBA 4OZ4B 4X7SL 4FXKB 3BAEL 4MJ4A 4G6AC 3CFJB 4WEUD 2YN5A 3O2VL 2EDTA 1BD2A 2F5AH 3H42L 2YK1L 4MNHA 3RA7L 6FABL 3RWHB 1YEJL 1PGRB 4N1EA 4PRDB 2EDBA 3UAJD 3FHAA 4JREB 2IANA 4ONGH 3CFCH 2WBJC 3Q0HA 4HIHA 4H20H 4JJ5B 4P2QA 5BS0D 1LP9A 4XMKH 3UEZA 1MWAA 2JCCE 4TTDD 4PRIE 2F53D 4XZUB 1EK3A 1BOYA 3MUZ1 1UEMA 4KKNA 4P3WA 1N7MH 1OSZA 4WO4B 2VQTA 3BQUC 4FN0A 1G9NL 3VW3H 2P7TA 1IT9L 1ADQA 15C8H 2EECA 5D2NA 5EU5A 2IH3B 5F44A 5D6CB 4MLIA 1RZFL 1VPOH 3KPNA 1KCLA 4Z7OE 5KVEH 2ZKHL 3NVQA 4BK4A 4MNGA 5IHLB 1MVUA 1AR2A 1PD6A 5B8CC 1EBAA 3WE6A 1NFDA 5EO0A 3L7EA 4UV7H 5GGUA 3SDXB 1N59B 3OR6B 5I17B 2GJZA 4BZ1L 4LCWD 1WBYA 1YN6B 3WFDH 1CD1A 2GW5A 3GI9H 4PJCA 4NRXA 1CGSH 3O3AB 4NQXA 4Z0XA 4QNPE 1ED3B 5F9AC 32C2A 3I75B 1YMMD 5DHXB 1KEML 5DSCA 4K2UL 4X4XB 4NDMA 3KNBA 5TFSH 1CS6A 3DRQA 3WLWD 2HH0H 4K8RD 1KXVC 1HKLH 4XP4L 4G6AD 5CJ5A 1RZGB 5E1HB 4PJ9D 3VFNA 3AS0A 3UTQA 1BOGB 4FABH 1JE6A 5SWSD 2OYPA 4WI8A 5TF0A 3B2UC 5FK9A 1YEKL 2VH5H 3CSGA 2HN7A 2WBJD 4P4KA 3VWKC 4WDIA 4X6CF 5JA8B 4BQ8A 4KTEH 5C08D 4YUEH 3CNKA 3QBTB 4NKIL 2H1PL 5ID0A 2X5PA 4OD1L 5I9QC 3LHPH 4CDHA 3RP1A 2AEQL 2NY7H 1A0QH 3O9WB 3H9SA 4QHLA 3PWPD 2ZG2A 4L4VA 2G5RA 2YKLL 3B3IA 1QLFB 5BMFH 1Q9LA 1P6FA 1RU9L 5CHNB 2V2WA 1KJ2H 5E5UB 2VIRB 4IRZL 1NSNH 2H41A 4WV1C 4LSRH 5DK0A 1XIWA 4MCZB 3U4EA 3SDYL 3AFLA 3UJJL 4YAQA 4KJWC 3DRTA 3UTSE 3KPPA 1F4HA 4OLUH 4XPGH 5T1MB 4NT6B 4G8FB 3DGCR 3WXVL 1MHEB 3QUMH 4X6DA 1J05B 3HPLB 3L7FA 4F33B 3ABZA 4XPTL 5DRNA 4PP2A 4XCEA 1M6OA 1KCVH 1FAKT 1IGMH 2OK0H 4FTVD 1OLLA 3C2AL 3RBSA 3BEVB 4HULB 2ADGB 1NEUA 5KSVB 1E0OB 4M9OA 1BVKA 1CLYL 3OV6A 3HI6H 5DEFA 3BJLA 3RKDC 1NJ9B 4M8VA 4WU5A 4FP8H 3ZTNL 2P5WD 5BV7B 5KSBF 4FQ2H 4N0YL 5D2LB 3JWOH 2CO7B 3SDCA 2Y5TB 4KY1L 5HD8C 1HI6B 4JO3L 5D7LA 3QJFB 2B5IB 1A14H 1T04B 1CL7H 4M93C 4R4FH 1UZ6F 1D6EA 4CVXA 4QRPE 2IADA 5L2KB 4OZGB 5E24E 1SBSL 2Q76B 3W9EB 1W0WA 1NGXA 2DBLL 3CDYA 1TCRB 3VWKD 1HHIB 1MUJB 3MRKB 2E6QA 4X6BA 4J3UA 3IDNB 4U1GC 3JWNC 5BZWA 5CWSB 3P30H 1EXUA 2NLJB 4PJ8D 4OCLC 5D8JL 3N1MC 1PBYA 3U4AA 1EHAA 2HFTA 5C0CB 5HGHB 4MQXD 1BZQK 2H26A 5F3BB 3UDWA 2P8PA 1AJ7H 5IB5B 1N2RA 5B39A 2ATPB 1SBBA 2Y06L 3BH9B 5KVMC 3F58L 3P4OA 5L9DH 1Z9MA 3PIQB 1CE6A 1UJ3B 3QUXC 1OHQA 2Z8SA 5HPMB 4F9PC 5HDBE 2EYSB 3ARBA 5HHMD 2Y7QB 3PUCA 5DJDB 4KJWD 4LIQH 4LQ1A 4PBWD 4BH7A 4UTAL 4JFDB 1UYWL 1F00I 1U3HC 2NW3B 3ARFC 3QIUB 2ZUTA 2J5LB 1WQVT 4HZAA 4JAMB 4M7JH 1PEWA 4PJHA 3QP3A 5TGBB 4Z77B 2QHRL 4Z7QE 4RGOH 4GQ9L 2X9WA 3QULB 4P9ML 3QR2A 3FQNB 1JZ2A 4P2RB 4OGXL 3HLA