2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
1HAWA 3MBWB 2WO3B 2MTAA 1OOWA 3T6ZA 3FS9A 4TXVB 4DP0X 4KOCA 5PCYA 5AKRA 1M9WA 1NIDA 1SFDA 4GP5B 3G5WA 4UANA 2RACA 4FAAB 4UAHA 1AS8A 1L9RA 1E5YA 4DP1X 1JZFA 4G7QB 4W9ZA 2BHFA 1AG6A 3CVCA 3T6VA 2PPAA 1IUZA 2ZOOA 3NSDA 1MZYA 3EH3B 3PAZA 1OCZB 1QNIA 2H5UA 2XLLA 4G71B 2GBAA 1KGYE 1ASPA 1AOZA 4YL4A 2QDWA 1AZRA 1ASQA 1IC0A 2I7OA 2UXFA 5B1AB 2YAMA 5I6OA 3FQ1A 2XV0A 3X1FA 4A2DA 4NB7A 4BWWA 3OM3B 5I6MA 4X4KA 1JZIA 5B1JA 2R7EB 1PNDA 1NIBA 3NSYA 3QQXA 1OE2A 1WS8A 4YVNA 1V54B 3EF4A 1ZV2A 2QDVA 2VM3A 2DV6A 2BP0A 1SHXA 2YXVA 3FU9A 3TA4D 1M57B 3NJIA 1E67A 4W1TA 3ASOB 3JT2A 3NJGA 3WIAA 2YAHA 1XB6A 3CDZA 8PAZA 1A65A 2TSBA 2BP8A 4G72B 3AG2B 2XU9A 1J5CA 4HALA 1ET5A 3S8GB 3FT0A 1W6LA 3DTUB 1NINA 4E9TA 4P5RA 3SQRA 2CALA 3CVDA 3PPSA 4DP9X 2VSMB 3AZUA 3SBPA 2EIKB 2QT6A 3HB3B 2FT6A 1A8ZA 1W8EA 2DWSA 3NSFA 2IWFA 2IDSA 2YXWA 3UAEA 4HCFA 1GY1A 1OCCB 1PZBA 4HCGA 1AZBA 2PP9A 1ZDQA 2PLTA 1AZCA 2BW4A 3CZUB 1JXDA 1NIEA 1NZRA 3ABLB 1FA4A 3T9WA 1L9OA 4GP4B 2DYSB 2DY2A 1WA2X 1E5ZA 1KBWA 7PCYA 2BWIA 1CYWA 2Q5BA 3X1EA 4AZUA 2CBPA 1OV8A 1SFHA 1TEGA 3EH5B 1WAEA 1NIAA 2GI0A 4A66A 2J5WA 1F56A 1BQKA 3GXUB 3NYKA 3NJFA 3AW5A 5I26A 3UGEA 4AKQA 1CURA 2Q9OA 4YSOA 1OCOB 4YSTA 3X1BA 2YAPA 2H3XC 2IH8A 1PLBA 4AKOA 3TBCA 2XYBA 2IAAC 1KCBA 1KYAA 2OJ1A 1R1CA 2YAEA 5I5MA 5LDUA 3H56A 2DWTA 3T6XA 2EIJB 4YSCA 4JHUA 3ZDWA 1NDTA 4KO5A 2XVBA 4YSQA 1PMYA 4HHGA 1J5DA 4DP6X 2X88A 2Y69B 3ZBMA 1EHKB 3UABA 4BDVB 2P80A 1KV7A 2A3TA 2VM4A 3KW7A 4GXFA 4RH4A 3TBBA 4YSDA 1KBVA 1PNCA 1ET8A 1SJMA 3NP4A 3S3DB 3DIVA 4BXSV 5A7EA 4HIPA 1ZPUA 2IDFA 2YAFA 1PY0A 2EILB 1GW0A 2BO0A 3EHBB 3OMAB 3QJTB 1FWXA 4F2FA 4G7RB 3RYMA 4DP5X 3IBOA 3PLYA 1SF5A 1XMEB 3U25A 2B3IA 3QJVB 3PAVA 2BW5A 2J57A 3X2QB 1BQ5A 4AI7A 1BAWA 2HXAA 3HEIB 3S3BB 1WS7A 2LLNA 1CC3A 2HX9A 2YQBA 2HRGA 2VSKB 1PZAA 2EINB 5AFAA 4YVUA 2BP0B 3CVBA 4DPBX 3FU8A 1ET7A 4QLWA 2PPDA 1JVLA 3ZIYA 3CDZB 3UAAA 3AG4B 5D4JA 4G7SB 4E9YA 1A4CA 3BQVA 2BP8B 3AG3B 1MG2C 4EF3A 4QKTA 5B7FA 5D4HA 1JXGA 1WA1X 3NJNA 3OD3A 5TK2A 1N68A 2IWKA 4HHWA 2HRHA 1MZZA 3NJMA 4DPCX 2H47C 1ID2A 5B7MA 4E9SA 6PCYA 1GY2A 2YAQA 1XB8A 1J9QA 2OV0A 2VMJA 3ASNB 2WSDA 5I6KA 1NPJA 7PAZA 3DKHA 5ANHA 2J55A 6PAZA 3H4HA 1AIZA 3AY2A 3OQRA 4DP7X 1IBZA 2FWLB 3NJKA 3FPYA 4A67A 3NJLA 1OE3A 1JZHA 1J9RA 1GSKA 1QLEB 3FPXA 1N70A 2PPCA 3IEAA 1NICA 1JZJA 1JOIA 2PCFA 3SBQA 5EHFA 2JFCA 1IBYA 2FQEA 4M3HA 1BXVA 1ETJA 4N8UA 2UXVA 9PCYA 2FJSA 4YSSA 4P5SA 2ZONA 1M56B 2JKWA 1GYCA 2XUWA 1X9UA 3WNJA 1V10A 2IH9A 1VLXA 4E9VA 1NTDA 2XV3A 3FQYA 4PAZA 3WI9A 4KNSA 3TASA 1SDDA 2XX1A 3FU7A 5AZUA 2VW7A 2XXFA 2HZHA 1JZEA 3T6WA 2VW6A 1AS7A 3V9EA 4N4YB 2UX6A 1BXUA 1AG0A 2XWZA 2YARA 3SBRA 1ASOA 1JZGA 3FSAA 4JHVA 2PPFA 3UACA 2IWEA 3PCYA 3IN0A 1PF3A 1URIA 4YSPA 3OMIB 3IN2A 3ABGA 3QJQB 1TKWA 3FYIB 4KO9A 3NSCA 1EZLA 1HAUA 1AS6A 3FSWA 4KOBA 1OE1A 5I28A 4GP8B 1ADWA 2FT8A 2AVFA 2FQGA 4A68A 2CUAA 5FC9A 1IKOP 3S3CB 1KDIA 3CG8A 2HX8A 5PAZA 2IDUA 2TSAA 1PAZA 4BWTA 2N0MA 1AACA 3X1NA 3PXLA 3FSZA 4E9RA 1WA0X 3JTBA 3KW8A 2P80D 1RCYA 5I5IA 5F7BA 2BZCA 3NJHA 3QJUB 1NPNA 1J9TA 2DYRB 2PPEA 4A2EA 4YSRA 1PZCA 4UF7C 1L9SA 2NRDA 5TK4A 3FSVA 3QJRB 4GY4A 2CAKA 2X87A 1TEFA 1A4AA 2GIMA 2XV2A 4JKNA 4L0PB 1AR1B 4WTQA 2EIMB 1OCRB 5D4IA 1JERA 2HLEB 1MG3C 1NWOA 1JXFA 2GHZA 3UADA 1ZIBA 4YSAA 4NAJA 3FQ2A 2B08A 3N2JA 5B1BB 5B7EA 1E30A 3S8FB 1AZNA 3C75A 3L45A 4NERA 5E9NA 4AKPA 1BYPA 2CCWA 1JVOA 5I5JA 4KNTA 1AANA 2ZWNA 2FTAA 5I6NA 4HAKA 2UXTA 1RKRA 2QPDB 4BDVA 4E9WA 2BZ7A 2CJ3A 1SF3A 4M4RB 3GDCA 3GYRA 1MDAA 5F7AA 1AQ8A 4HCIA 2GB2A 2MRYA 5B3SB 4Q8BA 2WO2B 1UATA 3BVDB 2IDTA 2QPEB 4KNUA 1NWPA 3QJSB 1W6WA 4G70B 4YSEA 2E86A 5I6PA 4A2FA 1L9PA 1SNRA 4Q89A 1J9SA 1A4BA 1ZDSA 2FQFA 2PCYA 1QHQA 2XXGA 4KO6A 5I6LA 2FQDA 5IY5B 4YSUA 4F2EA 1AZUA 3EH4B 1SDDB 3FU7B 1OF0A 2ZXWB 4MFHA 1B3IA 4BWUA 4A2HA 3WKPA 3NP3A 1PLAA 4WKXA 2I85A 2VN3A 3QPKA 4AX3A 1AAJA 1BEXA 4K9JA 3ABKB 2YAOA 2Y1AA 1T5KA 1HFUA 1FFTB 2FNWA 1BYOA 3FYEB 2R7EA 2PP7A 1BQRA 1DZ0A 4ZK8A 2HX7A 1KDJA 2PP8A 4GYBA 4CSZA 4DP4X 3AG1B 4BXVA 1E65A 3MX0B 2W8CA 4DP2X 1DYZA 1GS8A 1L9QA 2GC4C 4CSPA 4ENZA 1ILSA 2XX0A 1PLCA 1RZPA 1GS6X 4FA7B 1KCWA 3PAUA 1L9TA 4PCYA 3TU6A 1A3ZA 3ABMB 5B1JC 4A2GA 3H4FA 2AANA 1SHWA 1TU2A 1BXAA 3WG7B 2W88A 3OMNB 1XB3A 4KO7A 2FT7A 2GSMB 1CUOA 3WKQA 4F7KA 4DP8X 3T71A 2AFNA 1I53A 3ERXA 1RZQA 2OCCB 3N55A 1GR7A 3ZX1A 3IE9A 4HZ1A 3WNIA 1ZIAA 4E9QA 1PCSA 2VW4A 4BK5C 1CYXA 2AZUA 4DPAX 2BWDA 3X1GA 2AZAA 3D12B 2GC7C 2JXMA 1NIFA 4E9XA 2UX7A 2J56A 1YLBB 1GS7A 1X9RA 3NJJA 5B1KA 1V55B 2UXGA 1ILUA 2IDQA 3V9CA 3NT0A 2I7SA
chains in the Genus database with same CATH superfamily
4JB9L 1UH2A 2G9HB 3AWGA 5FO8B 3EYVB 4ZOEA 4Y0GA 2H3KA 3EOAB 2XWEA 3QQNA 2VXTL 1P84K 3FRPA 5DWPA 4AMKH 1JPST 2W0KA 4O2CB 2APXA 2CQVA 3NGBB 3D0VB 3EOBB 3QK0A 3VD1A 1JHLL 3NZHH 4UM8B 1EJFA 1N4XL 4JJOA 2O26U 4LAQH 3TH2T 4J3BA 2QEJA 3UGXA 2ED6A 4FXKC 2IADB 4B9ZA 4YDZA 2VLKA 4MJIE 2PYED 4WI8A 4LQ1A 4PD4K 3QZWA 4PM1A 1DBBL 4DO5A 3TBSB 1DQJA 4EQ2A 4OLXL 3QULB 3WEBA 2X38A 3R06B 2BC4B 4EI0A 2CE6A 1OCZB 1JZ6A 4ALAL 1NMBL 4U6YA 5I74B 3KBEA 4PWKA 1XGUA 2X4QA 5G4MA 5CBEA 3WJJC 3WS6C 3KZ8A 3VWJB 1TF4A 2OR9L 2QLYA 4Z0BL 2XWXA 4C58B 2C5DC 4LSQH 1KENL 3RVVD 2APSA 3HG3A 5HPOA 4RNRB 4XBEH 1I7ZA 2XPGB 3MLSH 2AXWA 1C5BL 4BGDA 5KOMC 1SQMA 4Y19E 4P8QA 2LQRA 1WS8A 2DQ6A 4CC4A 4J3TA 1IARB 3O6KL 1ZANL 4WLCA 3EXLA 4WI0B 1YEHL 1J11A 2ED9A 2BIIA 1CGSH 3VI3A 3GQFA 4W9FC 3CCHB 3DMMA 2NTFB 1T4KB 4NNPH 5EBLB 4JQXC 4K5MA 5LN4A 3Q06A 3ENEA 4ELME 2HCZX 5D7SH 1GGUA 2NY5H 4GEJA 5HPMA 1DO5A 1YUKB 3HS0C 4EZJA 1M3IA 3EYSL 1XEUA 2A5UA 3CDCA 4RLDA 2W1NA 4NRXA 3QFJA 4MRCA 4MQTB 5GGUA 3WEXA 2JK5B 2DQEL 3OKMA 4BCXA 3GXPA 1TNNA 4I5BA 1H5BA 4LIQE 4F93B 2ZWSA 5C08D 3KPSA 4D0BA 1E3FA 1S8DA 4Y16A 5D70H 2H9GB 4HBCH 3LKRA 3T3ME 1E9PB 4K3JL 2DMBA 3FO0L 3BSHA 4JG1H 3LCYA 3QC6X 1D7BA 1AXSB 1YAZA 1YPZB 2VTFA 1DUYA 3IAQA 3WJMB 3OGCB 5FA4A 3CZGA 3G6JB 4AZ8B 5T1LB 2F54E 5IESH 1B0RA 2IDCA 3GINA 1ZSDB 4F33A 1DL7H 1XEDA 4OKVA 4KRMB 4OZ4B 1EDHA 5A2JH 4MNQA 3Q1EA 1RZIB 1MI5E 5KSAD 1BQKA 1H15A 5AW3B 1CURA 1TUPA 2QVFB 2WAHA 3M1CA 3KPLB 3OSVA 3PRZA 4FXGA 3WFCH 2O30A 5HJDA 1JCVA 4PWGA 3ZKNC 3X1BA 4AG4L 4ZOAA 1WCBB 2WUCH 3BVTA 1P2CA 4PBWD 5LGKA 5ENWB 2XG5B 2ATPB 3CD4A 3H9SE 1CDIA 1S9YA 4JRYA 3H56A 1J10A 2GSIA 2WLHA 3Q01A 2I9LA 1R24B 1FYTA 3QO1A 5JPMC 3DURB 2VLJB 4X8XA 3MFFA 4WJ5A 1XX9C 4XN8A 5ANMA 4B27A 4V1DA 1DEDA 4FJYA 4U1MA 1A7BA 3CZEA 5E0FA 4EVNA 5L2KE 4NQEB 2CIIA 3TS8A 2WWOA 3O41A 1T1WB 2X9ZA 4KK8C 3T77B 4KZDH 2P8PB 3VJ6A 1TLKA 4OLYL 3HCVB 3TBBA 2YD7A 3INOA 1FZOA 2F8OA 4NLHA 3K6IA 2QPSA 4P23C 1ZPUA 2R29H 5IROD 3UTTB 4Z3TA 3GSWB 2X4NB 2OCJA 3FUHA 4S1DD 3SDDB 1ZHBB 1R3HB 1PVHA 3MUZ1 4UBDC 3HPJB 2UY6A 3VQ2C 1ZE3C 5FKAB 4GEIA 4AEEA 2A6KB 3D39D 3KXFD 1MW2A 4ODBD 3BEWA 1B2WL 1DBML 4H0IA 1FZKB 4UNTA 4X83A 3ESNA 2HXAA 4C55A 5AVUB 4APQB 5HVWA 2Y5TB 1YY9D 3B9DA 5I0YA 5LGHL 4MS6A 1UB6A 6FABL 3UPCA 3FF7A 3PV6A 2AJ3A 4J8RB 4PY8J 2JIXD 3F01A 4UOW1 3QI9C 1AO7A 5AAMA 4XWGL 4XAKE 1BA9A 3R8QA 3DPDA 1BD2A 4MB5A 5AG9A 1HI6B 1GYWA 2VZOA 3VXRD 1IFGA 1M2OA 5I16A 1THCA 3PNRB 2H3NA 1F58L 5E6IC 3BPCB 3H42H 4GH7B 3NESA 4Z7UB 2HRHA 3L95B 3EXJA 2YD9A 6TAAA 3RBSA 3QZLA 3CUPB 2YAQA 3Q6GH 4ZSOB 3IGAA 2C3GA 1G9NL 5FX3A 5A16A 2YIHA 2F1EA 5AW7B 3PGFL 2SEBA 2NUTA 4HCRL 3WGUB 1E43A 2D03L 1RL1A 2NXYD 1J0JA 4LVOB 2UY7B 4R6UA 2P47B 5K1NA 3NZ8A 2XOTA 3BCDA 4U6XA 4F2MB 4FI7A 3ZIMA 5T1DH 4G9FD 1O7DE 25C8L 3ARGC 1SXSA 4P4KA 1FO0A 2BSTB 5I75B 3H7BB 2IO5A 3EDEA 4FQCL 5D5MA 3SBQA 2AEOA 5KVGL 2QKIA 4CADB 1IGJB 4M7LT 2FQEA 3BPNC 1Z7JA 4WU5A 3QXVA 1KEGH 2UXVA 4YSSA 1A9EA 3RFZA 3T2OA 3LTVA 4NT6A 1EAQA 4PJGA 4WHTB 3UTSA 4HT1L 1A1NB 1TQWA 3KR3L 4M1DL 2HFGH 3MROA 2R4RH 4YHKH 2XV3A 4BV1A 1OARH 3FB8A 3FOLA 5CSGA 4JY4B 5GZOD 1Z32X 3G08B 3WI9A 2A9ML 4XN7A 1AD9B 3CFCL 5EZJA 3TT1L 4DAGL 5JW3L 3SE4A 5KJ7E 1K3IA 2FIKA 4XCNA 4ORZC 3GMRB 2IWEA 5GIRB 4EOWH 1K85A 1BMGA 1S9XA 5EOQH 4K3GA 2PETA 3DX1A 1TTBA 2EO9A 4WNSA 3IKCB 2QHLA 2GEEA 1J9CT 2J5LB 3ZQWA 2P7TB 3UMTA 3HC0B 1ADWA 1NCNA 1V7ML 4GP8B 2NX5B 1SMDA 1TETH 2NDFA 4OJYA 3QCTH 1JXKA 3RTLA 2D7TL 3N1FC 1YSOA 5PAZA 1MFAH 2TSAA 3HAEA 1J5IA 2VDRL 1ZAGA 3OXRB 3HE6C 5K39B 1QA9A 1CLYL 1QQDA 4LSSH 3WJLC 4FFWD 1JCKA 3T0XA 3ESMA 3O6LH 3QZMA 1RQ5A 5F7BA 4AVHA 2BZCA 4CDHA 4YIQB 4N26A 2CBOA 1M9SA 4OD2A 1XCQA 3LVEA 3FBQA 3SYQA 2B1AH 5LG1A 5IFJB 2DQHL 3OKDA 4FFVC 4ZXBA 4LOUD 1WT5C 2GTWB 2W91A 3L5WA 3QJRB 5JIKA 3UTQB 5DHYA 5DD3L 5AD0B 3VRIA 2FJGA 3MRCB 4NJAH 4S1QH 1AR1B 2YA1A 4ONFL 1OEZW 2L8AA 1W72H 3F58L 3N40P 2VN7A 3IE4A 5EZLB 2BJMH 5IOPB 1TVDA 2D31A 4Y9CA 4XPHL 1QI3A 3B7TA 1OGTA 1JPGA 1IC7L 1ZA6A 1A22B 1RZ8A 2BIQA 2K6YA 4WWPA 4DZBA 3NIDF 5CCGE 2GK2A 3HKFA 3TVMB 5J1AA 5IW6B 4JZJC 1FE8H 5AEAA 2HJKA 3UBHA 1S5IL 2CHZA 3ZK0A 2VDRB 2CCWA 4GW1A 5K69A 2AJYL 1Z6JT 5TF1L 3VNZA 2YMOA 1QFHA 2C3VA 2VLKE 3JV4B 3QUXA 1OGAD 4WF7A 2K4AA 3GRGA 1SJEA 1KNOA 2AK4B 2X28A 4ZYKA 1KFAL 1RKRA 4XOAA 4ZJ9A 3RWDA 5EEUA 4KQ4H 3UTZA 3EO9H 4F8LA 2EDOA 5TE7L 2X0VA 4PG2C 1NFAA 2D9CA 3DIDA 4OLUL 2QFRA 4Q9CA 5D8JL 3L4WA 5DS1A 4HKBB 5EU7E 4AQAB 2A0LD 1M1SA 3ZT6A 4DFHA 2J72A 1TZHB 4C54A 1EIBA 4OT1L 2XVKA 4H20L 1DCEA 4PBVC 1O6SA 4AJ0A 2Y7QB 2PCYA 3BDBA 3FTXA 5EDSA 4HWNA 4GXVL 5D7JB 2A74B 4ZD3H 3MNMA 2AXFA 3TNNA 1MCFA 3P73A 4X5XA 1A6ZB 1OZUA 4OCWL 3PDOA 3L5XL 3VI3E 2PF6A 5DJDA 2VN3A 1N64L 4PRID 5FFOA 4FFYL 3VFOA 2VXVH 4JJ5B 5I1HH 1I8AA 1CL7H 3CSPA 1LXMA 4HJTA 1IGTB 4GS7B 1PD1A 2VUYA 4BIKA 2WXFA 5GJTL 3GTNA 4J2XA 1HFUA 1BPLB 3DETC 4ES9A 1N9PA 1KCUL 2DQDL 5KVMC 1LYQA 3QFJE 4OCSH 1DZ0A 1WRFA 3OZ9L 1AHWA 4L29A 2P5ED 3U1SH 5B4MC 3KPSE 1I7UA 2KZWA 3VFPB 2C1OB 2RFXB 4CSPA 3TN0B 3EH1A 2OK0H 1M6OA 1YNTB 2OSXA 5C3LD 3UTPD 2VR4A 3I9GH 1WTLA 1T89C 3BO8A 4Z7OF 3GSQA 4IM8A 4Z7WA 3BX7C 4FABL 5I1DB 2DKSA 3H9YA 4N2AA 4WK0B 5DT1H 1A6AA 1JNHA 2YEVB 3GGWA 4MNQE 2BOCA 2DQTL 2Z7UA 2MFNA 1MHEB 5CJ8A 4Y1AB 1FH2A 1MCIA 1Y07A 2ZXDA 3VFTA 2CKBH 4Z7NB 3ULUC 1CLZL 2QQNL 3LRKA 3TA3C 3U0WL 4OFPA 1I9RH 1F1AA 2Z8WC 4DEWA 4PJBA 5H4ZA 5CD3B 4WW2F 5GSRB 4KUCD 4LSUH 3C5SB 4PREB 3DGDA 2WAQA 2MPAH 4R4FL 4JY5L 1I1RA 4JRYE 4HEPA 4N25A 3AAZA 1NIFA 2O72A 3AGVA 4HIHB 3AU1B 4G5ZH 1MUJB 4WU7A 1SM3L 5ANME 5FGBC 3WL9A 5BZDB 1CXKA 1RJYB 2GUOA 1Q72L 1T6WA 1X9RA 3BUQA 1OT2A 2F68X 3B9KC 3SODB 2G2PA 5JQ6H 4ZAKA 2YGOA 4WFFE 4CJ1A 4JM4H 5TH2B 3NACL 3D2TA 4LLQB 5JNYA 2X4SA 2NY3C 3JVGA 5F9OL 3BVNA 5AKRA 3BKCH 5A2LH 3VCLB 3GI9H 3MLZL 4X6FA 4GW5B 2HN7A 5DUML 2ENJA 2XPZA 3CN1A 1INEH 3L9RB 1MREL 2HVKA 3NA4A 4N22A 1JGUH 4OLWL 2NYZA 4RAHA 1CFBA 3P3YA 4TVPD 1F4YL 1QMUA 1USQA 3QUMH 4OD3L 1I3GH 4HC1A 2KLRA 3MGTB 3IJSA 3ZRFC 1IUZA 2W65A 3U0TA 5J4MA 5MEPB 3FO1A 1G4MA 2XTJC 3LV3A 4NXSA 1MZYA 4M3KB 2XSKA 1EBPA 3SOBH 1HILB 3IS1X 4B3VA 5F9WC 2NY0D 1KPUA 2NUPA 5GZND 1E6JH 3UG5A 1MW1A 2QGDA 1AO7E 1TTFA 1FFOB 2FNBA 2N1TE 4F7EB 1BD2E 3ILPB 2F7IA 1UWGL 5F6HI 1JPTL 1ZGLP 1JZIA 4PHXA 2VDQL 1NANH 5E94B 1E3ZA 2EIEA 2F61A 4I4WA 4RMRA 2OSLB 4AVJA 2DPKA 2Y6SD 5CJXC 2ORBL 3FSOA 4P23B 1HXMA 4BSVA 3H8NA 4HX1A 4XBGA 4RAVB 2I07B 4ZS6D 3U46A 4JM2D 4P59H 32C2A 5C0AA 4NSKA 1MCWM 3QISA 4HWUA 3SDXF 5I8CB 3DTXB 4PJDB 2BPBA 1N59A 5HHQA 1BGXH 3TEWA 4G6FB 2CA3A 3VRJB 3UO1H 3QNZA 2XWBA 4ORGA 5EF0A 3PHQB 5GISL 1U93B 2WXIA 1Q9WB 1AMXA 1WUNT 3GDBA 3O2VH 4RFOH 1UM5H 2W92A 3OKOB 4G6AC 3CTTA 4GB9A 4I9WE 4CUCA 5DVMA 1MRCH 4LCWB 1IGCH 4G11A 3LAFA 2DJUA 2APFA 1A1MA 2VDQB 3BKYL 3HB3B 4D0DB 5C1MB 5JXED 3ZTJG 1W8EA 1MQKH 4PJGE 2YUWA 4NAMA 3LEXA 2XWRA 2BCKB 3UO8B 2IDSA 4UNUA 5E6IB 4E36A 2H45A 3BUPA 2WLJA 4MYWB 2LU3A 4UQ3B 4FYSA 3SEPA 5IZ7A 1WGVA 5C8JA 4XPTH 1YY8B 2OL3L 3NOIA 4X7FC 5AW2B 3TZVD 3WKMH 1PKOA 5GJSH 3GXUB 3NYKA 1OGSA 4P49A 1VHPA 1X44A 4YSOA 1M7DA 2Q10A 5T3XL 4JLRB 3QUHA 3GMLB 3TO4C 2FJHB 1BXXA 4UV7H 4CSSA 4AKOA 1HVXA 4R96B 2FGWH 1R1CA 3QRFM 4P2QB 5FOBA 1IC4H 3PXJA 4IKJA 2BIPA 4GAFB 1A66A 2WWMD 3MGOB 4BRJA 5DD0H 2WLLA 4MQ7A 3S96B 4AYFA 4O4YH 4L37B 2EE3A 4Z77B 4PRNA 3W9DA 4XVJH 3NCYS 3WIFA 3QYCA 5IKCA 2BNQE 3HZKB 3IJ9A 4GRMB 3QEHA 4J28A 2OL3B 5EZIH 3EDDA 1T2QL 3LN5B 2A3TA 3F3HA 1SXZA 5I1EH 4YSDA 1PLGL 1T66C 5J7CC 4LP8A 5I76A 1BWWA 2JI1A 3PWLA 1MJJB 3O6MH 1N7ML 4HQQL 5ACMA 5A7EA 3RU8L 2WLNA 3AWEA 1O9WA 2R69A 4JO2H 3QIUD 4I2XA 2IJ0C 3O45A 2R0KL 1FSKB 1JZ5A 3MLYL 1EK3A 3E2HC 1WSST 3QJTB 4ZFGL 2FYYB 2ZOUA 3FFCD 2WBJD 5HGAB 4DP5X 3X11A 4DW2L 2O1AA 3OV6A 3GMNA 4M00A 1NEUA 1SY6L 4O02L 4GMSH 2VXTH 1PX8A 1XGPA 4JQIH 4UINL 1B3JA 2HVJA 3I9AA 4JFXB 1IV8A 2AJZA 3OWEA 4L3EB 4N90D 3L08A 5CP7B 3ECBA 4N6RA 4LLDA 3WNLA 1VACB 2YBRA 4E41B 5JPNC 2WUBL 1CI3M 5LO7A 4M8UA 3VGDA 3L6FA 1Q1JH 4XRCB 5ADOL 2MHAA 4MA7L 3N9GL 3ECUA 1YEWA 3RDTC 2WZ5A 1JGEB 3IDGB 5JA8B 1RUAH 5DJYB 4DPCX 5LKNA 4ALAH 1NMBH 3ZRSA 5C0IA 2ZPKL 1LLAA 1DP0A 3ZGIA 3UYRL 1RJZB 4N8VG 1ZV9A 4I3RL 2AJSL 2CO4A 2OR9H 4Z0BH 4HKJA 1QYGH 5HYJD 2ICWB 4O02B 1KENH 5ISZB 5HVHB 3F85A 1BZEA 3ZTEA 1NGQH 1EAOA 2HLFD 2WC7A 3K2KA 2R2EA 1B4TA 4LCIL 1WDAA 2C4FU 5ICYB 1AYRA 5JIPA 1BZ9B 1R3JB 1UGNA 4FG4A 4XHJD 2RB8A 3SGDI 4Q9QL 3OPUA 3E8UL 4AXWA 2V7HA 3ZDXE 4ZMQA 1DQDL 2R29A 2X1XR 3FT2A 1U92A 1ZANH 3NJLA 4FQQA 3KE0A 1YEHH 5F21B 1PZ3A 4PJ8B 3VH8G 1QPPA 5ID1A 5LXGH 3LHPL 3N41F 1BXVA 3OB0H 5IT2H 1YZZA 1EEUA 5JOFA 4AVIA 5J6GB 5E4OA 1IBHA 1MAML 1T0NB 3OX8B 1GYCA 1GKEA 1CGWA 3WOVA 1S7WA 3SO3B 3MV9D 4HU8A 2LTQB 4KJWC 5FHBL 5DWUL 2VR9A 5D1QB 4M7LL 3VXUE 3S9DB 5D7KE 5EU4B 4JFEA 2QTEA 3G5XB 1SDDA 4JO1L 1GYAA 3L3OC 1OPGL 5AZUA 5ILTL 1K4CA 5BS0D 3SDYH 1QRNB 2Y7OA 5E4EC 2QSCL 2XN9D 1VKXA 1IGFL 2Z31C 2P46B 1JG9A 2I24N 2IGTA 3PCYA 5D1XC 3O9WA 4R7DA 1CQKA 2JCCB 4HHAB 1KN4L 1FAIL 4LCYB 1RZKL 4GRLB 3SPCA 4PGDA 5EIVA 2QADC 4P3CL 4XMTA 2PYFB 4NP4L 3IFLL 1ZSHA 4PLJC 2DM7A 5T33L 4KXZH 2ICEC 5CO1A 4GUOA 4WO4A 2EDJA 3VO0A 3KYOA 1WWCA 4LLYB 3GLEA 1ZT1A 1JPEA 4YGAB 5C07A 5IIEB 5IBTH 1BIIA 2EC9T 2EVIA 2EDFA 2IFFL 3UAJC 3ATEA 5EDXA 4FS0A 4AG4H 4JHZA 3OPZH 4DZ8A 1MAJA 1DE4B 3DVNB 2BSRB 5BVPH 4PGCA 2OMTA 1YDPB 4XO5A 1KT2B 4IRSB 5HD8C 3KPRA 3V9FA 4M61B 4XC1L 2EDDA 5DMIH 1UD3A 2YSSB 1OY3B 1BFTA 1KB3A 3ZE2B 2H26A 5MP6L 3QIBD 4A6YA 1AXTL 5DUJA 3RIFF 2VN6A 1XD0A 5TK4A 3X13A 2P44B 1MRFL 3MCKA 2XV2A 4JKNA 5LCVL 3CMOL 1WP6A 4OLYH 3B7SA 2AQNA 2HLEB 3FT3A 2D73A 3ESOA 4Y2DC 2M83A 1GTNA 4BQCA 1NMAL 4EIZC 1FL5A 3S8FB 4O2EA 4AKPA 4Z7VA 1FVEB 1JZ3A 3BYTA 1SUHA 4XBPA 4KNTA 1OANA 2LV4A 3L81A 4FQXD 4U6VL 2YUZA 3BPLB 2HJLB 3TA3B 5CLYA 1G84A 4U3XA 5E9DD 3AS1A 2PKDA 2EKSA 2WIMA 4D2NA 5HDLA 3J2PA 1B2WH 2B59B 1DBMH 4MCNA 5KBDA 2RBLA 4QNPE 2YUVA 1VFAB 1KJMA 4BM7A 5F6IB 1XIWA 3GYRA 3C5ZA 1F45A 4LEOA 3CHSA 1CIDA 3C6EA 5FYLE 1NKRA 4NO2A 1PZ5A 5IQ9B 4WK4B 1NCJA 1W6WA 3MV7A 2L7UA 4J6RL 5I6PA 4XO3A 4EMZA 4LHUA 3O2DA 2JLPA 1F58H 1I9IL 2X2UA 2NY3B 3BAIA 1OPOA 3OLGA 4GUPB 1EJOL 4KRPB 4KXCA 1QSFB 4PPTA 1TTAA 4ZFOL 5KAQG 1UT2A 5IB2B 1FZJB 2EUVA 4OIAA 2LFEA 3PGFH 4HCRH 1QZNA 3IDYB 1W72A 4ODVL 1C5DA 1EAJA 5CU5A 4ABQA 5AAWA 2XXMB 5E1HB 1ORQB 4QLRA 4CVUA 3C08L 4F91B 3KCPA 4OJEH 3ZE1E 5F7MC 3TIEA 5EF2A 25C8H 4V11A 4BUQA 4GW4A 3SCMC 4UOZA 4GG8A 4FQCH 3STZB 2J1YA 1A3LL 1HTYA 3ARDC 4FQIL 4U2YA 4JN2A 5E23A 3U1PA 1OSEA 2WYHA 3MX0B 2W8CA 3A6CL 5DMGD 2NZIA 4DP2X 4HH8A 4QRRA 3I6LD 4CMHC 1COBA 2WKGA 2VERA 4TN9A 1BQHA 3KR3H 4M1DH 2VERN 4XPBL 2B8OT 4RESB 1NGPL 4ZFOB 4BZ1A 1SHWA 4IKIA 3CFCH 3TT1H 5K9JL 3W2DH 4DAGH 4XCFL 2GY7B 3GSVB 3BD3A 4F7KA 4IGBD 2AFNA 4N9GA 1M1XB 1CICD 1OXYA 2L4OA 2QSVA 5F93C 3V5KA 2DOCA 3EJJX 4OI7A 1FPTL 1H3GA 2QL1A 3Q0HA 5JTWA 1IM3A 1ETZB 4FTDA 3BQUA 2EDKA 3B4NA 3GSUA 3MRPB 5DEJA 4HUVA 1AY1L 3MPCA 2EABA 1GJIA 2BVPB 1JFHA 3D2UB 1RI8A 5SWQA 3LPWA 3DV4A 3U30B 3BUYA 3O3AA 4DPAX 3JWOC 5SX5H 4K9EH 4DJMA 4N2FA 5MERA 1V7MH 1PKQA 3CQPA 2GC7C 2WQUA 4PJAF 2D7QA 1YMMA 2FX8H 1IKFL 1QI4A 3OAUL 2D7TH 4QOKA 1XR8A 2WJ7A 1E4JA 3NABL 4WNQA 2QLVB 1D5MA 1AGEA 2Y9RT 3ZL2A 1DJYA 1BREA 1EZUA 1WCQA 1NANI 5FV1L 3V9CA 1CLYH 4FCAA 3MBWB 5JHDD 1RHFA 3TFBA 1YYMH 2OTPA 4Z3HA 2YGPA 5IFHH 1QFWL 2NY1D 2QQLL 3BZ4B 5BRZD 4Z8FH 4NPYA 3RVUC 1FF5A 3IFPB 2DQHH 3TIDB 1I1AD 3FT4A 1U8JA 2X6CA 1JHTA 4CNIB 5DD3H 3AVEA 1IAII 3HG1D 1FN4A 4ONFH 2IGFL 2VDKL 4AIOA 3F58H 2ZOKB 4PIRF 2X6MA 3GLAA 2JKJA 3PHOA 3T6VA 3TO4B 3VD7A 1LEKA 1DFBL 4KTYA 5EV7A 2Q86B 3P0VH 1IC7H 5DC9B 3RTQB 1T03L 1J18A 2F5BL 1JN6A 1O0VA 2CJTA 3MLTB 3PGCB 3PAZA 5SWSB 3WUZA 5EN3A 3LKOA 4IBSA 3FUJA 1S5IH 3R1GL 2H5UA 2GBAA 1NJ9B 5TDNA 1ASPA 4TSBL 3TBVB 2AJYH 2CKBA 3IRCA 2OPCA 5TF1H 2YAMA 2YEQA 2IH3B 3M86A 1LP9B 5D72L 2CIKB 4K8RC 2CJSA 3PL6D 3OLDA 1DBJL 1KFAH 1KIPB 4LNVA 3VB8A 1KCSH 3UJTL 4ZG1A 5B1JA 3DGCR 2ITCB 1ESOA 2J6EL 4OLUH 2D7PA 3EYQC 2GJPA 3IJEB 3PWUA 5D8JH 1E5AA 3MRKB 2WV3A 3EF4A 2H4EA 3F5WA 2CO7A 2KDYA 2VDKB 2VM3A 3U7WL 3MXVL 2YXVA 1EANA 4YE4L 1M57B 2J44A 2E59A 2F8VA 3ATAA 1CGUA 3O3EA 4OH2A 4OT1H 3NJIA 4B53A 3QXDA 3D25B 4ETYA 1IAKA 1L6ZA 4XWOC 3ARVA 3P11H 1OD9A 3FBKA 3TFKD 3TTYA 3VXQA 2AK1L 3FB6A 4R0LB 1ND0A 5IGXL 3H0TB 1U8NB 3T0EA 3DTUB 4OCWH 5IB4B 3LY6A 1A2YA 2K1MA 5GS0C 2R56L 2CDGA 3CSYB 3L5XH 4KKLD 3TYFB 2DJ4A 1N64H 4QO1B 1EDYA 3E6FA 3OR6B 3QUMA 4FFYH 3KWWB 3ASWA 5JPNB 1D6EA 4H40A 4KKAD 3PABB 5GGRY 1KULA 2Y06H 2YD0A 2FBJL 1U8OA 5JMOC 4QAWA 4L3CA 1AC0A 5GJTH 1IQWH 5L8JB 4CU7A 2ZYIA 3OAYK 2BMKB 2VAJA 4WV1B 2FO8A 1IBBA 1XT5A 1J8HA 4HSQA 4IBVA 2DQDH 1OCCB 4HUUB 1QW8A 1NA8A 3T0VA 4FNRA 4PJ5D 5LWYH 4JFEE 1NEPA 2WXJA 5B21A 5A3ID 3TT3L 1G7LA 1MEXH 4ONOA 4PG9A 2WGNB 5AW5B 5DZPA 1HZHL 2X70B 1JZ4A 3QHFL 2JJTC 1S9VB 2MCAA 2Q9OA 3MRFA 3DNKA 4Z0XA 2HKHL 1S3KL 1I1FA 4BFEA 5CGMA 5E08L 2ZSVA 3FB7B 2H3XC 3H2QA 1HSAB 2WLIA 4JKPH 4L1SA 2LFGA 4K2UL 4FABH 1SN2A 3TEYA 4NUJA 1KYAA 4BQ6A 3L2LA 5TE6H 1S9WA 4GRWB 1VRSA 5KJ4A 5IR1B 2VUOA 1ZHKA 4YZFF 5DRNB 5JLZA 4Y5XA 1FGNL 5C07E 4AEIL 1CLZH 1NAML 2QQNH 1RK0B 3JTTB 5FCUH 3T8VA 3MBXL 4TSAL 1VA9A 3LRGA 3LIZL 3S3PA 5DEZA 2J21A 1BZ7B 3ZBMA 2DEYX 4NUGL 4R4FH 4FTVB 4JY5H 2ZYHA 4GKSB 2JSFA 4P0DA 3DBXB 3D7PA 3DC0A 4M6AA 4RDQG 3GSXB 3TLRA 1SHMA 4HWBL 1Q1PA 2WLZA 2YAFA 2IAMD 4APXB 1SM3H 1AGBB 5ABZA 1G7MB 4A63A 5IVZA 2XHNA 3KLAA 1ZTXL 1NFIB 1Q72H 4Y8AA 5GGSY 2VAAB 3REVB 4HUKB 4OD1L 1OAZH 1DVFC 1S46A 2BHZA 3IBOA 4IS6A 1UM6L 3NACH 3ULVD 4PCKA 1R3KB 4LKXA 5CSZA 4BZ2L 5F9OH 3PAVA 2ATAA 3DVFA 3D18B 3MLZH 4HXBL 4YHLL 2E9BA 4WI6A 2PO6D 4M8RA 1HHKA 5DUMH 1NAMB 4Z7VE 1MREH 3SJVA 4OLWH 2DIAA 5I2IA 5H8DA 5DQ9A 1ED3A 4ZS7L 4FEIA 3WNNA 1F4YH 3MRMA 4RQQA 3OHXC 2GBVA 5E6SB 5KSBA 1JPSH 3FZUD 4U3HA 3F12A 2GPZA 5KVDL 3BQVA 4EN3A 2BP8B 2KHAA 1AVAA 1ZE3H 2V5SA 4OUUB 3VD3A 4QIRA 3EYVA 2P4AB 1U21A 1A64A 1N68A 3NFPB 4FP8H 4UQCA 1MZZA 2KZKA 1TFHA 3HIZA 2DM3A 4O2CA 3EOBA 5MEND 5CBAB 5D2NC 3ULUF 3B2PA 3LMJH 1T7WA 4J12A 5EH1A 4FKEA 2YWZA 1E8WA 1NFDB 3MV7E 3MN8A 3EOTL 1G6RL 1UWGH 3QHZH 3NCMA 1X7SA 2VLRB 1C1EL 1L7TH 2GBTA 3NIGF 3US9A 4RWHA 1KIQA 2YPKB 1IBZA 5B8CB 2H2PD 3TTSA 2J1WA 4L8SA 3N91A 1CF8L 2WZPD 1NAKL 1NCHA 5HHOE 1IGYA 5T1MB 3IMBA 4LU5L 1ES0B 3T0DA 1MCRA 3D87B 5D6DA 2Q87A 1FH5L 2ZWKA 3D85D 2YPLB 3HNSL 1NKOA 3PWVB 4OIIL 4NBXB 2W0FB 3RUGB 5I0VA 4X2UA 3F7VB 1IBYA 3WS3A 3W3BA 4MMYB 5K59F 3AU0A 3QW9A 5C6PB 4P5SA 5IMMB 4JEGB 5TD4A 3MRBB 3SE8L 4JQIA 3WNJA 1N0LA 5FGCB 4DTGH 4R4BA 4I18A 4X5WA 3IDIB 5I15L 4XP4L 3AC0A 5FFLA 2YPVL 1G6RB 3OJ2C 1NGZB 2XXFA 3DYOA 1JZEA 5JQHC 3SKOB 2VW6A 1AS7A 1A1OA 4Y5VC 1EZVY 2GK0B 3EHBC 3KJ6H 4QRRE 4X6DF 3SBRA 1ASOA 1JZGA 4PRPB 4QXWA 4JRXD 2NTFA 1HNFA 1T4KA 1K4DA 3RVVC 4AEFA 1CQYA 1FFQA 5F97E 4UIMB 3NCBB 5I0XA 5KYWA 2GITB 3ABGA 4X6BB 4H5SB 2LT9A 5JDSB 3LB6D 2GVYA 4DOHB 2OL3H 4KJPD 4U1LB 3U2JA 3SQBA 2FQGA 1PSKL 3V8OA 5MEQA 3KPOA 5IMKB 4Z78B 5ICUA 2V6HA 3ET9F 1SRDA 1XGZA 4LSDA 5T3XH 1U8CA 3TJPA 1KLGB 3AM8C 5C7XL 4Y4FD 1C5CL 2Y07L 1J0HA 1ZEAH 1AXSA 2OMWA 4IEFA 3WJMA 3KW8A 3O8XA 5DK0B 4IMKA 5I5IA 4MHHG 3FU3A 3WNMA 4X7SH 2WP3O 4WW2A 1PKQE 3WAJA 1YMME 2GG1A 4TL5A 3WN5B 4QOKE 2UUDK 2X4RA 4UF7C 1F4XL 4N8VB 4Y4KB 3RY4A 3VWKB 4TQPA 4ISVA 4TF4A 5C6WH 3VRLF 2YZ1A 4DPRA 2NYYD 3LS5L 3MJ9H 1ZWIB 1Z3GL 3LIUA 2O6EA 4TL4A 5AKSA 1PDKB 3ZHLA 1NC4B 2Z4TA 4LF3B 1HK6A 4GAJL 4P5MB 4G82A 3O2WL 4Y5YC 1AE6L 5E7BA 1L3WA 1PLGH 3HBGA 4WJKB 3PDDA 3UADA 5DJZB 4HQQH 1QUNB 2ATPA 4N3TA 4TNEA 3TJHC 1LK2A 2FEJA 5JA9A 2DYPD 3KGRA 4NERA 2VR7A 2YGNA 3L45A 3OAZH 4YLCA 3MLYH 2VDLL 3K72B 2UZYA 3L2MA 1RU9H 2VUKA 3VH8B 4ZFGH 5CM1A 5KSAC 3US1A 2X44D 2ADFL 3F6LA 5DURD 1CXHA 4DW2H 5JW4M 4YAQA 1J86A 4NQEA 5EU6A 5DCCA 4A2MA 4UOJA 4UTCA 4O02H 4PV8B 1LO3L 5DZOA 5LAPA 1HOCB 2QPDB 4PGBB 4E5XB 2VYRE 2W9EL 4UINH 3BWSA 3HCVA 2ZUTA 4GUQA 3GXTA 4ANKA 4A1RA 1MDAA 4GBXD 5DD5H 1FJ1B 1FRGL 3MV8B 4YEFA 1AQ8A 5C0CE 4TSCL 4I48B 4M9OA 4O00A 4AGMA 3UTTA 4AW4A 1HE8A 5DJCA 5LAXA 3HN5A 3CN3A 2AQSA 1FLTX 3Q6FA 2MQ0A 3SDDA 4YSEA 2Z93B 1HIML 1NGWA 3K4DA 3N9GH 5FKAA 5EF3A 2A6KA 2PXYA 5DD6A 1U2YA 5BCAA 2I25N 5C0ND 4LOEA 4P3DB 4PB0L 2AQ3A 2VDLB 4F58L 2ZPKH 1SQ2N 2JB6B 4F2EA 4N0FB 2P3YA 3UYRH 4PEEA 4I3RH 5IROC 2AJSH 1OAUL 1UJ3B 2Z35A 5DK3A 5J12C 4S1DC 5GS2H 2A6DA 4XNZC 4J8RA 4LESA 1GL4B 2DEWX 2HFFA 2WN2A 3V8CA 5F7DB 3RJDA 4Q9QH 4GIAA 3SDXA 5D7LB 1GJUA 4RBPH 1HI6A 4M8QA 1YEGL 2FNWA 4NIYE 1DQDH 3T0EE 4AC4A 4AK2A 3QNYB 3L1OH 3TEUA 1Q9KB 3E8VA 3ZDYF 1OCWL 3L95A 1O9ZA 1T7YA 5E1AA 2YR3A 1MXDA 1YY9C 3P30H 5C09E 3LHPH 1ZLSL 3MUGB 2WSPA 2PP8A 3ZKXC 3BC9A 3BYYA 3ECVA 1CE1H 2E4TA 2YEZB 4ZSOA 2AVGA 1JFQH 1MAMH 1VIWA 5J0BA 1RJLB 4W9DC 1Z9PA 2FYVA 1JYWA 3QEUB 3U4BL 5CINH 3UXFA 1RULL 5FHBH 1J8HE 5GS3A 4P2OB 5DWUH 4U1HA 4M7LH 5L4IA 3G5ZA 4G80B 1F0LA 4MD4B 5D6CB 3UZQB 2VQ1A 4F2MA 4D7PA 2HAZA 3CVIH 1VENA 4ZMTA 1A6WL 1OPGH 4IKLA 1P7BA 4CBZA 1QOKA 4D9LL 3H7BA 3INUL 3I85A 4PN6A 4U4BA 1E90A 5KUKA 4Q6IA 1PCXA 2UWEF 1F3RB 1UOVA 5F7HA 4XCEA 1KGCE 1FAIH 2NXYC 1W80A 2DTSA 4KQ3H 4RGND 5FUCE 3VGAB 3D05A 3QQDB 4DKTA 1A1NA 1O6TA 2P26A 2Y3NA 4XNDA 3BRDA 4O2FB 3IFLH 3QWRD 4HH9A 5LVEA 2JCWA 2FATH 5T33H 4TLTA 3MLRL 4BZYA 3UPRB 4PJEB 1GRWA 3F7YB 4H0LC 5A2FA 3L4XA 1M2VB 1OK0A 5FYJU 1H0DB 2ZXEB 3FB5B 2IFFH 4NKOB 4OLVL 1X4YA 2PCXA 3GPSA 4LSVL 4HS3B 2BVOB 5I1CH 2VITB 3D3VA 1A4KA 1HHJA 5CZRA 3W9EB 3CSGA 4YHZL 3ULUH 3PS6A 1XL4A 1HDMA 4JPVH 5H37G 1ZHLA 1J5OH 1UOLA 4XC1H 2VM9A 4AEHL 2V37A 3P9MA 3IKCA 3P4MA 4P2RB 4HPOL 5MP6H 3ARFD 3QIWB 4KVNL 4HJ1A 2P8LB 4NDMB 1AXTH 1GIGL 4YHNB 2DL2A 1J1XH 2NOYA 4LBEB 4TNWF 3D51A 1H3TA 4NQDA 2A6IB 2CGRL 4DP1X 4RFEA 3U82B 4G7QB 4OGYH 5LCVH 3O4OC 1P53A 3RVXD 3CDYA 2ADYA 2YKLL 1S7TA 3KBHE 4GI6A 1EJ6A 5H2BB 3NSDA 3FRPG 3U4EB 2RGSA 1NMAH 5EA0L 3SGKA 1KF9B 4R8WH 4Y19D 2ZXBA 5JR1L 3GI8L 1K5NA 3SJVE 1RURL 1YYLL 4JDTH 3KS0H 2PTUA 5IV2A 3NIDE 3QVAA 4P46A 2ZP0T 4R9HA 1KWKA 3CXDH 4U6VH 5KYNA 4ILDA 1RSYA 1M05B 5KSBE 4JZNA 3EJYD 1DLFH 3WE6B 5L2JB 1U8PB 2V7NB 3HNTL 3QZWG 5ID0B 4RA3A 1OP5K 4X9BA 5CILL 1KIRB 3UDWC 1TJGL 4MAYD 5J89A 5ADPL 5IVXB 4FFWC 1WFMA 4I1RA 4FFZL 4X80H 4OAWA 5CHNA 4FJZA 4EI5A 1BOGA 1CBJA 1O6VA 1P5VA 3O6FD 1R46A 4LOUC 3FH8A 5DC2A 5FDWB 4H2CA 2IANB 4F9LC 5IW6A 3CC1A 3FU9A 3KMDA 1D5XA 5IJKC 4PRHA 4J6RH 1KY6A 2NY2D 3B8SA 4J3UA 4MKTA 5FV2A 3WIAA 4WW1B 4IRZA 1I9IH 5BOPA 4DGIL 2AK4A 5TF0A 1TXKA 3QARA 4WI7A 4DESA 1ET5A 4PQXA 3RJQB 4KQ0A 3RPKA 4BK5A 1EJOH 3BRGC 2F54D 4E9TA 1MCNA 4JFZH 4OUOA 5GGVL 2UZXA 3HUJB 2G5UA 3MSPA 5DO2D 1FQ9C 2VLME 4M6ML 4B0MM 4AQAA 2VGLM 5ESQB 2LU7A 2B2XL 4ODVH 1GHFL 1KXVA 1VZHA 4R7NA 1MI5D 2DWSA 1U8LA 2HJFA 4LGSB 3SE3C 4RRPM 3C08H 3UAEA 3WEOA 4ZQKB 2DQCH 3ZO9A 2MKWA 3VU1A 4U1JB 2EIZB 2FD6L 4XN9A 2V9QA 3HI6L 4NQCB 1E4XH 2BCMA 4FF9A 5BW7C 4OVVA 2JQAA 5E8EA 2CLVB 4FQIH 3RNQB 2EEBA 5D2NB 5GRUL 3A6CH 1DN0A 1FNEA 5SX4I 1MJ8H 2B1OA 2RJMA 2ZX9A 3CPLA 4FXKA 5E9AA 2D4FA 4JFWA 5GRWA 5L2KD 5ICZB 3SDCD 1TCRB 2QPUA 4Y2OB 1NGPH 4CW1B 5ICXA 3WHE0 3G5YB 5K9JH 3UG3A 3GO1H 3GLZA 1MRDH 1N67A 2DWTA 3T6XA 2IIJA 4PLKD 4IHOA 2ATKA 3WJJA 2CZNA 4NYLB 3WS6A 2PTTB 5F0JB 2MNUA 5CEZL 2WXGA 1NDTA 1FPTH 1Z0NA 2PABA 3GSOA 3VFPA 4PUBH 2RFXA 5DFAA 3ATBA 2JB5L 4YHIB 4DP6X 4PLNC 1S7XB 1AY1H 2EH7L 4GXUN 1I85C 1YNTA 1YPZE 2NY4D 4RISL 5GGRA 1KV7A 1SUJA 4O51B 2ZOWA 1UCBL 4W9CC 4L4VD 3S3DB 4FFYA 5C7ZA 4MDRA 3OAUH 4KUZH 1KEML 1EXGA 4RMVA 4Y5VB 3GJFB 2BO0A 3EHBB 1MLBB 2VH5H 3RL1B 4MVBD 2AERT 1MHEA 3H2PA 2I9TB 4JQXA 4Y1AA 2DQFB 1OWRM 3CLFL 1F4WL 1SF5A 3U25A 3AXLB 4XAKD 5AW8B 3QJVB 5JORA 1QFWH 5FM5M 2QQLH 3WENA 3G5VB 3HS0A 1L0YA 4G43B 1XF4B 1JXJA 2ETWA 1T2XA 2K45A 1H3PL 3FQTB 4OZHB 1RZ7H 3Q2CA 3HZVA 3BH8A 2EINB 3KPNB 1O5PA 3B7RL 4DPBX 2VLJE 3GC3A 1RD6A 4R90H 3AU1A 1SN5A 4TRPL 1H9VA 1NLBL 2G5BB 3AREC 4OFQA 1ET7A 3VFVB 4A2LA 5SV4A 2IGFH 2ESVA 2Z64C 1RIHL 1RJYA 4NQEE 4TUOB 5EU6E 3WNKA 4MAUH 1CT8B 3Q7JA 4ZW8A 1IO4C 4BINA 3LKNB 5D2LF 1FHGA 5M94B 4HS8L 1CWVA 1E28B 1WZLA 4NKQB 1T03H 1BF8A 4G9DB 4NO3A 1Z9SA 1EEYA 3DTDA 4JREC 1KYDA 2TRHA 2CUHA 1D5IL 3VCLA 1VAHA 3DOSA 5HXMA 2H47C 2Z4QA 4TSBH 4GW5A 3UTTE 5IVNA 1ZT7A 2OYPA 2QELA 4FMKA 5KJRL 2QPFA 5LNDA 5D72H 4DVBA 1RIVL 3Q9PA 2G75B 5I8OL 1BJ8A 3UJTH 1FZMB 3F62A 1NCDH 1AIZA 3OZKA 4HLZG 4X7DC 2J6EH 1FGVL 3R19A 1CPUA 5GGSA 2FR4B 1U8KA 4W9IC 1SVBA 3GMOB 1GSKA 4WKZB 3FPXA 3MXVH 4PJFF 2AQPA 2PPCA 2VKWA 2GIXA 5JPMA 1VEOA 4YE4H 2AJUL 3UC0L 5GGQL 2OQJA 4IRJD 1ETJA 3V0VA 1PU0A 4PJ9D 4ZQTA 1J5HA 1KTKE 4Q2ZB 1FFOA 2K7PA 4NEHB 4JKLA 4HUNB 3SDXE 1OP4A 3UJJL 3ILPA 4J27A 2AK1H 4C59B 5DO8A 5E6RB 5E5LA 2AGJL 3CXFA 2J8UB 1LDPL 4Z7UE 5IOKA 1U6AL 2EEXA 2R56H 3L2NA 1B4LA 4P23A 1BVNT 5KANG 2NY0C 2XKNA 1NCAH 4UTAL 3O3BB 4ZSOE 5GZNC 2NQCA 5C0DA 2R0ZH 3BLPX 5T5NG 4MD5B 2ADGA 2CDFB 5CJBA 2ARJA 2H32B 1PEZA 4NO0B 1WBXB 2OMZA 5T1KD 1XH2A 3VRJA 2F53A 4F2ME 2Y6SC 5HHNB 3PHQA 3QUZC 3B7UX 3QORB 3X14B 3ZVVA 4HP5A 3TT3H 1HZKA 1Q9WA 3F64A 3IMUA 3MNZB 2JJUA 1HZHH 4ZS6C 2AVFA 3QHFH 4FOMA 2CUAA 2BSSA 1CD1B 1VPOL 4XNZB 2C9QA 2ICWI 3K6SB 3QI9A 2NLJB 5KEZA 2EXTA 2I60L 4YDJA 1MKFA 5E08H 5IJVB 3MRRA 3QHTC 1AACA 4AGLA 1UZ6E 4MJIB 1JSYA 4X9HA 5E6IA 4DNLA 1YQVL 5E6UB 4LLWA 4LMQI 5A6MA 5C92A 4QR7A 3S3SA 5JHBA 4OTXL 1YY8A 2X4PB 4X7TB 3U6RA 4FQJL 1FGNH 2HPTA 3MBEB 1IIIA 1UXWA 5CUSL 5DTFA 1Z0MA 4PJAA 4WTXA 2XZAH 4RGOL 1NOAA 2MQCA 4TSAH 4J1UA 2CXGA 4XN5A 3D3VE 4L0PB 1E5UI 4JKKA 1B0GA 1XCWA 3FU0A 3PFQA 4LIQL 2N4IA 3DHPA 4URTB 4NUGH 4A04A 1UD6A 2CBTA 1NCCL 3W56A 2TAAA 3ZTJH 1ZIBA 4HWBH 2JQZA 1QI5A 2B08A 2CLZA 3ARGA 2YGVA 3GSRB 1OB1B 1IJNA 2P8MA 5I9QC 4CU8A 1VGEL 1UACL 5CWSB 2CO6B 5E9NA 3TZVC 1SJXA 2JJSC 4WUUD 2HFEB 4Y7OC 1JWSB 2WW8A 4GKNB 1XCXA 1UM6H 3K6OA 4FQHB 2E75C 3A67H 2WY3B 3AQXA 3WTXA 4ELMB 4BZ2H 3QDMD 1U8QB 2EADA 4JPIA 5TFSL 3MLPA 2OL3A 4Q9RH 2EECA 4HXBH 4YHLH 2HSIA 3LN5A 3BMVA 1DR9A 3GZPA 1IEBA 3GDCA 4AQZA 5F7AA 1W15A 4KK9D 2DQGL 4PHZA 4ZS7H 5C0JA 1KCRH 5F3BA 1T1ZB 2WWMC 4MLSA 4HKXB 3CHQA 3BVDB 3KD4A 4N2GA 3BSGA 4U1GB 3QJSB 3DMMD 4UYQA 1UQSB 4D9QE 4YHYC 3RIFK 3SQOL 3LDBC 5HI5D 3MU3A 4LSPH 1Q94A 5BMFL 5F1IB 3IJYA 4DGVL 5I6LA 1NCTA 2Y6TE 4G6JL 4QRUA 1F97A 4C4KT 2ZXWB 5KSVA 1CFSA 3QFJD 4LCCB 4Q4EA 3NP3A 5T5FA 4XTRD 43C9B 3QIUC 4JUTA 4OGXH 3MJ9A 1OD7A 4PRHE 2W07A 1G6RH 3MNDA 4E41A 5HI4D 2ADIB 2IF7A 2OYKA 2WBJC 4N0UA 5JHMA 1C1EH 1UH4A 2EP6A 4XB3A 5D55A 4GKLA 5KBNC 2BVYA 2KQNA 2AK4E 2EXSA 4XRCA 3HE6A 2NZ9D 4BKLA 4TNVF 1BYOA 4G3YH 3WJLA 3BFWA 1BYNA 1UD2A 2WTRB 4WUKL 3BMWA 1KPRB 3H9SB 5D1ZD 3BGFB 3JV6B 1IL1A 3Q5YA 1FH5H 3HNSH 3LH8A 3VXTB 5K9OB 4QMEA 3MLXL 1H8LA 1WT5A 2QSQA 4KHXL 4NHCL 1AGDA 1LTXA 3IPBA 4BXVA 4ELDA 2FO4A 4MNQD 2X4OA 2ZOTA 4JDEA 4O02A 1JGDB 4OJAA 3BWUC 4AYSA 3GTTA 5SWZA 5ISZA 2IXQA 4ZUTA 5LGJB 2X09A 2OFQA 3CZSA 4QF1B 5KN5A 5F71A 3T3PF 4F8PA 4PRAB 4QXUH 5ACLA 1AKJA 2RCSL 5JUEH 1TU2A 5I15H 3AFLA 2LE9A 2YPVH 3D69B 3FQRA 4G8GD 5FDYA 4ZFFB 2AEQL 3T0WA 2GBUA 3I75B 4JZJA 3O3UN 3LEYL 2OCFD 4M7ZC 1WFNA 3GIVA 1K8DB 3FQXA 3HBQA 4R97C 5HDRA 1GYUA 2K9UA 1F8TL 1N8OE 1XGQA 1E8YA 1D3CA 4DUWA 1M3JA 2R2HA 5DRXB 4XHJC 1I8MA 4WFFD 1FCGA 5DUBB 3A24A 5DK2B 3BJLA 1NUFA 3AUVA 2F74A 4BKTC 1A14H 4PG2A 2AZUA 1OSPL 1GGIL 5D7IF 1JDAA 2CCVA 3G5XA 1PSKH 3VMPA 4JG5A 3T2PA 5E99L 1P6FA 5E0QA 3MKGA 3TM6A 2E27L 4RDBA 2DLFL 4N87A 4GQPH 1T1YA 5C7XH 3IGFA 3GSNL 4Q58C 2X7LB 4HHAA 3T6ZA 4LCYA 3MRDA 2EYTB 2J43A 4OM0H 4UT7L 4NKDB 1M9WA 2CLRB 3D0AA 4FN0A 1IM9A 2C3XA 2UZIH 1F4XH 3MJ8B 2BFVL 3OBAA 1ACYL 4PJCF 1Z3GH 3RWFB 2A6JA 4HLJA 4Y1AE 4Z7NE 1UKSA 3P1VA 4JFUA 1MWAA 4GAJH 3U2SA 1I8KA 3O2WH 1AE6H 4HIIA 3MYJB 5E4AA 4F37F 3H9HB 4HXAL 3CFUA 3IF1B 1GGBH 1VB9A 4XP9L 3JVFC 2FSEB 3MLWL 2WBXA 3VDCA 4YBHA 4KK6D 1IGMH 4A7SA 4IRSA 3RAJH 2H1PL 4ZMYA 1JWMA 2E7CA 1NDMB 2VDLH 3BP6B 3U0PB 5INCA 5HDQL 1N5AA 3LH9A 4NN6B 1UYWL 1U42A 5LG6A 2ADFH 3GSNB 5DJAA 3S2AA 2AC0A 2ESVE 1BM3L 3FQ1A 1LO2L 3VSVA 2XDHA 1L5GB 3BD5A 5DJ6A 3VSTA 1OT4A 4JO5A 4JFFA 1LO3H 3ESPA 3O4LA 4OJFL 1BVLB 1LWHA 2W9EH 1LO4L 2XQBL 1VFBA 3FUNA 4KK5D 2ZKHL 2R7EB 1T89A 5GRJL 3MKKA 1MIEL 3JXAA 1S7UB 3QPXH 5E8PA 4EBQL 3HRZC 5IB5B 5FYKH 1BBJA 3T4AB 2DV6A 1Y7VA 4I9WD 2NW2B 4IRJB 3ZKSD 2DF3A 1MFNA 5AL0A 4AT6B 1SOQA 2HJLA 3TA3A 1P4LB 3CDZA 3ZE0B 3QR2A 4GLRH 4HOZA 3CC5B 2EDQA 4BJLA 4K8RH 1OKEA 4PB0H 4F58H 3ARTA 4ZO9A 4J23A 4JFDD 4AJYV 4ICXA 1UXSA 4UV4H 4IU3B 4W93A 3BP5A 4CAGA 1PQZA 1XAKA 1KTLA 3OJVC 3AREB 2IQ9L 4ODTH 5FGBA 1UWFA 5HYIA 3L5IA 1ZY9A 5IQ9A 3CH1B 5EC1B 3ILQD 3B9KA 1UWXH 5T3ZH 1QPKA 4MQSB 1OAJA 4WNJA 4I0KA 5BVJA 2ICES 2WWKT 1TMCB 2WBKA 1OCWH 4F8QA 1ZLSH 5GQBA 3C6SA 4L1TA 3AGWA 4JFOB 4TUUA 3V0JA 1FIEA 3REWA 1NM9A 2CBPA 1QHPA 1SFHA 4HW6A 5GS0H 4N0RA 1VFUA 1XSOA 1U3NA 2X5PA 1QFWI 3L3KB 5F1NB 4AENB 3RWEA 1RULH 4XMLL 1JMZA 3H7LA 2BNQD 2IH8A 4JO4L 1H19A 3UH8A 5MI0B 4M62L 1A6WH 3JV0A 3FRPB 3ARQA 4IU2A 4D9LH 3FUEA 3J27A 3QE5A 3H54A 4B9IA 3INUH 3N42F 4BFFA 4DKEL 2QFPA 3L48A 4LCWE 1YECL 1YEEL 2WXNA 5GRXG 4PJIF 5HHXL 3IMVA 3MX0A 1YN6A 1UTDA 4BFNA 1QR1A 3FTGA 2VLKB 2XIDA 2RIKA 1AZZC 3QZWB 1I8IA 5DGQA 4CDGC 3P69A 1DQJB 3VQ1C 4F57L 4BFIB 3MLRH 2BP3A 4ZFOA 1AZVA 2CPUA 4JRFA 1EERB 2KERA 4OQTH 5CJXA 5KYYA 5LXVA 3EGDA 3ZDZB 4U6YB 3FQUA 4YWGL 4OBRA 1PY0A 1RHHB 1XGUB 1OZTG 4OLVH 2V5TA 5E2UL 5C0BD 4PJAE 2XRAL 4L4TB 3WFBH 2D3NA 5DMGC 2X6VA 1DANU 4LSVH 2JWYA 3KVPA 4XXCC 4J3VA 2VSDA 3PLYA 3ROLB 1XMEB 3QUXD 1ETZA 5D93C 1I7ZB 3MCG1 1DVYA 4L0ZA 4AEHH 3QZOA 1TVHA 3QUZB 2GFBA 4HPOH 3VWKD 2X0UA 4UAOB 4N2EA 1GIGH 2XN1A 5AFAA 4KHTL 2JKRM 2EO1A 4K7PY 4IGBC 4LPVA 3KG5A 4FERA 2CGRH 3VI3B 4ZNCD 1EFXD 1F3DH 2BY0A 1QLEL 4XH2A 1MCPL 3GWJA 4RBPK 2YKLH 1DJGA 3MRGA 3LH2H 3DX4A 5HPMB 5K33A 1YO4A 4NC2B 5EZOL 3P4LA 5EA0H 3QQ3B 3BZ4A 2FRGP 2IWKA 3GI8H 5JR1H 3MHZA 3NJMA 1RURH 1YYLH 4NRXB 3ZT5A 3WEXB 3M46A 4QJ4B 3TIDA 2X9XA 5T3XE 4I5BB 1H5BB 4N9OB 1J9QA 4PFEA 3KPSB 1M6UA 3NH7L 1S8DB 2IOIA 4Y16B 3LKRB 1N19A 3DKHA 3HNTH 3O11A 5CILH 2Z91A 2J55A 4WI5A 3HBPA 3P0GB 4ACPA 1TJGH 4AY0A 2QVMA 2ALAA 3TO4A 4XC3L 1GZHC 5FA4B 4L8CA 2NY1C 4FFZH 2M2DA 1W0VB 4YK4B 1B0RB 4OGQC 4PTTB 3IDJA 1NSNL 3FFDA 3EJRA 3MLTA 1ZS2A 3VXUD 4XP5L 4F33B 1QLEB 4PP2B 5D7KD 4XAWL 2GCYA 4OKVB 4HIJA 5FO7A 3ZZSA 1NICA 4I0PC 2OI9C 4IQHA 2V8LA 3TBVA 4NN5B 4E41E 5BJTB 4OF6A 1H15B 4N0UE 2BRRL 2IH3A 2J8HA 3OL2A 9PCYA 2Z7YA 1ZJAA 2CO2A 4M7KL 2ZONA 4DGIH 1IGIL 1KIPA 1RP8A 1EXHA 1BF5A 1NTDA 1P2CB 2PR4H 3RDJA 3KLHD 2B3RA 4KGLA 4WAFA 2B9BA 5GGVH 3V0WL 1ID5I 1HWWA 1S9YB 2BERA 2P1YA 3QZPA 4JRYB 2GSIB 3QSKB 4G7VL 4LRIC 3QO1B 1FYTB 3VMOA 1JDDA 4M6MH 5AWNL 2VW7A 2HZHA 2B2XH 3BDYL 3BIAX 1GHFH 3MFFB 4G8AC 4WJ5B 5ANMB 4V1DB 4U1MB 5I8EB 1TQCB 4E9QA 5ISZE 3O41B 4KMTL 2G3ZA 1JV2B 3PL6C 4P9ML 5CSBA 4YSPA 4ADGA 4JPKL 3NEEA 3OMIB 2IPTL 2FD6H 4IYKA 3VJ6B 3WBDA 3HI6H 1MQ8A 1Z66A 3H0TA 1U8NA 1HAUA 3CFQA 3IK2A 3VI4F 2L3BA 3FSWA 4Z3IA 4MB3A 3QZBA 5GRUH 1V7NL 2I69A 4ABUA 1IEHA 4NC1C 4QO1A 2HRPL 1IKOP 2EXYD 3ZHFA 5JPNA 3D0LA 3BUIA 5AW0B 1TJHL 2UY6B 2UWEA 2J6EA 4KROD 1RUPL 2N0MA 4ZAKD 3TFKC 4X4MA 2PW1A 3BEWB 3RDTA 1VZIA 5DFWH 3LZPA 5F9AC 1MFUA 4QTFA 5HJBA 3KWUA 3VXMD 3ZTDC 3LXBA 2A2QT 1LVEA 4KKLC 1UB6B 4P48A 1Q0XL 5CEZH 3PQYA 3PV6B 1QRNE 4JBSA 2AJ3B 4YZFE 5F0MB 1FO0L 1AO7B 2JB5H 4MMZC 4N2HA 2GIMA 3BN9D 1QNZL 3LRHA 1BD2B 5EU5A 4RISH 2DMHA 2D9QB 2H3NB 5DVOA 3PGDA 1NFKA 1CFQA 2DTML 1HSAA 3SYPA 1KBGL 4P07A 3K91A 4P2CG 2D7NA 1KEMH 3HFMH 4ZUSA 3COOA 5A3IC 2B15A 2ZIDA 3HBZA 3I9IA 1HSBA 4M7ZB 1N2RB 2BNRB 5A16B 5HDWA 3CLFH 3U36A 1AQHA 2SEBB 2NUTB 1F4WH 1RK0A 3PWPB 5DQJA 1MWOA 2IC2A 1B6DA 3QUYB 1HS6A 1SYVA 2XZQL 4PJHF 3NZ8B 4ZFFA 3RB5A 2ZWYA 4NZFA 4FTVA 2LHAA 4RZKA 5E24E 4P4KB 3O0RL 4B96A 1FO0B 3RLSA 3GSXA 2EDWA 3EFDL 3L3OA 1G9EA 4TRPH 5D5MB 1NLBH 4N2NA 4APXA 2QKIB 4Q8BA 4UIKL 2WO2B 1HH6A 3B2UD 4WU5B 4LPCA 4CVXA 2QPEB 5KOVC 2DL9A 2Z31A 2IOOA 1A9EB 5D1XA 3RFZB 3BXNB 4JFFE 3O4LE 4NT6B 1DSFL 4PJGB 4HS8H 5FHAL 3K81A 1J9SA 3UTSB 2GJ6A 3DBSA 1A4BA 1WD9A 3MROB 2VZVA 4QCIA 4AVKA 2FQDA 3FB8B 1BZ8A 3FOLB 2IG2L 4M4PA 5IY5B 1JUFA 2XY2A 3UIZA 1KB5L 1KOAA 2ICEA 2JELH 4TOYL 2IAMC 5EZJB 3SKMA 5MHSE 5KJRH 1A6VH 2Q1EA 3VXSA 2GEQA 2Y5EA 2FIKB 1RIVH 4XCNB 4LHUG 5I8OH 1A6PA 5F1SA 3ULUE 2H0FA 4GT7A 1AXIB 3UAJA 2WINA 2WNWA 1S9XB 5AAPA 3ULVC 2GT9A 1J88A 2IPUG 1T2JA 5IQLA 4PVBA 4HWBA 4PS3A 4OUUA 4PSRA 3Q8BA 2PO6C 1OGPA 5I1JL 3QPQD 4NM4L 2AJUH 4FULA 3EBAA 3ZU8A 2OMXA 4KKRA 5FB8A 1N12A 1PG7L 2FLBT 4BZ2A 1V3LA 2C4FT 1NFDA 1A02N 1NC2A 3FZUC 3GHEL 4J4PD 2WXLA 4XMKL 2AGJH 2IMNA 1QA9B 5J9PA 1KB5B 5KS9F 1LDPH 1QQDB 3BAWA 1GC1C 4Y2DA 4AYDC 4MQXD 5EO9A 1NCWL 3BZDA 3HRZB 4OD2B 2W88A 4MCYA 2AITA 5T1MA 1ES0A 4UTAH 3OKDB 4ZXBB 1JMXA 4PMFA 2Q7YA 1X5LA 4NWUL 3L5WB 3F7VA 5DHYB 1RIUH 1BQHG 2K8QA 3PP3K 4G2AA 4KUCF 1H3VA 2B5IB 4NCC1 4UUJA 4U1SA 5FW7A 4FKHA 5IHZA 1ZGLM 2H2PC 2XTJE 3CJJA 3APFA 2MIZA 1OGTB 1JPGB 1ZA6B 4MJ6A 5CN1A 1ZVNA 4L2LA 4DZBB 3CDGA 5J1AB 4D9RD 2HJKB 1G6RA 1Z1WA 4KKNA 1VPOH 5I18L 4PS8A 4GFXA 3APNA 3ALXA 3GM8A 1KMGA 4N28A 1SXNA 5KBPA 4AM0Q 1MHCA 2Y23A 4YXLH 2C3VB 5J13B 3T09A 1ANUA 5KBKA 1KNOB 4QYAA 1X9LA 5GS1C 5CZVL 1HAWA 4OLZL 5ALCH 4HD9A 3ARWA 5FYKU 2F7OA 2VABB 5L0QB 3NIFB 3L3GA 2CUIA 1QWNA 4FQJH 1TZGH 4ZTOL 4X0KA 1U30A 3MOQA 5F1OB 2BHFA 3B37A 5F7LB 1O6SB 1UCTA 2ZAGA 3B2XA 3BWAB 3GB7B 4RX4D 2AXFB 2YPVA 3LB6C 3GXFA 3HR6A 4RRPG 4IOSD 3ZDXB 4N1HB 3SCMA 3CZFA 1VGEH 1UACH 2VIRA 1MHHB 1HCVA 1UD8A 2ZAHA 3PDOB 3ARDA 5DVNA 4U1IB 2NSXA 5JXAH 3VFOB 4FQ2H 3IS0X 2HT4C 4OZIF 3H6AA 1KIUA 2XBDA 7FABL 4Y4FC 2ERJB 5TFSH 1PDKA 1NC4A 3APMA 1MW0A 1VERA 3RVTC 1GMIA 1XZWA 3UYPA 5D2LA 4QRPA 5F96H 2R0LL 1M71A 2DQGH 1YNLL 1QSED 4JM2F 1FAKT 5AVXB 1RK1A 3LRSA 3HKZA 1AHWB 4ERSL 4KAQL 1IB5A 5JHAA 1I7UB 1GSMA 2AXGA 5FR3A 2Y4SA 1E6OL 3ASOB 3GBEA 4TNWK 1L4IA 1NBYA 1M6OB 4DGVH 2VNCA 3LPFA 4LE8A 1JHKL 3BO8B 2WM0A 4Z7WB 5SWSE 4F7TA 1NINA 5DD1H 2WVVA 1OP3K 1AD0A 4JFED 1NGXA 1A6AB 1JNHB 5L8KB 2AJXL 1KGUA 4I48A 2BOCB 1P7KA 3AZUA 4X42A 2WXQA 4PJFA 3WE1A 4U7SA 4WI2A 5FS5A 1IJ9A 3VFTB 1A8ZA 1LP9E 3MRQA 1PX4A 2OMYA 4ESKA 1WC7A 3FMGL 4PJBB 3SYOA 4CU6A 3WY4A 2J71A 4WUKH 4HCGA 4RZCA 4HC1L 1QBMH 4P3DA 1VEMA 4GBXC 1WAAE 3V6ZA 2WXPA 1L9OA 3MLXH 4FHKA 3AAZB 4YHML 4KHXH 4LSTL 3SKJH 4NHCH 5ECJE 4M5YH 1UJ3A 4WK2B 2WB7A 4K94C 4WU7B 1IFRA 2QGEA 3WL9B 4JO3L 4EUPG 1OLZA 2GUOB 4TLSA 3THMH 4IDJH 4ODWA 5C07D 4OFVA 4AKQA 4E2OA 3OR7A 1PFOA 4ZAKB 5FOJA 4AE1A 5FYLL 2CM6A 1MJUL 3MOAL 1C8PA 2YAPA 2X4SB 4M6OL 2BOBA 3BVNB 1JRHI 4QRQA 3NMEA 2DIBA 2VJ8A 3NBNA 4X6FB 2AEQH 4FLQA 3V4UL 1MJ7L 4I0PB 4YE0A 2ZJSL 5DDHA 2HVKB 4WCYL 3SKNA 4XI5D 3SIKA 2EDLA 1G7JA 2BZDA 3L5JA 5ETUA 1DDTA 2UWEE 1L6XA 1RJLA 4X6EA 4EJ1C 2VXQA 2XA3A 5DA4A 3U0TB 3EZ8A 1AQKH 3UABA 3FO1B 3LV3B 3HE7D 4RH4A 1L0QA 2D7OA 4G80A 1B0WA 3E6HA 3RGVC 4EXKA 4H8UA 2X41A 3VFRA 3DDFA 5E99H 4M8VA 3GHPA 1KPUB 1VCAA 2NUPB 3EBHA 4Q9BA 3OMAB 2DLFH 1KELL 5HHPA 4IOFD 4LAQL 3DXAD 3T1WA 4JZOA 3RZCC 1MFMA 4LFHD 5GPRA 3FCUB 1NEZG 3ZR5A 2WD0A 4ZX3A 4ZODA 2X2JA 3K8LA 4M7JH 4UT7H 1SDYA 4I4WB 3HJ0A 4BSVB 1IZKA 1HXMB 3BVWA 3HNVL 4HX1B 3UPRA 2ENPA 4PJEA 4XBGB 2BFVH 3F7YA 3GT6A 2GJJA 1ACYH 3U7YL 3I3DA 3ARBD 4XVUC 32C2B 3BWUF 4M93B 4UT6H 5C0AB 4NSKB 1FDLL 1H0DA 4POUB 4R7VA 4WHDA 3BZ5A 5HHQB 3U9UB 4RGNC 1TT6A 4G7SB 4LSQL 2ITEA 3P2BA 4XP9H 4QKTA 1ZVHA 4TMPA 3MLWH 4XBEL 3CHXA 4QT5B 4FTVE 4ORGB 4Y2NA 2IMMA 3GTVA 4IW4C 5HDQH 4P2RA 5HHOD 1UYWH 3T4YA 1XFPA 1XB8A 2P8LA 4NDMA 4HEME 4YHNA 1R5WA 4MBRA 1BM3H 2NMSA 1A1MB 2JJTA 1A5FH 1N6UA 3AS2A 4KRLB 4Z3GA 4NNPL 4HDIA 7TAAA 4LLAA 2XQBH 3LN4A 3ME0A 2ZKHH 1KY7A 3E7JA 5GRJH 1PGRB 4OQTA 4X4YA 5I1IL 1MIEH 4L8DA 3U4EA 4FG6C 4JM0A 3WFEL 5C8JB 3QEQB 1JZHA 1J9RA 5I0WA 3ARFC 4JE4B 5I71B 3GK8H 1TSRA 4F7PA 4WFHD 1P1ZA 3OF6A 4F1ZA 2PCFA 1E2ZA 4BFBD 3KYMA 3DROB 4N2CA 4PLOB 1MY5A 2DMGA 4JFVA 1M05A 2JVUA 3BFQG 4BFGA 5CJOH 3UERA 5JHLA 2R69L 4WWKD 1FORL 5ID0A 4QGYA 5I73C 3BH9B 1MCBA 3KAAA 3KYKH 5IQNA 3N50A 2QR0A 2XNAB 4POZC 2OBGA 4HIEB 4MMXC 3FQYA 2CNYA 2J7LA 5IESL 5F7KC 5AYUH 5C9KA 2IQ9H 3TWYA 4PB9H 1J0IA 1MFDL 3FH7A 4MQ7B 3VYOA 2Z7ZA 5FDWA 2BHUA 4AYFB 1JS4A 3GXMA 1NFDE 4K5LA 4PRNB 3EJYC 3EBIA 4YFEA 4QRAA 4TVPH 1P7QD 3IN0A 2ZG2A 5LB1A 5IKCB 5DEGA 4HSAC 4BFRA 1SXCA 2CSPA 3BQUD 1H3UA 4MAYC 5F0PB 4ZOCA 3QJQB 3ZKQD 2HFTA 3ZHNA 3QJOA 1CJYA 2F9BT 4Y89A 4DCQA 2OJEA 1BF2A 3O6FC 4KOBA 3L4YA 1TPXB 1FV1A 1GC1L 1E8ZA 2YPLE 2FT8A 4I2XB 2HP4A 2DIJA 3O45B 4QOKD 5J06A 3SD5A 3S3CB 1KACB 4X6CF 3HI5L 4B6ZA 5FO2A 2NY2C 3BISA 3OHXA 1KDIA 1JZ7A 3CG8A 5DS8B 3X11B 1A6UH 4XMLH 3ZXAC 2V5YA 4FFTA 2RH0A 4WDIA 4JO4H 2EE0A 3FSZA 3GUFA 5FGCE 4M62H 5I0DA 1XGPB 4U1JA 2EIZA 4KZDL 4MRBA 4LAJH 2HVJB 4A7QA 4QI3A 2AJZB 4NQCA 4DKEH 3PJLA 1U3HD 1GZPA 5DO2C 3V4VA 4TLUA 5IW1A 1YECH 1YEEH 2CLVA 3ECBB 3EJUA 4U33A 2W60A 5HHXH 2R29L 4LLDB 5D7IA 2Y5QA 5D2NA 4CVWA 2NRDA 2F1BA 1CDUA 3CK0H 4GY4A 4LXFA 4QAMB 2Y7LA 5DR5L 2FL5A 3L3HB 1FI8C 2Y2WA 3L6FB 2MHAB 3B5TA 4F57H 1UKQA 3WY1A 4XXWC 5ITFA 2H0PA 4Y2OA 4XZUA 3IKKA 3R18A 1UEYA 4DOHE 3DX7A 4CW1A 1QABA 2XZCH 1HYSD 2C7FA 4YWGH 2EYRB 4H8VA 4E0RB 1WH0A 2ODHA 4W9KC 5F1KC 1AZNA 3SDAD 5C0CD 4HMEA 5EO1A 2AKRA 3KLKA 4LLUB 2KKQA 3MRLB 4PJCA 4RMTA 1T5WA 2R2EB 4WFGE 1UZ8A 3SDCC 1F3DJ 2PYEA 3RY6C 1OAQH 4AXWB 2V7HB 3DI2B 4GG6F 2C1PA 3FT2B 1U92B 4FQQB 4O51A 4KY1L 4DSYA 2F7QA 1URZA 5E00A 4UDUA 2WQXA 4QXTA 4PLKC 4HWZA 5ID1B 2JMRA 3B3IA 3QQ9D 5IQMA 3DUUA 4Y5VA 1G5GA 4CBPA 5J11B 3Q6GL 4K5PA 5TGBA 4XGZA 1MCPH 3FCTA 4ZMXA 2VL5B 4IBQA 2BHYA 2DQFA 3Q5TA 2JTYA 2OSYA 2NY4C 3I84A 2MOGA 1NL0L 1S7WB 3T0ED 3BLKA 1CLCA 3FQTA 3VD5A 1SDDB 5T1DL 1TFPA 1E9OA 1K4CB 4PSPA 1H3XA 3NH7H 5C09D 5JYMA 4MVBC 2OA9A 4AX3A 3B8YA 3RE0A 3AABA 4JR9L 3MUUA 3M17A 2XKUA 2WKLA 3HOGA 4Y4HD 4PGEB 3VXPB 3O9WB 4Q7DA 4R7DB 4LCUA 3AM8A 4TUOA 3VUAA 4A6YL 1P5UB 1F86A 4XC3H 1XH3A 2YAOA 1YQ2A 3HMXA 3LKNA 2Y24A 2Y25A 1GOHA 1TZAA 1NSNH 4PGDB 2VL4A 2X6BA 4XP5H 2CMRL 5CIPH 4XAWH 1IQDA 4WO4B 3RL2A 2B4CC 1ML0A 5E4IA 3K2MC 2EDBA 3P9LA 1ZT1B 5C08A 1DJZA 2BRRH 4GMTH 1BIIB 2G5RA 4M7KH 2GC4C 2WK2A 4Y1TA 3WY2A 4CN6A 2XACC 3EIFA 3LD8C 2OMTB 3ABMB 4B3EA 4JRWA 4WEUD 2FR4A 5EOQL 3H4FA 4H8QA 3SPHA 4IIQC 3KPRB 4G7VH 5AWNH 3GMOA 1R47A 1W16A 1ZRUA 4WKZA 4X9GA 3BDYH 4QRSB 2H26B 4MS8D 4NHUA 4A6YB 5EIQA 5KSAA 3X13B 1CXLA 3GRWA 4OZFA 5IG7A 3MCKB 3QCTL 2R0WL 2APBA 1PZDA 4TUKH 1TITA 4Q2ZA 3ZX1A 2IPTH 2F5AH 4FL4C 4Z1PA 2E8YA 3HS8A 3ZSSA 3FT3B 4KC3B 4S1SH 5FYKE 3F6IA 2GW5A 2WBWB 3VW3H 1PCSA 4LSSL 3O2DL 2B14A 3O6LL 1FL5B 4TNVK 4JUSA 2IBZX 3PP4L 1BV8A 4HLZH 1KTJA 2K3HA 4OZGF 1TQBC 2V17L 3D6GA 4XBPB 2W0LA 5JIMA 1TJHH 1YEKH 4E9XA 4IKNA 4M43H 3IPFA 4Q14A 4FQ1L 1RUPH 4GAAA 4PVLA 1CXIA 1V55B 5FFGA 2ZF8A 3ARSA 1RLWA 2CRZA 4FCHA 2WO3B 1KTCA 1W72L 2V2WA 2AEWA 4N2BA 4PIBA 1G1KA 3EO1A 1XIWB 4WRLA 3C5ZB 4LEOB 4MHHI 5IROA 1MF2L 3C09B 3G5WA 4GP5B 4KX8A 1EV2E 4PR5A 3SJVD 1D5BB 4L1LA 1FE8L 4NO2B 2AABL 4XPFH 5C6TH 1E5YA 3VFWA 1PZ5B 5T3ZE 1XTLA 3FRUA 1QNZH 1JZFA 3VFUA 1E8XA 2YRZA 3MV7B 3LQZA 4LHUB 4NLAA 4FLOA 3D39A 3KXFA 4J3WA 4LB8A 4ODSL 3CXHJ 2DTMH 3UZVA 4OI8A 1I1YB 1KBGH 2F8IA 4N0YH 4UTAA 3EH3B 4X8GA 4ATWA 2AV1A 4PJEE 4HGKC 2EZ0D 1O75A 1X5ZA 2XLLA 4XO8A 4BZ1L 1S7QA 2WQAA 5BUAA 2JIXA 4FNLL 1RUQH 1W72B 3IDUA 1C5DB 2D8KA 3EG9A 2BNUA 3X1FA 1JWUA 4N2DA 4UQAA 2XZQH 2G0LA 3VXRA 1YEIL 4ANWA 3KCPB 3TIEB 1NGYA 3BUDA 3RGVB 1NIBA 2A7BA 3O0RH 3EFDH 4GG8B 1S7VB 1INQA 1IAIM 3R4RA 1WIPA 4P2RE 1V3JA 3CBRA 1WK0A 1OB1A 1V54B 4UIKH 3RNKA 1NMCC 4JN2B 2WYIA 1GGCL 1KXTA 5KZCB 4WI4A 2HFEA 1J8RA 1JWSA 4QRRB 1X7QA 4ZX4A 4GO9A 5FHAH 4W1TA 3VWJD 3KJ4C 4W6YB 5CGYD 3RZCB 4Y8DC 1HC1A 1BQHB 3IWUA 1IVTA 4KKCC 1PG7X 1U8QA 3ZO0A 4PJ7F 4F37K 5B39G 4G6KH 4QHKI 1F2QA 4G9FA 1UWEH 4Z7QF 4YC2B 1KB5H 4HOWA 4TOYH 3CSBA 4NI6A 1KSRA 1TENA 2GAZB 1SVZA 1GYVA 1P4IL 2CALA 1FBIL 2VSMB 4N9GB 5EU7C 1WYJA 1ACCA 3U1SL 4WQOA 1EO5A 4XNAA 1P4BL 4H26A 1IM3B 1UQSA 1NH6A 3NSFA 4HUVB 1WIUA 1S7SA 4HCFA 3NFNA 2GTQA 3B6SA 3DV4B 5SWQB 2EEDA 3O3AB 2NQDA 3I9GL 2MNJB 2CKNA 2AXHA 1C8QA 4QGTA 5MERB 3VB9A 3T9WA 4F7CA