2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
3QPKA 2GI0A 3AG3B 2IH8A 2VW6A 4YVUA 2IDSA 3WG7B 1L9SA 1ADWA 1E5YA 3QJUB 4DP6X 4E9SA 1CUOA 2AANA 4G7SB 3WNJA 2ZXWB 1EHKB 4KO6A 4GY4A 3TBCA 1OV8A 3FQYA 1AAJA 2YXVA 2BW4A 4GXFA 3TA4D 4PCYA 1J5DA 3IBOA 1PZAA 1KYAA 4BWUA 1NIFA 2DV6A 4BK5C 3FPXA 5B1BB 2EIMB 4Q8BA 4BXSV 1CYXA 3U25A 1BAWA 2XU9A 1A8ZA 2AVFA 1AS6A 1OF0A 2OJ1A 3FT0A 2BP0A 2J57A 1SNRA 4AX3A 1AS8A 4ZK8A 2FT8A 3ASNB 1SDDB 4KOCA 4E9QA 3UACA 5ANHA 2JXMA 3T6XA 3FSAA 1BQ5A 3NJFA 4G71B 1N70A 1OE1A 1PY0A 3FSZA 4YL4A 2HRGA 1KCWA 1M9WA 1TEGA 1PLBA 3NT0A 4GP4B 4WTQA 3NYKA 1L9QA 2IH9A 2EIKB 8PAZA 4KNSA 1MG2C 2E86A 3AG2B 4QKTA 3NJIA 1ASOA 4KOBA 4F7KA 4HHGA 2B08A 4DPAX 3GXUB 3T9WA 1SJMA 2FJSA 4JHUA 3PXLA 4DP2X 1JVLA 2YAPA 3GYRA 1ASQA 2PCFA 5D4IA 1WAEA 2BW5A 2MRYA 2UXGA 1A65A 1FFTB 4A2HA 1XB8A 1RKRA 2GSMB 4E9VA 1RCYA 2IWEA 3X2QB 5AKRA 1YLBB 4KO9A 2J55A 3EH3B 2VSMB 2WSDA 2YQBA 4HZ1A 1XB3A 4HCGA 2AFNA 5I6OA 2XWZA 4TXVB 1JZJA 1PF3A 2CCWA 2EIJB 1DZ0A 2GB2A 5B3SB 3NJNA 3NJKA 2VW4A 4X4KA 6PAZA 3TASA 2PPCA 1BYPA 2VM4A 4HALA 1IKOP 3KW7A 4UAHA 3FU7B 3RYMA 1ZV2A 1OCZB 2IDUA 4KO7A 3DTUB 2YAOA 4KO5A 3UAAA 1AQ8A 2EILB 4BDVA 1A4BA 2XXFA 1PMYA 1W8EA 2Q9OA 2YXWA 1SFDA 2MTAA 2GBAA 4HCIA 1AG0A 3CG8A 2PPFA 4AZUA 4BWWA 1DYZA 1X9UA 5B7MA 2XX0A 2NRDA 7PAZA 2TSBA 1NIEA 4A2EA 3S3BB 1GYCA 4DPBX 7PCYA 2IWKA 4W9ZA 1KGYE 5PCYA 2H3XC 5D4HA 3FQ1A 1NZRA 2PLTA 4WKXA 1L9TA 1NWPA 3DIVA 1AZNA 3DKHA 2QDWA 1ZDQA 1JOIA 2BWIA 5I5MA 1BQRA 2ZONA 1R1CA 2Y1AA 1ET7A 2HXAA 4BDVB 1ETJA 1ILUA 1CC3A 2GC7C 1BXUA 4NAJA 3HB3B 1OE3A 4CSPA 3NJHA 4YSCA 2QPDB 5A7EA 3CVCA 1URIA 2DYRB 2OV0A 2XX1A 1NWOA 2LLNA 1N68A 1NPJA 3NP3A 1J5CA 1MZYA 1AG6A 1ZPUA 3ABMB 3FSVA 2HX9A 4HCFA 1PZCA 2H47C 3NSDA 1NIDA 2GC4C 3EHBB 3MBWB 5IY5B 2Q5BA 1F56A 4AKQA 3FU7A 2XUWA 2BZ7A 1WS8A 1NDTA 1RZQA 5I26A 4YSOA 2YAQA 1B3IA 4YSTA 1OE2A 2BZCA 2XVBA 1HAUA 2BP8B 2QDVA 4EF3A 3ERXA 1L9RA 4UF7C 2DY2A 3L45A 3CVBA 2BP8A 5TK4A 5B7FA 4BWTA 4DPCX 1M56B 4AKOA 3NJGA 2CUAA 4M4RB 1ASPA 1IBZA 1XB6A 2PP7A 4DP1X 2XV2A 3AW5A 3BVDB 3NP4A 1OCCB 4JHVA 4A2DA 3UGEA 1E5ZA 1AANA 1EZLA 2PPDA 3PAUA 3ZBMA 2P80A 1SF3A 1CURA 4YSRA 5I6LA 2GIMA 2FQEA 2R7EB 3OMAB 4M3HA 1IBYA 4NERA 1V55B 3WI9A 2WO3B 4DP7X 6PCYA 3X1NA 2W88A 4GYBA 3V9EA 1L9OA 2AZUA 5I6MA 5B1JC 4G70B 2XLLA 4HAKA 3T6WA 3QJTB 3QJRB 2FQGA 2PP9A 4YSQA 3PLYA 3T6ZA 1J9QA 2FNWA 1GY2A 3ASOB 1HAWA 1ET5A 1AZUA 1PNCA 1JXFA 3ZIYA 5B7EA 1BXAA 4FAAB 1ET8A 1GS8A 5LDUA 1AOZA 4N8UA 1JZIA 1W6WA 4YSAA 1UATA 3TBBA 3CDZB 4AKPA 3AG4B 2QPEB 1NIBA 5E9NA 1MG3C 1ILSA 1E65A 1RZPA 3S3DB 1SHWA 3ZDWA 4A2FA 2X87A 4YSPA 3V9CA 1AZRA 3QQXA 3BQVA 3MX0B 1JERA 4DP4X 1NIAA 3D12B 5I6KA 3PAZA 4DP5X 2VW7A 3AZUA 1SHXA 3QJSB 3G5WA 1GW0A 3ABLB 2XYBA 3C75A 2PPAA 2DYSB 4Q89A 2GHZA 3OD3A 5FC9A 2CBPA 1QHQA 4YSDA 3IN0A 5B1JA 2H5UA 1HFUA 1JZFA 2TSAA 2FQDA 4MFHA 4E9TA 3CDZA 1FWXA 2J56A 3UAEA 4A66A 1NPNA 1QNIA 1BXVA 3SQRA 2N0MA 2YAMA 2I85A 5D4JA 3WKPA 1KV7A 4L0PB 1A4AA 4GP8B 1SDDA 2OCCB 3S3CB 1OCRB 1GS6X 1OCOB 1JVOA 4JKNA 5B1AB 3T71A 1E67A 1L9PA 1KDIA 3AG1B 1VLXA 1I53A 3PAVA 4HHWA 3FYIB 2FQFA 2PCYA 4YSEA 2JFCA 3N55A 3H56A 1TKWA 4AI7A 2UX7A 4YSUA 1NINA 3H4FA 3X1FA 2FT6A 2BP0B 4HIPA 4W1TA 3S8GB 2HZHA 2UXFA 4F2EA 1QLEB 3FS9A 3KW8A 3NJMA 1GR7A 4GP5B 4G7QB 2W8CA 1AR1B 5I6NA 3GDCA 9PCYA 1PZBA 3FYEB 5I6PA 4P5SA 1KDJA 1GSKA 1ZDSA 3H4HA 1A4CA 3NJLA 2EINB 1T5KA 2YAHA 2HRHA 1GS7A 3ABGA 4E9RA 2VSKB 2VM3A 1PLCA 1AZBA 4N4YB 1NICA 1BQKA 1PCSA 2BWDA 5F7BA 2CJ3A 3EH4B 4P5RA 5I28A 4G72B 4QLWA 1IC0A 2B3IA 3ZX1A 1V10A 1CYWA 2DWSA 3IEAA 3NSFA 3SBPA 4CSZA 1PLAA 2VN3A 3FU8A 4F2FA 1SF5A 2QT6A 4KNTA 1V54B 1AIZA 2HX7A 3CVDA 2YAFA 4G7RB 2HX8A 1E30A 1ID2A 2X88A 3NSCA 3X1BA 4E9XA 1XMEB 2BO0A 1BYOA 1TEFA 2PP8A 2CAKA 2Y69B 2YAEA 2IDQA 5EHFA 1GY1A 3FPYA 2UX6A 1WA0X 2FTAA 2IWFA 3OMNB 4UANA 1SFHA 2UXTA 4PAZA 2WO2B 3ABKB 4E9WA 3TU6A 1FA4A 3IN2A 1NTDA 3OQRA 4DP0X 4FA7B 3SBRA 3FU9A 5AFAA 1AACA 1ZIAA 1PAZA 3AY2A 3EH5B 4A67A 1KBVA 5F7AA 3WKQA 4ENZA 1J9RA 2RACA 3NJJA 2YARA 3PPSA 1JZGA 5B1KA 3CZUB 3NSYA 3X1EA 4KNUA 2A3TA 2IDTA 1JZHA 4A2GA 1JZEA 3EF4A 3FQ2A 4YSSA 2FWLB 4E9YA 2P80D 3FSWA 3QJQB 1A3ZA 1JXDA 3QJVB 5I5JA 1WS7A 2XV3A 5I5IA 1TU2A 2ZWNA 2R7EA 5AZUA 5TK2A 4YVNA 2ZOOA 1J9SA 1W6LA 1WA1X 3OMIB 1JXGA 3JTBA 4RH4A 1ZIBA 3WIAA 5PAZA 3PCYA 4NB7A 3JT2A 2XV0A 2CALA 2PPEA 3T6VA 1WA2X 2DWTA 2I7OA 1J9TA 3IE9A 4K9JA 3OM3B 4DP8X 2IAAC 2J5WA 2HLEB 2XXGA 1OOWA 1IUZA 2BHFA 4A68A 1MDAA 1MZZA 2I7SA 3N2JA 1M57B 1X9RA 3SBQA 4DP9X 2IDFA 1KCBA 3WNIA 1AZCA 1AS7A 3S8FB 1PNDA 4BXVA 3X1GA 3UABA 2JKWA 1KBWA 3HEIB 1BEXA 2FT7A 2VMJA 3UADA 2AZAA 2UXVA
chains in the Genus database with same CATH superfamily
2AMUA 2J43A 1S5IH 5FAAA 5F7YC 5KSAD 1B3JA 4ICWA 2IH8A 3M8OL 2ZD0A 2Z91B 3RFZB 4DP6X 1CBVH 4KJQC 1MKFA 5IR1B 1FNLA 1CUOA 1ETZA 3G5YA 3C5ZC 5KVGE 1YECH 1FRGL 3M86A 2R2BA 3AB0B 3S9DB 3FQYA 2UYLA 5E4OA 3SJVE 3TA4D 3QUMA 1QTPA 4HC1L 4GXUN 3IBOA 4ONHB 4J3BA 1XCTB 1EAQA 4BH8B 4GI6A 3P9MA 3H9SB 2OR8A 3JV5A 1CYXA 3SE3A 3QWNA 4F8TA 1WZ1L 2R83A 3LN4A 1E2VA 1ZY9A 1IVLA 4LGPB 5C07B 5BPPA 3OR6B 3DXAB 3VD5A 5JZ7D 4G5ZH 2N7SA 1OAQL 2XNAA 2YRZA 4JRFA 2CLVB 2E27H 2BP0A 4DGWC 1PW3A 1BZ8A 3VXUD 1NUGA 2FT8A 2DQFB 4E9QA 4PJEE 3UACA 1R9FA 3T6XA 3HBPA 1EDHA 3D5OF 4NFBA 4PRNB 2DAVA 4QTIH 4GQRA 2IGFH 4JQIH 1IU1A 5FDWA 3VI3B 4QXUH 1YQ2A 2IH9A 1O5DT 2E75C 4K2UL 2YZ1A 3MJGX 3ULUL 5E7FA 4IHOB 2KDGA 1TKWB 3OX8B 4IBQA 3UL4A 2AGJH 2EDFA 4PJXE 3CU7A 4YBLB 3BP5B 3SSGA 5BVPL 3DHMA 3C6SA 1Z0NA 4H4NA 5IJBC 4ONFL 4JFFB 5FO9B 2A83B 5A2BA 4IM8A 5EZLA 4OFYD 1MVYA 1JSYA 2XBTA 1WAAF 3GHEL 4MZRA 4UNUA 2L7QA 2VXQA 3MV8B 4Y5XA 5KSBE 5DUML 5DS1A 1FDLH 2GQHA 2CBOA 4TLTA 2XZCH 4P06A 5F6HJ 5CFHA 3ZZQA 1Q9KA 5ISZE 1UJ3A 3Q8AA 2Q3AA 4WEUD 4ES9A 1MRFH 2AFNA 4ZO7A 3VI4B 4ERSL 2ZKHH 4XOEA 3HJ0A 3ZUCA 2EH8L 5EU7E 1QO3A 2AQPA 4PB9L 1CI3M 4WO0A 1T3FB 1VCBC 1FVEA 1EEZB 1SRDA 4H0LC 4I2XE 2VLJB 5EOCL 5T3XL 4GKLA 2R2HA 3ARZA 1FLRL 4Y4FD 4G8AC 5IK3A 1HHGA 4LSSH 4PY8I 3VFGH 3DLQR 4K7PY 5F3BA 4Y2DD 1DQMH 1WCQA 4W81A 3UXFA 4G80A 4XNXH 1P7KB 2IH3B 5HGGS 5KS9B 2B0SL 2QKIC 1RLWA 2GIYA 3Q6FB 4MCYB 3ZO0A 4YL9A 12E8L 5I71B 3UTTB 1UASA 4Z7QF 4XBGB 1A6WH 1FC2D 3ZHFA 3RIAK 2VQ4A 2XX0A 3HG2A 5T1JA 3DOSB 2O5NA 4LF3B 1OGAE 2GITA 4N1CA 5EORL 1NEUA 3PJSA 4PV8A 1E5AA 5DS8B 4WJKB 3IB4A 1XZ0B 3QUKB 2QVKA 5FGBA 1A7OH 5B3JF 2VXTH 4KRPB 2XY2A 4EBQL 3NABL 2VKWA 3ARYA 1L9TA 2NCEA 3O2DL 4JJHA 3QUYA 3K6FA 2KI6A 1SLWA 3BDBA 2KZBA 4ZQKA 4N90E 2H6OA 3PJLA 1YPZB 1DBMH 1C1EH 1RMFH 4XO5A 3GMOA 4P3WA 4BDVB 4MZ3A 1Z9NA 2FATH 2VDLB 2PMZA 1IT9H 3WLBB 4NM8L 1IFGA 3PWVA 4CSPA 4HKZB 4QXTB 4KY1L 4BH8A 1MDTA 1DE4B 4YSCA 2M8XA 4NAMA 1ZEAH 2NY2C 2DYRB 1I9IH 1PZDA 1MY5A 4OCRH 1RZIA 4KUZL 3EYFA 1N19A 1UCBL 1CDIA 5EO1B 4XNQA 4X7FC 1N68A 2AF2A 2OL3B 4N2LA 1XD1A 3MJ9H 3L4WA 1F5WA 3PV7A 3K2UH 4ETQA 2EZ0D 4TNVF 3VRIB 2UWEA 3GMPB 4EN3C 1FL3A 2GC4C 5CWSA 5HHOD 2OMTA 2NY5C 2RCSH 3RX7A 4Z77B 4TQEL 4PJGB 2J2ZB 5F9WB 4QCIA 3G6DL 4LPCA 2O6EA 4OZFH 4UM8A 4G82A 2GTQA 1O75A 4X80L 4OIFA 4ZQTA 4ZS7H 2OSWA 2G60L 2P4AB 2YAQA 1FFQA 4J27A 5F89A 4YX2L 1IFHH 1JUFA 2N0KA 3FT2B 4X5RA 3QIWC 4CADA 1E8ZA 4CC0A 4FCAA 3PWVB 3WEXB 3K46A 5A6IA 5EC2A 1EHAA 2CO3A 4IGBB 3CCHA 1LE9B 1B0GB 3LXCA 5EIIA 4Q56A 2PP7A 1IBZA 4BQ6A 2VMCA 2JB5L 2BVUA 3OG6B 4U6XA 4JFZL 1OGTB 3W9EB 1BZDA 1X6LA 2EABA 4EN2A 3QDJD 4FQXB 3V2AR 1F00I 2OW6A 2EDQA 2RMNA 3GMNA 5HYSB 3O4LE 1XO8A 3KWWB 3MRBB 1F4HA 2OS7A 4QWWC 4NRXB 3C60D 1RZKH 3I50H 2W88A 1DQDL 2EVHA 5L7XH 1VEOA 2J2ZA 3TPUA 2BLFA 1RZFL 4LAQH 5HI5D 2Y6TE 1G9MC 3N06B 4YFDB 1KTCA 2ALWA 3FCGA 3NPSC 4C56A 1PD6A 1A1OB 4U3SA 2XIBA 2QGDA 3W0WA 3P54A 3MRLB 4ADIA 4OZ4B 1HSBB 2MCG1 3KPPB 1AGCA 1UGNA 1UKTA 3PQYD 1QBMH 4LRIC 1GS8A 3EYFB 5F7HA 2AV1B 4OCXH 4PYHA 5E99L 3ZO9A 1W6WA 3TZVA 4B53A 4YSAA 4RFEA 1UATA 3QQ4B 5MHSE 3CK0H 5LWYH 5FO2A 3VNZA 5HVGB 2NCMA 5E8OA 1EFXD 4U3XA 2H2SD 5CZXC 1AZRA 4WO4B 3L3KB 4UIMB 3QQXA 3UPRA 1NC2D 2ARWA 3KPNA 3W11D 5KSVB 2BVPA 2NLJB 1UJ3B 1K8DB 2L04A 1QMUA 1P9MC 1T1YB 1JGDA 4MJ2A 5J5EA 4M8QB 4QXGH 5EOQH 4FTVD 3VTTA 4XMTA 4HPYL 4Y5VA 3QBTB 1KT2B 1XZ0A 2WVVB 4GRLA 4WNQB 1AY1L 3PQYA 1JE6A 1MFUA 3OZ9H 2QPFA 4DTGL 3HOGA 3LEYH 5BRZA 5E95B 3RTLA 1JHLH 2GHZA 5C92A 1LO0H 5ECJE 1HCVA 4WTXA 5D7LA 5CGYC 5ID0A 3RI5F 2H0EA 1KGXA 1LQBC 1JZFA 3OHMB 4UOJA 5BMFH 1LE5A 4OF3A 2VDKL 4NP4L 1SM3H 1LXMA 3CDZA 3UAEA 3U0PA 5CEXB 4XCYA 3QPXL 1DQTA 2BIIA 2C7UB 3U4AA 1SLXA 2WLNA 3EDJA 3BN3B 2DBLL 2WLHA 4LSVL 1QI3A 1S7UA 1X4XA 4LPTA 1FVCB 4J4PA 2X0UA 4A38A 3S4SB 3ETTA 3FYIB 3WE1A 3QCUL 3H9SA 2FQFA 2DD8H 1WQVT 4I0PB 5DFVC 3VMPA 4DGVL 1SZNA 2VIRA 3QCVL 2RQ8A 4FG4A 4HEPA 4Q14A 4B9GA 2QMKA 2JKNA 3N55A 4EN3A 4HYTB 1UB6B 4KJYA 5EU6B 4AGNA 1RZGB 2C4FT 2LQRA 5JPNC 5KW9L 3PP3H 2CO7A 4XBEL 2R59A 5BOPA 1N18A 3L8QA 3VGGA 3B2VL 3B6SA 4OLZH 3GDCA 5E4EB 4Y5YA 4TYUA 4U1GB 4WHCA 5HGDA 2IPTL 3ROOA 3QHFL 4UB0L 3T09A 3SDDD 3BI9X 3C8KB 3QZLA 3GIZL 4NC1E 3K6DA 1ACXA 3PE9A 4XE0A 3FHQA 4UNTA 1KGCD 1MAJA 3IMSA 3FW6A 1KLUB 1TJHL 1UA3A 1ZHLA 2P1YA 2D7TL 4XOAA 5EZJA 3SKJL 3D3VB 4OQTL 5KWYC 2RALA 3ZT6A 2MNWA 5CD3A 3C08H 2WN2A 5HJDA 4EE2A 1E4XI 3RGVB 2RB8A 3QDJE 2Q7AA 4I2XA 1ZTXL 5T1KB 3HG5A 3FT2A 3U9PH 4XNZC 4ELMF 1RQ5A 3MRDA 5DTFA 1MFBL 1KJMA 2XZQH 1JHTA 3VWJD 4G7RB 3BWUF 2ATKA 1Q0XH 2VDQH 2EUVA 3FO2A 3FT9A 2F53D 1CL7L 2BO0A 1IGFH 2NW3A 2E3VA 1F1AA 1GYAA 3LRKA 4NLAA 2VZ1A 3BAIA 5E2WH 4P2QA 1TCRA 4U1JA 2X4OB 3QUMH 1LLAA 3VSQA 5INCA 4ZOCA 3CN0A 2YMOA 3WNKA 5J0BA 4EO5A 3TZVC 5ISZD 2JWYA 4L4TB 3GHPA 3IK2A 3QIWD 4G6AD 2Y0SA 2RGSA 3IN2A 3MV9B 2G3NA 1AGDA 1UZ6F 4JPKL 5J6HB 3CZLA 3QG7L 1NAMA 4BRVA 1J86A 4DN4L 2IG2L 3N85L 3U9UA 1I4FA 5KYNA 2WOYA 2J73A 4P23A 4P4RA 2EKJA 3TA3A 4E68A 3IJSA 1LDPH 5HGAB 3CQQA 4JO1L 2G9HB 4JDZB 3QCVH 4KH2A 2LTQB 1ND0B 4NN7C 4A2GA 1F3JA 1BX2A 2W60B 4IRJD 3S48A 3R0MA 1NKGA 3QIWB 4AYFB 3BESR 1K5NB 3U6RB 4HHAA 5E94A 5DMIL 2ZSWA 3MV7E 1DZBA 2IWGA 1IJNA 4OLXL 4N8CL 2MKWA 3ZZ1A 2QVTA 2QADC 1OXYA 4G9FB 4JG9A 1WE5A 2H0JA 1FZMB 1Z7JA 3Q2LA 3WKYA 4WW2F 1JYXA 3WS6A 3FCSB 3Q5TA 4D0CA 3MOAH 4PGBA 3SKMA 2IF7A 3CFDB 4H8WC 25C8H 5HDQH 4YGAB 3J07A 1AO7D 3ZRSA 2I60L 2J4WL 4NC1C 4J3UA 4YUEL 4LKCA 1YRKA 3PWNA 1BQLL 3CD4A 3GSOA 3CSYB 4JPIB 4RFOL 1HDMA 4TTGA 1OSEA 4I87A 3WYRA 1KCBA 3Q1SH 4PJFB 4MXQD 1N5AB 3BEVA 1GH7A 1ZWIA 5DQJA 2JKWA 3RWEB 1T1XB 3EJZD 4I77L 2ITCB 3P1VA 2G9HA 4JDZA 4G7SB 2VZVA 4MYWB 4UAOC 5LHDA 3QPKA 1QG3A 3UTTD 4P9HL 4R84A 4BE6A 2WUBL 3P0VH 3AG3B 4ZMAT 3VQ1C 1RI8A 1MCWW 4YXKH 2ATAA 2YC1A 5TF0A 1CDYA 4OD2A 3BDXA 5I1JL 1MH5B 5FUCC 2YUVA 1WT5A 3AWEA 4X5PA 3HE7C 2Z31A 3KNBB 4KDVA 4KXBA 3BUTA 5EO9A 4GG8B 1GGYA 5HDOA 4C56E 5ALBL 3HE7D 1E27A 4P2RB 5DQ9B 1AGCB 2YD0A 3Q48A 3MUHL 3ZE0E 4X4ME 5B1BB 3V4VB 1K5WA 3AABA 1INEL 4FI7A 1B0WA 1OD9A 1GGBL 1B9ZA 1G1OA 4PB0L 1UT1A 2EE0A 5JR1L 1OP5H 3AY4A 3X14A 4M29A 4UU9A 4WEBL 5DJCA 4BUQA 3SO3C 3NK4A 1SHMA 1RZ7L 4TVUA 4JCMA 1CVRA 3U36B 5EZPA 3CHSA 2K8MA 2ATKB 2QZQA 4Z7NE 4MXQC 4GMSL 3CFBA 4IS6A 3OKKA 1N9PA 2A74A 1S78D 4G7VL 2R15A 3HMXL 2BSSB 4O9HH 2Q87A 2A6IB 4RSVA 3O6KL 4JCWA 3HG1E 3V6OA 4NSKB 4Z7WB 1F58L 3BDYL 2B9BA 3FQRB 3WS3B 4IBTA 2F7PA 2Y2WA 5B8CB 1WD8A 1Z9LA 2OXGA 1ASOA 4J3VA 3MCG1 5CEZL 2B08A 2P7TB 4YAQB 4PTTB 4E41D 4OV5A 3CZJA 4LLMB 5HYEA 5B8CA 2VDML 5IHLB 1L0XA 2MEJB 4RWHA 5B39G 2X9YA 1GC1H 3HVDA 4I1PA 2X3CA 3T0EB 5I1GL 4S1DC 2F68X 2E74C 3L5HA 4OV6F 3QQ3B 1XGUB 4ZYKB 4LCWE 1JZ7A 2IWEA 3DRTB 3S34L 4X98B 3I75B 5JOFB 4GW4A 3MVSA 2UWEB 3GMPA 4YEEA 4YNYA 3SDXA 2OMWA 2Q8BL 2YQBA 2Z31B 5FA4A 2WBJC 1PX8A 1XGUA 4ZYKA 4OQTH 1ETA1 4HWBL 3QEUB 1DL7L 5C7XL 1FH5L 4R4FL 3VFVB 4IU3A 4X6BA 3NN8B 5C0JA 2ZF8A 3DSFH 3MRQA 1U92B 3MV7B 3MRIA 1YO4A 3ZTJG 5DZOA 5KSUA 3G9AB 4JUSA 1N8OE 1ZLUH 2P5WA 5IVZA 4E2OA 1O7VA 5GS2H 4ZUTB 3VFPB 1A9VA 5BJTB 1V5JA 2AK1L 1ODUA 5EMYA 8FABB 1JZ2A 1NUNB 1FZJA 4YQXH 4CU7A 4LSRL 1NPUA 2ADFL 5IVXB 5KSAC 2B16A 1AE6H 1QSZA 2I07B 3A22A 1RZKC 5GXBB 4UBDC 1CD9B 5SWQA 4L29A 4ORGB 2C5DC 4HMCA 5IF0B 3RGVC 2VXTL 3L3OC 4UTAA 4PJ9B 2NY7H 1ZXKA 2GITB 4DUVA 4IRSB 2GJ6D 1F3RB 1ZVHA 2NPLX 4X9GA 1U8OB 3QQDA 2CPUA 4MAYA 3MRNB 2OMUA 1ZDQA 5I0WA 3K2KA 3Q8BA 1IL1B 5J8OA 4H20H 4R90L 3BZEA 3GF8A 3ZKXB 2F18A 1CC3A 2ESVA 1FYTE 3TBSA 1BXUA 1QEXA 1OARH 4PVMA 4AQAA 5IOKA 3FAWA 3V6FB 1VAHA 5IB2A 1PG7H 4NT6A 1X7TA 2AKRA 2I5YH 4NYLB 4KKZA 2BC4B 5IB1B 4NUGH 5JLZB 1BJ8A 2OYLA 3RWDA 2PW2A 1LMIA 1YUKB 5ECGA 1KJ2L 4KZEL 2EDLA 2WINA 1G6RL 1Q9KB 4HEME 1JCVA 1ZTXH 1K8IB 3C6LC 4IJTA 1NIDA 1NAML 1UOKA 3K5SA 3QG6A 1C08A 1DVYA 4XWOC 1TJIH 2DM7A 4MAYB 3CVHA 1WCBB 2LU4A 4U1SB 1ETB1 4AEIH 3DVNA 1HI6A 3O9WB 4LIQE 2MFNA 2N7BA 3L3JA 2AJXH 3T2OA 2YXMA 4QI3A 5JPMC 2QQLL 2NY3B 1MF2H 2EAEA 4F3FA 5LWYL 3KM2A 1Z3GH 2Z34A 4KKAC 3V4LA 4N2AA 2E56A 3LKNA 5C9JB 3UTPE 3BWAA 4NRYB 3OKEA 5C8JA 1MWAL 3LNEA 1H3GA 2MHAA 4U4IA 4WI7A 5AVXB 4YR6A 4CJ1A 5I30L 4PJCB 5E5RB 3VNYA 4OZIF 1T5WB 4X6FA 1NMAH 4J28A 3H55A 2BNQE 5KW9H 5C6WH 3OLDA 4J7RA 2W60A 2XQYK 4IDJH 3WFZA 3SPJA 2H6PA 3CQFA 4WY7H 4ELDA 4KBPA 4QRPA 4RIRB 4WDIB 1L9OA 1PYWB 1TETL 1HSAA 3D4GA 1AYRA 1IGTB 2CJUL 5AOJA 1BOYA 2Z0UA 1EEYA 1GKEA 4PRAA 4U6VL 5HGBA 2KBGA 2VUYA 4XAKD 1T22B 1U2CA 3QJRB 4LCCA 4BSVB 5LLIC 2H6UA 3WXVH 1XIWD 3KPTA 5DVLA 1AZUA 1MCQA 1IC5L 1VJSA 3NBNA 5F1IB 1GC1C 1TYJA 3IF1A 7TAAA 2CG9X 5IBLC 2YPLB 2QV4A 4GG6A 1W72A 4J5VA 2K8QA 1FCGA 3QXTA 4G6JH 2JJUA 4TUOA 3DV4B 4DVBB 5DRWA 2ZWSA 2C9SA 2R0ZH 4Y4HD 3NK3A 2P52A 4FYTA 4Y4FA 1SUHA 1W16A 2D7MA 3SPIA 1QPKA 4K3DL 4GMTH 2DYPB 1G7IA 1ETZB 2XC8A 5D2NC 3VYNA 4AK2A 1P4LB 4HJJL 4Y1TA 5ICZA 1G94A 1MI5A 2AQQA 1JG9A 2XG4B 3DX3A 5HDBB 4RIRA 1CFSA 3CZGA 2WNXA 4NZUL 3RE0A 4D0DB 1PBYA 1OSPH 4PJAB 5E9AA 3O8XC 1XIWA 5JMRA 2Q3XA 2JELL 3G5WA 5DJXB 2NQCA 4LPUA 2W5PA 4PV1C 4D9LL 4LPXA 4G8FA 3RX5A 3O3AA 5MI0C 2PPAA 3H3PL 2CHZA 3SOBH 1NCAH 2Y7OA 5JYMA 2Y7SA 3KCWA 5HI5C 3RGVA 2W07A 5KVEH 4MD0B 2XWDA 5C07E 1K2DB 1DSYA 4FG6C 1B88A 5CUSH 5HHPB 1AZZC 1Q90A 5TH2A 5GGUB 2AITA 5LAXA 4MDRA 3UFIA 2N0MA 4JPQA 1T0NA 2PTUA 3CLFH 3B7RL 2IAMC 5EU4B 3BVVA 3P0YL 3TV3L 1FN4B 1PFCA 2WKOF 2OCCB 3S3CB 1EMTH 4M7JH 4YBLC 4F7PB 5B1AB 3NCCB 1QEWA 1AKJD 3NCJL 4D0BA 1IBBA 5EUOF 1KDIA 4MJID 4PJBA 4Y5YB 1DEEB 3V6ZB 3PL6C 5ES4B 3T0EC 3OWRA 5GGTL 3KPOA 3EO1B 4Y0GA 5I1AA 1N5YL 3CFNA 4BQ8A 1CXLA 1TQBB 3LAFA 1I3GH 3D1MC 4QY8A 1D5IH 3EO9L 5DD0L 3SGEI 3ZHLA 3G08A 2HFGH 3K7UA 4NN6C 5DJ6A 1AKPA 1SY6H 3X1FA 12E8H 1NGPH 4W1TA 4AQAB 4JBSA 2X6UA 5EZOH 5IB1A 1II4E 4Z7UF 4AUYA 3A47A 4HLEA 4P3CL 3PXHA 2B4CL 4OLWH 5HDRA 1KIRA 1XH3B 1S6NA 2Q86B 4IDJL 4LCWA 4P5SA 1KJ2A 1KDJA 3PXJA 1ADQL 4WWKC 4BUGA 5C0AB 2WTOA 5DXWA 2V9QA 2Z3FA 2WTRA 3SDXE 1AGBB 4AGOA 3ARBC 5DJYB 3ZTEA 1RHHA 3V79C 1F18A 1Y7VA 2B1OA 1Q94B 2FX7L 3MYJB 3ASWA 4L2LA 4M61A 4Y7MA 3ULVC 1H19A 1PCSA 1MFMA 1WIPA 2IPUK 4QAMB 3SN6N 1IC4L 2K7PA 2UY7A 3EH4B 5FYLD 4Z5RA 1IC0A 4MLIA 4PS4L 5L4FA 3JYBA 1O0VA 4N3TA 4W9DC 1KPRB 4XH2B 4PGZA 1M7UA 4PWGA 4WFHE 3JXAA 3FCTA 3QIUA 1Q9WA 3T2LA 3TF7C 3GK8L 4R5XA 1E30A 2ZCHH 4W9FC 5AVRB 1DSWA 2J1ZA 5K93A 4ZFOB 3ULVD 1UD2A 4NM8H 5HHMD 3IJ9A 3T3MB 2K7QA 5HYJB 1WV7T 4B9YA 1OT2A 3FUJA 4HPOH 5HD8C 5INDA 2VXSH 1T4KA 4KWUA 2WWOA 5CBEB 4C8XA 2TRHA 4JQIL 1W0VB 2IGFL 3ARFC 3FO0L 3WEOA 3FTVA 2CKNA 4BYHA 2Z35A 1MCIA 4YHNB 4C59B 1A9BB 3QORC 5DC9B 1FIGH 1D5ZB 3KCPA 4LLUA 1LD9B 4NWTH 5EG6C 2X2YA 3MTRA 2EXWD 2X05A 5AVTB 1ACZA 2O61A 3VG9B 1W0VA 5DO2C 1YEWA 3EH5B 4XB3A 1BM3L 1FF5A 1OAQH 4L8SA 5HYQA 4KKRA 3F5WB 4UNVA 4EDXB 1P6WA 5HPOA 2GTWA 4F37F 1QRKA 4MQ7B 3L5WA 2K45A 2WXHA 3EF4A 1PY4A 2BSTA 3WU1A 4Z95H 3ROLA 1CFTA 2XICA 4E9YA 2H45A 1TZIA 5FYKU 1F4WL 2AEPL 5CR1A 3PL6D 2VITB 4AK1A 5JO5A 1R5WB 3O4LD 3VCLA 4UQ2B 2WXMA 1YN6A 5D96B 1GVIA 3JWNC 1A4JA 1J9SA 2WGXA 4HAGA 4OTXH 4N68A 1CDHA 1JWMA 1NBCA 3BH8A 3JT2A 4XN4A 3T1FB 3T6VA 1PLGL 1FL6A 1WA2X 1XH2A 2IAMD 3TS8A 1BIIA 4UQDA 3TT1L 3IGAA 4N87A 1U8LA 3Q2NA 1ZHBB 4W68A 1XL4A 3MV8E 3HC3H 1XGQB 1EXHA 2OYKA 4WFFD 2J8UF 3D18A 4UT9L 3UABA 4HJGB 5LCVL 1BZ7B 1CFNA 2YBGA 1OB1B 1C08B 4X4MA 3ARXA 3DX8B 1R33A 3WG7B 5CP7A 2X4PB 1ADWA 4IBSA 1NMCC 2Z35B 4J6RH 3DBSA 4L3EB 2FBRA 3SYPA 4KZEH 3N9GL 2F7QA 3I6KB 5BVPH 4HUVB 4NNXA 4PWHA 1TU2B 4UNIA 4WDIA 5TFSH 5F9AC 1YEJH 1PG7L 2EICA 2Z4QB 3BGAA 4Y88A 4QY8B 1KYOJ 1AR1D 2P8MA 3TV8A 4GG6F 4PJEB 4Z3EA 4HJIA 5IBLD 4HETA 2WBWB 1IE4A 3Q5YA 4A55A 4YXLH 4GEJA 4Z7AA 2YBRB 2XWTB 1XSKA 2DJMA 3FCTB 3QIUB 2VMFA 1HKLL 4OFQA 4XN1A 5CEXA 2BHZA 3SJVA 1FHNA 3D69A 2VDRL 1MCRA 1C9SA 1XX9C 1B90A 4YHOH 5J6GB 4H88H 4KOCA 2C3GA 1RUQL 4GW5B 3ZVVA 1UCTA 4HFUL 4XN2A 3MOBH 1OE1A 2CJSA 3CH1A 4XBGA 3MV11 4BD4A 3C60B 1TEGA 1JGLL 1A5FL 1SDYA 1ID5I 1WAAA 4R6UA 3WHE1 5GRVL 3ARDB 3FF8A 1XTMA 2EUWA 4HJSA 3F6LA 4ZMWA 2CHNA 4G9FA 2NZIA 1KENH 2X40A 4FNLL 1SJMA 3JTSB 3O3AB 2AXFB 2ZUQC 5E6ID 3B7SA 4P4RB 5CO1A 2V7HA 4JY4A 1MXDA 2WLIA 3RVUC 4FZ8L 3CZSA 5C07A 1JBJA 1S5IL 3EYQC 5MEQB 2IQ9H 5KN5B 2G4GA 1GIGH 1SBSH 4KTDH 3ZDZF 1MW3A 1A65A 2DTMH 4K0OA 3EYOA 4B3EA 4EZMA 4E9VA 1EHXA 4OCYL 2ENSA 4X42A 4KO9A 2C1OA 1H3UA 2PW1A 3C5JA 5HHOB 1UD8A 4UT9A 3PHQB 3I85A 5F0LB 4N1EA 4AVHA 1MREH 4BSWB 2A4CA 1QASA 4GSRA 4I7ZC 3ZOAA 1JGVH 1KLFA 3LZRA 4IQHA 4YLBA 2OA9A 3UZEA 4B3VA 3LS4H 5I1AB 4FJZA 3GMMA 1IARB 4L4VB 1SMOA 1JZJA 4LQ1A 2WC7A 4JRXB 4OUUB 5E6IA 5BXFB 1E43A 2GB2A 4U6HB 2I9TA 1FAIH 3CDGA 4WU7A 1UEMA 2CKBH 1OCZB 4KK5D 5HGBB 4KO7A 2E6PA 2WV3A 1FNSL 5KJRL 4PPTA 2CBTA 1NGZB 1MFDH 3FUHA 3MRGA 3ZZLA 1J18A 8FABA 1QATA 4JFXB 4LXFA 2F8VA 4E5XB 4ZMLA 4XVOA 5EEWA 1JF1B 3ZGHA 4EI0A 3QFJE 3S3BB 1DVFD 1THCA 1QHOA 2PETA 3QEQE 2F15A 2FO8A 4MRCA 2P8PA 1TETH 1M53A 1Y0LA 1JXJA 4P2OA 2PLTA 3LH9A 4WY7L 5E51A 3UGXA 1OT1A 4UOW0 5J89A 4J1UB 2X70A 4CC4A 1U8KA 5I5MA 2ZONA 4HU2A 4RGNC 4JE0A 4PU2A 2ZXQA 4NQDE 3BO8A 3D05A 4WW2A 4ANUA 3D8MA 3IDJA 1D5ZA 3PREA 3FU0A 4XCFH 2V2XB 4DAGH 1CFVH 1PZ3A 2OV0A 4G8IA 5FO8B 2YQ3A 5I1CH 3W9DA 2HG5A 3N42B 5D2LE 4WUUE 1ESOA 4U1NA 4OD1L 5E2WL 3NP3A 3MR9A 1J5CA 2CD0A 2N01B 3FSVA 1G7HA 5GRWA 1IGFL 3B8SA 4N2MA 3VG9C 3BP6A 2ERJB 2WBJD 3MNZA 4FABH 5K9OA 1S9KC 1TTUA 1MW0A 1UWXH 2VR3A 3CE1A 2B4CC 2ICWB 1CICD 2VO5A 4QTFA 2SEBB 3WXWL 1KJ2H 1O9VA 4NC0B 3V8CA 1P4IH 3TIDB 5FOBB 4EIUA 4YSTA 3Q8CA 4PRPE 1M6UA 2YUXA 3GRWA 1P4BL 4LE8A 1WBYA 1FFNB 1QFUL 4LDOB 3WN5A 4FFZH 5EULV 1MCLA 2QQQA 4TNGA 1EEUA 3LPFA 2Z8RA 3TEUA 2C3VB 2VDOL 2HLFD 4IOFD 3VSUA 1QRNE 1LEIB 4UZGA 5DVPA 3BWZA 3N0AA 3UGEA 4OFVA 2R0KH 1MAML 4XO4A 1ZT1B 4ZBJA 4H8WH 4GAYA 5DMIH 1CURA 1BPLB 5HGHA 2YJLA 3IDMB 3LRSA 4CN6A 5C0EB 2EYSA 5D2NE 1DVXA 2YGQA 2LV4A 1ZK5A 5I9QB 4B7LA 1XFPA 2X1PA 4FGMA 3VWKD 2DI7A 5I6MA 3B5GA 3L4TA 1ZMYA 1JXKA 3BQUB 1P0SE 2VR6A 3HG1D 3T3PE 4N85A 2IAMA 5AZEL 2L7JA 2LAGB 2X44D 3SKOB 4JKWA 5AL8A 1AJ7H 4PJ8D 4A7GA 3RVVD 4OGXL 4PGCA 3CZKA 2APVA 3RDJA 5IGXH 1OTSC 4AJYV 1KBBA 3QCUH 2XKNB 3BSHA 3NAAL 1FFPA 3QIBA 4XVJH 5TF1L 2NUPB 3MV8A 4Y1AD 2YGNA 1D3CA 3CMOH 3KL3A 3DMMC 4NKIH 2FGWH 1KJVB 1BZ7A 1MFCH 3IPFA 1EXUB 2Y5TB 4G8GE 4UTCA 1YJDL 3BJ91 4AENB 2FLBT 2D7QA 3NEOA 1HKFA 4MB3A 1NIAA 3U7WH 3KWWA 3WDHA 2DQJH 4UDUB 3UJJH 4Z7VE 4LZKA 1P5VB 2VDQL 4XVTH 1FFNA 2GJ6A 3QIBD 2AJZB 5BZWB 4PUBL 2P5WE 4ONGH 1K2DA 1CT8A 2QJDA 2E9IA 3BZFB 3D6GA 4YSDA 5HDWA 1YEEL 3TBYA 4GUOA 4MFHA 6FABL 5IMMB 4GRMA 1I7ZB 1CZ8L 3S6CA 4F9LC 2E7LA 1SVBA 3QXDA 5EA0H 4QGYA 3RQ3A 4A2LA 4FZEH 5I66A 4LEBA 3GSUA 5D4JA 4NZTH 5D1ZD 3OR6A 1KV7A 4KHTL 4GP8B 1VCAA 3RUGB 5K59E 4W6YB 2D9QB 5CEYB 4PJAA 4K23L 4MASA 4KKCC 4MNGB 3B3BA 1AO7E 1XR9B 3U7AA 1AGFA 2LVEA 4KKBC 4UV4H 5D7LE 4HS3A 1AD0A 4Q7DA 4RGMB 1SBBA 4MVBC 4J3OD 4EEEA 4IRJC 2IBZX 2FEEL 2NXZC 1JGIA 2YEZB 3GBDA 2BSCA 2WGNB 3RWHA 1PU0A 1TVHB 1EGJH 4ALAH 4BGDA 5D7JA 4AI7A 1RPKA 2WLJA 4YSUA 2C9RA 3QEHA 5E6ZA 5GS2D 4A2MA 3PHAA 1MCPH 1R3KB 4Z0XA 2WIIB 1ZS8B 3F62A 1WBXA 4C83A 4F2EA 4JFUA 15C8H 2IOOA 5EO1A 4HOXA 3S5LB 2X9WA 3C2AH 3ZE2F 3VGFA 4BZ1A 2PO6B 3AXHA 4KQ0A 1YHPA 3GPSA 3GXDA 1YEIL 3MFFB 3QORA 4QRPB 5I6PA 3U4KA 1TQCB 1OAYH 5IB5A 1JFHA 4B5EA 3DX9A 1ZDSA 2XFXB 4XMPH 1A4CA 2OYPA 1FVCA 5AW2B 1ZT7B 1Z5LA 4CC4C 1GYVA 1S7UB 1IGYA 2P46B 4Z7WA 2AMGA 3GJEB 3HUJB 4JAMA 1NICA 1BQKA 2ENQA 3G5ZB 5IB4B 3IDMA 3QPXH 2A6IA 1CGYA 1E28A 2ZE0A 3V4UL 4BK8A 5I76B 3LQMA 5I28A 4G72B 4QLWA 4B9CA 2XWEA 1A47A 4TSBH 3VGDA 3A4DA 4AG4L 3Q06A 3ZL4L 3MRRA 4K71B 1MW1A 4PJ7E 3UP6A 4CVXA 3DHUA 1SF5A 5E6RB 5E8DH 5CMAB 1E4KA 4YZWA 1I1AA 1CXEA 1KXTA 4XGZB 2HJKA 1JGVL 3OJMB 3OZ9L 2NY0C 3V55A 4RMBA 3RDTB 4AMWA 4F8PA 4HPYH 2E4TA 4G80B 3NSXA 2CLRA 1NGXB 3P4NB 4OZHE 4AYDC 1H5BC 1K8IA 1MCDA 5E6SB 2ROXA 4YBQD 3MACL 4HLJA 2HFEA 3QFJA 2A1WH 2FTAA 3CIQA 3EDEA 4N0FB 3SQOH 2IQ9L 4D9QD 5HY9B 1S7RA 3QE5A 1O6SB 5J9PA 3FUMA 5HHXL 4Y4KD 2WN3A 4NKMB 3SDDC 2DLGA 3Q3GA 4IOSD 3W57A 2PYFA 5D2LF 3WEBA 1D9KC 1VSCA 4MS8D 1M4KA 1WDAA 3WUWG 2DI8A 5J6SA 3QI9C 4ZOAA 3PNWA 2K9FB 4P2QE 1IEBB 3HZVB 4GBXD 4JFHE 4JY5H 1CL7I 4FLRA 4P49A 1DJYA 4FXGC 2IJ0C 4AL8L 1P6AB 3BO8B 1HHKB 1BLNB 3RVTC 4UTAL 4DZBB 3QJZA 4KNUA 4TKWA 2W9LA 4HXAL 2J8UB 2XG5A 5LBSH 2P80D 3CHXA 3FSWA 1CIUA 1HKLH 2L0DA 4R5VA 1SY6A 3ARED 2UUDK 4RFNB 5GISH 1AXTL 2AJUH 2NZ9D 1FZOB 3MV01 1C7TA 2CA3A 4PLOB 1GHFH 2SEBA 5FGCE 3VFGL 3LRGA 1XAUA 1IAMA 2MQ0A 4WI5A 3ZR5A 2AJVL 5FUZH 1OO2A 5DJXA 3CN2A 4FFZA 1PQZB 5F3HB 2DKMA 2J5WA 2XXGA 4FABL 1B0GA 3CX2A 1DBBL 3QO0B 3U1QA 3L1GA 1AS7A 3D06A 1RUAH 5BO1H 2R2EA 5D1XB 4B97A 3X1GA 2GHWB 5FR3A 4P9ML 1GKOA 3CZFA 2DQTL 3OAYK 2HKFL 2WUCL 3UADA 3DX8A 3FCUB 4HMEA 4G59C 4M7KH 1FO0L 1DLHA 5JNYA 1CFNB 2CCLA 5JHLA 2XTJD 3PWPE 1J05A 2LLLA 3SGJC 1MFAH 4GW4B 5D2NA 3DSNA 4K3GA 4Z0BH 1OM9A 2XJKA 2V8LA 3ZTDC 2B20A 4GY4A 1TLKA 5EO0A 4L9LB 4GJTB 2E9WA 3FRUA 1ZHBA 2PYEE 3B9EA 4KJYB 4LQFL 3DX6A 1RJZB 1KIQA 2HTLD 2WLYA 2WZ6A 1BD2B 3OXSA 2EIMB 4JM0A 4BXSV 5TDPB 3U83A 1OGTA 4OB5H 3W9EA 4NP9A 2OL3L 3EOBA 4CJ0A 5I8KH 4EMZA 5L2KB 2F19H 5K39B 3HRZA 5LXGH 3FAXA 4XXDA 2FR4B 3VFWA 3F00A 4XWGL 5I73B 4AX3A 3BUIA 4ZK8A 2Q10A 1QW8A 2QVFB 3OZLA 5IJKC 5F6IB 4M02A 3NJFA 3UPCA 1I8MB 4P9HC 4ELMB 2Q7YB 1BGXH 1TXKA 4I3RL 4GUPA 5TD4A 4M1DL 5F7NC 3VQLA 4KQ3H 3D30A 1WTLA 5GZOC 5BQ7B 4L9DA 1KLUA 5CD5C 4PR5B 5AAWA 3CXHJ 3CHOA 1R3IH 8PAZA 4GLRI 1A3RL 4F7KA 1OGAA 3OTTA 5C0GA 5FGSA 5T5FL 4LSSL 3V6OC 2EDMA 4KAQH 3RY4A 2ICWI 2YBRA 3Q2WA 5D4IA 1KZQA 1U3NA 3O8XA 1RZIB 3PL6B 4TVPE 5G5DB 1HIMH 5BOZG 2HTKC 2F8IA 3HG1A 3V6OE 4GRWB 2GSMB 2UZXA 3V5DA 3INUH 3M8OH 3X2QB 2ZP0T 2WWKT 1JGUH 1J88A 3DJTA 3O45A 1KCLA 4NT6B 1FNHA 2ICCA 4XHQA 4XP4H 1SEQL 3HAEA 1WG3A 3NEXA 1IC4H 2YA1A 4N28A 3S2AA 5E24E 4NX0A 4HUVA 1E4WH 3WIIL 4AJ0A 4J3TA 2WQAA 4WV1A 3DGCR 4A39A 5IWLA 1T83C 3ZHDA 5AEAA 3V0EA 5E4EC 5DS8A 3NJKA 4X4KA 4Y16D 1BYPA 1I9JL 1HNGA 1YJDC 2BNRA 1I8KA 5D7JD 1SYVB 3RYMA 5DUBB 3VXRE 4TSAL 1QSED 3VDBA 1G5AA 3DTUB 4AVIA 2BSDA 4OI8A 1A1MB 3D18B 3JQOB 3NIFF 4RX4A 2WB7A 3I2CL 2IDCA 1YY8A 2O5XH 1CIDA 3CXHK 4DOHE 4AM0B 4Q4IA 2D7NA 3AITA 4ILDA 4N2OA 3MCYA 4PP1C 4Q0XH 3OB0K 1QUNA 2E9GA 1KN4L 2J88H 1AOHA 1C5DA 3ESUF 1NLDH 2NRDA 3I6LE 5DJZB 3AT9A 2X12A 1MRDL 1KGYE 2AJYL 2QQNL 4B9JA 2DQUH 2Z4QA 4PJHA 1YAZA 3IBEA 4Z7WE 4GAAA 4W9GC 5D1XE 4OM0L 1DDTA 1S9XA 1VEMA 1CR9H 1MCBA 2FHFA 2WLZA 1T04B 1QSFB 4EZLA 3FZUD 1M7DA 2CUIA 2R56H 2YGOA 1T66D 2UY6B 5JMOC 3HB3B 3WY1A 2UZXB 5E5UB 5J6HA 2IEPA 4QD2E 5D1QD 3WGUB 4FQ2L 5GPRA 3TZVB 3ARFB 5GRXG 4BFBD 3MQIA 2A1WL 4BFOA 2N1KA 2V2XA 1PAMA 2ZKXA 5C0IB 4FEMA 4XC1L 3KBPA 1U8CB 2DQGL 4W9LC 1XGQA 3L2NA 1P1VA 4OZHA 2XWJA 5AW8B 3HC3L 3QI9B 4FERA 5IG7B 1CBVL 4QHMA 2X4SA 4KDTC 5GGSB 4GO6B 1SEQH 3SDCD 1HH6A 2NNFA 4MJHA 3TT1H 1JIBA 3ESVF 2XUWA 2X41A 1ZTMA 3HPJA 5CLXA 2NY6D 4Z23A 5K5YA 1LVEA 3MJ9L 4M56A 1U8LB 3MRDB 5C86A 5JUEH 3C09C 3SKUD 1HAUA 1KBPA 2DWDA 2K6WA 5IVXF 4EF3A 4LLAA 2A6KB 1L9RA 2WXFA 2DY2A 4Y9GA 2BNUB 3VXSB 4XXDB 3V0DA 5D96C 5LG6A 2CUAA 3KJ4C 1MQKL 3B2PA 4H40A 5C09D 1Z5YD 2R39A 4XO3A 4XVUC 5H8DA 5HP5A 3QWRD 4QRQA 2B59B 1J8RA 3QXVA 1S3KH 5HPMB 4UQ2A 2P24B 3BPNB 3Q44A 1AANA 1UD3A 3V7AG 1FUNA 2Z1PA 1YEIH 3ZIMA 5ICXA 2KKQA 5C0DB 2R0ZL 3UAJA 3NVQA 4OZHB 2NSXA 3CIAA 5FHBH 1FGNL 2OMXA 2R2BB 4PJHF 4F1SA 1RJYA 3LDBB 3ECVA 5I8EA 1G6VK 2R29H 3G5YB 4AQZA 1MCNA 1L7IL 4UOW1 3SEPA 3ALPA 4QXWA 5EORH 1A1NB 5FHAL 1J05B 1IC5H 1ZPLA 3F7KA 4N2CA 5AW9B 4G8GA 2VSCA 3ASOB 1HAWA 1A6WL 2HN7A 1UC6A 3GM0A 3IGUA 2YA0A 1VEPA 4DERA 3PP4H 1CPUA 1MJ8L 2I9LA 3DGGB 3NCBB 2EE2A 4PGCB 4XAWL 3UIZA 3QUZD 3ZE0F 3C5ZB 3E9TA 2R0WH 4WQOA 3EBHA 1X4ZA 3AG4B 4I9WE 1IBFA 1MRCL 3IFOB 1ILSA 1RZPA 3S3DB 5C08D 3STLB 2E7HA 5DUPL 3ELAT 1KEGH 2ZG1A 3C5SA 4I3GA 1OT4A 4X6FB 4LVOC 3MX0B 2FZ3B 4NZTL 3EO1A 3QDMD 3UYRL 3VQ2C 4TULH 1HHIA 2XETA 3FB5A 3EJCA 4G8GD 4WUUD 2EVGA 4O2EB 5I8OH 4ELKB 4WI4A 2DQTH 1SVCP 4XTRC 1KWKA 5JPNA 1BECA 2GCYB 1YSOA 3I9PA 4U2ZA 3WOVA 5C6PB 3RAJL 4F27A 2DQCL 3UO8B 5DUMH 4HQQL 5FC9A 1LE5B 4BA0A 5EU4A 1VERA 3E80A 1DBBH 4KFZC 2VXUL 1HHJB 4KJWD 4PHXA 4KGLA 4NO5A 5JIIA 2J56A 2NNAA 4UCFA 4H26B 2J5LC 3DX4A 2X2UA 1OAKH 3NCFB 4MD0A 2I85A 1M2VB 2I27N 2N4IA 3C5JB 4KAQL 3S35X 3MLXH 1T1YA 1PJWA 1Q8MA 1KXVA 5FM8A 1Q72H 5IREA 2HVBA 1KJ2B 1W8OA 2UWEF 3VTAA 1SXSA 2KPWA 1L9PA 4P3DB 4UTBH 4YS4A 2OMYA 2O6DA 4TLUA 4Y2NA 4LPWA 5JOPE 1ED3B 1G1YA 3JWDC 4ETYA 4RISL 3SKNA 3QEGL 1OWWA 1I1AC 1JTTA 4D0DA 5HY9A 4HXAH 5I17A 5DC4B 4ZMYA 3SE9H 2EO7A 1ORQB 3DRQB 3E1ZA 4RMRA 3US0A 3V6ZA 2QGEA 4E5XG 5LBGA 5FDYA 1ML0A 4Q4EA 5DRWB 3GS4A 4LCUB 1HH9B 3OL2A 3MLTB 3M7FB 4KMQA 1OAZH 3I9AA 3NJMA 3ALXA 4GP5B 5FS5A 1BCIA 3CZEA 4YDIH 4H1LH 3FB7A 5BVJB 5B3NA 3IS0X 4L1HA 3GSNL 1F3DJ 4UQIM 1IIIA 5EU6E 1B0IA 4LQFH 4PJ7A 5CLYA 1JPGA 4Y4HB 4P2OB 3GKWL 1ES0A 3LS5L 4LSUL 4G43B 2I07A 3ARPA 5DHVH 2P26A 4TV3A 1ZSDB 2B3RA 1S7WB 4GSXA 4B9ZA 2HVKB 5I71C 2DQIH 1XR8B 3BUQA 4PIBA 3QJFB 4MZ2A 4Z8FL 2JJSC 1CYWA 2CNYA 4FLOA 1N0LB 4GH7B 4QHUB 5DRZB 5HYFA 1PLAA 3MLPA 4GW1B 4X8JA 3MRQB 3MV7A 1B6DA 4K5OA 4NHUB 1D6VH 2GEEA 1QRNA 4NWUL 3MXWL 2HX7A 3WTVA 3AU1B 3KYMB 2F54D 3L5WB 1FNFA 4LKXB 3O6FD 1XCQB 3BHBB 4AUUA 4M9OA 3L1FA 4GMTL 3H7BB 2YD6A 1NCOA 4JK0D 4YXHH 2NY5L 5E2TH 3FSOA 3P73A 1TEFA 4MXWH 4IK7A 2BCMA 5FLVA 1AHWC 5I16B 2NZ1A 4J3XA 4D2NA 1MIML 3C6EA 4V1DB 1T89C 3CSTA 2UVFA 3PHQA 1GGCH 2G2NA 3B34A 4UANA 1VADB 2IMMA 3GZOA 2NY2B 4IK6A 2EDWA 3MV7D 1AD0B 2GKIA 1O6TA 2WZPD 3V4PB 5KJ4A 2DQUL 1T4KB 4LCYA 5FCUL 1FL6B 1IGCL 2VR7A 3E8UL 3TM6A 3BGMA 4AY0A 1LK3H 1AACA 5KYYA 2HT3D 1JNLL 4YDKL 1F0LA 5AW6B 1CDUA 1BZEA 1YYLH 2ERJC 3GSUB 5F7AA 5IVNA 4M5YH 3BKYL 4M43L 4JCLA 4ODXA 1UTDA 2VITA 4G7VH 3KG5A 3B7TA 2C4FU 3GIVA 1T20A 4MXVE 3I6SA 4IEFA 1OSZB 2VH5H 4FDWA 2ZCLH 4P46B 2GTWB 1JXDA 3S96B 5DA0B 1WS7A 1PD0A 5D1ZI 2WZ0A 3CZNA 3X12B 1BFTA 4LF3A 3KDMA 2R7EA 4AXWA 2OCJA 1CU4H 5KBMA 4CSSA 1BF2A 4JQVC 5GRJL 3LEVH 2HT4C 1WPCA 2JI3A 2MPAL 2NMSA 4U1MA 4XOCA 5FK9A 4KZCA 3BPNC 3GHBH 1KB9K 3UYPA 3L1OL 1BBJA 1EJOL 3FH8A 1BJ1J 3KR3H 3AY4C 2IFFL 5SWZD 3RWJB 3PGDA 2X4QB 4YGVB 2ZAGA 1OOWA 3P02A 3N2JA 4X5WA 1S7VA 5KOMC 3ZKSD 3ZTNH 1UG9A 4GAJH 1MEXH 2TAAA 4D7PA 3O3EB 4WLCA 1VKXB 1BQLH 2VZTA 2CXKA 2I5YL 5TE6H 3BUYA 1HIML 5T1LD 5CAYB 2CJTA 3HI6L 2Q76A 3RU8L 4Y5VC 3TJEL 3RUGF 3WDJA 3LKOB 4E9SA 2Z92A 2OM5A 1YJDH 5J06A 1SBSL 1ZLDA 4G6KL 3MRHA 3P4MA 4DWHA 2A77L 3GUFA 4P05A 2EDYA 4AYGA 2YXVA 1KCKA 2WKLA 4K3EH 3TT3L 1PEWA 2JKSA 5F88A 4ZX3A 5BRZD 3W0WE 5EU7C 1KIPB 4ZW8A 5DYFA 4FD0A 5F21B 2GCYA 4BFNA 4LLVB 5HHQA 3JWOH 2VLME 4CMHC 3S36H 3TN0C 1SVZA 2AVFA 2FH8A 4NUPA 5DJ2B 2GFBA 1RUPH 2D3VA 4YE0A 5IUSA 1CGTA 1R19A 4KPHL 3ASNB 4P0DA 1SDDB 5D71L 1IAKA 2A9CA 2ZZUT 2P45B 2VDRH 3LMJH 5HI3C 4FNRA 4HIEA 1BX2B 3OAYH 3U4EA 3VXPB 7FABH 2ODIA 2HJFB 2RA1A 1IAIH 1R3LB 2HRGA 2VE6B 3D25A 4M7LH 4PWJA 2X38A 3WN6A 4L8CB 1NL0H 3GMLB 2J8OA 3HNSL 1ACYL 2BSSA 4APQB 1AO7B 4HUMB 4WWOA 4LIQL 3R7RA 2VDLL 3ULUD 2F2HA 4TTDD 3U9UB 1KFAH 3T9WA 1AQMA 4JHUA 2RFXA 4DP2X 1QQDA 3GYRA 3OKOB 3PGFL 4G11A 1J9CT 2Z65C 3EG9B 4X99B 5C0RL 4JFED 4Y5YC 4DQOH 3ML9A 1B0RB 5EA0L 1JNHB 1G7IB 2DYPA 4WKZB 3UBGA 5L8KB 1S7QA 4XPGL 4MX7A 4WW2B 3HW7A 3DROA 3NESA 4G42A 2GPZA 5DEJA 1YLBB 3KPQB 5FYLL 2ZNWA 5ITFA 1TZOA 1XTLA 5I1GH 4IMLB 5H35B 1DJHA 4RLDA 2VLJE 3I75A 4JRYD 5JOFA 4ALAC 4PVBA 4WTWA 1BZOA 5BO0D 4FQQB 4F92B 2JJSA 3LKQB 4YAQA 4JFPB 5KBNC 4L5FL 1KACB 4AW7A 1PF3A 1JPTH 3CN1A 1NAKL 3TH3T 4UV7H 2I26N 1HINL 5I1EL 5KYUB 3K4AA 3TASA 1HSAB 5AB1A 4JHBA 2A6KA 4HALA 4L4TD 2DYPD 5ISZB 4XCFL 4Z8FH 1ACYH 5CHNB 1U2HA 4JG0H 2Y7QA 4JN1L 3VFSB 3TBYB 1BMWA 2GYSA 4XRCA 4ACTA 1RPUA 3SDYH 3ULAB 1M6OA 1XR8A 1TTAA 4BZ2L 2UZIL 4MA3B 3FFCE 1HXKA 3LS5H 3OKEB 5C8JB 2CO6A 5EF1A 2PPFA 4XP6L 1WFOA 2ZX7A 1JPSH 3TCLB 2ZWYA 2ZOKB 4PJ7B 1R0AL 2VL5B 2B15A 4WK4B 4JY5L 3VGAC 1JPFB 1UFUA 2CWRA 1UWFA 4FL4C 4HSCX 4XNZB 7PCYA 3BH9A 2ZICA 3LKRB 3WFDH 1M7IA 4JRXA 3M1BA 2BJML 4AVJA 2BS9A 3WTSA 5DUBA 4R2GD 1XF2B 3RDTC 1G0YR 1HXMB 3U6RA 5F7EL 3MAWA 4KK9C 4C4BA 5EU3B 4LCUA 5SWZB 3V4VA 2WQUA 3D3VD 4OJCA 3K91A 2QEJA 3Q7JA 3N3EA 3TVMC 3L4CA 3CVIH 1QBBA 5L8LB 1H9DA 3MRJA 3QEGH 3HTLX 5FKAB 2NYYC 2WKGA 3RG1C 3IDNA 3MBEC 3NDZE 1JCKA 3G5VA 3G3LA 3RHWF 4CN4A 1WH0A 2Q2EB 2V6HA 3GC3A 1NGQH 3MUGB 3RZCC 2DIAA 2CK2A 4GAJL 3D2UA 1N4XH 4HOMA 2MHAB 3UMNA 1G7PA 4Y2LA 2H47C 4QTHB 1CE6A 2Y2YA 4N24A 5DMJB 2WYIA 1CTOA 4UYPA 3SE6A 5JORA 5C0GB 2M1KA 3FHAA 3QZPA 4LU5H 4XNBA 2XT1B 5JXAL 2WBXA 2ADGB 4N25A 3X11A 1CB4A 4AYMC 1WAPA 4OF0A 4LAJH 1QFWI 2R4SL 1G5GA 1IM3B 1HX0A 2VRKA 4FXKA 4B9KC 5TH2B 5AKVA 3IAGC 4BFGA 4ODVL 3DUSB 3TBWA 1KJMB 2XWTA 4ACPA 3FN3A 3RNQB 3TNNA 4JO2L 3MRCB 5KZCD 1EO5A 32C2A 5F9OH 3GGWB 5C3TA 4ZFGL 2AEWA 2ZSWB 3WN5C 4JM4H 1FZJB 3HAEB 3K5RA 4K5PA 1CQYA 4UIMA 5DUPH 5DJ8A 3UPRB 1J0JA 2PPDA 5L2KA 1HNYA 1SF3A 2ZPKL 1B4JH 4I5BB 1MCPL 1YYLL 3KLKA 4M5TA 3JWNE 2HWZL 3VWJB 3X1NA 2PXYD 1JZ5A 1EFXA 5H4YA 2G30A 3IPEA 1IGCH 1OHQA 3QFJB 1A1NA 5ICZB 3MU3A 5D1XC 1RJZA 1NGPL 1E8WA 3CVHH 3V10A 5I8EB 4BZ1H 1A7NL 3F7QA 3PHSA 2ALAA 1NSNL 2W59A 2ZJSL 4CVZB 4TOYH 4GXUM 4G8GB 4ZXBD 1W72B 3MGOB 5I8CB 1MIMH 4AQEB 4O51A 5DEFB 5LDUA 1NC2B 3E8UH 3SGDH 1HILA 1T7YA 4PGDA 4QGTA 2NW3B 2F8OA 3LSOA 2WOBA 4IRZA 2BOCA 4AITA 4MNQB 5KSBA 3S35H 5IJCC 1GZQA 1VRSA 3U2SA 3O4OC 4YXHL 4DKTA 2P43B 5AWNL 1UOLA 3KHOA 2DB8A 4OR1A 3OAUL 4JO3L 3V9CA 3KHQA 1D6VL 4PW4A 3DK2A 4K94H 3QUXC 3GBML 5DHXB 5H2BA 1HCYA 3CFMA 4O5LH 4LNVA 5CCGE 2QR0A 1VFBB 1X7QA 3IFLH 5A7BA 5HHOE 4U1IB 3UTSE 1QTSA 2P47B 5DZPA 4OCLC 4NSKA 2AEQH 1GYUA 2BNRE 5IESH 1TZAA 2E7MA 5L8JB 2XWCA 3EZJB 2FDBP 3QUGA 5CJ5A 3LKSB 4EJ1C 2VLLA 3ZMRA 5SWZE 2V5RA 3OGCB 2YUWA 1ZS8A 1JMXA 3GIZH 3IMUA 4P57B 5HGDB 1OM3H 1OK8A 4GRLC 2XG5B 3RKPA 1JN6B 3G9VA 1HILB 4Z7VA 4BIKA 5ID0B 3RRQA 2KZ1B 4FQPA 4R0LC 1J8HE 1YPZF 1S7SB 2VLRE 4Z1PA 4FI6A 2GJ6E 4JKNA 3DRTA 1JRHI 3QAZC 2ENPA 5DO8A 1KTDB 5LKNA 1ZHKA 4PRPB 5DMGC 4LSUH 4HAFA 4XNQB 4ZMVA 5JQIB 2ATPB 2VRAA 2DQEL 1NCBL 4TL5A 3ZDXF 2AJSH 4ZNEE 1BZ9A 4EBQH 1IM3D 4N2EA 3KGSA 1HESA 4AT6A 4O2FB 1KB5H 5A2JH 3A6CL 1H3PL 4GQZA 2RFXB 3MBEA 5JIQA 4XCCL 3H6AA 3LEXA 4LMQI 4QRRD 4GQPH 4WFED 4HF5H 2UX7A 3TFKC 3VXUE 2EC9U 3AS1A 4ZTPL 4HK0A 1JNNH 2AP2A 4NNYB 3EJTA 2TRYA 4U6VH 3KLLA 1EX0A 4WUUB 4M4PA 1V05A 4WW1B 3NCYP 3JWDL 2XHNA 5LGHH 1RIVL 4KJPC 1QUNB 2PR4L 4J3SA 1L6ZA 3BUPA 3FYEB 4DO6A 1FORL 1N26A 4CILA 5C3IA 2EVIA 3EYUH 5E9DB 4X9FA 1ZAGA 2YAHA 1UJTA 3SPVA 2O5XL 4XN5A 4HGMA 3FU6A 1PLCA 3LVEA 3N9GH 2H32H 3ZL1A 2X6AA 5DI8A 3CH8A 2D3JA 2ZKHL 3ARQA 4ZXBB 3TVMA 3ECBA 3F83A 3P30H 4P5RA 5IZ7A 1HEJC 3G6AA 5EOCH 2FEDD 3AXLB 3IEAA 2AJXL 5DEGA 3FUIA 2BWQA 4NNYA 3ZE1E 2HMID 3QUYC 4BFRA 3OKYA 3KLSA 3WY4A 4L3CA 1KIRB 1UXLA 1XH3A 3RI5K 4K15A 2BY3A 5IWLC 1LE9A 4QOKD 1REIA 3IJEB 5D9SB 4LSQL 4N6QA 3GO1L 2C4XA 3BMWA 4FFWC 3D39B 2FJGA 5C3LD 3BUYB 4S0SD 2LR4A 5CN1A 5F70A 3TA3D 3ILDA 1EBAA 3ZKXC 5EHFA 2V2WB 1UENA 5E1QA 3B83A 5IW6B 4ZMPA 4NCC1 1ADQH 1HEHC 2WP3O 4HS8H 5C0AD 2EO9A 4EDWH 4J8RB 2O6FA 3U82B 2YPVL 5D7JB 1S5HA 3SDAA 3SYAA 3G6AB 5GS1A 1Z9OA 4MNHB 5DVNA 3TIEA 5T5FH 4FA7B 3RZCB 3NCEB 1ZGLP 3FJTA 1A3RH 4W6XB 1FJ1B 5DVMA 4U1MB 4K5LA 3N6YA 1EWHA 3PU7A 2ZG3A 2ZP8A 1SY6L 1HXYB 3N04A 3WAKA 1DE4A 1TJGL 5AYUL 4IKJA 4J12A 4MQXC 4YHYC 4PJIB 5FCSH 1I9RL 2WPGA 1BGXL 3R1GH 4HUUB 1K5NA 5SX4I 3SOTA 3ZMNA 4K3JH 4JFQB 4RAUA 4OF8A 4HDIB 4PRNA 3H7LA 2XQYG 1DBKL 3GIVB 5H2BB 1Z9PA 3QJQB 2NY3C 3F58H 5B3JE 2ENYA 3FO0H 5CKAA 5I5JA 2C9UA 5I24A 3PWJB 4TQPA 1MELA 5LXGL 5KBPA 2UUDH 2Y22A 3NCJH 5CD3B 3KJ4B 4Y2DA 4IS6B 3ISYA 3JYCA 1NCCL 4LOVA 5JA8B 4AE0A 4HPOL 2LLGA 5KYYB 2G60H 5E4AA 2N3JA 5MENB 4Z7VF 2DWTA 4YDVB 1J9TA 4CADB 3D39D 3GEFA 4O2FA 2OR7A 3UTQA 4AGLA 4H25A 3JVGC 5GGTA 4G8IB 2CR6A 4C55A 3CN3A 5H94B 1JD9A 3LNDA 3VM5A 2I7SA 3B8YA 1VESA 5FUOL 4MJJA 3Q1EA 3EF7A 1XF5B 3GK8H 1DVQA 1LTXA 3BFOA 3FTZA 4OKVB 2L8AA 3EW3B 2ZYSA 4GB9A 1GMEA 2V3FA 3QUYD 3PYCA 4H25B 2WQXA 1FO0H 3WCYA 5DSCB 4AYEC 1NFDF 2UXVA 2W9DH 4FNTA 3SGDI 1NFIA 5L2KD 1OHZA 4KY1H 4PP2B 5MP6L 1S8DB 3GBNL 4YVUA 4LEOA 3MA9L 4JZNA 2HUEA 3GZKA 2ZUVA 4Y2DB 1I8MA 1RUML 3CUPB 4OZIE 3EGXB 4DUXA 2VIRB 2ZXWB 3PWJA 1IM9D 2N1TE 4OJFH 4EIZC 1GC1L 4GXFA 1CVSC 3F7PC 4KRLB 2MOGA 1NANI 4WTZG 3IT8D 3OKDA 1VFBA 1X7QB 2PN5A 3HE6B 1NBQA 4DNLA 4X9BA 1X5FA 2FO1A 5EBWB 2YRBA 3A67H 4FMKA 4HFUH 3D51A 1N3NA 1RZ8A 2IC2A 3BDYH 4H88L 1BQHA 5FLUA 5IB5B 4IBVA 1NSNH 4XNUH 2ILLA 3BIKB 2ZIDA 3NCYS 3MJ6A 3E0GA 4BZ1L 2GI7A 5IW1B 3WJLC 3CFIC 4Q0XL 5MI0B 3T6QC 2H26B 3KPRB 3PAYA 3PJSB 3QC5X 2PYEA 2H3NA 3DTDA 2JJTC 5GGRB 1MRDH 1A9EA 1CICA 1SJHA 4HGWA 2E9BA 5BVJA 1JZDC 4UT7H 1RL1A 1K3IA 1X9QA 2QSCL 4K73A 2FYVA 4HS8L 4GRLB 1ZLVH 3WY2A 3OJ2C 2BNQB 1B6UA 4WJG3 4PBVC 5EPMB 3MOQA 3ZYZA 4L37A 3WE6B 1I3VA 3QDJA 5F9OL 3TCTA 5BV7B 3PXLA 1X5XA 4R8WL 2PCXA 3NJXA 1YY9C 3IJEA 1T3FA 1WAEA 3HN3A 3V0GA 3O45B 1UB5A 2A74C 3GEWB 5T3ZL 4RGMC 2EP6A 3E2HB 3K81A 5E6YA 3VGHA 2G5UA 2ICEA 1JGUL 4P5TD 3V8OA 4JKKA 1E4JA 4F15C 4DQAA 1JFQH 3RURA 2HG5B 3QJHB 3KPSD 3BYTA 4M6OH 4ODWA 4X2UA 1JZ8A 1V7NH 1CICB 4WGKA 5EIQA 1NBZB 2VR9A 1U8MA 3FFDB 4I77H 4HP5A 1JS4A 3O3DB 3A23A 1E90A 1D5MA 3L3DA 4PJBE 2X4UA 4PRDB 2Z4TA 1S7XB 4L8SC 4FADA 4NO3B 3ZXAC 4ZD3H 5I1IH 2X7LA 2W91A 5D2LA 4QRBA 1DZ0A 5FA3B 5IUCA 3C12A 3MKKA 1XGTB 4U0RB 5BQ7A 6PAZA 4YWGH 3TPUB 3QPQC 1E4HA 2H1PH 2JI2A 3IJ8A 4KXZH 3KW7A 3KEHA 3BKMH 1PZ5B 2Y3NA 3IAQA 4ZW6A 3CVIL 1WFUA 2EILB 5FYKE 3ZTJH 4I3RH 4NENB 5IEHA 3HG3A 2FGZA 2LW3A 2FH6A 1WUZA 1RV6X 5IQOA 5I19L 2Q9OA 1JK8A 1SUJA 4KROD 3ARGC 5D7HA 2RH0A 2CLVA 2XTSA 1P7QA 1YN7A 2VUOA 5JW5A 1LWRA 2QQKH 3VFPA 1C8QA 4PW3A 4XXWC 3LKQA 3IVKB 4HF5L 2XPYA 2TSBA 4ZDHB 1J87A 5D1XD 2E4FA 1U3ZA 4I1NB 4H44C 2EJ1A 1ZV5A 1NZRA 3ETBF 3VD1A 3NOIA 5KSAA 3DHJA 5F96H 2X2HA 1X5AA 4FQJL 1NCBH 1TQUA 4Z0XB 2JVUA 3CLEH 3QWOB 2YS4A 5CWSB 1NMAL 4MB4A 1HU8A 4O51B 5DEFA 2ZWZA 3VFRB 1TQWA 4BCXA 4OB5L 4OZFG 3UTZB 4F7MB 1U8KB 2D73A 2W65A 2FBOJ 2OJZL 5D1ZA 3ZR6A 3E6HA 4JFVA 5J12B 3PIQA 3KGRA 4YN3A 3NZSA 1EO7A 1URIA 4LVEA 1W72H 3FQNA 3GO1H 3VH8B 3WIFB 3VXME 4K94C 5D1XA 2LAAA 1KCRL 3DARA 4DHLA 2LLNA 5I1HH 5AYTA 4R4FH 3QXDB 2NR6A 3U46A 2V2TA 3NGBB 1FP5A 4HWBH 3GJEA 3HUJA 3HS0B 4U6XB 3UH8A 1UEYA 4MAYD 3QNFA 1A4JB 4NS0A 5IV2B 4XP1L 2R51A 3KLAB 5DJ8B 3V4PL 1DJXA 1I1YA 5CZRA 4U0QB 4OIIH 1T6BX 1FFOB 1NCGA 2ZKWA 2AQ3A 4J2QA 2IGTA 1OALA 4NENA 5IEHB 2FSDA 1JPST 1ZE3C 2VERA 3RNKB 4TVPD 3IDIA 3CFTA 4NUQA 3O6ML 4OBRA 4FTDA 2AERT 4U6YB 3MLUL 2LABA 3FULA 1QI5A 3CBRA 5EF3A 2MCMA 3VX0A 1A7PL 2H7WA 3MV9E 4OW6A 1HXYA 4DP1X 3TVMD 1KBGL 3DURB 2CR0A 4JHVA 4FJYA 1EAPB 1BMZA 1HHKA 1LO3L 1TO5A 2D31A 2FYYA 1BVKB 5C0IA 2VLKB 5CJXC 4J8QA 3S3JA 3VX1A 3RA7H 4YSRA 2FQEA 2DRUA 3HMXH 4R2GC 4DP7X 4NKIL 3CVHL 4GEIA 1UWYA 2GSIA 3OMZA 5HJBA 1FVEB 2OMNA 2Y3AA 3NAAH 4XVJL 3VWJA 1JYNA 5L9DL 4OSUL 5IGXL 3QCTL 5B38G 4JFOA 4PJAE 3QJTB 5E8NA 2FQGA 4ZQKB 1S7VB 4KV5E 5KANI 2GSIB 1AO7A 5AZEH 5F8QC 1GGBH 4P2QD 4GT7A 5CZKA 3HCVB 4OCNC 3PRZA 4ADJA 2BVTA 5JQ6H 1J0HA 5JIDA 3EYSL 5AD0A 4K5NA 3KPPA 1ZWIB 1KLGB 1Q0YH 4I48A 5DQJB 2JJTA 3ZE0B 2BM3A 4LHUG 3ZGIA 3QDAA 4AH2A 2EYSB 3LZFH 1MCOH 4QRPD 2DMHA 2GFBB 4YLQT 2DBLH 2OSLB 2OP4L 2X87A 3FQTB 3NZ8A 2BXYA 2DQMA 5CUSL 2R0KL 3SIKA 1F8TL 4DCQA 2ED6A 5AENA 5SWQB 2EADA 2AV7B 2J1KA 3PFQA 5HI4C 1IBHA 3D85D 3MC0A 4NJAL 5DFTA 3WLWC 2Z31D 4AEHL 4RETB 1YEHL 2ITDA 3FBQA 1MEXL 4IJ3C 2OMZA 1UOVA 5A6LA 3UAJC 4APXA 5E2VL 3B43A 1QAWA 3G04B 1DBJL 5JIMA 4JZOB 1OPGL 1TTCA 1Q0EA 1ZOXA 1FVDB 4YO0B 2CU9A 4MA7H 3VDCA 5HSFA 4JZNB 4M4RA 4H1LB 2EEXA 5DHYA 3F6JA 4OVVA 1GS6X 2GW5A 4LL1A 4GPVA 4Y5XB 3SGEH 3OKNA 4HD9A 2PWFA 4BH7A 4XMPL 4IMLA 5H35A 2A73A 5AOZA 2PWDA 3VXQA 4ZAKC 2C3XA 4NKDB 2ZCLL 3BD3A 5GRUL 1ZLWH 1ZVYA 2O4EA 4IKIA 1NCDL 4O9HL 2J7LA 2WXJA 3QDGD 4JFFA 3MREA 5D6CB 3IFNL 1FBIL 2H8PB 2RIKA 3C2AL 3MCKA 4YSEA 3LKSA 2A99A 5DWUL 4WK0B 1V7MH 4OCMC 4NHUA 5DQDL 5J3HC 3LD8C 4YPGB 5KVDE 4YDKH 4TS6A 1L5GB 3ULSA 5CEYA 3RPKA 3P3TA 5L9DH 1T7XA 2HG0A 1U3JA 2PTVA 4W93A 3WDIA 4PVLA 4FXTA 5ENWA 4Z18A 3EFOA 2XWRA 1MWAH 4PRIB 3MV9D 2BERA 2JMRA 5I30H 4MSWA 3DO7B 3RA7L 1PZBA 2X9XA 1D5BB 4ABQA 5A2AA 1JDCA 4FS0A 2P28B 4UV4L 1CCZA 1U6AH 1A7RH 3BPLC 3QUZB 3H1ZA 4PV8B 3WNMA 2BHUA 2Y1YA 1FNSH 5KJRH 3DECA 1P5VA 3RB5A 4FOMA 2BSRB 2ZYRA 4ZUUA 3WUZA 4NO3A 5CJXA 1CFQA 2R1WA 3MJ9A 3MCKB 3OPZH 2VAJA 3IDJB 1TR7A 2QT6A 3G6DH 4JB9H 1YQVL 4NBXB 3MNVB 5DLLA 3X1BA 4Y2OA 3APCA 3K2UL 3NEEA 2FRGP 2JF1A 1MJUH 4Y9BA 3KYMA 4DO5A 1G7JA 1IEAB 1QA9A 1RPQA 1IQWH 4ZG1A 3FQUA 2C9AA 4JANB 1TPXC 4KUZH 4KK8C 3JV4B 3KYNA 5D72L 5LVEA 3NRPA 1OGAD 3EOTH 4ZMNA 1T5XB 4F80A 3DETD 4N0CD 1U91B 2EEFA 4WJ5A 1EZUA 1QFPA 3AADB 5I15L 1URLA 1E2WA 3LMJL 5ADPL 4FNUA 1LYQA 1NOFA 1GPOH 1JK8B 2JIXD 3AS0A 1FNEA 3HS0C 3L4ZA 3MXVH 4KPHH 4L3AA 2APWA 5ESAB 4OGXH 4TUKL 2VQ1A 1IO4C 1A3LL 1BSIA 1DSFH 1P84K 3KPRA 1DVUA 4MAYC 3L95A 1EERB 4K8RL 4CMMB 4FF9A 3M88A 1CK0L 4LRNH 2K6ZA 3V52L 1SHSA 2VQ1B 1AGBA 3VE0B 1XD0A 1MI5E 1RERA 3DPDA 5FYKD 2IALA 4F8NA 4RISH 5CSBA 2OSXA 4KY2A 1J7VR 4KXAA 4ZTOH 3VFNB 3N1PC 3QYNA 2WXNA 3LKOA 3PY9A 1LHZA 1W6LA 2YLHA 2NY4C 3TEZA 5I1EH 2IOMA 2BVPB 4LK4A 1QSFD 1IKFL 2VUKA 3WJLA 2HPOA 4PJEA 5MENE 1YNLL 4X4XA 1H0DA 1KNOB 1RU9H 3NIDB 1Z0MA 4BQBA 4TQHA 3RIAF 4ZX5A 2HLEB 2QV2A 4LVHB 3FT4B 5JXEA 3QS2A 1QWUA 2FEJA 3BGMB 3MRJB 4DP9X 4OGAD 2H32A 1XF4A 4RGNE 4JB9L 3G7TA 2X5PA 1KBWA 4CNIA 2B5IB 1GRWA 1UVQA 4PJBB 5IW3A 4MMZB 4ZODA 3V4PH 1DUZA 4WHTA 1UXSB 5M94B 5E23A 2J1XA 4NBZB 5LCVH 4DQOL 4F7PA 4X7SH 4JO5A 4PJIE 1HXMA 4C56B 2Y1ZA 2WNGA 2HPTA 2VR8A 4Y9FA 5GGRA 1OP5K 1JWMB 3AQXA 4QHPA 3HG4A 1CLVA 2AAAA 4P4KB 2R1XA 4PCYA 4G1MB 3O3UN 2VL4A 2XN9A 3VJ6B 2VH5L 3QS3A 4O2EA 1YG9A 4RBPK 1O7DE 4WFGD 1P69B 3TYFB 1BIIB 4BCYA 1C12B 2JCWA 2QLYA 3QO1A 4G8FB 4OGYH 3LVTA 3CFCH 1OLZA 4L1LA 4U05A 4UUJB 1UXWA 1RUPL 1MFNA 2QKSA 3K6SB 2COQA 4JGMA 4JKLA 2CA4A 2J57A 5CU5A 2MSPA 1JNLH 3D39E 4QRRB 3VI4E 35C8L 1I1FB 3IU3A 5JOPD 2XG4A 1JPEA 4PJGF 3ECWA 5FCUH 4GIPD 3G6JF 1QI4A 2WXOA 3FUDA 2DDQL 3ZU8A 4B41A 4DGVH 2Z7WA 1MFEH 5CCKL 3FSZA 4YL4A 3FRUB 1FHGA 3JV6B 4WEMB 1I1AD 4H0HB 3NT0A 5D5MB 1L9QA 4ZZKA 1BM3H 1KIUA 2EDBA 1JK9A 4GAFB 2X2JA 2PCPA 5E6IB 3UTZA 1XL6A 2E7BA 4R0LB 3V9FA 3HLAA 3MN8A 2EYTA 1N0XL 3QWOA 1QX1A 3RWHB 4CVZA 5F1OB 2LU7A 2PCFA 3H2PA 2LU5A 1S4IA 3UC2A 4ZAKB 2YD8A 3F12B 4ZO9A 4KRNA 1KB3A 5E03A 1JF5A 3FO1B 5ALCL 1XR9A 4ODTH 2OTUB 1S3RA 4OLYL 3DBXB 3L2LA 4NYLA 4HULB 2DTML 3HIZA 4BUHA 5ERWB 1YEHH 3EH3B 1JI1A 4W9EC 1A6TA 3LN5B 2VZUA 4NCDA 5CFAA 3E9UA 4Y1SA 2J4WH 3VXTB 3GMLA 1TYEB 4G1EB 1ZA3A 2VE6A 1OPOA 2CCWA 2F7OA 4QDGA 5CKGA 4Y4HA 3X17A 1SYSB 4Q9QH 3JZ7A 2R1YA 2QFPA 1F8TH 5I18H 5DYOB 1GIGL 1Q94A 2CGZA 3MYJA 4QR7A 5DRNB 3TH2T 1XEUA 3LZFL 1NFDB 3HKFA 2EIEA 3L81A 4AQ1B 4BV1A 5JW3L 3WTXA 3IGLA 3R18A 3CK0L 4KK8D 2UY7B 3BPLB 3QUZC 5C6TH 3WGVB 1KXQE 1U42A 4FNLH 4XHJC 2WYTA 2CO2A 2MTAA 4JHWL 1QBML 4M1CD 1UWEH 3F6IA 3KPLA 1K8DA 1COBA 1OP4A 4U7SA 1EH9A 4P3CH 3HAEH 3QFJD 2BC4A 2Y4SA 3VB8A 5IJVB 2H3XC 4N2IA 5EZOL 1LQSR 2HRPH 3FQ1A 3J8F7 3QG7H 4NKMA 4WUKL 1YMHB 4F9PC 5MEOA 1OL0A 2NY0B 5EDSA 1KN4H 2BIHA 2O5YL 2CZNA 4A7GF 4FULA 4DVRH 2I69A 4NNXB 4GG6E 1KZYA 1NKOA 2FAUA 3SGJA 5BS0B 2X6VA 1O9WA 3BAEL 4MDJA 2GY5A 1ILUA 4JFZH 3IGKA 4YHKL 5C09B 3ML8A 2EXYD 1QVOB 3MRLA 4X5WB 1OTUC 1NGYA 4HKJB 1FPTH 4LKCB 3FCBA 1BREA 1RLBA 5TFSL 4AQOA 4AIOA 2XX1A 4XVSH 4OLVH 3W56A 1A14L 4OM1H 1JL8A 4C4KT 4LNRA 3LPWA 2NXYD 3CPLA 4MNQE 2IMNA 6CGTA 4OIIL 4YDZA 3O11A 3NSDA 4XPTH 5E9DA 3SYQA 2VDKB 1SQMA 3VU2A 5J3HD 1KELH 1F56A 3GRGA 4Z3TA 3GBEA 1I1YB 2JJWA 2Y5EA 3MRMA 5J56B 1U91A 2B1HH 3EH2A 4IBUA 2ISDA 5F1SA 2BNUA 5I1HL 1G7MA 3O2DA 2RD0A 4LCYB 1BVLA 4BFKA 1MIEH 4XP5L 5F8RC 2XRAL 2E46A 3L6FB 4OFPA 3QHFH 4UB0H 2NY4B 2UZPA 4PJXF 4FHKA 2MH4A 4Z7OF 1EIBA 1T0PB 5L0QB 4HWUA 4XI5D 4YDIL 4Q6YA 3D0LB 3HBQA 1WJ3A 3GJFB 4OCSH 3B2MA 3GTTA 3H53A 2X1WL 4LVHC 4JL2A 2KLTA 5CU9A 5I6LA 4DGUA 3MRKB 1DLHB