2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
5B1AB 3AG4B 3AG3B 1CUOA 1ZPUA 4GP5B 2B08A 3NJJA 5I6KA 2B3IA 3SQRA 4HALA 3NSCA 2IDFA 2XWZA 2DWTA 2WO2B 3NJFA 2BWIA 1AZRA 2VSMB 3IN0A 3DIVA 3AG1B 2XX0A 1A8ZA 2IDSA 1AOZA 2GC4C 2BP0B 2HXAA 4K9JA 5B7EA 3NSYA 1GW0A 2NRDA 5IY5B 2VW7A 3T9WA 2XV0A 2FT6A 3T6VA 1JXGA 1OCZB 2ZONA 3X1EA 1AS7A 1PLCA 4FA7B 2GSMB 2TSAA 1V10A 1ZV2A 2BHFA 1PZBA 2YAHA 3FU8A 1X9UA 2PP8A 4YVNA 2VW4A 1J5CA 2AFNA 4E9WA 1L9RA 1AG0A 3N2JA 1NIFA 1BYPA 2QDVA 2X87A 1V55B 3UAAA 2PPEA 5B3SB 3TA4D 2BZCA 3PPSA 3GDCA 3FYIB 3IBOA 3IE9A 2XU9A 3UABA 4CSZA 2I7OA 2CAKA 5ANHA 3NJKA 4YSCA 2FQDA 2PCFA 3NYKA 4A2HA 1M9WA 1ASOA 2UXGA 1NIBA 4GP8B 2HX8A 1GS7A 2VM4A 3WNIA 2IH9A 5TK4A 2ZOOA 3FU7B 1KCBA 1GS6X 2H47C 2UX6A 3MX0B 3OMNB 2LLNA 4F7KA 1NWOA 4KNUA 3X1BA 1SDDB 3H56A 1MDAA 3ABGA 3WIAA 3ZDWA 3FSWA 1AS8A 3AZUA 2UX7A 3GXUB 1W8EA 2EIMB 4A2DA 3X2QB 1GSKA 1JZEA 3ASNB 2IWKA 2XYBA 3C75A 3CVDA 3FPXA 2BP8A 2DYSB 1WA0X 1RCYA 2BZ7A 2ZXWB 4NAJA 1NICA 2UXVA 3AW5A 4HCGA 5I6LA 4G72B 1KCWA 1L9SA 2YAEA 4HHGA 2FTAA 3H4FA 4HHWA 2OV0A 4A66A 4RH4A 4UANA 4YSAA 1WA2X 4M4RB 1CURA 3KW8A 3X1GA 2CBPA 5B1JC 1BQRA 4BWWA 1PLBA 3NP3A 1AIZA 1E5YA 1AQ8A 1XMEB 3ABMB 1PZCA 1BYOA 3L45A 3TBBA 2YXVA 1AACA 1JXFA 2XXFA 1NWPA 3OMIB 1W6LA 4KO5A 4YSRA 2GI0A 3QJTB 1IBYA 3H4HA 3UACA 2XXGA 2UXTA 3CDZB 3NJGA 6PCYA 3ZIYA 1ETJA 1BXUA 1T5KA 1MG3C 1QNIA 3SBQA 3WKQA 3FQ1A 5I6OA 2P80A 3TBCA 2J5WA 1TKWA 2YAFA 2VSKB 1IUZA 1OCOB 4GYBA 2R7EA 2XV3A 2YAPA 1NZRA 1OE2A 3NSDA 3T6WA 1A65A 5B7FA 2IDTA 1OE3A 3NP4A 4BXVA 1PMYA 4DP9X 3WKPA 1IKOP 3T71A 4HCFA 1ASPA 2YXWA 4M3HA 4UAHA 4PCYA 4A68A 1URIA 2VMJA 3IN2A 1OE1A 1ASQA 1ID2A 4A67A 4WTQA 4YSUA 2HX9A 1AAJA 2PPAA 3FQYA 1FFTB 2W8CA 2GB2A 2CUAA 1I53A 1TEFA 2HLEB 3S3CB 2IWEA 1L9TA 1AS6A 3FSVA 1AANA 1ET8A 3HEIB 1DZ0A 3ERXA 2WO3B 3QJQB 5I5JA 3WG7B 3ASOB 3ZX1A 4QKTA 2AZUA 4DP2X 4DP1X 2AZAA 4JHVA 4WKXA 3NJIA 4DP6X 1WA1X 3T6XA 3EH3B 2PPDA 1N68A 1SHWA 5PCYA 3AY2A 1BQKA 4KNTA 1MZZA 3FU7A 3NJMA 1E65A 2OJ1A 1ZDQA 2ZWNA 2VN3A 1TEGA 2DY2A 5F7AA 1JVOA 4QLWA 1GY2A 4F2EA 4E9QA 3QPKA 3UADA 2DV6A 4E9TA 3AG2B 2MRYA 1JZIA 2XVBA 4L0PB 1AG6A 1CYXA 2RACA 3QJSB 2JKWA 3PAUA 4KNSA 2Y1AA 6PAZA 3PXLA 4P5RA 3SBRA 1IC0A 3NSFA 2IAAC 4Q89A 1RZQA 1KV7A 4G7RB 1PNDA 4NB7A 4KO6A 1NDTA 2I85A 2XV2A 3QJVB 1KDIA 3MBWB 4E9XA 2Y69B 2WSDA 1MG2C 4KOBA 4TXVB 2JFCA 2YAOA 3WNJA 7PAZA 1HAUA 2PPFA 3QQXA 1SF3A 3NJHA 4BDVB 1XB8A 2GHZA 8PAZA 5TK2A 1ILSA 3PLYA 2CCWA 2H3XC 3FT0A 3GYRA 3NJNA 4KO9A 4CSPA 2IDUA 2DYRB 2QPEB 1R1CA 2DWSA 2XLLA 2CALA 4NERA 3ZBMA 4E9RA 3JT2A 1XB6A 3CZUB 1NIDA 1AZCA 4DP4X 3FSAA 1ZIAA 1AZBA 4DPCX 3CDZA 3TU6A 1M57B 2Q9OA 2EILB 2HZHA 3PAZA 2BW5A 2EIKB 1TU2A 1PAZA 1F56A 3FS9A 1ILUA 1IBZA 4HCIA 4AX3A 1YLBB 5B1KA 2N0MA 2XX1A 3EH4B 3EHBB 4AI7A 1OOWA 3CG8A 4YSOA 1NTDA 1NIAA 1OV8A 1BAWA 4HIPA 4AZUA 5AFAA 4BWTA 2BW4A 2J56A 1J9QA 1ET7A 2R7EB 1SNRA 5F7BA 3WI9A 1B3IA 4KOCA 1AZNA 4DP8X 4HAKA 4AKQA 1NINA 3FU9A 2TSBA 4BWUA 1J9TA 2YAQA 2FQEA 4EF3A 1PF3A 4W1TA 4DP0X 3EH5B 3NJLA 2FQGA 2PPCA 1AR1B 4ZK8A 1V54B 1JZFA 5I5MA 3HB3B 2AANA 3TASA 4YSEA 2A3TA 2J55A 2AVFA 2VM3A 2GC7C 1OCCB 2Q5BA 1SFHA 2IH8A 3X1NA 5A7EA 4AKPA 2H5UA 1JZHA 1WS7A 1BEXA 9PCYA 3S3DB 2VW6A 3S8FB 1VLXA 1ZDSA 3NT0A 2HX7A 3T6ZA 5B1JA 3V9EA 4DPAX 4E9SA 2GBAA 4PAZA 1KBVA 1QHQA 2QDWA 4P5SA 5D4HA 5AZUA 4A2FA 1ET5A 4FAAB 2EIJB 1ADWA 1GS8A 4GY4A 3FPYA 5EHFA 1JOIA 1JVLA 1OCRB 2I7SA 4BXSV 4N8UA 2YARA 2HRHA 1BQ5A 2PLTA 3QJRB 4ENZA 5D4JA 4DP5X 4HZ1A 1NIEA 3ABKB 1GY1A 1L9QA 4YSTA 1NPNA 2OCCB 1J9SA 4G7QB 2X88A 3CVCA 3S8GB 1PCSA 4N4YB 1CYWA 3DKHA 1ZIBA 2XUWA 1E67A 1A4BA 1NPJA 4G71B 4GP4B 2BP8B 4BDVA 3FSZA 1E30A 2PCYA 2BO0A 4GXFA 5D4IA 5AKRA 4F2FA 1L9PA 1KYAA 3UGEA 2CJ3A 1RZPA 1BXVA 4E9VA 1XB3A 2E86A 3IEAA 4A2EA 4YSQA 4KO7A 1X9RA 4YSSA 3D12B 1CC3A 2P80D 4JKNA 1BXAA 1MZYA 4MFHA 3BVDB 3V9CA 1OF0A 1HAWA 2BP0A 1FA4A 1FWXA 1PLAA 1M56B 1UATA 3OQRA 3OM3B 4DPBX 2HRGA 4X4KA 2EINB 2FNWA 3JTBA 3FQ2A 1RKRA 3RYMA 5B1BB 2FWLB 1GR7A 5B7MA 2PP9A 2MTAA 1A4CA 3PCYA 3X1FA 3EF4A 1KDJA 1PY0A 1JXDA 3PAVA 3N55A 1SDDA 2PP7A 3DTUB 3FYEB 1N70A 1QLEB 2JXMA 2BWDA 1W6WA 4UF7C 3BQVA 2FT8A 1GYCA 1EHKB 1J5DA 3CVBA 5E9NA 5PAZA 5I5IA 1PNCA 1KBWA 3SBPA 4JHUA 1A4AA 1SHXA 5I26A 1SF5A 1L9OA 5I6MA 1HFUA 1EZLA 1WAEA 3KW7A 4YSDA 3ABLB 1WS8A 4W9ZA 2YAMA 1SFDA 3U25A 1SJMA 2FQFA 1JZJA 2J57A 2IDQA 1PZAA 7PCYA 5FC9A 5I6NA 4Q8BA 2IWFA 3S3BB 3UAEA 1A3ZA 1AZUA 2UXFA 4YL4A 2QPDB 2W88A 3OD3A 1JERA 1J9RA 2QT6A 4G7SB 1DYZA 4AKOA 1KGYE 4BK5C 4E9YA 3G5WA 3OMAB 4G70B 5LDUA 5I28A 1E5ZA 4YSPA 2GIMA 2YQBA 3QJUB 4DP7X 4YVUA 1JZGA 5I6PA 2FT7A 4A2GA 2FJSA
chains in the Genus database with same CATH superfamily
1Y07A 1KGWA 3SE3A 3AG4B 4L3AA 4L4TA 3RB7A 1K8DB 4H26A 4TUKL 2B14A 2Q3ZA 2BIMA 2JJTC 3CMGA 3ZSTA 2EXTA 1UWYA 3ARXA 3MBEB 2DWTA 4O02B 5J1AB 4PTTA 2V33A 2DW5A 4N5EC 1KTLA 1R5WA 2VZ3A 5JIMA 1QPPA 2EEXA 3CFCH 5CFAA 4PGZA 5DRNA 4PJ7A 2NRDA 2A74A 5E1GA 5BVJB 3MLZH 2Q8AL 1OPGL 3SBWA 4HIEA 3GSNA 4Z0XA 1UFUA 2FLRT 7FABH 2FJHA 3QP3A 1MAMH 4YPGB 3IXAB 3RTQC 4QF1A 4LCWD 3CHPA 5DLLA 4QXUH 2YKKA 1BBDH 3RZCC 4CVXA 4UOJA 1A14L 2FBOJ 4KXAA 4TMPA 4JQXC 5DK3A 4LVEA 3U4BL 5FA4B 1C1EL 3D25A 2FLBT 3IDIB 4MJ2A 4Q14A 3V0EA 3ZHLA 2E75C 3TVMA 1E4XI 2FQDA 3BMWA 3MOBL 4KQ4H 4E2OA 4EDXA 3A67L 3P3TA 4NO3B 1VACB 3WOVA 1FUNA 1KPUB 4KZEH 3BCDA 4B9CA 3QEUA 2VDMB 3UZQB 3FU7B 5KAQF 2W59A 3MGAA 5G4OA 4G82A 3HFMH 4OZ4A 5ISZE 1EV2E 3LN4B 4TTDD 1BDYA 3GT6A 1S8DB 3I9GH 4OAWA 2XFGB 3C8KB 3WN5B 5GRXG 3QIWD 4CC4C 2G5BA 3HHRB 1GMEA 2J8UB 2C3VA 2XN2A 5D7JB 5DD5H 4R0LB 4DK6A 3RWIA 3C75A 4D0BB 3PJSA 3AU0A 2XTSA 1LXMA 3TEZA 4WFFE 4HPOL 4HIHB 5HHMD 1A7OH 1S7SA 1T21B 3RBGA 2JKIS 3TBTA 3EJYC 3V4VA 5IFJA 2VDLH 3EKCA 5F1IB 3D85A 2BCKB 2FIRT 3JYCA 3SGJC 3WYRA 2OV0A 1VADB 4PRHB 4DHLA 3CHRA 3IFNH 1TYRA 4JRXA 3VDCA 3U9PH 5ABZA 2CWRA 2ZYSA 1AIZA 2GJ6B 1T0MA 4ABUA 3BYYA 3B9KB 2GJPA 1NAMH 1WTLA 5EUOB 2E8YA 1NC4B 3BT2L 3DX7A 1FSKC 3W5NA 4YSRA 2ENQA 3F12A 3MVSA 4HSAC 1HHJA 1KB9K 1BG9A 5DQ9A 5GGTH 4AM0Q 1CCZA 3ZE1B 4URKA 2HT2D 3SKJL 3VD0A 5KSAB 2K7PA 3BWZA 4RGMB 2RALA 3WIHH 5GRZA 4AWJC 3MRJA 3RDTD 1A6UL 4URTB 5I1LA 1SMOA 2GJRA 2CK0L 5DRZA 2X40A 1WVZA 1IAIH 2NOYA 2VNCA 2ZYIA 3NAAH 2NW2A 3NZSA 4QO1B 3WKQA 2OKMA 3N44F 4RQQA 4WY7L 2PTUA 4F20A 4QOKA 1ETZA 1QOKA 1CE1L 3L54A 1PZ2A 5BV7L 4O5LL 1Y0LA 3MBXH 1T6VN 2Y06L 1NCBL 5INCA 3T4AC 3ZR6A 2B7DT 3ZR5A 1GC1L 2GAZB 4XAWL 1MI5A 4EN3A 4ALAH 3VX1A 4GG6E 5KJ7E 2FJFB 4J3OD 5EBLB 1KBBA 3DVIA 4MDJB 4P5MA 3T6WA 1A3QA 3D52A 2OSLB 4JO3H 4UU9B 2HB0A 3QEQB 2CHZA 2YXWA 3OXRB 3T6QC 2BOCA 5CCJA 2ITCA 4QRRD 4Z8FL 2WLJA 3MYZA 4FE9A 1FLRL 2GB2A 4WNQB 3QJFA 1MCWW 3SDYH 2ENJA 5GS0D 1WCBB 4ACPA 5JIQA 2AEWA 3WKML 5HYQB 4WY7H 3C6LC 2HUEA 5IROC 3VWJD 3ASOB 3G7TA 4NO2B 3A6BH 2NNFA 5A2IH 1IRAY 1WA1X 1YEGL 4XPBH 1Z7JA 3SDCB 5IQ9B 1BZOA 2P8PB 1AFVH 1J48A 1EXUA 2JVUA 2Z35A 3CBRA 1TZGH 3D39D 3KYKL 3HRZC 1E65A 2V2XA 4NNYA 3MMEA 1IIKA 2WCPA 4PMFA 4LLVA 4AJ0A 3KLDA 1CG9B 2DY2A 4H8HA 4H8VA 4M7JH 1YEFL 1T7WA 4ZSOB 5IBTL 3MBEA 4BFRA 4F2EA 4A7GF 3WNNA 1J1OL 1QLFA 2XVBA 1DJHA 3BDYL 5CINL 3SCMB 3VWKB 3H42L 1CFTA 3MLUH 4AC4A 3C8HA 2FX7L 3Q13A 4HJJL 4Y1SA 1JWUA 5IK3B 3ULSB 1QFHA 4ERSL 4NAMA 4MA1C 2DBLH 3D9AH 1TO5A 3MA9L 2IQAB 2MCPH 4NUMA 4LLYA 4F2MA 5IVXB 2JELL 4GO9A 2MQ3A 3D3VB 1U6AL 2P4AB 3FFCA 3LN9A 2VN5A 3OLEA 3VXME 3T0DA 2GSGB 4UOW0 4KMTH 1MHCB 2FUQA 5JIDA 4MQTB 3RTQB 4WCYH 2A0LD 1YDPA 2I07A 1X4ZA 4PW9A 1EGJL 4N2GA 4FQHB 2E76C 3VU2A 5F6HJ 1S9WB 2WCGA 2VLJA 1F3DJ 2F53E 1NBVH 3W56A 3O4LE 5HD8D 2E56A 4GKSA 4X9HA 5D1QA 3FT0A 4U3SA 3GC3A 5BV7C 3QXAA 5IFAL 1SOKA 4AEHH 5E70A 2XOTA 3IPBA 2OM5A 3ARFA 4YZFF 1IKFL 2BHZA 4X4XA 3U7WH 3FFDB 4L4VB 4E9RA 3CZUB 5CSZB 4LRNH 1OB1A 1IBBA 1VEMA 1Z3GH 4HWZA 2B5IB 2APFA 3EDJA 3LIZL 5FW8A 4L8SA 2D31B 1JYNA 3PAZA 3WXWH 1TU2A 1TTCA 4IK6A 1E42A 1ZD6A 2N0MA 1AVAA 1VA9A 2NT1A 2VM9A 3HZMA 1SXCA 3WE6B 5BS0D 1F58L 5H37G 4P4RB 2DQGH 4OF5A 2CBTA 3SOBL 1JF1A 1BX2B 1SEQH 2D9CA 3R4RA 4EUPA 5BXFB 5JUEH 4QXVA 4RX4A 4MNHA 3N1MC 4UM9B 1QSFD 2XXCB 5EZPA 1WFMA 4XVTL 5JIHA 1J9TA 2A9NL 4J27A 3V52H 4MMXB 4F9LC 1WJ3A 5AD0B 3GXPA 1EEUA 3S88L 1I7UA 1I1CA 1QAWA 5C0IB 2A9DA 3BIKA 2W0LA 3PIQA 4ZMYA 4FFWD 3V4PA 5M95B 5DEGA 5SX4I 4IDJH 2NYYD 2V37A 2P42B 5ERWB 5C9JB 3KPSD 1EJ8A 1HZHL 1HIML 1XZ0B 5AVUB 3QPXH 5AW9B 3U4BH 5D8JL 4TUKH 2EDKA 4WU5B 4XRCA 3RHWF 1P2CA 2AJVL 3QARA 1C16B 4F5CA 4QHKI 4UYQA 1G7JB 3SYQA 3V0AC 1EHLL 3HMXA 3FQRA 4ZTEA 1YUHB 4C83B 3STLB 1C12A 5I17A 1QASA 4LSVH 2E7MA 4KWUA 3CE1A 4ODHH 3M17B 4PAZA 2IPTL 1X5ZA 1XH3B 3MODH 3HZYB 3UDWC 4O58L 4D0DB 4TUJA 1T22A 2DLFL 2P7TA 4TNEA 4JEGB 4PWEA 5E4EB 2NY1C 3D4YA 5FO9B 2IOMA 4PUBL 4XTRD 2EKSA 3ZKXC 1JPTL 3CX2A 3HI1A 2R51A 3GSUA 2X2HA 2XQBH 4IGBC 4ADGA 1IC4L 4X6DE 2XA3A 1JGVL 3MRKA 2QZQA 3SKNB 3DV4A 3CZNA 5FDWB 1NCAH 4MXVF 1MCHA 4IS6B 3QWOA 1NLDH 2DPKA 2VH5H 3FUNA 5K33A 1GY1A 3NGBB 2QHLA 3I50H 3MCLL 1NMBL 1S9YA 2AXFA 2PXYA 3ZN6A 3DIDA 3WY4A 1IEBA 2DEWX 1MCJA 5GSVB 1PCSA 5IB4B 2XT1B 1BP3B 3ILEA 2H0JA 4OJCA 1R5VB 4L5FL 5AVYB 5ICXA 2YJLA 3CLEH 4GAJL 5D4IA 4AGNA 4HH8A 1VEOA 1PSKH 3S34L 1CMOA 2DLEA 1IGJA 2VDRB 4HJ0C 4UQ3B 3B4NA 3BP4A 3CNKA 4S0TD 3AMKA 4WWID 4WEBL 3RIFF 4D7PA 1IM3A 4JM0A 4JKNA 1JG9A 1BXAA 4E41E 1TJGH 5GGSY 2GFBA 3HRZB 5BUPA 3Q5OA 4H0GA 1TYEB 3BUQA 4TRPH 3RWFB 3U1SH 4C55A 2R2BA 5FGCB 1L0YA 5D5ME 3ARGB 4DKDC 3FTWA 3KAAA 4HIJB 4DQOH 3BUTA 5FA3A 3L3OC 4WFGD 5C0ND 1TNNA 2JKNA 4JFQA 2MTAA 3PHSA 5DQDH 3LNHA 2V7NB 3FO1A 5KVEH 2V3DA 4NUJA 1MEXH 5BW7A 3C8KA 5I8KL 1HIMH 4LLWB 2MMXA 3VXRD 5IB1A 1YG9A 2NYKA 1W6WA 2BSSA 2JIXA 2VXVH 4PIRF 4WI5A 2NX5B 1M42A 1KXVA 2DICA 1JMXA 2ICWI 1SF5A 4ZUUB 1PEZA 2D0HA 2KLSA 4JE4B 5IT2L 3CHXA 2GITB 1T2QH 3EBHA 4F8QA 3VNYA 4R3SB 1H3TA 1WS8A 1LJMA 5IESH 1MCNA 5H94A 4M5ZL 4LSTH 2BNQB 3QXAB 3CZGA 3V5KB 5CD5C 3OSVA 5E4OA 4TNGA 4FADA 2Y6SD 1QI5A 5I1DB 4KI5D 4AM0A 2IWFA 3FFDA 2F5BH 3ATBA 3ESMA 4X99B 1HL8A 2NLJB 3VFVB 1G9ML 2QT6A 3DUSA 3IWVA 3QFJE 1UKQA 2RBLA 3UYRL 3GI8L 3FRPB 1SJHB 4HXAH 3OPZL 3ETBF 1JCVA 1QRNA 1AD0A 3OVUB 3GF8A 5JPMC 4LQFL 5T3ZL 3D85B 3HI6L 5D9SA 2VR8A 4CDHA 5F88B 3UZVA 3SYCA 2BMKB 2YJQA 4RMSA 4R4FH 3AG3B 4A6YH 4IEFB 1T0OA 3OR7A 1IGYB 1RIVH 5LGJB 4EUPB 1WT5C 5LAXA 1WGOA 2IDFA 4NC1E 4HWBA 2WO2B 5GZOA 1FZOA 4IK7A 3AG1B 4U6VL 1TTFA 4F57H 3K2IA 5C8JA 2XWRA 2HXAA 3T1FA 4RRPM 4PN6A 1A47A 3FT9A 3QXDA 2N59A 5HVFB 1TMCB 2OMVA 4KKZA 5JR1H 2G5UA 2WKLA 4P2OD 4GH7B 4X50A 4EIUA 2EXYD 1Z0NA 1V10A 1EAPB 4YVNA 3D07A 4QYAA 1FAKT 1J5CA 2FUTA 3C5SB 2XRAH 2VLLA 3QUGA 4ODUA 5HJBA 2X87A 3C60C 1Z5YD 5CGMA 5BUGA 5CEZL 1QTSA 2LU3A 1AMYA 4K7FA 1M9SA 5ITBL 3PJSB 4RGOL 1XX9C 3U2SB 4FLQA 5EZLB 4NHCL 5E00A 3ULUL 4KROC 4GBXD 2CAKA 2HFGH 1BJ1J 2WB7A 4NQUA 1T1YB 2BCKA 1A0QL 3IS0X 2ZYRA 3WNPA 1N10A 4OV5A 1CFVH 4GO8A 3V4UH 5KVGH 2R0ZL 1IGIL 4O9HL 3EHBC 3LXAA 5I8CA 4MJIB 2A74B 3H9SA 1TQTA 2F6AA 1KSRA 3V10A 1HCYA 1J88A 1ZXQA 4JUSA 3B3BA 3QIUC 4TNWF 2V2WB 3C5ZB 4BKLB 5AQ0A 1HYSC 1AS8A 3EFFA 5T1MB 1S9YB 2F7RA 4ACTA 1ZT7B 4K23H 2DH2A 2DQCH 3O45B 4XWOD 4E36A 4OVVA 4ZAKA 2AQ1A 3CVDA 3KWWA 4G8EB 3ZQWA 4G43B 4AQAB 4EI0A 3GBNL 5LGHL 2EYTA 1T1ZB 3B7YA 3DVGB 3INUL 4IU2B 2X4RA 1P1ZB 1RL1A 2H6PA 3W9DA 1U8QB 2ZXWB 5DHYA 1KLFB 1RZ7L 3FT3B 4PS8A 2ATKB 5JHLA 3STZB 5EBWB 5IVZA 1OSYA 2K6ZA 1S5IH 1ZLSL 3UBFA 4OLYL 3X1GA 4YEFA 4XMUA 4RCAA 4W6XB 5J11C 1TVBA 3K0YA 5ANMA 4NHUA 3P9WB 1X7SA 4QGYA 2OBGA 1AQ8A 2Z8RA 2OL3L 2Z93A 1A1NB 1HXYA 3QFDB 1GCYA 3FMGL 4OQ1A 4AG4H 4L4VA 2QJDA 1UXSA 3FULA 1WC7B 2ODIA 3MNZA 2VSCA 1Q94B 2XBDA 3RWIB 3FB5A 5AAMA 1CT8B 3A67H 4DGIH 3B2PA 3GTTA 1XSJA 2E7DA 4K5LA 5I76A 3BHBB 2VLJB 4NAQA 4F9PA 1XF5A 2R9HD 3VFNA 4CKVX 4LHUB 3ML9A 2QQLL 5FGBA 2YPLB 4BQ6A 5LBVA 5ACZA 1QHPA 2ARJB 2YAFA 2E4TA 2XZCL 1YY9D 4NIKB 3AU1B 4C54A 2XCMC 1LEIB 2X4OB 4DJMA 3WKYA 3Q8BA 4OGXH 2HFEA 3P69A 1KCUL 5CZVL 3LYRA 4JY6A 2I9TB 4OLYH 3B83A 1LILA 4JKWA 4KUCF 1NZRA 1HXKA 5HDOA 5GRJL 1BAGA 1N5YL 5EUOA 4DKFL 2IDTA 3NIFF 2G4EA 3DGGA 4G6AD 2EJ1A 4M61B 3GXFA 4A68A 1URIA 3P3YA 3UZQA 1DHKA 5A2CA 1A9EB 1HHJB 1A7PH 1ZY9A 3IN2A 4YIQA 1C5DB 3SQBA 8FABB 2ZX9A 1EBPA 1FFTB 1I8IA 5E08L 2DIBA 2D7OA 4J4PC 3AQYA 5A6IA 5C9JA 4Z3HA 2IWEA 4MAYB 5MERA 3ZHKA 3ABZA 2FH8A 5SX4H 1SBBA 4Z0BL 3ZUNC 3X12A 4MA3A 3VFPA 2VT0A 3FU0A 4K71B 1PLGL 4M7ZC 3RIFK 4QMEA 4WENB 4J6RH 2OL3A 2ZIDA 3EJSA 3EH3B 2F54D 1J8HB 1RU9H 4N9GA 4OLXL 2EIDA 4MQXC 2ARJQ 2JTYA 3U2JA 5JA8B 4NRZB 3VXUB 1RJYB 4Y2OB 1ZVHA 1RZJC 1A9VA 1FNSH 4JO2L 3VI4E 4UIMB 1W0YT 1EO7A 5IKCA 1ZLWK 5E5MB 2NQDA 5DK2B 5JHLL 4BKSC 1BQHG 3B6SA 5L2KB 1X9LA 3U6XS 4NUPA 3CSPA 1RUKL 5BVPL 1A14H 1E8YA 1P9MC 3PDGA 2XHNA 3D39B 2ICEB 4ZZKA 3VG9C 3X13A 5I9QB 1MFAL 1H19A 4R97B 4D9LH 1NM4A 1GYVA 1KB3A 1WUZA 4LBEB 1E6OL 1S9XA 1IC0A 4YHNA 4L8SB 4ZBJA 1KGIA 2WKGA 1UZ6E 3TJEL 5GS0L 3EAKA 4O00A 3TT3H 4PJHB 4R7NA 5EEXA 1FO0H 2VDPB 2VOTA 4RRPA 3QIBC 2DYPB 2XWBA 5DJXB 3UBXG 3WEXB 1D5BB 2OMTA 3HE6A 5TE6L 2CJSA 1FFPA 4Y2NA 1C5BH 1AGBA 3HZVB 4UQ9A 1KTDB 4OW6A 5IWLC 1HWGB 5ILTH 3JWDC 2YO3A 3B9KA 2ORBH 2PCFB 1BVNP 2QPEB 1RZJL 1QBMH 1JV5B 2HH0L 1HJBC 4MDIB 4MB4A 3AB0B 3DRTA 1TQVA 4F7CA 4ODHL 3VGHA 4X5RA 4CU8A 3HRPA 3TIEA 3UGUA 1B4LA 3AWFA 3TZVB 3CDZA 1P4UA 3GSOB 4FTVD 3TU6A 2C3WA 1GGBH 1X5AA 5GZOD 2FJGA 4LBAA 1AGEB 3LS4H 4NRXA 1PAZA 5K9OB 3N5AA 3BAEL 4QWWD 1HSBA 3SZKC 4ZTPH 3EJRA 3MLYH 2EVFA 5DC0A 5IQNA 2G9HA 2XYCA 2CD0A 3OL2A 1VGEH 4YSOA 4FC3E 1OV8A 5E2UH 2DQ6A 5TPWH 4J3WA 5E6ZA 1NDMB 2VMDA 2WVTA 1XH0A 5D1QD 4N0FB 3IKCA 2PW2B 3V8CA 4WHYG 3WI9A 5TE7H 4YQXL 1WBYB 3MUGA 4DP8X 1JRHI 4HAKA 1H6EA 1VFOA 3BPCA 5CEZD 2ZSWA 1F1DA 1U3YA 3T0VA 4BWUA 2YAQA 1N6UA 1E7VA 4MZRA 3EH5B 1WZMA 3FF8A 2IJ0C 4X4XB 5EZIL 4G8FB 4JBSA 4X4ME 3SDDA 3KVDD 5K9JL 4ZK8A 4LZKA 5CF3A 2ZYHA 3LKNA 1R5IB 4DKAA 2FAUA 2HJLA 3AS1A 2A3TA 3UC0L 4KPHH 1R17A 5EIIA 1UYWH 4L1HA 4RGNE 1OSPH 2AVFA 3H3KA 2E46A 1QFPA 1U9KA 2VN6A 4M1GH 2XG5A 1T1WB 5A7EA 1DJGA 1Z2KA 4GUPA 1UB6A 5GGQH 2D03L 3PHOB 3NT0A 5C07E 4CSTA 4DQOL 3QNYA 1OGSA 1AC6A 5TD4A 4L3ED 3PL6C 3FQXA 3MUHL 5AB0A 3KCPB 3QUZB 3RVUD 4F15B 2LTQB 2AMGA 3QIWB 2N56A 4Q9QL 1DLHB 2X70B 4JPKL 1B4JH 2QSCH 4NQDA 5AD0A 3QW9A 3RZCB 2V7HB 3QRGL 2Y7LA 3EYSH 5GGRA 4LHUD 1E5UI 4GO6B 4I89A 1DANU 4JO4H 2CDGA 4BXSV 3Q6GH 4G6FD 4HUXA 4V1DB 1YPZB 4FNTA 4OSUH 4NKIH 4RMBA 1P4BL 4RGNC 2IVFC 3NA9H 2HJFB 4DP5X 5BMFL 3MRIA 5I0DA 2P26A 2W94A 4BQ9A 4YSTA 2NY2C 5F0MB 4RGOH 2A6IA 1WYJA 3L1GA 3MA9H 4G7VL 1OLLA 2DJMA 3DNKA 5DUMH 3VG0H 4AQEA 3S8GB 2ENSA 4RAVB 5BPPA 5JZ7C 3TLRA 1EAOA 4WO4B 5D9SB 3GXMA 4PRAA 5CJXA 4G71B 4TSCL 3DHMA 5ISZD 1CICC 2R29L 2W0PA 4JG0H 1P4IL 4M03A 3C09C 4WJKB 4P4KB 3RVWD 1JYXA 3HVDA 2EH7L 3MCYA 5AKRA 5TPWL 1EZSA 4P59L 3CFQA 3OGCB 3DXAE 3OKLA 4ZX5A 1IKNC 2Q76A 2V5TA 4WIQA 2D3NA 3AVEA 4KH9A 3QUMB 3HPJA 1JUFB 2XQYK 4HC1H 4F92B 5GXBB 1E27A 1D5IL 1FA4A 5AG9A 1HNFA 2YWYA 3OQRA 4P2RA 4ZPTB 4Z7OF 4N0YL 4IS6A 4UIKL 3QUYA 5F7DA 4OBSA 4WHCA 1EHLH 2BS8A 5TE4H 3LRLA 4CMMB 1Z66A 3UDWA 4CA4A 5BZDA 4RISH 5I66B 5E9DE 2K8QA 4R97C 1L6XA 3D18A 4NEHB 4CNIB 4AV0A 2PP7A 4HCRL 2QQKL 1H5BC 4X9IA 4F37K 4TNWK 1CR9L 3BAKA 1PGRB 2Z3FA 4XPGL 4YXKL 2BJML 4G9FB 5TE6H 1O7VA 1DR9A 4JB9H 4L8DB 1WISA 2Q3AA 6CGTA 2O61A 4UTAA 1A4AA 2HTKC 3T3PB 3QDME 3VFTA 1M1XA 2FIKB 4FX5A 3GXNA 3HW7A 1CGXA 2AABH 1U8KB 2J12B 2ATPA 5I8CB 5E03A 2R69H 3GIZL 4WWKA 4D0DA 1ZGLP 2VZ1A 2R2BB 1S5IL 2N4IA 4WEEA 5I73C 1LK2A 2Y7QB 4FXKC 4ZFGL 4HETA 2E27L 3MRNA 1N7ML 1A3ZA 3JSSA 3FW6A 3MRBB 3NZHL 4YZWA 5I19H 4U6HA 3B7UX 1THAA 1IEAA 2GW5A 2CJTA 1T3FB 5C6PB 1JYVA 4L9LA 4UBDC 2V9TA 5KVDL 3RY4A 4EUPH 4F7TA 4NZDA 3VGBA 2AEQH 4XNQB 4X9GA 5IOPA 2EEBA 1IKFH 1FIEA 3S98A 3W57A 3EYOA 3EH2A 4UM8A 4BQCA 3GM0A 4YUEH 1CBVL 2KZBA 3MNMA 1DBML 4PJ7E 4LNVA 1IT9H 4F8LA 1BOGA 5I1HL 1I85A 5F0JB 4UUJB 1R6VA 1QBLH 4XPFH 1HSAA 5EU4A 2G2PA 3OC5A 1YNLL 3O0LA 2WUBH 3FTVA 3UC0H 1AOZA 1U92A 2DWYA 2CR3A 1QWNA 4B9FA 1W9XA 1ADQL 3NFNB 1MXDA 4MJIA 3MJWA 4JAMA 1AYOA 1MLCB 2VDOB 2Z65C 1VENA 1BJ1H 3NZUA 5KYXB 1BVLB 3NCJL 2BHFA 4IRZH 2FX7H 1MNUL 2VW4A 4MXWL 3IRZA 2YPLD 3V0WH 3ULVF 4AY0A 5IG7B 2JELH 5EWIL 1IGJB 3AXLB 3TH4T 4OV6F 5FO2A 2XZAH 5F88A 3QCVL 3RVVD 5CP3A 1U0QA 3B3IA 3MAWA 1HOCA 4I87A 5CINH 3F7RA 3MV11 4LLQA 5FYKE 3VD7A 2IANE 3UABA 4NENA 5ANHA 3HNVL 4RNRA 4QHPA 4XPFL 3S2AA 1ITBB 3BXNB 3ATFA 3VJ6B 4F9LA 4GP8B 3ZL4H 1M3IA 4X83A 5C8JB 4M6NL 3AS2A 4LLMA 4U31A 5KBDA 4HUMB 5D7LB 3EYUL 5DMYA 5L2JA 4P2OA 3QXDB 4HGMA 4R5TA 2EC8A 3FTGB 1T0NB 2I60L 4F7KA 3GZQA 1IZKA 2I27N 4PREA 4A6YL 3H0TA 3MC0A 1RURL 4XCYB 5EDXA 4PRIB 1NCCH 4KRPD 5HJGA 5IV2B 3DX6A 5GS0C 3NG5A 4J3OH 4AEHL 3U46B 2VDLB 4LAQL 4MA7L 5ICZA 5GRWA 1O9VA 4P5TB 5TQ0H 4NQSB 3ARGD 2F9BT 4WO4A 1A5FH 3MNWA 2B5IC 2D2OA 4APQB 4H44C 4YDZA 2WLNA 4POYA 4QIRA 4P5KB 1JSYA 1CLVA 3B7TA 3BP7B 3QXVA 4JDZA 2EUWA 1DLFL 1DSWA 1B2YA 1NCBH 5E5MA 3KXFB 1HU8A 4AIOA 2JI1A 1FNAA 1TVHB 3ARUA 3KW8A 4ZS6C 3M86A 3PWNA 3PWJA 1IAOB 2VDQL 1NFDE 3SE8L 4BKTC 5KBLA 4LQ1A 5GZNC 4G8GB 1IM9B 2WQXA 4N5ED 4Z7AA 1JV5A 4OCRH 1AH1A 1NWPA 1QPXA 1YJDL 4P8QA 1MFBL 5CHNB 3BH4A 3GTNA 4FP8H 3HVNA 4HWUA 2ADIA 4HCRH 4HJGA 4BIKA 3KDPB 6PCYA 1DQIA 1CGWA 4HX1B 4CMHB 1KF9B 1NEUA 4P9MH 4PR5A 4UZUA 3V9FA 1MIEL 1BM3L 3S97C 5L9DL 1S4IA 2YGNA 3ROLB 3DVFA 4YFEA 5D7IF 5FO8B 4Q6IC 2YMXH 1A4KA 1QI3A 2D3VA 43CAB 3EZ8A 2N3JA 3GSUB 1X7TA 3KH4A 3LHAA 3PP4H 4KXZH 4BQBA 1T1YA 1HHGA 3UC2A 2X3AA 2KKQA 3NP4A 5E24E 4DP9X 1PMYA 4PJ8A 4OV5B 4FQQB 4OM0H 2AI0H 1QWUA 1NGWB 4HCFA 1WWAX 4M3HA 4NQCA 4P5TD 1M7DA 4NZTL 3VTAA 5K93A 3BAYA 4X2UA 2GI7A 4JFSA 4UQBA 5C86A 3F5WA 4HMEA 2HX9A 5F7NC 3RBSA 3LJ3A 3FQYA 5D5MA 2VITB 5CAYB 1CXLA 1Q1PA 5C0EB 4DGWC 4M48H 3IXTA 3S3CB 4JN1L 3F85A 3D85D 3T1WA 2BRRH 5ABDE 1L0PA 5L7XL 1AZVA 2OMNA 5JZ7D 2R59A 4UQ3A 1CE1H 3WG7B 3JWNC 1TCRA 4IHBA 1QD0A 1P4BH 2AZUA 4Y0GA 4P0DA 3K5SA 3W11C 1J0JA 1MRCH 3G6AB 4J3BA 4FQ2H 3REWB 2OMTB 3HE6B 4FI8A 3RX5A 4Q9RH 1KV3A 3AS0A 3FQUB 1R75A 2R15A 4DGVL 2VLMD 5DJCB 2VL4A 3BSZL 3PGCA 4BUQA 1T4WA 4HXAL 1CR9H 1B4JL 2OMUA 3VFUA 3RY5A 1KLUB 2Z7WA 5EB9A 1P53A 2IGFH 1VGEL 4I1NB 1KGJA 4X4ZA 2NW3A 3VXPB 2WVUA 2YGQA 1AO7A 4PRNA 1BREA 2E9BA 2EE9A 1GGBL 3ZE2E 4HULB 2N1TE 3L95A 5F9WB 5A3ID 4GRWF 2HJFA 5DO8A 3J27A 3JUZA 3D4GA 3DECA 3SB3A 4AK2A 2NX5D 3S96A 1PNDA 5K39B 5C6TL 1J5HA 4L4VD 2VN4A 4X4YA 4NS0A 1NJ9A 1RZJH 4PRPE 1E4KC 4TXVB 3LD8B 3N6YA 4RFOL 1A2YB 5B4MD 3UCQA 5CKGA 4XNMB 1Q0EA 2NY6B 4GAFB 3MREB 1GZQA 5KW9L 2GIXA 3OKOB 3I85A 1QKZL 4F7MB 4ZMPA 4XMPL 5CJQL 2AGJH 5D7IA 4AQ8A 3OKLB 1HH6A 1YCSA 3F65A 1OCWL 3N1QC 1A7NL 4R96B 4JZOB 5IJVA 2ZCKH 3EFOB 4NI6A 1BG1A 1FVCB 4OZGA 1MXGA 3ZIMA 5D96B 1RZ8A 2DQMA 4F24A 3FUHA 4AYFA 4GG6A 1B6DA 2ESVB 4O9HH 4OVUA 4AQEB 3L17A 2WQSA 1XEUA 4NFCA 4YHNB 2ADJA 3PS6A 1FZJA 2EC9U 3S35H 1TYJA 4F7PB 4IKKA 4N1HB 4HCIA 5CFHA 2DJSA 2PW1B 1BIIB 4JPQA 3SO3B 4QRAA 4HKZA 3HS9A 1EK3A 1UXMA 5D2NC 1T04A 2ZXEB 3MNWB 5E7BA 3DX2A 5KN5A 4JMNA 1BSIA 2AF2A 2H3KA 1S7SB 3BUDA 3QZWG 3QO1B 4UBDD 4XMWA 2GABA 4B27A 5JW4N 1W72B 3RPKA 1EDYA 1NH6A 4HS3A 1J8SA 4TSCH 3OKKB 4W1TA 1BZDA 4LSSL 3O2VL 4FN0A 3NJLA 3HE7D 1JMZA 3S4SA 3GB7B 3VW3L 4KKAC 2HLFC 5CD5D 1I8MA 3VQ1C 5BZDB 2J55A 2WSKA 2IAMD 5AVQB 3FN3A 1MCPH 4AGMA 2Q5BA 4YXLH 1DEEA 5EO1A 3WNOA 4DETA 4DTGL 1LEKA 2JK5A 1BEXA 1FO0B 3WNMA 5F6IB 4PH8A 2MCPL 2W60A 3EO9L 4X80H 4TUOB 3JV6A 5B1JA 5HGAA 3UYPB 3IFPA 1NFDF 4IOIB 1B0RB 4JZJB 4EI6B 1E4XH 3QIUD 4FEMA 3C5JB 2XWJA 1N5AB 2A74C 1JNLH 2ICWA 4MAUL 4QRPA 5DJXA 2ZSWB 3ARDC 1IEHA 1HS6A 2PF6A 4K8RD 4Z76A 3AQXA 5BZWB 3GMLB 2YK1H 1QSVA 4Z1PA 4QHLB 4O2FA 4YK4B 4LIQH 1TQCC 4AYSA 4N5UA 5IR1A 3HHSB 3FPYA 3MO1A 2NNCA 1RJLB 1NA8A 4N8UA 3S36L 1T66C 3GJFB 4Y5XC 5F96H 5L2KD 1NOFA 3CIQA 3GO1H 4PJ9B 4WW2A 2VXQL 4KPHL 5L2KE 3BGFC 3GSRB 2GBUA 5T3ZE 3QEGH 3VXUD 2IV9A 3JWDH 4F7TB 4FFYL 4RFNC 1BVKA 1JF6A 3B8YA 1C08A 1QA9A 4NKDA 4WI2A 4G43A 4AQ1C 4AVKA 3IMBA 3G5VB 1TJIL 2DQDL 4QLRA 5JXAL 3ATDA 4R26L 2VXVL 1RK7A 1G0XA 1UWGL 3DI3B 1MCSA 2E47A 1PIFA 3DDFA 3C12A 1L3NA 3HG5A 4QRFA 2VQ1A 1DQMH 1KYAA 2NMSA 4XNBA 2CJ3A 2CRIA 3BGMB 3DI2B 2CO7A 2B1AL 1EFQA 5DZ9A 1CC3A 3BH9A 4IBLT 3CPUA 3MRCB 5M94B 2RHEA 4Z78B 5C0GB 1PKQE 5DRNB 2J8OA 3PV6B 4U1MB 4UQ2A 1K6QH 3DOIA 1OANA 2FNWA 1N8ZA 2Z4QB 3E8VA 5AW6B 3TIDB 3TJPA 3WFCL 1T20B 2ZOLA 5GS1A 4XB3A 2WTOA 1GGIH 3TEWA 3KDMB 2OR7A 2X4QA 1P6WA 1GR7A 3GNML 3NIDE 3NN8B 1ZSDA 2QR0A 3L3DA 4GKLA 4F80A 2X4NA 4NM8H 4QRPD 4R4BB 1A6UH 3KD4A 2ORBL 4N3UA 1GOFA 3CHQA 3ILPA 5GGSA 3IJYA 1M7UA 1HL4A 2VXUL 4QPEA 3RQ3A 4F2MB 1TUPA 1FNSL 4JO2H 3SKMB 1R4XA 3BQVA 4U0RC 3GSWB 1DVTA 1GYCA 1TKWB 2R2CA 3L3KA 3QGVA 4GG8A 3VE0B 4MLSA 4HF5L 2FB4H 3COOA 4ISVA 4FI6A 4IBSA 4H25A 3KZ8A 5DVLA 3TYGL 5I6MA 1JK8A 2HN7B 2XN9A 3IDGA 3KPSA 4NZUL 4AH2B 5KVFL 2OW7A 4M48L 3KL5A 3DV6B 2FBJL 4PI2A 3KWUA 4Q6YA 3ZY7A 3DPBA 5F93C 3MUUA 5IEKA 1AHWA 4UT7L 5CBEA 1JZJA 2WLMA 4PJ9D 1LO3H 2NY1B 4MVBC 4GMTH 1Q0YH 1UCBH 3ZSSA 1XSKA 4N20A 3UAJD 4PP1D 5DTFA 3VUAA 1A7PL 1UASA 4M29A 1LWJA 1Z1WA 5FUZL 4YLCA 3BVXA 5KOVC 2I24N 4IMLB 1GVIA 2NY3B 4UNTA 2DQCL 2FNBA 4KRNA 1Z9NA 2WYTA 3P30L 5LDUA 1N5YH 1RZKL 5A2LH 4BE6A 4F9PC 4UNVA 5J6HA 1E5ZA 4UZGA 2ZWKA 4Q7DA 3P73B 4QXWA 4YDMA 3RL2B 3S37X 3UPAA 5F1IA 3W9EA 2FT7A 1DQLH 1U8HB 4J1UB 1PZ3A 4JRFA 4CBZA 5J56B 4HAGA 1WE5A 3KXFA 4CVXB 1ZPUA 1MFEH 1U8KA 2IADB 2NY7H 3ENEA 1UOWA 4QRTA 3TO2A 3GWJA 4OLZL 3KH3A 4Y5YA 2M1KA 1WQVT 3HN8A 3MQIA 2XIDA 4H1LB 1F97A 3ATEA 1LMIA 2BWIA 2C3GA 3PJNA 4L37A 1TJHH 3KPRE 3ZYJA 5EN2B 2VR6A 2VL5A 3ARFD 1T5XA 4MDJA 1NFIB 1UUSA 2WTPA 5IY5B 1GPOL 1GH7A 1ES0B 5D1ZC 5AOJA 2ZONA 3QFJA 4FKKA 1RHHA 2X6CA 1MDTA 5J4MA 1G1KA 2HTLC 2PP8A 1VKXB 2JJVA 3L7FB 3S6CA 4XNQA 5AVZB 2PCXA 4QNPF 3F8UB 1WK0A 2J1YA 3WJMB 2O5YL 1ZTXH 1XCTA 5KUKA 3HR5A 4FXLA 5AW7B 4Y4HC 2PPEA 2Z31C 4PS7A 4JRLA 3P3UA 5DJAA 3T3ME 5D6DC 3FZUD 2P45B 4LCYA 2FB4L 3FN0H 2ZXAA 4TVPD 1NFKA 1AQKL 4HUUB 5IVOA 1K5WA 2LR4A 5DT1L 2HPOA 1W0VA 2Q6WA 4KGJA 5HPMA 2K9FB 2HX8A 2VM4A 3NJXA 4HIXH 1FGNH 2GJ6D 4GOSA 4NWUH 4EO5A 1R24A 1H8NA 2R4SL 4Y19B 1GXEA 3MX0B 3RWJB 4AMWA 4ZUVB 3I02A 5FKPB 4HUVA 5DJ6B 5EU3A 4JE0A 4N8VG 1SDDB 2AQQA 1FFOB 1FJ1A 2HWZH 5L4IA 4I18B 2E7HA 2UWEE 2OP4H 1RK1A 4QAWA 1K4DA 1BBJB 2EDDA 5DQ9B 2NY6D 2WHVA 3ASWA 3TA3A 3ULSA 3CQPA 2Y7MA 3DHJA 5IW3A 3H9ZA 1YC7A 4BYHA 5DJ8A 2BP8A 6TAAA 1KJMA 3FQUA 4GSRA 4KMTL 4Y2LA 2BZ7A 5DJDA 1BF8A 3W81A 3VXQB 5GGVL 1CDUA 4WEBH 3AFLA 3TO4A 1MREL 2N7BA 4MRCA 4ZX4A 1CG9A 5F1NA 5CILL 5ID0B 4S10A 2QPUA 4IBUA 4KK9D 4DZBA 1QSZA 4HEME 2Q7NA 2VLME 2VLJD 4NPYA 1V3MA 4FJZA 2R29H 1OM3L 5CJXC 2QKIC 3ARDA 3HFML 5MP6L 1X44A 1TNMA 5C3TA 3U6XA 3E2HB 2QV2A 3KPPA 3HBQA 1UXWB 4NCC2 5FHAL 3OF6A 5KEZA 3T77B 1I8LC 1AFVL 1ML0A 2ZWZA 4ZOCA 2IDCA 2WXJA 5I8KH 5HHQB 1QW8A 5IOPB 3MDJA 5SWQA 1N3NA 1T7ZA 1LWRA 3JVFC 5IMLA 2AITA 1BXUA 3D06A 3HLAB 4LPUA 1Q72L 4HIHA 1LO0L 2WXMA 1RJZB 1MCQA 4N2LA 1MPAL 3GRWL 2IXQB 1WFIA 3CN4A 2R0LL 4LRIC 3L3IB 3MNVA 2EYSA 4H8QA 4P4RA 4FQXB 5FUCE 3AT0A 1LWHA 3QCTH 1F6FB 3BC9A 1ITCA 1K3IA 4MJJA 2VSDA 4JQIA 4R2GB 2W9LA 1OOAA 2A9BA 3TVMB 2OTPA 3I9PA 4A55A 4HKXA 4U1GC 5F9JA 3CSFA 3GMMA 4F15C 1E9QA 1XD0A 4NO3A 3BFOA 4Z7OB 2JJUA 3QNXA 5FW6A 4X6CE 4P3WA 4N25A 1TU2B 5E8OB 2G75A 4Y9GA 1OE1A 1AGDA 2O26U 4WEMB 5IB3B 2X9XA 3V6ZA 2QEJA 1W2KT 5IFHL 4GI8A 4PRHE 4KUZH 4P49A 3W38A 3HAEA 4NWTH 3U0TB 2Y1VA 4B3EA 1L9TA 4HK0A 5F3FA 5DZJA 2PWGA 4KI5E 1V7NL 1BQHA 5CIPA 1MFNA 3OJDA 3B2VH 4DF9A 3DIFA 5DQJB 4JLRA 1JGVH 1XCWA 2J5LC 2DQHH 1NL0H 3EBIA 4ODBD 4PS4H 4MMXA 4JR9L 1CICB 3T2OA 2DBJA 4I9XA 3VM7A 2ZKYA 4LVOC 2N7AA 3QHTC 4QGTA 4XBPA 2O6EA 1BZ8A 2VXUH 1YEEL 2BY3A 3Q2LA 4JM2F 1F58H 4OZHE 4GMSL 5JW4R 1EEYB 3EJUA 3I6LE 1BMWA 5DHDA 2MNJB 3FTZA 4BK5A 1FCGA 1JP5A 3QI9A 4N86A 5BZXA 1EPFA 4G9FD 3UJIH 1J0HA 3HUJA 4E9TA 4NXSA 5J11B 3D2TA 1LK3H 1E5BA 2GCYB 3GJFA 3QQDB 1OGTB 2RACA 2AERT 4UV4L 2VKWA 4A7QA 4KNSA 3QWOB 2ZOTA 3PXLA 3E8UL 3ZMNA 5T1LA 2UY7A 1FVEA 3FTUA 3L2NA 4KO6A 2FX9L 3B37A 3V4VH 4HPOH 2OMZA 1YN7A 1XH3A 3GS0A 4W9JC 1BQUA 1CTMA 2V17L 4XXCC 2RA1A 4Z7UF 3DC0A 2D7MA 4NP9A 1CQYA 4G8AC 3N85H 4MNGE 3TWYA 4L3EA 1L6ZA 3CN3A 4NZTH 1ILSA 3U2SA 1XHHA 3AY4C 5DUPH 2H3XC 1F4XL 1A1OB 3KGSA 4PRID 3L1FA 2IFGA 4V11A 4UDTA 3M45A 4MHHI 4KY2A 1W0VB 2LFEA 3KR3H 2G60L 5JORB 4X6EA 4LVHC 1PU0A 4NERA 3JV4A 1FGVL 4PBWD 2ZPKH 15C8L 1XB6A 3JT2A 3SKUD 3SE4A 3QDGD 5I0ZA 4TSAH 2Q9OA 2UYLA 2PYEA 4MZIA 5B3JE 4ENEC 4WTWA 2A73B 4G5ZH 1UENA 4V2CB 1Y18B 1T83A 1YLBB 5JHMA 2BIIA 1CVRA 4PJFA 3E7JA 4M7JL 4NUJB 3FCSA 3DYMA 1FQ9C 3LEXB 3QZWB 5BS0B 5TFSL 1Z3GL 2PTTB 2EYTB 2O5ZL 1LE5A 3VO0A 3SDAD 1V8HA 5DJ0B 5GISL 3BI9X 1HEZB 5IMMB 4OGAC 1GSMA 2H6PB 2HKFL 4I2XB 5DMGC 5FYLL 1UGKA 2ZCHL 5BRPA 4P23C 3TT1H 2DQHL 4PS4L 3L2LA 4FOMA 4L1DA 4O02A 1BEYL 5J1AA 3MV9B 4EF3A 4DP0X 1JK8B 2HN7A 2XN9B 4PJBE 2FQGA 4FFTA 3OKMB 3FSOA 1YECH 3MACL 5DDHA 5DWUH 4KDTA 4YWGH 4KI5C 5B39A 3VFGL 1XT5A 3QWNA 2C7UB 2CMRH 5AW4B 3VXRB 3QQ3B 4BSWA 5I75B 4NKMA 1QABA 1TTRA 1DVYA 1SGKA 2RB8A 4KQ3H 4ZMZA 4N28A 4QHNB 5A43C 1RPUA 3ARBC 3I2CH 2J44A 1DQVA 4ODTH 4HEPA 2WANA 1HH9A 1KLGB 4U1KB 3S3DB 1HX0A 1MQKH 2QGDA 3C2SA 1VLXA 4RGMC 4NPKA 3B9KC 3MRLA 3QJXA 4HWBH 4ZX3A 2C3XA 4K3EL 4YQXH 5TE7L 3RTLA 3RWGB 1MI5E 2GITA 3D3VD 2WOBA 4MNQE 3ZDXE 1KGCE 2WINB 3VXMB 5K9KA 4LB8A 3QIBA 2DDQL 5D1XC 3U9UA 2EIJB 2WC7A 5E2WL 5LQBL 4NRYB 1VHPA 4JANB 3DBSA 4G2AA 3ZL4L 4D8PA 5D1QB 5ICUA 3FU6A 2WQWA 5IW1B 5B38G 2WVVA 1KCVL 1V27A 3TCLB 1BQ5A 1F4WH 4L37B 5DD1L 4ENZA 2CPUA 1JWUB 5IK3A 5I1KH 4MCZB 3WFHB 1NIEA 1KELL 1PDKB 1MNNA 2Z31D 4QTHB 4DGVH 4UI2A 3CVIL 1UACH 5IQOA 3VH8G 1NANI 1G84A 1RHHB 3L5HA 5D5MF 1X5KA 4R4BA 5JHDE 1YUKB 2CKNA 4HKBA 5FYJE 2BMKA 2CNZA 4R7DA 4NSKB 1A7RL 3C5JA 5C09E 3IJYB 3SPGA 2DI8A 4BDVA 5MI0B 5DD3L 4BH8A 1BIIA 4Y88A 3DROA 1H3PL 1NDGB 4U3SB 3CZEA 4IGBD 3FBQA 2WLZA 3WIHA 4PJDF 2E86A 1CF8H 5MEQA 4ZW8A 3DOSA 2QQNL 1X9RA 2DEYX 4OT1L 3L1OH 4XAKE 5C6TH 3O6LL 5E00B 1EVUA 1HAWA 3SDAC 1YNLH 2QVMA 1U6AH 1PLAA 1TF4A 2Y2WA 5IF0B 4J4PA 1RUQH 4H20L 3Q6FB 1NSNL 3QHZL 5IIEA 3CFTA 1LQSR 1A6ZA 4N26A 3S4SB 3L5JA 4F93B 3C5SA 4PLNC 3PWLB 5EULV 1J11A 3VFSA 3PIQB 2O5XL 1NM9A 1EZUA 1EA9C 1KDJA 1OPOA 1PY0A 2EC9T 3KPLB 1KENL 4IW4C 4IMLA 3FC8A 4PG9B 3SOTA 5FYLE 1OKEA 3P9LB 5HI5C 1Q72H 1TZHA 1QLEB 4FFYA 2X12A 2X53A 3F7QA 5E51A 4YDJB 5KVDH 2FT8A 1JCKA 3AQDA 1TQBB 3EO1B 4QR7A 4JQVA 4UM9A 3I75B 1J86A 4X98B 43C9B 2FD6L 1Y0LB 4DVRH 4L48A 3DSFH 5H4ZA 3ES6B 2KL6A 4X5QA 1QLEH 4HLZH 2PKDA 1HFUA 3UH8A 1WAEA 3QUXC 5HGHA 5TGBB 1SJEB 1J8HD 4LDLB 4NBZB 2JCCE 2DBLL 1KXTB 3D9AL 1F00I 5AAMC 3S9DB 4H20H 2O5YH 2Y5TA 1FORL 3HS0B 4WHTA 3BX7C 3ARYA 4G6FB 5CN1A 3QUHA 4XO8A 4YE4H 4HMCA 4KZDL 2VC2L 3DMMC 2W88A 4LKXB 3WIFB 3HPLA 3MLZL 1I1YB 2CCLA 4QUOA 2Q8AH 1RIHL 3VWJA 2YN5A 1EAJA 2ZSVB 2QLYA 3IK2A 4B60A 1UD5A 2J8UF 3OMAB 3OGOE 2VABA 4XPGH 3BAEH 2NY2B 3IF1A 3L5XL 4OGZA 4UYPA 1KCUH 3OB0K 1IEBB 3MRDA 3TBVB 4K3DL 2DRUA 2YOCA 5HHVH 3PP3K 1G5GA 4DP7X 3FAXA 4YVUA 3S5LG 1W0WA 4Z5RB 5GGVY 1QRND 2NUTA 2EDLA 3G5VA 4TPRH 4PGEB 1A3RL 4FGMA 2DQUL 1RUMH 3MRQA 3VFOB 2PO6B 1MH5B 4AIZB 3FUDA 1REIA 1ZLDA 3CX5J 2BSEA 3OKEA 5K9QI 5KYNA 3W82A 1CLYH 2WYHA 3DPBB 2VQTA 5F9OL 1HT6A 4EE2A 3H7BB 3AACA 4HJEA 5C97A 5IJKC 5IZ7A 2CGRL 1I7ZB 1A8ZA 1PZDA 1D7BA 1XR9B 3EYUH 4UOQA 4AVIA 4JNXA 1F18A 4M6NH 5IMKA 4ICWA 4HKXB 5DWPA 3UJJH 4Y19A 1IAII 4IKLA 3IMUA 1U36A 1RIHH 2GSMB 3L3HB 1NGPL 3C5ZA 1NAKH 1WAAE 3FU8A 1D5MA 1DN0B 4TNVK 4I18A 3SCMD 3ZZSA 3K6OA 4NX0A 4K3JL 3GUTB 2Q86A 2P24A 3WFBL 3F01A 1RK1B 1HCVA 3KJ6H 3O45A 4U1SA 4Z7VF 4LLWA 2B9BA 4GBXA 3RPBA 5HDBE 3V5DA 4WUKH 2AW2A 2SEBA 1G9MC 4A37A 2VDLL 3PUCA 1FZMB 5BVPH 2WIIA 4ZFQA 1X7QB 2EUXA 5I15L 5D1XB 4HSCX 5IVNA 5GSRA 2OMXA 2Y07H 1JZ6A 1CIUA 1EZVX 4JO4L 4ZXBC 4K7PH 1S5HB 5TK4A 3H6AA 3KG5A 1OAYH 2VMCA 4C4KT 1URLA 3QUML 2H47C 4FXGC 3VFMA 4KDWA 1AO7D 3TURA 3GFUA 1YO4A 2HLAA 2UUDH 2Z7ZA 2O4EA 3CX5K 1MWOA 4S1RH 3L13A 1QI4A 3DHPA 3IJ7A 4U3HA 3WDIA 1Q9LA 3AGVA 3DJRA 3GXIA 3LS5L 4JQXA 3D39A 2IH3A 3RVXC 3CDGA 4QRUA 2VQUA 2YPVA 1PY4A 3D51A 3M8OL 1ONQA 1K6QL 1OGAE 4AYMC 3EDKA 3WXVL 1ORQA 5AB2A 2AEQL 1EDQA 1IBHA 3IDNA 4OJAA 3RUGB 1J8HA 5BXFA 1X3DA 1CLZL 1H15A 3HE7B 1RJZA 5SV3A 5ITBH 1OLZA 1C1EH 2EO7A 4NRZA 1CFNB 3VXUA 2APTA 3DV6A 3CV5A 5F7EH 4BUHA 5DUBA 4NUQA 4FA6A 5IKCB 4UANA 3QI9C 2K1MA 4PJGA 5E6YA 3FUJA 5E8DH 1IGFL 3B5TA 5LO7A 3RWDB 3MX0A 3RWJA 4H8WH 3HCVA 2ED8A 3NCYP 3CFIC 3QDAA 2EO1A 1IM9D 2WXPA 2YXVA 5GGVH 4X6EB 3VSVA 5FDYA 5HGBB 1FNEA 1O9WA 2EECA 3S3PA 5ADOH 1LP9F 1U30A 1JNHA 2UXTA 4HPYL 1EAQA 3P73A 4Z7WE 3CDZB 5FHBL 1HQRA 4XBEH 4CN4A 3MV7A 1XSIA 4NP4L 3DO7B 4NM4L 1MJ7H 2EIEA 3MLYL 5SWZE 2DMHA 4YXKH 2DMCA 3BSGA 3ZTNL 4APQD 5EOCH 3RA7H 3ROOB 1E43A 4GSQA 4F7EA 5MEOB 1MFEL 4G9FA 1MW0A 3OJDB 2ATKA 4XMLH 1PG7X 1A9BA 3L4UA 1IUZA 4I3SH 4OZHB 5BQ7B 4UV4H 1EJ6A 2XA8L 3M46A 5AWNL 2VDNB 3HC0B 3P4MB 2ICWJ 4L9DA 4MLIA 4ODWA 4QHUB 4WHYH 3B2DC 1K4CA 4RFNB 3GIVA 3CFEA 3R4DA 4ZNEE 2FYYB 2GT9B 2Y5TB 4KZDH 1L6PA 4M6AA 4PCYA 5DDHB 1C5BL 3MNZB 4A67A 1A66A 1BVKB 2QTEA 1CI5A 2R39A 2R8SL 2BSTA 4HKJA 3IGLA 5LB1A 1PQZA 1QEWB 1M71B 1TEFA 5BS0A 3TT3L 4YHYC 3KLKA 1FI8C 1OGPA 1SM3L 1HEZA 5IMMA 1HL5A 2P9RA 2Z0UA 4Y1AA 3L3IA 1ZOXA 3LNGA 3WE1A 3RVTC 1W0WB 2YMTA 3EOBB 2BNQD 2JJSC 4DP6X 5E95B 2ZOKB 3TYFB 4K94C 1ZHBB 2X4RB 4KK8D 5KBPA 2R1YB 3CN0A 1JAEA 2IG2H 4X6BB 4EIZC 1CGVA 4KKCD 2NTSP 5HHOA 3X14A 3PF2A 2WZPD 1ZE3C 1FBIL 1MRFH 2A6KA 2ZWNA 4G6AC 4BSVA 1PYWB 3DVNB 3FTXA 4HV8A 3MV01 3OWEA 4NHCH 2APWA 1AGDB 2VXSL 4M3JA 4L1BA 1CYGA 3FB6A 4JY5L 4L2LA 1HI6A 1I8IB 1L7TL 4TYUA 4JO5A 4FNSA 1AGCA 3UOAB 1QLRB 3U7AA 5CN3A 1DVZA 1DZBA 3HBZA 4DWHA 4Q89A 1RZQA 3VXSE 1D5IH 4HC1A 4PJXA 5J12B 5EOCJ 4M02A 3W11D 3HNSL 3KR3L 4P46B 2CM6A 4UILH 5FECB 4M1GL 4PTUB 1P5UA 3HMXH 5DUJA 2YEZB 2JV6A 3GDBA 2ZUUA 4JHBA 3QIUA 2X6BA 4OLUL 5K1VA 2FATL 4PLJC 5DZAA 4O2EB 1MAJA 3ISYA 3WIIH 3NJNA 2X2YA 3DJZA 4UT7H 1CL7I 2BVTA 3FH7A 1QG3A 2BP5M 3EGSB 2YQ3A 2ITFA 2YD1A 1ED3B 3IB4A 1T83C 3O2VH 2CALA 2DOCA 3ESOA 4M8QA 4GSDL 1LLAA 3R0NA 5E4IA 1UXSB 3K6FA 3ULVL 2F7IA 1FL6B 2X28A 3KBPA 1R5IA 3FSAA 3QEGL 3ARQA 3BUYB 3LRSB 2ZCLH 3FB5B 3PXHA 3ARZA 4LHQB 1G7LB 4XWOC 1AR2A 1GAFH 1AD0B 1JPGA 4ELKB 1MFCL 2XFXA 4QHMB 3ISWA 3K3QA 2VR5A 3GSXB 1FAIL 1ILUA 1IBZA 5E2WH 5LQBH 2G5BB 4R7NB 2XX1A 4PI0A 4NZ8A 5E1IA 2A7BA 1QACA 3MBEC 1E6JH 1G9HA 1BA9A 3ARWA 4S0HA 2DIAA 4ZFGH 2XQYG 4OF7A 1JNLL 3BAJA 4U7SA 3WS3B 2H0FA 5ID1A 4ZMQA 2ICCA 1YEGH 3FU9A 43C9A 4ZNEA 1OAXL 3QG7H 4WW2C 2VLRA 4XP4H 4GRMB 4I0PA 5H2BA 2CDEB 1M1XB 2FIKA 4A6YB 3ARBA 2VL5B 4YEEA 4C56E 5CU9A 3DSNB 3GBLA 4J3XA 1EX0A 3OAYH 5I5MA 2AANA 3U4AA 3NIDB 3QUKB 4DAGL 5IW1A 1GW6A 4LKCB 3ILDA 3TV3L 5FGBC 2VM3A 1RZ7H 4U6XB 1F11A 1BM7A 3DUHA 1SYSB 5D7LE 5DJYA 3GZPA 1FFRA 2Y36L 3FCSB 3OB8A 1N19A 3FHAA 3V9EA 3VMPA 3MRJB 3ZDXF 2R2EB 4Z3FA 5CLYA 1WFNA 1SYVB 1BWWA 3K81A 1MHEA 3SOBH 4CADA 3ROOA 3SGJA 2X09A 4L8BB 2F1AA 4XMLL 5HHME 2Y3AA 4UV7L 3S8WA 4PVNA 3L5WB 4O5LH 3F7KA 4Y16C 3GHBL 4X8JA 3KVQA 1R0AL 3C08L 3MGTA 4ZOAA 5EHFA 3L7EB 2WD0A 3WXVH 2HJLB 2Y0SA 4KHXL 1S78C 5EU6E 1C9SA 1RD6A 4NKMB 1GC1C 3FT2A 1MVUA 1KTLB 1R5WB 4J6RL 5ESVA 4MWFB 3VD9A 4G9DA 1YA5A 4PLJD 5T1KB 2Y23A 1MRCL 2XWEA 2C1OA 2WGNB 3PABA 3RZCD 1ZTMA 5E9AA 5AAWC 1YNKH 3LY6A 4OZIE 5E6IA 3F5WB 5D7JC 4FLHA 3KCWA 1YPZE 5GRVL 3NFPB 2QKSA 1NPJA 2E5EA 3QUZD 5CN2A 3V5HB 5JW3H 4AOFA 4JFYA 4HD5A 1T03L 2HP4A 3J2PA 5HI5D 3ULUD 1E30A 1FNLA 2ZWSA 4K5OA 5DJDB 4K7PL 1S3RA 3N85L 4A7TA 3G5YB 1XO8A 3BWUF 3O3DA 4MD0A 1OARH 4XPHH 1BXVA 2X4UA 4PJEA 5TH2A 3IEAA 2RMNA 4N0FA 4YSQA 3RZCA 3R0MA 4PJXE 1DQQA 1MZYA 2C9AA 4MFHA 5F1KC 1OF0A 3IDMB 2YD2A 2DQTL 4RNRB 4YOKA 3U6RA 3N41B 3ZDYB 2OX5A 2VLKB 5I9QC 1GRWA 3OQ3B 3QORD 4X7FC 3MLXL 4MA7H 1JHTB 3T08A 5KBNC 2J4WL 1CFQA 4AJYV 1AOHA 4QTFA 5AZ2L 4HUNB 4F33B 5CEYB 4FEIA 3H54A 3UXFA 4NQCD 3OF6D 1UH3A 4JFEB 5GJSL 3EF4A 4BM7A 2ED6A 3WHE1 1I1YA 1VZGA 1HKFA 2FWOA 3MJ7B 5J6GA 1IEAB 3UTSD 1ZT1B 4PJFF 1QTPA 3Q2WA 4PLOB 2FSDA 3ZYOA 1T1WA 1FHNA 3RA7L 1Q1JH 1DQDH 4IQHA 2PW2A 2JXMA 3UMNA 1AQDB 2CGRH 3KYOB 1NJ9B 4Y9EA 5E9NA 2XVLA 3G6JA 1XGTA 4ZUTA 1DL7H 3KE0A 2C4FT 3IETA 5A2KH 4XZ4A 1A6VH 4XXCA 1XR8A 5FK9B 2XIIA 2RCSL 1OP9A 4CN1A 4CJ1A 1K8DA 2NX5E 2BHUA 4JDZB 1SVBA 5D2LE 4IGBA 4PLKC 2ZCKL 1BOGB 4PRPD 2F08A 1ZLUK 3LEVL 3LKSB 3O41B 5E8NA 4HIIB 4XTRC 5T1DL 3ZQ9A 1BZ9B 2V7HA 4K3GA 4JO1H 4F8NA 4U7KA 3D7PA 3NCMA 3VFSB 5CLTA 3QXUA 1IM9A 2EDHA 1K3ZA 1J5OH 3WMSA 1DYZA 2RH0A 3QK0A 1YEHH 4AKOA 2OFQA 3PHOA 2KH2B 3BZEA 4BK5C 1TSRA 4RMRA 4QHMA 3QRBA 5EOTB 5FF6A 2ADIB 3I3DA 1CU4L 1SMAA 3LEYH 4IRJB 2Q86B 1I8AA 3ZK0A 2VAAA 3DIFB 1C7TA 2QVKA 2OJEA 4AUUA 5K9KB 4YBLC 5L88L 5ESAB 2P43B 4OCMC 1NCCL 1XH2A 2EIBA 1RURH 3V5DB 2B08A 3NJJA 5ETUB 5LGYA 3KBEA 2YR3A 4LPCA 4JVWA 3T4YB 4GSXA 3DROB 4OIFA 5FPIA 1FZMA 2YZ8A 3QG7L 4PRPB 4NENB 1DVXA 2AS5M 1G6RH 3ZZ1A 4LPWA 5HHVL 3Q9QA 3V4UL 3GEWB 1J1XH 3HS8A 1UWXK 1OL0A 4POZD 1JNNH 2FGWL 3ARPA 5CGYC 1Y1DA 1XV8A 3RDTB 4FQIL 1T0NA 3MLRL 4AK1A 3B56A 1Q8MA 1YYML 2BX5A 4FLSA 2N1KA 3C87A 2ZWYA 3H0TB 4XHJD 5D2NA 1ZV2A 5DVMA 5JOFB 4IU3A 2EE3A 1E9OB 3U9PL 1IGFH 4GQ9H 5E8DL 4LSRH 5GGTA 4WV1A 5I66A 4XC1L 4X80L 4XODA 3GIZH 3G9AB 1A4JB 4KXZI 5J06A 3RVWC 2HVJA 4V33A 1P7BA 2P5EB 5CP7B 2M8XA 2HRPL 1J8HE 5E0QA 3LMJH 2QQNH 4M93C 2VH5L 3OJ2C 2GG1A 2AK1L 4K2UH 3HZYA 4PMEA 4BSJA 3B5HA 3LQZB 4EAEA 1QSFE 3KPOA 4XHQA 3QZBA 4XN7A 1NIBA 5I74C 5IQ9A 3EJTA 1GS7A 4X6BA 4DVBA 1JPTH 2NYZA 4TQIA 3O9WB 32C2A 2F5AL 4OD3H 3U82B 2JB5H 1G4RA 2A38A 3DHUA 3DX8B 2LLNA 4ZSOE 1WIUA 3FU3A 1PFCA 2BNUB 4HIEB 5ESQB 1CBVH 1EFXD 2A6JB 3AC0A 3ZDWA 5C09A 4OCWL 2GJZB 3VXNB 3MV9D 3GEFA 3LZQA 4I1RA 4UIKH 5HHPA 2VXTH 4LEOB 4WO4C 5IBLC 1SEBA 5CR8A 5KSVA 1H0DB 1WA0X 5L8KB 1C5CL 4MQ7B 4NAJA 5TGBA 1KB5B 1L9SA 4Y4HA 2VDPH 2Y25A 3ALWA 2JKJA 1PYWA 3DVNA 5FYJH 2WBJA 4NJAL 3VWKD 5DZPA 2F8VA 3PP3H 1YEDA 1KEML 2ZXQA 1K5NB 3WDJA 4LCWB 5D1ZA 1GYWA 4FL4C 5DEFA 1HVXA 5J6SA 4TNFA 4PY8I 3L6FA 4JHAH 3TBBA 3ETTA 5EBGA 1U2HA 2GTQA 4HIJA 2QPFA 1I1FA 2CA3A 4GG6B 2B15A 5HYJA 4KQ3L 3RWHB 3ULVD 4K94L 4KVCL 2NY0C 4HWZB 4OZHF 1TJMA 4GRWB 3A21A 2VXTL 2FWOB 2H41A 4RBPK 1DQJB 5F96L 4B0MM 1N59A 3G5ZA 1MG3C 3D48R 4F37F 1INEH 2XPZA 1Z9PA 2J1KA 3FT1A 3AXLA 4KKLD 1DBMH 4O58H 5I71C 3B2UC 1VADA 3GSVB 1I9RL 1IC7L 3TEYA 4Q9QH 5GZND 2XTJD 2QMKA 4LEEA 1FG2B 5KVGE 3RE0A 4XC3L 4NXKA 3SPVB 2H26A 4XNZC 1T1XB 5D6CB 4J3OG 5KANG 2AJVH 4LSDA 1JF5A 3NFNA 2ZT9C 4IGBB 4LFHD 3HG1B 2MFNA 3MRGB 5EUOE 5FO7A 1DJZA 5JMOC 5H2BB 4N2DA 3TNNA 1IKOP 3J07A 4FXKB 4ZPVA 2NW3B 4UT6H 4M5TA 4TM9A 4X6FB 2MHAA 4UTAL 2PXYD 1LP9E 3W0WA 5FYLD 2UY6A 3QHFH 1F4AA 1DJWA 1UA6L 4Z3EA 1AI1L 1O6TA 5K5YA 1JNJA 4L5FH 1I1AA 2CUMA 3BUIA 1JRHH 3WEAA 5DHVA 3OJMB 4PV9A 1MUJA 4FG6D 4JUTA 3K72B 1ET8A 2BVQB 3ESVF 4ZRGA 4YNYB 1F4YH 3ERXA 4A2MA 2WO3B 3QJQB 1Y1UA 1SXBA 3OGCA 2X1XR 4J5VA 3GD1C 2ZCHH 3HI5H 5HJ3B 4IOIA 1YUHA 4HWEH 1VACA 3BDYH 3JT0A 3LQAH 1USQA 5I30H 4U1JA 2B20A 2DD8L 2J1WA 5C92A 4KZEL 4L8BA 1MWAL 5KZCB 1NLBH 3EGXA 3AREB 4ZUSA 5IP4A 1JVOA 2H9GA 4RIRA 4QLWA 5EORH 4NQCB 3LX9A 5IJVB 4DOHE 3BZ4B 1JZIA 2VDNL 4NN7C 1XF3A 4F58H 4P46D 1KZQA 5TE4L 3QORB 3RDTA 1V5JA 1AXTL 2DZEA 1PQZB 2LABA 1ES0A 4A63A 2WBWB 5E99H 4R2GD 3UO1L 2IAAC 5ABAA 4BCYA 1TTAA 1E9OA 4GUCA 3HFFA 5HHMB 4ENED 1QQDB 4G6KL 1QA9B 3K91A 3WE6A 2P28B 2YAOA 4ZFZA 3EBAA 3QZOA 1UWGH 3WENA 5F7UA 1F3RB 5EG6C 4B96A 2AK1H 2KDGA 3WV0A 1W8NA 5GGUB 2WB1A 4JQIL 2V2XB 1XF1A 2DQJL 2VUKA 1SQMA 1JFQH 3LPWA 2C9VA 4Y5XB 1P6FA 4OZHA 2DYRB 4HUUA 2YD8A 1RVFL 4NO0A 2HKHL 4NQXB 2GUYA 4PP2B 2XLLA 1U58B 2BH0A 3RWFA 4YDVB 4M1CD 5DJ2B 1GZHC 1UQSB 4WZ9A 1ZT4B 4OZFG 1MFAH 1WAAF 3QEQA 2VO5A 1DFXA 3FUEA 2ZG3A 1X6LA 3EJYD 4IM8A 5CMAB 1G9NL 4AX3A 2ZUQC 4X4YB 4XX5A 3PDDA 4PGDA 4W9HC 1PL3A 3N1GC 2OQJB 1FO0A 2BNQE 1A21A 1NIAA 1KJVA 2DLTA 2I07B 2VQ1B 1OTSC 4HUKB 4FULA 4QRBA 2BW4A 1WAPA 2QVIA 3P0GB 2J56A 3S5LA 2OJZL 2GK0B 1J9QA 3GK8L 1NEZG 2EE2A 1UKTA 2HFFA 4ODVL 1XF4A 3G6JB 4H0HB 4PJDB 4TQPA 4AKQA 5KG9B 1GGCH 1CLYL 4FQQA 4DTGH 1K8IB 4OH2A 1HCFX 2GSIA 2VC2B 2ZAGA 4QHLA 1BVOA 1BZQK 5CUSL 2YUXA 2G4GA 3HI1B 4JHWL 2JJTA 2QFPA 5EORL 5FCUL 4LCWE 4HBCH 5INDA 1JWMA 5KYXA 3CUPB 4GSUA 4ELKA 1FNFA 2AK4A 3LV3B 5MENA 3CPLA 4JS7A 4LHJB 3GMPB 3MA7B 3SCMA 2H2SD 3OX8A 4FA8A 2PWHA 1M53A 2ZUSA 3RKDD 2KT6A 3QZLA 3UL4A 4D9RD 4ESKA 1PAMA 4H88L 4Z7VA 2B59B 3TJEH 2YPKA 3BYTA 1S9VB 4DNLA 1FCCA 2FX9H 4MJID 1U3HB 3IDIA 1JDDA 2A6DA 4FXGB 1HL9A 1EXUB 4BCZA 3QWRD 1QHQA 1KUMA 2VAAB 2XJLA 3LZNA 1U95B 1EJOH 3IMSA 4OFKA 5GSRB 3P3RA 4Z3GA 3MLRH 4G8GE 2F74A 1VF5C 2YEZA 1JZ3A 1XGRA 2VRQA 2DMBA 2CO7B 3BKCL 1GS8A 4GY4A 4P2CG 3CSYB 4MD4A 4NKQB 4POZC 4I13B 4GFTB 1J1XL 5B38A 4U1MA 1MQ8A 4QXTB 4OIIH 4P9HH 4UQ2B 5AVXB 5B3NA 4XPBL 1JNNL 1AGCB 1U3HD 1XAUA 2WYZA 3ABKB 1UHVA 2H32H 3C5ZC 3D0LA 3ZKMC 3KYKH 4ZMOA 2VIRA 1QZNA 4MD5A 2ZX6A 2J8UA 4FABH 3RI5K 1C5DA 3EYVA 8FABA 2CGYA 4BFEA 1CYWA 3DKHA 1RP9A 3UZVB 2EE0A 3B2MA 4O51A 2GBTA 3GLDA 2D7NA 2PCYA 3DMMD 1QFWM 1ZEAH 3PDOB 1JGDB 2JXMB 4EN3D 3OAZK 3I6KA 2HVKA 2MCG1 1EFXA 3VFPB 1Z6JT 5BZWA 2QSVA 3MJ8B 4JRYE 2HRPH 1U8PA 3BLKA 4Q9BA 1PG7H 4X0KB 3IS1X 3BVDB 4LHUG 4WHDA 5HDBF 1M56B 5GS0H 2JKTM 4AGQA 4HQQL 1T80A 2QQLH 2X6UA 4JO1L 2ZUTA 5IUCA 2ZAIA 3QI9B 2D31A 5D7LD 2FWLB 1LK3L 3O9WA 4MTMA 3RU8H 3F00A 2XG4A 5E8PA 1QRKA 4ANWA 5DRXB 3VXOB 7TAAA 2WXQA 1UACL 1JXDA 2NXYC 2WMPB 2NY6C 2VDPL 1SBSL 5CS7A 4AGLA 5E8EB 1YY8A 4NP4H 2G3NA 1J12A 5JQ6L 5C0JA 2F18A 1TJHL 1K4DB 3LRHA 4PJHA 3MXVL 2CDFB 5J3HD 4MYWB 5FV1L 4DSYA 4PJEB 1EO8L 4W9EC 3ZMRA 5BO1H 5I26A 2W0FB 1DQQB 2XICA 1M4KA 2F54E 3UZEA 2YAMA 4YHIB 4Y5YB 3SD2A 4KRLB 2HH0H 5EBMA 1MJJA 1KXHA 2J21A 1I8MB 4WLCA 1ESOA 1VRSA 3MR9A 2IDQA 2P7TB 3ARGA 2WBJB 3QRLA 3KS0J 2IPUG 1PZAA 2DKUA 1I4FA 1TZIB 4MAYC 3OC8A 5FFOA 3K80A 4ZMLA 3GINA 1CXFA 1ZHNB 2O6DA 5D1ZI 2UXFA 4U49A 4NZJA 1ZA6B 1T5XB 5AVVB 4G80B 2VJXA 4XXDB 2CK2A 3HMXL 1E50A 1VFBA 3H9HB 3N42B 1X5HA 2OR9H 1G7JA 1DDHA 1U93B 1SEBB 3S37H 1N9PA 2B2XL 1E9PB 1EVTC 4AVJA 3MKKA 1QW9A 5T1DH 3GBEA 2FZ3B 3QJZA 1JTOA 2Q8BH 2Y9RT 4LNRB 3UPRA 5IVZB 3WUWG 1QZ1A 4G1EA 2XQ0A 5I16A 3UYOD 4OCXL 5G55A 2IAMC 4HALA 1BEYH 1A8JH 4YBQC 2X2IA 4HPHA 5ANMB 2OTUA 3F3HA 4JFZH 5JHLH 1BAFL 4FF9A 2JKLA 1QBBA 4LCCA 3MV9A 4M7ZB 2GK2A 2AP2A 1Q1JL 3LSOB 1DQKA 2R27A 2GC4C 2IO5A 5DTFB 2C1OB 3PABB 3WMPA 1WBXA 3D09A 1GW0A 4NJ9L 3TM6A 1Y6KR 2FX8H 2ZXDA 2XZZA 1C08B 1JXGA 4NKDB 1X5IA 4D3CL 4UV7H 1PCXA 1G7MB 2KC0A 1EJOL 4PJ8C 1WHPA 4PJXB 3WO3B 2EICA 3N9GH 2G30A 4WEUD 3RG1C 3W9EB 2Q8BL 2HVBA 2QDVA 3IAGC 1XCQA 2BSRB 2VXQA 3T04D 5FYJU 4UWQB 4M5ZH 4OQTA 3WLBB 2EYSB 1LE9B 4Q6IA 4WNJA 1IM3B 3L8QA 3QG6B 3T4AB 5EU7C 4KKRA 3OKNB 5FYKL 2UZYA 5E94B 2X4SA 3ME0B 5FAAA 2FATH 3MV8E 2FLMA 3RRQA 1JI1A 3L9YA 3A6CH 4P46C 3QIBB 4A2HA 1J5OL 1KIPB 1ZVSA 2BIPA 5E6SB 4JDTH 4L1TA 2YSSB 1IGTA 3BH8A 3CFCL 4NRYA 1T03H 3HNSH 2ZOOA 4XVSH 1A9EA 4RZCB 2NDGA 4P57B 1F90H 1A7RH 1IAMA 4NOFA 2C4FU 1KEGL 1N0LA 2IWGA 1QEXA 5A2AA 3HI6H 5KVEL 4W9KC 2CIKB 5FYKD 2CO6B 1OD7A 3GSXA 4R4FL 1XL4A 3FFCE 2H3NA 3ZJAA 3FZUC 4XMKH 1GL4B 2BVQA 3TBYA 4X99A 3VFVA 4JDEA 2YN3A 4Z7WA 4ZAKC 4X7DC 1E6JL 4AZ8B 5GRVK 3BZEB 3KLAB 4JN2A 4WI9A 3WHXB 1FL3A 2DYSB 3HBGA 3IJEA 3V6FB 2UY7B 2TRYA 4CW1B 4JFHD 3OTTA 4DIXA 1U8IA 5IQLA 2KQMA 5I76B 2LOEA 3UJTL 2J72A 4MCYA 4CGUB 1UOKA 2K6WA 2YAEA 2AQPA 3JBG7 3QISA 3IGUA 4G11A 4NO0D 4DKTA 3Q06A 2H2PD 3RY6C 1OQXA 1EQWA 1ZMYA 3PHAA 1QSFB 2A2QT 3CVHB 5EIIG 3NMEA 1R9FA 3UIZA 4Y8DC 1OF2B 5IM7B 5GGUA 5AB1A 2E7LA 1GTNA 3QYMA 1E27B 1EIBA 4BA0A 5CJ5A 2WBXA 1QBML 2ICEA 3WHE0 4XXWA 5F9JB 3EJZC 4HXBH 4JM4L 5IT2H 1FFOA 1BPLB 2X1WL 3DSFL 4IIZA 2DMGA 4TQ8A 2B8OT 2WUCL 1NCDL 4ES9A 1L4IA 4X7SL 1TPXC 1F13A 2F8OA 1T7XA 3BAWA 3M8OH 3ZIYA 3ZTJG 5E7FA 5ESAA 4BFKA 3WNKA 3UBXI 2WZ6A 4DK5A 2L7UA 4QOKD 2C9UA 1NGXB 2P1YA 3CZKA 4NIYE 4CADB 1KLFA 3VX0A 1ZS8B 4AVHA 1DUZA 4XCNB 2Z1KA 3NH7L 3ZYZA 3O0RL 1UM6L 2C1PA 1IKNA 1PBYA 3S3JA 2DTMH 4Y5XA 5D7JD 5C0NC 1BFOA 5FIEA 1KJ3H 1AXTH 2NY2D 3Q05A 4PP1C 5F0LB 1B2WL 1MFMA 4U1JB 5G4NA 4YFLF 2WJ5A 3EO9H 4OY9A 2WQRA 2Y07L 3M1OA 2V4LA 1MHHA 4U1NA 3KPQB 5GGQL 3P4LA 1BZ7A 4JPIB 4MWFA 5HGDB 4X5WA 3ETBJ 1UEMA 1I4FB 3LRKA 4JPSA 3NCCB 2K9UA 4QCIA 3SGDI 5A7BA 1GAFL 3OG6B 1YJDC 4PJCF 4HPYH 2YZ1A 4LPXA 4WTQA 5C0AE 4X7SH 4XO4A 1DE4B 3GHBH 4PJFB 2VDKH 5AB9A 5IHWA 2NY3C 3BKJH 5ITFB 3UP6A 5IMLB 5JW4M 4R4NC 3LEXA 3CPLB 1KCSH 5AZEH 4L9LB 3BHBA 5FX3A 5K1JA 4TTGA 3VXNA 2RD0A 3UX9B 3QDGB 3JWOH 2AXGA 5JNYB 2ZQKA 1QSED 5LNEA 4LEOA 3VXUE 4DGYL 5JR1L 4DP2X 2H4EA 2X4OA 3NJIA 1NMBH 4YGVB 3QNYB 3PJLA 4B50A 1KPRB 3IJHB 4FFYH 1CD9B 4BFIA 2B39A 4G8IA 5C1MB 5KW9H 3IMRA 4JDVB 1UADC 2J6WA 4JKPH 1ACYL 3P0YL 3GLAA 4XP1H 4FTVB 4LFHG 4N8VA