2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
1QHQA 1BYPA 8PAZA 3IN0A 3OMIB 1GS7A 1PY0A 1SFHA 3T6ZA 3ABMB 1X9UA 1PCSA 3GDCA 3KW8A 1ZDQA 4A2DA 1PNCA 1SDDB 1J9RA 3QQXA 1IUZA 1RZPA 4GYBA 4JKNA 1KYAA 1AIZA 2YAHA 3FU8A 4AI7A 3EH3B 2FQEA 3H4HA 4E9QA 1W8EA 1JVOA 5I5IA 2E86A 1ETJA 1W6WA 1OE3A 2PLTA 2TSBA 3ASOB 5I6PA 1AS8A 3FQYA 1TKWA 2BP8B 4GXFA 1ASQA 4WTQA 2J5WA 1AR1B 3TASA 4AKOA 2DV6A 3DIVA 3UAAA 4PAZA 3WNJA 2H5UA 4A2FA 1GW0A 4K9JA 3CVDA 3MBWB 4BDVA 1MG2C 4YVNA 3QJVB 1IKOP 5I6MA 1NZRA 2B08A 3AG4B 3CVBA 3FPXA 3PAUA 3EH4B 4CSZA 1J9SA 1HFUA 3FU7A 2UX6A 3T6WA 2VSKB 5D4IA 1FWXA 2PPFA 1E30A 2TSAA 2FT7A 3ABKB 4HIPA 4E9VA 3U25A 1X9RA 1AZRA 4TXVB 1NTDA 1AZNA 3S3BB 2IWKA 2IAAC 1HAUA 2R7EA 1V55B 1GYCA 3FQ1A 4A2GA 2GC7C 3NJMA 5I6KA 4NAJA 2GIMA 4KNTA 1AANA 3CDZA 2PP8A 4G7RB 5IY5B 2YAPA 1CYWA 1GS6X 2VW6A 2H3XC 2BP0A 1JZFA 1XB3A 1WAEA 2VN3A 3EH5B 3QPKA 3PCYA 5LDUA 1F56A 1TU2A 3AG3B 1B3IA 1CYXA 1QLEB 1A4CA 3AW5A 1XMEB 2IDTA 1SHXA 4M3HA 2XU9A 2I7OA 2FJSA 2I7SA 3NJLA 1KCWA 4DPBX 1OCCB 3DTUB 1BQRA 2JFCA 1BYOA 2N0MA 7PCYA 2FT8A 4G71B 3X1BA 3X2QB 2CBPA 4JHUA 4E9YA 1ASPA 3WNIA 3TBCA 3GXUB 4Q8BA 1L9RA 4HCFA 3BVDB 5I5MA 3UABA 1JXGA 1I53A 1GSKA 1OF0A 1V10A 2GI0A 2VMJA 3NJIA 2BZ7A 1JXFA 5B7EA 2BZCA 1SNRA 2IDSA 2MRYA 3PAZA 1RZQA 1SDDA 2XLLA 3SBPA 2YAFA 1A8ZA 2PP7A 2XV0A 3NSCA 1BQKA 2YAOA 3NSDA 4GP5B 3SBRA 2Y69B 1OE1A 2CUAA 2HX8A 4E9WA 4AX3A 2X88A 2UXFA 2A3TA 5AZUA 2VSMB 1KDIA 2IDUA 3CZUB 1OE2A 4KOBA 1BXUA 1GY1A 2JKWA 3HEIB 4DP7X 1OCOB 2BP8A 2P80D 5AKRA 2EINB 4N4YB 3G5WA 4ENZA 1A65A 5I26A 3NP4A 2X87A 3HB3B 1AZCA 4F7KA 3ZDWA 4EF3A 5I6OA 1PZAA 2RACA 2AVFA 1PLBA 4KO7A 5PAZA 2HLEB 3TU6A 4MFHA 5I6LA 1ADWA 1L9PA 4YSCA 3SBQA 4KO6A 5AFAA 4YVUA 4QKTA 4G7QB 2HX9A 1ZDSA 3T9WA 2ZXWB 4DP1X 2YAMA 2QPDB 4DP5X 1J9TA 3GYRA 1JXDA 5I5JA 4HHGA 1DZ0A 3QJQB 4P5SA 3JT2A 1GY2A 2FNWA 2GC4C 1ET5A 4UF7C 4E9TA 1IC0A 1WA0X 4F2EA 1AG0A 4A2HA 2W88A 4YSOA 2FQFA 5D4JA 3FYIB 2BWDA 2VW4A 3PPSA 1PZCA 2BW5A 1NDTA 4WKXA 1KGYE 1SF5A 2WO2B 3IN2A 2EIKB 1ID2A 2PPDA 4GP8B 3H4FA 5F7AA 1ILUA 1EZLA 2IWFA 3ZX1A 3OQRA 4AKQA 1CC3A 5TK4A 1ET7A 1RKRA 3SQRA 3QJTB 1KCBA 3AZUA 4BXSV 3NT0A 3FSZA 3NJFA 3IEAA 3FPYA 2WSDA 2EILB 4QLWA 2BWIA 2JXMA 1ILSA 2HZHA 2DYSB 1AS6A 2ZONA 2Q9OA 2YXWA 1NPJA 2CAKA 4HCIA 2BW4A 2VM3A 1NIDA 4HCGA 2YARA 4RH4A 4GY4A 2EIJB 3QJRB 2OCCB 3NSYA 1BAWA 1MZZA 1TEGA 4KNUA 3UADA 3FU7B 4YSUA 3ERXA 3FS9A 1NWPA 3JTBA 3OMAB 4CSPA 5PCYA 2YQBA 1L9TA 2HRHA 2HXAA 3S8FB 2R7EB 5TK2A 1FA4A 3OM3B 3TBBA 2XV2A 4HZ1A 1JVLA 3WI9A 2PP9A 5I28A 3TA4D 4X4KA 2QDWA 3CDZB 3D12B 1XB8A 3L45A 3T71A 4YSEA 1OCZB 2UXGA 1A3ZA 3IBOA 2AANA 2QDVA 1GS8A 2IDFA 2VM4A 4YSPA 4AKPA 1PMYA 1N70A 1ZIAA 4G7SB 1JZIA 2OV0A 2PPEA 3KW7A 6PCYA 3FSVA 2IH8A 3EF4A 3PAVA 1UATA 2FT6A 3WG7B 1OV8A 1AACA 1SFDA 1PZBA 1GR7A 1SF3A 4HHWA 3WKPA 1NIFA 5B1JC 2QPEB 3MX0B 1PLCA 4YSSA 1CUOA 3X1EA 5D4HA 2P80A 5B1AB 4A67A 3AY2A 2CALA 3CG8A 2IWEA 1JOIA 2W8CA 3T6XA 1BEXA 1V54B 1AQ8A 3ZBMA 2XX1A 1SJMA 2AFNA 2XWZA 1PAZA 4P5RA 5EHFA 3ABLB 3NYKA 1AOZA 2XXFA 1HAWA 4G72B 5B7MA 1T5KA 1R1CA 2GBAA 3S3DB 3NJJA 1NPNA 2BO0A 5FC9A 1OOWA 1JZEA 4N8UA 3WKQA 1L9OA 1NIAA 2HRGA 1WA1X 2XV3A 4AZUA 2YAEA 4GP4B 4BWTA 1PLAA 4DP6X 3CVCA 1NICA 1ZV2A 4PCYA 1FFTB 4ZK8A 1NIEA 4FAAB 3NSFA 1IBYA 1WS8A 1ASOA 2UXTA 1NWOA 4BK5C 1M57B 2DWTA 1URIA 3UAEA 2MTAA 1OCRB 7PAZA 2J56A 4DP0X 3OMNB 3NP3A 3X1GA 5E9NA 4BWWA 1IBZA 4BWUA 2H47C 4G70B 9PCYA 2PPCA 2B3IA 2HX7A 1M56B 2IDQA 1ET8A 2PCFA 3N2JA 5ANHA 3X1NA 1E5ZA 3UACA 2DY2A 3PXLA 3FU9A 3T6VA 2EIMB 4YSQA 6PAZA 3ZIYA 3NJNA 4L0PB 3N55A 3FT0A 1E67A 1JERA 1SHWA 2NRDA 4Q89A 5B3SB 3NJHA 1N68A 1ZPUA 1ZIBA 2XYBA 4W9ZA 4A68A 2I85A 1TEFA 3AG2B 4KO5A 1JZHA 1YLBB 2GB2A 1L9QA 3IE9A 4DP2X 1XB6A 4DPAX 4DP9X 5I6NA 3DKHA 4A66A 3S8GB 1VLXA 2YXVA 2ZWNA 1KBWA 4YSDA 1NIBA 1WA2X 2QT6A 4BDVB 1DYZA 1A4AA 2LLNA 2OJ1A 4YSRA 4DPCX 4BXVA 4E9SA 1JZJA 4F2FA 2UX7A 1AG6A 3EHBB 4KNSA 3QJSB 1EHKB 3BQVA 2GHZA 2FTAA 1KBVA 2PPAA 1MG3C 1CURA 2YAQA 1KDJA 4UAHA 1NINA 2AZUA 1KV7A 2PCYA 4UANA 1QNIA 2IH9A 1AZBA 1J9QA 3S3CB 4JHVA 3WIAA 1RCYA 4E9XA 1MZYA 1W6LA 4M4RB 2DWSA 1AAJA 4KOCA 2BP0B 5B1BB 3NJKA 2VW7A 1PNDA 3UGEA 3FYEB 5B7FA 4W1TA 1J5DA 1E65A 2J55A 3ASNB 2ZOOA 3PLYA 5B1JA 4NB7A 2Q5BA 4FA7B 1MDAA 2CCWA 1WS7A 3V9EA 3V9CA 2WO3B 2GSMB 3AG1B 4DP4X 4A2EA 3OD3A 1PF3A 2XUWA 3ABGA 3FSAA 2FQDA 3H56A 1AZUA 4NERA 2UXVA 2DYRB 4HAKA 1E5YA 1A4BA 1L9SA 2AZAA 4YL4A 2XX0A 2XVBA 2FQGA 2Y1AA 1BQ5A 3FQ2A 4HALA 1BXVA 1JZGA 3X1FA 4YSAA 5B1KA 5F7BA 2J57A 5A7EA 2BHFA 2XXGA 1BXAA 2CJ3A 3QJUB 4E9RA 4DP8X 2FWLB 1M9WA 3C75A 3FSWA 4KO9A 4YSTA 1AS7A 3NJGA 3RYMA 1J5CA
chains in the Genus database with same CATH superfamily
8PAZA 3HZMA 2D3JA 2HRPL 3ARXA 3QJHB 3T3PF 3VSQA 1TZIA 2EIZA 3VNZA 2D9QB 1R5VA 1X5HA 4BQ9A 3CZFB 3J27A 3KVPA 4ZMPA 5IV2B 4A2DA 1AO7A 3HC2A 4UBDD 2DOCA 1KIUA 2F58L 2IPKA 4K5OA 1C12B 4C47A 2VISA 5KANI 1NDMB 2J44A 2PYEA 1W8EA 3BVVA 4HZAA 4KAQH 1HK6A 1G7LB 1ZHNB 4G5ZL 5DR5H 1K8DB 3WENA 4K9EH 5JIHA 2VXSL 3QUZD 4MZ2A 1XQ4A 4OH2A 3A24A 2K3TA 2TSBA 3ZL2A 3NZUA 4P5TD 5I73C 1J0YA 3QI9D 3AUVA 4HT1L 3NFSH 2WYHA 3ML9A 3O3EB 3R0NA 3AT8A 4NQDE 5J1AA 4WWID 1ZLSL 3NIFB 5EEXA 3RY5A 3ZE0B 4QRRB 2MEJB 2PN5A 3QDJB 4OCYH 2J1ZA 1WCBB 4KRPB 5BMFH 4RFEB 2X4OB 3KPMA 5FM5O 4P2RE 5HYQB 2ADJB 3BQUA 3X13A 3O3UN 1A3LH 2DDQH 3O3DA 1RJZB 1GC1C 1Y1UA 3HNVL 3L4XA 1NSNL 1RZIB 2LVCA 4N9GA 4WO4D 4XBPB 4XN2A 1F00I 2X4RA 4OJCA 4NZUH 2HN7B 4LCWD 1IM9D 1FNSL 2VSKB 3FCSB 5IF0B 4C58B 1AFVL 1G9ML 1BSIA 3QB7C 3PY9A 1UXLA 4GSDH 5D2LA 4Z76A 1HHGA 5L8KB 3ZTEA 1TQSA 3QORA 1ACZA 3A4EA 1IVLA 4M1GL 2H1LM 5AL0A 5DVOA 2ZWKA 2NY5L 3EG9B 2R69H 3UG4A 1AIFB 1MRDH 1X6NA 3DX0A 4L4VB 5EPMA 4OD3H 1N67A 2C5DC 1A66A 1KGXA 1FQ9C 1KTDB 3R06B 4ORGB 2BNRA 3PQYB 5LDUA 2F54B 4KDWA 4CVUA 1OXYA 2VAJA 1EHAA 2IPUK 2R1XA 5KTEH 3ZU8A 5CGYC 4X7DC 4L8DB 3NMEA 1FSKB 3OGCA 4H8WL 4XNAA 4HKXB 1CFVH 4N8PA 3UBXA 5I0ZA 3UTSB 2L7EA 4X9BA 5HVGB 4Y19D 3X11A 1G7JB 4DPBX 1EA9C 2XVLA 2DIAA 5C0ND 4XAWH 2A9MH 4FFYL 2P5WA 5E0FA 4MJIE 3BAJA 3IGUA 5I1EH 2WXRA 4IRZL 3O6LL 4JO3L 3VAEA 4D9RD 3V52L 4DQOL 1OTSC 2BFGA 4QAWA 1XH3A 1ASPA 1L6XA 3K2MC 2P52A 3GXMA 1IKNA 3T2QA 2CA3A 1WVZA 1F4AA 4Z7QB 2XOTA 3MACL 3E9UA 5JA8B 2VE6B 4P9ML 3BVDB 5E6IB 1GPOL 2NX5A 4XH2A 2FR4A 5DRZA 4CVZB 5B39A 2VDPB 3RHWF 1KCVL 4O51A 1CQKA 4HLEA 1OVZA 1VCAA 2G75B 4Y7MA 3TV3H 4FZEL 2QKIC 2WM0A 2YPVA 3MA9H 4PY7B 4WI5A 1N19A 3WLBB 3M8OH 3BP6B 1JGUL 2F7PA 3PIQA 1MCIA 1BVKB 3F7QA 4QNPE 3DBXB 4BK5A 2HX8A 1OZTG 2OMZB 2VSMB 2YJLA 4FQXB 4Y16A 1TJHL 2VDRH 2KZKA 3CZUB 3N1FC 4J12A 4XC1L 4OIFA 1QI4A 4X0KB 3ME0B 1GY1A 4PJCE 2R2EB 5FO8A 1EHNA 1OSZB 2EDWA 4MJ2A 5IHUL 3QQDA 4F9PA 1A65A 3L5WA 3FN9A 3MYZA 4RGMC 4YHNB 2J4WH 5C0BE 1I4FA 1W72A 3K8KA 4N90E 3ZDWA 2VO5A 2QGDA 5HPOA 4NQSB 1PZ3A 4FI8A 5I19L 4EIUA 1HHHB 4QRAA 3APFA 1KELH 3EYQD 3OKEA 1FLRH 4J3VA 5I30H 1HH6B 2VR3A 3QDGA 2KYIA 3IMUA 4WSKA 3SBWA 3MUY1 1WBXB 3LRKA 5EV7A 1EXHA 3SDDC 2I25N 1R6VA 2ZXWB 3C5JB 4DP5X 3ARZA 5H2BA 4LLDB 1J9TA 2EVIA 3HI1B 1DVFB 1M71A 3CVHL 3GTNA 5MEPB 3PHOB 4TVPL 2XC8A 1CDYA 3OR6B 4AEFA 1I3GL 1BG1A 1GC1H 1FJ1B 1SMAA 3G08A 3QWOA 3NCFB 3C5SA 1I8LA 1ONQA 3VQ2C 4A2HA 4DERA 4FCHA 3SE9L 5BW7A 3ROLB 1AGEB 1Q0YH 1I1YA 3DUUA 4O58H 2NY0D 4B41A 1YEGH 2WXLA 3B2UD 1KGYE 1A3QA 1ID2A 3ES6B 1KGUA 2NQ3A 3EDFA 4L1BA 3RWFA 3OB8A 1TJIH 4PRPE 2J88H 1UD2A 3ARDC 3NFNB 2O6DA 4KK8C 3FSZA 2CJUL 4FNPA 4PEEA 4OZGA 2NCEA 5I8EA 4GQ9H 5IG7A 3LKOA 2E4FA 4LO9A 1G7QA 4EBQH 1T22B 2NNRA 5IBUG 4WTWA 1G43A 2OMVA 5HDBF 1EGJL 2KC0A 4LRNH 2X6UA 4JDEB 4X6DE 5FPIA 3U0TA 2AXJA 1BVZA 2CLRB 3F58L 1HCYA 1E40A 4WDIB 5E99H 4QXGH 5CU5A 1X7QB 1YJDH 3LZFL 4GY4A 5I1CH 3TNNB 3VXRA 1EEZB 4LK4A 1F6AA 5CO1A 2XTJB 3CGTA 1MRCL 2RIKA 5CUSL 3KXFD 3P2DA 4OD1H 3VD5A 1NWPA 3MRLB 2WAQA 1NUGA 3E2HB 5C07E 4PFEA 4H0LC 3ARWA 4NN6C 4Y4FA 1KCKA 1MJ7H 2OZ4L 5HYJA 2A6KA 5BRPA 3ISRA 2ZT9C 4NIYE 3OC8A 3CSFA 3HUJE 1G94A 4N2IA 1E8ZA 3VRIB 2VR9A 1IV8A 1JF5A 1T1WA 1MI5B 1F11A 2H2PD 2XXCB 1QSFE 3M1BA 3AMLA 4QRTA 2B2XH 3BPLC 4JO1H 5D7LA 4FQLH 4CN1A 4ORZC 4HDIB 1ORQB 5AOLA 2ZZUT 1KEMH 4WO0A 2AV1B 4N0UB 3UL4A 2N7AA 4XP5H 4QLRA 4R8WH 5E6YA 1TNNA 3SD5A 4P0DA 3L9YA 5C0AE 4PWGA 4ZG1A 4HUVB 2Z4TA 4NWUL 5DEGB 4O2EB 1FL6A 1ORSB 4FQ1H 2EDOA 4ZFQA 4NZFA 2AQ3A 5DO2D 2C1OA 4ODVL 5KJRH 4OQTA 2ITDB 4LEXL 1KJ2A 1SMDA 2QPEB 4AIZB 1KLFA 1SBBA 3O9WA 1E27B 4XRCB 1YEJH 3FU6A 2A1WH 2HFFA 5B1AB 3B6SB 4EUPH 2IWEA 1NAML 4APQC 2Q3AA 3FT3A 1UACL 2B4CH 7CGTA 5IVXF 2NY6C 2Q6WA 2BNUA 1HNGA 4X8JA 5CEZE 1XV8A 4P46B 3HG2A 3BAKA 2N3JA 2ZCKL 4HUXA 3NYKA 1F6LL 4FQJL 5EC1B 5DJ2A 1L9NA 4V1DB 1ZT1A 4PS3A 5I1IH 4L0YA 3WKQA 4EI6B 3DHJA 4G83A 2RFXB 3IDGB 5F3BB 2DJSA 4ZX4A 4KDTC 3D3VE 1ZV2A 1FFTB 3K0WA 3UFIA 1MXDA 2N56A 1MH5B 4G9DB 3NSFA 3LXCA 3TFBA 2Y1YA 3QWRA 3SGKC 4HIJA 3R8QA 2W9DH 1LGVA 1F3JB 4XX5A 2ZKMX 5KAQG 1QFWM 4NPYB 5ID0A 4JY4B 2IANE 1OTUD 1TJXA 2K8MA 3KLAA 3PV7A 5DJ8B 5LXGH 1WRFA 5IT2H 5ECGA 5F88B 1B88A 3H42H 3FU9A 3PXLA 1VEMA 4PJIE 5E4EB 5F7WC 5F9WB 1ZA3A 3AMKA 1MFDH 3B8SA 3LHAA 3MNWA 3KNBB 4NO5A 4M8QA 2NZ9C 5C9JB 1RUAH 1U8KB 1DBJL 3G6JA 2X6VA 1G6RL 3LKRB 3NRQA 3VFUB 1DVSA 3KPSE 2X2IA 4U6VH 4DWHA 4DVBB 4ANUA 1PIFA 3T2NL 5JORA 4ZFZA 3D39D 4KHXH 3VGAC 3LPGA 2GB2A 1UD3A 4ODWB 3UTQB 4P4KA 1D5XB 4PMFA 3WNPA 5K93A 4MXWL 4UM8A 5EU4A 4FCAA 2WD0A 1OALA 3ARFA 2WZPD 4YSRA 4ERSH 3CLFH 4NLAA 2LV4A 2HLFD 4RRPG 5C2UB 4Y5YC 4G6AC 3EHBB 4S1DC 2Y06H 1A7BA 3JZ7A 3O4LD 4O2FB 1UD4A 5F9OL 1P2CB 3QIUD 5BZZA 2RALA 1QSZA 1QSEA 1N26A 3PFUA 5EBWB 5F96H 3LNFA 3U0WL 3KJ6H 1K3ZA 1MQKH 4MCZA 4MWFB 3CN1A 4J23A 4NEHB 3SGJA 5AVTB 4LASH 3FQNB 1AGFB 1JTPA 3C08H 2H6PB 2WYZA 3UX9B 3QG7L 5IB2A 1SBSL 3IE4A 2Y4SA 3IETB 4LVNC 2IH9A 1MCOL 2F6AA 3ZDZB 2IC2A 3V2AR 3NGBC 5GGTH 3W9DA 1H5BA 1C1EL 4X6FA 4B50A 2V2XA 3NJKA 2MCPH 2QR0B 4OZIF 2EYSB 3WFHA 3EYOA 1OAUL 2IGFL 4U6HB 3OJ2C 1UOLA 4FX5A 1JGVL 5INDA 2QBWA 5B21A 4JFQB 1S7QB 1MDAA 4XVUD 3OR7A 5DD1L 2EO1A 4PJ5D 1NGPL 4OVVA 4MJ5B 2AJSH 3VRLF 4DFHA 4V33A 1EMTL 3V4VB 4DF9A 1V3LA 5MP6H 1MNUH 3H56A 5D6CA 3FTYA 4IU2A 5DYOA 3SKMB 5CCJA 2RJMA 5D2NE 2NY4B 3NIDE 5IB4B 4K55A 1T5WA 5FS5A 5D96C 3FFCE 3Q9PA 4PRBB 4Q6IA 2VNCA 3NVQA 1JZGA 1XGZA 4UQCA 4YDNA 4C55A 1NANH 3DARA 2O72A 1PEZA 4Y4KC 3FUDA 4GKZA 4JPQA 2YRZA 4XBGA 1IEAA 5HHXL 1M9WA 3D0LA 2IAMB 4HK0A 2AGJH 1AS7A 2WN2A 1QI3A 4FZ8H 4R9HA 3ZKXC 4XCEA 5KVFE 3VXOA 5IGXL 1OAJA 2CO1A 3NPSB 1MPAL 5GSVA 2G5RA 3LKQA 4Z7NE 1TVDA 2YJQA 4ZOEA 2ED7A 4LCCB 3U7WL 5BUGA 1JNHB 2WIIA 4YBHA 3B3IB 4W9IC 2GBTA 3ZL4L 1K8IB 1ETZA 4IBLT 4AQ1C 2DPKA 3BMVA 1OHZA 1X6LA 3QJFA 4JFOA 5AKVA 1P7HL 2X70A 4GFTB 1MHCB 2AK4E 4OCXL 1HL5A 4ZSOA 4IMKC 1R3LA 4OIAA 4D7BA 4P3DB 4BSVA 3Q2CA 5DRNA 5CKAA 2BP8B 3CFQA 2EQDA 5HXMA 3QQNA 4F37K 2LTQC 4WWNA 1G0XA 1TPXB 1XH1A 3MJ9L 3BLPX 3UAAA 4HPOH 4F27A 1FVCA 1UXWB 4JRWA 4RETB 1XGYL 4XXCA 5EN2B 1DQMH 5FF6B 3F7VB 3WAJA 3WFBH 3UYRH 4YVNA 4AG4H 4M61A 1NEZG 5E1HB 4JN2A 1HKLH 4Z7WB 1D5BA 3FB5A 4TVPD 4J3OD 1J9SA 3O8XB 5DTFB 1HFUA 5HPMA 2UX6A 4LF3A 2PPFA 4XXDA 2ODIA 1PX8A 2YEZA 3CXHJ 5F7MC 1RZJH 3SO3C 3U9UB 3NIFE 4PI2A 4GFXA 3IVKB 2R29A 2VH5L 3BVNA 3S3BB 4OLEA 4QRRE 4C4KT 4HIQA 1HI6B 1R9FA 3QDJE 1JNLL 5TDPB 4P3CH 4M48L 3A23A 5LUMA 2J1XA 3NAAH 4BFGA 4WCYH 1F4HA 5HHVH 5DI8A 3QUMH 2WLJA 32C2B 4OUOA 2Q86B 1VZHA 3FCGA 4A6YL 3V6FA 1WTLA 3OJMB 3RE0A 3SO5A 1V7ML 2WJ5A 1UH3A 2EEXA 2Z9TA 4P5KB 4WY7L 3CZNA 4FJZA 1F56A 2FO8A 3HC4L 3L3KB 5HSFA 2E46A 3IKKA 4GAAA 3GSUB 4MD5A 1DQJB 1NCTA 4FHJA 3FTVA 1JL8A 5ID1A 4UM9B 1G7MA 3GKWH 1A7QH 2M8XA 2DQJH 1X7TA 5DEFA 1FVEB 4JN1L 4W6WB 4JB9H 4Y5VA 3S5LA 1G1KA 5FKAA 5EU5B 4ADIA 1G5AA 1BQRA 3CDYA 1FC2D 2ZWSA 2B5IC 3FTUA 2EDKA 3PQYE 3QUYA 7PCYA 1TEYA 3OL2A 4IOSA 2HT4D 2MOVA 1MSPA 1UWGH 4FEMA 1BHGA 1SXBA 4WI2A 4ELME 1HJCA 4PJ9A 3L95A 1S7RA 2ZG1A 3FJTA 2GSGB 3P9LA 2AQRA 4XR8C 3W39B 2GT9B 2ZUSA 1W8NA 5I1HL 3MNZB 3GXUB 1YEKH 2WSKA 3UTSE 1OPGH 1CT8A 3QG6B 5FOJA 5D6DA 3RVWC 2O5NA 3CHOA 4DK3A 2OQJA 1OF0A 3RWCA 3VFMB 4DVRH 3ZKSD 3HE6C 3Q43A 1IGFH 3EOTL 4YLCA 4BQ8A 4FXKB 4C56A 3AAZB 3P1VA 1YEHH 2CJTA 1BJ8A 3NSDA 3PDOB 5HHOA 3GMRA 3QCTH 4GBXD 1O0VA 4BE5A 4Z7QE 1KC5L 1RUML 1U21A 3EDEA 4XI5C 1AQHA 2DTSA 4ZZKA 2BY1A 1H9DA 1PLGH 4P9HH 1GTFA 4X9HA 5LDSA 3OKNB 5A43C 1RIUH 4IIQA 3UCQA 4CW1B 1GSMA 1IGIH 2R23B 4IKKA 3P77A 5I26A 1RVFL 2P8PB 5D1QC 3GK8L 1ULVA 3HHSA 2C26A 4O2CA 3HB3C 3LQAL 3KWUA 3GMNB 4LHUG 2Y7LA 3Q0HA 2ZYHA 5J6HB 4YH6A 4W6XB 3UJIL 4YBQC 2WOBA 3BWAB 1L9PA 2NTFB 3OXRA 4U6XB 1LHZA 2GTWA 5LAXB 2HKFL 1T6WA 4A63A 4C4BA 4A2LA 3TA3D 2BCMA 4PVBA 3PWUA 1IC1A 4JDZA 3IFNL 4HK3J 4AW4A 2R4RL 2AJVL 2ZD0A 4PVNA 3IF1A 3W11C 4Q0XL 3W9EB 2VDOL 2VJXA 3MV9B 2ZWLT 4JUSA 4FXGB 5EUKB 3U9PH 3ILPB 4XMLH 3SN6N 1RZKL 2WMPA 5HDQH 5F89A 4PBWD 3SE8H 1F8TL 1MNNA 5HY9A 3MCLH 4Z7VA 4JFFD 1NEPA 5DK2B 2DM3A 4LSTL 1MDTA 5JIMA 4NKOA 1QPPA 3ZZ1A 2ZCLL 1NGQH 3GO1L 4BGLA 1X5YA 1SOQA 4HWBL 5DFTA 3MRNA 4I1RA 3V6OA 5KSAB 2JKNA 2XKSA 3VU1A 2C9UA 3MXVL 4JVUA 1PTZA 2VCOA 2Y2TA 3ARGA 3CVIH 3VX0A 4F2MB 2VITA 2ZONA 2EDNA 4KROD 1S9WA 1ES0B 4OJFH 4GEIA 2AQ1A 4ZMYA 1DQQA 1XTLA 1KIQB 4ELKB 2CCVA 1IC7H 4DW2L 4HCGA 3VGEA 3RDTC 1G0DA 2X12A 4L8BB 3ZDXB 3QJRB 4XMPH 3NSYA 4ZTPL 2CKBH 3HFMH 5AL8A 5E9DE 1ZVSA 3BD4A 3UTZB 4NJ9H 4YSUA 4OD2A 3SQOL 1U91B 1X5IA 3O0RL 4NKMB 2VRAA 3IMVA 1G6VK 3QNYB 4WK2B 3J8F7 1EANA 3OXSA 3FN0L 2KERA 3VFRB 4OAWB 1UM4H 1XGTB 4IKIA 3QEQD 4YGVA 1KJMA 4KVNL 4DH2A 1UOKA 1A5FL 1H3UA 3CXDL 4TTDC 4WUUD 4L05A 4X9GA 3KYMA 5CNHA 4HZ1A 5E8DL 3TBBA 3TH4T 4QYOA 5I28A 2ROYA 2ZOLA 3GZQA 5IROC 4WI3A 2XTJE 2PCPA 3ATBA 2QHRL 1EWHA 2YPKB 4U1IB 1P6FA 4NM8L 2IDFA 4Y2OA 4W9KC 4PM1A 4L4TD 1S7XA 4Q9BA 4RMWA 3TIEA 4EUPG 2R4SH 3Q3GA 2HMIC 4GAFB 3GMMB 4M5ZH 3FSVA 4RAUB 5BS0B 4JR9L 1MI5E 2EUZA 1XAUA 4WJ5A 1S3KH 1MRFL 1WHOA 2X4PB 3QIWC 4Y88A 4H5SA 4RAHA 3VGDA 1FZKB 2A74A 4EZKA 5FEBA 4YPGB 1Q38A 1XGUB 4CC4A 3QISA 3T09A 1VFOA 2DMKA 1TCRB 5C08E 2WB1A 2V2TA 4M8RA 4A67A 2WYIA 4BZ2L 1IMHC 4BSJA 1JD7A 1NKOA 1DUZB 1HZHH 5T5FA 1R3JB 1T2JA 3QS3A 4RA3A 2F19H 5LQBH 4PB0H 5T33H 4D9QE 4C83B 3S8WA 5D7IF 3QZLA 5F1NB 2VXVL 1LE5B 5E5RB 3RKDC 2WQXA 4KTEH 2VB5A 3FC8A 3DOSB 3DVNA 3L3OB 4XPGH 5GJTL 2UZYB 3UC0H 3WMQA 3U1SH 3HOGA 4PRDB 1OGAE 2P4AB 3DGDA 1GHFL 3T0ED 3EYUH 2YPLA 3GQFA 4NOBA 2F2HA 2XN9A 4UUJA 2E7DA 5HHMD 1ICTA 4Y1AB 4ZK8A 3IBEA 1ZSHA 4HIIA 2DD8L 3QR1A 1NWOA 4AC4A 3MRQA 3L81A 4GSUA 1KEGH 2R2BA 1YDPA 3HZMB 2G2RA 3FXIC 3PP4H 3DX9A 4TLSA 4K23H 4DP0X 2EIZB 5JPMB 4S0HA 1FYHB 1R5VB 3KLLA 2J8UF 4YDLB 4PR5B 3F84A 1AO7B 1EEQA 1U8QA 1KIUB 2IPKB 3IRPX 3TLRA 3E6FB 4J8RA 1BOGA 5C6PB 1QUPA 4I88A 2DQFB 3WXVH 1HC1A 6PAZA 1EFXA 2ZWYA 5GGSB 3SJVA 4KV5F 1LD9A 1E67A 5ETUA 5HD8D 3WS3A 1P6AB 1KPVA 3NJHA 4ZO9A 3BVWA 1U8PA 5EN3A 1I8KA 1N0XH 3PREA 1F4WL 2EH8H 3OWRA 1YUHA 2WLZA 3POHA 5K39B 3NJVA 3U0PA 2YEVB 5CILH 1K4DB 1KG0A 1U0QA 3H3KA 2AEPL 5F9JA 4ZUVA 1T0NA 1YEEL 3LEXA 1T6BX 1KLGB 3VD3A 1INDL 1XCWA 1OANA 1KBWA 4J3WA 2QT6A 3KPMB 5IVXA 5D93B 2VUKA 1QUNB 2Y5TB 1QOKA 3WO3B 4A7GF 1E4WH 4EPSA 2UX7A 3NUKA 3MBED 3BZFA 5HI3C 5DRXB 3QZWB 2VABB 3V5DA 2WUCL 4G6FB 2FBRA 3L3DA 1U8IB 1L3NA 2DQUL 3LH8A 1RIVL 3N43B 3OX8A 2WKOA 3EO9L 4TVSa 5BVJA 3TVMD 5L2KA 1NINA 1BBJA 3SDYH 4ENED 2H0FA 3AS0A 4KDVA 3KVQA 4UQ9A 3Q2WA 1W0WB 4JHVA 5DT1L 4HOXA 5EPMB 1RJCA 3F5WA 3UTTA 3RLSA 4LCIL 3BGAA 1BV8A 4IHOA 5C7ZA 5D2NC 3BT0A 4DKAA 1JZ5A 1EXUB 3DIDA 2BNRB 3JV0A 5DZVA 3MZGB 4PIBA 5CEZH 1XH2A 2XPYA 2HTKD 3TCXA 1CG9B 4W9HC 1IEBA 1I8MB 2EACA 5LCVH 4NZRL 2OZNA 3BD5A 1Z9LA 3ZK0A 3GSQA 2XICA 3KG5A 3KPRE 2NXYB 4R7VA 4Z1PA 2WTRB 2CHDA 5IQ7L 3T0VA 1VFBA 3VXNA 2AEIT 1U8LA 2Z91B 5FA4B 1NCGA 3TWCL 3LZLA 3ZR6A 4WUKL 1P5UB 4N9OB 1B3JA 5SWZD 4XNMA 2NSQA 3NPZB 1E9QA 2CKNA 1BBDL 3QJXA 4TUOA 3FT4B 5A7EA 5E00B 5JYLA 1ID5I 2CJ3A 4HCRA 3DHUA 3ETSA 5FK9B 1M05A 1BJMA 1KGCE 4YHIB 3FSWA 1S7TA 2OP4L 3NJGA 2NX5B 4JRYD 4XH2B 4ODUB 5DVMA 1J0JA 4HWZA 1A7RL 1BWWA 4RDBA 5CJQH 2FR4B 5B39B 4HHAA 3MRCA 4GIAA 3FDWA 3PWPB 3K72A 2WYTA 2O6CA 3ZQWA 1XL6A 2ADGA 1BMWA 1ZDQA 3TBVB 4AMKH 4FI7A 4XGZA 2XV6B 2ZYRA 3F6LA 4JG0L 5JQ6H 3L13A 3ATFA 3PGDA 3DK2A 2P5PA 3PIQB 4G6KL 1E4XI 3Q7JA 4S1SL 4BCXA 4F8TA 3DROB 2VXTL 1YMME 4OR1A 2Z8RA 4AEIH 1F0LA 4WHDA 2XQBL 5FGSA 4X4ME 3Q8FA 1I1FB 4OZIA 1DL7L 4Z6AT 4MS6A 3T4YB 3MLPA 1SJEA 5T1LA 1G7PB 3OLGA 3LN4A 4TV3A 3EFFA 1BAFL 2RBLA 4B9ZA 1I4FB 3WNJA 4JPKH 4OCSL 1YEFL 1RZFL 4KRPC 3MODH 2OLDA 3P11L 1OAYL 4NNPL 1SJHB 1TVHA 4BDVA 1MVUB 4IRJD 2ZAIA 5I6MA 4JCMA 3BPCB 1TZGL 4R84A 2D7TL 3RGHA 5F6IB 2QVKA 1C5DA 5DQ9A 3UXFA 1LDPL 3QFJE 3BIKA 1RU9L 3ZKMD 4PGZA 2JELH 4B5ZA 4AH2A 3OKDB 3RWGB 4GRMA 4KKBD 1T1YA 2Q1EA 3H9SA 3SOBL 2IWKA 4GUPA 3HI6H 5JHDD 3KM2A 1FNHA 2Y7MA 1E6JL 2A6DA 3X17A 3LN5B 1AVAA 2Z31B 4AW7A 5L88H 3C6SA 1ONQB 4NZDA 3CE1A 5TQ2L 3SZKC 4Y9CA 5I6KA 3CDZA 3ZL1A 4Z7WE 4BUGA 3DUUB 2YKKA 1OW0C 2VW6A 3TZVD 5DJDA 2NT1A 1RD6A 3FOMB 1T20B 2VN3A 3Q01A 3SYAA 2YLHA 1AXTL 3QPKA 2R8SH 2IFFH 3QK0A 3UAJA 4KUCD 4FQIL 3BN3B 4UMGA 3RWFB 4W9EC 5HTSA 2E7HA 1B3IA 1ZLWK 1CTNA 3Q1EA 4LU5H 4EN3D 1QLEB 3L5XH 4NHCL 1HZLA 3AW5A 3DUSA 4Y2DD 1T21A 2YRLA 3CFDA 5EMYA 2B1AH 1AE6L 3JYBA 1NBVH 2XU9A 3BUYA 4DCQB 1FSKC 5G5DA 5JW3L 1MWAA 3BC9A 1G7QB 4LP5A 3OWEA 2OSLA 4OF6A 1T89A 1FO0H 4AQOA 3L16A 1K5NA 2NSMA 3B2PA 3U0TB 3N04A 4NPJA 4Y9FA 5DLMH 4MMXB 1KCLA 1Y6NR 2C4FU 2J2ZB 4GW5B 3VXRB 4V11A 2MPAL 1Z9PA 1F6AB 2O1AA 2Q3XA 3IDMA 3KGUA 1UD6A 5IB5A 3MQIA 4YHKH 1H6EA 1KWGA 1TETL 5JYMA 1EO5A 2QEJA 4S10A 5I1KL 1D7DA 2ARWA 4XN5A 5DHMC 3Q13A 5E6IC 1CLZL 2KBGA 3Q6FA 1DUYA 5AB1A 3HNSL 5T3XL 5ILTH 3T04D 4L9DA 2I32A 1NGWA 2DQEL 4JFYB 5KJ7E 3CH1A 4JQVC 4QRTB 4ZFFA 1LDSA 3BZ5A 2ZKHL 2NY7H 3EYSL 5D7LB 1ROCA 3NSCA 5JXEC 5I8OL 4L9LA 3ZY7A 1P4IH 1QHOA 4RMQA 2OS7A 4X5LA 4F3FA 2X88A 4UQ2A 5EG6C 5ABZA 3CUPB 4ODHH 1R24A 3POCA 3F7LA 1MW1A 3I75A 4ODXB 1U3ZA 1Q72H 3HI5H 3LZRA 3D25A 1GYUA 2BJML 5KOVC 1MHHA 3EZ8A 5D7JA 5JHAA 4CJ0A 3AADB 3VGGA 4XPTH 1FL6B 5H8DA 1KXVA 1X44A 1MY7A 4HJJH 1MCWM 1CTOA 1IAKA 4FTVA 2FLBT 4GMTH 4QPEA 5I6OA 3V6BR 5CCKL 5CJXC 5DD3H 1KLFB 2KT6A 4HWEL 1YEDA 2WNWA 3HRZB 2PXYB 3FT3B 1MCDA 3LIUA 4OM1L 3T8XA 3OAYH 1DSFL 3MFFB 5JUEL 2BNUB 4X8JB 3MNDA 2DEXX 2X6BA 1HXKA 3JWOH 3FZUD 1DVFC 5F9DC 4B7IA 4R3SA 1JSYA 3HR6A 5ICZB 1JZ7A 3DJSA 5MEOA 1SJXA 1DQDL 4F2EA 5AB9A 4XPHL 2BXYA 4HKJA 3QDMD 2YQ2A 4KKQA 2KZBA 4JFDA 4GXVL 3QARA 2WP3O 3WTUA 1VERA 3WKYA 4WKXA 3HPJA 4HUWA 4PREA 3IN2A 4IOIB 3VXSA 3FB6A 4ES8A 5ESAA 3X3FL 1ET7A 4X42A 1LO5A 3KCPB 3QJTB 5JIIA 1CE6A 3JUYA 3E9TA 1FORH 4FNTA 1KIPA 4YHPB 3HMWH 1BJ1H 2O6PA 5I76B 1UA6H 3GSOA 1QPXA 5BV7B 5CGYD 2EILB 4I18A 3MV9E 5ID0B 4M4RA 3MJGX 3T2PA 4IBUA 2EKJA 3JV4A 1DBKL 4BKSC 3KYKH 3MUZ1 1MKFA 1ZA3B 1OAQL 1N8OE 4O02L 3K2KA 1TJGH 1QX1A 2WXNA 4EZLA 4M8QB 5JO5A 1MIML 2VM3A 3QRFM 1F41A 4GUQA 3MAWA 3O6FA 3Q8EA 5C2BH 5I1AA 5D1ZB 2XTJC 2OCCB 3QH3A 1AJ7H 3VXUA 4E42A 2QQNL 2CO6A 2OM5A 1OTSD 5KYXA 2ZG3A 1UASA 3GHBL 4AZ8A 3E2HC 3MLSH 2CZNA 1YECH 5I16A 1FAKT 1CQYA 4KQ4H 4PJFB 2B9BA 1OGTA 2Y2WA 4P4KB 4F2ME 1NUDA 1EAQA 1CF1A 4UM8B 2HXAA 1BDYA 2CUHA 4X99A 2APSA 1ZY9A 4U1GC 1JE6A 5LAPA 3A6BL 2R39A 2RD0A 1LK2A 3WY3A 1X4XA 2X1OA 2YD2A 3FMGH 4MMZB 2VDPH 5IOKA 5EIQA 4J3TA 1T3FB 4RDQG 2OMYA 2P8LA 4BQBA 5L8LB 4MAYB 3U83A 2DI8A 2GBVA 1ZLDA 2ZOKB 3L4TA 1AXIB 2YK1H 3RA7H 5IKCB 1CD1A 3KL0A 5EZLA 4XVSH 4NBXB 4DSYA 6PCYA 4LCVA 4ZUTA 3WEMA 1KFAH 5IB2B 2IH8A 2H2SC 1LWJA 3M1OA 3LX9A 1DJXA 3W9DB 3DRQB 2DMHA 5BO1L 1J8RA 1EAOA 3VDBA 5ITBL 4WZ9A 3AQXA 4XXWC 4P23D 4ZX5A 1LP9F 4N5EC 2J12B 3WFHB 1P6WA 3CNKA 4JE0A 3CZGA 3R19A 1A1OA 1D6VH 4YSSA 2K1MA 5DDHB 5INDB 4AENA 2P80A 2G5UA 4N2MA 1MLCA 2X3CA 3LSOB 1INQB 5DZOA 2Y07H 2V7HB 2YMTA 3GRWL 4FP8L 4APXA 1VHPA 4PRHE 1PAZA 5EHFA 3DPBA 3L7EA 3PJSA 3IFPB 5B7MA 4UT9L 3S3DB 3KBPA 5DYOB 4LCUA 5DS2A 2VLKB 1NKRA 2PYFA 5TPWL 1R3KA 3PL6A 3NCJL 4Q6IB 1EPFA 5IR1A 4JQXC 2WQAA 5I8CA 4TNGA 1OGSA 4FADA 1PLAA 3BSZL 4U1MB 5FYJE 1XT5A 1BMZA 4HKZA 3QNXA 1PZDA 3ARVA 1NIEA 2DQHL 3MLTA 2APWA 4I89A 1MCPH 1WS8A 4WW1B 3VD1A 5F1IA 2CXGA 3MRKB 3FFDA 5E7FA 5F7EH 1B0WA 1YMHB 4OF8A 2NW3B 4OZHF 4Z0XB 1U6AL 3GMPB 3ARDD 1SUJA 5E8EB 1CGSL 5EEYA 4JM4L 2YA1A 3HMXL 4PGEB 4K3DL 4BKLA 4BYHA 1QW9A 1FUNA 1NOFA 2CRZA 5HYSA 2IDQA 3GDBA 1QR1B 5E4EC 4KTDL 3VMPA 1WAAE 4I3SH 3O3BA 2VDKH 1TITA 3U4EA 3Q48A 3PGCB 3QQ3B 4NO0D 1A7PH 3WKML 2VIRB 2QVIA 1FH2A 1R3LB 5DJYA 1OP4A 1E4XL 2Q7AA 2VDNH 4BSVB 1LE9B 1AGCA 2UY7A 4A68A 4XB7A 3HNTH 3LHPL 5I6XB 2OK0L 1ACXA 1DDHB 3B2VH 4MKTA 1I9EA 4Y4HB 2HFEA 2XWTA 3RNQB 3O4OB 1CBVH 1GW6A 1YLBB 1OAXL 3FTGB 3RVTD 1J5OL 4Z5RA 1AO7E 4M7JL 4K7PL 1NEZA 4XP4H 4RX4D 2PYEE 3BW9A 2R9HC 4P2QA 4L8SA 1KGWA 3RURA 2DTML 4OJAA 5DHVB 2JJSA 3LPFA 3OAWA 5DUBA 5FKPA 1AQDB 2CRIA 2NW2A 4JN2B 5GRUL 4ZYKA 1A0QH 1D5BB 2J7LA 3EHBC 3CU7A 1ED3A 4GKLA 3MROA 1UHVA 3MLZL 3RJQB 3KGTA 4FQ2L 4OTXH 5DZNA 4XB8A 5DUPL 5GZOD 1TZAA 2IXQA 2Q3ZA 1U8HB 4HWNA 4PLKC 2ZP0T 2JKLA 3BVNB 5C8JA 3KMDA 3ESNA 1KDJA 1L0PA 4BRVA 2A73B 2ESVA 2GBUA 1I9RL 3PRZA 3MJ7B 4JREB 1KV7A 2HLAB 2PKDA 2PW1A 2WLNA 4JDTL 1AZBA 4N0FA 4TOYL 3TNMA 1KPUA 4U3SA 4U49A 1R5WA 2JXMB 3ETTA 1IGMH 2ZSWA 1LEIA 2YIHA 3QDHA 3COOA 15C8H 4Q7DA 5L7XH 3ECBA 2J8UA 4YOKA 4YS4A 4X50A 5AZ2L 2D03L 4XZ4A 1U8CA 4ICXA 1EUTA 1AOHA 4PD4J 3FU3A 2EADA 1QWUA 3SCMA 1A7OH 2DQTH 5EU6B 5DEFB 3N06B 2GAZB 4E41D 4L8CB 2NY6D 3UMTA 1MCKA 1KB5A 3OD3A 4Y5VB 3S5LB 4I0PA 4ZUSA 5C0JA 2OJZH 2AS5M 1WZ1H 2AEQH 2NY4C 4MB5A 3RGVB 5AB0A 2BNRE 5HHQB 3QUYB 2X4SB 5F0JB 1L9SA 1X5GA 2AZAA 4HMEA 4MJ4A 4OKDA 4YL4A 5GS2H 5ICUA 3MNMA 4FFZL 3SDAA 3VVWA 2BVPB 2VMEA 5T3XD 4F5CA 3V0JA 4GINA 3VXQA 3VW3L 2NY1D 4LSSH 4R5TA 2BHFA 4E0RA 2XN1A 1EERB 2IAMC 2VRQA 3UH8A 5DMIH 5E5MA 5HGHA 4IBWA 4TNVF 1NCWH 1TFPA 1CT8B 4A7GA 1M1SA 3FNKA 4MYPA 1R3HB 3GPSA 3IU4H 4MXVF 4NHUA 4PJ8A 5JQIB 4MZIA 7TAAA 3NPSC 5JDSB 1EDHA 2P5WE 2WBJC 4K5NA 4XE5B 3ORJA 4R26H 4J4PA 3ZE1B 3WHXB 4LCCC 4B9IA 2Y1ZA 3C60A 5E51A 5AWNL 4DN4L 1J12A 4LT7A 5BVPH 4LMQE 4NQCD 2OTPA 4AI7A 1LEGA 2UUDK 4PJXB 2EC8A 5HHOB 1BFVL 4C4UA 4CNIB 3VXMD 2JLLA 4KFMA 2F8VA 2O93L 3L3IB 5EOTB 2NX5E 3KYOA 5C0RH 1MAML 4QT5A 2CGRH 1WWWX 2H0JA 3PWPE 5T1JA 1ASQA 4EQ3A 1TPXC 2PO6A 3P77B 1IO4C 4J7RA 2Q20A 3ESUF 4NUGL 3HHSB 3IJSB 3BLKA 3SHSA 25C8H 2WBKA 4YXHL 3VDCA 3UPRB 1JDCA 4ZO8A 4JO2L 4LSUH 5TE7H 5IW6B 3HA0A 4KVPA 4KZCA 2H5UA 4A2FA 4G59C 2BMKA 4PH8A 1YYMH 3ZDYE 2E27L 5C0GA 2B08A 3FPXA 3WSQL 4PJ7F 4Y9EA 1LO4H 1N59A 5TH2A 3U46A 3EJRA 3OXRB 4HOMA 5LGJA 1Z9SA 3AREA 3CQQA 5E5LA 4G6AD 5I8KL 1KT2A 3WN6A 4UQ3A 4S1DD 1LK3H 2FT7A 1ADQH 4QAMB 4Y9GA 3SKJH 4G1MB 3SYOA 2BVEA 3WJLC 4N3TA 3KPQB 3R7QA 1B4LA 1QKZL 1PIGA 1Q9WB 4HGMA 3LRGA 2L7UA 3O81A 3NCYP 3RAJL 1OWRM 3VGHA 3WJMB 3BOVA 2HWZL 3BEVA 4N8CH 5AOZA 3NEEA 5E94A 5IESL 2CBQA 2HB0A 5G55A 3GD1C 4XN8A 1KACB 3MDJA 4JX0A 4MVBD 3F00A 3KLHC 1FH5L 1C5CH 3FTXA 3UYPB 4Z7VB 4LDOB 4EOWH 2EE3A 3FCTA 3OSVA 3AG3B 1IAIM 1B2WL 4N68A 2C3GA 2EXSA 4WFGD 5K1JA 4L5FL 1G9NC 4AUJA 4BFNA 2I7OA 1I7ZA 5AW4B 4AYFA 4M62H 1MHPH 1BGXL 3EJQA 3D33A 3FO9A 2JLPA 3QO0B 3ROOA 3OAYK 2BZDA 5I0YA 5IB3A 2ADFH 1GOFA 1M7IA 4IKJA 2JFCA 1GJWA 4TTGA 4FLHA 3B2XA 1X5KA 1I8UA 4NI6A 3G9AB 1JGEB 1BZEA 5GRVK 2PNDA 2Y36L 1CFSB 4OZGE 1ZVSB 1XH0A 2FD6H 4UTBL 2R0KL 4Y4KD 4J3OF 3RILA 3BPOB 2W0PA 4P59H 2EO9A 3OJDA 2CMRH 4J6RL 5D1XA 2CBTA 3FCBA 5DVPA 1UWEL 3WE6B 2LABA 4Z77B 1SLUA 1I53A 3HTLX 3IDXH 1ZK5A 3DTDA 4N2NA 1WFOA 2DYPA 3KYMB 2H1XA 5CEYA 3VXRE 4FXKC 4QYOB 1RZQA 3BKML 5J6GA 4A55A 3A47A 1CS6A 5I0VA 5EOQH 3ZRFC 2J6EL 3C5ZB 3AVEA 2Y69B 3TWCH 1KCSL 4F1SA 4J39A 4IJTA 1XVSA 3BUDA 4JFEB 2UXFA 3SYCA 4WWKD 1GGCL 4Y2OB 4XMVA 3IJYA 5HYJE 3EBGA 3TIEB 1OE2A 3Q3GB 5IEKB 2WXMA 4KMLB 4OLWL 1M2VB 4FS0A 2ZXQA 2AJXL 3BZEB 2CG9X 3TYFB 5FHBL 4AM0Q 1JBJA 4WJ5B 4BZ1A 2W95A 1ZT4A 4WFED 2V9UA 2DQIL 4DEWA 1J1PH 5D7LE 3LTVA 4H5SB 2X53A 3CFBA 3O2WL 4IEFB 1XWVA 4X5PA 3GM8A 3CFUA 5FW8A 5KW9L 3U4KA 2P5EB 3OC5A 1K72A 2KDGA 3FT2A 4I4WB 4P5TA 5EORL 2V2TB 3RX9A 3QI9A 2UYLB 5GS1B 2ZX5A 4YSCA 3QPXH 3TBTA 1IAOB 2J20A 4QKTA 4G7QB 5F8RC 4ZBJA 4PYHA 3QUXD 3X14A 4WJG3 2B20A 1AZZC 4W9FC 4A04A 1KCUL 1JXDA 2OR8A 4HHGA 4S1RL 1M6OB 1FYTD 2G3NA 5E56A 4DGYH 5L4FA 4XVJL 4YIQA 3WY2A 2J72A 4G7YH 4FXGC 1Q9OA 4WO4A 1UB6A 4AYSA 1F2XK 5SX4I 4YHYB 4LCWA 4N2HA 3BP5B 3OVUB 4RAVA 3IDJA 2YPLB 3QXDB 12E8H 4TRPH 3DHPA 2E9WA 4OGAC 4K7PY 4ZXBB 3TT3H 5LWYL 2LFEA 4MJID 4NAQA 1HHIB 2W9LA 1YDPB 1CB4A 1KTKE 1PSKL 2HT2C 2JB5H 3JVGA 3P40A 4X7SL 3TO4B 4GO9A 2X6AA 2WVVB 2CK0H 2H6OA 1DJWA 5T5NG 5KSAC 5I1JH 4U05A 4ZTOH 3IJEB 2BNQB 4UNVA 2TRYA 2D2CC 3NK3A 1KULA 4K5MA 5DXWA 4MAZA 4OFQA 3SPVA 3QYNA 5FYLH 4ES9A 1VB9A 2CAKA 3B7TA 2IBBA 4XNXH 3I9PA 3DYPA 1KPRA 3I6SA 3L48A 2JJTA 1I8KB 5DCCA 1I3RB 4AV0A 3WXWL 3T08A 4LHQB 2OJEB 1ODAA 5EEZA 4Y19A 4QXUL 5KVFL 5F9JB 2ROXA 5IZ7A 4ZUVB 2MPVA 1T0NB 3ATAA 1RUKL 1JHTA 3FQRB 4FQIH 1CFTA 4MNGA 4BKTC 3NZ8A 4Z3FA 3S36X 1CI5A 4TPRH 5DJ0A 5E2VL 1KZYA 3BDYH 3Q2NA 2F18A 3B9VA 3QQ9C 2K9FB 4A38A 4HOZA 4DGIH 3CZJA 1QFWH 3D7PA 4UQIM 3RVWD 5IK3A 5EU3B 3G6JE 1P5VA 1CDJA 3WE1A 3WDHA 3BZFB 4YHLL 4LEBA 3GINA 1JPGB 4JG1L 1QNZL 5F7NC 4N90D 4EVNB 4F7MA 4Y8DC 4KJWC 5MHSE 1XIWD 3IPBA 1AHWB 5J56B 4TUKH 3OAZH 3OX8B 1GS8A 5E1QA 1K2DA 3LV3B 4F1ZA 5BVJB 4IGBB 2CCLA 2SODB 4U3XA 4NQVA 3OPZH 4XI5D 3L7FA 2FUQA 1SHSA 3FRUA 3EF4A 2WOYA 2OL3B 3D2UB 3EJTA 4AJVA 4HG4J 3Q05A 1OQOA 2V17H 5AOIA 1RIHH 4H1LA 3P4NA 2VN6A 3VB8A 2EDEA 4IHOB 3CFKA 2X2YA 4OF0A 5H94B 2Q2LA 3RWEB 5J7CC 2PR4H 5D1QD 5GXBB 4FERA 1QSEE 1XF4B 4WHTB 3BAYA 2X0WA 5DD0H 5B1JC 1SN2A 2M83A 3AWFA 1B4RA 1IEBB 3H9HA 4XZUB 3H6AA 3F6JA 2VN4A 9CGTA 1U2HA 1T5XB 2ZPKL 1H15B 1SJMA 2AFNA 2XWZA 2G60L 4M7ZB 1P9MC 1OIOA 1QO3B 1VPOL 4WV1B 2JSFA 2PWFA 4LCYA 1K9TA 2ZOTA 3CFIC 4RISL 3DURA 3QIBB 2IQAB 2HG5A 4LOUD 3L3OC 3TJEH 1Z0NA 4Q2ZB 5AAPA 4KZDL 5GRVL 1JIBA 3W11D 1CR9H 4QTHB 4F8QA 2I07A 4ODSH 2CO2A 3LD8B 5HGAA 3NA9L 1RK1B 4HUMB 4IYKA 3VI4F 2BH0A 1HIMH 5JPNA 4NNYB 4FAAB 3R1GH 2ZF8A 3BWUC 4PJGF 4L18A 4EI5B 2H32H 1URIA 1GGBH 2MIZA 4HWZB 3QUKA 4L1HA 3ARUA 3OMNB 3KDPB 4U7MA 3K72B 3NP3A 4KH9A 4YDLC 5K9JH 2PPCA 3BKCL 4H8VA 3KR3H 2ALAA 1UZ8B 3PGDB 4FABL 5FOBA 4HV8B 1FFNB 4PBVC 4RRPM 4UT6A 4YSQA 1ERNA 2XZAL 1PX4A 1JERA 4S2SB 4G6JH 5FUZL 3NDZE 3LKPA 3ZT6A 4CUCA 5FYKE 1KWKA 1IRAY 2D4FA 5JMOC 1FP5A 4AL8C 3SDCD 2ZCZA 1PYWA 3Q44A 1LP9A 1SJEB 4YK4B 5T1LB 4JFPA 1WG3A 2A4EA 3V0HA 5G4NA 3AQZA 2FGZA 3U7YH 5IJKA 2EDXA 2P1YA 5IW3A 1AD9B 1OSPL 4C59B 5J1TC 5HDWA 2BDNL 4WTZG 4YSDA 1KUMA 5D93C 2CLVA 5AQ0A 1IT9L 4BDVB 4M43L 5IB1B 4ZSOE 4K7FA 1X5MA 5CSGA 3WFEL 1RI8A 3TBSA 1GOGA 1JZJA 3KXFA 4N28A 4TTDD 1E5CA 4I2XA 2JCCA 5DQ9B 3MRHA 4LSQH 4U0RB 3NCBB 2A9CA 3LS4L 1UD8A 5HHPB 4AXWA 1USQA 1EJOL 2JQAA 5KVEE 3SKOB 1NGXB 2DKUA 5IWLA 2VQ1A 2XZCH 1LO0L 1PD0A 2X2JA 4P5MB 2APTA 1CZ8H 3QORC 4PGBA 3S88L 1NFIA 3SE6A 1VGKB 3TN0D 1NFDF 2AZUA 3C6SB 4HAGA 2HMID 4KK5C 3OKKB 1JNNH 2V2WB 3T65A 5CJOH 2RB8A 3KCWA 3LKSA 3Q8CA 4LAQL 4OZHA 3V4PA 4JGUA 2ARJQ 1HINL 1MF2H 5DGRA 4HJGB 1QFHA 3H7LA 4OFVA 5IBUB 1T21B 4KI5E 4PW3A 3EXJA 3QNZA 4M5YH 4LLVA 1MWAB 3CHPA 3HHRB 4OB5L 3VJ6A 4P57B 3RDJA 2C3VB 4FNSA 2NXYC 2MQ3A 4K15A 2OSLB 3DX4A 1A3RL 2IMNA 3K4ZA 1PF3A 2ALWA 2BSTA 4GQPH 2XWRA 1HJBC 4PWHA 5E2TH 3IFOB 2M2DA 4XO9A 4MD4A 5FYJH 3TCLB 3RKDD 4TUUA 4PJDB 3HG1B 1UKQA 1HDMB 3TPUB 3HLKA 1NGYB 1JZ6A 5DWPA 1IKNC 3BPNB 1ZD6A 5TE4L 4YHOH 3U9WA 4DOHB 1MUJB 5AVRB 3MLRL 3FTSA 2BFVL 2V6HA 2DQDL 1VDGA 4YSTA 4W9GC 3TJPA 3B8YA 3PWNB 1BF8A 5DVKA 2Z35B 2Z8WC 4U1HA 1PFCA 1H3PH 1DQLH 3EOBA 3HS0A 4X4ZA 3NZHH 4KJYA 5E5UB 4ODTH 1BZQK 3CH1B 1CE1L 4ZFFB 4P07A 1KBGL 2Y0SA 1FN4B 3S6CA 3CX5J 4UOZA 3ZE2B 3QC6X 5D8JL 1J1XL 4L9LB 4NDMA 2HJFA 4E9QA 3MMEA 3WNNA 4FLQA 3K4AA 1DLHB 1GZQB 1NMAL 2NY2B 3REWB 4F3FB 5IREA 1G1OA 4QHMB 5FB8A 1R24B 1IFHH 1OE3A 2VRKA 3EFDL 5BXFB 1MHHB 1LNUB 3DOHA 4U1JB 1Y07A 1GXEA 5IMMA 5L8JB 4KI1A 5F93C 5ALCH 2XETA 4C56E 2Q8BL 3MLVH 2GFBA 4UIKH 5DJ6B 3SB3A 1BP3B 5HHOE 5C0IB 1UFGA 4RNRB 3HE7B 1RPKA 3QJVB 4OLUH 3SBWC 5KSUA 2A9NL 2QFPA 4TLTA 4V2CB 1ACYH 3CMOH 5F6IC 1YSOA 3D39A 3GBML 3OZLA 4UOJA 2HFGH 2Y2YA 4IBQA 5KS9A 4KKLC 4JFTA 2G9HA 4K8RC 4UMSA 4QCIA 3KPOA 4HIPA 5HI3D 2IG2H 5MI0B 2FX9L 1MW3A 1NBYA 4NYLA 1DBMH 6FABL 1W0VB 1G7HA 1NTDA 1QAWA 1XGRA 2PUQT 4JZNA 1VGEL 2WVSA 3JXAA 4LPXA 4YHZL 4GJTB 3GSRB 3H0TA 2WZPA 3W38A 1A6TA 1SZNA 2Z31C 1I8LC 3S34L 3ATEA 3UZEA 1J0ZA 1VF5C 4IDLA 1FBIL 5BW7C 4HKJB 4JLRA 4HUUA 1N8ZA 2NLJA 2JKXA 4LIQL 3O4LA 5FECB 4XNYL 3VFOA 4PP2B 3QIUA 1DQIA 1ZA6A 4JFDB 3BISA 5INCA 2XY1A 3HPJB 1O9ZA 4PREB 3VB9A 1XB3A 3EH5B 3KPTA 3VM7A 2CKBA 4RQQB 4K94H 3CFCL 1TU2A 3DV6A 5D55A 3ALXA 4FTDA 1VEOA 4XP6L 3KWTA 2AMUA 1LO5B 3S35L 3SDXA 5B38A 1CE6B 5AOKA 1KIPB 2ED8A 1NBZA 1PL3A 3NFPA 4HP5A 5EIIA 1KENH 1IGJA 1FAIH 2AK1H 2WQRA 1F3RB 4LARH 4TMPA 4DEPB 1NCCL 4M6OH 4NRXA 2K4WA 2NUTB 5EEUA 2BVTA 1NEUA 1AI1H 1OAZH 3L4CA 4KY1L 4Z7VE 4WU5A 2W0FA 3U7AA 1JYXA 4MMXC 5JO5B 1LQSR 3N9GL 1T7YA 2AJ3A 4FFYA 2JK5A 4PJ5A 3JUZA 1NGZA 3KL5A 1QVOA 4LEEA 3TS8A 3JQOB 1IC5H 3IXTA 4JPSA 1UCBH 2XZQH 1S9YA 4IRZA 2DWEA 3EGDA 4HC1L 3V6OE 4NXKA 5I71B 2AXFA 2IBZX 4Y4FC 4YWGL 2Q10A 1TVBA 1OGTB 2AVGA 2DLFH 3H53A 4MRCA 3A4FA 4PJ7A 2W60A 3NH7L 2NZ1A 1VADA 4WHCA 4MLIA 3UABA 3A21A 4OIIL 5CZVL 3CN3A 1R46A 3L6FA 2VMJA 4NM4L 4KJQD 3U6XA 1CGYA 1FNGB 3AROA 3MLYL 4PRNB 1S7WA 4OI9A 3QR2A 5GIRA 3IDNA 4JO8A 3QXVA 1CFQB 2P8LB 3PNRB 2VXUL 4O9HL 4G8EA 2P7TA 1H6TA 3VQ1C 1NJ9A 5JZ7C 5J1SC 3OKOB 1EO8H 1DLFH 4QXVA 5DD5L 5FGBA 2YPVH 4KUCF 3C8DA 3PWJB 5LBGA 4ZUTB 4UTAL 4DP7X 3MV8B 1OCOB 4U1SB 2J73A 4N4YB 3S9DB 2IVFC 1CGXA 1IM3B 3TBWB 1VACA 4GLRI 1SM3H 1GGYA 4P4RA 5CZXD 4K07A 4ONHB 2X87A 2Y7QA 3QDJD 3FBQA 2EVHA 2AVFA 1C5BL 1RSFA 4KRPD 4F37F 3V0WH 2XN2A 4JFEE 4G6ML 3HRZC 1EBPA 2Y6SC 2PXYC 3V4UH 1A6VL 1UB5A 2IWGA 2AQQA 1W72H 1VFAA 3ABZA 5HVHB 4XP1L 4WNJA 4TQPA 1R4XA 3I6GA 2QVFB 3I9GH 3BEWA 1A1NA 1U4EA 3DPBB 4B9GA 3DUHA 3S37L 5FO7B 2ILLA 4TKWA 5FWRA 3RY4A 2VO8A 1U36A 4LCUB 3LN9A 1TLKA 1VEPA 2G9KA 3CVHA 4OGZA 5BRZB 4QRQA 3UZQA 4S11A 3PL6B 4K8RH 5BNXD 1UJ3B 5IR1B 1FNLA 3F7RA 4KRNA 5HDBE 3NG5A 2VR8A 3DGGA 4L4VD 2VMFA 4R5XA 3ZKQD 3WMPA 3ML8A 4JQIH 2DLIA 5J6SA 1SF5A 2WO2B 3QNXB 2FSEA 1DE4A 3PQYD 4HK3N 2F54D 2WNXA 5F1IB 4AKQA 3NSJA 2G5BA 4NJAH 5DWUL 1XCQB 3MU3A 4WW2B 5BV7C 5K69A 4EDWH 5L0QC 4PJAF 4BKLB 4HIEA 1Q90A 2DYSB 4LSDA 3UTSD 1OQXA 1QLEH 2YPLE 2XN9E 3T2LA 5CF3A 4YHML 1NPJA 1EGJA 4NGHL 2F61A 1P4UA 4OGQC 4TLUA 1NIDA 4W9LC 5D1ZC 5K33A 4ISVB 5TD4A 5AUMA 3RWHB 3NEOA 2R56L 2PETA 1BAWA 3MGTA 4WWOA 3V4VL 4RFOL 1JPEA 3L4WA 3RFZA 4JJ5B 3RL2B 3ULUH 4L37A 4UCFA 4UZUA 3MLXH 1H3GA 4P4KC 1NEZB 4OJDH 3N42F 1UT2A 2N1KA 2HRHA 4H88L 1CJYA 4KPHL 2OZ4A 1II4E 3DRTA 1JMZA 3BKYL 3SJVE 4UINL 5DUBB 3WFCH 2BSCA 4H7VA 1HQ4A 4D3CL 4MB3A 4N2BA 4GXUM 5DMYA 1FZMB 2X4NA 4QO1A 5L6YH 2QDWA 3EXLA 1VA9A 4MMZC 1ZCRA 4M4PA 3S2CA 4BQ6A 1QLFA 4U1KA 5JXED 2IXQB 4MAYC 5KN5A 3SGJC 4ZUUA 5JDJA 3AXLA 3GMLA 2JH2A 2XXMB 3CFNA 3D69B 1FL5B 2Z64C 2BLFA 3O2DL 4FQXD 2XACC 4GAYA 4MAUH 5JOFA 4I0CC 4N0FB 1KPUB 1FVDA 1H5BC 3CZKA 2FO1A 1MFMA 3D51A 5TE6L 3WOVA 4EI0A 3P0YL 2BP5M 1YN7A 1Z9MA 2ZSWB 5DHYA 3WY1A 4YNYA 4GBXA 1NMBH 1LEIB 5DFAA 1KCRH 3OKMA 1IBFA 5F7KC 3VTMA 3V6ZA 1AMXA 4W81A 5KG9A 1RV6X 5EA0H 1BM3H 4KKAC 3DLQR 4XNUL 3PWLB 5L2KE 3HZYB 4TNEA 4OLXH 2VDMH 1WYJA 3WNMA 3P0GB 3QHTC 5JTWA 2YBRA 2OFQA 3IKCA 4XC3L 1CXFA 4OQTH 5LGHL 1IC4L 1KJ2H 1NAMA 4X9YA 2F68X 2V9QA 3KGSA 4LQFH 4KVCL 1MVYA 2FWUA 3RWJA 3UTTE 5AVSB 1HAWA 3GUTA 3MV01 1DVFD 4TVUA 4B5EA 1JDAA 2A6IB 2YRBA 4R4FL 5HJBA 4HBCH 4YBLB 3VFVB 1V05A 3KH4A 2CLZB 3ARTA 3RNKA 3NACH 4Q6IC 4QRSA 3SDAB 2HJKA 1NIAA 4LSRL 3TA3A 4E0RB 2VDRB 2I69A 1JPST 2JMRA 5KVGH 1OK8A 3D4GA 1ASOA 5HGHB 1AY1L 2AXWA 2WZ5A 3ILQC 5ADOH 3RUGA 3ZTJH 2XIDA 4KZEH 4NHUB 2FJHA 2MTAA 4BH7A 7PAZA 1OT2A 4J2QA 1RK0B 3VI3B 2J5LB 5D70L 1T0PB 2YGOA 2LU4A 1ZTXH 5I73B 4HS3A 4PUBH 1DZBA 3TC9A 4JFFA 2D3NA 5ADPL 5F7UA 2DL9A 1LEGB 3MJWA 1I75A 5IVZA 4X5RA 3N55A 5BV7H 1G9NL 4L1TA 1DQKA 1JPSH 3IGKA 5HJDA 2O5YH 3KYOB 2APVA 2KUTA 5I6XC 1EJ6A 2I5YH 1G6RA 3QP3A 2XTJD 2NNAB 1ETA1 4LHUB 3O4OC 1XR9A 1T66C 2R0LL 3VVVA 5GRJL 3B9DA 3W2DL 2G4GA 5E70A 5AW2B 4DP2X 3BE1L 4BINA 1E28B 4A66A 5IMKB 2VTFA 3BUPA 5JOPD 1WZMA 4OFIA 2I9TB 5C9KA 1A4AA 2LLNA 1DN0B 4Z7UB 2QQKL 4DPCX 2EZ0C 4GMSL 5C0GB 4XO4A 4GAJL 5TH2B 3II2A 3CDGA 1WFMA 2BS8A 5EU7E 4ALAL 2EYTA 1Z9SB 3BYYA 3O11A 5AAWA 2HKAA 3DSFH 1M4KA 3L1EA 4GG6B 4OZIE 2Z1KA 3E6HA 2OYKA 1WV7T 3G5ZA 5KVDE 4F80A 4D0DB 3QEQA 4FNLH 2OR9L 4UAHA 1DVTA 2V5RA 4WUUA 3VI4A 4JREC 2JWYA 3AS3A 3QULA 2FATH 3BEVB 1WEJH 2W07A 2CWRA 5EWIH 3HBZA 4Z0BH 2O5XL 4PJGA 4R7NA 1FFOA 2MJWA 4NWTH 5DS8A 2X4QA 4TUJA 5B1BB 3RL1B 1PVHA 2ATPA 3G6DL 3TONA 1N5AB 2RGSA 3CIQA 3N3EA 5B7FA 1MFAH 3GPEA 4L4TA 5BZWA 4BA8A 4N5ED 3H9SE 5GJSH 2P9RA 1P84J 3MLWH 3OHXB 4G8FB 5F0LB 1UVQA 1O9VA 4XP9H 4WIQA 1OP5K 3FO9B 1QNZH 5CHNA 1LEKA 1Z3GH 4ZOAA 4LNRA 4Y5VC 3AG1B 4P46D 4AIXA 2LGNA 3FSAA 2UWEA 2E9IA 5IVNA 2BC4A 3RGVC 5IB3B 1F58H 3KS0H 1IBDA 3QUYC 4F33A 5ISZB 1Q1JH 4HAKA 4V1DD 4N2KA 2CRMA 3SYPA 4B9FA 3GZOA 5D7EA 5F70A 4YX2H 3V79C 4QXTA 1BXVA 4PJ9C 5GRXG 3W37A 4GW1B 3T2OA 1T2QL 1WC7A 1BXAA 1HH9A 4QHNA 3M88A 3QJUB 3JBG7 3T8VA 3BAIA 3OJDB 4MSWA 4BRJA 4FOMA 2UZXA 2H1PH 3HBQA 3T6ZA 5ESQA 3T0EA 1PCSA 4ZD3L 4MCYA 3FB7B 4PN6A 2G60H 5FHAH 1S5HA 3JWDC 5TQ0H 5J6GB 3PGFH 4JKNA 1HSAB 2MTPA 1AIZA 1UM6L 3B4NA 3CFEA 2DWXA 4EUPB 3M17A 1NFDA 3BDBA 4DOHE 2BVUA 1OTTC 4U6YA 4QI3A 1O5DT 4DKTA 3IJYB 1TIUA 2PLTA 3L1FA 4H8QA 3G5YB 1Y0LB 5KBPA 4ZTEA 4IIQC 3CCHB 4X80H 4G1EB 5FX3A 2H41A 1T1XB 4LVOB 3TASA 4JFHE 1OCWH 4AK2A 3QSKB 4KXCA 4JO4L 4YZWA 1UEYA 5SWSB 3LPWA 4FMFA 4PB9H 3NQIA 2DI9A 3L9EA 3MJ9A 4KHTL 2K70A 3CFBB 4ZW8A 4ZW7A 4Z3EA 1J05A 2FHBA 3CVDA 3GXFA 1MG2C 1PS3A 2AJUL 3MOAL 3L8QA 4KGLA 1HESA 1T80A 2KKQA 3PAUA 3Q5TA 1RURH 4XCYA 2FLMA 3TBTB 3ZOAA 4HIHB 4FKEA 3FU7A 2IMMA 4JKLA 2MHAA 3EHBD 3LQZA 4AT6A 3WLWD 1NM9A 2BOBB 1N10A 4WK4B 3G5VA 4Y9BA 5DK3A 3MXWH 3L5IA 1WZLA 5DHXB 6CGTA 5EBMA 3PPEA 2EDLA 2C1PB 3T4AB 4PLKD 4RMUA 4QMEA 2R7EA 4FTVE 2D4DA 4AQ8C 4YIQB 5I2IB 1Q9OB 1ZV9A 4UV7L 1UB6B 4WO4B 1MEXL 4M7KH 3QZBA 2GC7C 3MBEA 4OVUA 2R29H 4LCWB 3D9AH 3IDJB 2E3VA 2OMXB 1I9JL 1U95A 3GXDA 2P44B 1IGCH 4A6YA 2VXQL 4JHBA 1PQZB 2F5AH 1I82A 1NLBH 3AFLA 5DJZB 1VIWA 2MNJB 3EZJB 3TVMA 4XX1G 3UBXG 3S98A 3ULVH 4M9OA 3SKUD 3SODB 1Q8MA 1IX2A 2EXYC 1SHXA 2ZTBA 5IOPA 3OLEA 4N0YH 3V6OC 4U3HA 1WFJA 4N85A 3LZQA 3RZCD 1RJYA 4MJHA 4BE6A 1KGCD 4X7TA 3M7OA 4OV6F 4JFDE 1T6VN 2OMUB 4PWIA 3HHMA 4JUTA 1UM5H 4J3BA 2Z92B 4ETQB 2N0MA 1R3IL 1MIEL 3MX0A 3FN3A 3EFOB 2NY4D 2WIMA 3L3GB 1MXGA 2X40A 3IU3B 5IEHB 5MEND 1W16A 1ZHBB 2IH3A 1HOCA 3I84A 3K8MA 3EJPA 4P99A 5IIEA 1R17A 2G30A 2E8YA 5TDOA 3RWDA 3T3MB 4AM0B 4ZPTA 2YEQA 2E5EA 3BPLB 1HE7A 3X3GH 1CVRA 2XFXB 4Q8BA 3BPOC 1DBAH 3O2VL 3LY6A 4PCTA 2IAMD 3KEDA 3AABA 4JY6B 5GS0H 3GB7A 4WEBL 5SWZA 1JPFB 5GHWL 2F15A 4BEIA 5F21B 3ZJAA 2BP3A 2XT1B 4KUZL 3PAZA 2MWCA 4QTFA 4DT2A 2CO7A 3D07A 3MOQA 3GSWA 4LSVL 1OP9A 5BZDA 3CC5A 4JRYA 2A83A 3E8UH 3OKLA 5ESVA 1OE1A 1OWWA 2EVJA 3FT1A 4F92B 2C4FT 3BESR 1OB1B 4XBEH 1TQBC 2IOIA 3EIFA 3D85B 3LIZH 4HXAH 3L7FB 4QEGA 1D5MB 4KK9D 4N6RA 4LP4A 2WLKA 5TFSH 3U4AA 4EZMA 2AV7A 1J0HA 1GYWA 1YPZF 4MNQB 1NQBA 3P4NB 4IW4C 5D1ZI 4KXAA 4Q9QH 1A14L 5HGDA 1M3IA 3DIFB 3G6AA 4PCSA 4PJEB 1ROWA 4CC4C 5A16A 1PZAA 3HAEA 2DQ6A 4B9PA 4AL8L 3H9HB 1ADWA 5I82A 2IOOA 2ZOUA 5ICXA 3N85L 4PJHB 7FABH 3O8XD 5J9PA 3QYCA 4LLYB 1WFNA 2PWHA 4ZJ9A 2AJYH 3V8CA 2X6CA 3DURB 1CF8L 5KSBB 2CBOA 4ZRGA 5IM7A 4MD0A 4IRJA 4RZCA 3C2AH 4EO5A 4YHYC 3VFSA 2BPBA 1CU4L 1EFQA 4JKWA 3DO7A 4FFWC 1SXSA 4NKIH 4QHUA 4QTIH 3KLHD 2YD9A 1H3TA 3EO1B 4V2BA 5JHDA 1GZPA 2FAUA 3ZX1A 1SEBB 5ITFB 4XCNA 1RKRA 4Z7OF 5CD5D 1KJ3H 2H3NA 2Y7SA 4D2NA 3QAQA 1MFUA 1ZEAH 1IE5A 2VR4A 4QLWA 4B3EA 1JV5A 2NY0B 3TZVA 1PGRB 1OARH 4MZRA 4HWBA 5L2JA 4J1UA 1HXMB 1S5IH 1FV1A 4O5LL 2J1KA 4HCIA 1H0DB 3ZGIA 4EN3A 1RZ8B 3RU8H 4B9KC 1QFOA 2WXPA 4Y2DA 2ATKA 2FEEI 4YE4L 5JW5A 2CJSA 5C6TL 2MKLC 2OMWB 4WVRA 3HG4A 1WUZA 3FRPA 4OGYH 1OY3B 2MCAA 1TEGA 1KIRB 1KTLA 1PYWB 5SX4H 1AXSA 2E6JA 3DX7B 3ERXA 4JFPB 3UP1A 5CEXA 3K6NA 1YYLL 4JFZL 1JWMA 1MFEL 3QUMB 4XP6H 4AGOA 2D73A 3C9NB 3BFOA 1WLHA 2NY3B 4FFVC 3TYGH 3P69A 2WTPA 2V33A 1JGLH 3TBSB 5ICYB 4LVNB 4RWHA 5IMLA 4NN7B 2JCCB 3WHE1 1XB8A 3MRHB 3MZTA 2UXGA 4LDEB 4X7CC 2P47B 3I2CL 4Q58C 3F12A 2Z8SA 1UT1A 4UU9B 5JLZB 4PHXA 4JZOB 4IGBC 3C5XA 1L4IA 2JJVA 4G42B 5IW1A 4K2UL 1PMYA 4B97A 1NFIB 1JK8A 1ZHLB 2FBJH 3OQ3B 4IMLA 2PPEA 3PABB 4P2QE 3WIHH 5A7BA 1N6VA 4H2CA 4UOW0 5D72H 3I6LD 2WBWB 1GMIA 1O7DE 4RWYL 1JGDB 3DX6B 3A6CH 3MSPA 4WFHD 1HVXA 3V4PB 1U3YA 2X2UA 4YLBA 2BRRL 3TX4A 5CZVH 1D5IH 2VMDA 4PJAA 4NM4H 5EEWA 3RFRA 4JRXD 5ACZA 1N64H 1YEWA 5EZOH 3M1CA 3CG8A 5CP7B 3QBTB 2WWOA 5CIPA 3UJJL 3ZBMA 4BZ2A 4M7ZC 3HC0A 1Z5HA 4PMEA 3U2JA 4WV1C 1SPDA 2K9UA 2PR9A 3CFJA 2QZ5A 3GI8L 4EIBA 2AKRA 3QIBC 2BSRB 2F08A 2P26A 2BSTB 2MOGA 3V5KA 1T5KA 5T1MB 5KSVA 1NC4B 4MD4B 3MRIB 4ZAKD 4QNPF 5T5FH 1FGVH 5E2UL 3KE0A 1FHGA 4QKXB 2J8UE 4HX1A 4NENA 1ZGLP 5DJXA 3STZA 4CKQA 2E7CA 2AABH 4XN9A 4N2EA 1UYWL 4PJCF 2YUWA 4AWJC 4YUEH 4AYBA 4PTTA 4YEFA 1F1AA 2W59A 1GYAA 4OGXH 4OGAD 1YNTF 3OTTA 1CK0H 1D7CA 2APXA 5CBEA 4EI5C 3OG6B 1MCEA 2COQA 4H44C 4IJ3B 4P2RB 1JRHH 4AGLA 4U1HB 2XPGB 3FO2A 2HT2D 3HS0B 3QDMA 4FFTA 4DAGL 4E2OA 1XGQA 4MDIB 3MGOA 3Q8BA 3SQBB 5E0QA 3X1GA 4LL1A 3U2SB 2EIBA 1I3VA 4UILH 2O61A 2YZ8A 4F5CE 3ZHDA 1ET8A 5ANHA 3D34A 2Q8AL 3UACA 3MYJA 1A6ZA 4YFLF 3MJ6A 3RIAK 1AD0B 3U4BL 4L0PB 2ZYSA 3CHRA 5C0EA 5E8PA 3QCVL 1PG7H 2HFTA 4LLMA 4YLQT 5I66A 4H25A 3ZGHA 3Q06A 5MEQB 2H26A 4K73A 1S3RA 4YK4C 3GJFA 2ADIA 3VI3E 1UGNA 2I60H 3P3UA 1VFUA 3CBJB 2QZQA 3G04B 4DTGH 1PFOA 3AM8A 1TTUA 1N4XL 3H6JA 4MQ7A 2ARJB 1HCFX 1S46A 4F7EB 4NRZA 1CL7I 1DDTA 1FNEB 3FUEA 3QQ9D 3ULSA 5JHLL 1F90L 1JHLH 2F74B 3SPJA 5KS9B 3RTQD 1NCIA 3EYFB 4U0RC 4D8PA 5DURB 1EAPA 3FUKA 2G9HB 2C3XA 3D08A 5TF1H 4K3JL 4QCIB 3KPOB 4C8XA 1RL1A 5EO0A 2KDYA 4TQEH 5FV1L 2KLSA 2VR7A 4KJWD 5FWQA 2YAQA 2W9EL 4F93B 1BZ7A 2HSIA 3R18A 3H0TB 4X4XA 1A6TB 3H3BC 3MOBL 4J3UA 2VLJD 4Z7UE 1N8ZB 3DYOA 5BS0D 4E9XA 4BFKA 1MCHA 1JI2A 3QIUB 5E6SB 2C9QA 5INCB 4M1CC 2E76C 3FO1A 2ZXEB 5DO8A 5JQHC 3S4SG 1J87A 1LO2L 2HVKA 5JW4R 4LB8A 2CKBB 4PRAB 1TU2B 3H3PH 4FLOA 4R90L 5AW8B 4FF9A 2RHEA 3QCUH 3SDXB 5JOEA 2MOQA 1E5AA 1ZANH 4L2LA 5T1KB 4JPIB 1IGJB 3MV7D 1SYVA 1R0AH 2P45B 1OAKL 1T89C 4DO5A 2L8AA 4HF5H 1WF5A 2P8MB 4IQHA 4P23A 1AYRA 2L7QA 1QHPA 4K3HA 1AZUA 2H4EA 2W0FB 3B1UA 4NERA 5HDOA 2NCMA 1GVIA 4X5XA 4UI2A 1BQ5A 1UGKA 1JHKH 3BPNC 1KNOA 1YY8A 4CGTA 1S9YB 1YNKH 3MCYA 3HE6B 5GGSY 3BMWA 1KTRL 3QFDB 2ZXAA 4Y1AD 1PKOA 1ZT7B 1TVBB 4Z3JA 5GGQH 5L9DL 4XAKE 4PJ7B 1AOZA 4XOBA 1HN1A 4R83A 1UH2A 1VADB 5DMGC 4GI9A 3IN0A 3OMIB 1CLYL 5ISZE 3X12A 1C8QA 1MJ8L 2FUTA 3P4LA 1G7IB 1X9UA 4HCRH 3WFDL 2ZSVB 1QFUL 2OW6A 5J8OA 4JK0D 2R2HA 5IBTH 5D7KD 1RZPA 5BOZG 1A6WL 1U93B 3KPLA 4L9LC 1QRKA 4IOFC 2GSIA 2ZUYA 3K0YA 3OSKA 4R4FH 3K7UA 2NY2C 1KJVA 1TZHA 4G8EB 2B1HL 3L2NA 3LRLA 4D0CA 1D2OA 1LO3L 3ARDA 4OZ4A 3B7UX 1E6OL 4U1LB 3LKNB 5MERB 4BH8A 1NCAH 5GGVH 3ULAB 4BUQA 2OTWB 4PSPA 1JCKA 4WTQA 3VTAA 1CI3M 3OHMB 4NFDA 1VACB 1KXVC 1K6QL 4P4RB 1LILA 2DV6A 3O6KL 4NO0A 4PV9A 2FEJA 5KYWA 5LG6A 2KQMA 4TSCL 3KZ8A 2DICA 2IH1B 2DQGL 3J07A 2OYMA 3HE7C 2YN5A 2CIIB 1TQTA 2YOAA 3BP7A 4JJHA 5KVDH 3DWTA 3AG4B 3WIFA 4CU6A 4KBPA 1QEWB 4KK6C 1J0KA 4RGOH 2DQCL 1VFAB 2F7RA 2NR6D 2OTUA 3T6WA 3I6GB 5GGUA 1J11A 1DO6A 4DQAA 3ABKB 4X6DB 4QYAA 1IL1A 5K9KA 4RX4A 1PD1A 1WCQA 4G6FD 4QXWA 5AALA 1AZNA 1YQVL 4AOFA 1ZHKA 1HAUA 2EDJA 2F7QA 4GAGL 3WGVB 2WNKA 1P7QD 3FQ1A 5K59E 1CWVA 3EJZC 3MUGA 2YBGA 4TULH 5IHZA 4FJYA 1DEEA 1UWXH 4F57L 1N0LA 5T1DL 4KK5D 5C07B 2AERT 5GZOA 1GS6X 2Y3AA 5T3ZL 1RMFH 4DKEL 2FSEB 1RZGA 4JHAL 1S7UB 1I8IA 2BOCB 2XG5B 3I6KB 4GB9A 2FX7H 3DJZA 3QHFH 3AWEA 1ZE3C 1WGVA 3MNVB 5CN2A 5TDNB 4W6YB 3WUWG 4PTUB 1F97A 1QSFB 4P05A 5KUKA 4ALAH 3RDTB 3PYCA 4I18C 3KBHE 1KYOJ 4NC0B 4FQQA 4S1QH 4X6CA 5TJWK 1AKPA 4DEPC 1EZVX 2I7SA 4LCWE 4L29B 1M53A 5CD3A 2BRQA 4JMNA 1Q9KA 4TLKA 4AYDC 1OCCB 4G3YL 3GXIA 2DAVA 1ZPLA 3QEGH 3PAYA 3WGUB 3ZSTA 4G80A 5K9OA 4PJBA 1Q94A 4A7TA 4Z95L 1JUFA 4JS7A 1TLMA 4KZ0A 4OCWH 2FEEL 4XMZA 4R2GC 5H35A 4XHJC 2BSED 4E41A 2BIIA 2KLTA 5I71C 2Q7YB 1TENA 2VDLH 4U3CA 4M1DL 1WFTA 1PY4A 4PBDA 2H8PB 3EGSA 1TTGA 4BSWA 1DANU 4HXBL 2NYYC 3RPKA 3GSXA 1FL3B 3I3BA 4L3ED 1BPLB 3Q1SL 1UC6A 5AVWB 3VFTA 3DRTB 2X1WL 4AVKA 2OMNA 2IO5A 3PWPD 4JDVA 5ALBL 1JXFA 2X4NB 2BZCA 2LR4A 2XNAA 3TO2B 3RHWK 1YRKA 4LPCA 1NCBH 2XV0A 1TXKA 3M46A 5FYKL 1QLFB 4Y19E 5KJ4A 2WKLA 3IGAB 5HBBA 5KN5B 2Z93B 5C0CD 5E2JA 5I17B 4ZUUB 5B3JF