2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
1J9TA 3AW5A 1AIZA 4X4KA 3FSVA 2FT8A 5B1JA 1A8ZA 4YSEA 4BXVA 1V55B 2UX7A 1PNCA 4G7RB 4ZK8A 1CYXA 1IKOP 1OE3A 5I6KA 4YSTA 1CC3A 3X1NA 3FQYA 2BWDA 5I6NA 1GY1A 3AG4B 3H4FA 1JZGA 2HRGA 3CDZA 3QJTB 4BWTA 1OCZB 2ZOOA 2UX6A 1ADWA 2JXMA 2VW6A 5I6MA 2BWIA 4JHVA 1KCBA 1EZLA 1L9QA 1I53A 2PPEA 4F2EA 4AKOA 1J9SA 4GP4B 1NDTA 2CALA 5B3SB 3TBBA 2VM4A 1XB6A 3OM3B 4FA7B 5LDUA 1NZRA 1JZFA 1BQRA 1J9QA 3ABKB 4WKXA 1SDDB 3SBPA 4L0PB 5AKRA 5E9NA 1E5ZA 4RH4A 5I6PA 2FTAA 1AG0A 3UGEA 4CSPA 1SF3A 4NB7A 4A68A 2UXFA 4QLWA 1SNRA 3IE9A 4DPCX 2YAFA 1WA2X 2XV3A 3WNJA 3ZX1A 1OF0A 2WSDA 1E5YA 1AANA 2HRHA 3NJHA 2VM3A 3FU9A 2I7OA 1GW0A 4DPBX 1KGYE 3EH5B 2Y69B 3X1FA 4M3HA 5PCYA 3IBOA 2TSAA 1L9OA 1NIDA 3IEAA 1SF5A 2LLNA 1N68A 3V9CA 3QQXA 5TK2A 1T5KA 2EIMB 3CVBA 1L9TA 2DYRB 4W9ZA 4E9VA 5B7MA 1PF3A 2PPCA 3ZIYA 1JZEA 4N8UA 5B1JC 1AQ8A 3EF4A 4KO7A 2IDFA 2UXGA 3NSCA 2IWFA 3TBCA 2GC4C 3PAUA 4G71B 4CSZA 3WG7B 1E67A 1NIBA 1ASOA 2IDQA 2OCCB 4DP5X 1JXDA 4A2HA 1WS8A 2IH9A 3NT0A 2BO0A 5B7FA 1KDJA 2XU9A 3FSAA 1AS7A 3FU7B 3OMNB 1PNDA 3SBQA 3FQ2A 2J56A 2YAMA 4KNSA 4AI7A 2IWKA 3QJRB 1DZ0A 4UANA 3JTBA 4YSSA 6PCYA 2FNWA 4UF7C 2X87A 1KCWA 3AG2B 1CUOA 3T71A 3UABA 4TXVB 1AOZA 1ZIBA 1J9RA 2FT6A 3ASOB 2GHZA 3T6WA 3UADA 1PAZA 1BXVA 4E9RA 5FC9A 2QDWA 4A2FA 3SBRA 8PAZA 1QHQA 4AZUA 2NRDA 1ET8A 1MG3C 1JZHA 3HEIB 4KOBA 3UAAA 3S3BB 1AS8A 1JOIA 3MBWB 1W6LA 2FQFA 2FQEA 1BYOA 3ZBMA 4UAHA 4K9JA 5TK4A 5B1BB 2MTAA 4M4RB 3BVDB 1SFDA 2QPDB 3WKPA 3X1BA 4NERA 1PZAA 1AZBA 2UXTA 3DTUB 4A67A 2BP8A 4AKQA 3GXUB 3T6XA 1BYPA 1GS7A 2Y1AA 4BK5C 1URIA 5I26A 1AZNA 3NP4A 1ET7A 1ZV2A 1WAEA 4AX3A 4YSOA 1FFTB 2QDVA 4F2FA 1ID2A 2RACA 3FT0A 1RCYA 2CUAA 1PMYA 1A4BA 4P5SA 3BQVA 2J5WA 4E9SA 1ASQA 2HZHA 3PXLA 1SJMA 4A2DA 1XB8A 1XB3A 4JHUA 4E9YA 4ENZA 3C75A 4DP1X 4DP6X 4KO9A 4YSQA 2AVFA 1J5CA 3TASA 1SDDA 1OE2A 4HCFA 4E9TA 5F7AA 1ASPA 2DYSB 1RZPA 2H47C 3NSDA 2IWEA 4NAJA 3D12B 2B08A 1B3IA 4G72B 4GP5B 1L9SA 2XLLA 1FA4A 4HCGA 3AG1B 4GY4A 1XMEB 2GI0A 2IDTA 4JKNA 3OD3A 3EHBB 5I28A 3KW8A 3RYMA 1W6WA 3FU8A 5I6OA 2PP9A 3QJQB 3S3CB 4KO5A 2HX8A 4YVNA 1VLXA 3U25A 2H5UA 2IDSA 1WS7A 2Q9OA 2YAOA 4HIPA 2BZ7A 2ZXWB 1BXUA 2TSBA 4GXFA 2I85A 4G7SB 2YXWA 3CVCA 4PCYA 5D4JA 1J5DA 3N2JA 1OCOB 2XXGA 2VSMB 2OJ1A 5ANHA 1IBYA 1NWOA 4DP2X 3ABLB 1GS6X 2VW4A 1M56B 1V10A 1DYZA 2CAKA 4YSDA 1AR1B 2EILB 2HXAA 1PLAA 3NJFA 3NJMA 4A66A 3NSFA 2XWZA 3FU7A 3NJKA 3ABMB 3AY2A 3CVDA 1KV7A 4HHWA 3T6ZA 1PCSA 2CJ3A 2MRYA 1AAJA 1JZIA 4E9WA 2QPEB 4YSRA 1KYAA 1TEFA 1ILUA 1ET5A 2XX0A 3GDCA 5D4HA 3WIAA 2UXVA 1PLBA 2GB2A 1BEXA 1JVLA 2R7EB 3FSWA 3MX0B 2XV0A 3GYRA 4KOCA 2YXVA 4MFHA 3EH4B 1AACA 1PZCA 2YAEA 2GSMB 2X88A 2DWSA 3JT2A 3PCYA 3N55A 4WTQA 3NJJA 2E86A 1GY2A 2P80D 1MZYA 3SQRA 4BXSV 2HLEB 3AG3B 3CG8A 3CZUB 3WNIA 4F7KA 3QPKA 4FAAB 3X1GA 2GIMA 5B1KA 2YAPA 3FSZA 1AG6A 2GBAA 3AZUA 1JXGA 2FQGA 2PCFA 4W1TA 4E9QA 2HX7A 3FS9A 5AFAA 2I7SA 3S3DB 2H3XC 3TU6A 2FT7A 1A4AA 1IUZA 1NICA 1AZUA 1N70A 2BW4A 1JZJA 2IH8A 2XUWA 7PCYA 1TEGA 3H4HA 5I5MA 3PAZA 3NP3A 3FYEB 5AZUA 3UACA 1CURA 5D4IA 5F7BA 1PY0A 3CDZB 2BW5A 1GYCA 2YAQA 1R1CA 2AANA 4GYBA 1UATA 3ZDWA 5I5JA 1NWPA 5PAZA 2YARA 2YAHA 3NJLA 4DPAX 1ZIAA 2BP0B 1JVOA 4KNTA 4KO6A 1CYWA 1X9UA 1KDIA 2XYBA 3FPXA 2BP0A 5I6LA 2Q5BA 2VSKB 1KBWA 1BQKA 1PZBA 1NIEA 1IBZA 1X9RA 3PLYA 3FPYA 1L9RA 4DP7X 4EF3A 4DP0X 2FJSA 4HCIA 2CBPA 4QKTA 4HALA 1OOWA 1EHKB 6PAZA 2BHFA 1NPNA 1W8EA 2A3TA 3IN0A 4PAZA 5IY5B 4YL4A 5B1AB 2P80A 3T9WA 2J57A 2FQDA 1WA0X 7PAZA 1MG2C 2JKWA 1HAUA 4YSCA 3FYIB 4HAKA 1ILSA 1E65A 2EIKB 2PLTA 3G5WA 1OCCB 2J55A 3OMIB 2XXFA 1M9WA 2VW7A 3NJIA 5EHFA 2DWTA 2IAAC 2EINB 2PPAA 1A4CA 2ZONA 2JFCA 2ZWNA 1QLEB 3X1EA 3IN2A 4DP8X 1JERA 3X2QB 3ERXA 3KW7A 2AZAA 2XVBA 3S8GB 1NTDA 3NJGA 1RKRA 1L9PA 1BAWA 3OQRA 3V9EA 1RZQA 2XX1A 2N0MA 2FWLB 1IC0A 3EH3B 3T6VA 4YSUA 3WI9A 1M57B 3OMAB 2XV2A 1E30A 1TKWA 2WO2B 5I5IA 2VN3A 2AZUA 2DV6A 4YSPA 4HHGA 3UAEA 4A2EA 1GS8A 1ZDQA 2CCWA 2AFNA 3H56A 2PP8A 1NIFA 4A2GA 1A65A 9PCYA 4YSAA 2OV0A 3NSYA 2W8CA 3QJUB 4DP9X 4E9XA 3NJNA 1NIAA 1ZPUA 3QJSB 1AZCA 1BQ5A 2IDUA 2PPDA 1SHWA 3ABGA 3HB3B 1MZZA 2PP7A 1BXAA 1GSKA 2R7EA 2DY2A 2VMJA 1MDAA 5B7EA 1YLBB 2YQBA 3S8FB 3PPSA 1KBVA 1JXFA 2PPFA 2B3IA 4Q89A 4HZ1A 1PLCA 1AS6A 4G7QB 2HX9A 4BDVB 3ASNB 2W88A 1WA1X 4P5RA 3QJVB 2EIJB 1F56A 1OE1A 1V54B 1A3ZA 2PCYA 4BDVA 4BWUA 1FWXA 4GP8B 1SHXA 4BWWA 4AKPA 3FQ1A 1HAWA 3PAVA 1NINA 1TU2A 1ETJA 4YVUA 1GR7A 2GC7C 3WKQA 1HFUA 1SFHA 1ZDSA 1OCRB 2BZCA 3DKHA 3NYKA 3DIVA 2QT6A 4N4YB 3L45A 3TA4D 4DP4X 2WO3B 4Q8BA 1QNIA 5A7EA 1NPJA 4KNUA 1OV8A 2BP8B 4G70B 1AZRA
chains in the Genus database with same CATH superfamily
1MLBA 2I60H 2X6VA 1AIZA 1OHZA 1VDGA 4Q56A 2IEPA 3ARDC 4F3FA 5T1LB 2H6PA 3FKUS 5KSAB 4WWKD 5KYYB 3PQYB 4ZK8A 1E8YA 1X6LA 3BWZA 1JNLH 4Y5VB 2ITEA 5T1LA 1GKOA 1UJ3B 3WFZA 4K8RH 2MIZA 4L3EE 2GUYA 2C34A 3PHQB 1DJSA 3UJTL 2JELL 1DVZA 3OX8B 1P5UB 1X7QA 4HJGB 4XHJD 3RFZC 1UJ3A 1RMFL 1UKQA 2CO2A 3PHQA 4OLWH 4GO9A 2ZQKA 3NACH 1L9QA 3O0RH 4HJGA 2KT6A 1W91A 3WS6C 3HB3D 4I1RA 2GJ6E 1F3JB 3LKSA 3HS8A 4NI3A 2YPKA 4MCYA 3O3AB 2PW1B 3KLSA 4L0PB 3U4BL 4L1TA 3ZKNC 4NQQA 3TYFB 4ZMTA 3GINA 2VQUA 4N5ED 4AW4A 4PJAF 4V33A 3C08H 4RAUB 4LCWE 4I1NB 2PW1A 5T3XH 3P9WB 2UXFA 5C0AD 4YPJA 1N6VA 1G7HB 1RJLA 3MLXL 3HAEH 1TTBA 3IE9A 4LF3B 35C8L 3PS6A 4HD5A 2DQGH 2P5EB 5HGBB 1T2QL 4L4TE 5LBGA 1E5YA 2HRHA 5IMMB 4LF3A 2VIRA 5JLZA 2P5EA 5HGBA 4DPBX 1KGYE 1NCWL 5DQDH 2H1PL 1NKOA 2IAMB 3TJEL 4KZEH 5LCVL 1I1RA 3SDAC 5IMMA 1IE5A 1E42A 2WZ6A 4TQPA 3RUGB 2XYCA 2IQ9L 3CFBB 1OAZL 2IAMA 1H19A 1Q1JH 4H8HA 2AGJH 2I9LB 3DUUB 2DYRB 3IFPB 4P2RE 4NNYA 3EDKA 1BGXL 3TFKD 3A21A 3VM5A 1B9ZA 4G5AA 1M1SA 4KO7A 4GS7B 5IFHH 1T4KB 5L88H 3T0DA 5K9KB 3C87A 5I71B 5EG6C 4F37F 2HPOA 4K3HA 5FUCC 4C56B 5DJDA 1T4KA 1XF2B 1NIBA 5JOEA 4JVPA 2VL4A 4WI7A 4C56A 2GBTA 4DHLA 2FHBA 1EJFA 5ETUA 3SKUD 4PJGA 4HGKC 1EO8L 4LPWA 1QBLL 1UEYA 3E6HB 1B0GB 2A6KB 4F7EB 1EDYA 2CO7B 5B21A 1UM6H 3RTQD 5JMOC 3GJFB 3QUYD 3OKYA 4UANA 3JTBA 2VR9A 4KVNL 4FYSA 4NLHA 3E6HA 4B0MB 5FYKE 4F7EA 4WJKB 2CO7A 3GJFA 3TBTB 4PJDB 4B96A 4UF7C 1KCWA 2ZT9C 3T71A 1CDYA 3MXWH 3CVIL 5AZEL 3KPLA 1WWWX 3TBTA 5CLZA 1UD3A 1FZJB 4LL4A 3G9AB 5JXEC 1PAZA 4ZX5A 2XVGA 1YECL 5KSBB 1MIEH 1RUAH 4UV7L 4KKQA 3JWDC 4PRPB 3SBRA 8PAZA 4JPVH 3QDGB 1RZ7H 4Z3FA 4OI8A 3BH4A 3HI6H 1E27B 4ODHH 3GEFA 4BFFA 1RHFA 3IGUA 3ZKQD 2O6EA 4JG0L 1CBVH 1A7RL 5C3TA 2VXSL 4ZS6C 5TH2A 4D0BA 1E27A 1U93B 1ACYH 5IQLA 4HUMB 3MUUA 3T09A 4P2QD 1IAII 3ARGA 1EK3A 1U93A 2X9XA 4AKQA 1PSKH 3H7LA 1CD1B 4BK5C 3MRPB 5DO2C 3NP4A 1UOLA 1KGCD 5CBAB 1JBJA 2RQ8A 4NWTH 2Y36H 5AW3B 3M6DA 3QRLA 3MRPA 3TNNB 4JGMA 4PRHE 1QWNA 5HHPB 3SE3C 2D31B 1O5PA 2VWEE 4H2CA 5I73B 1A4BA 1T1XA 2Y7NA 4P5SA 1OTUC 4OCSL 4X0NA 3TNNA 3A22A 1BMZA 2VB5A 3VCLB 5HHPA 2M26A 1D7DA 4U6HB 4XPGH 4Z7QE 2D31A 2PYFB 2HZHA 4QR7A 4ZD3L 2H9GB 3BPOB 2Z93B 2WOBA 8FABB 4Y4HA 4YDVA 4E9YA 4NHUB 1JUFA 4YSQA 1CD0A 1J5IA 3QFGA 1MDTA 2ZOLB 2H26B 2Z93A 4PJCB 4M5ZL 3C2SA 1F45A 1H5BA 2ZOLA 2H26A 4PJCA 3WUWB 2R4SL 3CZNA 3EO9H 3NSDA 3NRPA 2IGLA 4X7TB 4HWBL 2E27H 5SV4A 4K71C 2B9AA 3R8BB 2E4FA 3LMJH 3G04B 3F83A 1NCAL 1XMEB 4FLQA 3TT1H 2XWJB 1JNJA 3OHXA 4N0YH 3N42F 4AK1A 3V0VB 3ZUNC 4WI5A 1AFVL 3MRFB 4JFHE 2DIBA 2J1XA 4F57L 1VLXA 3VXSD 3MRFA 1FFNA 3BC9A 3RWJB 1DVSA 1QYGL 2DS4A 4XPBL 3OV6A 3O4LD 1SEBB 2Z4QB 1UENA 1DTUA 2H45A 2RTTA 2AP2A 3P0VH 1IQDB 3RWJA 4HP5A 1MPAL 4PCKA 3V55A 5F7HA 5D1ZI 1SEBA 3CFJA 4XNXH 4OI7A 5IROC 4M7KL 4LCCB 5D70H 2BY0A 1MXDA 5BO1L 5DJXB 1DBML 1FCGA 5FGBC 4LCCA 1MRCL 2X4SA 3DUHA 2DLIA 3MRDA 5GISL 4A66A 1NAKH 2NTFB 1NANI 5FGCE 4DZBA 3S37L 3EGSB 4PJ5A 1YZZA 2A99A 1KV7A 2LGNA 1YC7A 1HZKA 5KWYC 2NTFA 2E9BA 2WV3A 4AYMC 4OY9A 2ITDA 3OXRB 4OUOA 1AAJA 1FAKT 3EGSA 3IWUA 3A4DA 3AWEA 3RAJH 4NKDB 2OL3B 5J6SA 3OXRA 1MF2H 1S7VB 2EC9U 5A2IH 1JZ5A 1WFNA 1L7TH 5EZIH 4NKDA 1ODAA 4QT5A 2OL3A 4ORGB 4EXPX 4W4OC 2GTZB 5AVSB 2X88A 3VGBA 5DDHB 5J56B 3S36H 5IVXB 3VXPA 4X5WB 1YC8A 3VI3B 3ESOA 2GTZA 4L29A 5DDHA 4BXSV 1GIGH 4XMWA 5IVXA 3NIFB 2H2PC 2BXYA 1J1OH 4KK6C 3CN0A 1NFIB 2FIKB 4X6DF 2ZE0A 1NFKA 1WT5C 4F7PB 1QPKA 3RRQA 3VX1A 3QDAA 4YOKA 5I8KL 5E24E 3NGBC 1YG9A 2WO4A 3B2VL 4XTRD 3H53A 3VGEA 4F7PA 3UYPA 4PRNB 4W1TA 1R5WB 4YZFE 1WBYB 1JHLL 4E9QA 4OF3A 5KEZA 2O5ZH 1IUZA 3MZGB 3GO1L 3APFA 3KPMA 4QJ5B 3SE6A 4PRNA 3GNML 4NKOA 1WBYA 2B0SH 1CIDA 2P3YA 2R1XA 3QHZH 2D03H 3A6BL 3CVHH 3D85D 3GIVB 4QTHA 5FCSH 5K9JL 1IX2A 1D7CA 4ICWA 4P59H 4WUUD 3WO4C 6TAAA 1SBBA 1I9JL 4A7GF 1QAWA 3QIWA 4P2OA 2AANA 5A43C 4CSTA 2WAQA 3DX2A 3DOHA 5IBTL 3VFSB 3KBFA 3BAIA 4IRJC 3WTTA 4ODTH 2AK4A 3V4VB 5IT2L 5GS2D 1J12A 3FRPG 4I89A 2BH0A 4PB9H 2NR6A 1IC7L 2EXWC 1FG2A 4TSBH 4NNPL 3VFSA 4R9HA 5L4MA 2HLFD 5ADOH 2NDFA 4XP4L 1XCQB 5D9SB 1FNGB 1PZBA 3HJEA 5HHME 4P46D 3STLB 3ZL4H 4XBEL 3ZR6A 1OAKL 3DRQA 2H3KA 4LOFA 5D9SA 1FNGA 15C8L 4PN6A 2HA1A 4G7VH 5EU5B 1YSOA 5JHMA 4JB9L 4FEMA 4S2SB 1S7XB 3TEZA 2FUTA 4QY8B 2PXYB 3ZTCC 3CXFA 3T9WA 1WA0X 4WHYG 5F6HJ 2EUWA 3K72A 1EXUB 4WNJA 4TUOB 1VRSA 5CEXB 3H2WA 1T89A 1E65A 3AWGA 4XRCB 1FP5A 5IJVB 1F1GA 4P07A 4IBYA 5HJBA 3W56A 4CMHC 5I0VA 5EF3A 3CBKB 4XVUD 4GKLA 2B2XH 3IJEB 3P30H 4NCC2 4XRCA 3VVWA 2GY7B 5IJVA 1LHZA 3AMLA 4WI0A 4FFZA 3I50L 3MJ8B 4PY7B 4ACPA 3O9WB 5GZOA 4AQ8A 4FNQA 3IJEA 1EERB 1KXVC 4EI5D 5CP7A 3D07A 4G80A 3C8DA 3MJ8A 4HBQA 1AHKA 3O9WA 2F5AH 1GGIL 3FN9A 1BQLL 1RIHL 5GGVY 3AACA 3NABL 5CJQH 4NIYE 5D7JC 4HCRL 5JW3H 2W94A 1HNGA 1XGQA 3QJXA 3IXTA 3UAEA 1QVOA 2VXQA 3L5XL 2AF2A 5LQBH 1E3FA 5DJZB 4YZWA 4N0UA 1T5WB 5E51A 4OLYL 5AOKA 1DVFD 2XBDA 5LLIC 4FNTA 3JZYA 5EN2B 3L48A 4CGUB 1A3QA 3QJSB 1T5WA 5E6SB 2EVGA 3HB3B 3O3EA 1TETL 2WXKA 4TUKH 4X9BA 2ICEB 2A6DA 2W0PA 3QAQA 3RDTC 3VXTB 1MDAA 2JLPA 4MYWB 3GUFA 4Q89A 3WKNA 1MCJA 2ICEA 3HI1B 3VXTA 3QCUH 4PJGE 5C0AB 1F58H 5A2JH 4ZUUB 3F04A 3CFUA 1F18A 4KDTC 4ZUTA 4HU2A 2X40A 4NO5A 2XRAL 3APCA 1WUNT 3S5LB 4RGNE 1O7DE 5ECJE 1SQMA 5E8DH 4D3CL 4LOVA 5E8EB 1NINA 3CSBA 3MA9H 3GM8A 1F4AA 1KIRA 1GGUA 5I30H 2OMYA 2J21A 5E8EA 3QXDB 4OGYL 2OR9L 5GGQH 4N1CA 3AUVA 2XTJC 1E5BA 2HRPL 1H6UA 1O0VA 4FG0A 5DLMH 4X8GA 2KDYA 1S7WB 2IADA 1EJ8A 1MJ7H 4GW1A 4LHUG 1CZ8L 1YPZA 1S7WA 3WEAA 4FMVA 1GY1A 2I60L 3OLEA 4W9EC 5AVVB 1E6JH 4UQCA 3T2NH 4K23L 4MZ3A 2XG4B 4RDQG 4DETA 1JNLL 4OLEA 1X7TA 3KLAA 3SB3A 4K8RL 4Y4KC 3BKYH 1OANA 5BNXD 2FWOB 2XG4A 3QUHA 2G0KA 2WKGA 2OTUB 4Q52A 4L5FE 3HC3H 4IGBC 5D1XA 2CALA 3IXAB 1RFDH 1VFAA 2D9CA 1WFOA 2VZOA 2FWOA 1QEXA 3C8KB 4OLWL 2WGNB 3NACL 4LP4A 3O0RL 3QUYB 4HS6A 3RY4A 1IAKB 2YMOA 4FQCH 3C8KA 5MENA 1M2VB 4YN3A 4TMPA 1NBVH 4GMSH 1IAKA 4QLWA 3VFVA 1M2VA 3PWUB 4JFVA 3HG5A 5E70A 3GMNB 3C08L 3KEDA 4HKBB 1F6LL 3PWUA 5CUSH 5T3XL 1KV3A 1SXSA 3VTAA 2JJSA 1UOVA 5LGHH 4O02L 1KUMA 1P7QB 3GMNA 2DQGL 2YD3A 3LKPB 4HKBA 5IOKA 2F68X 4LPCA 4RMVA 1AOHA 2LLNA 1P7QA 3TA3B 1ZLUH 3JV4A 2WB1A 1LVEA 4PLKC 1G7IB 4AM0B 5DQDL 3K2UH 4TF4A 3W39B 5AYUL 4KZEL 2GTWA 4MQ7B 4XCNA 3TA3A 4P2QB 3BVTA 3QISA 2L4OA 4AM0A 4PW4A 4FKEA 1G7IA 5C0BD 4M5YH 3W39A 1Q1JL 3PWPA 1TJHH 2AGJL 1MRFH 4FFYH 4JO4H 4MQ7A 5A3IC 3RKDD 4I9WE 1R9FA 4HOMA 3BH8B 3QI9B 2RGSA 1TZOA 3FUJA 5FS5A 3QEUB 2A2QT 2FHFA 4LRIC 3QI9A 4IKLA 2X28A 3GZKA 3QEUA 2FH6A 3MAWA 4OF6A 4K0OA 4KKCC 2IH9A 5I0ZA 5DS1A 3FQXB 4PJBB 1IEAA 4XB3A 1BVOA 1XF1A 2WXRA 2XSKA 4WCYH 1UT9A 3FQXA 1I4FB 4PJBA 1N0XH 4M6OH 5E56A 3QWOB 2QHLA 5JTWA 5G5DB 2Q10A 1I4FA 5GGTH 2D9QB 5G5DA 3BCDA 4J3TA 3L8QA 1UM6L 4Y9CA 5C92A 4TXVB 3UZQB 4NQCE 4MNQE 4Y9EA 4B9JA 2K8QA 5FWQA 2GHZA 4PJ5E 3UZQA 1U3HD 5SWSD 2JKIS 2KHAA 4LEEA 4XR8C 1YDPB 3N1QC 1QHQA 3MXWL 4XWOC 3HEIB 1RP8A 3S3BB 1BFTA 4ANWA 3D39D 2F53A 1YDPA 2BNQD 1MIEL 1RUAL 4F2ME 4QEGA 3ZBMA 4UAHA 4PSRA 2VDQH 4LKXB 3DUSB 4JPVL 4JRYD 4WJ5B 3CU7A 5D8JH 3VXSB 1RZ7L 3WKPA 3HI6L 4ODHL 3QEHA 1NJ9A 3AVEA 4LKXA 3VWKD 4WJ5A 1CBVL 2E7CA 1S5HA 3EYVB 3O4LB 1MHPH 2EDQA 3N1FC 1DQMH 3DV4B 1ACYL 3DVGB 4IBQA 1AO7B 3IWVA 4R3SB 1H3TA 1BQSA 1ZT4B 3EYVA 1UASA 3IMSA 3BPLC 4YSOA 3NCFB 2NY2C 3DV4A 1DJGA 1ID2A 1PSKL 1AO7A 1ZPLA 4OIIH 2ODIA 3ZKMC 4R3SA 4JKLA 2LQRA 4POYA 1ZT4A 4ZQKA 4AVIA 2APFA 2JKLA 4FN0A 1DSYA 2YGNA 2Y36L 2AHIA 3S5ZA 3MRNB 5E1AB 5JOPD 1O5DT 3R1GH 2IO5A 4D8OA 1VAHA 4DP1X 3FB7B 3IMRA 2NUPB 3IT8D 4XPGL 1TNNA 2IIJA 3UMNA 3M1BB 1K2DA 4N0CD 5AOJA 1RP9A 3CXHJ 5FYJD 1H3VA 2EC9T 1MVUA 3TM6A 4GG6B 2NUPA 3G6AA 2P5WD 5F7AA 3WGUB 1NGYB 3ROLB 1MCDA 4HWNA 3CCHB 4K3DH 2GW5A 2AK4E 5HGAA 3GC3A 1SZNA 1I85A 1NGYA 2J1KA 3CCHA 4ONHA 1UVQB 4KGJA 4MWFB 3WE1A 3BQUD 4GY4A 1U8LB 3EO9L 4LOUC 3U83A 1I9IH 1UVQA 2E27L 4MWFA 1F2QA 3FU8A 2NNXA 4YO0A 1P69B 2DWEB 1U8LA 2AJZB 3LMJL 3NZHH 5IHLB 2K6ZA 3TT1L 5J4MA 3F7RA 4N0YL 2FYYB 2AJZA 3BZ4B 3SBWC 5A6LA 2Y6SC 4KI5E 4DUWA 1ITCA 5KBMA 1UH3A 4P23B 2YZ8A 1FBIH 2BX5A 4IOFC 4LDCA 1T83C 5JHDE 2WWMD 2XN9D 4FFVC 5IOPA 5D6CB 3VYOA 1YRKA 2H8PB 4P23A 2GITA 3V10A 3VRJA 3GSNA 3D85B 2C9PA 2VW4A 3P0VL 4HUWB 4IRZA 4FLRA 5DCCA 1ZK9A 5J6HB 4ISVA 4WUUB 4DERA 1MNUH 2H8PA 4PEEA 3K46A 3NN8B 4FI6A 4XNXL 1JYXA 4BQ9A 5KAQG 3KBHE 5SWQB 3D85A 4IKIA 4MNGB 4IOSD 1G6RH 1PLAA 3AADB 4WUUA 5D70L 3ULVH 2ENPA 3NN8A 3RL2A 3MNDA 1CF8L 5ICYA 5SWQA 4MNGA 3U9UA 1R17A 1JPST 3FCBA 4ZRGA 4HHWA 3QDMD 4K5PA 1KYOJ 3KH3A 4E5XA 5HI5C 4AUJA 1NAKL 2DQIH 5I1AB 2F1EA 2R1WB 5JPMA 1WC7A 1IKFH 2NY3D 5A2LH 4FF9A 3M1CA 2H2SC 5AVXB 1DO6A 3AROA 3FU0A 3IE4A 4N0UE 3RAJL 2VYRE 1C16B 2OXGA 4NFCA 4NOBA 2Z1PA 1E9QB 1FSKB 1MF2L 3MRCA 3N55A 4I7ZC 4WTQA 5IHZA 5EZIL 1L7TL 4O58H 1CE1H 4RMUA 5J6GB 1O6SB 1SLWA 3DXAA 5IK3A 3ZE1E 1E9QA 3VGAB 3GM0A 3QJZA 3I3BA 4ZO8A 4MZIA 3S36L 1S8DB 2K3HA 2XQBL 5EV7A 1BECA 4L8DB 4H1LH 1GIGL 1U0QA 3KYKH 2VZ3A 1J1OL 2F6AA 2V3DA 2F9BT 4L8DA 3C6LC 2E6JA 5H94B 2VITB 1LK2A 1RZKC 4TNWK 3VXME 2I7SA 3S3DB 4MMZC 3T3PB 5I8EA 2LTQC 2ZJSH 3V0EA 3QW9A 5H94A 3BIKB 3CSGA 1RK0A 3WN5A 1S7RA 4NP9A 4X9FA 2ZKHH 4EI5B 2BIIA 3E0GA 4YHKH 4XP5H 1J1XH 4P9HH 3BIKA 2O5ZL 2TRHA 4KV5F 3KGUA 2B0SL 5KUKA 3QYMA 2BW5A 3QHZL 1BG9A 2D03L 3CVHL 3VU2A 3SODB 4R84A 4DPRA 3RGBA 1WE5A 4P59L 1W0VA 5IHWA 3LKRB 2VLJE 2QZQA 1DVFB 4Z7NF 4NRZB 1CYWA 3IGFA 3C5JA 1YPZE 2WVSA 3KPPA 4F33B 4ODTL 4OF8A 4ILDA 1GCFA 4NRZA 4MAUH 4PB9L 4TSBL 3KLDA 3FN0H 4F33A 1PGRB 4OQTH 1IBZA 4DP7X 5FLVA 1EEUA 4GW4B 3QJOA 4AMXA 2WLZA 4HU8A 2Y23A 3RGHA 5ADOL 4PGCB 4U3CA 1OAYH 5EMYA 4KBPA 1PFCA 1MCRA 5GGRY 1FO0A 5D1XE 5AW7B 4L0ZA 2P80A 4PGCA 4Z95H 4PRID 3QYNA 1IFRA 3WY4A 4G7VL 5LKNA 2DQMA 3FT4B 2IC2A 5MENE 2JKNA 3CFEA 2EEFA 2WY3B 4WGKA 1ZE3C 3D34A 3FT4A 2ZCZA 3PJLA 5BRQA 2VRAA 5TDPA 3ZKXC 3LQZA 3EOBB 4UOW0 1UADC 2Z8WC 5IW6B 2XDHA 2X0VA 1H3WM 1UA3A 3W9EB 4D2NA 4B5EA 1BAWA 2NY6D 3B3IB 5C07E 3OQRA 3NIGB 5I6XB 3P30L 2OFQA 3T2LA 2VR3A 4D0DB 3I85A 1RZQA 4GAFB 1W0YT 3W9EA 4A7TA 1IE4A 4ELME 4OH2A 1HHJA 1N8ZB 1OPOA 5BRZB 2KI6A 4N2HA 2JKSA 4ABVA 4EVNB 2F5AL 4GXUM 5HDRA 3ZQ9A 5B8CC 3QS3A 1A14H 2AFNA 4J3WA 5CJQL 4A2GA 4X7CC 5BRZA 4MZRA 1PAMA 2DTMH 4BHUI 9PCYA 5JW3L 4FCHA 3T3MB 3H8NA 4EVNA 2ZXEB 5GIRA 3BZFB 3PWPE 4MX7B 4AYBA 5CWSA 1G7MB 3OB0K 4XVJH 5LQBL 5JW5B 3BZFA 4CKVX 4FI7A 4GNKB 2DQHH 4LBEB 1JDCA 2GSIA 5MHSE 4OCXH 1QSFD 3CHSA 2EEAA 3K4ZA 2OSLA 4LLDB 5JW5A 3PPSA 4Y9BA 1HN1A 2CM5A 4LBEA 5HHQB 3HTLX 1UCTA 4XC1H 1P7HL 1AS6A 4PRDA 4BCYA 4MLSA 2FBJH 4TUKL 3LRSB 1KLGB 5CEYA 4UOJA 2X4OB 1CDBA 4L2YA 4DH2A 3DV6B 1KLGA 3LRSA 1QRKA 4PJXB 2YD7A 1F58L 4PIRF 5IMLB 4ZAKC 3RVXC 5HHNB 4R4FH 4HX1B 3DV6A 4MHHG 2PYEA 1UGKA 4J1UA 2GC7C 5IMLA 4MJIB 4GG6F 3CFMA 4HX1A 5E8DL 5FAAA 1YYLH 4ZS6D 3MA9L 4KRPB 3OXSB 4MJIA 3D3VB 4MQXD 5I30L 5L7XL 1NOFA 1WLHA 5C0BB 1AKPA 5GGQL 5KSUB 3D3VA 5I76A 3UCRA 3QDJE 4RFNC 3GBEA 3V6ZB 1DANT 2F53E 3HIZA 4NP4H 1AKJD 5DO2D 3T2PA 5DLML 1MW1A 1YYMH 4YGAB 2BWDA 3RVTC 1UWXH 3H4FA 5KSUA 3Q2WA 4QRUB 3V6ZA 2JJTC 1YEGH 1MJ7L 4Z7UF 3BRFA 4QRUA 3VW3L 3ROOA 2VR4A 3L95A 2IBBA 1E6JL 4MCNA 4BZ1H 3T2NL 4PLNC 3L3HB 2WXQA 4FYQA 5ILTH 3JV6B 4FEIA 4PVNA 3ZW3A 5G55A 3RWCB 2VM4A 1XB6A 5BRPA 3KPNB 2YMTA 3L3HA 3O3DB 1DDHB 3BKYL 4X7EC 3S4SA 4RFOH 3PHSA 3RWCA 1HEZB 3QE5A 1ORSB 4GKZA 4K94H 4L9LA 4FKHA 2D7MA 3UZVB 5DD3H 3KDMB 1RFDL 1DDHA 2O6FA 3O3DA 5I9QB 1SF3A 5FK9B 1HEZA 1A3RH 2L04A 3BHBB 4AQOA 3UZVA 4XGZA 3KDMA 4FQCL 4LPXA 1QSVA 4BH8B 3CHPA 5FK9A 3PWLB 3DO3A 3IDYC 2YIHA 1U3HB 1NBVL 4JBSA 4HAFA 2CKNA 2COQA 3P54A 3PWLA 3HZYA 5F93C 1C12B 1PPIA 2BNQB 5T5FH 1MH5B 2AV7B 5CUSL 1SF5A 1QLRB 3D0LB 1C12A 4JRYB 4JG9A 5B7MA 1BFOB 2MTPA 4BFKA 1QLRA 3VWKB 3D0LA 3VFNB 5HVGB 4B9IA 3F7LA 2OMWB 4BKTC 2IDFA 3FQTB 3TBCA 3KPRD 3K2UL 3VFNA 5D2NB 3I74A 2OMWA 3GQFA 5CR8A 1OW0A 1FNLA 4JY6B 2CRZA 4M5YL 2AEIT 2BWQA 3RVUC 3L7FB 3UTZB 4JO4L 1TJHL 5D2NA 1MRFL 4GXVH 2B1HH 6CGTA 1ROCA 2AV1B 1JGLH 3WNKA 3IFNH 3FZUD 2JSFA 4GSXA 4WO4A 2QKIC 3OAUH 1G7LB 3L7FA 4LSDA 1P53A 5CN1A 5EU7E 5AW1B 2WLIA 2ZUSA 5I24A 2AV1A 4NQTA 2ENSA 3FU7B 3E1F1 3R7RA 4ZSOB 3GKZA 3Q7JA 4JHBA 1XH3B 2J56A 2O6DA 1H9DA 2CLVB 2WQWA 3T3PF 4ZSOA 4JGNA 1LMIA 1GYUA 4WCYL 4LVOB 3KJ6H 3ZDZE 2CLVA 1YNTB 4OJAA 2P5WB 1N0XL 4M6OL 1JGIA 3GMOB 3KDPB 2O93L 2YO3A 5GS3A 4BK8A 4IQHA 4WSJA 2APTA 1YNTA 2JKTM 3GSOA 1XCWA 3GMOA 2ZPKH 3IDGB 4LPYA 5GGTL 1HHKB 4BELD 2QVTA 2WLHA 3BQUB 3IDGA 4RA0C 3QG6B 3N0AA 5FXCH 1VFUA 2JCCE 4K8RC 4O5LH 5DD6B 5I1DB 4AV5A 1RUQH 1VA9A 1S46A 2FBOJ 4GPVA 4G42A 2QPDB 4YXHH 4U49A 3QEGH 5I1DA 1PZUB 3VFMA 5I1EH 1RIUL 1WBXB 4NUJB 1AZBA 2M8XA 5E9DE 2VDQL 3WBDA 1MVFA 5FUOH 4F1ZA 5D8JL 1T22B 2XN9B 5HHOA 3HAEG 2LU3A 1MHHA 3LPOA 3T2OA 1MHPL 1OAUL 4FDWA 3REVA 5L9DH 3ZT7A 3WY1A 4M02A 1DQML 4FZ8H 4GW5B 3AU0A 4FQLH 3KWWB 2LU7A 4PJ9A 3IJ7A 4EJ1C 4OIIL 1IVLA 3KWWA 4BFIB 4JAMA 3F65A 3O8XC 4U1GB 4IRJD 2YD6A 3L3OC 3ET9F 3K2KA 1F11B 3QDMB 5CGMA 3MYJB 4BFIA 4F8TA 5I15H 1CGTA 1R3LB 2MEJB 4MAYD 1DQVA 1N2RB 1TZHB 3R1GL 3NIGF 1INDH 2OMNA 3MRJB 3QDMA 4HCFA 5DK2B 3MYJA 4TS6A 4NT6A 3FQNB 2G75B 3QUXC 1KN2H 4LGPB 4WW2B 2HN7A 3SZ6A 3MDJA 5J13C 5DK2A 2X2IA 2JJUA 2OP4H 5CJ8A 1J86A 5HHXH 2A73B 2G30A 3A5VA 3PGCB 4GQQA 2A73A 2WMPB 1TJXA 4K3DL 3PGCA 4N6QA 2BIMA 3HG0A 5F0JB 5B4MD 3QFJE 2WMPA 4C8XA 4XXDB 5IBUG 2WP3T 1CK0H 3VDAA 4JN2A 2R29H 3L9BA 2OL3H 1I9IL 3GI9H 2CGRL 5CIPB 1MJJB 3NZHL 2HG5B 4G7SB 4E9LA 1J5DA 5CIPA 1MJJA 1LE5B 3B34A 5F7FA 1TJIH 3WS3B 1IBYA 4Q6IC 1IIKA 4FFTA 4N3UA 2J6EH 2B16A 3BVUA 3J2PA 3FO0H 1FBIL 2W9EH 3LKQB 3M8OH 4HLZH 3WS3A 1TKWB 3HZVB 5CEZD 5D7JD 5FOJA 3GXFA 1I1AB 2Q3AA 3L3KA 5EUKA 4IU2A 4EIUA 1S78C 4F80A 5JOFB 1N0LB 1I1AA 1MNUL 2VH5H 1YEEH 3ABMB 4IMLB 5IB3B 4B9YA 2ZSVB 3RIAF 3CX5J 3HR5B 1G6RL 1N0LA 2DMHA 1NL0H 4IMLA 4HA1A 4NZ8A 2E3VA 3RJOA 2VCOA 5D96C 5FHAH 3RDTD 5ESVB 1R0AH 2DQIL 1YY9C 5EPMB 3B9VA 1IKFL 2PO6B 4PFEA 1CCZA 1S9WB 5ESVA 2J25A 1Y1UA 2E86A 2DEYX 4UQBA 1QFUH 2PO6A 5HHVL 3V4VH 2VDPB 3MJ6A 3SQRA 1S9WA 3VACA 5TFSH 3GUTA 1HYSC 1ZT1A 4PRIB 4Y5YA 5INDB 3BEVA 4BCXA 1AY1H 4K5NA 4A7VA 1WZ1H 1U58B 1CE1L 4O58L 2FR4A 2AI0H 1NBZA 2YUWA 4J2QA 5INDA 3V6FB 1VZGA 3KR3H 4LKCA 1KBGH 1S7QB 3F84A 1ZLWH 3WMQA 1BFSA 1HCFX 3KYKL 3TU6A 2XTJD 5L0QC 2VN7A 1BIIB 2X1XR 1N70A 5AW4B 5DWPA 5A2KH 2NY6B 3OKOB 3SCMC 1PX4A 3IBEA 1BIIA 3OZ9L 1MI5D 1H3UA 1UHVA 3VJ6A 4Y1AA 4JFZH 2PYEE 4HC1H 5F7BA 4M1CD 2FB4H 4TSAL 1PY0A 2ZKHL 3E8UH 2QJDA 3UTTA 3D4GA 1UD5A 3L4TA 4YHKL 4XP5L 1J1XL 1YEHH 4P9HL 3W5MA 2CIKB 4LHUD 1AGEB 3UJJH 1AD9B 3GJFK 1W72B 1WV7T 4UTBA 2D0HA 4Y2DC 1WH0A 1RHHA 1AGEA 1FFQA 2XYBA 1KPRB 4JRXA 1J0ZA 4ADGA 3B2XA 2J71A 4DK3A 3ARBA 3G08B 4F7CA 1QSFB 1R34A 1RVFH 2ZX5A 3I6KA 2VXQH 3DSNA 5EUOB 3T65A 3BRGC 3L4CA 2VL5B 1P6FA 1U8JB 3FC8A 4MAUL 4CVWA 3IB4A 4F15B 3LH9A 3ZE0E 4WLCA 3FN0L 5EUOA 3ZHFA 4OQTL 1U8JA 25C8H 3DO7A 3HRZC 1M9SA 2CZNA 5I1LA 1GGCH 1OAYL 2ED8A 3LRGA 5E08H 4HPHA 1IBFA 2MQGA 5IB4A 1F86A 3NJIA 5EHFA 2ISDA 4Z95L 1DQQB 1IAIM 3X2QB 4J7RA 1ZHKB 3QUZB 1N7MH 2IALB 2WBJC 3DX6B 3O6FD 4JFEA 4EIZC 3G6DH 3MCYA 5F7DB 4F92B 3GWJA 1DQQA 4AY0A 5IB2A 4BZ2H 4LARH 1I7RB 3L13A 3SDDC 3QUZA 3UDWA 3DX6A 3FAXA 4LASH 4H0GA 2ZAHA 5F7DA 4ACTA 5A3ID 1AKJB 1FNFA 3VG9B 1E30A 4WFFE 1KCVH 1KTCA 4HHGA 1AKJA 3QRBA 4WWOA 4RX4A 1D2PA 2UZXB 3T77B 4GMTH 4CVZA 5E8PA 4KKCD 4E2OA 1S2EA 4AYGA 4XMTA 2E75C 1X9QA 4PJAE 2X6CA 5C0JB 1YAIA 3T77A 2TAAA 1A14L 1DVYA 1NIAA 2XWBB 4M5SA 4S10A 3WIIH 3U6XA 1S5IH 2DTML 1OM3L 2AJUH 5C0JA 2PP7A 2E59A 1K4CB 3DLQR 3S2AA 1TQTA 4XVJL 1UXWB 2B59A 3QORB 2CHZA 5CGTA 4DGWC 5IKCB 3VX0A 8CGTA 3W0WB 1K4CA 1HHGA 1PLCA 3VGGA 2DQHL 1GYVA 2WNXA 1WO2A 4OCXL 1UXWA 3QORA 3VXQB 3N0PB 3W0WA 2BNUB 2FSDA 4XO5A 1NC2D 3EHBC 1OE1A 3EOYG 1Q4NX 3V8CA 4XC1L 4K71B 4BWWA 2W91A 1LJMA 2FBJL 3VXQA 3D4YA 4N26A 1AIFA 2BNUA 3FB6B 3NDZE 5DJ0B 3T4AC 2DQ6A 2FZ3A 4U7SA 4PJ7B 4FNPA 4WI3A 1D6VH 5DGQA 5EH1A 4TTGA 1ZA6B 2BSCA 5DJ0A 3STZA 1UFGA 3PJSB 3R0MA 4APQC 3SZKC 2V37A 1JCVA 1VEPA 4R4FL 2WNWA 4A04A 3DETC 1ZA6A 2WLLA 3L4YA 1CGWA 2BRQA 4OM1H 1KGXA 5L2JB 4G70B 3FFCB 3EZ8A 4YIQB 2VKWA 4N9GA 3FSVA 1YYLL 3KPRB 3ZYJA 4G7RB 5F1SA 5L2JA 3HJ0A 3FHEA 3FFCA 2C5DC 2EDDA 4Q4IA 2NYZA 2F15A 3ML8A 5K1JA 2F58H 3CDZA 3QJTB 2BLFA 1LWRA 1UWEH 1YUHB 3FB8B 4NP4L 3TPUB 3RWHA 3H9YA 4U1JB 1SJEB 1YYML 2H6UA 2Z7YA 2VN5A 1XWVA 3MCKB 3FB8A 1YEGL 3TPUA 4U1JA 3MV8A 4Z7OF 3OJMB 1DN2A 5HHOE 3L5JA 3MCKA 1T7ZA 4FA7B 2A9CA 2OI9B 3P0GB 5I75B 1CI5A 3UP1A 4F20A 4BZ1L 4IJ3C 4AEFA 5C86A 5ILTL 3ARZA 4OIBA 4DQOH 4X7DC 4C57C 2YFNA 5LNDA 1XZ0B 4P4KC 1NANH 4CNIB 4N5UA 4RFOL 2WQ8A 2P1YA 2QVFB 4ADIA 4K94L 5DD3L 4OV5B 2GI7A 1FNHA 1XZ0A 3PF2A 1VESA 4CNIA 1FIGH 5GQBA 1OF0A 3N04A 2OMUA 1A3RL 3JUYA 3JWNH 1PJ9A 4AEIL 3WAJA 5CBEA 4JQXC 1QR4A 2Y69B 1F97A 3C09C 3QPXH 4LOUD 4G6KH 5ITFA 4PG2A 1JPEA 5DHYB 2AQ3A 2N59A 2YPVH 3V9CA 5JHAA 2P8PB 2Z31C 2C3VB 3IFOB 3CVBA 4L4VD 1TTAA 4D9QD 2JKXA 5DHYA 3NEOA 3HS0C 2P8PA 5T5FL 2BSBA 5DFAA 5H35B 1U36A 3OKNB 4IOFD 1U8PB 2A74C 2VMEA 4FFVD 5H35A 3MOQA 3QO0A 5AVQB 3IMVA 1XV8A 1U8PA 4P4RB 4J6RH 2W81C 3AM8A 4PB0H 4GRWF 4P4RA 2DLGA 5E1QA 2IMNA 5AG9A 1PKQE 4GXVL 4MYPA 2B1HL 4O51B 4YWGH 1JGLL 3IFNL 5GRXG 2Z8RA 1IBHA 2IH3B 2YAMA 2FBRA 3OAUL 4AI7A 5B39B 4O51A 3C60A 4EI0A 3X3GH 4MAYB 2N1TE 1FGNL 4J8QA 3B6SA 1H3GA 4MAYA 3UABA 3BGMB 3F05A 4LT7A 4BFRA 1XGPB 5CJOH 1IAOB 3ASOB 3ZQXA 4TRPH 3KJ6L 1BWWA 3BGMA 2IXQB 1BXVA 1HH9A 3RFRA 4J28A 4X6EA 1XGPA 4ODBD 5EC1B 1CFSB 1IAOA 3Q06A 3F5WB 4I3SH 4LPUA 5DVLA 2ZPKL 1KJMB 2N01B 3ES6A 5EC1A 4Z5RA 1CFSA 3V79C 3HA0A 4ALAH 4FERA 1A8JH 5TK4A 5E9AA 2C7UA 1HSAB 4GXUN 2XZZA 3PPEA 4IU3A 1DZBA 5JMRA 4O5LL 4PJIA 3J7HA 3IU4H 1PZAA 1HSAA 2UXTA 4HBCH 2HFTA 4GQZA 1TO4A 1RUQL 4MSWB 3C6LD 3MOAL 5TF0A 2BP8A 5E6UB 1N59B 3PV6B 3HC0B 3T6XA 5CD5C 4YXHL 3QEGL 3MREA 5D1QA 2JI2A 4MSWA 4YS4A 5I1EL 5D7IB 2BSTA 3HC0A 4TTDC 5FUOL 2RACA 3TCXA 3ZHKA 3HZMB 5IESH 1CFNB 4FULA 3F8UB 3CN2A 3S3PA 5AUMB 3BQVA 3HPJB 3NZ8A 3HZMA 4FLSA 3OAYK 3LRMA 5L9DL 2RMNA 1X5KA 4Y2LA 1KNOB 1KC5H 1MY5A 1P6AB 1M71A 3P0YH 4FZ8L 3CIAA 4FQLL 5FECB 3FUNA 4A2DA 1OL0A 1YEIH 3X11B 4N2DA 3ESUF 3BSZA 5CSGA 4BFBD 1E9OA 1QLEH 1MLCB 3MMEB 5FECA 1LP9F 4Y1AE 4FTVD 4NO3A 4JW3A 4UIMB 3WJJC 4NOFA 1IKNA 4OFPA 1ASPA 3UTTE 2DYSB 1MXGA 3TO2A 4FXKA 4G1MB 3RDTB 4UIMA 1INDL 4X6DE 2Q76A 1HIMH 2A5UA 3QUGA 4KHTH 5L4JA 4XBGA 2BDNH 2WZPD 3H7BA 1KN2L 3MV9E 4G1MA 4HJJH 2IDCA 3QIBB 3QXAA 3KWTA 2EVJA 3VXNA 2F54B 2BINA 2OP4L 4QIRA 5HHXL 3UIYA 3E8VA 4PG9B 2NXYC 4QHNB 5GS2H 3FO1B 4MKMA 4JRXE 1Y6KR 2R2HA 3QIBA 4HK0A 4KROC 3NQIA 2F54A 3CGTA 5JO5A 4PG9A 2O5XH 1QRND 3FK3A 2X41A 3BCFA 4GLRI 1E8ZA 3IDMB 4X8XA 4MDJB 3NK4A 3VRIB 3QH3A 2XA8H 3VNZA 4YFLI 1L3WA 1ZA3A 3D69A 1I1CA 2FGWH 3IDMA 1CK0L 2CO1A 2I85A 2Y7QB 3GXDA 4MDJA 2R29L 4G43B 2WN3A 1GOHA 2OL3L 4FQHB 3GI9L 5DD5L 5AENA 5I1CH 5FA3A 1G0DA 4QF1B 2GTQA 2RD0A 4FQHA 1CYGA 1GS6X 1GOFA 1TQBC 1MI5B 2OSXA 5EFIB 4NKQB 5IIEB 4B5ZA 4Q9CA 1TJIL 4U0RB 3AITA 5JPNB 1JRHI 3VXRD 4QF1A 4PJ7F 4XOAA 4ZMXA 2A83A 4JX0A 1PZ5B 2J6EL 4UQDA 4JFEE 4X7SH 3WEBA 3CFKA 3FO0L 3M8OL 2W9EL 5K93A 5JPNA 5L4FA 4C83A 1PZ5A 3CSPA 1O75A 1W0WB 1Y18A 5LN4A 5I8OH 5BZXA 4LVNB 4WFEE 1QI3A 2QPEB 1IM3D 2VH5L 4KX7A 1YEEL 1ZS8B 3VMNA 4A39A 1W0WA 1QQDA 1T1ZB 5HSFA 4JZOA 4C58B 3MX0B 1HILA 1SY6A 1ZS8A 1NL0L 1R47A 1V7MH 2CJSA 2K45A 2VMCA 2YBRB 2IGTA 3MTXA 3KXFD 1T1ZA 4XB8A 5DMGC 1PZCA 43CAB 5HYSA 5JORB 3HHRB 2GJPA 2YBRA 5FHAL 1I8IB 1O9VA 1L0YA 43CAA 4H8VA 1R0AL 4W6XB 5JORA 2XG5B 1MZYA 4Z7VF 4ZFZB 2PETA 1I8IA 2CUMA 1EVUA 2R51A 4OCYH 3CG8A 4LQ1A 1TQWA 5CSZA 3CZUB 2EYSA 3W11C 2XG5A 1XGYL 3ATEA 4ZFZA 4ZAKD 1QFUL 3RVXD 4P5TC 3V4VL 4I0CC 4YDLC 1VERA 4UM9A 4JGJA 3QXUA 5TFSL 3MLSH 5C09D 3T1FB 3D1MC 1VKXA 2BOBB 3MYZA 4LSUH 1AY1L 3VYNA 1A1MB 1WZ1L 3EBGA 1FL6B 2JH2A 3T8XB 1RERA 2AI0L 4OGXH 2HX7A 5DXWA 3O6FB 3MNVA 5E6IA 1T6WA 4A2LA 4OF0A 3KR3L 2MMXA 7PCYA 1KBGL 4LP5A 3T8XA 2VQ1B 2MHAB 3ZR5A 4HWZB 4H4NA 2L0DA 4BSWB 4LLUB 3KCPB 2ED6A 3NP3A 4HJ1A 2VQ1A 4WTZA 3UAJC 4EI6B 1YMMD 1ZXKA 3QPQD 4BSWA 1UURA 2L3BA 4LLUA 3LZNA 3QEQD 1GYCA 4EI6A 4KK5C 1SN2A 4JFZL 1XEDA 4HC1L 1L7IH 2VLKB 2KQNA 3HG1A 2FB4L 3ZMRA 3E8UL 5C7ZA 3RNKA 3HLAB 1YEHL 2VLKA 5IHUH 5ICZA 3V0IA 2W1NA 5I6LA 3UJJL 3HLAA 2GG1A 1UWFA 4N2KA 4RNRA 3DVNA 3OAZK 1JTTA 5E2WH 4BFJA 4CU6A 5CN2A 1ULVA 3BP5A 1HL4A 3MRGA 2O1AA 4HJSA 3EW3B 3EJCA 3DJ9A 1RVFL 3MV8E 4MMYB 4F8NA 2Q6WA 2VXQL 1SPDA 4EZMA 5FF6B 2Y3AA 1M53A 1XIWA 1NC2B 3QIUD 1XXFC 3FU6A 1CICC 1NCJA 3PG2A 4UT9H 5KVFH 1TCMA 3C9NB 3TS8A 1NSNH 3L9RB 3HLKA 2O61B 1HAUA 5CGBA 2W95A 5JNYA 5FF6A 5TQ2H 5C0CE 2YD5A 1RH8A 3KHQA 2XXFA 3P3UA 25C8L 1GA2A 3OZKA 2PPAA 2O61A 3VD2A 2JFCA 4NC1E 2W9LA 4P99A 1GGCL 3VFPB 5EORH 3MLYH 4R6UA 5E08L 3ULVC 1BXXA 4J6IA 5IHBA 5BZZA 3UBXB 3PWNB 1WAAF 4W9KC 4QKXB 1UT2A 4FFWC 3WNNA 3GBDA 1SUJA 1AGBB 2AQ2A 1BHGA 1NCCH 1EV2E 3CDGB 3TXAA 3UBXA 3PWNA 3UG4A 4PGEB 1N7ML 1Z9MA 4XZUA 3T6VA 4G8GD 3N43F 4XNYL 1AGBA 3ZK0A 4BZ2L 2GEQA 3ECBB 1J11A 2XV2A 2Z64C 4LARL 2EEDA 2R0LH 5EOCJ 1ZLSH 4JM2B 4PGEA 4LASL 2LU5A 1CXIA 2BVYA 5DZAA 3QWNA 3RVUD 2V7NA 4MHHI 2G0LA 5D93B 3P4NB 3CDCA 2CCWA 2CIIB 3PP3H 4JM2A 1GVIA 1KLFB 2OBGA 1QUNA 1ACXA 4H1LG 4OAWB 3GLEA 2ZF8A 4Y4FC 1KCVL 2W8CA 3ZYZA 1FHGA 2XIDA 1KLFA 2P8MB 4KQ3H 4PI2A 5F97E 4GMTL 1U9KA 4MXQD 1QR1B 4IEFB 4JKMA 3OC8A 1FE8H 5M7QA 3R4DA 3FH7A 5LB1A 2R7EA 3JV0A 4WTWA 1JXFA 2YQBA 3PWVB 3WIIL 3N3EA 1LE9B 1WHOA 1S5IL 4H8WH 1KWGA 1IAMA 2AJUL 4ZFFB 3MHZA 5C0DB 2J43A 4ODWB 2NY4C 2HJFB 3WD5H 3WFEH 3PWVA 3FHAA 3SO5A 1ETZA 1FYTD 1IEHA 1YYCA 4YBQC 4TLSA 4TNVF 5IVZA 2EIJB 1V54B 3CK0H 4ODWA 3LHPH 2D3VA 4JFSA 3VSQA 1KIQB 3PFQA 1CLOH 3TT3H 2WVTA 4HIIA 3JT0A 3K74B 4E42B 3CDYA 3LN5B 5DS8A 5D7KD 3BDYH 2BIOA 3VUAA 1KIQA 4KNQA 1GH7A 2APSA 2QHRH 1WSST 3NYKA 3OKLB 3BJLA 3LN5A 4EN3A 1QNIA 2PCXA 2C26A 4YR6A 1FF5A 4L4VB 3NCYP 3H54A 1CLYH 1D6VL 1HH6B 3IPEA 2OW7A 5I0YA 1DHKA 4PP1D 1FFOB 4M9OA 3V2AR 3ZX1A 4L8CB 4L4VA 1F4WH 5B1JA 2ESVE 3NPZB 3MRKA 2Y2WA 4X5PA 2G2RA 3FUHA 5AB9A 4OM1L 4KJQC 4TYUA 1I7UA 4RRPM 2EIEA 3CSFA 1V3MA 4PJEF 4ZMNA 4PJIE 1F1AA 1G7JB 3MLVH 3LQAH 2ZAIA 4IMKC 1CTOA 4J3OD 1KY6A 3CHRA 2F58L 1A6AA 1RIVH 1G7JA 1UWEL 1GZHA 3IU3B 2GAZB 5D1QE 1A4JA 3O8XD 1RZGA 2VLRB 2CUIA 4QHLB 1OWWA 3V7AG 2GAZA 1U95B 3WJMB 4WKXA 1CG9B 3SBPA 4AYFB 4DGUA 4EKJA 2VLRA 1MAMH 3SHSA 4YEFA 1WCBB 4S1DC 4OCRH 4XX1E 5I6PA 4CSPA 1NAMA 3FO2A 4AYFA 3UP6A 3WJMA 1CG9A 4KJYB 3RX8A 2YFOA 3WFDH 5J11C 1KTDB 2CQVA 1RZJH 2YXMA 1V3JA 3FUMA 4DQOL 3UX9B 1CVRA 4KJYA 4NC2B 3HBZA 2X4UB 4HS3B 4JL1A 2WSDA 4PBVC 5DVPA 4OGAC 4ANVA 3APMA 1NFAA 5E7BA 1MCHA 3BP7B 4HS3A 2V2XB 2VR5A 3HHSA 3FH8A 1K9TA 4XNDA 4CJ0A 4NZTH 5FYJH 3ZDYB 2ZUQC 4RDQF 3QPXL 3HE6B 3LZFH 4AIZB 4G6KL 4G1EA 1Q0YH 3KLKA 2YPVL 3D50A 3C6LB 3QNYB 4B3EA 3HE6A 4R97B 4BSVA 2A0LC 2VM9A 4LEBA 4N2GA 1FZOB 2X09A 2LTQB 5KSAC 4DKFH 2SEBB 4MB3A 3LS4H 2VLMD 4Z7WB 2VUYA 4Y5VC 4PGBA 3OAWA 1UJ3C 3IGAA 3CHQA 4RZCB 4DP5X 2SEBA 4G6MH 4Z7WA 5DVKA 3TWYA 1KWKA 1FV1A 3ZTEA 4LHJB 3TIEB 1PG7X 3IFLH 3O2VH 3OMNB 4TPRH 1S78D 4OVUA 1ZVNA 3L4XA 4OZGB 4PV9B 4F8OA 3QUMB 3GKWH 4L3CA 4J6RL 4PB0L 3TIEA 2WBKA 3JBG7 4HFWB 3S8WA 1EEZB 2V2WA 4KAQH 4QRTA 1JPSH 1VACB 4OZGA 4PV9A 4G8IA 3QUMA 4NN7B 4YWGL 3P9LA 2JQMA 4FTVB 3IAQA 3MRQB 2A7BA 4NJ9H 1EEZA 4M6ML 4PWKA 1ZLVK 4UQEA 2B9BA 3LEXA 1KPVB 2WGXA 4N90E 4NN6B 4X6BB 2XN0A 3T08A 3X3GL 2CHXA 1FLRH 3MRQA 4LSSL 1YY9D 4W4NA 5C3LD 3NA4A 1KPVA 4X6BA 3PY9A 4PMEA 3INUH 4NDMA 2EAEA 3EXJA 2MCG1 1F13A 2GT9B 5CJOL 3QAZB 4TRPL 4F9PA 1ZHNA 4K5LA 4WTXA 4PV8B 3B4NA 4PJHB 2GT9A 2PWHA 1BYOA 4DGYH 4EEEA 2IAMC 3EJSA 4WFGD 5AW9B 5ABAA 1QRNB 1X4YA 1S7UB 4I3SL 1LEKB 2WUBH 3BW9B 3U4AA 3AY4A 4B41A 4CRPA 2Y5TA 5D55A 4ALAL 1QRNA 1S7UA 3HUJB 4I9XA 3DX7B 1P1VA 3BW9A 3ZKXB 2Q7YB 4IHOA 1BYPA 1RLWA 1VHPA 4KHXH 3US0A 3ARFA 2WB7A 3ZTJG 5ID1B 1PU0A 4UBDC 3IU4L 4HBCL 3SN6N 2Q7YA 4HLJA 3RVVC 3LIZA 3FQRA 5T1DH 4GIOA 3OF6D 2ZUXA 1SQ2N 1BM3H 5ID1A 3C5SA 1G9EA 2WPGA 1WD9A 1FN4B 2QTVA 3I9GH 3DGDA 4X9IA 5IESL 2WTRB 3GS4A 1FN4A 4OCLC 4PRBB 3F3HA 4AE0A 5CIPH 4P3CH 2FRGP 2WTRA 3MV01 2WYZA 2DQDL 1O7DC 1PDKB 3HN8A 3MPCA 1XGUB 5EN3A 4PRBA 5FUZH 4Y2DD 1KC5L 3UPCA 3R18A 3HMXH 3P0YL 3NDYE 1U91B 3Q01A 3CFNA 3SJVB 2OX5B 4ERSH 4BGLA 1YEIL 3IF1B 1XGUA 3MZTA 3SKMB 3JXAA 1QLEL 4PGZA 4UM8B 1IC4H 1PEZA 3WIHA 1G94A 3SJVA 4Y16D 5TJWK 2OYLA 2I9TB 2NZ1A 3F7VB 4PUBH 2WJ5A 2ZP0T 5FO9B 3HG1E 3SKMA 2RAMA 3L54A 1II4E 4UM8A 5DD0H 2GSGA 2CJUH 2I9TA 3GZOA 1TQUA 3F7VA 2C7FA 2ICWI 1ZRUA 3RI5K 4JY4B 1HIML 1JZ8A 2QADB 1U42A 2V2TA 4HJJL 2E46A 5G2NA 2VGLM 3KLHC 4JY4A 3FXIC 2HTLD 2MOVA 1DFBH 2YUVA 3K0YA 4ZAKB 1KXQA 3U25A 1UB5B 2HLAB 5C09B 3FF7A 2FUQA 3H6AA 1QSEA 2I24N 4HIPA 2QFRA 2EKJA 2YEZB 1X9LA 3S97C 2O5XL 3NFPB 2XBZA 3ATAA 4KV5E 2HLAA 2N56A 1I8AA 1I8UA 2H6OA 2Q0ZX 2WBJD 4M1GH 3V0DA 3N2JA 5DRNB 2YEZA 2XA8L 3NFPA 4C59B 3SDDD 1ZVSB 3OMZA 2FGWL 4QXUH 5DC2A 2EDLA 5ANHA 4WIQA 2VDPH 1NWOA 3BLPX 4FQQA 4W9FC 4YHOH 3ARQA 4KDVA 4JPQA 4RFNB 1F00I 4Z7NE 5I17A 5J8OA 1ZVSA 1AHWA 4I4WA 2WXLA 1J0JA 1D9KA 4BZYA 5I1CL 2ZKWA 4LOEA 1T21A 1XO8A 4L8SB 3QEQB 4XN7A 4LCIH 4ZFQA 4MJ5A 1UH2A 4Y4HC 4OKDA 5KOMC 2BXZA 5D2LB 5JIQA 2OMVB 1KT2A 1PCSA 4X7SL 1ZJAA 1UFUA 4KZCA 1DN0B 1JZIA 1XHHA 3ECUA 1BJ1J 4XPHH 3WUWG 5CCJA 1H5BC 4NPYA 3BVNA 4LU5H 1NPUA 4ICXA 2UXVA 3IMTA 1DN0A 4JE4B 5I8OL 4XVOA 4RBPH 2XV0A 4KKLD 2EDRA 3NCWA 3L6FB 2QPFA 3BIAX 5C08B 1TQSA 1K85A 1UACH 2WXMA 5EU6B 1CLZH 2CKBA 3SGKA 1Q72H 3L6FA 2VAJA 5C08A 1V7ML 4JLRB 5DEFB 1Z5LB 3V5DB 2DDQH 1MW0A 3CUPB 3QIUB 4KH2A 5EU6A 2BNRD 3EHBD 1W72H 1A64A 3MBWA 1C08B 5AW6B 1OWRM 4JLRA 1Z5LA 1EWHA 3CUPA 3ESVF 3MV7E 1D3CA 2YLHA 2ZF9A 4N8CL 4WI6A 5KAQF 2BOLA 4TQHA 2GBAA 4OCYL 1RJYB 5FYLE 2XVLA 2FQGA 1BOYA 2PCFA 3CLWA 5DQ9B 1QZNA 4Q6YA 2V5YA 2H3XC 1RJYA 3MLSL 1AQDB 3LTVA 4GO8A 3WNLA 4AJVA 4CMMA 5DO8A 4N2MA 4LSUL 2ED7A 4QHUA 4OGXL 1AQDA 1HE8A 4H2AA 2FEEI 3FYEB 1P6WA 1MUJB 4G8GB 4H8UA 2QV2A 2VO5A 2XTSA 3JWDH 1SYVB 4ORZC 4LCCC 5F8QC 4YFLF 2VR8A 4Z3JA 3ZZ1A 1MUJA 3QS2A 3Q2LA 4YMPA 1R1CA 2CNZA 1SYVA 1T0MB 1NEZB 1E4XH 1IILE 3CXHK 1N10A 2NSQA 2Z6FA 4Q9RH 3U2SB 2ADJB 1T0MA 1NEZA 2OMBA 1CXFA 3K6NA 4KXCA 3UTPE 2EIDA 1NM9A 2Y0SA 4F37K 3C6EA 1NLDH 1L7IL 1VPOH 4YDIH 2Q8AH 2KH2B 2ADJA 4D8PB 3K71B 5C1MB 5FEBA 2ZIDA 1NIEA 3H9SD 2HVBA 2JJWA 5IHUL 3K71A 1SXZA 4RIRB 3SYAA 4P48A 2X4RA 3NZSA 4MD0A 2K6WA 1AD0B 4HLZG 2XXCB 1FVCB 4KH9A 2E6QA 1KFGA 2LE9A 3BKCH 4P4KD 1UUSA 4FKKA 1FYTB 4RIRA 2IOIA 5E2WL 4XO3A 5MEQB 3FFDB 4XAKD 1AD0A 4R2GB 4YL4A 1FVCA 4YQXH 2R0WH 5EU3A 3CNKA 2F8XC 2QPSA 3LPFA 3BEWB 3MUGA 5MEQA 3FYIB 1ILSA 2R9HC 4K7FB 1D5XB 1A6PA 1PFOA 1JHKH 3BEWA 4UT9L 2I27N 3EYSH 5KVFL 4EBQH 1NSNL 2Z31D 4RRPA 5TQ2L 3ERXA 4S1QH 1I8LA 2LU4A 3IGKA 5J3HD 3EADA 5F0PB 5EORL 3MLYL 4Z7UE 1Z0NA 2BSEA 4IKJA 4U4BA 4KK9C 3EH3B 1WJ3A 2ZCHH 4P2OC 3SDCA 4DJMA 1NCCL 5AVUB 4PJHF 3LYRA 2XPGA 3TJPA 4LGRB 4WWID 4BUQA 4WNSA 1A65A 4UTAA 5F3HA 1K4DA 2R0LL 1ZLSL 5KYXA 2VR7A 1IT9H 5ACMA 5CLTA 1FAIH 4DP9X 4TL4A 1HVXA 1EFXB 3KM1A 3FO9A 1SHWA 3ABGA 3LKNA 4TN9A 4UMGA 4MQSB 5A6IA 3QWRD 5DMKB 1EFXA 3GLDA 1ZHLB 1TO5A 3KVQA 4KQ3L 3Q1SH 2ATAA 4HJIA 4HZ1A 1FE8L 5DMKA 5D7EA 4F93B 5I16A 3OGOE 2GJJA 1K5WA 1KELH 1ZHLA 3PIQB 3POCA 4X83A 3QJVB 1ROWA 4H8WL 3B1UA 2PCYA 3QNFA 4NHCH 4XN5A 2WWKT 2J1YA 1T89C 3WD5L 3WFEL 5DT1H 5BQ7A 5HVHB 3NSJA 4H44C 4U1HB 4G9DB 2HJKB 5KBNC 3RWDB 4JFOA 1WG3A 2YD8A 3CK0L 4M3KB 5GSVB 3LHPL 1MFEH 1Q9WA 1VF5C 1MHEA 4U1HA 4G9DA 3DIVA 3EG9B 3TT3L 2A6JB 3RWDA 2VDOB 3AQYA 4U6XA 5GSVA 4G9FA 5GZOC 4O2EB 3BDYL 4AQ8C 2PCPA 2HT2C 3EG9A 2QHRL 1IJNA 1QG3A 1QFWI 1XSIA 4UT6H 4V1DD 1EXHA 3O9WC 4LLQA 3FONB 3BZEA 1A8ZA 4YSEA 1CLYL 1JAEA 3BVXA 4I2XB 3U79A 4ATTA 4YSTA 4X2UA 1YJDH 1KFAH 4KJWC 4XP9H 2FCBA 3FONA 2R69H 4OR1A 4TTDD 3T0VA 1F4WL 3VFUB 3BGFB 1W15A 2BVPA 3L81A 3MGAA 2BP3A 4LCYB 2YEQA 3I75B 1BOGB 1QBMH 1ONQB 2WWOA 3VFUA 3UTOA 5IP4A 1KCBA 4XHJC 4UUJB 4JRWA 3DSFH 3I75A 1J0KA 1BOGA 1ONQA 1IEBB 1NDTA 4NX0A 4OFYA 1A9VA 3MLVL 3LQAL 5B3SB 4OLZH 4UUJA 2X53A 4IOIA 2X2JA 3VQ2C 4OI9A 3JVFC 1RIVL 3MUJA 1BD2D 2FSEA 3HB3C 4KXZH 3TZVB 4DOHE 1XTLA 5JYLA 3RJQB 5CCGE 1UWGH 1JGUH 2ICEC 4D0CA 4H88H 4YAQB 5DK0A 2ICWB 1EO7A 3S5LG 2DPKA 3SPJA 3TZVA 4LK4A 3S5YA 4N5EC 4FCAA 5DQJB 2Y9RT 1MAML 4XXCA 5CZRA 4YAQA 4QDGA 4AEHH 1OGAD 1YEKH 4OCRL 5JZ7C 1E3ZA 3MRHB 3WFDL 4BUHA 4EAEA 3FU9A 4ZXBA 3W9DB 1RZJL 3MRHA 1DUYB 3H42H 1EAPB 1RY7B 1UG9A 5KVDH 2TSAA 4U7KA 3OLGA 2LLGA 2R1YB 3DWTA 5AOLA 2EIMB 1NFDF 3I2CH 2R1YA 2DW5A 3W5NA 1PF3A 4XCYB 2V5MA 4NZTL 5FYJL 1PZ2A 3NSCA 5CILH 3IGLA 4YLCA 3LZFL 4ZOEA 1Q0YL 4JO5A 2BMKB 3EUUA 5DJAB 3LZLA 1CVSC 2MH4A 4I18B 2GJ6D 3IRZA 3R4RA 2DLHA 1A4KA 1R3KB 5DJAA 4QXTB 2NY5H 1QSEE 4A2HA 4EZLA 1D5BB 4DKFL 4FC3E 4LCWD 4PD4J 2CNYA 3LS4L 1JGVH 4WI8A 4DGVH 2EDBA 4OZHF 4PBWD 4HLEA 2XU9A 5K39A 4QXTA 5D1XC 4XB7A 4KRMB 3WTSA 1E2VA 3PP4H 1BAGA 4L4TD 4G6ML 3PABB 2QSVA 1UM5H 5GRUH 2H32B 3MLUL 3P3RA 4Y2DB 5HI3C 1R6VA 3IFLL 3O2VL 4MJ6B 4TPRL 4B9PA 3PABA 1IGYB 1MCKA 3QUYC 3RU8H 2W59A 4MVBD 3GKWL 2H32A 2FNWA 4UIKH 1PD0A 1U2YA 2DMCA 4HMDA 4MJ6A 4KAQL 2WC7A 1JPSL 1RZFH 4FHBD 5ANME 1J8RA 3GK8H 4JZJB 4Y16B 3SGJA 1ZIBA 2N0KA 4NJ9L 4P2RD 5CEZH 4TVPD 4Y19B 4WI4A 5IM7B 1OK0A 3BH9B 2JJSC 4Y16A 4GRMB 2CHWA 1FLRL 2ZUYA 5JHLH 2J73A 1XBRA 3W57A 4Y19A 4HZLA 1T04B 5IM7A 3BH9A 4JPSA 5HPMA 2DJMA 4LLMB 5HJDA 1IBDA 3INUL 3ZE2B 1T04A 1Y1DA 1HJCA 2BIQA 4P5TD 3TA3C 5CLXA 2DI8A 3N41F 4YJZL 4DGYL 5ES4B 1H15B 3MA7A 2WUBL 4ZW8A 3RBGA 5IMKB 4HUUB 5GGSB 3S7GA 1H15A 2BC4B 1ZV2A 3D87B 4ODSH 3U4EB 4HUUA 1WBZB 3QI9C 5FYKD 4KHXL 3JWNG 4GAJH 1UTDA 1XZWA 3UAJD 3M7OA 3U4EA 4HHAB 1WBZA 3CD4A 1NMAH 5T1DL 1FVEB 3T8MA 1BM3L 4E9SA 4ZO6A 3WDHA 4HETA 4KK5D 4Z3IA 3I9GL 1XB8A 3GXNA 3VWJB 1M7DB 3JWNC 1P2CA 4ENZA 4KO9A 3BLBA 1Z9LA 1J5CA 2UWEB 3VWJA 2JB6B 1SDDA 1WDAA 3RNQB 5HVFB 4HPOH 2UWEA 2X89A 4NQSB 3VDCA 3FTYA 5FUZL 2VXVH 2JB6A 4FXGB 5ACLA 1Z3GH 3BP4B 4I48B 3HMXL 3RNQA 2GQHA 2LAGB 3STBA 3OBAA 2WK2A 3PHAA 4ERSL 5JXEA 4NQSA 1UEMA 4MJHA 4FXGA 5E94B 3BP4A 3D33A 3EXLA 1IC4L 5DUBA 4X4MA 4MS8D 5L8LB 3G7TA 2R2EB 4NZJA 4PUBL 3TO4B 2YWZA 4HIJB 2Z0BA 5FB8A 3NIDB 1KB9J 1HQRB 3EHBB 1QW9A 5DD0L 2K6YA 3UTSD 1FJ1B 1VFMA 2CJUL 5B38B 2R2EA 1FLTX 3TO4A 4HIJA 1HQRA 4CSSA 4FG6C 2J2ZB 5SWSE 3ZSTA 1FJ1A 5B38A 2IDSA 3NQKA 1AQHA 3KHOA 2Y5EA 2ZXWB 3U46B 3TESA 1JV5B 3GRWA 2JK5B 2DL9A 3ULVD 1CMOA 1DFBL 3D39E 1PD6A 4K5OA 4NKMB 4DN4H 2JK5A 5DYFA 4PI0A 4YFDB 2C3XA 2DQTH 3UC2A 3B37A 1CFVH 3TX4A 2J7LA 32C2B 1XF3A 4MRBA 1QNZH 2B5IC 4DKEH 4PJFB 1U8MA 4M1GL 4DP2X 3BRDA 4QNPF 4BBWA 2ADGB 3DI2B 2V33A 1N67A 3I9PA 4LEXH 4QXUL 4Y1TA 4YHOL 2VDPL 1COBA 1GPOH 1YMHB 2RH0A 3GI8H 3QT2A 3AT0A 1L3NA 1G6VK 1DE4B 4OCNC 4ABQA 3PNWA 4ONOA 3KJ4B 4QLRA 2JV6A 4LCIL 3V5HB 2CJ3A 5BZWA 3NH7H 3QZBA 4HYTB 1DE4A 1U3ZA 4KUZH 2DBLH 4YSRA 4E9WA 1KYAA 1YEJH 3LEYH 3G9VA 3V5HA 3MLTB 1Q0XH 1JPGA 1PLBA 3FSWA 3WELA 4JFHD 3H9SB 1AXSB 4JPKH 4ODUA 5DC9B 5DMIH 4XPHL 4ONFH 1KJ2H 4GKOA 1I85C 4JHAH 5H4YA 4LU5L 2YAEA 4KKNA 2IANA 1AXSA 5L2KB 3O3BB 4M61A 1CU4H 2NY4D 1KCUH 1GY2A 4OZIF 2EYRB 4YBQD 5L2KA 2X7LA 4XN9A 1WFTA 1MW3A 2HKHH 1UACL 5KS9B 1CLZL 3B2PA 1Q72L 2F08A 5TQ0L 4DVBB 4IBUA 3TF4A 1OSPH 1VEOA 1W72L 2DQCH 2VZ1A 4DVBA 3QQDA 4WGVB 5I82A 5KG9B 5EBWA 3PV7A 2V7HA 4PWFA 3HE7D 4N20A 2N7BA 4HKJB 3GJEA 2FT7A 2OTPA 4P23C 1M2OA 2V9TA 4AC4A 3SPCA 4PRAB 5I5MA 5MI0B 2ZOKA 3F7KA 5KVEH 4OCWH 3ZMEA 4KITB 3NFNA 2EE6A 4PRAA 4CU8A 4OGZA 4KJQD 3DX8B 4Z7VA 4KQ0A 2Q1EA 2BCKA 4YHZH 4G9FE 1HWGB 2J20A 2JXMB 4UNIA 3DX8A 3JWDL 2EO7A 5PAZA 4R7XA 1ZIAA 2X9ZA 5I19H 4JANB 4FG4A 4KNTA 1NEUA 3DRTB 1KJ3H 4NQVA 4X9HA 5JPMC 4DCQA 1IGMH 3LY6A 4JANA 2H0EA 4Q9RL 2C8NA 4HT1H 4UOQA 2XZQH 1PX8A 5HY9A 3RY5A 3S37X 4RMRA 1O6TA 4X6CB 4DAGH 2HLFC 1A7PH 1NLDL 1VPOL 4YDIL 1BAFH 1DJWA 5DWUH 2Q8AL 2HKFH 2E47A 5IW1A 4X6CA 4HCIA 2HFEB 3SKJH 1JWSB 3QXWA 4ZW5A 3CH8A 3C5ZB 4X99B 4B9ZA 4DKDC 6PAZA 4DTGH 4HUXA 2A3TA 1FSKC 4DUXA 4A6YB 1JD9A 1DQLH 5BV7B 3C5ZA 4X99A 2YHGA 2CH8A 1HOCA 3BKCL 3VGAC 4A6YA 5L8JB 3I6LE 1WT5A 2EIKB 4PCSA 2J55A 2XT1B 3MO1B 1EGJH 2XXMB 3OMIB 4JFXA 4N2LA 3QA3A 4YQXL 4AQAB 2R0WL 5D7SH 4FE9A 4UZGA 2GHWB 2ZWNA 3QARA 1E40A 5DI8B 3UMTA 1T3FB 3NCYS 2ARJQ 1IZKA 4AQAA 2PTUA 1QOKA 4X98B 3RZCD 1MVYA 1JHKL 3EYSL 1YA5A 1T3FA 1G9MC 1CT8B 1RSYA 1KIUB 4EBQL 4X9GA 1QLFA 1TXKA 4U33A 4V1DB 2HPTA 2A0LD 2K1MA 3VXUA 4FQXA 5E1IA 4EI5C 2MQCA 4JY5H 4Z7OE 1JI2A 4NZFA 2WO2B 3CX5K 3FUIA 3T0EB 3O6ML 4Z1PA 1MCIA 4YSPA 2ZWSA 3L5IA 3UJIH 1ZDQA 4KKPA 4XP6H 1P7BA 1QMUA 3P1VA 2DICA 2ZCHL 3T0EA 1CGUA 1EIBA 2APBA 5E7FA 5DGRA 1R33A 4JFTA 2F7OA 2P9RA 4N2IA 1DVFC 3ARXA 4OLUH 3ILPB 3QJHB 2DZEA 4L05A 1IVTA 1UCBH 3HBPA 2JQAA 1CGXA 1WAAA 1IT9L 4N2BA 1FAIL 4UZUA 1BD2B 3V0AC 2VDNB 3DVFA 3QJHA 2QQQA 5C0GA 3VG0H 2B3IA 4XBMA 4NLAA 3K4DA 4FJ6A 2WXHA 3H0TB 5DZJA 3CIQA 2OYPA 2YGQA 5D5MF 4UU9A 4WDIB 4KY1H 1OGAB 3Q1SL 4MZ2A 1ZOXA 4P5RA 1FORH 3H0TA 3N1GC 5JQ6H 3B9KD 3W2DH 1KGWA 4W9LC 3SPHA 5H37A 2ODHA 1HZLA 4WDIA 1KELL 2CRIA 1MJUH 3VFGH 5AALA 1NKRA 1UA7A 3V4PA 4NHCL 4O2FB 2VJXA 1KMGA 4JFQA 1ZDSA 4L3EB 2IAMD 3TA4D 2NLJB 4N4YB 3EYOB 1KB5A 4IIQB 5DT1L 5KYUA 4B9KC 4Q8BA 5J9PA 4S0TD 1PG7W 1SN5A 4L3EA 2NLJA 1MFEL 4RMTA 5KJRH 1FRGH 2VERN 5FR3A 3LXUX 2YD1A 4HGMA 2Z91B 2J72A 4GRWE 4R0LB 5HI4C 4HOXA 3BDBA 1GOGA 5I6XC 1R5IA 4YEEA 4OD3H 1XMWA 3FCTB 1B90A 4H8PA 2GJ6B 4UT6L 1DUZB 4R0LA 3VFRB 1TQBB 3FCTA 1Q9KB 1YJDL 1DUZA 1KFAL 4LCWB 4W6YB 3WNMA 4POUB 2R69L 2B1OA 4Q0XH 3SPVB 3WMPA 4DESA 3KYAA 1A2YB 5F0LB 4F2EA 2B3RA 4YX2H 4K9EC 4L4TB 1QBML 2DIAA 3SPVA 5LDUA 1A2YA 1RZKH 5ESQB 3CZLA 1P4LA 3DSFL 3KEHA 4NNXB 1JRHH 1OP3K 3DPDA 4IBSA 1X5JA 2VRQA 4NBZB 2DN7A 4PJFF 2UY7A 4OLZL 5ESQA 4LVHB 5EC2B 1AXIB 1T5XB 2AVGA 4P05A 5T1KB 1LYQA 3DOSB 1AC6A 4NPJA 1UWGL 1JGUL 4P2RB 4U1IB 4JKPH 1WHPA 5EC2A 4H88L 4F27A 3KPOB 5T1KA 2OSWA 3DOSA 4N87A 4U1IA 1ORQB 2V9RA 4WK4B 2DAVA 4JFYB 2E7DA 4KTYA 4AEHL 3RY6A 1YEKL 4M3HA 1VIWA 5IEHB 4NEHB 1JWUA 1X5HA 4APXA 4JFYA 1TPXB 4OJDH 1QWUA 5D71H 1NM4A 1AMXA 3K80A 4P5TB 1IRAY 5IEHA 3H42L 4HD9A 3ARGD 5KVDL 3F64A 5G4MA 2ATKB 3I02A 4KRPC 4XNMB 5DUJA 4LNVA 1NH6A 3ZN6A 4B7LA 2UXGA 4ZTEA 1IGTA 4AK2A 4Y89A 3NRFA 4AQZA 2ATKA 3I2CL 2Y1VA 4ZFOB 4XNMA 1FFRA 2ZAGA 2NSXA 5LN8A 1HWHB 3BWUC 3RKDC 3KGTA 3EOAB 3BD5A 3FTVA 2GKIA 4ZFOA 1AGCB 4FMFA 2QQNH 5DD1L 2ED9A 2XNAB 1UB6B 2GUOB 2J3SA 1LP9E 3EOAA 4FD0A 3E3QC 4WGWB 4OD1H 4OKVB 2CJTA 4AITA 4QRQA 3SBQA 1ZE3H 1YN6B 4IGBA 4Y4HD 2NY5L 2ATPA 1TZIB 3RIKA 3A24A 4J3SA 1P0SE 5IB5B 1PLGH 2CXGA 1JGVL 4FJZA 2ZZUT 3NEXA 3L3JA 3LIZH 4I5BA 5EBLB 4DGVL 4WF7A 4L9LC 5JQIB 4PY8I 3PE9A 4YSSA 4G7YH 1JIBA 3NMEA 3PP4L 4EQ2A 5IB5A 1MFMA 1NCBH 1UM5L 1T20B 5KW9H 5GRUL 1MJ8H 4JJ5B 3MGTB 2YJLA 5DZ9A 1RPQA 1S7SB 5I9QC 1UGNA 4L8BB 1DSFH 1EDHA 2ZX8A 4YDJB 3RU8L 4JJ5A 3ATDA 3MGTA 4ABWA 4UIKL 1MREH 2RHEA 1P4IH 4U0QB 3K0WA 4XNQA 2QEJA 1RZFL 4XE5B 3BO8B 3GPEA 3GK8L 4AIXA 2XOTA 1U3HC 1MSPA 1JZHA 2Q2EB 2BOCB 1E9PB 3BLKA 4KVCH 5CEZL 2X1WL 4M8RA 2N7AA 3BO8A 1N8OE 3CZFB 4K9JA 4PRHB 2R4RH 1E9PA 1F0LA 5DLLA 5JHLL 3WIHH 3HHMA 5FDWA 3LQAC 3N06B 1QHOA 3O2DA 3CZFA 2IANE 2EH7H 4PRHA 4DEPC 4NERA 2DIEA 2Z3FA 3OWEA 1W8NA 4CVXB 4Z7QB 4A67A 3WCYA 4B60A 3U6RA 2WYIA 1OW0C 1JZDC 1ET7A 4CVXA 4FL4B 1QEWA 1SVZA 4AX3A 4GAGH 3K7UA 5D2NC 2WXIA 4RAVA 3GTTA 5ABDE 3R19A 2CRMA 3GXTA 3WY2A 1AE6L 3FT9A 1HL8A 1QBBA 4WO4C 5AW2B 2C3WA 4TVSa 3DK0A 2BS71 1JZ3A 3ZJAA 5EEVA 2QMJA 4ODSL 1PQZA 3QQ3A 3HN3A 3NRQA 2HYMA 4NQCD 2G2NA 1RZJC 3QULB 3X17A 4N3TA 3RPBA 4EO5A 3Q9PA 1BDYA 2K9UA 5JA9A 1KYFA 4PJ5D 4LIQH 1NDGB 3DJSA 5F21B 3TH3T 1AZVA 4DP6X 4QRFA 1MCFA 1NMAL 4AZ8B 3VH8B 1E3XA 2PW2A 4AZ8A 3TCTA 4Z7VE 4HVBA 1GRWA 1MCWW 4LVOC 2L7UA 4TNWF 2FIRT 3VH8A 4HEPG 4QRRE 4J2XA 3CQPA 1X44A 3MSPA 2ZCLH 1KENH 5HJ3B 1M7IB 4CC1A 3GMQB 4HPOL 2CDEA 2VXVL 1RSFA 4ZDHA 2XN1A 4K5MA 1Z3GL 4WHCA 5E99H 3C5XA 3DO4A 4WU7B 5HJ3A 1M7IA 5IQ7H 3SDXF 3GMQA 4IBWA 3BQUC 3GMRB 5IB1B 2IOOA 5I28A 3ECQA 3QO1B 4WU7A 2DEXX 3VD0A 2BIPA 2C9UA 1T03H