2XWZA

Structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xwzA02
2J57A 2H3XC 1YLBB 1KGYE 3UGEA 1A4AA 2QT6A 4DPAX 2JXMA 4W1TA 3SBRA 2EILB 2GIMA 3FU9A 2GC7C 2XYBA 4G72B 7PCYA 5PCYA 1QLEB 1KCWA 4KO9A 1BYOA 2JFCA 2IDTA 3QQXA 3ZX1A 3FPXA 1AZCA 1RZQA 2YAOA 3ZDWA 4Q89A 2P80D 1L9SA 3CVCA 3UAEA 2PPDA 1JZJA 3ABLB 4M3HA 1GY2A 3NJJA 1XB8A 1AS6A 2A3TA 2AZAA 2GC4C 2GI0A 1SHXA 1KV7A 3FYEB 3BVDB 3H4HA 3CVDA 2DYSB 5F7BA 4G71B 3H56A 4DPCX 2TSAA 4G7QB 4DP1X 1IUZA 3NSCA 1RZPA 3ASNB 3TBBA 4YSAA 1SF5A 1NWPA 1EHKB 1W6LA 8PAZA 2PP8A 6PAZA 2FQDA 1JZEA 1PNCA 4EF3A 1NDTA 2XX0A 1BEXA 4P5SA 1GSKA 1A8ZA 2UX7A 1ET5A 4DP5X 2BP8B 5IY5B 2X87A 3X2QB 1A4BA 4G7SB 1NTDA 2CCWA 2GB2A 3DIVA 1PLBA 2XV3A 2P80A 1XB6A 3IE9A 1NIEA 3ABKB 4FAAB 3U25A 4E9YA 7PAZA 2QDWA 1ZIAA 4A2GA 1PZAA 1N70A 4BWUA 1FWXA 1OE3A 1CYXA 4GXFA 2QPEB 2FT6A 1ZPUA 4AKPA 3CVBA 3MBWB 4UF7C 4YSUA 1OE1A 2XU9A 1NPJA 5FC9A 9PCYA 4HHGA 3SQRA 2IDUA 1GS8A 3UABA 2X88A 4F2FA 1CUOA 5B7FA 1KYAA 4E9VA 1JOIA 3WKQA 2IH8A 1SF3A 2IWKA 4E9TA 4YSCA 4PAZA 2LLNA 3NT0A 5TK4A 4JHUA 1KCBA 3FU7A 2W8CA 1ET7A 4YVNA 3N55A 3T6XA 1PLCA 4BWWA 1A3ZA 1I53A 1WS7A 3C75A 5I6MA 1AR1B 4K9JA 3NP4A 3EHBB 3NSFA 2VM4A 3AG1B 5AZUA 5B1JC 3ZIYA 2AVFA 1IBZA 4E9XA 1AZBA 1MZYA 1FA4A 2FT7A 4GP5B 5B1BB 3PLYA 4JHVA 4UANA 2XXGA 4ZK8A 4YSTA 1NZRA 3NSDA 4KO6A 4A2HA 3JTBA 4KO5A 1MG3C 3AY2A 1L9QA 4F7KA 2FQGA 5I5IA 3ERXA 2RACA 3DKHA 1E5ZA 4BXVA 4DP4X 4E9RA 1L9OA 2J55A 4HHWA 1ASPA 1XB3A 2XLLA 2IWEA 2FNWA 3EH3B 4MFHA 5AFAA 3CZUB 3UACA 3V9CA 2VW4A 2PCYA 2BP0A 4E9SA 1CC3A 3AG4B 4DP6X 2OJ1A 3T9WA 3FU7B 1ILUA 2XXFA 1CURA 3NJNA 4CSPA 4BWTA 1GW0A 1AIZA 3S3DB 1M9WA 2CBPA 1QNIA 1GS6X 1X9RA 2VW7A 1AQ8A 2PPEA 5B7EA 2UX6A 1OE2A 3D12B 3TA4D 2WO2B 4DP0X 4AI7A 4W9ZA 3ABGA 1HAUA 2CALA 1ZV2A 1TU2A 1ETJA 3FSWA 2H5UA 3NJMA 3KW8A 4YSPA 5TK2A 2BW5A 1SJMA 1E5YA 4KO7A 2HZHA 5D4IA 3X1NA 2XV2A 1AACA 1EZLA 2IAAC 1WAEA 3NJKA 1IKOP 3HEIB 1DYZA 1PAZA 2I85A 2YAHA 2VSKB 3JT2A 2E86A 2R7EA 3FPYA 2HX9A 2CJ3A 4G7RB 2XVBA 2JKWA 3ASOB 2ZXWB 1KBVA 1L9TA 1IC0A 2W88A 3QJTB 1E65A 4P5RA 3SBPA 3TBCA 4YSOA 2XV0A 5E9NA 4PCYA 1A4CA 2VM3A 3CG8A 3FQYA 4FA7B 3X1GA 1PMYA 4WTQA 3WG7B 1V10A 1XMEB 1JXFA 2DV6A 1NIFA 2BWDA 1E67A 3WNIA 5D4JA 2YAPA 3QJUB 4DPBX 4NB7A 2OV0A 2DYRB 1BQKA 3EF4A 3OMNB 3T6ZA 1QHQA 5ANHA 4A2EA 4YSEA 2NRDA 1HAWA 1RCYA 5I5JA 1OCCB 2QDVA 5I5MA 3ABMB 3OMAB 1W8EA 2DWSA 2EINB 3GDCA 5EHFA 1OCRB 1AG0A 2R7EB 3EH5B 3KW7A 3X1BA 3FQ1A 4BDVA 1L9PA 2PPAA 3X1FA 2B3IA 2YARA 1SFDA 1V55B 2FTAA 5I6LA 1BQRA 1PCSA 3OMIB 4HIPA 4GY4A 2Y69B 4JKNA 1CYWA 4YSRA 3OQRA 1TEFA 3V9EA 1FFTB 1AAJA 4DP8X 4N8UA 2PP7A 3SBQA 5LDUA 2EIMB 4KOCA 3PAZA 4A66A 3WIAA 3S3BB 3IN2A 4TXVB 1JXGA 1JZHA 1OCOB 3TU6A 2YAMA 3AZUA 1J9RA 2FWLB 1JVLA 1L9RA 1MZZA 1BAWA 4ENZA 1SFHA 4HCIA 2YAEA 2J56A 4A2FA 1BXVA 1NIDA 2BZCA 3CDZA 4BDVB 4Q8BA 3T71A 2AANA 3EH4B 1JZIA 1MDAA 3GXUB 3PAVA 3FS9A 1T5KA 2IH9A 1SDDA 4AKOA 5I6KA 1GY1A 4HALA 4A2DA 2J5WA 2DWTA 2VMJA 2PPCA 4HCFA 2OCCB 1AZRA 2VN3A 4A68A 2HX8A 2HLEB 5B1KA 4L0PB 5PAZA 2XX1A 1NINA 1ZIBA 1PF3A 2H47C 4F2EA 1KDIA 3T6WA 1BQ5A 1A65A 1ID2A 4YVUA 1SHWA 2HXAA 3PXLA 4DP2X 1AZUA 5B3SB 3IBOA 2WO3B 3WKPA 1JZGA 2BWIA 3HB3B 1NICA 1NPNA 3PCYA 2IWFA 4YSDA 4UAHA 2CUAA 3S3CB 1PNDA 3ZBMA 3FT0A 3OD3A 3FQ2A 2FT8A 3FSZA 2YQBA 3CDZB 3QJSB 5I6PA 2BP8A 3QJRB 1J9SA 4KNTA 2ZOOA 1J9TA 3RYMA 2BP0B 4A67A 5B1JA 2IDFA 1WA1X 1SDDB 1V54B 3AG3B 3IEAA 4QLWA 3FSVA 2MTAA 5I28A 3L45A 3PAUA 4GYBA 4M4RB 4NAJA 1J5DA 2QPDB 1BYPA 1MG2C 1OCZB 1ASOA 2IDSA 1J5CA 1ZDQA 1JERA 4AZUA 2CAKA 4GP8B 2MRYA 1AANA 2B08A 2ZWNA 1ZDSA 1OOWA 1TKWA 3T6VA 1OF0A 4HAKA 2BO0A 1B3IA 2GSMB 1JVOA 1BXUA 2EIJB 3QPKA 3NP3A 4X4KA 1ASQA 4HCGA 2YXVA 3UAAA 5D4HA 3BQVA 4DP9X 2GHZA 5A7EA 2UXGA 3DTUB 1N68A 1NIBA 2TSBA 1X9UA 3NYKA 2UXTA 3WI9A 3S8GB 3AG2B 3G5WA 1OV8A 4KOBA 5I6NA 4QKTA 2BHFA 3QJQB 5I6OA 1WA0X 1M57B 2HX7A 3QJVB 4YSQA 4YSSA 1AS8A 2AFNA 2BW4A 1JXDA 1GYCA 2VW6A 4BK5C 1AZNA 4KNSA 1URIA 2PCFA 3NJLA 3PPSA 3GYRA 4AX3A 1RKRA 2PLTA 4DP7X 2GBAA 2Y1AA 2YXWA 3FYIB 1KDJA 3MX0B 1AG6A 4WKXA 3FSAA 1PZCA 5B7MA 2N0MA 4E9QA 5AKRA 4E9WA 3S8FB 2XUWA 1UATA 2WSDA 3NJGA 3UADA 4CSZA 1J9QA 4BXSV 1BXAA 4KNUA 1TEGA 3X1EA 1PLAA 2FJSA 1M56B 3IN0A 1HFUA 2AZUA 3NJIA 1IBYA 4HZ1A 3AW5A 4YL4A 5F7AA 5I26A 1R1CA 1ILSA 3TASA 1PY0A 2I7SA 1DZ0A 2FQEA 1SNRA 2YAFA 1WA2X 1AOZA 3NJHA 2I7OA 1W6WA 1WS8A 3N2JA 1ET8A 3NJFA 4NERA 6PCYA 3NSYA 1NIAA 1VLXA 2UXVA 4N4YB 2YAQA 2Q5BA 1E30A 5B1AB 3H4FA 2PPFA 2HRHA 2Q9OA 4AKQA 2DY2A 1NWOA 2BZ7A 4G70B 1KBWA 2UXFA 1ADWA 3OM3B 1AS7A 1GR7A 4GP4B 2VSMB 4RH4A 1GS7A 2XWZA 2ZONA 2EIKB 2FQFA 1F56A 2PP9A 1JZFA 1PZBA 2IDQA 3FU8A 3WNJA 2HRGA
chains in the Genus database with same CATH superfamily
4PV1C 2UZXB 2FWOA 5C92A 2VC2L 4HHAB 4Q74A 1PG7H 4CVZB 3SE6A 3WIHH 1D5ZB 4MX7B 4W1TA 1E5AA 4PP1D 1HH9B 5IVXE 4GO6B 2WSPA 3VU1A 3ENEA 1R75A 3ECUA 4GSUA 2YC1B 1OKEA 1MJJB 3FXIC 4YDLC 5SWZB 5K59F 2VABB 2JFCA 1BQSA 1LHZA 2G3NA 1R5IA 2WKOA 5HI3C 4A6YH 3IPFA 1AGDB 2W0PA 3A4EA 1DVQA 4MCYB 2DD8H 3RWCB 3ZSSA 1X5MA 1M6OA 3RY6A 1AD9A 4XOEA 3OAYH 5GXBB 5KSBE 1XB8A 1IFRA 3PUCA 4ZUVB 1ZTXH 3GXPA 1KV7A 4HIHA 1FZMA 2VDLH 3KWWB 3FT3B 5DUBA 3EG9B 5J6SA 4ES9A 4HS6A 4MNQA 4OFYD 3FQWA 1DVFD 2C26A 2KMWA 5BS0B 2YBRB 1G9NC 3L3GA 4WVRA 1CBVL 4IW4C 1CK0H 1HEZA 3T2PA 1KYFA 3LQAH 1A2YB 5I18H 2VLJB 3NCYP 3FC8A 4FQJL 2ZYRA 3ARBC 1LK3H 4GG8B 2P8PB 4JKPH 1NDTA 3UX9B 1YEDB 4AENA 4PJIF 1WYJA 2AMUA 2BXZA 3PABB 3SQBA 4DEUA 2Z6FA 1ET5A 4NEHB 1WSST 1S7SA 4UCFA 1CD9B 1VADB 4RFNC 2R1XB 5IY5B 3MRKA 1IM3D 4P8QA 5D8JH 5DHVH 5HVGB 5A2KH 5FM8A 3VG0H 3QUXA 3TIDB 3RWEB 5LQBL 1E5UI 1CLYH 3BP7A 1GMIA 3D7PA 4ANXA 2JTYA 3ZIMA 1FFNB 1XB6A 4S1RL 3ABKB 3U25A 4Y5XA 3MXVL 3QQ3A 4FTVA 4ZXBB 2Q10A 1XGPB 3K1DA 1EEZA 1EXUB 4FQ2L 5DUJA 4Y2DA 3T65A 4QXUL 1L5GB 4PBVC 3B43A 4UNIA 1FWXA 3LS5H 4XNAA 4FHBD 2QPEB 1SN5A 4MJ5B 4R84A 1RZJC 5EOTA 1TKWB 1MWAL 3I02B 3VH8B 5ESAB 5C0NC 2CCLA 25C8H 3EOTL 1KJ3L 1VGKB 2DLEA 5E7BA 3MV9A 4OZ4A 1Q0YH 4ICXA 3LN4A 4OTXL 4A7SA 1UH4A 4GXUN 2ZXEB 3OVUB 4TQEH 4NRYB 4ZMLA 1MFNA 5DK2B 5E0FA 5AAMA 1CLZH 3RBSA 1ET7A 5K9KB 1T2JA 3P3TA 4QOKE 1M7UA 5FPIA 4GMSL 1M7DB 3SE8H 2OLDA 4TVUA 4J2XA 1VB9A 4DO6A 1PX3A 5I6MA 1UA6L 3EOYG 5F7EL 4J3UA 5J9PA 5B1JC 5IM7A 1DUZB 4TLUA 1FGVL 5CMAB 2FT7A 1UH3A 2I32A 5JIIA 3PYCA 4J3OF 1UT2A 5BZZA 5CJ8A 4D0CA 2CO6A 4JHVA 3T3ME 4X9BA 2XPZA 5BRZB 4NUGL 1YPZF 3T4AA 4AM0Q 2WSKA 2NR6D 3OAWA 3GWJA 2BCMA 2RACA 2ZCLL 4PRPD 2HH0L 5A3IC 1XEUA 1DBJL 3LHAA 4XB8A 3IGAA 3TONA 3DHUA 4LEBA 5C09B 5T1LD 1WFTA 2X4UA 4FG4A 4KKZA 2CLVB 1MFAH 2PCPA 3LS4L 1EDHA 1OAXH 2FR4A 4D2NA 3K0YA 4HV8B 4KFMA 4HWBA 2LW3A 3AG4B 5D7JC 4X6CB 3T3PF 2J8UB 2E8ZA 3M1OA 3VVWA 2BOCB 1H3PL 1T2QH 4Y4FD 2SEBB 3DMMD 4BWTA 1NFKA 4IM8A 4O5LL 1GA2A 1KEGL 3I75B 5DA0B 1QNIA 3OXRA 2CUIA 4CKQA 1BMGA 2VQUA 3X3GL 3G6DH 3HC0A 1KCSL 1H6UA 5E6YA 1WAAA 4MJIB 3K46A 2R23B 5SWZE 4LB8A 3U4BH 3I6KA 5HHXL 3TZVB 4H7VA 4JFPB 4WTZA 3BGAA 1GZHC 2TRYA 1IIKA 1GZQA 4XTRD 4YO0B 4H8WH 3SGEH 2Q1EA 3MODL 1OP3K 2J1KA 1MFDL 1J8HD 3QNZB 4JREB 4UT6L 2Y1VA 3ZYZA 3QIUB 5I71B 3GS4A 3AB0B 4AMKH 2KL6A 4FFYH 3H2QA 5C0AB 5EORL 5BS0E 5GJTL 4M6ML 4J12A 4ZD3L 2X2IA 5L6YH 3FHAA 1LQBC 5HTSA 5AALA 3C5ZD 3V4PA 2I85A 2XQBL 1RIHL 3FPYA 1JHKL 2VLJE 3FQUA 2CJ3A 2E27L 5CZRA 4GH7B 2VMCA 2VDNL 1E43A 2RQEA 1ACYL 3SKMA 3U0WL 3QDGD 1PJ9A 2EYSA 4PJ5B 1S7UA 2OTWA 1I3GL 3WFCH 3QJTB 4MA7L 1VKXB 1ZHKB 1YECH 2AGJL 1U8LB 1QPXA 3DUUB 4K5NA 4QRQB 1A4CA 4KY1L 5KSVA 4KITB 1VGEL 3D4YA 3JVGC 1VHPA 3KS0J 3QH3A 3TL5A 1EGJL 1OT4A 1RJZB 3O45B 3C6LC 4I4WB 4NZ8A 2ICEB 2EDBA 3CWGA 3KPOA 3CXHJ 1G1KA 3MLUL 5JHDB 1JI1A 1ACCA 1F4HA 4BK8A 4WGVB 4QF1A 3P77B 1WTGT 2EAEA 1FL5B 3QFJB 4LT7A 1EFXA 5F1SA 2FB4H 3V55A 4IBWA 3NG5A 3QZNA 3LKNB 2NY0B 4U33A 3MOBH 5IB5B 4ZG1A 1OTSC 1F2XK 3DJZA 3OMAB 4YFLF 2DWSA 2F0CA 1LL1A 3KG5A 4ODXA 5FYJL 5IQOA 3K6FA 4RMVA 1WBXB 2I60L 2X12A 4GRMA 1SFDA 3VSTA 3QORD 1JZ6A 1G7PB 2BWQA 1HZLA 4BFIA 1V55B 3LQZB 3IMVA 4IJ3B 1THAA 3UG4A 3TVMA 3B2DC 5CD3B 4GMTL 2OPCA 2APWA 3MLYL 3NABL 1CYWA 4K7FA 4QWWD 4FABL 5BMFH 4N68A 2CIIA 4NKMB 1GYVA 4DK3A 2GTZB 4C57C 3SBQA 5LDUA 1KGWA 4S1QL 3WY1A 3VWJC 2O1AA 3BPOC 4C59B 5DUMH 5B22A 2C7UA 2GY5A 3JV0A 4OKDA 4UIMB 2ARJA 3M45A 3UJIH 4NQXA 1Y07A 2HFTA 4L1DA 1KUMA 4OLYH 4Y0GA 2Y6TE 3C9NA 2C3VA 4PGZA 3C5JB 3CFKA 1PQZA 3QS3A 1WE5A 1J9RA 2AJYH 2DS4A 1BEYL 2WXNA 4KVCH 4DHLA 5KZCD 1JVLA 1Z9LA 3KM1A 4FFZL 4HUUB 5ALBL 4M9OA 5BRZE 1QZ1A 1TNMA 3O6LH 3PDGA 4BFBD 4A2FA 1R46A 5GGSB 4XCCL 2H45A 1P5UC 1BYNA 5DYOB 5C09E 4B3EA 1T7XA 3BVVA 4RMBA 4XAKE 3C08H 4PJDB 5F1NA 2WZPD 1WJ3A 4ZS6C 1KGXA 2H2SC 4AQEA 1I8IB 2QSCH 4E5XB 3NDZE 3FFCB 4X6CE 2J8UE 3BDBA 4XB3A 2B3RA 1HHIB 1FGNH 1MCCA 1MW1A 2IFGA 3OTTA 1FNEA 4FQXD 1FORH 3I6GA 5JHAA 3UZVB 4RSVA 2HLEB 2A6JB 1P1VA 1JZDC 2BNRD 4F7EB 1ID2A 4Z7UB 4GBXA 2BVPB 3PXLA 2B9AA 3WFEL 4MJIE 2BWIA 1YEEL 5EF2A 3SY6A 3LH2L 4DW2H 2WLLB 5FOBB 1KWGA 5DWUH 1NCOA 3NZSA 4PLJC 5FS5A 2VR9A 2Z7WA 4LVEA 5TF1H 4B97A 4JFEA 5I6PA 2J8HA 1Y6MR 1QFWI 1I1AB 2F54A 2PTVA 4IOFD 4WKZB 1J1PL 4PRDA 2WO4A 3CFNA 1JK9B 2YGQA 3JQOB 1GSMA 4JO5A 4WW2A 5JPNA 2HMID 1S4IA 2IDFA 4ORGA 2Q86B 2V2WA 2HT3C 4G8EB 3QC5X 1FH5H 3RNKB 1M6UA 2QVFB 1A7RH 1XL4A 2OFQA 3OX8B 5KJ4A 3HPLB 3MRMA 3RWJB 3U0PB 1SLVA 1HOCB 1BG1A 1OK8A 1AXIB 3WN5B 4PD4J 1NL0H 3VG9C 4EDWH 1OCZB 1HKLH 4BH7A 3GSXA 5G4OA 4FMVA 3QZMA 1IAII 5KTEH 5J13C 3CMOL 3ULUH 2CAKA 2R0WL 5GISL 2LQRA 4HKJA 1UWGH 1U9KA 3MX0A 5E9AA 4PJ5E 3E0GA 1OTTD 4DSYA 5T3ZD 1JPEA 1Q9OB 4IU3A 5IB3B 3RQ3A 4XZUB 2NW2B 4HUMB 3AY4A 1FFOA 1NBZA 3HG1D 3O41B 2EDDA 1S3KH 3FF8A 1Y7VA 1HCYA 1DEEA 3N42F 2FO4A 2CHNA 1N68A 3LTVA 3V4VL 4FFVC 5I1HH 2VDKH 4N1HB 2R1WA 5JHDE 3QEGL 2BNUB 3GTNA 2A6KB 3QFJE 5FV2A 3WI9A 1OB1A 1Z6JT 2NNFA 1X4XA 5B38A 1XGQA 4J3OD 4XPAH 3TCTA 5J6GA 1AS8A 4BKSC 3APFA 1GYCA 4JB9L 2NY4B 3FB5B 4KNSA 2PCFA 4TNEA 3EOAB 1YJDH 3O3AB 3OL2A 4Y1AB 4HS8L 4U0RB 4I48B 3TJEL 4ZMAT 5FM4A 2OULB 1X7QB 5LBVA 3LZLA 1INDH 4LPYA 2WHVA 5HHMD 4UT7L 4ADIA 3BFWA 3P0VL 1QABA 3VE0B 2QVMA 4LOVA 2HKFH 2VDLB 1QKZL 5D1QB 3UTPE 2X3AA 1UA3A 3QHFH 3SKOA 2OQJB 4QPEA 3WUWB 1T0OA 1JCKA 4N2GA 1B0GB 4P3CL 4ZBJA 5H4YA 1OAYL 1PLAA 5EU3B 5K9OA 2NDFA 1ZA6A 2YPLB 1LO0L 4WJG3 1PCXA 1DZBA 4PJ7A 1XO8A 1TDQA 3HTLX 1MSPA 1JF5A 4QKXB 4XNBA 3ZKSD 4K2UL 2I7OA 4FLSA 2ARWA 3A23A 2R29A 3SPVA 1DUYB 4H1LB 1ET8A 4LK4A 4U1GB 2Q2EB 3Q1SL 1I1FB 1M05B 2HRLA 5DQJB 3BIKA 3FQXA 2UXVA 3IF1B 5I1EL 1CGSH 5ETUB 1DJGA 5DHVB 1KWKA 4A2MA 4R26H 4PJDE 3DXAD 1NFAA 3OKNB 4ODHL 5C08D 3T5WA 3VXQB 4B5EA 5CP7B 1P0SE 2PW2A 2V37A 3FFCE 5JDSB 1OHQA 4ADGA 3QHZL 2O6PA 3SPCA 1FZJA 1R17A 1PZBA 2HJLA 3LRSA 3WNJA 5J8OA 2ZP9A 3KBHE 1LO4H 1YLBB 1X7SA 1A4AA 1OGTB 3P73A 3MNMA 5CKAA 4DFHA 2FYYB 5DCCA 3OAZK 4Z7UE 4XNDA 1S7WB 3LZRA 3LEXA 5AKSA 2GC7C 2XA3A 1NFDF 2H3NA 4PG9B 4R83A 4DKFH 1ZGLA 3SYAA 4N2DA 3U46A 4OZIA 1P2CB 1U2CA 3HC3L 1RZQA 4U6TA 1MIMH 3F64A 2VMFA 3CVCA 5DZLA 4UMGA 5IJDC 2B7DT 3ULVF 4M3HA 3BRFA 4QRAA 2A6IB 3JV4B 2B4CH 3CSFA 2BIMA 1JNHA 2E7BA 4NQCB 5HY9B 4OZHF 1AVAA 5CJOL 4NAMA 2P5EA 3RUGB 1F11B 1MCPH 1MJUH 1NUDA 3F7QA 4JFYA 3BQUB 3VI3A 4DFIA 3WTWA 1QFUH 3MBXH 5AZEH 5DHXB 4OB5L 4HKBA 4W9KC 4F33A 1SXSA 3AXIA 3VWKD 2ZWLT 2APBA 3T2NL 2OZ4A 1OP9A 3NSCA 4IRJB 1SY6A 5D55A 2Y5EA 3CZSA 2QEJA 1EHKB 3H6AA 1W6LA 4JM2F 2PP8A 2DOCA 3NCYS 1BVZA 3GMOA 1QQDB 2XX0A 1BEXA 2JK5A 4GOSA 3AREA 3RVUC 2UX7A 3NIFB 3V95A 4UQ3B 4Q7DA 3CHQA 1D5MB 1OARL 1LEKA 1R3JB 3QQDA 5E4AA 3EBHA 5D7SH 3CZEA 3F12B 3SGKA 3C5XA 2ILLA 1OP4A 3VFGL 2X6AA 3DIVA 5C3LD 4UUJB 1JRHI 1PLBA 5KOMC 3FB6B 2CRZA 3HBPA 1T66C 3GJFK 3I3DA 4ZT1A 1QWHA 3S8WA 4HDIA 1EO5A 2QVKA 4L8CB 4DOHB 2Q7YB 5JPMA 5IMLA 5FA4B 2AQQA 1LD9A 3B8SA 3ZL2A 4JQIA 1NGYA 3K4ZA 3IFNH 3G5VA 1FIEA 1LJMA 3UC0L 1AY1H 1Q8MA 4Y1AE 3SQRA 4PJ9D 5JLZA 3TJHD 1NC2A 2AJSL 4HD9A 1XH3B 1TZIB 1FL6B 2MTPA 2VT0A 4PJAA 3VJ6A 4DTGH 2N59A 4BEIA 5HJGA 4NGHL 2Y72A 4GB9A 1BMZA 1ZTXE 3QZLA 3ATDA 3VTTA 5D1QE 4HAGA 1MI5D 4NCC2 3SDAA 2X7LB 3SJVA 4APQA 3OR6B 2A6DB 3OKLA 4JRLA 2NXZC 1DQJB 2C34A 5B1CA 4A63A 4X80H 3TIEA 1MHPH 3DV4B 5D7EA 2YPLE 4NAQA 4BCYA 3QDMB 4NDMA 2P49B 4Y16D 2YPVL 1OWWA 1VEOA 3ARQA 3FUDA 4NNYB 1CVSC 3QUMH 4W9FC 1DQML 2F58L 4ECNA 3BKYL 3GSVB 3NN8A 5HGDB 1JTTA 2RGSA 2YHGA 3RGBA 3WO4C 3VXUA 4HUVA 1ZT7B 2PETA 1E4KA 2R4RL 3PDDA 4ZMQA 1S5HA 1D7CA 4JO8A 4N2KA 4X0KA 3ARUA 4NPKA 4EI5C 5I16B 3HNTL 5CEZH 5CGTA 3GTTA 4YDZA 3QULA 4M5ZL 4O02L 2Q76B 3L3IB 4KPHH 1A5FL 4XXDA 4DP6X 4HS3A 2ALAA 1LK2A 5E51A 1ILUA 3ARGA 2Z8VC 4RESB 2JWYA 1CURA 1IVTA 3NJNA 4X9FA 4F58H 5GGTL 3SDCD 1RU9H 5HDRA 3WEAA 4FNSA 3TO4A 2HVJB 4LDLB 1GOHA 3KPSB 4OIFA 43C9B 3MACL 4U6VH 2NX5B 1P4LA 1XIWC 4ZPTA 1QRKA 1DCEA 5AZ2H 4ZZKA 5HYQB 4MQ7B 3GXDA 4W9ZA 3W9DB 3CFIC 2FL5A 1ZV2A 5ESVB 2H5UA 1S9YB 1X7TA 3CX2A 4WO4C 2A73B 4AUJA 4TVPD 2WVVA 4L37B 2HZHA 4NXKA 3WHE0 1AHWA 4KX8A 4NQCE 4NUQA 4U2ZA 2VH5L 3RUGE 5BVJB 3IGUA 2F68X 3HJ0A 4MS6A 1X5AA 3MXWH 1A3LH 1VFMA 2ZZUT 3D87B 3KYOA 4TUKL 2VR3A 1VEPA 3RIFK 3TS8A 2JTDA 4WI3A 1IAKA 4JY5L 4ETQA 4IHBA 2GAZA 1XGYH 5IT2L 3GMRB 1PAMA 2QSQA 3U2SA 3FUEA 3V7AE 2HSIA 4DVRH 4LPTA 4XMKH 2W94A 4JG1L 4OF3A 4ONGH 4PG2C 1G6RA 3L7FB 4TS6A 4JX0A 5FWQA 4PJCB 1IZKA 5ID1B 1EV2E 1EJFA 3P3RA 1ZHBB 4K3HA 3CFJB 3NIFE 1G5AA 5I74C 3DHMA 4G1EB 4XN2A 2BP3A 2ZUSA 4FI8A 2EH7H 2XNAB 1HQ4A 4IIQA 5IJKA 1SOQA 1FFQA 4PH8A 4HCRL 5AOLA 3NCBB 3KNBB 3KH3A 4CVXB 1LXMA 4BQCA 2IMNA 1DQLH 2B5IC 5FUOH 3RVTD 4BUHA 2UUDH 2CDFB 4DOHE 3ZL1A 3ZPDA 1LEGA 1UM4L 1YG9A 2QTVA 5EBWA 5F9AC 2F7PA 5DJAB 1DN0B 4I0PD 2YLHA 1NBQA 2WD0A 3EF4A 3MMEA 3FQNB 2Y1ZA 1W0YT 1RCYA 4G9FA 5I5JA 5MENA 1UD4A 2OTUA 1G7IB 3WAJA 4J6RH 4GLRI 4RFEB 3WJMB 4LL1A 4OF6A 1PLGL 5CZVL 2Q3AA 4MXQD 2HT2C 3VI4F 1KFAL 2WINB 2YARA 2NYYD 2WLHA 2V17H 1CMOA 1T0PB 2YRZA 2FYVA 4PJEB 3QO0B 3GK8H 3KYMA 3HE6A 5EOCL 5GJSL 3VYOA 3T0VA 4ODVH 3QUZC 1CU4L 4LEOB 3BUYA 4FZ8L 3RPIB 5BUAA 3P30L 3RWHA 5I8CB 4KX7A 1BPVA 1I3RA 2LE9A 2H2PC 2QQNL 1CFVH 3OHXC 4OCRL 5C7XH 1NC4A 3NTCL 4XBGB 4FQLH 5D5MF 1IM9D 1QO3B 4APXB 4PJFB 1CD1A 3QDME 1R6VA 3II2A 4TUJB 4JPSA 1KG0A 2C8NA 3MO1B 4M7JH 4ZX3A 5EG6C 3CPLB 4OQ1A 3U30B 1YYCA 2FX8L 1TCMA 5GHWL 3VXNA 1VFUA 1MRFH 1VPOH 4NBXB 4X6BB 5DTFA 5FECB 2J56A 3QUYC 2QKIA 5ACZA 2XVKA 2R8SL 3D0LA 4M8QB 3B7RL 4NQEB 2K1MA 2VDRL 3WEOA 5L0QC 3ULVD 1LEIA 2IH9A 1XF4A 3RZCD 1SDDA 1SXAA 3NA9L 4YHMH 3HI1B 3D18A 4AKOA 5KUKA 5E99H 3QJZA 4H8VA 1X5LA 4G80A 4G43B 2G9HA 3TV3H 1WIUA 3NRQA 4AC4A 4OLXL 2AQTA 3K72A 3L3HB 1TFHA 2DWTA 1UZ8A 2H32B 1KPVB 1ROCA 1VACB 2V3DA 1KXVC 2Z4TA 3BT2L 2K4WA 5GS0H 5J3HD 5FO8B 1KDIA 3KPSE 5F96H 3MJGX 4P2AA 2Z31A 5T1KB 2IPUG 3EJZC 5ICUA 4AM0B 1AFVH 5DD3H 4JM2D 1AZUA 3WKPA 3V0IA 1YMME 2W5PA 5I5RA 1NGZA 2OMUA 3PRZA 4KTYA 4IRZA 1ZA3B 3U7YH 1OXYA 5FHAL 4BQBA 4P2YA 3TYFA 3WGUB 2N01B 2ZQKA 2OI9C 1ZEAH 2WTOA 4JZOB 4POUB 3QP3A 5EN2B 3FONA 4KK9D 3WS6C 2EUWA 3PWVA 5E8EB 3MNZA 2W07B 4FTDA 3RTQB 5JXEA 3BFQG 2CIKA 3PL6B 4EI6A 3PAUA 2AJ3A 4FNLH 3UFIA 4NT6A 4ZNEE 2FEEI 5I1JH 5ISZA 5CEXB 1COBA 2HVKB 1ZDQA 4JCLA 3SPGA 3FO2B 2IGTA 2YRPA 5HI5D 1ZDSA 2A83B 1DDHB 3DJTA 3PHOB 4PJCE 2E7MA 2XA8L 2V5YA 2HUHA 5CILH 5KVGL 1ZK9A 4F57L 3H55A 3KCPA 3APMA 3ZHFA 1BXUA 3B34A 2ZUQB 3FCBA 4FYRA 3R8BB 4LCUB 5AVQB 2MCPH 5AENA 3ZTDC 3BVNB 5I73C 4M5TA 4PW4A 1GVIA 3MUJA 5EFIB 1NMCC 4QYAA 3RILA 2WMPB 4WI0A 4DPRA 4OQTA 2IMMA 2VL5A 4A7UA 3INUL 1KJMA 4IGBA 3ROOA 3FO9B 4YAQB 2ZUYA 2NZIA 3WMQA 1R34A 1YEKL 5LBSL 5DXWA 4P5TA 4N0FA 1HT6A 1CQYA 3JZ7A 4K71C 4YHOH 1R3LA 5FA3B 4OI7A 1RZ8B 2A4ZA 1JWMB 5TE6L 4G3YH 2XQ0A 3N9GH 4X98B 4MAYB 4JG0H 4O9HH 1AQKH 3UZQB 1UC6A 4PJEE 4XMWA 2CLZA 1DFBL 4QGTA 2V9UA 1IX2A 1X5GA 1YEHL 5B7MA 3M8OL 4UOJA 5DRWB 4OIIL 8FABB 4R4BB 5IIEA 4CSZA 1MFCH 2VZOA 4LNVA 1IGYA 1U8KA 2R4SH 1TTGA 4BXSV 1D9KD 3FTYA 5AVTB 3RA7L 5I0ZA 3KXFE 4WIQA 4ZTPH 3AADB 2P24A 5K1JA 1U3HA 1TQUA 1AIFA 3AW5A 1S7VA 3VXME 2CUMA 1UXMA 3MV8A 3ULUE 5E00B 1GXEA 1DZ0A 1T03H 3MJ8B 2AP2A 4PV8B 3MBEA 1ZLVK 1UFGA 3F01A 4WNQB 5IV2B 2NNRA 1IE4A 4NO2B 3VCLA 1WS8A 1CDCA 4M5YL 4MA1C 6PCYA 3MFFB 2MSPA 2H6UA 3US9A 1IEBB 2J12B 2GG1A 2A4EA 2WQXA 1HE7A 1JV2A 3IETB 4NQEE 4TMPA 1E27B 1TQTA 3Q1EA 3WDHA 4JFXA 3HE7A 1E0OB 4X42A 4AQ1C 1DBKH 1H9VA 1KBWA 3ATFA 2EYTB 3NESA 5I19L 1AS7A 4BV1A 1IJ9A 1DVXA 1Q1PA 2XC8A 2X38A 2FQFA 1E5BA 1PFCA 4OZGB 1AO7B 3MCLL 4PUBH 2OMTA 1JTPA 3MJ7A 3K7UA 2DB8A 4W4OC 3QCTL 3W9EA 4FA8A 1TJIH 5DJZB 2VDMH 2ENQA 5G55A 1U8QB 1DVFC 2X4TA 2V8MA 1TPXB 3VQLA 3D3VB 3EAKA 1KTKE 4HXBL 1G7MA 2K4AA 5D72H 2D31B 4HH9A 1WG3A 4RWYH 2DLFH 2G75B 3BUBA 1MN4A 2VJ8A 4V1DA 1ZE3H 4P46A 1FE8L 3F85A 5GGUB 3U4EB 2BOBB 3HVDA 3S36L 4XMVA 1E8ZA 1RZGB 1JPTH 3NSXA 3H4HA 4CU6A 4LLQA 1L9MA 4OCXH 1GGYA 1NCBL 2EACA 3GMMB 5F71A 3GRGA 2TSAA 1JG9A 1IKNA 3DOIA 4KHTH 6CGTA 4GFXA 1U3JA 1NANI 3TBYA 2ICWI 3D85D 1BAGA 3I74A 3EYUH 4ANKA 4C4UA 5L9DL 2E7LC 5AOMA 5GSVA 1ZRUA 3MRFB 3KLAA 2NUTA 2Q20A 2XZQL 5L4FA 4OI9A 4GUPA 4L3FA 3LXBA 4ALAL 2Y2WA 4P5SA 1X4ZA 1USQA 2VXQA 3PWJA 1FNSL 4L0YA 3UH8A 3DETD 1CICB 4OUUB 5D6CB 3MC0A 3T3MF 2J44A 5DJ2B 2VQ4A 2XV3A 5HVFB 3L6FA 3FMGL 1MJ8H 1RHHA 1G0DA 1H8NA 1NOLA 4K07A 5IHUL 1KY7A 3CDGB 5ICZB 2G0KA 3FOLA 4WUKL 2H4EA 4JEGB 4CW1A 2VLRB 4G11A 4Y5VA 1KACB 4L2YA 5FF6B 1OAJA 4FQPA 5EA0L 1MVYA 1RHFA 3E3QE 3LH8A 4OFYA 3S3JA 3HS0A 3CVBA 3MA7B 1SVCP 1IRAY 1A4KB 4WW1A 4YSUA 2OMVA 2D2CC 4HK3N 1MNUL 2P46B 5D2NB 4A04A 1VESA 1J0HA 1W8NA 4KVNH 1BVLB 5JZ7C 4UTAA 5AW9B 1EO8H 1IGML 3HR6A 1I9RH 4N2EA 3B9AA 3HBZA 3KLSA 4DAGH 1FDLL 1SF3A 1MFVA 3B37A 3VXSB 1DBAH 3CSYB 3FU7A 1Q9KB 2XXMB 4U1IB 2I9TA 2NR6C 4LCWB 2K9FB 2WCSA 1I7TA 1OP3H 3KPMA 4C55A 1R0AH 1JFQH 1OAUH 2WWMC 1XGZA 3OJDB 1IM3A 2J5LC 5IFJB 5GRJL 3NEXA 5IW3A 4AL8H 1FA4A 3VGEA 5TPWH 4NRXA 2YZ1A 5AYUL 2XZCL 5IJVA 3QI9D 4PGJA 1KXTA 4NI3A 4IRSB 3AACA 4RISL 3UG5A 4KO6A 5C9JB 3JTBA 5HDQL 2FIKA 4MSWA 1L9QA 3ZKQD 4PJGB 5F44A 4DGYL 3L2LA 2YD9A 1L0YA 2R0LH 4ZFZA 3WKMH 2FBJL 3ARVA 2Y06L 3QNXB 1I9JH 3ET9F 4YBLB 2C3HA 3G08A 3IU4L 3UACA 1BVNT 2EE9A 2O61A 1NH6A 1SVZA 1EHAA 2BP0A 4OIAA 2CJUH 1YAZA 2P52A 1UQSA 3EGSA 3SKUD 1XCQA 4GRWH 1IQDA 3K6SA 4XTRC 3VM7A 4M8RA 4OZGE 1QVOB 1AO7E 2ITFA 4CSPA 2R83A 4OLUH 5DRXA 2LU4A 5DVKA 3U83A 2YOAA 4NNPL 4YOKA 5DJDA 4Z7QB 1E42A 2KLTA 5HGHA 1VFAB 3O9WD 4P49A 4PRHD 3D3VE 4OU3A 5E4IA 5JYLA 3MRLA 3AMLA 3CIAA 4K94L 4DP0X 4X5XA 5GZOD 4X99A 1F4XL 4F7TA 3DX3A 2DYPD 4AK2A 4P05A 3NJMA 1QD0A 2EDLA 3O6KH 1NM9A 3EDFA 3NA4A 2VXSH 3QJXA 1WF5A 2HUEA 4XBEH 4PRPA 3VO0A 2IAAC 1QOKA 5HGGS 5TE4L 2AK1L 4U1NA 3DPDA 3S4SB 2XACC 3O8XC 1MEXH 2HTKC 4R96A 2WXLA 2ZP8A 5SX5K 3QFDA 4G8GA 3BVTA 4M43H 5IB1A 1UWYA 3G7TA 1UHVA 1A0QL 5JW5B 4JFHD 1RUPH 5HYJD 2QHLA 5EUOB 2KQMA 3O3EB 3MJ9A 4Y4FA 3VQ1C 3DMMA 3TFKD 3U4KA 1K2DB 4GAGL 3DV6A 4HIJA 2Y23A 4EKXA 2HN7B 2YFOA 4JPKH 1OO2A 3O11A 3U36A 5CEZE 1PG7L 1FFPB 2ZOKA 4XBPA 3TEXA 2LAGB 3IK2A 3SY0B 4IMLB 1B2WH 1EZVX 3QORC 2Z4QB 3QUKA 3W0WB 4X7EC 4ELMA 3NACH 1FO0A 2YA0A 3D48R 1N64L 5CAYB 3BXNA 4A6YL 4IKLA 4X5RA 7TAAA 4Z7WA 1O6SB 1U33A 4HPYH 4UNTA 3QIUC 5ANHA 4NCC1 4YSEA 1J8HA 1WT5A 2NRDA 2AXFB 2VLRE 3IFOB 3OB8A 4XWGH 4XPFH 4XN9A 5JIKA 3S96A 3TA3A 4UM9D 3VMNA 2YKLH 3P4NA 4L1BA 3WY2A 2WWKO 1ZTXL 2EJ1A 3PF2A 2VDLL 1QG3A 1RFDL 3RX5A 4X6CF 4HJ1A 2XICA 3C5ZA 5D2NE 4KNQA 1S5IL 5LGYA 3UTTB 1Q9LA 1CDGA 1AGCB 4J3OG 1CK0L 3HPJA 4GKLA 3LQAL 4NN7C 3VXSE 2AABH 4JY6A 5I18L 3QDGA 2P26A 2PW1A 4P4KA 4GG6A 4RMSA 5D2LA 1LVEA 2NXYB 1JGDA 4MJHA 4LCWE 3K5SA 4ABQA 4LCYA 3E8UH 4KOCA 2ESVD 2CMRH 5D96B 5T1DH 4RGND 3AGWA 2J43A 3DX9B 1I9IH 2E9BA 5IB4A 4ODWA 4JZNA 5GGRY 2B77A 4KV5E 5BZWA 5C0GB 3N50A 5BO1L 3TU6A 3RFZC 2WTRB 5I1LB 2NCMA 1BFVL 2F5AH 1U95B 5D8JL 5F7YC 3HFML 3VG0L 3ZL4H 4ALAC 1YC8A 3PNWA 4N9GA 3WGVB 4ZOAA 5SWSB 4LPUA 1CLYL 2GTQA 4FQXC 5E4EC 2P8LB 5KYUB 4CMHB 4UU9A 2J25A 2NY0C 3F58H 4UQ2A 3TJPA 1IILE 4QUOA 1Z5YD 5IEKB 4PJGE 1BVOA 1Q9WA 1CGVA 5KBLA 3QEQE 3QVAA 3L3OB 3LS5L 3NFSH 3T0EB 3THML 4L1TA 3WLWC 3ES6B 3QXDA 3IDUA 4A2DA 2J5WA 3UCRA 5GRYA 25C8L 5GS0D 4HW6A 2QHRH 4IOFC 2QQLH 3PWLB 3DC0A 5H35B 1U8OA 2HMIC 5C6TH 4KMLB 4URTB 1RUMH 4TQEL 3T6WA 4YBQC 1E4WH 3TPUB 4Z7QE 1CLZL 2ENPA 4O2FB 2WXJA 1A6AB 3SE8L 5E6RB 3K6DA 2IWFA 4LU5H 1ADQA 3C6EA 1PNDA 2F9BT 3ZOAA 4YR6B 1CQKA 3FT0A 3VD1A 3SQOH 2UVFA 3NK3A 1V7NH 3WHXB 4IOIB 4NKIH 3BP6B 3CDZB 1AR1D 4Z95H 1J9TA 4ORZC 1FN4B 1P7QB 2HG5A 1V54B 3IEAA 1J88A 4FXGA 1RJLA 3IKKA 3DX2A 2WZPA 4U6HB 4HX1A 4PPTA 1E9QA 4AQOA 3LPOA 4J23A 3EXJA 1OAQH 4MDIA 4CU8A 1R24A 1ORSB 2EEAA 1MFAL 5EUOE 1OAXL 1ZT1B 1AANA 3IJSB 2WIMA 4XR8C 1UKTA 1TZGH 3V6FB 3WNKA 1JI2A 1IT9L 1T2QL 3N1PC 1NCWH 1G7QA 3U9UB 3FCGA 5F9JB 2ITDA 2VDOH 3ZGHA 2OMNA 3SCMC 5FLVA 3BMVA 1CXKA 2IXQA 3EYQD 1IZJA 4PVMA 5I1CH 5E8OA 2ZE0A 3G6DL 5C0JA 5FV1L 3W0WE 4X8JA 2DWDB 2CU9A 1X5IA 1EAPB 3UP1A 4PJIA 4CDHA 3MRHB 2OL3A 2V4LA 1HWHB 2ZX9A 3OC5A 4GAAA 3NYKA 4I8DA 4OD1H 4RAHA 1CT8A 1MREH 1NCHA 3BGFB 4NQSB 4MDJB 1PY9A 4MMZA 1U8MB 1ZLWK 2VDMB 4H8WL 1WA0X 4K94C 3LKQB 5EEYA 3RG1C 5CEYA 2O5ZH 4WCYH 5LAXA 4PREB 4XN4A 4ZFOA 2NY3B 1E9OB 4MCZA 5FKPB 4AMKL 3OAZH 3QEHB 4FFYL 5L6YL 3SBWA 4JFFB 3UTTE 2WLNA 1TVHB 3GBML 2KPWA 3QAQA 5BS0D 2MJWA 3L13A 3QEUB 1AG6A 5DMKB 3HUJA 2OJZH 2P1YA 4IU2B 4DEPC 4GJTB 3D51A 3REVB 4KDVA 1D3CA 1D5BB 2X28A 4L29B 4XHJD 4QHUA 2W80C 2QGEA 3GMLB 5DS1A 3HG1A 2IH3A 3KLHC 4XNZB 2B1AH 1SXCA 3WFCL 5CWSA 4XX1G 1YECL 4TNVF 1H19A 4HZ1A 4X4YB 4YDKH 3M6DA 5JIDA 2ZIDA 5CZXD 4R2GB 5DS8A 3RDTB 1KBGL 5SWSE 5A2FA 4NRZB 1FNAA 1PPIA 4XN1A 4Z3EA 4M1GH 4N8VG 2YWZA 3N2JA 4HWEH 4PW3A 5AVWB 4CADA 3NSYA 4YPGA 5EEUA 1EZVY 2EDOA 1VLXA 3KE0A 4ZXBD 1B0WA 2P48B 2FB4L 3MRDB 2BSEA 5F97E 3HZKA 2PPFA 2E7CA 3L4ZA 2HB0A 3T0EE 5E94B 2XDHA 2VL4A 2H8PA 1MH5B 2DJSA 2OXGA 4ZODA 4MJ6B 2GFBB 3DX4A 2ENJA 2IDQA 3CVHB 1C12A 1IQWH 3GJFH 2WQRA 4H26A 4RETB 2K3TA 4F9PA 2XCMC 1IGJB 2OYMA 1D6VH 1H15B 5BMFL 2JXMA 4H0LC 4D0DB 3FU9A 3FFDB 1ZHLA 5MEPB 2P4AB 5DUML 1RK0B 1J8RA 1RIUH 3LQAC 3HMWH 3TEWA 3VWKC 4K3JH 4JANB 2BRQA 4PW9A 3UJIL 1T1ZB 4Z77B 5LXVA 1KJVB 5K93A 3R7QA 2WWNA 2P80D 1KV3A 4OLYL 3TTSA 2W9DH 3BEWB 1JZJA 5ERWB 1O7DC 1EXGA 3FB8A 4KVCL 4QY8A 3TF4A 4XZ4A 3NJJA 2CKBA 2QPUA 2VMDA 1AS6A 1E3FA 1XF3B 2P8MA 3NPZB 3VFUA 4PU2A 3CE1A 2EICA 3O6LL 2GY7B 3RWGA 4PBDA 3K6IA 2QVTA 4NZRL 1MCIA 5IG7B 3DXAA 1O5PA 2A5UA 3DGDA 4NC2B 3V0HA 4G6ML 4N0CD 4MD5A 1RLBA 3FK3A 2JJTC 3DYPA 2WIIB 3C08L 5EU6D 2I07A 3TN0D 4L4JA 3IJHB 4JO1H 1JDCA 5BV7B 2GITB 2LR4A 4XMPH 2MCG1 1FGNL 1N12A 2Y7QA 1FORL 2OSLB 2OMWA 5I1KH 4PJ8A 2NTSP 2KKQA 3V6OC 2MKLC 3H7BB 5F6HJ 4YHYC 4GSRA 5CO1A 1BAFL 4EN3D 3SPHA 3TJHC 3FTXA 4KTDL 3ROLB 3ZUNC 3KDMA 1HQRB 4Z78A 4KAQH 2W38A 5AVYB 2AXGA 4DW2L 1O7SA 5DWUL 3EBAA 3MLSH 2E75C 4J3VA 5EF0A 2HP4A 4BHUA 1DQKA 1J11A 1TETH 3N1FC 1GW6A 4XNQA 2VRAA 5TF1L 3HB3D 4U1HB 1CR9H 5C0IA 4OCMC 2E76C 3QIWD 4PVNA 4EVNA 1JHTB 3UDWA 5H37G 4QHLB 1CYXA 1FNGB 4Y4KA 4AKPA 5CLTA 3MBWB 1FH5L 1P6AB 2LLLA 3BW9B 1A7RL 2AEOA 4P5KA 4JFFE 5EZOH 9PCYA 5IESH 4JDTH 5C0AD 1RUKH 2QQKH 1AYOA 1NLDH 1NL0L 4CC0A 5E24E 4A2LA 4EDWL 1HKLL 4XE0A 1KYAA 4KZCA 3PJSA 3ZHNA 5HHPB 5KTEL 4E9TA 1JZ5A 3ULUL 2ZCZA 1BZ9B 5L2KD 3FRPB 4LHQB 4CC4C 2W8CA 3AUVA 4YIQA 1UWGL 3LZQA 3Q3GA 2OJEB 3OKKA 4UNUA 2ATKA 3KL5A 3NP4A 5E1IA 2ZXGA 3MLVH 1I8KA 4KWUA 3KL3A 4Q97A 1S3KL 2LVEA 1TYJA 3ESUF 2L7QA 4NJ9H 5C7ZA 2Z92B 1KXQE 2FIRT 5I30L 4LDEB 1Z7JA 4ZMVA 4ZO7A 4M3KB 4PRAB 5I1HL 4L8SA 2VDKL 4OY9A 2XXGA 4I3SH 3RUGF 2D7MA 2WBWB 1PKQB 2AKRA 3ZYJA 3NQKA 2RR3A 5IQLA 4Q9QL 3MRNB 5E03A 4XPAL 4XPTH 5DHYB 1G6VK 3C60B 4XPHH 3ZMNA 5E6IC 2IWEA 2PWFA 2HJFA 4PJ9A 2Z91B 3FQ4A 3JWNG 5L4MA 1HSBB 2VW4A 2P5PA 4BSWB 1YJDL 4H8WC 1YY8A 3EFOB 2AEWA 2LFEA 3GMNB 5JTWA 1OSPH 3NIFF 1GW0A 1SOSA 4TSBH 1INDL 5IQ9B 1MI5A 3CN0A 4MRBA 2V9TA 2VXUH 3STLA 4Y7OC 2HKFL 5EF3A 5HGAA 1B2YA 3STZB 3O6FD 2R2CA 3L81A 1FZOA 3QHFL 2Q2LA 4FKEA 4LARH 4ZUUA 4Y16A 5IHZA 4WWKB 2GSIB 3V8OA 1QNZH 4EZJA 3D07A 1M7IA 4B41A 2ETWA 3B5TA 5E08L 2BHYA 5TK2A 2O6EA 4JDEB 4GW4A 1A25A 1EZUA 3SDYH 3QIBD 4QRRB 4MB5A 2FJHB 2K7QA 4P3DA 4ENED 4BHUI 1DJSA 3NJKA 1C7SA 2NTFB 3LIZH 1SEQH 1N8ZB 4ZPVA 1CGSL 1OLLA 1XZ0A 1FYTE 4Z0XB 2DWEB 4R26L 1KTCA 4XRCB 2WY3B 5B3JE 1SLUA 1VF5C 3FHEA 3SE9H 5AVZB 2EE6A 1KCRH 4JHAH 4GUQA 5FYLD 3TLRA 3SDCA 2XJKA 3JXAA 3LD8C 4G8FB 3KVDD 4I0PC 3UBXG 4AE0A 2R0ZH 2KERA 4W9JC 3U0TB 4QO1A 1LO4L 1CFNB 2QMKA 2W60B 4WUUB 4OV5A 2GK0B 3FQYA 1UB6A 4FA7B 4MXQC 1HI6A 1YHPA 1V10A 1YNKL 3KVQA 4I18A 4O2CA 5DD6A 3IMRA 3RAJH 3QJFA 4DKFL 1T20B 2BLFA 4NB7A 4ODUB 4FXKA 1JS4A 3QFGA 2XWXA 1MIML 2B0SL 4JW3A 1YN7B 1FH2A 4Z3JA 3OZLA 3SYOA 3K74B 2D3LA 1SYSB 2B4CL 3ABMB 3D30A 3PV6A 3S35X 2A74B 2EDWA 2P5WB 3HC4H 3FQTA 1UA7A 3OKMA 2R7EB 5D6DC 1LDSA 3ZRFC 5FFLA 1MCPL 1MJUL 1B88A 3MBXL 3RGVB 5CJXA 2FZ3B 4MXWH 4XXWC 4QHMB 4TRPH 3OMIB 3LNGA 1JD9A 1FSKB 4C4KT 4KQ3H 5D93B 2GSGA 4X0NA 4QR7A 5IUSA 2WLZA 2DMBA 2WXPA 1P53A 2X70B 3HBGA 4HIQA 5B39G 4FQQB 3HAEA 3WIFB 1SMOA 1LDPH 4XVUC 2CDEB 4LCCB 4JHZA 3ULVC 1Q0EA 3KD4A 3RZCC 4XP5H 2ATPA 1OCOB 1DQVA 4FERA 2AJZA 2R27A 4MA8H 2OX5B 2QGDA 4WHTB 3B83A 3WEXA 3ECQA 4LDCA 1LNUA 1DE4B 1MW0A 4J7RA 1YMHB 5CBAB 4GRLB 4WWPA 1S9VA 1H5BA 1PKQE 1QUNA 3DPBB 3GXTA 2AANA 4TV3A 3EH4B 4Z9KB 4FQHA 3ARRA 1J1XH 4M4PA 1TZHB 3IFNL 4PSPA 2A38A 1Q0XH 4N3UA 2JCCF 2UYLB 5G5DB 1AY1L 1GKOA 3LV3A 5KYNA 4ZZFA 3QB7C 2I9LA 4LHUD 4OH2A 4HJTA 4DTGL 2X4QB 2DLIA 3BDXA 3DRTA 3ETSA 4Z7NF 2QL1A 4MRCA 2WP3O 2XX1A 4UT6A 5HJBA 2ROXA 1UZ6E 3VXPB 4RFOH 2DQJH 1IM9A 1FNHA 3A0OA 4KK9C 4Z76B 5J5EA 1I7UB 5B3SB 5D1QD 2PWEA 1NGQH 3CFDB 4JRYB 3S34H 4P2OB 2VUOA 4X80L 3ULUC 3IFPA 1MHPL 3WEBA 5DDHA 1BGXH 2BCKB 3FQ2A 2APFA 1OEZW 1QI5A 3TH2T 4U7MA 3QUML 2Y0SA 4OUOA 3S6CA 1AE6H 1NFDA 4R5TA 5HHVH 3RYMA 3GSRA 1SRDA 3L17A 4HUXA 4RAVB 4X50A 4QRRE 4YE4H 3LAFA 4FYSA 4ZAKD 4IHOB 4QXWA 5JOFB 4DN4H 3NIDF 3D06A 2MTAA 4CC1A 5DFWH 5A16A 5CCJA 3GRWA 3ISRA 4L3CA 4PJEF 4AYBA 3QISA 1MQKH 1RPQA 4OJAA 3IPEA 1AQDB 5HHOB 2DQIL 4J5VA 2WB1A 5FWRA 4Z6AT 5ES4B 4KPHL 3QUGA 3IM1A 5DGRA 4PJFF 2YUWA 5CGYC 4EUPB 2EXWC 1N18A 1RU9L 3QPKA 1T7WA 2LV4A 4FYQA 3PHQB 4JCMA 4WUUE 3ZDYF 1S9KC 1YJDC 5EF1A 4JM2A 3V5DA 2E4FA 3H0TB 2ZF9A 4K7PX 4U6VL 1M3JA 5BCAA 5DK0A 3MRPA 1NUGA 4ZSOA 4G83A 2TSBA 5AZ2L 5TDPA 3HBQA 2R15A 3TBWA 1MUJB 3AJ7A 3APNA 3DX8B 1Y1UA 1TTFA 1NCTA 5AB2A 3GJFB 2E47A 4N26A 2IPUK 3BRGC 1E50A 1I1YB 3B9KD 3D09A 4YXHH 4RMTA 3GB7A 3NFPB 2EDTA 5DC9B 3L8QA 1P4BH 2IH1A 2WLMA 1A1OB 4LCVA 2P5WE 5FK9B 1ED3B 3DVNB 1JXDA 1YEWA 2Y5TB 2COVD 3MXWL 1A3LL 1YYLH 3UBXA 1TEYA 3MOAH 4PRBA 3BQUD 3EFFA 2OSWA 3MRGA 2YXWA 1HCFX 1N10A 2BVQB 2XBDA 3FUFA 1JE6A 1XGYL 3NCXA 1UVQA 1REIA 3NK4A 5JOPD 4DVRL 3DURA 4E9QA 5IVZA 3UPAA 4YHLH 1TQBC 2VN6A 4XMKL 5EB9A 4NM4H 5AB0A 2UWEA 4HWBH 4FX5A 5F6IB 1I82A 2ZUTA 2YD7A 3S37H 2PXYB 2Q3ZA 5C0EA 1IBFA 2XWTB 1M56B 5LCVA 2Y2YA 5DQDH 1KGUA 2D0FA 3BH8A 2B8OT 3ESNA 3ZTEA 1JZ3A 3MTRA 1ORQB 3GJEB 5FUOL 1R3HA 3QG6B 4P2RD 3G6AA 4NERA 1BZEA 35C8H 1CE6A 1MW3A 3DJ9A 4XE5B 1C16A 3E3QC 3GC3A 1KT2A 2VKWA 1K4DA 4MAYC 4HT1H 1UB5B 5F9OH 4E0RB 1KLUA 4J6RL 4OBRA 2C9RA 2PTTA 4P4RB 4YC2B 4Q0XH 3MGOB 1ZT4B 3NGBC 1AGBA 3GMPB 3G5ZA 2V17L 4C54A 2EIKB 2PP9A 2VDQL 2O5XH 3MNVB 2ZAIA 4R7NB 1U8PA 1JPGB 2GCYB 3FT2B 4ODVL 3V4PH 1I8AA 4PRNA 4B5ZA 2AV1A 5AL8A 3DO7B 1T89A 2G3ZA 1D9KA 2QR0A 3RWIA 5C7XL 1CFVL 2CXKA 1CXHA 4JRYE 1Z32X 3BAXA 3WFBH 2ZP0T 4FQLL 3WS3B 1QLEB 4AYEC 5A2IH 3TWCH 1SHMA 3SE3A 5DC0A 1NDGA 5CNHA 3ESOA 3D4GA 4XC3H 5IROC 3MLRH 5KUMA 3R7RA 3CGTA 1IL1B 4I1PA 2CHWA 4M7JL 2NT1A 1IJNA 2O72A 2ZX6A 5DEJA 3OGOE 3ZZSA 4G7YH 2AS5M 1MRFL 1OZUA 1PIFA 2JE8A 1VPOL 3W81A 3O3BA 3SO3C 1RAMA 4YHKH 2G5BB 4XMTA 3MLZH 4PJHF 4KHXL 3P4OA 5EO9B 3PV7A 4L9LA 3DETC 5C8JA 3IDXL 1H6FA 2OCFD 5HHOE 1RZPA 3MLTB 4YHML 3M88A 3IDYB 2O6CA 5E99L 3EGXB 4LXFA 1C08A 4JRFA 5CGMA 3TV3L 3UBXI 3BIBX 3SGJA 3L1EA 1JZEA 1MHEA 1PNCA 4WI8A 5K39B 4KI5E 2X6MA 4EDXB 3F04A 4MMYA 1MCHA 1EERB 5GS0L 3UPCA 5F96L 3CC1A 2RJMA 1FVCB 2GB2A 2X9XA 1AFVL 4YZWA 2NX5D 4XMLH 3FB7B 4P5MB 2R39A 2X42A 3HN8A 5LJYH 1JVKA 4AXWB 1VRSA 2CA3A 2XXCB 3V52H 4HIIA 4JKMA 4NN6B 3NCWA 3IE9A 3U7YL 4L4VB 3FOMB 3KGSA 5MHSE 1UXWB 2RQ8A 4EXKA 4AG4H 3F6IA 1N0LA 5FO9B 4LOEA 5F88A 1ZEAL 3ULSA 4U1MA 4BKLA 5ENWB 3D39B 4XCNA 3DBSA 4OCYH 3T1FB 2MHAB 3OQ3B 4XGZB 2R2EB 5F3FA 5JO5B 1HH6A 2CDGA 4AUYA 4FNLL 4XWOD 1T7YA 2X88A 3RU8H 1C5CH 1N0XH 4U2YA 4PMEA 2VR5A 5T3XH 2XT1B 1R5VB 4IBZA 4MB1A 3DECA 3D85A 3QI9C 5I1JL 5CN2A 1SJEB 3UGXA 2EC9U 1IGTB 3WMPA 4IBVA 1FAKT 5AD0B 5HHQB 3IBEA 4PP2B 4AT6B 4WWNA 4PV9A 1A3ZA 5CILL 1KIQA 1WCQA 5A40E 4X8GA 3EHBB 5C3TA 1T83A 1CICC 3MNWA 2MCPL 3SDDB 1ZXQA 1A47A 2GUOA 5CM1A 5CR8A 2VE6A 1JUFA 3DSNA 5D5MA 5DFVC 1VSCA 5HYSG 2PWGA 3J7HA 5F7LB 2ADGA 1IBHA 1MRDH 1SXBA 4HJGB 5EIQA 4Y4HB 2KC0A 1CWVA 4XP6H 3HZVA 3AY2A 5GSRB 4O51B 4X9YA 4UQDA 2B14A 4IBTA 3DTXA 3A4FA 3SOBH 1CN4A 2IALB 4UM8B 1O7VA 1N5AB 4YHOL 5INCA 5CCKH 4X8CA 4C83B 3Q8AA 1KTLB 1KBBA 4M7ZC 1QSFE 4G3YL 1S9XA 1B0IA 2VWEC 2ITCB 4JG0L 4O9HL 1AQKL 4S1DD 2E9IA 4WGWB 3BSZA 1J05A 3RX8A 3WL9A 1V27A 4MVBD 3KWUA 4WNJA 1DL7H 5I0WA 1RURH 3AU0A 4EJ1C 1VZHA 4P23B 1KY6A 4ABWA 4AGQA 4DETA 2DEYX 4UQAA 4FD0A 1VFBA 5C0BD 1V5JA 1F90H 1W0VA 3NZHH 5DJ8A 1WAAF 2WGXA 4ZYKA 1AGFB 1TR7A 3BH9B 2DICA 2R4SL 3CFEB 4U1LB 4X5WA 2UX6A 5B7EA 4KTGA 4MASA 4Y5YC 2CGRH 4XCYB 3N1QC 3ARDC 3TA4D 4PY8I 3KWXA 2Z7YA 2VQTA 1I8LC 3NCEB 5LNEA 3ABGA 1JWUA 1YN6B 2AK4B 4KUCF 3W39A 3QI9A 1T03L 1KJ2B 5F0MB 3WFHB 1AJ7H 1PTZA 2CH8A 3APCA 5L2JB 4ZOEA 2APXA 3HKZA 4DGIH 2DIJA 4ISVB 3S5LG 4C56A 4ODBD 1IEAB 4E41B 1A7BA 1AACA 4FQ2H 1EVUA 1XH1A 2XI9A 3AWGA 2WKLA 2ZSVB 3RI5F 3UPRB 1DYZA 1MWAH 5AKVA 3LKRA 2MNWA 3MGTB 5D1ZA 3MOQA 3I84A 5TH2B 1B90A 1DBKL 2VXTH 4Z7VB 3H9SD 3QDJD 5JUEH 1LE9A 1HINH 1HIMH 2FLRT 4PUBL 3ZT7A 4NYLB 1OVZA 5DURB 4F8QA 3CG8A 1TJIL 3O9WA 1AD9B 5F8RC 5F7UA 4EOWH 4ZQTA 3IS1X 2JKXA 1FZMB 2JKSA 4Q4EA 4MNQB 5GZOA 5KG9A 5D72L 5EC1A 1YNTA 4L4VE 2DYPA 4RWYL 3MJ6A 2DLFL 1V05A 3L3GB 4RRPM 4QT5B 2VXVL 1HEZB 1YC7A 1QHQA 3ALXA 5EWIL 2WZAA 3VUAA 1DN2A 4H8HA 4PS3A 1ZSDB 4AVJA 2VZ1A 3RWFB 3E2HC 4RGNC 1C9SA 3BWSA 4J1UA 5F89B 3V0VA 2ZICA 3D39E 1HEJC 4KKQA 1JPTL 3EH5B 5LNGA 2R29H 1I85C 3FTGA 2IPTH 3V5HB 5BNXD 5C86A 1IEHA 3X1FA 4UDUB 1N7MH 4U7KA 3VFPA 3EGDB 2GJ6B 3PL6D 5I6LA 2HJKB 2RCSH 3QQ9C 4J8RB 1PCSA 5TTRA 3MRKB 5HYJA 5J57B 3FFOA 2P45B 4KHTL 3DVIA 3AGVA 3U7AA 4P59H 4KXBA 2VUYA 3GLAA 1JGEA 4Z7QF 4DP8X 2PP7A 15C8H 1F0LA 3EYUL 1KIRB 4WQOA 5T5NF 5IKCA 2CNZA 1U8NB 4GINA 3B7SA 5E8DH 4K3EH 3QT2A 2R2BB 4HGWA 3X3FH 5DRNA 1SDYA 2BINA 1SXNA 1PDKA 5IVXA 2YAMA 3H9HB 1I75A 3EJTA 5EPMA 5GS3A 2HT4D 4G6AD 5IBTH 1FV1B 2GK2A 5GS0C 3L3JA 4P9HH 4YDLB 3VNZA 4LKXB 1MJ8L 1M71A 5CLXA 4AIZB 1QFHA 3LKSA 3RB5A 4HCIA 1OW0A 2YAEA 4M29A 1DEDA 3KYNA 4HGKC 3X12A 3MODH 4NUPA 3BC9A 1AKJB 3MV9B 3JWOL 4UM9A 5I1AB 4Q8BA 3KH4A 4AYMC 2M2DA 4LPWA 1NCJA 1PGRB 1F58H 4KKLD 3WTXA 4HZAA 1N6UA 4RMRA 1G7HA 1R4XA 3ZHKA 3HZMA 4HOZA 5I23A 2YSSB 3ARFA 4LMQE 4H25B 1O6TA 3EO0A 3HHMA 4HOMA 1MY5A 4GI8A 1RIHH 3KYAA 4DVBA 3GLZA 1RZKL 2OXHB 3V10A 4KVNL 4W9DC 5A43C 5IUCA 2D2OA 5FYKU 1AR1C 2VDNH 1EO8L 3ZE2F 1I9RL 2IBGA 3L5WB 1CPUA 5D1ZI 1XT5A 1YUHA 3KPQA 1W91A 4LVNB 1SY6H 5KYWB 2ESVA 3G5YB 4B9YA 4YVUA 4HIEA 1ZLWH 5HJDA 3RVWC 3FAWA 3ARBB 2AGJH 2JLLA 3WEMA 2ISDA 3T4YB 1NAMA 3A3YB 4D9QD 5FM5M 1R0AL 1JFQL 1OAUL 1VGEH 1JV5B 1EEQA 4CAGA 4PS8A 5JHLA 5GS1A 4RFNB 4AL8L 2ZF8A 2XZZA 1IC1A 2HTLC 5TPWL 2BP8A 3DTDA 4FEMA 4LKCA 5KVEL 2JKLA 4HJIA 4UIKL 1S7XB 2ORBL 1TQSA 3V4UH 4E41E 1KCKA 4TULL 3REWA 2WANA 4FTVD 1NBYA 2V2XB 3W5MA 3BWUC 1DLFH 1A9BA 1BVNP 2R0LL 2QPDB 3WKML 1QRND 2WXKA 4JQIH 4H8UA 3RX7A 2F19L 4R9HA 4Z7VE 4WI9A 1F4AA 2CJUL 4G9DA 2JMRA 1OOWA 3QXUA 3JWDH 5C70A 2Z7ZA 3Q0HA 2GSMB 2MOQA 1O6VA 1MCWM 1QLFA 4OLUL 4KRPD 3LSOA 1ASQA 1JYVA 3MR9B 4ZO6A 4OFQA 4NIYE 3BQVA 2B59A 3C6SA 3IRCA 4IBLT 3ALWA 4QOKA 3VGGA 4I9WE 4MNQE 3BJ91 2AAAA 3VXRD 5I24A 1B6UA 3D3VD 5IP4A 1G4MA 3L7EA 5J89A 2YPKA 5KJRH 3AG2B 4I0CC 1OV8A 1VENA 4WGKA 1QBAA 5DHEA 5GS2H 4RX4D 2PCXA 3SD2A 4XHJC 5G4MA 4BRJA 2VXSL 2RBLA 3SKMB 4XCCH 3RL1A 4KDTA 5I6XB 4QXGL 1L0XA 4XBEL 1GJUA 3L3DB 1QTSA 1XR8A 1QBLH 4CU7A 2GBAA 2Y1AA 2GJ6E 1MEXL 4NQDB 2X4RA 5E5MA 3KEDA 4WKXA 4GKOA 4M43L 3IU3B 3B2UD 4PWEA 2N0MA 1KYUA 1MWOA 5E70A 5FGSA 3VA2C 2ADJB 1J0YA 1UATA 3KPOB 1UWFA 3F7VA 5D7JB 2IVFC 4HSCX 4J3WA 3K6NA 1Y6KR 3S2CA 1EXHA 1QEWB 2UZXA 1E4HA 4TL4A 3UBHA 3ZHDA 4HHAA 1OT1A 4JPKL 3WAKA 4CVZA 1KTRL 1D5ZA 1LTXA 1HH9A 4YL4A 1CGWA 5CBEB 3NRPA 4MNGB 2CM6A 3TASA 1PY0A 3W3BA 1QX1A 3LKOB 1H6TA 4LLWB 2YC1A 5SWZA 1MJJA 1B2WL 2VABA 3NJHA 1W6WA 2HLFD 2VLME 4GRMB 4H40A 4Y9EA 3VGDA 3NACL 3FCSB 3F7YB 5HPMB 4AQ8A 4WEBH 3MV9E 4AYSA 4KUCD 4LP4A 2B1HL 4XWGL 4ZUVA 1HNGA 4XPFL 5T1JA 1A6PA 3K2IA 3QPXH 2YKLL 3FT3A 3EG9A 5HHNB 2BSBA 3ILQC 4PI0A 3RKDD 3NDYE 2C7UB 5BS0A 2XQYK 3IYLW 2YBRA 1TQWA 5I2IB 4MYWB 4N2MA 4IK7A 3WCYA 4AE1A 2NNXA 4B3VA 3L9EA 2AABL 3FZUD 1PQZB 1DO5A 4F91B 2EUXA 4J4PD 1TTRA 4L3AA 4JBSA 4XNZC 3Q05A 4GG8A 3F6LA 2Z64C 1S7TB 2QELA 3S98A 3X17A 1YEDA 2CMRL 2MOGA 1IC7H 3IDJB 3PABA 4R0LA 1I9IL 1E7VA 2HKAA 1VADA 1ZV9A 4N0CC 2R1XA 4P06A 1W80A 5F7WC 4IS6A 1KB5B 2YAOA 5GRXG 4HPHA 3C5SB 3TN0C 1JMXA 4BE6A 3UEZA 3HRZC 2F5AL 4MHHG 3TIDA 3RWEA 3ZL4L 1HHGB 1HJCA 3C6LB 1S9WB 3LRKA 1FFNA 3BYTA 3VI3F 2XN9B 4WDIB 5HPOA 5DJ0B 4ZXBA 1XGPA 3CQFA 3F58L 4IRSD 2VDPH 2DYSB 4G71B 1EXUA 1K4CB 4XP9H 1L5GA 3HA0A 4EN3C 4PHXA 4DP1X 1UG9A 4N2IA 2BSDA 4Q6KA 4QYOB 4BFJA 1ZKAA 3I02A 1NKGA 2AJXH 3NFSL 2XN0A 1SF5A 2N7AA 3FH7A 2H41A 4WLCA 5ESAA 3JWOC 1DVTA 5CR1A 2L3BA 4POZD 2RHEA 3TVMD 2X4SB 2QHRL 3QIWC 1HVXA 4ZI8A 4RGOH 5HDBB 2QQLL 1AXSB 4ZNCD 1RULL 2X87A 5DK2A 4WSGA 4AGOA 2HG0A 5C6TL 3DUHA 1RUML 3PGFH 2BNQB 4P3CH 1RZKC 1E4WL 3BISA 5AVRB 4Z3FA 4HC1L 3VWJB 5EC2B 5F7KC 1UOVA 5C1MB 3OLEA 1CI3M 4KRLB 3MZTA 2E7HA 4LU5L 1DUZA 3FCTB 2P80A 5CLYA 3MRMB 1LO3H 5CMAA 2PUQT 3SQOL 1V7NL 1Z3RA 3QUHA 4NKIL 3GSXB 3Q2WA 4Z95L 4B7LA 4ATTA 2BY1A 1OE3A 3GUFA 3PDOB 4GXFA 5IWLA 3DNKA 4X4ME 1G7LB 4HKJB 2ED6A 3ARYA 4AL8C 2YRLA 2IBZX 1OE1A 1ZLDA 4PJAF 1GPOH 4IU3B 1BIIA 2VJXA 1P5UB 3BGMB 1T4KA 1ULVA 1NEPA 2C9SA 1FLRH 2CLVA 1OAQL 1DEEB 1X44A 2ZG3A 1UWEH 1O9VA 4HV8A 1QLRB 5TK4A 4X6CA 1KCBA 2E6JA 3UERA 2BOCA 2BS8A 2J6EL 1TZGL 2IQAA 2SEBA 1WS7A 4WFHE 1JF6A 1NCWL 1AC6A 3I75A 3HMXA 2VDOL 5DO2D 1MWAB 4NLHA 1SM3H 5C71A 4YQXL 1P7HL 4UQIM 2J1XA 5F9DC 1UJ3A 4GBXD 4PJBF 2R9HC 4MJIA 1A6VH 2R23A 1B0RB 4W6XB 2PCFB 4JFPA 2M83A 3RRQA 1UGKA 2DRUA 4ZK8A 3TZVA 3IMTA 4OD1L 5I76B 5LB1A 4IRZH 4YO0A 4GI6A 3TO2A 3VFOB 1F13A 5JQHC 4JFED 3L2MA 3UZEC 1CIUA 3ISYA 2NSXA 2JKTM 4A7QA 4DP4X 4PB0H 4IEFA 3QNZA 5C07D 4JVUA 3MNDA 2O5ZL 4YH6A 5C0AA 1WDAA 4WU7B 2QZQA 1ERNA 5BXFA 4ZMTA 1YNLH 3R4DA 3BDYH 1ECYA 4BIKA 5JZ7D 4Q6IC 4X4ZA 1WGVA 4K8RD 1BJ1J 2OJZL 3O0RH 4X6FB 1AIZA 3VG9B 5J13B 4PJ7B 2VW7A 1I4FA 1JNLH 2XG4A 3QCUH 3QIBC 3KWTA 3WY3A 4ONFH 4ENEC 4JE4B 2NXYD 4LHUG 2JIXB 1J10A 1QAWA 5HDLA 1U8LA 2B1AL 3DUUA 4QRQA 2GJZB 3FQXB 3B2VH 2DL9A 4Y2LA 5T3XE 3BZ4B 1ITBB 1TQVA 5DHDA 5AW2B 2KUTA 4DO4A 1RJZA 3O45A 2PTUA 4I4WA 4BKTC 4KRNA 2ICEA 4NS0A 1UT9A 2FGWH 2P9RA 4FA6A 3W11C 1N59B 1SJMA 5JHDA 3WUWG 4M1GL 5SWSD 2DJ4A 2XV2A 3P77A 4HWEL 3QFJA 1FL5A 1I7RA 2J21A 1FZJB 3F00A 2Y25A 3I85A 1HXKA 3MV01 4GW5B 5IB5A 4WTXA 4OAWB 3OAUL 1T80A 4GW1A 5FFOA 1AI1L 4NKDA 5FYKD 3LEXB 3P9LB 2X9YA 4G7RB 4GEIA 4XNYH 4ZUWB 3CPUA 4H1LG 1WBXA 1G7PA 1NANH 3LQZA 4NGHH 5E2UL 2L7EA 5CD3A 2BY3A 4BINA 1CLVA 2EDYA 4BZ1A 5HDBE 3SBPA 1IQWL 1F4YL 3WE6B 4P5RA 4BSVB 4ODSL 3T8XB 1D6VL 1L7IH 2GTZA 4LGRB 4LF3B 3O6FA 2BNQE 1F2QA 3PWPD 4WWKC 2ZKHH 5HDOA 5A2BA 3W38A 1JNHB 4UIMA 2GTWA 2D3JA 3WTYA 3TNNB 1RIUL 4G1MA 4JFYB 1OPOA 1SN2A 1UH2A 3PGCA 4K3JL 2K7PA 4F33B 2VDNB 2F58H 3C5JA 3E7JA 1MCKA 2W9DL 3B1UA 5KBKA 5ILTL 1M1SA 1ZVNA 2DTMH 2GEEA 5F7HA 1G87A 1T5XB 2EINB 3GDCA 2YQ3A 2AQ1A 5GGSA 3VSQA 5F3BB 1P7QD 5LKNA 2B3IA 1IE5A 5DYOA 2JK5B 4OM0H 4M5ZH 4M02A 2VLLA 3SKJH 5KBMA 1HCVA 1TSHA 4H88L 4PJDA 5CSZB 2XPGB 1UZ6F 4E5XA 3OQRA 3FFCA 1D5XB 5E5RB 3UYPA 3X11B 5F7NC 3ZE1F 4W9CC 2VNCA 4N8UA 1QW8A 2EIMB 4XMPL 3MREA 3GNMH 3IMWA 3UZVA 2A6JA 5KAQF 5LUMA 4LRIC 2VIRB 5E5LA 5FW6A 5I1KL 2YJQA 4ZUTA 4Z7OB 3EYOB 1LD9B 1XX9C 4ANVA 1NGYB 2VO5A 1SOKA 2BVPA 4Z7UA 3WFZA 3VB8A 2OM5A 2BP5M 4YMPA 5CSGA 5F7FA 5K1VA 4AGLA 1SLXA 2F1AA 2WLLA 5FOBA 4KAQL 2FAUA 4BZ2A 4JMXA 2D7NA 1W16A 2WXQA 3T8MA 3MLSL 4FGMA 1MKFA 1XGRA 2OR7A 1TETL 2P47B 2EDXA 1CR9L 1JK9A 2WLIA 1SEBB 3GXUB 2Q86A 4FZEL 1JFHA 1FVEA 2MOVA 4D9RE 2WTPA 3D4ZA 2P5ED 3SDAB 5EEWA 3SJVB 4AC2A 3OX8A 3HPLA 4B9JA 2NY3D 3QAZC 1UUNA 5EZOL 5IESL 4PGBB 4JDTL 1NJ9B 1RUKL 2VMJA 1FQ9C 3WN5A 2QQKL 1UACH 4NDMB 1NLDL 5KSUB 2IPKB 3GSNL 3DVGB 3VQ2C 4JAMB 4UOW1 5C0RH 3O81A 4PJ7E 4F2EA 2JJVA 3QZOA 3SN6N 1RH8A 2CGZA 4HKXB 5DD5H 4ZAKC 5GGRB 3ATEA 1Q9OA 4G8IB 5IB3A 4U6XB 4XZUA 3VXUB 2NW2A 4K3GA 4YSDA 2ZG2A 3ARED 4HUVB 1B6DA 3MLVL 1XCTB 2D9CA 2MFNA 4MHHI 2AQ3A 2VXQH 3VNYA 1CFTA 3N40P 2ZUVA 3WJLC 3PGDA 4D7BA 3BUTA 1UM4H 2BNUA 4PYGA 2A6KA 1X4YA 4I3SL 5F9WB 3T08A 3ARGB 1T04A 3OKOB 3WIHA 3TP4A 2HCZX 2OSXA 2NW3A 3PIQB 2C9AA 2YKKA 3TO4B 1BYPA 5IBLD 1QHPA 2DM7A 2JVUA 4LOFA 1P4LB 4ZPTB 1K5WA 2BSRB 3AABA 3O3AA 1NC2D 1A6WH 2K3HA 4I48A 5AUMB 4G8AC 3B9KC 1I3VA 3D69B 4M56A 4WV1C 2XTJB 1OSPL 3ZU8A 4TSBL 4UTAH 3KL0A 1BF5A 2VXUL 3VE0A 5B3NA 1N2RB 2FLBT 5EIVA 5D1QA 1HTYA 3VA6A 1Z5LB 4APQD 1WCBB 4NUMA 3UBGA 3WUWA 1B0GA 12E8H 2PO6C 2NXZB 4LARL 5EU3A 4PY7B 2BIQA 2YPLA 5GS2D 5E95B 4OF5A 4BM7A 4ETQB 2GAZB 3JTTB 5EBGA 3U2SB 1TIUA 2XWBA 3EYSH 4H1LA 1BA9A 2B9BA 4Y19B 3SDYL 1GYAA 1I1FA 2WBJD 3MRBA 4XOAA 5I8EB 3NJLA 3IF1A 2DM2A 4X6EA 1NSNL 2VTFA 3LIZL 1SEQL 2H1XA 4FFWC 4KJWD 5ETUA 2BVYA 5F72S 1W2KT 4HK0A 3V4VB 4A38A 3GGWB 3L48A 4XP1H 4JGMA 4DP7X 3Q48A 4EI5B 5A7BA 2H3KA 3OKNA 3VXQA 3PE9A 1HQ4B 4G6FD 1PZCA 2YMXH 1W72H 5JDSA 2WN2A 4PRIB 3SE9L 2A0LD 1WFJA 1KCRL 1J5OH 4JHAL 1NBCA 2V9QA 3GBNH 2VDPB 4GIPD 3TBSB 2R0ZL 1LEGB 3KCWA 4K73A 1OGTA 4Z7OE 4R7DB 4QHNA 4G9FB 5H4ZA 4FQIH 1MCSA 4HWNA 3FTZA 5F0LB 5CP3A 3LPGA 4MMXA 4PG9A 1XIWB 1OOAA 3RAJL 4FN0A 2AQPA 3BZDA 2YN5A 3FO1B 5DVOA 3CIQA 4NJAH 4BH8B 2XWRA 4NENB 1A6ZA 2A6IA 2RTTA 3JV4A 3AXHA 4WO4B 5BRQA 4MQXC 4RNRB 4D0BB 2DL2A 4GQZA 3OV6A 4NQCA 5HY9A 3RUGA 2FD6H 4L3EB 3SJVE 4AKQA 1F11A 3NBNA 3HC4L 3TEYA 1NC4B 1NCGA 3BQUA 3Q5YA 4M93C 4YXLH 2A99A 1EAJA 3OM3B 1HN1A 1H0DB 5E2VH 2OBGA 4KI5F 4MXWL 4KKBD 2YUZA 4XNMB 4IRJA 4TRPL 1TSRA 3QWNA 3DSFH 2WPGA 4KQ3L 3WTTA 2UZYB 5LN4A 2A9MH 5F7DB 4JCWA 1E2WA 1QQDA 4FQ1H 5PCYA 3VXUE 1ZSHA 3CQPA 4W9IC 5J1TC 4UQ3A 4KRMB 5I74B 1R3JA 5JIHA 1OQXA 2QKIB 2GEQA 1AZCA 3D0LB 1HK6A 3F12A 2AMGA 3VRLE 3VD3A 2C1PB 4P2RA 4UUJA 5DD0H 4DESA 3FB6A 3OZ9H 4MA8L 3H1ZA 1IBGH 5I8KL 4NZJA 2B5IB 3DX7B 4ZMXA 4L8CA 3AXLB 1UZ8B 2Q7YA 2BDNH 2J20A 1URZA 1FO0H 2C9XA 1OF2B 3UJJH 5MEND 4AYFB 2V9RA 1J1XL 4QCIA 5DEGB 1IARB 1AZZC 4Z1PA 1Q0XL 3C60D 1J0ZA 2Q8BH 5D7IB 1A3QA 3Q8EA 1TZIA 1FL6A 1YEGL 2QFPA 4WENB 4DKEH 2XTJE 2IQ9H 3HE6D 3UAJA 3V7MA 3TESA 3QUZB 1KTDB 4N2FA 1UYWH 5D1XD 4B9KC 4RFOL 1D5IH 5J12C 4RQQB 2X7LA 4G7SB 4JQVC 2DQJL 3NZ8B 3OR6A 1RK1B 2A6DA 4F9LC 3WNNA 1DQJA 3LVTA 4JDZA 4F2MB 1RZ7H 2YQGA 3S34L 1INEH 3W5NA 4XWOC 3DV4A 3PWVB 5B4MC 3QDMA 1G7JA 1DDTA 2ERJC 1BZ7B 5DA4A 4EI6B 1NIEA 1KELH 1BGXL 4NNYA 4FAAB 1K5NB 2N3JA 1TCRB 3WU1A 3HRPA 1OTUD 3CDCA 3K2KA 5ISZB 5F0JB 2ZPKH 1KYDA 5HGDA 3ZLQC 1AE6L 2P43B 5HHVL 3MAWA 3VFSB 5E8PB 3GIZH 4Y19E 3TPKA 4YE4L 1ZT7A 3FUIA 4UF7C 4QRRD 2NQDA 3PQYB 4FNTA 3EO1B 3OR7A 3WBDA 2DWYA 4DN4L 5I16A 3QUYB 1E4XI 4OV6F 1CUOA 2N56A 1MQKL 2CNYA 3K4DA 4N24A 4AYDC 1WWCA 2IWKA 3DVFA 2Q76A 4PRIE 3L3IA 4Y2OB 4PAZA 4YLQT 4TTDD 4F5CA 4HOWA 1YY9C 1BBJB 2PYEB 2RALA 4Z3TA 4P5TB 4X9GA 1F02I 2HVJA 2F08A 3BSHA 3ZIYA 3KPSA 3NEEA 4G9FE 2Z31D 1IC4L 2VUKA 1AMYA 2NX5A 4JQXC 4KJQD 3SO5A 1WITA 4S1DC 4UDTA 4FADA 5C0FB 3PU7A 4HJUA 4MQ7A 3JV6A 1DQDH 3W9DA 3ZT6A 4ZFGH 2X44D 3NSDA 1ADQH 5E8NB 3ZMEA 4B9GA 2BIOA 3IXAB 4P9MH 1ZHNB 5ESVA 1S9YA 3RIFF 3ERXA 2A73A 3P2TA 4YXHL 4L37A 3MUHL 1L9OA 1FI8C 3HHRB 1UOWA 2CJTA 5BVJA 4L3EE 5IIEB 1XB3A 2F61A 3CC5B 1IGYB 1MNNA 1ZLUK 2XIDA 1U8KB 2FEDD 2ZOUA 4K3DL 4ZTEA 1ZANH 2PCYA 2DKMA 2YRBA 1CC3A 1EUTA 2VERN 1YYLL 1WLHA 4LO9A 3MOAL 4RAUB 5JXED 1H8OA 1IGCL 4G5AA 2P28B 4ZNEA 1A9EB 4BFFA 1KPRB 1U3HB 2XBTA 3GMRA 1TLKA 1S7VB 5CFAA 1MDTA 2CBPA 4BK5A 3CTTA 4YHLL 4EPSA 4XO3A 4ALAH 3AVEA 5ID1A 4NM4L 5B8CC 4V2BA 5KW9H 1ZHBA 4HWBL 4MA3B 3AITA 3SGEI 3SODB 3C12A 4AEHH 2OKMA 4OKVB 3GIVA 3IRPX 3L5HA 5DQDL 2CALA 3EUUA 2MCMA 3FJTA 3QYCA 4F15C 4OFIA 1DVSA 5I73B 4CVXA 1F3RB 2VM9A 2CRIA 2WGNB 3OGCB 2C4XA 1TTCA 2KYIA 2IO5A 2H6OA 4IGBD 2CDFA 1OGAB 2F6AA 35C8L 4GRLD 5DJAA 5BOZG 1NGWB 5AYQA 3FQNA 1I1RA 5EA0H 1CDYA 2OMTB 1WHPA 3A47A 3MJ7B 2TAAA