1FBIH

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
221
structure length
221
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQGPGQGLEWIGEIDPSDSYPNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCASLYYYGTSYGVLDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/antigen)
total genus 31
structure length 221
sequence length 221
chains with identical sequence Q
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH02
4K7PH 5E9DA 1P69B 1T7XA 3CFKA 1KTRL 3ARGC 1EMTH 3PWPA 1G7QA 2R56H 5IOPA 3BUYB 2VLKD 4R7DA 4Y4KC 4ZG1A 4PJBA 4CW1B 3U4EA 3X11A 3SE4C 3EDJA 5TH2A 1EERB 5C1MB 1SMOA 4YK4C 4KKLD 5EN2A 1KB5B 4MAUL 4TSCH 2Z4QB 2W38A 35C8L 2FR4A 4XVUC 1RZGB 2AJXH 3KLHC 3MCLH 5HGHA 4MX7B 3D85A 3T2PA 3WO3B 1NGWA 5IHZA 2BOCA 4N0UE 1U8JA 5CCKL 5BRZA 2HYMA 5GRUH 1GGTA 3MR9B 1OLLA 4LKCB 4P5TA 4ERSL 4PJFF 4NIKB 5DEFB 1FBIH 1TIUA 2XFXB 4NN5C 1C08B 2C9AA 2AQ1A 5IUSA 1QO3B 1XR9A 4MD5A 2DLEA 1TVDA 5FEBA 5DRZB 1KCSL 2VDKH 3VFWA 3FN0L 5D7JA 3HC0A 1EFXA 4P3CL 2ZUQC 5IFAH 2APFA 1FG9C 3QZWG 4JDTH 1LEIA 1J88A 2FJFA 4YHLH 1MLCB 2YRLA 1RJZA 5DO2D 3UDWC 4LSSH 1IAII 5AUMA 3V4PH 3RKDC 1IM9D 3DRQB 1K4CA 4GS7C 5EU7C 3SQOL 3MRCB 4ELME 3OJVC 2IH3B 4WUUA 2O93L 5T1KA 4ORZC 2A6IB 1XGTB 3VW3H 5I9QB 5FO7A 4TOYL 3ZZ1A 5CUSH 3KGRA 3V0WL 2EDDA 2R1XA 1FO0L 2IG2H 3M07A 3LKPB 3ISWA 1I7ZB 1UZ6F 1W8OA 2X1WL 3CMGA 4U7SA 4I2XE 3Q3GB 4X0KA 1CGTA 2GJZB 4TSBL 3RHWF 3TIDA 3VRIA 4Z7QE 2LQRA 1N7ML 5JIKA 3PHQA 1ADQL 5EZOL 4RSVA 5JXEA 4N8PA 3CDCA 4KUZH 4QXUH 2OJEB 3ARFC 1A7OL 3ECBB 4HXAL 1YQVH 2ED8A 3RY4A 1QACA 5SWZB 2J5LB 1RY7B 2OSLA 3QPQC 4YHYB 2DMBA 3NFSL 3GMMA 2Y1VA 5D8JH 4KKNA 4XC1L 1WAAF 4U1IA 1H3VA 2P42B 5DJXB 3GSOA 1GVIA 2ILLA 1A8JH 3H3KA 3B5TA 2DQEH 5GSVB 3WNMA 5C0BA 3DXAE 3MRKB 1A9BA 2BCKB 2QR0B 4O9HH 5I1KL 2BNQE 5DFWH 1IC4H 3QDJD 2CK2A 4XAWH 4NQEA 3W9DB 2Z93A 2Z91B 2AJYL 1BM3H 5FKPB 4G6AD 5FO9A 1I9IL 4AMKH 2XG4A 3PDOB 3EOAA 3FB5B 2QQKL 2CJUH 5A16A 4EUPH 1I4FA 3U30C 1JCKA 3WUZA 1Q1JL 5GXBB 1CGXA 3WD5L 4HBCL 4N0UB 2X4TA 4DFHA 4L3CB 3TBYB 1LDPH 4N90D 1T2XA 4Y7MA 1EA9C 4KRNA 4U0QB 1CFVL 3WN5A 1KEGH 1WC7A 2F8OA 5IKCB 4PY8I 4PY7B 3P4NB 3UC0L 1UKSA 5IB3A 1MCCA 2NY2D 1TQBB 1DLFL 4U6YA 1EHXA 3PWLA 2PNDA 4HIIB 3VMPA 4LPWA 3G6JE 3EZJB 4GXVL 5C6TH 4CVUA 3RX8A 4R4BB 3ALXA 1A6VH 4NZJA 3EBAA 3QXVA 1U8PA 5IBUB 5GS1C 3MRQA 3C2AL 1MHEA 4YXHL 5H35B 2Q87A 1QA9B 3OV6A 3RPIB 3V7AE 3P30H 1JZ3A 3KPSE 1R5WA 2J8OA 2KL6A 4J3XA 5DI8A 4ELMB 3LSOB 4HIJB 2W9EL 4ZOAA 4N68A 2RFXB 1JGUL 3IFNH 4LVNB 2J4WL 5EC2A 1K8IA 3BISA 5E5MA 3RY6A 5I73C 2HKHL 5EOCH 2D7PA 4I2XB 2XA8H 3FQTA 2NY0B 5HYSA 3RI5K 5JOEA 4IRJB 4F7MB 2NXZC 3IAPA 5EPMB 5E6IC 4JM4L 3VFSB 2ZSVA 5E94A 4FQJH 4B7IA 5CP7B 4TVPD 3HRPA 3MLZL 4U1SB 4PJBE 4JKPL 3GK8L 4ZO7A 3NFPB 4QGTA 4FMKA 1ODAA 1YY8A 4HLJA 5ISZD 1AFVH 5EBGA 3WDIA 4WUUD 4X6DF 1AGBA 2BDNH 4XPTL 3I9GL 1WIPA 2Q20A 4HKBA 4PGZA 1GZPA 5F9JB 4ZO9A 1UACL 1QFWI 1G9EA 3RTQD 5EU6A 1M6OA 2B2XL 2VNCA 4JPIB 1KBGL 1XF4A 5E99H 1K4DA 1DQDL 2W0FB 2B0SL 3VI4F 1JWUB 3QA3B 5L8KB 5BRZE 1U95B 1CS6A 4HUWB 3DXAB 5HHQB 2XWTB 2QTEA 3MRMB 3O3EB 4OF5A 1Q72L 5FB8B 2PKDA 4M7KH 2BNQB 5DMGD 4K71C 3WV0A 3RZCC 3BWUC 2YC1B 2M1KA 4UZGA 5TDOB 1YEHL 1GCFA 4XHJD 3DRTA 3E2HC 1T5XB 4PB0L 4JRYD 3QQ4A 4JY6A 1YMMD 1WITA 1TVBB 2YBRB 5GISH 3RVXC 2BERA 3O8XD 3ULVD 4PJIF 4ZFOA 5DC0A 1VERA 4GRWH 3OJDA 5BVPL 4KVCL 3S6CA 1NFDE 3VXOA 1ROWA 1R5IA 5ESAA 4P46A 1BOYA 2E9IA 5E8PB 4G3YL 3OKMA 3LIZL 1QPXA 1ZXQA 2AKRB 1U8OB 5D7SL 2PYFB 3MNVB 3X13B 1IQWL 4WUUE 2R39A 3BH9B 4OFYA 1C16B 3BYYA 4Q7DA 5CP3A 5KSVA 1KXQE 4MAYC 1XGYL 2IQ9H 1NGXA 2J1KA 3T3PF 4HPOH 4EI5C 1KELL 4J1UA 4MMZC 3WFDH 3MRLA 2EE2A 5FYJL 2R0WL 4AEEA 1C12A 4RX4A 5GRZA 2BZDA 4Y5VA 2D03L 4Z77B 3KPSB 1TQCC 3WLBB 1F4YL 1H3GA 1VGKB 1IGYA 3O6KH 4JQIL 3K8LA 3U1SL 3S88L 2G60L 3SE9H 1JZ7A 3OXRA 3MLTB 1GJIA 4HFUH 4G8IB 4OZFB 1S78D 3DUUA 3MSPA 1DVFC 4Z78B 2I26N 5E9DB 2GIYA 4JPWH 3CFKB 2VLLA 2GY5A 5GS0H 5T1MA 1JYXA 4ZD3L 3PWPB 1G7QB 2OL3H 5IOPB 1PG7L 3MREA 1OAYH 4R7DB 1F3DH 1GGIH 2CO6B 3EYUL 4JDVA 2B39A 4PJBB 3U4EB 4OJFH 3WJJC 3X11B 5TH2B 1P2CA 2ICEB 5L2JA 4NQEE 5EWIL 2FO1A 5EN2B 3IRPX 3I6GA 1U8HA 4PJ8D 2FR4B 3BPOB 1RZ7L 4I18C 2HRLA 3T1FA 5KTEL 2RBLA 3RNKA 3IDNA 4M7ZC 3C6LC 3AS0A 4OGAC 3VXMD 1AY1L 3BEWB 3C6SA 4FOMA 3ARQA 5HGHB 4FQPA 3D85B 1NGWB 4YBQC 5IHZB 2BOCB 4LPCA 1U8JB 3QDMB 4UDUA 5BVJB 1H3UA 4WFED 5BRZB 2OTWB 5CBEA 1FNGA 2XZQH 5DD0L 5L88L 4PJFA 5DTFA 5BMFH 2CLZA 4P5TB 4M1DH 4GMTH 4BSVA 4GFTB 2YUWA 3L5JA 2HLFD 4OIIL 3IKCA 4AL8L 5T3ZH 3BX7C 2A77H 2E9BA 4U6XB 1FYHB 1SEQL 1XR9B 2DF3A 4MD5B 4RISL 5CGYD 5DLMH 5LQBL 1AC6A 3ULUH 5EZLA 3SGKA 3K2UH 4U05A 1KJ2H 3VFWB 1FORL 5D7JB 2J88L 3U9PL 1OOAA 3CXHK 3LKSA 1EFXB 5I2IA 1D5IL 3CXDH 4RGNE 3AY4C 2IBZX 1LEIB 1RUPL 2FJFB 1MRFL 4YHKH 3A67L 2K7PA 3MJ7B 1P1ZA 4K8RH 2C3HA 1RJZB 4KK6D 5AUMB 1PSKH 1TPXC 5D93B 4AIZA 5K9JH 2VKWA 1K4CB 5F7WC 4YEFA 2YEZA 1MWAB 3CU1A 2F19L 3RVUC 3VCLA 2D7MA 3E3QE 1NMAH 2WBJD 5T1KB 2NY3C 5ACMA 2JCCF 2I5YH 5FO7B 1MFCH 3MTRA 2R1XB 3MRRA 3EOBB 4P3DB 5DA4A 3KJ4B 4LNRA 4K9EL 5CAYB 3VRIB 3ARDD 3TIDB 1RIHH 4QNPF 2D9CA 2Z31C 3PHQB 2NXYD 4GMSL 4L9DA 5H8DA 5JIPA 3A6OA 1FL3B 3VWKA 2BXYA 2VB5A 3HZMB 3WUWG 5MP6L 2D4DA 2X1XR 1U8LA 4KKAC 5DD6A 4U2YA 1YYMH 2OSLB 4KJPD 2OJZH 4E0RA 4KI5F 3GMMB 4P23C 4HXBL 5DFTA 2DTMH 1WAAA 5F6IC 4MCYA 5CFHA 5EU6E 4U1IB 2EKSB 1S9XA 2OBGA 3GSOB 2ADFH 2DL2A 1AGDA 3TN0A 5C0BB 4JLRA 3B2UC 4R26H 2NX5A 2X7LB 1FNSL 2DQDL 5I1CL 1F02I 4WUKH 1A9BB 3HCVA 5JA9A 5GRJH 2DQHH 3TVMC 2ZOLA 4OQTA 5IHLB 1XFPA 25C8H 1PW3A 4NQEB 2Z93B 5E5RB 1PY4A 2K9UA 5FO9B 1FL6A 4ESKA 4P2RD 4ODXA 2P8LA 3EOAB 5A16B 3UTPD 3V5KB 2XV6B 2X4TB 3ILPA 4Y2DC 3ARSA 5FDYA 4GAYA 3OKOA 5HHXH 3WN5B 2XWJB 4XP4L 4P4KB 1VGEL 1WC7B 4HWEH 1DQLL 4JFPA 1FRGH 1J11A 1T83C 3QP3A 1F4WH 4YDKL 5IROA 4U6YB 3PWLB 2MNUA 2NR6C 3HI5H 3NCJH 3WSQH 2XKUA 1I1AD 4I3GA 1UCBL 3AREC 5IBTL 4RGNB 1WT5A 3OWEA 1U8PB 4JPKL 2VAAA 3OR6A 1JF1A 1MHEB 2MQ0A 5KJRH 1RAMA 4F37F 1ZHNA 4OCWH 3ROOA 5IGXL 4LVOB 1GL4B 1R5WB 4OSUH 1BGXL 4FABH 4MZ2A 5IVZB 1WQVT 2UZYB 3WDHA 1YN6A 3HAEH 5TGBA 4WVRA 5EC2B 1K8IB 1N5AA 5E5MB 4R0LA 1U58A 3GRWL 2X4SA 4JVWA 3NABH 3FQTB 1BFTA 4KK5C 4OKVB 1NPUA 3MJ9A 2NY4B 3AB0B 2JIXA 4XWOD 2ARJA 1AR1C 2ESVD 3I2CL 5C3TA 2ZSVB 5E94B 4PJ9D 4XC3L 5T3XL 4ETQA 1HINL 3GBLA 4NQDD 3P0VL 1YY8B 1WBYA 4X6DA 4Z18A 1CXFA 4HGKC 1AGBB 1EPFA 4HKBB 1N6UA 1C5DA 1GZPB 5I75B 4NJ9L 1RUML 2GAZB 4Q9RL 5EU6B 1M6OB 4BKLA 1XF4B 1K4DB 1QRKA 2JJTC 3L1OL 4UV4L 4HWNA 2P5WB 1F6FB 5E8DH 1B0RA 3AUVA 4Z95L 4MDIB 4OZHF 4PJFE 4CNIA 1OD7A 2MCPH 4Y5XC 3T0ED 1G9ML 2R69L 3VWKD 4UIMA 3ZDXF 4AENA 4G6KL 3FJTA 4QRSA 4Y4FA 1K8DA 1G6VK 3G5XA 3OKDA 4D9RE 3QQ4B 2DMCA 1G6RL 2NQCA 4JY6B 4LDOB 1NFKA 3S4SA 1CLYH 4HSQA 4PJIA 4ZFOB 4V1DD 3V7MA 3V6OA 1JZ5A 3OJDB 2DL9A 4WTZA 3VXOB 3CSPA 5GZNC 4YPGB 1R5IB 4P46B 5D2LF 4A6YA 2K3TA 4WV1A 5GRXG 5JXAH 2NY6B 4LPTA 1AHWC 1GC1H 3OKMB 4M48L 1PDKA 5LCVH 3RAJL 1FLRH 1UXSA 3AAZB 5MEND 4XXCA 5KSVB 5IIEA 3EHBC 1J87A 3OPZH 3WJLC 1UZ6E 2LU4A 1OQXA 3UTZA 5HVFB 4YPJA 2IBZY 4NKIL 1HIMH 3MV7D 5EO1A 1I3VA 3EFDH 4NGHL 4PV8A 5D5MF 5CJXA 3FB8A 2FIKB 5JOFA 3OKKB 3MRLB 4ONHB 1JPFA 3UTQA 2P47B 3T0EE 4EN3D 1RHFA 3NTCH 4Y5VB 3K81A 1HCVA 3BKCL 3T0AA 2C1OA 2QQNH 4LLUB 1IGCL 1S7WA 5FCUL 5DVNA 3QI9A 2DKMA 1IGYB 4ZDHA 4K94C 3OXRB 2DS4A 3P4OA 3MA9L 3STBA 3VWJB 1WAAE 4RFEB 3KR3L 3UEZA 4LPYA 5I71B 5KSBF 5T1MB 4P59L 4EI6A 4FQXD 1BD2D 1FFQA 4YEEA 3TT1L 5GJSH 3MA7A 2NX5E 1WFOA 3WL9A 3MREB 4POZC 4NM4H 4LSPH 4JDVB 4OZFH 1N59A 3P2TA 5MENE 4G6JH 2P4AB 2ORBL 1N4XL 1WTGT 3I6GB 1U8HB 3IDMB 1T1YA 4HT1H 4EDWL 2OZ4L 5A43C 3T1FB 4XCCL 4PJAF 3RNKB 1LNUA 3IDNB 4MQ7B 2VZTA 3S3JA 2ZNXA 1AJ7H 1D9KA 5TF0A 3C6SB 4Z0BH 3PQYB 4ZPVA 2XKSA 1D5MA 3FMGH 3QUXC 3W81A 1QSFA 3L7EA 5CBEB 1FNGB 4PJFB 4U1NA 5DTFB 2CLZB 1BZ7B 2JIXD 4O02L 4MMXC 4BSVB 3SGJC 4M8VA 3CGTA 3IKCB 2YZ8A 5BZWA 5M95B 5E8OA 3OHXA 1WZ1H 2HJLA 4X9IA 1SY6H 2NNAA 3QRGL 1W8NA 3K2MC 3STLB 2B1AL 5EZLB 1CK0H 2NY1C 4J4PC 1C7SA 4GRLD 2VSDA 1DSFL 3LKSB 1Z6JT 3BDYL 2HJFA 4FZ8L 3CVHL 2QHLA 4GQ9H 4AG4L 3MXVH 5KZCB 3RDTB 1P1ZB 1BFOA 5ANMA 5DMIH 3HE6D 4G43B 2Q1EA 5CSZA 2YEZB 4QHMA 1H8OA 1RSFA 2JCCA 4I9WE 1EH9A 5DUMH 4PJ5A 1N0XH 3IRZA 3EDKA 4S1QL 1EAJA 4Y4FD 4DZBA 2EDEA 3PNWA 5FYJU 3MRRB 4NQUA 1F4XL 4QXGH 3SKMA 5GS0D 1AE6L 4MA8L 5FA3A 3JUZA 1BQLL 1KC5L 2K7QA 4JFOA 4GBXA 4LNRB 5E7FA 4U1GB 1MWAH 4M6OL 4WHTA 5KVGL 3BO8B 4NNYA 1E4WH 5HYJD 3M17A 3SO3C 3OKNA 4LSVL 4OF0A 4WNQA 3V4UL 4GG6F 1MIML 2A9NL 4NNPH 3D39A 1Z5LA 4QRUA 4XP1H 1MCOL 1U8LB 3JV5A 2L0DA 4TYUA 5KVDL 5DMJB 4OLWL 3KYOA 3BW9B 4CMMA 4TNWF 5DMKA 2BC4A 2HT2C 1RK0B 4X6DE 2VXSL 4WW2F 3P0GB 4BQ9A 4E0RB 2Q8BL 1T89A 2NY5H 1NUDA 3ARBD 1I9RH 3H3PH 3WNLA 3KPLA 1S9XB 2D4FA 3VI4E 5CJBA 3K4ZA 3QNXB 5T33L 1NLBL 4PRIA 1AGDB 1DQJA 3TN0B 5GHWH 4JLRB 4UOW0 2NX5B 3V5DA 2ZG2A 1VPOH 4FQLL 5T3ZD 1DBJH 3NOIA 2ZOLB 3L3HA 4LIQL 1JJUA 2ZWLT 3ULUD 2Q86A 4L4TD 1RZJC 2D2OA 3HS0B 3OJ2C 4CVXA 2YD4A 3OG6B 2DIJA 1FL6B 2IAMC 3L5IA 2GK2A 4KH2A 4ODXB 4JRXD 4OLUL 2HWZH 4PJIE 1GAFH 4F7PA 1VHPA 5FYKU 5HYJE 3V6OE 4P57A 1MCSA 5HD8D 1YUHA 4PPTA 2GJJA 1HE7A 4QRTA 5DC9B 1MEXH 1XMWA 1U3HA 5D6CA 4AEHL 5E00A 1HHGA 4H25B 1NAKH 4YHOH 3LDBC 1CGSL 3CX5J 1L6XA 2J2ZA 2WQRA 3U7WH 3O9WD 4H20L 5D7KD 1J5OL 2XACC 3J7HA 1IKFH 1MCBA 4LFHD 4PV9A 4DFIA 3QUZA 5C3LD 3IJYA 1TTGA 2H32B 3LZFH 2UWEA 1KN4L 5J1AA 3T3PE 3P4LA 5IJKA 2UZIL 3QIWA 3UAJC 1P7KA 3U7YL 1DBMH 1D9KD 1UJ3C 3DSFH 3OR6B 2VAAB 3HC3H 4JQXA 4OI7A 3U0WL 3CLEL 1JF1B 4LLYA 3C60D 1FHGA 5DK0A 4EXPX 3O0RL 1ZHNB 4I77L 2YWZA 3ROOB 3V4VH 4PG9A 4OZGF 4ODSH 5HSFA 1OP5H 3MZGB 4AM0A 4D2NA 3MBEA 1YN6B 3OSKA 5TGBB 3KXFA 3LPGA 4MSWA 5BS0A 1YNLL 4R0LB 4F57H 2ZG1A 1IAIH 2X4SB 1P4IH 1MLBA 1I1CA 4G8GB 4PRNA 4TQEL 4HQQL 5ADPL 3JBG7 4DKDC 4XCEA 5DUPL 2ARJB 2EE6A 5E1HB 4NHUA 1HZHL 5CJQH 4NC0B 4BH7A 3KPPA 4XWGH 3GMRA 3B6SA 5ERWA 3S37X 4F15C 3HR5A 4ETQB 3H8NA 4L9LA 4MA7H 4NQXB 4LAQH 4NJAH 4X6DB 1RULH 5IVXF 2NY7H 2X40A 2VDRL 4JRWA 4OD3L 4EIZC 2A9MH 2HT4C 3MV8D 4M6NH 3LCYA 5HI5C 3HUJF 3KHQA 3NCYP 5CLTA 1S7QB 1KV3A 2XTJD 1RZFL 3BYTA 4N5EC 4GBXD 5C0JA 5K59F 2I25N 4OZHA 1QSFE 3BT2L 1IC7L 1U3YA 3FRUA 4KQ3L 4UUJA 1CFQA 1DR9A 4CNIB 1ADQA 5C07A 2DQUH 1A7QL 1HILA 2WBKA 3SGEI 3ARXA 4X6FA 3D39D 4UIMB 2DQJH 4AENB 2LVEA 4QRSB 4XNMA 1K8DB 4PD4K 4M4PA 5GS3A 3OKDB 4PLNC 2PR4L 2CMRH 3KNBA 5KVFL 3EYOA 4N0YH 1D6VL 4PJIB 5FYKH 4FN0A 3PHSA 3VXUA 3Q6GH 5CS7A 4KAQH 5D2LA 3N1FC 1R3LB 1EJOL 1AD9A 3UJTL 4JGUA 4A6YB 2VL5B 4PRID 3F12A 5ANME 4HMEA 1A1MA 3MRIA 4QY8A 3RWIA 4KXZI 1OAZH 1PG7W 3UTTD 3VD3A 1DN2A 5HDQL 4GKOA 4G6FD 3QIUC 4J7RA 2JCCE 2KPNA 1UXSB 4PJ5E 4YO0A 1P4BH 1RUAL 4M00A 5IIEB 4LMQE 4KZEL 3OGOE 3D5OF 3UTZB 4NZUL 5HGDA 1WCBA 4LCIH 5EO1B 5D5MA 4QNPE 3D2UB 4PGEB 4PV8B 3FB8B 4W4NA 5JOFB 2LAGB 1JPFB 1RVFL 5CP3H 4PRHA 5E2JA 2NY0D 2VITA 4NKMA 3D39E 4KRPD 3VFTB 3WIHL 2C1OB 1ZHKA 3QI9B 4KKLC 2D7TH 2V5TA 1F4AA 3D9AL 4ZDHB 5DMYA 2MFNA 4FP8L 4KI5E 1FFOB 4DKFL 5B22A 3E8UL 1IGIL 5F9OH 3P4OB 3HZYB 4WY7L 2ZKHH 1IZKA 1L9NA 2VLRD 4HX1B 5LGHL 4JN1L 3BRDA 3PGFL 3MACH 2IPUG 4NQSA 5SX5K 1A47A 1SM3L 1YEKH 1D6EA 4LHJB 4PRIE 4EI6B 3X14A 3ZKSD 2Q8AL 4UAOB 5T1LA 5C08D 1JHKL 3KPMA 3MA7B 3WL9B 3ILQD 2LV4A 4IRSD 1N59B 4MQXD 1UYWL 2V17L 5IJVA 4X9FA 1FFPA 4CADB 3VFRA 1T1YB 4PJAA 4UIKL 2F74A 1HQRA 1N26A 4GXUN 3MBED 3U82B 1LNUB 3G9VA 1UA6L 3S98A 3KXFD 4HUUB 3RNQA 1QNZL 2OQJA 2ARJQ 4ZPVB 1QR1A 5DO2C 3TBTA 5IESL 2CIKA 2EDTA 4BQ6A 3L7EB 4XPBL 5I0ZA 5IB2A 5F8RC 4YIQA 5F72S 5BQ7A 1J1OH 4PLKD 4JANA 1XAUA 1ZSDA 2J8UF 2IFFH 2W0PA 3QUYB 5IEKA 1SVZA 2OXHA 3DMMD 5BZWB 3OHXB 5CINH 5B38A 3GNML 5HDBF 1F5WA 1GZQA 2HJLB 2NNAB 2XWBA 4APQD 2NZ9D 1ORQB 1IT9H 5J0BA 1ZTXL 3AFLA 4DKEL 2UWEE 4LKXA 3QXWA 3BGAA 1I3RA 3MRDA 4LCCA 1VKXA 1JGVH 5ADOL 4P9HH 3F7VA 4P2QA 1BFOB 5ANMB 5F9WC 1CR9L 3UJJL 2EYRA 1NDMB 3P3YA 4WGWB 5CSZB 3R4DA 4K7FA 4HJJL 5C07D 1QFOA 1QYGL 2JCCB 3C08H 4OLZL 4XAKD 3WNNA 3T08A 3MV11 1H3PH 4PJ5B 4AZ8A 1MI5D 5D4QA 2YZ1A 5I76B 3HNVL 5L2KD 3BQUD 3PHOA 4KKBD 2WQ8A 4DZBB 3MX0A 1YN7A 1NCDH 1EO8L 3KXFE 4UBDD 3SKMB 5BS0E 3HMXL 5FA3B 4JFOB 2N1KA 1KLUA 4RBPK 3MUJA 2JB5L 3PP3K 4WHTB 3BH8A 5IMMA 2FEDD 4NNYB 3VXUD 4GG6A 3M17B 1XZ0A 3OKNB 2Y72A 4JKWA 4NHCL 3ZTNL 5LAXA 5D71L 4H88L 5EH1A 4QRUB 4PJGF 3ALPA 5FUOL 4K94L 5ICYA 4QRRA 4LARH 3LRGA 3RI5F 4CMMB 4WW2A 5DMKB 2BC4B 5C0RL 2CUIA 4G6AC 3JWDC 1A6WL 4UTBL 1A3RH 4JFDB 2DQGL 5BXFA 5C2BH 1Q0XL 3BHBB 1NGZA 5CWSA 1BVLA 4PGCA 3KPLB 1OAKL 3DVNB 4NBXB 1D5BA 1QBBA 3HRZA 5J1SC 4OZHE 2APTA 4LLDA 4J3UA 1MCPH 2DDQH 4NFCA 5JR1H 1BX2A 4TUKH 3KJ6L 4WHYG 1WIOA 2NW2B 5DJ0A 5C07E 4XAKE 3L3IA 3JWOL 3WNOA 3QDMD 2FH8A 3ZDXE 3L3HB 4ZQKB 3H9SA 2ZCKH 3WFEH 1EVUA 4M6AA 2Q86B 2NY2C 3THMH 3AS2A 4CVXB 4YJZL 1BECA 1B2WL 4R4ND 2OR8A 1OAXH 4PS4H 1T20A 3BD3A 1CFBA 1ZVHA 1L7TH 3HI1A 4CN6A 4YDIL 3AC0A 3RWGA 3KPRA 3VXUE 5C9JA 2F8VA 3FN9A 3D0VA 4P57B 4DN4L 1YUHB 4LLVA 5D2LE 4QRTB 1U3HB 3S96A 4U0RC 1HHGB 1EHNA 3GSUA 3NGBB 3CVIH 1F90H 5T1LD 4WW1A 3TA3D 3VFUA 4K3JL 4NQVA 3EJJX 4H1LH 1TVHA 4JAMA 5D72L 1QRNA 1TTUA 3V52L 4B50A 5ELIA 5C8JA 4PV9B 4CN4A 4WCYL 3QUZB 3MOBH 3IJYB 1IC5H 5FGBA 5J1AB 1JNNL 4OGXL 3QPXL 3QIWB 3SDDD 1RQ5A 5D5ME 4XPAL 3RZWA 4OLXL 1P7KB 4PTUA 4S0TD 3QDGA 1T3FA 4O2CA 4X6EB 1HH9A 4OTXH 2Y23A 4LLYB 2GCYB 4L4VD 4PRHE 5DK0B 2JJUA 4OZGA 4NQCA 1Q9OB 2H32H 5GGUB 4PG9B 3NFNA 4TSAH 3ROLA 3R06A 3LKNA 3KDMA 4AQOA 5CILH 4AM0B 4I1NB 1FJ1A 1MNUL 2EDFA 5DD3L 2CK0L 2YD3A 3FTGB 1TJGH 1JN6B 5J7CC 5LGJA 3RTQC 5BS0B 1L0YA 2E8YA 1IEBA 1F8TH 5J3HD 1MLBB 1WEJH 4QRPA 2O5YL 3IFPA 5C0AA 5JHDA 3IS1X 4P4RA 1OY3B 4PRNB 4X6BA 1U8MA 1YJDC 1F2QA 1M71B 3VFMA 1I1YA 4G7YL 4XCEB 3ZT5A 4NHUB 4BH7B 1F45A 5DMGC 5I1EH 3KPPB 2V9TA 5ERWB 3GMRB 3B6SB 2AJ3A 3I6KA 4L8CA 4L9LB 4XHJC 3GJFH 4NWTH 1NAMB 1B0GB 1WFUA 4KROB 4PJAE 4QCIA 3TWCH 3HUJA 4K3EH 1OF2B 2FECI 3C9NA 5E2VH 2DTSA 5EIVA 3O8XC 5TQ0H 3ULVC 4DK3A 3DOSA 1DUYA 2NYYD 3WEXA 4F7EA 3GKWH 3CLFH 5D2NB 5C0JB 4OV5B 1MQKL 3F65A 3DUHA 4F7TA 4OZHB 5MI0C 4JG1L 5GIRB 3FRUB 5EBMA 1CFQB 3H42L 3VRJA 3RA7H 2HTLD 1HILB 1H15A 5FOJA 2YR3A 1JPGA 4DZ8A 5D6DA 4XPGL 4Z7UF 1T5WA 1XEDA 2KDGA 4HAGA 4OI8A 5IFHH 4P4KD 2ZUVA 3GO1L 2DD8L 2AVGA 4L8BA 1DN0A 1ZOXA 1TZGH 3KNBB 4C56A 3EYOB 5ID0B 3DGGA 3SJVA 1NSNL 1I85C 1YQ2A 5FAAA 3LKQA 3HG1D 5EUKA 4U1JA 1ORSA 1PLGH 5D2LB 3FQXB 4F3FA 1AD9B 4DVRH 1YEGL 2VDOL 3ARGA 4P2QE 3CK0H 3F12B 4G6MH 4KZDH 5DJZA 1A1MB 3OZ9H 4QY8B 3RWIB 3GMPA 3VDAA 1JTOA 4Y4KA 4XBPA 3RBGA 1U8NB 5E2UH 5D9SA 5FYJD 2MKLC 3SE4A 3VGGA 4F7CA 4YO0B 3BWAB 2B1HH 4NO5A 1S78C 5HDLA 4A6YH 4HPYL 4L3EA 3OB0K 4AJ0A 2C4XA 2J6EH 3HPJA 4PRPD 5IWLA 5B4MD 5HGDB 3QEQA 5D5MB 4NYLB 3BP4A 1EIBA 3N85H 2MKWA 1R0AL 1JNHA 4CN1A 2F54A 4GG6E 4JY4A 4PRHB 5AZ2L 4XCFL 2QSCL 2VITB 5D7LB 4NKMB 5JDJA 1ZHKB 4GW1A 2VQUA 2GT9A 2WZPD 4QRRE 1S9YA 3E3QC 5L7XH 1FVCA 4PJ8C 3S3PA 5I8KH 1IQDA 5HGBA 4JY5L 4MXQD 1FLTX 1WBXA 5GGQL 3VGEA 3TO4D 4BK4A 3AGVA 2DQFA 4W6WB 5E8EA 3GGWA 3V8CA 3DV4B 4NQSB 5CJ5A 1QUNA 5KSBB 1D6EB 3SY0A 1QLEH 3X14B 1LO3L 5CEZH 3KPMB 4HWBH 1PKOA 5EC1A 5FYJE 2HLFC 1RMFL 4HCRH 3TGXA 2P5WD 5IJVB 4KTYA 3H9SE 4X9BA 1CXEA 1FFPB 1WJ3A 1UM5H 1QP1A 5CGYC 1H3TA 5MEOA 1ACYH 5FYKD 1J10A 2F74B 1HQRB 3WXWH 3PGDA 3O11A 4MDJA 4NFDA 1MJUH 4UNUA 3MODL 3RIAK 4DVBA 4FFVD 4M5YH 3KPRE 3O2DL 3KLDA 2IF7A 2OQJB 3RNQB 5CD3A 2PXYD 3GRWA 1QR1B 4KK6C 3TBTB 2CIKB 4ZUTA 1JZ8A 1P84J 3QDAA 4L1DA 1UWXK 4YIQB 2J8UA 3VXRB 1NCNA 5LWYH 4JANB 2YS4A 5JOPD 1ZSDB 4XBEL 3ARFA 2WBJC 4FNLL 1BWWA 1QRNE 3ARVA 4X6CE 5C70A 5B38B 4O2EA 4S1RL 3QNYA 1K6QL 3QNZB 2V5SA 1IAMA 3EDFA 3TNMA 4DN3H 1HN1A 1W0YT 5KW9L 1AQKH 1HXMA 4LKXB 3ARDC 1RI8A 1I3RB 3MRDB 2DLFL 1INEL 1G7PA 4XZUA 2NXYC 4R90L 3F6IA 3QDGE 1W2KT 1AR2A 1VKXB 1AO7A 4HK3J 1I7RA 3F7VB 1I9JL 4P2QB 4NZRH 5E03A 2N4IA 3HLAA 4Y16A 4OZGE 4NQCE 5GZOD 2EYRB 3UZQA 3SBWC 1FV1A 1J1PH 4K7FB 2CR6A 1B4RA 1HWHB 4QHNB 1GIGL 5I1JH 5KG9A 4KJPC 2VC2H 4M6ML 3SEPA 4RFNB 4OF8A 3QH3A 4N9OB 3S8WA 3PHOB 1KTLA 4D0CB 1YN7B 4W4OC 1Q8MA 4XPHH 3LEVH 3GBNL 1UC6A 1G6RA 1KLUB 2EDWA 2BSSA 4QRPE 2OK0L 5JHDE 3BH8B 1RHHA 5IMMB 5BV7L 4LL9A 3QYCA 3VWJD 5I8EA 4GG6B 4M9OA 1XZ0B 3TM6A 5EO9A 2HMID 1JZ2A 1G1YA 3OJMB 4FFWD 3NACH 4DUWA 4LHUG 4EVNA 4XMLL 4X4XA 4QRRB 2X9YA 4WW2B 1REIA 1I3UA 1QKZL 2EDQA 1UADC 2VABA 3ZL4L 1J0JA 3ES6A 4YHZH 1AI1L 3LD8C 2XN9D 3HUJE 3V2AR 2WWKT 2EYSB 3QJFA 4OM1L 3S9DB 4X99B 4ZS7L 5CWSB 1K5NA 1UVQA 1BVLB 4PGCB 5AWNL 3HZKA 5FHBH 2UYLA 3U6RA 2V7HB 1OVZA 3PIQA 1CF8H 1LO0H 3CCHA 4J8RA 1D5BB 2HH0L 3UYRL 3HRZB 2F54D 5A2KH 4LLDB 4ODVL 1CE6A 4DGYL 1G7MB 1BX2B 4HV8B 4KGLA 5DJ0B 1AQDA 1JF6A 3L3IB 3GSNH 2FX8L 1S7TA 1GRWA 3H9SB 2DLIA 2OR9L 3MLYL 4QKXB 5MHSD 1DBBH 4Y1AD 1YEFL 4EQ3A 1I1AC 3JUYA 4E9LA 1ZKAA 1B4JL 1ZA3A 1T20B 3NCBB 4C56E 3HI1B 3SDYH 3RWGB 3DVIA 3MO1A 4JREC 3GIVA 4PRAA 3SJVE 3KPRB 1H5BA 5C9JB 3ZSSA 5IBLD 2AXFA 1MCEA 4IHOB 2VDPH 3S96B 4JFFA 1KENH 3TZVD 1BQUA 2A83A 3UBXI 4R97B 2BRRL 1XCTA 5EIQA 1FH5H 3IVKA 4WW1B 3VFUB 1J0KA 1B88A 1TDQA 2HA1A 4JPVH 4NQVB 2YPLA 3ESUF 4JAMB 5KZCD 1QRNB 4FQHA 3V0VA 3DX8A 3VGBA 2QADB 1X4XA 3B83A 4ZOBA 3U36A 5C8JB 5AYUL 2EC9T 4FQIH 4NRYB 4I0CC 4L3EE 1TMCB 2GJ6A 2VZSA 5CEYA 2OZ4A 3QEQE 3S35L 5C6WH 1BOGA 2UV3A 4YFLF 5EZIH 1IJ9A 4PTUB 2F54E 1T3FB 4O2CB 4XWOC 3DYPA 1HH9B 5EORH 3CSGA 1YMHA 2O5XL 4PJ9C 4KJWD 2YUVA 4OZGB 4X4MA 4NQCB 4PLJD 1O7SA 3O3AA 3NFNB 5FUZH 5IBUG 3ROLB 3R06B 4FZEH 4ENED 3KDMB 3RZCA 4M7JH 1C5CH 4WEMB 3N1PC 1FJ1B 1EEZA 4P9MH 4LK4A 4HKXA 4UOW1 3RWHB 4B41A 4ZS6D 2W60A 3TV3L 2ZUXA 5T3XD 5MERA 2CSPA 2L7UA 3EYFA 5LGJB 4OCSL 3VG9C 3FOLA 1IEBB 1KCUL 4QRPB 3IFPB 2VR9A 5C0AB 5JHDB 4X6BB 1U8MB 4DW2L 5HDOA 5I1LA 3VFMB 1I1YB 3O3BA 2Y7QA 3CVHA 3N1GC 4R2GD 3T0EC 4IJ3C 3TJHD 3VWKC 3I6KB 4L8CB 5HYQA 5EU7E 3BZEA 2XY1A 5IVXB 3JWDL 1PZ5A 5F9AC 4YHNB 4ZFGH 5F21B 1JYWA 1YNTA 3U4BH 4QCIB 3HUJB 1JZ4A 4MAYA 3TO2A 3BP7A 3KPQA 5HHOA 4UILL 5J89A 3LHPL 1MCJA 4JFXA 5F1SA 4CJ0A 4F7EB 5TDNB 4EI5A 1FYTB 2Z8WC 5DURD 4F7TB 1MCKA 1UB5A 2DM4A 1FN4B 3PP4H 4PBVC 1NAMH 5EBMB 4GKZB 2J8UE 5JMOC 2BJMH 2R2CA 4XNYH 1JPGB 3VFOA 1SJEA 4DZ8B 5HDBE 2EE3A 3FL7A 5JUEL 3X3GH 4LNVA 4A2LA 3B9EA 5T3XE 1Z3GL 1KCKA 3GIZH 4L8BB 4C56B 3TNNA 4YZFF 4ZXBA 2Y6SD 3SJVB 5TE4L 3FB7A 4XMPH 4LSTH 4EN3C 3O2WL 4NO0A 4F3FB 1AO7E 5GGVH 4FMFA 3ARGB 1JK8A 1W72H 5DJZB 3GMPB 3QUMH 3O6ML 3UBXA 1YEJL 4UT7H 4XBPB 4Y4KB 4Q97A 4KTDH 3H9ZA 4GRMA 2O5ZH 3QXAA 3WFZA 4BQBA 4CU6A 4F7CB 4YK4B 1FSKC 1QBMH 4NO5B 4XCYA 3RWFB 1VSCA 4OF7A 4L3EB 5IROC 3GKZA 3B9AA 2A38A 5ICXA 1K9TA 3HPJB 1KF9B 1XH3B 3QEQB 5EU4A 5DD1H 2F5BL 1K3ZA 3BP4B 4M61B 5LXGH 1JNHB 3L5XL 1WT5C 4FQXC 4M3JA 4TVPL 4KY1H 4ISVB 3LN4A 4JY4B 3CFIC 2OX5A 5D70L 1A7RH 4PJXF 3IU4L 5A2JH 1U3JA 4GW1B 3X3FH 2AJYH 3IDUA 4P2CG 3SE8H 3W9EA 1S9YB 2HFTA 2HFGL 2E6PA 1IQDB 1I1FA 5HGBB 4NN5B 3V7AG 1WBXB 1KJ3L 3SGDH 4LVHC 5IVNA 2DQFB 1G9NC 3TPUA 5E8EB 3GGWB 4YH6A 3BZFB 5HYFA 4U2ZA 1YJDL 1LO2H 2ZUQB 5GGRB 4X7SL 3SY0B 1Z2KA 3BIKA 3AY4A 4OCYH 1NUNB 3BPLC 1XF1A 3GSWA 4Q2ZA 3T3MF 5EC1B 2EO9A 4RFOH 3AMLA 4GS7B 4JEGB 1A6AA 3SKNA 4MB3A 3RRQA 2EDJA 5MEOB 2PYED 4F8TA 4GRLC 3O11B 4MDJB 3ULVL 3LH2H 4DVBB 3ABZA 4EXKA 8CGTA 5DZNA 4I0PD 2VDLL 5ITBH 4M62L 5EA0H 1VCAA 1NBVL 2Q3ZA 4AIXA 2Z31A 4ZUTB 4B53A 3HE6C 4JFFE 3C5ZA 3KWWA 1CZ8H 1CFSA 2IADA 4BZ1L 1DDHA 2XRAH 5D1ZA 2YPLE 3LS5H 3ARFB 3CC5A 3QCTL 3HNSH 4O2EB 3Q5OA 4Y4FC 3QNYB 2VSCA 5C09A 3TNMB 5GS0C 3PWNA 4L8SC 4YFLI 5E2WH 1HXMB 4K3DH 2GJ6E 1BPVA 5FHAL 1R3KA 1V7NL 1JBJA 4G9FD 4XZUB 5DHVA 3MLXH 3SGEH 3BAEH 4LP4A 4YE4H 2ZCHL 1I7RB 3LPWA 4LOUD 4YDVA 1A1OA 3D0LA 3D2UD 3HLAB 4WV1C 4X4ME 1DBKH 3H7BA 5IW1A 1MFAL 1FV1B 1JNJA 3TVMA 1CDUA 4UU9A 5C0CD 2HN7A 3QH3B 2CXGA 2EDLA 1FGNL 3ARBC 1KTLB 2OI9C 2VXVL 2AK4D 4BZ2H 4RIRA 1P7QD 3RY5A 3MJ6A 3RBSA 3SOBL 5CEZD 2BSSB 3D69A 3U30B 3VE0A 5I1AA 2BNRA 4J12A 3QQ3A 4Y2DA 1JTTA 3HNTL 2KUTA 4ZSOA 4PJGB 5J4MA 2VDQL 2CH8A 2FH6A 3WIFA 3ULUC 4EVNB 3FN3A 1Q94B 1T83A 5DQDH 2I60L 4YXLH 5T5NG 5IT2H 3QR2A 4M5ZL 1X5IA 3ES6B 1MFNA 2AXGA 1VDGA 4KVCH 3QJFB 4OFVA 2QJDA 4PJ7F 3B5HA 2R0LH 1MJ7L 2EH7H 5HHOE 1MRDH 4Q9QH 1UVQB 5HD8C 1A3LH 2CQVA 3RVWD 3HZKB 4KU1A 1EV2E 1N64L 2UYLB 5LBSL 2Q6WA 1RIUH 3PIQB 3AREA 2P44B 4GLRH 4J8RB 1QVOA 1SJXA 3QG7L 5GS1B 1S7SA 2ZOKB 3BKJL 3BZDA 1XR8A 1CE6B 2VIRA 3I75B 5FGRA 2CKBL 4K23L 3O9WC 4UT6H 1AQDB 2HRPL 1S7TB 4MJIB 3WIHA 5E1AA 2VN7A 2E27H 1N6QL 2EIBA 1Z9SA 4L8DB 4ODUA 2E7BA 1TETH 1ZA3B 1P4LB 3MO1B 1S7VB 2EIZB 3BN9D 3GIVB 4PRAB 1XGPB 5I73B 1D9KC 1HEZA 2Z35A 2AXFB 4KUCF 1EGJL 3C60C 1WZMA 1UM6H 2NXZB 4YFDB 3WIIL 4XVTH 2G75A 5E6IB 4JFFB 4TPRH 2W1NA 1RU9L 4S1DD 2IAND 4RGOL 3IVKB 1XCTB 1P6FA 4NC1C 3GUTB 1GXEA 2YPLB 4BA8A 4K7PL 4FQHB 3V0VB 3DX8B 2YD8A 2WK2A 3DHJA 1HWGB 3KPOB 3WS6C 1QFWM 5SWQA 4Z7OF 3U36B 3Q1SH 4LIQE 4AYFA 1EMTL 1ZS8A 2QKIA 1URLA 2R56L 5JHLH 1PEZA 3NA9H 2GJ6B 3Q0HA 3WHXB 5IR1A 5DRWB 1F58H 2RGSA 1NCAH 3P9WB 3EJZD 2JJTA 3P0YH 4F58H 4TSCL 3ET9F 4X7DC 5IP4A 4ZAKD 4IMKC 1MY5A 1OB1A 4MJ5A 5FIEA 3O3AB 4Y5XA 2FWOB 3BKYH 1FPTH 2AJXL 4HJ0D 3MCLL 4K71B 3RZCB 5J13C 3RIFK 3STZA 1EEZB 4Y5YC 4HKXB 4JFZH 1KGCE 2W60B 3E2HB 5GRUL 2DYPA 3EYFB 3SDCD 1DQMH 2XTJC 3FOLB 5CZKA 4GBXC 1B6DA 4B5EA 1FBIL 1L7IH 1PX3A 4JFDD 5E6ZA 1T2JA 3KPNB 5I1LB 3VGAC 3CVHB 1SBBA 5GRYA 2VDKL 3MZTA 5HYSG 5I8OH 2GSGA 2P1YA 1AXTH 5CJOH 2VRAA 5HYQB 1L6ZA 5IFAL 3BZEB 4WI5A 1PZ5B 1E4XI 4JDTL 1ZGLP 4YHLL 4FQCH 2WLZA 4LSSL 3X12A 4LCUB 3FO0H 3V4PL 4MAYB 3TO2B 3W2DH 2HTKD 3WJLA 3KPQB 5HHOB 4JFXB 4QXWA 5I0DA 4IOFD 3OAUH 3HMXA 4UINH 4EI5B 3JVGA 1I1RA 1UB5B 5DR5H 3VW3L 2BNRD 2AEWA 5CUSL 4M4RA 3EW3B 1YA5A 4JN2A 3CSYA 2IG2L 3BOVA 2WWMD 1TQCB 2OR7A 4Z7UB 2VQTA 1SJEB 2DQIH 5HTSA 5F7EH 1ZEAH 1B3JA 3AS3A 1QFUH 4KUZL 4QXUL 5C09E 4U1LA 2C4FU 4DGIH 4W6YB 2GUOA 3PL6D 1NC4D 1TNNA 1DVFB 5HGAB 3FB7B 4M7LT 3P40A 4L3AA 1WWCA 1YQVL 1V3JA 4NO0B 2NY0C 3GFUA 4KRPC 2R2HA 1JK8B 1EHLH 2E9WA 4X7CC 2Y36H 4OD1H 3QULA 3UBXB 5D8JL 3RU8H 3QFDA 5F8QC 3OKLB 4JDZA 2Q76A 4G80A 3JTSA 2DQEL 3HC4H 4XCYB 2Z0BA 2FATH 5LG1A 3V5HA 4QO1A 4OZIF 1KPRA 15C8H 4I18B 3D1MC 5ICXB 2V6HA 5FM8A 4EEEA 4O9HL 4NQTA 1ZLSH 4M7ZB 3C6LB 5EU4B 5ABDE 1IC4L 4KDTC 3FFCD 1FCCA 4XAWL 1JRHI 2BNRE 1MCLA 4PJXA 3LN4B 2PTVA 3ILQC 4MZ3A 3QUXA 1BM3L 4MQXC 4IRSC 1HI6B 1INDH 5FUCE 1T4KA 4AMKL 3OL2A 4ZSOE 1X44A 2W9DH 1XCQA 2CJUL 4L5FH 3SGJA 4ORGB 3W9EB 1I1FB 2VZ3A 1O5DT 5ICZA 3MGTB 2O61A 2WM0A 3MBEC 1LDPL 2P8PA 5GGTH 1DL7H 3QO1A 4X5WA 5A1AA 1TJHH 4XX1E 1KEGL 1JV5A 3O3UN 4J4PA 1GC1C 5D1XA 1Q0YH 2HG5B 1F13A 3BIKB 4PLKC 3GSWB 1RIVH 3MRJB 4Q2ZB 2ENSA 2GQHA 1GOGA 1TPXB 3DMMC 5C6TL 2BNUA 3GSQA 1A6AB 1A6VL 3ULSA 4APQC 2NZ9C 2VXUH 1A6UH 3U48A 2NY3B 3MMEB 2MTPA 1W0VB 4FQQA 3M1BA 3P30L 2P5ED 4E41D 1KG0A 2MCG1 3G6JF 3OKEA 2Z31B 3PF2A 3V6ZA 3WNPA 2O26U 5HVHC 3IFNL 1CFSB 4OT1H 3UYOD 1FAIH 5KN5A 1DDHB 1CDGA 2MMXA 3FFDA 3ZKXC 1S5IH 2Y5TA 5EOCL 4TTDD 1CIUA 2XA8L 2XNAB 1G0XA 1KT2A 3BQUC 4KKBC 2JB6A 4TRPH 1IAOA 4UBDC 5C09B 1TCRB 2QHRH 2Z92A 4P23B 4FQJL 1VFBA 5F6IB 4OCNC 3MV9D 2FEDC 1CL7H 3BE1H 2ICWI 2QL1A 5DHVB 4WTXA 3HI6H 1AFVL 1RJCA 1VENA 3EO0A 2BDNL 5IW3A 1A1OB 3D0LB 1NH6A 5E8NB 5A2FA 3H7BB 2BHYA 3K7UA 5IW1B 5F1IA 5SV4A 2H45A 1JPST 4RGMC 3TVMB 1MJJA 4JM2D 1KFAH 4J2XA 4UU9B 5E99L 2HN7B 4OKDA 3LKRA 4ODHH 1B6UA 4QHKI 4KFZC 1MRCH 2IAMA 4RIRB 4M7KL 4G7VH 1WZLA 3RWEA 1YEEH 3VE0B 1LVEA 5GGVY 3LY6A 4Y89A 4DUXA 3EOTH 3MLWH 1E27A 5DZLA 3WCYA 4Y2DB 5GJTH 1QOKA 4EIGB 5LJYH 4ZSOB 1MAKA 5GISL 4KMTH 2HT3D 3WIFB 4NM8H 3SDAD 1OAUH 3LV3A 2AEQH 4OV6F 2WW8A 5H2BA 2JELH 4HIEA 4OUUA 1EZVX 4R4NC 5F3HA 1NGPH 2E7LC 3RGHA 4GKSA 2EC9U 2WLYA 2Q6WB 4JZJA 1NC2A 1DANU 1JFQH 3AREB 1QVOB 4GSDH 4JZOA 5MEQA 1OTUD 1S7SB 1NGQH 1XR8B 2BHZA 3SE3C 3NCFB 3TA3C 1EFQA 1NFDF 2IQ9L 1F2XK 1ZGLA 3NZHH 5B21A 2ZP0T 4TVSa 2BSTA 2P24B 2DJSA 4HPOL 2H3NA 4DK6A 4GW4A 1OD9A 1MIEH 2YRZA 5IQ7H 3WFDL 4ODUB 2G2RA 4XP5H 2EDXA 3VFPB 2JTDA 3FZUD 2YMXH 1LE5B 1CD9B 2X10A 5GQBA 3GI8H 3SDDC 1HEZB 2Z35B 3O6KL 5FCSH 5I1HH 5D1XD 3DO7A 1QSEB 2G75B 3SE9L 3D3VB 4KHXH 4LCWA 5M94B 3C09C 4HFUL 2FL5B 2WIIA 5EOTA 1RUKH 1J05B 1EJ6A 4JFYA 1KCLA 1LK2A 4BUHA 5I1DA 3DUSB 4JPWL 1OHQA 1UEMA 1JUFA 5SWQB 5GS0L 4JQVC 4JB9H 4PREA 1ZS8B 2QKIB 2OL3L 3QAZC 1U8KA 1OAYL 5J3HC 2FEEI 1GGIL 5C2UB 1MH5A 4OJFL 1A4JA 5IR1B 3NIDF 3HE7D 3ULVF 4BM7A 4LCCC 2VISB 3O6FD 4PJXE 3O2DA 2AQ2A 4OB5H 2IBBA 2ATPA 1A6TB 1CD0A 2BVYA 1OB1B 4MJ5B 5D7IF 3B3IB 4Y5XB 1DUZA 1UWEH 4DEPC 1F42A 5DWUH 2D7NA 3STZB 1CFNA 1IL1A 1S9VA 2CLRA 4D9QD 5DC4B 2XZQL 3I50H 4Q6IC 2NYYC 1ZA6A 5BMFL 1GGBH 3LMJH 5H37G 4GMTL 3GHBH 3TFKD 2R0ZH 4HUVA 5A2IH 5T3ZL 2A77L 1SHMA 5IMKA 3IJHA 4YAQA 2FB4H 5DLML 2HTLC 5F96H 1ITCA 3ULUL 3K2UL 1KJ2L 1AHWB 2GSGB 1UM4H 5DZOA 3CXDL 4MWFA 5F7MC 3VMNA 4NUGH 2FYYB 4YHKL 5EBWA 4K8RL 3X12B 1PSKL 1RURH 5F7HA 3FOMB 1RZIA 5K9JL 4MLIA 1DTUA 4ONOA 1NCBH 1NMAL 4HIXH 4CL7A 4HWZA 2OTUA 4PYHA 2I5YL 2XQBH 1FIGL 1KCVH 5DJDA 1MFCL 1MCHA 2VLKA 1MY7A 3RIAF 4JN2B 1X5FA 3CSYB 1TZIA 2FD6H 3RWDA 4GH7B 4ZTPH 4YX2H 1RIHL 4QOKD 2AEPH 4WI6A 1IGJA 4U1LB 5AZEH 5B4MC 2GUOB 5I18H 2VE6A 1AXSA 4M93C 2GI7A 2J3SA 3FO2A 3S4SG 1YYML 2YUZA 6FABH 2DWDA 1NC2D 3WDJA 4LGRB 3UPCA 3R0MA 2OJZL 3WNKA 4WIQA 4RAUA 1PD6A 3QULB 2DTML 4WTZG 1CXKA 3L3OA 4FQ1H 3QFDB 3K3QA 1XF2B 1HKFA 1FZJA 3MRNA 4JDZB 4MXQC 2Q76B 1QSVA 4G80B 2ADFL 1OM3H 3JTSB 3TO4C 5GRVK 3V5HB 1AKJA 4OZIA 1E28A 2DIBA 4R26L 3OB8A 5FKAB 4UT9L 1OP5K 2EIEA 4W6XB 4WUKL 2K1MA 5BJTA 5GRJL 5CZXD 4IM8A 3QCUH 2F15A 3B2VH 1GPOH 25C8L 3VXPA 1CQKA 1ZWIA 4N1HB 4PJXB 1M4KA 3QUXB 5I15H 1U8QA 1T4KB 1IM9A 1DBAH 4KQ4H 1XCQB 4N0FA 2FO4A 5K9QG 2VKXA 4OLUH 2AAVA 3B8YA 5ICZB 2DM2A 1J8HD 2F9BT 2VO5A 2P8PB 3BD5A 4FFVC 4D0DA 4PTTA 1JI1A 5HHXL 5FA4A 1JV5B 2NY1B 4QT5B 4HWEL 2PXYC 1Y6KR 2H6PA 3RGVD 1FRGL 1XIWD 5FYLH 1F4WL 4MNQD 4QTIH 2CUHA 3KLAA 2V5RA 3HI5L 3IB4A 3NCJL 5DJ2A 3WSQL 2BNUB 3GSQB 3IS0X 5ID1A 3VDBA 1EZVY 3KYMA 2V2TA 1Z0NA 3ULSB 1VEOA 4I5BA 3ZDYF 2BY3A 5KJRL 4DWHA 4WWKD 4HUMB 4OCWL 1HNGA 4OSUL 1KG0B 5MEPA 2VOTA 4FABL 2B5IC 5KVEH 3OKEB 1TTFA 2FBJH 4FTVA 3SO3B 5GZOC 4OBSA 1HKLH 1KACB 1LD9B 4LCWE 4POYA 2QV2A 4PYGA 3FHQA 5KN5B 1S3KH 1WLHA 3FFDB 3QDJA 1KTDB 2Y5TB 3NABL 4GKNA 4NRZA 4AIOA 1KT2B 1CTNA 3C5JA 1EBAA 4GOSA 5HY9A 4HZLA 2JB6B 5JW4M 1FGVH 1IAOB 3O81A 2CLVA 3EYSH 2Z92B 3NIFE 3SQBA 2OP4H 3BD4A 1VFBB 4U1KA 4C83B 5J12C 1UWGH 4OFIA 2HMIC 3EO0B 4FFWC 1IEAA 2OTPA 4G9DA 5B39A 5F1IB 2YN3A 2AABH 1MF2H 3QSKB 3DYMA 2CGRH 1MJJB 3OX8A 3ZE1F 3CFCH 1U41A 1WSST 3QISA 3NA4A 3IJSA 4LGSB 1SBSH 1NCCH 5HHPB 3TIEA 3GDBA 5I8CA 2IAMB 1HH6A 3DHMA 4NPYB 2MCPL 4F8QA 2XQYK 3TJEH 1ZV5A 5IWLC 1R5VA 3WXVH 3L7FA 3RWEB 2AJUH 3IF1A 1GGCH 2IPTH 1J0YA 5F44A 3UTSD 2EC8A 1UKQA 3T2QA 3FO1A 1E27B 3W0WD 2JKXA 4Y19D 4JG0H 2YXFA 2AV7B 1G0DA 2AJZB 1CLYL 5SX4I 5AG8A 5EU5A 4DTGH 3NN8B 3LDBB 4XNUH 4IIQA 2R1WB 1X5KA 3LV3B 5GS2H 1TJIH 4HF5H 1DEEB 5H2BB 4HIEB 4OUUB 3VXTB 3F7RA 5IB5B 4PJ7B 1AGCA 5I74C 4Z7VF 4KI1A 5JXAL 1LO5A 5KAQF 3QEHB 1GC1L 4XCNA 1AKJD 4P9HC 1INQA 3U9UB 5IBLC 2YKLH 5DT1H 4M3KB 1BIIA 5LCVL 4LU5H 1FLRL 4JZOB 4U6HA 3BPNC 5HDQH 1UJ3B 3TZVC 1NFDA 3K8KA 8FABA 1DP0A 2VLKE 3RVVD 3OPZL 1A4KA 2R15A 5F71A 2X9WA 2E7MA 4NZTH 4P2YA 3G08A 3U2SA 3BVNB 1HIML 7CGTA 2H3NB 5KSAD 5ISZA 3B9KD 3EFDL 1CFTA 4WRLA 2G2RB 3K1DA 5IMOA 3NTCL 4Y0GA 3RTQA 4OCXH 5CKGA 2QQNL 1HDMA 1MFBH 1F3DJ 3BRFA 5CSBA 3DO7B 5DQJA 3CDGA 4KJWC 4LHUB 5ILTH 4PLJC 4BH8B 1DQTA 4LCWB 1DEDA 3SO5A 1V7MH 4ENEC 3RX5A 4F15B 4JFYB 4OIAA 4R7NA 1LK2B 5GGRY 5HPMA 5I1DB 2C3XA 4YNYB 4OLVH 1A9EA 1JUFB 1PX4A 4ZS6C 4HH9A 5HVGB 4JRYA 4OZIE 1YMMA 4PREB 5GJSL 2Y06H 1BAFH 1U8KB 2R4SH 4NM4L 4LSPL 2A6KA 3A6CH 3AM8C 3DX6A 3MCG1 4LP5A 5E2TH 4RWHA 3VGHA 1EK3A 3O8XA 4X8XA 1A4JB 1I7TA 4G6JL 3CH1B 2J8HA 2DM3A 4R2GC 2ICWB 2KZ1B 4JZNA 3CX5K 3D48R 3E1F1 4HT1L 1MCRA 2ATPB 5D7IA 5IVOA 4Y16C 1ZANH 4FTVD 2X4PA 1DUZB 1A6ZA 1AJ7L 4LSRH 4G5ZH 1CI5A 3FAXA 3FRPA 4Z0BL 3W5MA 1CFNB 1G9MC 2CLRB 4WHYH 3FMGL 2B4CC 3BGFC 5ALBH 1QQDA 3QFJD 3MBXH 2LTQC 1MHHA 4YDLC 4KJQD 1I85A 3K74B 1JNLH 4HUVB 4MJ6A 1P6AB 4M9PA 4OM0H 5L6YH 1G7JA 1WZ1L 4M1CD 3M8OH 5IMKB 1SY6L 4YAQB 5F6HI 2PO6D 2A74B 4I3RH 4JJ5A 2IBGA 4MWFB 1CDCA 3QIUB 3WMSA 1R3IH 4J23A 3G5YB 4RZCB 3MXVL 1AGFA 5EBWB 4TULH 2Y6SC 4MJID 5DMIL 1RZIB 1A7PH 5ADOH 3QXTA 4HWZB 5DUML 4NUJA 1N0XL 4PG2C 4FTVE 2VLKB 4WGVB 2PTUA 3LQMA 4MHHI 4QRQA 2E9JA 1TZIB 4QXGL 3HNVH 4J6RH 5E4EC 4BSWA 1NCUA 3QDJE 5DJCA 1MWAL 2DMKA 1JWSA 1GHFH 4UQ3B 4GO6B 2HKFH 3GM8A 4PJ8A 1E4WL 5E70A 2F53A 5DEGA 1IGJB 4NRXB 1SEBA 2D7OA 3L3DA 4NNPL 4GRWF 3QIBD 4NZDA 3VXMA 2ZUTA 2WUCH 4XP1L 2VE6B 1AXSB 1H5BC 4XNZC 3FO2B 3VFVA 4U4BA 4N90E 2DWDB 1U93A 3LOWA 4V2CB 3TCXA 4RAUB 1YECH 4URTB 1NBYA 2NY5L 1A02N 1I9RL 3H3PL 4TUJA 2GITA 3H9HA 2BP3A 3CZJA 2CKBA 3L3OB 4Y4HA 5INCA 3MRNB 1I7UA 1FZJB 1NMBH 1T66D 3HR6A 5JW3H 4OZIB 5GHWL 3IDGA 2OYPA 1VPOL 5SWSA 4UQ2A 1DBJL 2YUXA 5BJTB 4WEUD 4NCC2 2IH1A 4WFFD 3VXPB 1ZWIB 4X98A 1EGJA 1U8QB 1IM9B 4LASH 5CD5D 2X70A 1MVUB 2RIKA 2HWZL 4N0FB 2F8XC 1TNMA 1GAFL 2WBJA 3CFJA 1IM3A 1FE8H 3WKMH 1H8SA 4KC3B 4HFWB 1MEXL 4ONGH 4ODBD 1BJ8A 4O5LH 1NAKL 3MRGA 4YHOL 4I0PC 4C57C 3GJFK 3U7WL 1VFAB 3ARDA 2H6PB 3PWVB 3UZEA 4JFQA 1IKFL 1XGUA 2H8PA 3I84A 4M7LH 1T1WB 5M7QA 4TVPE 5F9WB 3KLAB 3CMOH 3LZFL 5F1NA 5DJ2B 4XBGA 2JJSC 2VH5H 3SBWA 5DD5H 1A5FH 5ID1B 3KYMB 7FABH 2V2TB 5ISZE 1I8LA 1DBML 3DSFL 5EZJA 1QLFA 3HC3L 1HXYA 4I5BB 5HHMD 4OUOA 4F33A 5K33A 3VRLF 5GPRA 4U3CA 3V4VL 5GRVL 4WFFE 4W4OA 2BMKA 4ODSL 5KSUA 5FFLA 3G6JB 5MEPB 4LSQH 3GM0A 4WI4A 1UEYA 4LOUC 1HSBB 2EH8H 4TNVK 3H9YA 1E4XH 2NLJB 1DVFD 3DVGA 3MGOA 5KOMC 1X7QA 1BQSA 3BDXA 2CRZA 2Y9RT 5C0FA 4U1MA 4F57L 2GTWB 4WO4D 1IAIL 3QDJB 1P4IL 2RQ8A 4B7LA 4GKNB 3B9DA 2ZUSA 3ULUF 4HZLB 4U1HA 32C2A 1DE4A 4JRYE 1A21A 3O4LD 5TDPA 4QXTA 1YMME 4P2RA 3AU1A 5CJQL 2BY1A 4XWGL 3NIDE 4ZXBC 5B38G 3ULVE 5D1QD 1AXIB 4UV7H 2P8MA 1ZHLA 3MRHA 4LF3A 4LAQL 4MA7L 4NJAL 1YC8A 1NJ9A 4OF6A 1RULL 4PJHA 2NY7L 1WCQA 5D7IE 2Z8VC 3S34H 3SCMA 3FONA 2A9ML 5B39B 4M6NL 5F7NC 5JLZA 1Y0LA 3OX8B 2X89D 2NY2B 3IJSB 3HFMH 5KANG 3MOQA 3SDXF 3TIEB 1QHPA 2MQCA 5I8CB 2F53D 3N06B 1I1AA 1HH6B 3LS4L 2DQUL 3RVWC 3MV01 3ME0A 5FYLD 1R5VB 3L7FB 2FGWL 3FT3A 3IF1B 1CBVH 1Y6NR 2DQJL 1T7ZA 3RIFF 1Z9LA 2DI9A 4JFEA 1EEYA 1RZJH 5CHNA 1KB5H 4U0RB 4UB0H 2CMRL 4N0YL 5EU5B 5J11C 4C4KO 2YOCA 5FYKL 1RD6A 3IDXH 1WFNA 3LQAC 3E6HA 3Q6GL 1WIUA 1T0PB 1MPAH 4YHPA 3IFLH 4Y4HD 4KAQL 2BXZA 4Z7VA 2PTTA 1JRHH 1AGCB 4HS3A 1FP5A 1LO5B 2I9TA 3BN9C 4H5SA 1OP3H 2H1PH 1INQB 4Z8FH 1F97A 1OAZL 4RRPA 1HK6A 1CLZH 5SWSD 4GT7A 3HC0B 1BIIB 3BMWA 2VLJA 4KVNH 2P49B 4WFGD 4U6HB 4S1DC 1NFDB 1P4BL 3VH8A 2ESVA 4HKZA 8FABB 4PJ9A 1Q9LA 3WLWD 3OKYA 1PQZA 3PGCA 3G08B 3U2SB 2OXGA 4KK8D 4LCIL 4PB9H 4NQDA 4EUPA 3NVQA 4WUUB 1JPSH 2F53E 5KBNC 1Z9OA 5IMOB 1WUNT 1MFEH 3S5LA 3VXME 3WFCH 3RTQB 1HDMB 3NMEA 3QEGH 3U83A 4TN9A 3K8MA 4RAHA 3EJZC 4JFHD 5DS8A 4DQOH 1G7IA 2D7TL 3KYKH 4X0KB 2XZAH 5DQJB 3BKMH 3CDGB 4WFEE 3INUH 4ZAKC 3LAFA 1FZKA 1WZKA 3C5ZC 3A0OA 1H9VA 4N8CH 3T0EA 5F9OL 3R0NA 2ZKHL 4HJ0C 4O58H 5D1ZC 5GGQH 3MACL 5HPMB 3KVQA 3PWUA 3OAZH 4PP2A 4P5KA 4G8FA 4Q58C 1CDHA 1F11A 1YEKL 4HC1H 4HH9B 3SDCC 4JRYB 3TT3H 2ZUYA 1A7NH 1YMMB 3UPRA 1CICD 1FAKT 5SWSE 2A6KB 3DX6B 4UNTA 3O8XB 4WFGE 4WU7A 4I4WA 4V1DA 5IG7A 3RP1A 4JO4H 4KPHH 1CLOH 3VA6A 1RK1A 3L9RA 4JZNB 1FQ9C 5MI0B 2UUDK 3DURA 5D7IB 4H0HB 2X4PB 3EGSA 3RUGA 3SKOA 5MENA 3EYQD 5AEAA 2HTKC 2F58H 5C7XH 3PE9A 1MHPH 1J1OL 3CPLA 4DCQA 2I24N 4BUGA 4J3OC 4S2SA 4IOFC 3MV7A 2IFFL 1MHHB 1I4FB 4MJ6B 4O4YH 3TYFA 3DX7A 5CINL 3LEYL 1G7JB 4EN3A 2ITCA 2YD6A 1IT9L 4JVUA 1Q9KA 4OFPA 1KJVA 5FUCC 2WWMC 1A14H 4HJGA 1VACA 3C8DA 4JJ5B 3SCMD 2CXKA 1JYNA 1V3MA 3ZDYE 2NW3A 1ZHBA 1XGRA 1S5HA 5DK2A 3H3BC 4XB7A 1T03H 1AGFB 1UB6A 1E6OH 4CU7A 1JGVL 2DQCH 3PL6C 2DKUA 4P9HL 5FDWA 5IB3B 4F80A 4XTRD 3C08L 2UWEF 3M45A 1H3PL 4FQXA 1BD2A 5K9QI 2BK8A 3BZ4A 3MRQB 4UTAH 4JFED 2R23A 4Q6YA 1NCDL 5LKNA 3T0DA 1LQSR 4BSWB 1KIPA 1C1EH 4L29A 5I1GH 5DI8B 4A2MA 4PJ8B 5F7YC 5DEGB 4PP1D 1RZ8A 1S9WA 5I17A 1M7XA 4NN6C 4P2RE 1SEBB 3L3DB 1ED3A 3D6GA 3U0TA 2ARWA 3VXMB 1ETZA 4ACPA 3IDIA 3UTPE 5JIHA 4LARL 1Y18A 2R4RH 3VFVB 5L9DH 5HYSB 2C1PA 3K4DA 4PJHE 2VLJD 4XRCA 4H0IA 1A3RL 1NBYB 1NCTA 3IGAA 5C2BL 4TUJB 3VXNA 2GITB 3ZE1E 5K9OA 2CKBB 1T7YA 4WI8A 5C0ND 1I7UB 3TYGH 3G5VA 2BVOA 4OF3A 4F2MA 3NPSC 5JQ6H 3IDGB 3B5GA 1MCPL 4MXVF 3SKJH 2DDQL 2WWKO 4IDLA 4GRLA 4UQ2B 5JR1L 5HVWA 4TUKL 3NCYS 1T2QH 1CXLA 3DGCR 4IBLT 2IH1B 4JO2H 3WFEL 3THML 1UCTA 1CDIA 4JFEE 4K3GA 4EOWH 3BMVA 4X98B 5DVKA 1M05A 3HE6A 4N8VA 1CWVA 1OAXL 2X70B 3BJLA 3MJGX 5F3BA 1CQYA 5I6XC 1L7TL 3LEXA 2WMPA 3GZKA 1U2HA 1FNAA 2WBJB 3CFJB 4MXWH 2B4CL 2R9HD 4N0RA 2PF6A 4Z7VE 1CT8A 3DRTB 5B3JF 3R8QA 3MRGB 3CVIL 4RMUA 4L8SA 4DKAA 2OL3A 1K85A 3ARDB 2W9LA 3CDYA 2VLJE 4JFQB 5HYJA 3A6BH 2NXYB 1XGUB 1JPTH 2ESVE 5CZVH 3MOBL 4QHLA 5ESAB 1M7DA 1IC5L 3MNZA 4IMLA 2W92A 5F1NB 2D0GA 4NWUH 3K4AA 5HYEA 4NQDE 3BUYA 4OCLC 1X5LA 5EZJB 1OSZA 4BK5A 1HXYB 4CW1A 2X4UA 4OTXL 3L6FA 4F33B 5DEZA 4LMQI 4FFZH 3ARBA 1QPPA 3RWCA 1NANH 2BMKB 1NGXB 4MQTB 4TSAL 2Z4QA 5KSUB 1X5HA 2YD7A 5T1DH 2W65A 5CILL 4J1UB 3V6BR 2V7NA 1KN2H 3JVGC 5CIPA 3DVGB 3SKUD 1TJGL 1C12B 5C0FB 4U1MB 4JM2C 4OLEA 2IFGA 3S37H 1F8TL 1R3HA 1WEJL 1KJ2A 4LKCA 4L4TA 32C2B 1BEYH 5DEFA 5TDPB 3WFBH 1KPUA 4P2RB 4Q0XH 4JRXA 3AU1B 3OAYH 3LD8B 4MYWB 3K46A 4FFYH 5I1EL 1C08A 3OGCA 4BJLA 2KH2B 3DUUB 3PDGA 3BPCA 3MXWH 4V1DE 1P84K 1BFVH 2P8MB 1ZHLB 3MRHB 4LF3B 4XNQA 2WINA 3H0TA 4NWTL 2VLLB 2HT3C 3TWCL 4K3EL 3FONB 1ES0A 2QLVB 1VFMA 5IB1A 5DHYA 5E2VL 1PEWA 3SDAC 3UO1H 5TQ0L 1ZT7A 3O9WA 3DECA 1P5VA 3QWRD 1UENA 2FSEA 3RUGE 4MLSA 4HK3N 3GKWL 1P2CB 3CLFL 3DRQA 3JWOC 1QD0A 3SDXA 5L2JB 1HSAA 4ONFH 3VG0H 4UDTA 5HI3D 3MRCA 4NSKA 1I1AB 3QCVH 2YPKA 3RA7L 5DQ9A 3MV7E 5IM7A 3FT3B 4JREB 4YGVA 1OTUC 1C5BH 1RFDH 3C60A 5IFHL 3ARRA 3VXSD 1L4IA 1EEYB 4UDUB 5CHNB 2ZJSH 1TZGL 2HAZA 1FZOA 3GSVA 1CLCA 4OLYH 4AEIH 1QG3A 3E6HB 3QEUA 2OJEA 4YHPB 1FVDA 1OARH 3G6DH 3EDDA 3WS6A 4Z7VB 4DVRL 2XZCH 2AJSH 4XP6H 4ZOCA 4HS3B 2VXTH 2M8XA 4G6ML 4KZDL 4H5SB 4PY8J 5BO1H 2X4NA 3OZ9L 1HCFX 4AEFA 1DFBH 4E42A 5E2UL 5D1XC 1OGAD 4DJMA 2N7BA 4EBQH 3RPKA 5I2IB 1TCMA 1HYSD 1BD2E 2B1HL 2ESVB 2LE9A 3IXTA 4HKZB 2ATKA 4A6YL 2ITDA 4PJ9B 1Q9LB 2MPAH 2VQ1A 3G5ZA 2J6EL 4Y88A 4IMKA 5GSRA 1PQZB 4AIZB 3PGCB 4Z6AT 4EDXA 3N85L 4NQDB 3MRKA 5L8LB 3MLPA 4ZO8A 3CDFA 3VCLB 2QR0A 4P2OD 4NNXA 2F5BH 1XGQA 2H2SD 4Y5YA 4GRWE 3MV8A 4NKDA 2QQLH 2J12B 3FHAA 1FFRA 3HE7C 3VG9B 2HT2D 3O6FC 5DS8B 1QEWA 3O2VH 5L7XL 1G7IB 1KB9J 4JCMA 2P43B 5I8KL 3FB5A 4AH2A 1MOEA 2UVFA 1UFUA 1FZKB 4PGDA 4IDJH 3T0EB 4YBLC 3DARA 1CG9A 4IJ3B 5HBBA 2GEEA 3VWKB 1F6LL 4XT1C 3O4OC 4PP2B 4P5KB 4G8FB 5ENWA 4YDJA 1F11B 5DD6B 5IKCA 1LO4H 2GK0A 1QLEL 2VDMH 2DKSA 4CGTA 4O00A 2WANA 5CEZL 4YQXH 5JTWA 3P4NA 3T2NH 2B7DT 4HWBL 1EAPA 3BN3B 3TFKC 1CYGA 2BOBA 4H0GA 4I4WB 4HCRL 4V1DB 1GOFA 5IG7B 5HHNA 4MCYB 5T5FH 1FNEA 1PJ9A 1RK1B 3L9RB 1ACYL 3DURB 2ZSWA 4NKOA 3WXWL 2FX7H 3LVEA 3C5SA 1MJUL 3UTTA 4HK0A 4M5YL 3HCVB 2AJVH 3HAEA 4OCMC 3EGSB 4WHCA 3SKOB 1EO5A 5MENB 3QHZH 4C55A 1ZMYA 2FHCA 2DWEA 3CPLB 1FL5A 4DCQB 2XICA 1IVLA 4S2SB 5LWYL 3JTTA 3MV7B 2AS5M 2P8LB 3MRFA 3T0WA 3FQWA 2DI7A 4K8RD 5B3NA 2FLRT 5I19H 3QHFH 3WYRA 4HS8H 4EN3B 2ITCB 3ILPB 4JHBA 5F89A 3T0XA 1Q9KB 4DN3L 1KJVB 1OSPH 4HJGB 1MREH 3GMLA 1AQKL 4WEBH 5DDHA 3LQAL 4GAYB 3OKOB 1VACB 2XKNA 4J3SA 4OGZA 1CN4A 4JFPB 5D96C 2NW3B 4LBEA 1XGRB 1S5HB 3LKOA 1UB6B 4MA1C 1FSKB 4X6CF 4YC2C 3VRLE 5FDWB 4NZRL 1CGVA 2VLRA 3F6LA 4D3CH 4OZ4A 1QBAA 1J1PL 2VZVA 3VD7A 1E4KC 4U33A 5SX4H 5I1JL 4JZJC 4KDTA 2VC2L 1MFAH 2DI8A 4FQXB 1BD2B 1MCFA 5C08A 3BZ4B 3IYLW 2EE9A 5T3ZE 2CDFA 4IRSA 2R23B 2DQTH 3LEVL 4GJTB 1KIPB 2A0LD 5FGCE 4L29B 3ULUE 2IWGA 2XWTA 3ZHKA 3MRMA 4L4TE 1I3GH 2A1WH 3G9AB 3K80A 1RZ8B 3S35X 1S9WB 4JGJA 4GRWB 2ZPKH 4JRXE 5CZXC 4LVHB 3U0TB 1ETZB 3NACL 3ARTA 2D0FA 1N5AB 5I30H 4HULB 3IDIB 5AAMA 5SWZD 1U58B 1HHIA 3H6JA 2YBRA 1TVBA 1NBQA 3O3DA 5DUBA 1N6VA 3UMTA 4KWUA 1QFPA 4KHTH 4XRCB 5EO0A 3L5WA 4YHZL 3BPLB 5J8OA 3D18A 1M7IA 1S8DA 2JIXB 3EKCA 3IGAB 1AP2A 2BFVH 1KNOA 3ZT6A 4OD2A 5D7KE 3DMMA 5FHBL 5TE6H 1CF8L 1LO0L 3G5VB 2BVOB 5TF1H 3SDXE 4F2MB 5AG9A 4KTEH 4APQA 1WBYB 3UBXG 1SQ2N 5J56B 1N64H 1RJLA 2LU3A 3X13A 4J3TA 2EDHA 5E95B 4GRLB 1LK3L 1C5DB 1U2CA 5E5UB 1ZLVH 3RGVC 2WUBH 2ZUUA 3GSNL 1XIWC 2ZZUT 4M1GH 4R4FH 4YBHA 3FQUA 4BKLB 1FO0A 3NH7H 3V9FA 2F5AH 1OTSD 1DBBL 1M05B 4LSUH 3HE6B 1B0RB 5F3BB 3MC0A 5K9KA 3JWNC 3LEXB 4IRZH 3SDYL 4N0CD 4KK9D 4NC1E 1BLNA 3GHEH 2IGFH 4RWYH 1MI5A 1KULA 4NKQB 5L2KA 1WWAX 3BQUA 4PUBH 2V5YA 3WLBA 4Y4FB 1CT8B 1VGKA 1ULVA 2VDPL 3G5XB 4WWKC 1KENL 3QB7C 1FH5L 3P77A 4L8SB 3DNKA 3S4SB 4JPVL 4NO2A 1T7WA 2OL3B 4RGOH 4OZFA 5HYJB 4YHMH 4Z78A 4QHLB 3VFGH 4FQIL 1M7DB 2XY2A 3MNZB 4IMLB 5KANI 4WV1B 1JYVA 2FHFA 4TUOA 3JV0A 5EZIL 5TFSH 1OSZB 1IKNC 5JO5A 3P73A 2X4UB 2YK1H 3L6FB 2E8ZA 5EORL 3UYPA 3ARBB 3LRSA 3MV8E 2ICEA 2OI9B 2FX9H 3RWCB 1YNKH 1OW0C 3GI9H 5FUZL 1NLDH 2XTJE 4FZEL 2W65B 1P7HL 4M7JL 1C5CL 2X44D 1JGLH 4P9ML 4LRNH 4X4YA 2V7NB 5CIPB 3BEWA 3BEVA 2E6JA 3UTQB 5BV7C 2V9QA 1ZVYA 2OMNA 3F7YA 1SY6A 3QDMA 3MLVH 5BVJA 4YFEA 5FGCB 2OTWA 4IRJD 1R3HB 1S7WB 1KJ2B 4L4TB 2RJMA 4DGVL 1F00I 1KPUB 4JRXB 5GRWA 1KIUA 4HBQA 3LRHA 3OGCB 4MB4A 3D25A 5CLWA 2E7LA 2YA0A 4U6XA 2ADGA 3BPCB 1ND0A 4JJHA 1PBYA 4XNQB 2WINB 3H0TB 4OGYH 4KMLB 4ZFGL 3CD4A 4XH2A 2E3VA 3U4BL 5I1IH 3SE3A 1ES0B 3TA3A 4OAWA 5IB1B 5DHYB 1WWBX 2I27N 3UTTE 3RX7A 3MJ7A 1ZT7B 3O9WB 1DCLA 3V8OA 1NL0H 2FSEB 2H2PD 1T22A 5C0GA 4U7KA 4KKCD 3SDXB 1MAMH 4JR9H 3DXAD 2Y07H 1HSAB 1MWAA 5JDSA 4XVJH 4UDTB 3PP4L 4NSKB 1NAML 2W0LA 4GAJH 2BNQD 4MJ2A 2YPKB 1U6AH 1HHJA 5DQ9B 3SDDA 5IM7B 2BJML 4XNYL 4YGVB 2YD2A 5DFVD 1CE1H 1D9KB 3X3GL 1IEHA 1X6LA 3G6AA 3EOBA 4P3DA 3C60B 3RVVC 2UY6A 4L4VA 2XXCB 1D5MB 2AGJH 2R8SH 3GIZL 2ADJA 1QSFB 4X80H 3PV6A 4U1NB 1FZOB 3GSVB 4R9HA 5KSAC 3B9KC 3QJHA 3QEUB 4XMPL 3ARZA 5HHVH 1FVDB 4MNHA 1ZLUH 1FL3A 4LSTL 3HZMA 5E8OB 1EO7A 1QFWH 5C6PB 2APBA 5IB4A 1Q9WA 5GGVL 5DK3A 4JQVA 5TQ2L 1OCWH 1W72L 2VLRE 2X4NB 3QUML 1UH2A 4UT7L 1T1XA 4E42B 5JPMA 4KTDL 1S9KC 2HJFB 2O5ZL 1BVZA 4FXGA 3RKPA 4RMSA 4XX1G 1QBML 5C08E 3IXTB 2ATKB 2EKSA 4BQ8A 1JZ6A 2ITDB 3D87B 2VQ1B 3G5ZB 4LEXH 4LRIC 5GSRB 4FG6D 4EDXB 1X3DA 5DD1L 4QHMB 2X7LA 5LXGL 5J13B 4X7TA 4NNXB 4KY1L 5DJ8A 2XG5A 1XGQB 1EX0A 4Y5YB 4X83A 3EJYD 5DF0A 1UXWA 3KPSD 1A7RL 3MV8B 4NKDB 3PNWB 2M26A 4Q6IA 5EFIA 3X3FL 2XTJB 1CGYA 5TPWH 3SE8L 3EDEA 1OL0A 4GBXB 2WBWB 1QEWB 3V6FA 4AH2B 3I3DA 4UMGA 4RQQA 1BQHA 3VGAB 3V5KA 4PGDB 4WNQB 1CG9B 5E9DD 3D39B 3EO9L 1Z5LB 2R0KH 1N2RA 2RR3A 1LO2L 4MCZA 5ENWB 1UG9A 4YDJB 2XWJA 4P4KA 3KYOB 1TFHA 3PWPD 3UX9B 2GK0B 4OCYL 4M43H 5IHUH 4MXVE 1E6JH 5E56A 3SPVA 3O45A 1EAPB 4KJQC 4BFBD 2BOBB 1S7UA 3HG1A 5IQ9A 4RFOL 5HHNB 3JV4A 4M1CC 1FNEB 2PO6C 4XPFH 2VR4A 3CJJA 4PRIB 5C0EA 3EFFA 2ZSWB 1DQJB 3MLSH 4NKOB 4XP9H 3PV7A 3C5SB 1QBLH 3LH2L 3UJIH 3UTTB 2PN5A 2MSPA 4HK0B 3V5DB 4G6FB 4N9GA 3ZKND 3O6LH 3D85D 3HAEB 1KYOK 3O41A 3NAAH 2XI9A 2RCSH 1MI5E 5BRZD 5L2KE 5ITBL 5EA0L 5B3JE 2B20A 4P5TD 1NQBA 4P48A 2DWEB 1JGEA 1FL5B 1CZ8L 4PRPA 4CVZA 3JTTB 5IVZA 2XRAL 3MRFB 3ZHLA 5E08H 3LS5L 3FQWB 1LGVA 5EOQH 1JL8A 3MQIA 1UH4A 4F7PB 4OQTH 1T21A 1IBGH 3HNSL 2APVA 4XNXH 3T0VA 5F89B 2VZUA 5E9DE 1NMCC 1RJYA 4JO1H 5D7JD 4KRPB 1DQQA 5D6CB 4OKVA 1UT9A 3GMLB 4PGBA 1EFXD 5E00B 5E2WL 4JO3H 5DDHB 4K3DL 2XKNB 2BVQA 4ZOEA 3PWPE 4IIQC 2OLDA 4G8EA 4LBEB 3MLXL 2YRPA 4X6CA 3LKOB 1IGFH 3BAEL 4YE4L 3QIBC 3TO4A 3IDYC 2V2WA 2VLRB 5F7UA 4OZ4B 1WICA 1DBKL 2UWEB 2VYRE 4J3VA 1OPGH 5T1KD 2VXQH 3OR7A 5EIIA 5CSGA 2GAZA 2X1PA 1XF3A 2Z9TA 3U0PA 2A6DA 4ZUUA 5C08B 2PW1A 4K7PX 1J12A 4LVEA 4YXKH 4Y8AA 3BRGC 2CDFB 3J8F7 4IRSB 1A7BA 4BZ2L 4Z7NE 3QDME 1IARB 2P5WA 3WS3A 1KLFA 1TENA 1T66C 4MDIA 4NP4H 5JXED 4H8WH 4TNVF 3NCCB 4S1SH 4BZYA 4DAGH 3MBEB 4U49A 4S0SD 3KXFB 4MSWB 3GBMH 1ZGLM 1HHIB 1J1XH 2PXYA 3MLUH 3O3DB 3I6LD 5DQDL 4CMHC 5DUBB 4YXLL 4DOHE 5CD5C 5IT2L 3TF7C 5EO0B 3L5WB 5H37H 5C0DA 2CDGA 3D18B 3F8UB 1M7IB 1S8DB 4OCRH 1AP2B 2DRUA 3N0PB 1KNOB 2R0LL 4YPGA 3S36H 4JE4B 2EH7L 4OD2B 1G9NH 1MRDL 2ZCLH 3DMMB 1RZKH 1A3LL 1VFUA 3HR5B 4Q9QL 1T04A 1RIUL 5C0BD 4LGPB 5C71A 3CAFA 4APQB 1RJLB 3MJ9H 3AAZA 3T09A 4UT6L 1WBZA 2X2YA 4NQED 1A2YA 1UJTA 3GSXA 2E27L 1GH7A 3T65A 3FQUB 1FO0B 1JTPA 1YEIH 4L4VE 1NKOA 4YUEH 1CU4H 1CIDA 2HLAA 4HDIA 1TETL 5CJ8A 5EBLA 1XF5A 2FIKA 5HVHB 4IS6A 5K9KB 4UUJB 3OKKA 4PIRF 5C07B 3F58H 4ONHA 1N5YH 4C4KT 3ZKXB 4HMCA 2HVKA 4X6FB 3N9GH 2MJWA 1BLNB 2VDNH 5K93A 1MI5B 5L2KB 1JIBA 3BQUB 4LLUA 4XNMB 1UM6L 4XVTL 2V9RA 4TPRL 5L0QC 5EU3A 1E0OB 3P77B 4NO2B 3I6LE 2X05A 3REVA 1VESA 3MLRH 3VWJA 3VXUB 3HMWH 4RFEA 1BWMA 3VDCA 3Q1SL 4WO4C 1DZBA 4HLZG 4BFGA 2IMMA 5JHLL 1GGYA 3NA9L 4RGND 3MRIB 1QR4A 4RGMB 5C0BE 4TUOB 4ZTOH 1F58L 5JO5B 1NCAL 3P73B 3P0YL 5E4IA 3ZDZF 3DX9A 1CDBA 2XN9A 4F58L 2G5BA 3LRSB 4C58B 1EDQA 5D1QC 1FCGA 3IDMA 2HP4A 4X7EC 1JHLH 2YSSA 3BKYL 1FPTL 1WCBB 1X5GA 4MQ7A 3BP5A 4X4YB 2KZWA 4JFZL 4PJEF 2EXWD 2AI0H 1BFSA 3BEVB 4CUCA 3PQYA 1DQML 1JVKA 3F7YB 4GG8A 4I3SH 1L7IL 2NY4D