1FBIH

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
221
structure length
221
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQGPGQGLEWIGEIDPSDSYPNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCASLYYYGTSYGVLDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/antigen)
total genus 31
structure length 221
sequence length 221
chains with identical sequence Q
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH02
4BQCA 1QLEL 5DHYB 3WE6A 1K8DB 4WEMB 3BAEL 2AQ1A 1FG2B 1PVHA 4KJYB 5H94B 4O5LH 3BUYB 4OTXH 3MV8E 3S8WA 4GH7B 5F89B 2BNUB 4U1LB 2UVEA 3VXME 1GZQA 4C59B 2ZSWA 3KYNA 1I7UA 3FOLA 1DN0B 4MAYD 3RWIA 2W60A 3JWDH 2UWEE 3LEXA 4NQDE 4XNUH 4UUJB 1T22B 4XRCB 1EEZB 3HC0B 2R1XB 2DI7A 1MIEL 4ZQKB 1PQZB 3L95A 5TFSH 2A77H 1WJ3A 4HFWA 4GQPH 3CSBA 3UYRH 3RWCA 5EWIL 1RJYA 3Q6FB 3PWPE 5T1MA 2JE8A 4EDWL 3D9AH 4KI5C 3SDCA 2IWGA 3X11B 3OKDA 4U6VH 4IRSB 3VXOA 3IDGB 4K71B 2IH3B 3LB6C 1F3JB 2F53B 2KH2B 3OB0K 1ACYL 3JV0A 3NZ8B 1RUKH 1Z9OA 3VMPA 2QKIA 1PZUB 1QO3B 3L5WA 1NL0H 5KG9A 2VDKL 5T3XL 3UYRL 5D5MF 2JJWA 2W0FB 1J1OL 3U9PH 1XR8B 3B5HA 3PGCA 1U8NB 5C0GB 5INDA 4NQEA 3I3EA 4KHTL 1L7IL 5CJOH 3LPFA 4ZTOL 4GRMB 4IRSD 2YPKA 3RDTC 3DV4B 2PETA 3G6JE 1AGDB 4OFYA 3BXNA 3HMXA 4MB3A 4PJ8B 2ZUXA 3EDFA 4NNPL 2F53D 1FV1B 4FZ8H 3V5DB 1NGZB 12E8L 3TNMA 2ZNWA 4NIKB 2BCKA 5TGBB 5AYQA 3BPCA 1BGXL 3CFDA 4HIIA 3L1OL 5J3HD 2N7AA 3QUML 4K07A 4YFLI 2NY4C 5KTEL 4U1MB 3TLRA 2ED7A 1E6JH 4ZUUB 2ZPKH 4HUWB 5I75B 1JGEA 1RY7B 3EFFA 3QH3B 2AJSH 4ZFGL 4HWBL 3ZSSA 2ZJSL 4OCYH 5B8CC 4PJ8D 3ZT7A 1XAUA 2FBOJ 3L6FA 4I5BB 3QDJB 3E6FA 1BFOA 3U0WL 4L3CB 4X6CB 2X4UB 3AMLA 3OAUL 4EUPB 1D7FA 5E5MA 2B8OT 3QPXH 5E8OA 1J10A 4MD0A 4U7MA 1VFBB 3MV9A 3P40A 2XACC 1HH9A 3QXAB 4LU5H 3SGJA 5DHVB 1HSAA 3IF1A 3MUHL 2IQ9H 1M7DA 3VDAA 1G9ML 2HTKC 4JO2L 3OKMA 3QDJD 5E8EB 1IQWH 1CLCA 5AYUL 4I1NB 3AU1B 5IB5B 4EQ2A 5FO8A 4AEHL 3IKCB 3X3GL 3IFPA 1QLFB 2M26A 3P77A 3L3GB 5SWZE 1ZGLM 3HZYA 1UM5L 5ISZE 4P2QB 5D4QA 3H0TA 3GIZH 4PV8A 2Y23A 4X0KB 1EAJA 5D7IA 1AXSA 1WWCA 3MOAH 3EJZC 4A2MA 5IVXA 5HPMA 5KAQF 3STZA 4MSWA 4WIQA 1F5WA 1OF2A 3CFEA 3LKOA 5FKPA 4N5EC 1OD9A 4I3SL 4WFFD 3V7AG 1LO0H 5FA3B 2OJZH 1J8KA 2IQAB 1IE5A 4OBSA 1FL3B 4LVNC 5EOTA 5HHNA 3BO8B 5IBUG 3WIIH 4JKPH 4TSCH 2ICWI 2ZKHH 4YR6A 2X10A 3MGTA 4P2QD 4JN1H 1HQRA 3C8DA 4OUUB 2PF6A 4ZUSA 1UVQB 2FEEL 4IMLA 3VI3E 3EYUL 3D3VB 4PJCE 4BFIA 2Y5TB 2VLMD 3KYMA 4J4PD 3UJIH 5IB3B 4P49A 4Y5XB 3IFLL 3DIFA 5J1AB 1UJ3B 1IZJA 4XPGH 3NCEB 4JHZA 3WIIL 4OLWH 2VDRH 2FX8L 1XGTB 4I9WE 2Z4QB 3OKEB 3ESVF 3X3FL 5HGHB 3QDGA 4HIXL 3IJHB 4UT9L 1A3RH 2DQHH 1N3NB 1NCCH 1FN4B 3SOBH 3VXTA 4NQUA 3D3VD 2DJ4A 2EEAA 3HE6C 4Z7WB 1OPGH 4CMHC 1K4DB 2XTJC 5EH1A 5DMIL 1O7SA 1N59A 5DJ0B 1EDQA 2C26A 3MLUL 3IAPA 1LE9B 5FUOH 3HAEB 4NKDA 4S1DC 4IIQA 4JE4B 5IKCA 2E9WA 4U1SB 2B7DT 2WIIB 4ELKB 5T5FH 3B2UC 2YSSB 3GM0A 2HVKB 3QQ3A 3SGKA 1OPGL 5FYKD 5FYJD 3ES6A 3DURA 3FZUD 3RU8L 2ZOKA 4S2SA 1BVKA 1LE5A 4BZ2H 5C2BL 3H6JA 3G5VA 1TTUA 2ADFH 1SBSL 5E2WL 3PDDA 3DVNB 3UTTA 5AD0B 1RK1A 2QQNL 2OMNA 4HGKC 3QUZC 5K59F 3JVGA 2PW1B 3OKLA 2AJ3B 2VLLB 1JZ7A 2UY6A 5A2KH 3K2MC 4PRNA 4C83B 4Y8AA 2H6PA 2RIKA 2I9LA 5JR1H 3LN5B 3WUZA 3H9SE 2A1WL 5T33H 2BY3A 3HCVB 4ORGA 1IGTB 2LAAA 3REWA 4ODXA 1BREA 5TE6L 1OVZA 1H15B 2WBJB 5HDQH 1EGJL 1HQ4A 3NA4A 1KIUA 4PJAF 1MFDL 5DMJB 3NAAH 2WP3T 4WU5A 4K23H 2WV3A 4B41A 4OB5L 2ZCLH 3KJ4B 4HUXA 5MP6H 1GL4B 5C8JA 4LSVL 2FO4A 5D5ME 1WBXA 2YPLE 3BDYH 1S7VB 4DN3H 5DJ2B 3GHBH 5FFLA 1J1XL 2R1YA 1H5BB 3F58L 1E4KC 4DKEH 4TUOB 1JZ8A 1B2WH 3MNVA 2Q1EA 2WBJD 4NKQB 1A7OL 2QQLH 3WKML 1EERB 4PYGA 5FYLD 3L3HA 4JFZL 3DBXA 1A6WL 1N5YL 4X9GA 1IBGH 4NN7C 1PDKA 5FO7A 4NWTH 2L4OA 4ZUWB 2ZSVB 5IG7A 4Y16B 1ZA6A 4DN3L 5KJRL 5CUSH 5DTFB 5L0QB 3MNZA 4EUPG 4D9LL 5CEXB 4XX1E 4TVPE 1L0YA 4FXLA 4OCXH 2QADB 4RX4A 3VFSB 5ESAB 4JVUA 2P24A 4KTDH 3SE3C 1NANI 2NW2B 2B1HH 3TIEB 1AO7B 2YBRA 3O2VH 2E7MA 1IBGL 3NABH 3BGAA 1G84A 4YAQA 1KPVA 2EDKA 2X70B 1T1XB 4L29B 4PS4H 3GK8H 4LHUB 5E4EC 4XNQA 4U3XA 3BIKA 4Y16D 4UBDD 4EZMA 1CGSL 4PLOB 3VFNA 2Z8RA 4E41A 3Q3GB 4DW2L 3RGVB 1NBZA 3VWKB 5FUCE 2QADD 2F5BH 5B3NA 2VDQL 1CXFA 2WWMD 3O45B 1BFVH 3HZMA 3NABL 1JN6B 3DV6A 2D4FA 4D8PB 1AO7D 4YFEA 2Y7QA 3PL6C 2Z9TA 1RSFA 4Y4FC 3BWAB 1QBAA 3UTQB 1G9EA 1SJVA 4PJIE 1IT9L 1XGPB 1HYSD 2CH8A 2NY3C 3ZKNC 4LHUD 5EZLB 1T1YB 1XR9B 5DQDH 5I8CB 2Y07L 5LQBH 3EAKA 4R0LC 1D5ZA 1G7MA 3RGVD 2YUZA 3VWKD 1QYGH 4G6ML 1NMCB 1YYML 4JHAH 2GJ6E 1VGKA 1PG7L 3ARDA 3BN9D 4QRPE 2FYYB 4LAJH 3O6FC 1I1AC 3KPLA 4H25B 3E1F1 1N4XH 2JB6B 3RUGA 2CIKA 1A22B 2VLKA 5MEOA 2PXYC 5DQDL 2DQJH 4KHXL 1N0XH 4MXVF 1DQDL 4HZLA 3I6LE 3VFPA 5IHZB 3S3SA 3SKOB 2HFTA 5HHPB 1QACA 2ZG3A 4RMQA 1ETZA 2A2QT 4KK8D 4JY5L 4NN5C 5JZ7D 5B3JE 4OI7A 2VXVH 5C7XH 1TCRA 1WZ1H 4GLRH 2A9NL 3FHQA 5IVOA 1IL1A 5JLZB 2A74B 1EMTH 1R3HA 3QFJA 4YBQD 5DFVD 1LP9F 4G9DA 4OKVA 2DQJL 3JWOH 4NN6C 3HI5H 3S36L 5LWYL 1BD2E 4MJ5B 2FLBT 1VFUA 2J8UA 1H3PH 3QIUA 3ZDZE 3EW3B 1HXYA 4NFCA 5HYIA 3BP7A 3QIWA 1LO3H 2DWEB 4DAGH 2VXVL 3HAEG 5D1QB 1EK3A 4JM2F 3LIZL 1QR1B 1FC1A 3K2UH 5DD1L 2WINB 5A2IH 2R2EA 4OF0A 4QRSA 5GS0L 3TP4A 2DLGA 4M6ML 5DZLA 2GSIB 1JFQH 4XBGB 1LO2H 4YHZL 1GC1C 4LQFH 4TRPL 4JPVH 1NDMA 4XNZC 1Z5LB 1CICC 3MODL 3T2OA 1X5JA 3KWWB 3QEQE 1CZ8L 2IBBA 4PD4K 3MLSH 4AY0A 3DMMB 1GYAA 1T04B 2HJLA 1FQ9C 2IGFH 4WW1A 5D1QD 1CE1H 1UXWA 3F65A 1QSFB 1JNNL 3MLWH 2F15A 3UEZA 1CXEA 3GSVB 3EOYG 1ZVSB 2NX5A 4Y5YB 4R26L 5K9JH 1NEZA 3IDIA 4JG0H 4RMTA 5IEHB 4OD1H 4MJ4A 5EDXA 1FAIH 1JTOA 4F9LA 3BKCH 1YNTA 3WIFA 3KYKH 4DGYH 1V7ML 1LGVA 4X9IA 3DMMD 4W6YB 2NZ9D 1X5XA 4PJ7E 1QSFD 4G6AD 2VABA 2VXSH 3CH1A 4JFEE 2HFGH 4NDMA 2I07B 4IDLA 4JG0L 4HXAH 1IGJB 2OQJA 2OX5A 1DBJH 3OAYK 5JTWA 2EYSB 5HYEA 1Y18B 1ZHBA 5DJ6B 4QXGH 1MELA 2DN7A 4URTB 5SX4H 4AIZA 5D2NA 2D7QA 4GW5A 3VFUA 1NPUA 1W2KT 4MQXC 5EUKA 1DANU 1VFOA 2VXSL 1W0VA 3I50H 4Z76A 5E08L 3HI6H 2Y9RT 3LEVL 4DOHB 4MJIE 3HPLA 1YEGH 2IMNA 3UYPA 4C54A 1G7PB 5HBBA 2NTFA 2R0KH 1LNUA 4LCIH 4XP9L 2WMPA 3UAJC 2A6KB 4OLXL 1A0QH 1BZ7A 4KROC 2OS7A 1U8HA 4G8FB 2E8YA 3Q1SH 4HDIB 3B9KA 2ADJB 5TQ2H 2MPAH 4XHJC 1E6OH 4NKIH 3VFMB 4G9FE 1K8IB 1YEGL 4CAGA 3G08A 2X4OA 1F45A 4LHUG 3QA3A 3L7EA 4JANB 1MCSA 5F9WB 4LCIL 4K94L 2VN7A 3KHOA 1AKJA 5TE4H 1FGNL 3WNKA 3ZO0A 4KI5D 5IGXL 3WFDL 3RDTB 2VH5L 3LS4L 3OL2A 1UFUA 1I7TB 5GGSB 1KB9K 3LB6D 4LLQA 1GSMA 4EXKA 2X4NA 4KTEL 4RFEB 2XXCB 3H7BA 2JB5H 1T0NB 1LO4H 5E2VH 5SV3A 1I3RB 4M7LL 5J6GA 1MI5B 1RK0B 4P9HC 4CBPA 4KKLD 4R6UA 1H3UA 2NY4B 5EN2B 3T4YB 1NAKH 4EUPH 3C6SA 3NBNA 4MWFB 1HSBA 5H2BB 1TNMA 1ZLVK 3K0WA 5IVNA 2HKFL 3EO9L 3WHE1 3Q0HA 4XH2B 4CU8A 3OKNA 1KJ2H 4ZUVB 3RDTD 4QNPF 1WEJH 4M00A 2Q76A 5B8CB 1LO4L 4F7CA 4HUUB 1XF3B 2DM2A 1NBVH 2H3NB 1RJLA 3OQ3B 4FZEH 5DHVH 1VGEL 3MRMA 5KS9A 1A6VH 2VITB 2QHRL 4ZFZB 1OT1A 4DUXA 4YHML 2HG5B 1NAKL 3VXSB 3CLEL 1MI5D 5L9DL 4G42B 5DS8A 3HNSL 4HAFA 4IM8A 2Q86A 1QLRB 5E6YA 1H3WM 2NY4D 2CQVA 2BHUA 1GZPA 1MJUL 1E27B 1MCPH 3U2SB 1WC7B 1A1MB 3HUJA 3F7VB 5IW6A 5E1HB 5E8DL 5DYOA 2BSRB 1NBVL 4OIIH 1X4YA 1R5WB 1WQVT 4PJFF 1GIGL 4NCC1 2MCPL 3C87A 1UYWL 2BNRB 3BZFA 1JYNA 3MC0A 2R23B 1FFPA 2NY7L 1MFAH 3SE9L 1S5IL 3VXSD 3G5YB 3QUKA 3ET9F 1NCNA 1IC1A 1NGPH 1JNLH 1BJ1H 4O4YH 3PGFL 4FQJL 4GBXA 3HPJA 4P23C 2GUOA 4WFHE 5D2LB 1AP2A 3OJMB 1Q1JL 1IKNA 5IR1B 5IFAL 2BSTB 3R4DA 4ZO8A 3QUYC 2HTKD 1A02N 2JK5A 1FYTB 1Q9WA 3MFFB 1NC2B 4L1DA 2BNRD 4YNYA 4OLYH 1FJ1B 4O2EB 1JF1A 2ARJA 1NGPL 4N0UB 5BZWA 3TNNB 2XV6B 4X4YB 4LVNB 2Z31A 3NCYP 3QNYA 1Q9OA 5I0ZA 3HC4L 5GRVK 1VB9A 2C4XA 4OZFB 2EXWC 4LDOB 3M8OL 1Z9MA 4GKSA 4F3FA 3OTTA 5L2KA 4PGCB 5C0CE 3RHWK 2DMCA 1HIML 3EJZD 1R5VB 3OJDA 1MCLA 5HDBF 5FYKH 1S7WA 4PJEF 4N5ED 5FYJH 5F1NA 1ACZA 1FYTD 1JGLL 1NC2D 1LP9B 4MX7B 4LDLB 3BUTA 1DUZB 3OGCA 4CU6A 3SDXA 2EDYA 1A1OB 5CJ5A 3PV6B 2WM0A 4NUJB 5JPMA 1LD9A 1JHKH 3NACL 3NCJH 3I75B 1FDLL 1IQDA 1JPGB 4NM4L 5HGAB 3WS6A 4Y89A 5EUOF 5DRWB 3WV0A 4EN3A 4AENA 3K4DA 3QBTB 2ADGA 1YEIL 5GSVA 2EE3A 2DM3A 2C9AA 1YEJH 3T4AB 1GCFA 2DYPA 4UI2A 3TWCL 4MJ6A 4CMHB 4ETQB 15C8H 3MRIB 4GG6F 1GRWA 5I16A 4P5KA 1I1FB 4M43H 2P1YA 1JK8B 3MLVH 2PO6C 1NC4A 4EBQL 2R0WH 3O3AB 4UNVA 4ODHH 3NCCB 1WTLA 4HIHB 4KRPC 1NLDL 4ALAL 4BKLA 1GOFA 4R7NA 4NNYB 2B0SL 1AQKH 4RGOH 3AAZB 1G9NC 3FRPA 3WNMA 4WDIB 3MZTA 2DQTH 4M4PA 3BKJL 5I30L 1S9VB 3C5JB 3G6DL 4JDTH 4LKXA 5D9SA 3ZHDA 2EDRA 4F7TB 4R4NC 5C86A 1MHHB 1QD0A 1N26A 3TBSB 4H88L 4S1DD 3MJ8B 1A6TA 4TSAL 4B5EA 5ID1B 1AQKL 2X09A 3O3BB 4JZOA 4JPIB 3B2UD 3QHTC 4QHMB 2XWTB 5I15L 1S7RB 4NO2A 5HYQA 1D5IL 2JIXA 4L9LA 4M6OH 4QTHB 1HINH 4YE4L 5D70L 3JTSB 3LKQA 3UTSB 2CK2A 5I17B 1AGEA 1WBYA 1WFTA 4LPXA 5IP4A 5FYLL 3PWJB 2IAMA 4NRZA 1QZ1A 3MACL 4XP1H 1FG9C 4CADB 1R3JA 3T2NH 4G8IA 4IRJC 1MVUB 4LLUB 1U3HC 5ILTH 4H1LH 3KPNB 4ODUB 1UB6B 3RVUC 1GPOL 4PGBB 3MGOB 2I5YL 4YDKH 4LCWB 4U1KB 5GJSL 5J13C 1U36A 4JJ5A 1OGAB 3PWNB 4Z7UF 3UTSD 4UQ3A 3MBEC 2NXZC 2R2BA 2JJTA 4U1HB 3OKKA 1KCVH 4NO5A 5D8JH 5MERB 3TVMA 2P5WE 3B3IA 4XCFH 3GUTB 3MJ7B 2UYLB 2ZUYA 5I1HH 5ILTL 1T0MA 5CBAA 3DOSA 4G6JH 4DUWA 2BXYA 3FOMB 5ADPL 4NO3B 4U31A 3T77A 3VGHA 2V9TA 4JFYB 3VA6A 4FABH 4ZTPH 3OX8A 4FQQA 4FQLL 4QNPE 4LCWD 4X8JA 1NQBA 4PIRF 5C0AB 1L9NA 1OGAD 3CMGA 2GITB 2XZQL 1EV2E 4XVUC 4DTGH 5FA4A 4XCFL 2GY5A 3DX7B 1P53A 3SJVA 4ONGL 3SPVA 5HYJA 2BVQB 1EO5A 3O6LH 1GGCH 2NY5H 3FT4A 3P4NA 1BHGA 4WENB 3ZL4H 1SYSA 1J05B 4UAOC 1CK0H 4OAWB 5J8OA 5EPMB 3HR6A 1MJ7L 3O6KL 5CEZH 3EZ8A 3S88L 4X7TB 4YK4C 1QPPA 3TH4T 5DMGC 2BJML 1C1EL 3CXDL 4DTGL 1G7HB 1QBLL 3NCBB 1DL7H 4S1QL 5C0AD 1KT2A 4RWYL 1EJ6A 3PL6B 3DUUA 4Y4FB 2G9HA 1RUQH 2NY5L 3U0PB 1KJ2A 5HY9A 2X44D 1P4IH 1A6PA 2ATKB 2W9EH 3HN3A 25C8H 2NY3B 1IJ9A 2DKUA 4P2RB 3FCTB 1J8HB 3QHFH 4Y4HA 3MRGA 2X4PB 4R0LB 3DI3B 5F9JB 3F7YA 3VCLA 3CU7A 3VXNA 5F3BA 2V5MA 2CRYA 3LOWA 2R69H 4H8WC 3L3DB 4OZFG 1UCBH 4L4VE 1HHGB 3VFVB 4IHOA 3VE0B 5EA0H 4WJ5A 4Z5RA 3O6FB 4XNMA 3GO1L 1I1AB 4ZS6D 5ETUA 1ZLWH 3VXRE 1Z9SA 5FUCC 3PL6D 5HHOB 5I74C 1MUJA 4OZIF 4N9OB 2PXYB 4Y4FD 5IT2H 1ED3A 1KXVC 4PJFB 4QXTB 3GBNH 3WD5H 2NY3D 3ZKND 4P2RD 3KHQA 4R3SA 3GMMA 3LHPL 5D7IE 4NN5B 5EFIA 3MR9B 3ZDXE 3MXVL 1UKTA 1UCBL 3CSYB 1X5AA 1H3GA 1WGOA 2YR3A 4HF5L 3QCUL 3DUHA 4MNGA 1C08B 4E42A 1JE6A 4O9HL 1EHLL 4M61B 4LLYB 1IRAY 1F3DH 3CCHB 2VL5B 4PG2C 5CAYB 4KK9C 3ALPA 3O6FD 1I1AD 2EIDA 4NN6B 2FD6H 5HHOD 2DTSA 5MEPB 2PXYD 1ZHKB 2KUTA 4WRLA 4LVOC 4XNYH 3ZE1E 1AD9B 4WFEE 1JPSH 2GCYA 4GRLC 4WW2F 4X5WA 4YWGL 2P7TA 1MWAB 4CUCA 2CUHA 2FDBP 3ARBA 2A6IB 1IC4L 3GMLA 1M6OB 4X4MA 2EE2A 3AS3A 2FLRT 1X3DA 3TPUB 3B2VH 5JW5A 4XMLH 4KPHH 1DP0A 3T65B 1QVOA 4GG6E 2FD6L 1QFWH 1UENA 2ZG1A 4NO0B 3PP3K 5CIPB 3NIGF 5KSAA 5C0JA 1D3CA 1C16B 4XNYL 2GJZA 1NGWA 5D7LA 4F2MB 2V2WB 5BQ7A 4XNZB 1ZHNA 1U8JA 4ZD3H 4OZGF 2WANA 5F1IB 4O51B 3LD8C 3HZVB 5B39B 4U33A 2UZIL 3K4ZA 3QRGH 1EFXA 2XRAH 4U2ZA 2YD1A 1NCBL 3BEVB 5A43C 4GSDH 3SKMA 3QIBB 2OZ4L 4J3SA 4LCYA 5DUMH 1ZT1B 2QR0B 5DJCA 5EUOB 5EZIH 3TIDA 2VDPH 3RPIB 4NO0D 4XP4L 5MENB 1HDMA 3RJQB 4ZD3L 3KJ6L 4KMTL 5MI0C 1MCWW 2FIKA 2R0ZL 1MFEL 2AK1H 1CG9A 5GXBB 3GBMH 3TO4A 3M07A 5F9OL 2HLFC 4JQXC 3WIHH 3TJHC 2X05A 4KAQL 3K46A 4OT1L 3FB7B 1CFNB 35C8H 5BV7C 3MROA 1J18A 4NC2B 2E9BA 4NHCH 5EIIA 1OB1B 2J12B 3LSOA 1M05A 3GKWH 3DUSB 2V7HA 4ELMF 3MUJA 4OLUH 5F3HA 3TYFB 1RHFA 4JQVC 4NJAL 1I7ZA 3QZWB 1RV6X 4NJ9H 3TC9A 2BP3A 1P1ZA 4LSSL 4S10A 1MCDA 1Q8MA 3WFHB 1PLGL 3SKUD 1YJDL 5HYSB 4DCQA 3LV3B 1YMHA 2X1WL 2ITDB 4PG9B 2W9LA 2V5RA 4NHCL 3U6RB 3C9NA 1NFDF 3U4EA 3NA9H 2Q8BH 1BQHA 2W07A 4GJTB 3WJLC 2HJFB 5IV2A 4NJ9L 4KKCC 2BK8A 4KROB 1HKLH 1N64H 3PIQB 5C9JA 4NZRH 1C7TA 1DQQA 5C0RH 4MQXD 4Z0XA 5EC1A 4OCLC 5MEQB 3FO0H 1FHGA 1LK3H 2YC1A 1KEGH 1TENA 1JRHH 3SQOH 4N90D 1NDGA 2UWEB 1JNHA 2FB4H 5EB9A 5ESVA 1DVFC 3BP5B 3SY0B 4HIEB 5J6HA 1U3YA 1KELH 4N8CH 2DKMA 1HKLL 1FNSL 4IOFC 3UAJD 4I0PB 1PKQE 2CXGA 2V17L 5C0RL 1B6DA 4H1LA 4KROD 3ARPA 3F7PC 4HKJA 1N8ZB 4MB5A 5HVHC 1KEGL 1J5OH 4XPFH 4GG8B 4Z7UB 1A9BA 4UU9B 3QWOB 3RAJH 4XHJD 3SE4C 2JCCA 5DRXB 3CX2A 4RA3A 4RGMC 4K8RH 1RIUH 1IC7L 4L3AA 1RZJH 2FJFA 4UQ2B 1I9IL 4P46C 3QO0A 4JRYA 3GKZA 3KPPA 4WWID 1KOAA 3OXRA 5EC2A 2ORBL 3IXAB 4WU7B 1CFQA 3C5ZC 1KTDA 3HR5B 4I0PD 1YEHL 1OTSD 5FHBH 5I1IH 3QEGH 3IU3A 3ESUF 2BVPA 3K7UA 4XWGH 2CIIA 2IANB 4X80H 4JZNA 5I8OL 2ZOLB 3BP6A 2BRRL 2VZOA 3G6JB 1U8LB 2W65A 4PJXA 4DQOH 1PY4A 4OLVL 5L6YL 2QEJA 4P2OA 1YYLL 1VA9A 4Y0GA 3BGMA 3L3KA 4KVNL 5I1IL 2ILLA 4HH9A 2E7HA 5DLMH 2FH8A 2QHLA 4YO0B 3GMQB 2DM4A 5C0DA 4G7YH 2IAND 3CDGB 3RWHA 3S97C 4R2GC 5T3ZE 3ARQA 1OTUC 1KB5A 4ZNEA 4X7CC 3D6GA 4GUPA 4ZAKB 2HLAA 5DEFA 2J8OA 1A6AA 4YC2C 4H0GA 2GHWB 4PB0H 3DX6A 3KYAA 3S96B 4R97C 7FABL 5HGBB 3NFSH 2VSCA 4TTGA 4OCNC 5DLML 1KXTB 2OL3B 1LEGB 1JGVH 4J8RA 5L7XH 2VLKE 4OZFH 1UEMA 4C56B 3KPSB 4ZPTA 1KPRA 4DK3A 3FRUB 2AGJH 1HHKB 2C3XA 3ULUF 3VXUE 1JL8A 1WSST 4PJHA 3V0WL 2VISB 1WLHA 1NJ9B 5DZOA 5JHDB 1NAMB 4B53A 1BOYA 3GIVB 5JUEL 1I9JH 4ZAKD 1MRFL 3UBXA 3V4VH 2A6JB 1B0WA 2CMRH 5L7XL 2MSPA 3C2AL 5EU3A 1M71A 3RTQB 3HC3L 4MDJA 5DK0B 3HTLX 1F6AB 3MRKA 4BA8A 5CJQH 5ADOH 2FIRT 5SWZB 2J8UE 5DJYA 4GKNB 5IJVA 4NNXA 4WEBL 5GS1A 4KVCL 1S7SB 1INEH 4C56D 3KPSD 5F6HJ 3UYOD 1F4XH 3PXHA 4XXCA 2EZ0C 1I9JL 5CHNB 3V6FA 5JHDD 3P4OA 2AV7A 4YX2L 3U4AA 2F8XC 4WO4A 4W68A 2G2RB 5JOFB 4NSKA 4WW2B 1REIA 2EXWD 1B0GA 4RAVA 3RTQD 5DQJA 1MRDH 2HFEA 3AXLB 4KQ3L 5SWZD 1RURH 3HI1A 4HK0A 4QCIA 4JFXB 3P9MB 2B39A 1F2XK 2BC4B 1RFDL 4FXGB 4AL8L 4JN2B 3FT3B 3WYRA 5IROC 1RZ7L 5EBLA 2J2ZA 3FO9A 5C3TA 2PO6B 4QO1A 2XZZA 3QZWG 4MLSA 4RZCA 4LP5A 2YD3A 3C8KA 1RU9H 2E6JA 3C6LB 1NFKA 4PLKC 4OZGB 4F37F 5HYSG 4KRPB 5MHSD 1BIHA 2J6EH 2BNQA 1AY1H 3I2CH 1D6EB 4GXVL 4NT6A 3CDFA 3HG1B 1Q9LA 2V2XB 5C0BA 2O93L 3GSQA 2NCMA 5DK2B 4XCEA 2D7TH 4DZ8B 1UGNA 5HGGS 5D96C 3O41B 1KLUB 2GFBB 3W2DH 1DE4B 2PO6D 5D72H 1RU9L 2AW2A 2MQCA 43CAA 2ARJQ 1S78C 3DX8B 4HUNB 2CGRH 3C6LD 4OSUH 1J87A 4KRPD 3WO4B 3B4NA 3DYMA 4FP8H 1AXTH 3WDIA 1RPQA 3DTXA 3W39A 4N0CC 2VLRE 3QJFB 4RFNC 1YEDA 3LRSA 4JGUA 3HG1D 1XGRB 4IOIA 3FB6A 3BT2L 5TQ0H 5FGBA 1Q0XL 3CMOH 1YQVH 3W2DL 5JIPA 4ELMB 3T08A 4LSUH 3ZTJH 4R4ND 1RZKL 3KPOB 3RL1A 4NOBA 3GRWL 5GISH 4L3EA 1NSNH 3O0RL 4OGXL 3L5XL 3U1SL 1CLOL 4X6FB 4EI5B 2HJKA 3WLWC 4ZUTB 4J6RL 1P2CA 1UQSA 5LGHH 5CINL 4IRZL 3WUWB 3CXHJ 3EFDH 4IRJB 5IMKA 4YHPB 3T8XA 4CDGC 3LY6A 1U3HB 2OK0L 4TPRL 3BVNB 4EVNB 3VFOB 5GS2D 3EOTH 4RFOH 2V9QA 1NFDB 5I1EL 4W4OA 2DIBA 2GTZB 5IOPA 2VOTA 4KZDH 3IDMB 5J13B 4YDJB 4XPTH 5GISL 3EO0B 3L9RB 2NXZB 3TA3A 1BWMA 4QRQA 1X5YA 4GW1A 3DVGB 4F33A 4EI5D 1CE6B 3GMRA 2NLJB 1I3GL 1T21A 3DX9B 1O0VA 1K5NA 4JFHE 1D5XA 4XPHL 3ARGA 4IRJD 3RFZC 1QKZL 5IK3A 4M1GH 1U3HD 5D1ZA 3QG7H 3RVUD 2YPLB 4OGYH 3U4BL 3SDCC 1YMMA 3QUMA 4Q9CA 1NCWH 3DNKA 5JORA 1FPTL 3MREB 3U30C 1WAAF 1R3KA 1T20B 5JOPE 3MBED 2NXZD 1NLBH 1HHIB 3GSUA 1INQA 1R3IH 3BZ4B 3MA7A 3X12B 3G5ZB 2FO1A 1PGRB 4M62L 3FKUS 4TQEH 5AUMB 4NRXA 3SE8L 3MX0A 5J0BA 2R8SL 4QHNB 3DRQB 4M1GL 2VJXA 3VFTB 4UAOB 4HWBA 4MVBC 1KBGH 2L0DA 1I8KA 3RWEB 5DD3H 1P6AB 3N85L 4YFLF 1G0DA 4YK4B 1RUMH 1NCWL 3GSXB 2YPLD 1NLBL 1QFUL 3R06A 4WI7A 5DRNA 4XVUD 3U82B 3AS1A 2KBGA 2R56L 2Q87A 1C12A 4P3CH 3RA7L 3TT3H 2X4RB 1KBGL 1KIRB 4D94A 5C0FB 4X98A 1I1YB 4PTTB 5J9PA 2CLVB 3N1QC 5I71B 5JXEA 1N7ML 1BX2B 1CGWA 3QNZA 5DMGD 3MRFB 3FJTA 4C57C 3KDMA 4LSTH 3T0AA 1X5IA 4PRIA 1S7QA 1HHJB 3ULUE 1T5XA 5I74B 4Y2DB 3KPRE 3ZE2F 2X5PA 1DEEA 1PYWA 1FRGH 3RJDA 3RKDC 3HLAB 3S35H 1KLGA 1MF2L 1A7PL 2AXGB 4JHWH 2P42B 1MCKA 3ZZ1A 1XCQA 1LEIA 5FB8A 2LU7A 4YBHA 1MWAH 3D1MC 4XAKE 5FUZH 4LSTL 4BSJA 2YD4A 4A6YL 1FNGB 5IBTL 3PWUA 2XICA 3SGJC 1FCGA 2WWKO 1FE8L 3LRGA 4YLQT 1C5BH 3MRCA 1KYOJ 1VFAB 2PYEB 3UBXI 4K3GA 4OV5B 4LVOB 5ANMA 3NCMA 4FFYL 2PKDA 1R5IA 5EBMA 3S37L 3PQYB 1YN6B 4GRLB 4NP4L 5LAXA 5L2KE 2CR3A 1S8DB 2Y36H 4BH8B 5DDHB 5GGRB 5DD6A 2Z93A 1KACB 5DSCB 2AKRA 1TVBA 1HI6A 2P43B 4LNRB 3BI9X 1NUFA 4HULB 3T3MF 1EJOH 2VAAB 3UJJL 3IETB 5GJTL 4WY7L 3EDJA 4KK9D 1SJHB 3MRDA 4UOJA 5CMAA 4GT7A 3OAZK 1GC1L 3TBWA 2PYED 4KUCF 1YEFH 4WCYH 8FABA 3SO3C 2BHZA 3ZKMC 2DQDH 3KXFA 5DJXB 3QRFM 2XZAH 1JI1A 3PQYD 4GRLD 2F5AH 3PJSA 1UXSB 4YDVB 2AJZA 5FV1L 3FQTA 3HE6A 3LD8B 3IVKA 4U6YB 1BD2B 2FATH 2VR9A 3OPZH 5F6IC 3BSZH 2HFFB 3I6LD 1TPXC 1NBQA 2DJSA 3MQIA 5J7CC 1QFWI 5IVZA 1F11B 2PW2B 1I8IA 4UIKH 4RCAA 5HHQA 5I1CH 2PN5A 4WCYL 1WV7T 3B5TA 4NZTH 4PRPA 5MI0B 4LSPH 5DRZA 1OSZA 4H26A 1U8OA 2FX7L 1TCMA 3OPZL 1MPAL 5EZJA 4L8DA 3ULSA 1BD2D 3MRJA 4AH2B 3ARXA 4YZFF 3O4LA 4PY8J 2APFA 32C2B 5CS7A 5BV7B 3QEQB 3WUWG 5ICZA 2CDGB 1P4BH 1MQKH 1FO0H 1U8MB 4OD3L 2J6EA 2RHEA 3GSRA 4EKXA 3DGCR 4OF5A 1SM3H 1KGCD 1Z3GH 5KSUB 1EEYB 5CJ8A 2G75A 3BKYL 5GRXG 3TJEH 3TJHD 2DLIA 4IIQC 1EGJA 3P2TA 2PYFA 3NIFF 1HKFA 3PG2A 2VIRA 3QEQD 2FBJL 3SGKC 5IF0A 4M7JL 3MNWB 4L8BA 4JO4H 1BQLH 3MV7A 4JFEB 5CZVL 4M7KH 3LQAC 5TH2B 5DGRA 4PGEA 1TZGL 1ZA3A 2PR4L 4YHIA 5FKAB 2ZWLT 4E0RA 2HKHH 1S9XB 1X9QA 2VZTA 3O9WA 4YPJA 3FN0L 4O00A 3WEXA 1MH5A 1VPOH 3N9GL 3JTTA 4YGAB 3FB5B 3JVGC 2H32B 1TJGH 2H8PB 1NMBL 2MOVA 5TF0A 3L3OB 1LHZA 1N6QH 2EXYC 4N8VB 1RZIA 3S4SA 1DVFB 2DBLH 2EC9U 2C7UB 1YECH 1IILE 1OAQH 4LLDB 4MNQA 4PY8I 4KKCD 4JFED 5JOEA 2CLZA 4DZBB 5CP7B 1VEOA 3PXJA 1AGBB 4F8QA 3DRTB 2CKBH 1A5FH 4GAJH 2F74B 5IFJB 4JKKA 4R7DA 2OTWA 5JO5B 1CGTA 4DKAA 4RRPA 1TJGL 4POUB 4D0BA 3UJTH 1JRHI 4G7VH 1VACB 2X9WA 4CW1B 1AIFA 2AEQH 4RGMB 4U2YA 1EZVX 4P9HL 2QSCL 4JRXE 1BBJA 3HFMH 3AUVA 1DVFD 4P46B 1JGDB 5IMOA 2NW3B 3GB7B 5E5UB 3GI8L 2V2TB 1OSPH 1DN2A 3I6KB 3MLYH 4IOFD 3C5ZB 5CD5D 1FZMA 1YNLL 3FO1A 3RX8A 5HYJE 4MJID 1DQTA 3MJ9L 4P4RA 3RVVD 1C7SA 5E2UL 3H9ZA 1X6LA 2MHAB 1ZSDB 1G6VK 3V5KB 3BE1H 4FQCH 3RY5A 3V8CA 4AZ8A 4PREA 3GI9L 4UILL 4UT6L 5IESH 1NGYB 4U1JB 3SQBA 3V6BR 5C08A 3GMPA 3MLYL 4M7ZC 5E5RB 4N0FA 4P46D 5KOVC 5IB4A 4P5MB 3PHOB 3TO2B 5C09A 1MHEB 3C5ZD 2E27H 1T1WA 1ERNA 1QFWM 1RJZB 2SEBA 5KANI 1TJIH 2OL3H 1L7TH 4PUBL 1TVHA 1IM3B 4ODVH 3QQ4A 1LDPH 4FQCL 4U1IB 4R2GB 5TJWK 4EDXA 3OHXB 1UKSA 4GMTH 4XC3H 1OAYH 1WBZB 2VXUL 1WZMA 4Z8FH 4LIQL 2A9ML 4LAQL 4BSWB 4PP2B 4PJ9A 3L5JA 4R97B 4LP4A 2BFVH 2D7PA 1U93A 4PJBA 1MIMH 3LH2H 4ODVL 4N9GB 5C0ND 5CP3H 2X1QA 4LF3B 1DLFH 4CRPA 4HKBA 1S7XA 5DJDB 3W9DB 5GGQH 1H3TA 2VERN 4RAHA 3WJJA 4R2GD 1OTUD 3KYOB 4JFDE 1UWXK 1UACH 4ZS7H 1NAML 1JMZA 4MNGE 4D0CB 5JMRA 4PY7B 5I73C 1ZS8A 4Y5VA 1Q72L 1ZKAA 4QY8A 4UT7H 4RMRA 1BZ9B 3T3ME 5C70A 4YIQA 1Q9KA 4MCYB 4HMDA 2DLEA 3RWFB 2CPCA 3MRQA 2VXTL 3ARDC 4LMQE 4IMKC 3KLHD 4XGZB 2DTMH 3QR2A 5GRVL 1W8NA 2X1PA 4ODTL 5KW9H 4PGZA 4U4BA 4OFVA 1I9EA 3RP1A 1QSEE 3M1BA 1HHHA 5CWSB 5L2JA 3I9GH 3LN4A 4O58L 1IC5L 1U95A 4UZGA 1MSPA 3S7GA 2FR4A 1ZT7B 5DEGB 3WL9A 2LV4A 4I3RH 1WCBB 4CVUA 2CO6B 4F8TA 3DSNA 5KVGL 4OJFL 5D7LE 5JNYA 1XT5A 5JA8B 5EU6B 2YEZA 3U7WL 4XVTL 1JHLH 4X6DF 3N1GC 1KLFA 5INCB 2VQTA 1G9NH 4NCDA 4UDTA 4NQVB 4OM1H 1AGFB 1FFQA 5LGJB 3QIUC 4RGNC 4NC1E 4ERSL 4OM0L 3QIWC 5DJZB 1MJJA 5E9DB 2QLVB 2BVOB 2ESVA 5IMMB 1G7LB 2K7QA 5T1LB 2RGSA 1JHLL 3DWTA 5IIEB 3EOBB 3MBXL 1FNFA 4Z7VF 4PJ5E 5EU6D 5TPWH 3T2PA 2WQ8A 4HUVB 4YJZL 1S7UB 5GS2H 1RD6A 3BDBA 3FQUB 5H94A 4AMKL 4RDQF 3P9LA 3NGBC 1KCUL 1GGUA 2P49B 3LMJH 1NGXA 1NBYA 4WI6A 4Y1AB 4U1LA 1G6RB 1V3KA 1JF5A 4PLKD 4K7FA 2F19L 5E9DD 3NIFE 2A0LD 5GZNC 4NRYB 1VADA 2X4SB 4BFBD 5T1LD 4HGWA 3UDWA 1N2RB 3GSNL 4RFNB 4JGMA 3MRNA 4N8VG 4UUJA 4YXKH 5KVDL 3HC0A 4OCMC 3WNOA 1FFOB 3DROA 5IEKB 4HKXB 3S98A 2DQCH 2Q6WB 4WFGD 2FECL 3QCTH 4F9LC 2GAZB 4JDZB 2B5IC 2E6PA 1S78D 4CJ0A 1U41A 4Y1AD 3WE6B 2O5ZH 3LKPA 1OOAA 4JFFA 1LDSA 2EIZA 2DQFA 3MV8A 2CXKA 4XCYA 3MRPA 3INUH 2J1KA 5ITBH 1YEEL 3VXMA 2E5EA 2XN9A 4N0CD 5DVNA 1T7ZA 4NQCE 1GZQB 1IGCH 4HS3A 2ZSWB 3KYNB 1R24A 1I7UB 2IH1A 3IB4A 3T0WA 2CLRA 1PY9A 2ZUQB 4NQDA 3REVB 3FOLB 3RWIB 1CR9H 2W60B 3X14A 4UNUA 5D2NC 5E4IA 3LEXB 1KULA 5C0GA 4EEEA 3WLWD 4XVJH 3L95B 4OQTH 5ITBL 1BF2A 4LRNH 4HFWB 3QXWA 3PWPA 5EO9A 3MOBH 3RWCB 3S35X 4XB7A 1RJYB 4KUZL 5I0DA 1U8PB 5T1MB 4OZHF 5GZOC 3SDCB 5HXMA 1WVZA 3OKDB 3U30B 1OTTD 2XA3A 1AFVH 3B9KC 4W4NA 4XAWH 1I7RA 1QQDA 4TVPH 5F97E 2QKIB 2CKBA 2V5TA 4P59L 2OXGA 3L5WB 4JR9H 3VU2A 4H20L 5KG9B 1BLNB 1F8TL 4ZFOB 1YNKL 2LQRA 3PGCB 2QSVA 5INDB 4NQEB 3AFLA 3OZ9L 4TN9A 3DPBA 3SDCD 1AFVL 1O7VA 1MRCL 2DL2A 6FABL 2YPKB 3P30H 5KVFL 1IARB 4H8WH 2IPTL 3BXNB 3D2UA 4JM4H 2X6MA 4WUKH 4NBZB 3TNMB 5F7DA 3K3QA 2AS5M 2BCKB 3BPCB 3CFDB 5GRUH 4WTZA 4B0MM 1T4KA 1E4JA 4FFWC 4MVBD 3A0OA 2C3VB 4NQED 4WEUD 4NM8L 1ZT4A 4OLZH 5GGVL 4X7SH 2A38A 1JGEB 1SYVA 2YD7A 3EFFB 1U8KA 3FFCA 4XZUA 4OFYD 2BVTA 3L6FB 4TUKL 2HWZH 4M9PA 4NPYA 3E6FB 1BFOB 1WFUA 3RY6C 3TT1H 4P23A 2WUBL 3T0EA 3RI5K 1JPST 2VZUA 2H1PH 2VC2L 4AEEA 3BISA 5E5MB 4HWEL 3QUYA 1TJHL 5E8OB 3CFBA 4P4KB 4MD0B 2B20A 3MV9B 2GK0A 1RUAL 1HH9B 3WSQL 2E7CA 3WDHA 3GNMH 5DD0L 1HSAB 1PSKH 3RUGF 3IF1B 3UZVB 1A8JH 4GO6B 1M7DB 2WLZA 1DFBH 3OKMB 4OF8A 5TDPB 1ADQH 3V4UH 2PTVA 2YD8A 3SO5A 3MLZH 3RKDD 5FO8B 4R4BA 3IFPB 5ISZA 5I18H 3P77B 4PJGE 1YC8A 1MCQA 3HZYB 2ED8A 1MFCH 3QDAA 3H0TB 4GBXC 3MV9D 1CLZH 4PV8B 1PSKL 1UJ3A 4NFBA 3U9UA 5D7IB 3MMEA 1IKNC 2UZXB 3Q2CA 5IVXB 5HPMB 3RVXC 1ADQL 1A4JA 4MSWB 1OF2B 3CFEB 3ZTNH 3LKOB 5FKPB 1A3LH 2HN7A 4FHBD 1MCEA 3WHXA 3QULA 4HC1H 1KJMA 3SO3B 1EFQA 3ARUA 4JREB 5EOCH 4G43A 3EKCA 5EOTB 4Z7WA 3SDYH 1MFCL 2Z31C 3U79A 2FJHA 1K4DA 5F6IB 5E8NA 1U2CA 5BVPL 4YR6B 3NFNA 4KZEH 4YGVB 1HQRB 4LEOA 4PJCA 3NZHH 4ZUSB 2N1KA 1D6VH 1IKFL 3ZTNL 4IMLB 5BV7H 4BFIB 1OLZA 1F02I 4L5FL 2APWA 5SWSA 2ICES 3KPQA 5J12C 2LABA 1CGXA 2YXMA 3DIFB 4O02H 1BM3L 3ZKMD 3QEUA 1IGML 1A7QL 5F7MC 3ULVE 2BNQE 4F58L 5ALBH 2FWOA 1V3JA 3ALXA 5DR5H 4DKFL 3QDGB 3F62A 2OXHA 1Q0YL 3VXTB 5FGCB 5IB2B 4POYA 2FX9H 2YKLL 2P47B 2PW1A 4Z7VB 1N59B 1S7TA 5SV4A 3TN0A 2F58L 1S9YA 5J06A 3MCLL 1KXQE 4NKDB 3H42L 3ILQC 1JPFA 4LLAA 4IIQB 3P11H 4HQQH 3VGBA 4JO1H 1F3RB 1MNUH 3WFEH 4TNWK 1YEKL 3QDGD 4YUEH 3MXWL 3VXPA 3QQ3B 2GQHA 2H32H 3BWUC 2O5YL 4QRRA 4YHOL 3ES6B 1NKOA 4L3EE 2ZOKB 1F90L 4S2SB 1BVKB 1JUFA 1LE5B 1LEKA 1OARH 2X4QA 3G5VB 3H9YA 4Z0BH 5EO0A 4XMKL 1B0RA 3UTTB 1CDCA 4LKCB 4M5ZL 4PR5A 4X4ZA 1RK1B 3CK0L 3VGEA 1FCCA 3WFEL 1T3FA 3K81A 4GRWB 3V6ZA 1JMXA 3ZLQC 3OKLB 4ODSL 2WLYA 4YBLB 1A6ZA 1DQML 4MYWB 5T3XE 4PRNB 1EUUA 2H6PB 4OIAA 3H9SA 5J11C 4WHYH 2I9LB 4OZHE 3SEPA 4WI3A 4PJDF 5JDSA 2WUCH 2HAZA 1JYWA 4L9LC 3REWB 4ZUWA 4ODXB 1LO5B 1FFNB 1HQ4B 2P8LA 4JPWL 3WLBA 3QHZH 1WWWX 2OTUA 5FEBA 4WU5B 4FG6C 3UTTD 2DQUL 5D5MA 4G6FB 4HUXB 3VFSA 5A40E 2IAMC 5C8JB 1VFMA 2FO4B 1QNZH 4P3DA 1WBXB 1GJIA 1EH9A 4I18A 5I1JL 2DBJA 1YMME 3VW3H 2EXYD 1KTKE 2D0FA 4XTRC 5CZXD 2LU4A 1CS6A 1CU4L 3D39A 3O3DB 4YXHH 2DLTA 5ACLA 4DN4L 5K33A 2X70A 2R1YB 4HWZA 3TH3T 4L29A 1CFTA 1RVFL 4HG4J 4IEFB 5TDNA 4UOW0 1UH4A 1VDGA 4DZBA 2X1XR 2Z35A 3L3HB 1DDHA 3DO3A 2JJTC 3V52L 3DBXB 4F57H 4FQHA 3TVMC 4JG1H 4NOFA 4G6FD 5FO7B 1C5DA 2XA8L 5IG7B 3VMNA 1ZA6B 4JQIH 4B50A 3MNZB 5CGYC 3BD5A 2R9HC 1RMFL 5GGTH 4M7ZB 4M6NH 2DAVA 1KJ3L 4HJJL 1B4JL 1WIPA 4RIRA 2P24B 1XH3A 4Y8DC 1LWRA 2IG2L 1A7NH 1ZTXL 1YQ2A 2YBRB 4TYUA 3LKSB 4HX1B 5KS9F 3IDXL 1EO8H 3BOVA 2GIYA 3E6HA 1KPVB 1DBKH 4HFUL 1QOKA 4J1UA 1E28A 4XNQB 2ZCHH 2OLDA 3BIKB 1K3IA 3S5LG 3RI5F 4KQ4L 3VFNB 4E41B 5DVLA 3W11C 1NBZB 1UZ6F 1NCDH 4RX4D 3PP4H 2DQIH 1M7IA 1C5CL 4OCRH 2E9IA 1B90A 1BFSA 4DGVL 5JHLH 1WUNT 5C0EA 2Y7QB 3D85B 5KSBF 4L4TE 4ZYKB 1WIOA 4PJIA 2X9XA 5M7QA 5DFTA 3H3PH 3B9VA 3FT2A 3UCRA 5HDOA 2AK4E 1U6AL 5JLZA 4Y4HC 1D5ZB 3BH8A 4Z95H 3H3BC 4E41D 1G7MB 2GJ6A 1A2YA 1KCSL 2XPGA 5JW4M 2I27N 4WHCA 1X6NA 4QRPA 3F7RA 3K80A 4HT1H 2KL6A 2AQ2A 4PBVC 3L7FA 4JFOA 4U6XA 3IGAB 1B6UA 3KPLB 3VDCA 4BZ1H 3D85D 4ZSOE 2X9YA 1F4YL 2B1AH 5E2TL 2CIKB 3RUGB 5MEOB 1HE7A 1URLA 1GAFH 3MLPA 5F1KC 4WHDA 4HZLB 5A2FA 5EOQH 3VFPB 1AH1A 1HXMA 1AJ7L 2IBGA 3VFGL 2D03L 1ETZB 1QHPA 4XMPL 4XBGA 5T3ZD 4KTYA 2G60H 3FONA 3N1FC 4HT1L 4XI5C 2VQ1A 3BP4A 4K3EH 3TYGH 4Z78A 5E94A 5C0IA 1ORQA 3ARDD 3BPNC 3QFJB 4KRNA 2UVFA 4OKVB 4UNTA 3SDXF 1OAZL 2J8UB 3QIUB 4RGNB 1HXYB 2V7NA 4M1CC 4I48A 2OZ4A 1RIHL 3BP7B 3QIWB 1NCAH 4HC1A 4AK1A 1FIGL 3P3YA 2HP4A 4RDQG 1RULH 1IGIH 4RQQA 4L8SA 5I1LA 1G0XA 2B4CL 2R2EB 3V4PH 1CXKA 4QRSB 4QT5A 3WFCH 1FFRA 4M48L 3QFJD 4MA7L 5KSAC 4D9RE 5FM4A 2Q8AL 3QIUD 4RGND 4RISL 1NDMB 5AWNH 1ZV5A 5HJ3A 4Z7OE 1XGUA 3QIWD 2P8MA 2HJLB 1IAOB 2COQA 4WW1B 1G6RL 2FSEA 1UXWB 4BQ9A 3QG6A 4DVRH 3D48R 1ZANH 4RMVA 3G9AB 4NC1C 1F4AA 3SDAA 4TNWF 4YHYC 2NX5B 3MLTB 1OP5K 2YD6A 1NEZB 3IDIB 2Z91A 4FQIL 4GKOA 5HD8C 5JW4R 1KSRA 3ARFA 1T2QL 1CGVA 1CGUA 4J12A 3WIFB 4X9BA 3CVIL 4GMSH 2B5IB 3TO4C 3DI2B 3ALWA 4YEFA 3AREA 1OAXL 4Q6IC 3IDYC 3O11A 2ZUTA 1SJXA 5GZND 1X4XA 2VABB 1T0PB 3CH1B 4NDMB 4Q9QH 5F7WC 4ACPA 3LPWA 2VSDA 2NX5D 2OQJB 2QQKH 3MV11 4PJAA 1I8LA 1ZHBB 2YK1L 3P4LA 4J3UA 5F88A 4AIZB 2E7LA 2I60H 5D2NB 5F96H 5BZDA 4GW5B 2P5EE 3I85A 3VFUB 3EOAB 5EUKB 2EH8H 1MEXL 4MMZC 2Y25A 2YA1A 4WHTA 1W0VB 4Z76B 3M17A 3HPLB 3PE9A 4RFEA 2LE9A 4LL9A 5JXAH 2NTFB 1LNUB 3SE4A 5IJKA 3Q5TA 2ZCKL 1XF5A 1U8HB 2J8HA 1I3UA 4JB9H 2FCBA 3B9KB 5F7YC 2PCPA 1JHTA 3BKMH 3D69A 1R0AH 5IQ9A 4MWFA 4G9FA 3QYCA 2O5XL 4NHUA 2W1NA 3G08B 2X4OB 3F6IA 3L7EB 3QA3B 1RZFH 4ZFOL 4G3YH 1XF3A 4XC1H 1AKJB 4APQA 2X41A 3IT8D 2NY6C 2Y06L 5BW7A 4PGDA 1SEBB 2CDFA 2CO7B 2EDOA 4HCRL 4G42A 4LLQB 1EZVY 2X4NB 3B9KD 3HMXL 4UINL 3W9EA 3H7BB 3O2WH 1E27A 1MREL 4JFQA 2W0KA 4FRWA 1A1MA 1MCCA 3GGWB 3N50A 3RZCA 5J6GB 5C09E 2X4TA 2BSRA 5AAMA 1UZ6E 4OD2A 4X6CF 3C6SB 4K9EC 4G6KH 1HSBB 3ZYJA 1AKJD 4AG4L 1CL7L 3L5HA 5A16B 4QOKE 3CXHK 2R23A 1FORL 5H35A 3GJEA 3OKNB 3G5XA 3BYYA 1Y6NR 1J0JA 2Q76B 3AS0A 4F7CB 3CLFH 2EDJA 4XVSL 2CD0A 1RJLB 3ZE0E 5DO2C 3MRMB 5KS9B 3Q6GH 3HB3C 1TTFA 4AEFA 1V05A 3HNTH 4PJBE 2GSGA 3BD3A 3MSPA 1OP9A 5IR1A 5DS8B 5JA9A 4P2OC 2BSTA 2GW5A 3MV01 1GGIH 1V7NH 1GZPB 3NN8A 3PGDA 2MNUA 4GOSA 3HUJB 5IW6B 4K3JH 4G5ZL 5DYOB 1U3JA 3X17A 2PUQT 2YPVL 5GRWA 4ONHA 2VDML 1F2QA 3ARZA 3BZFB 1FFPB 3FFDA 1GVIA 1YUHA 4Z7NF 2J4WL 1DSFH 1ZHLA 3QUKB 1YN7A 4NZDA 5EORH 2Z8SA 5HGDB 1XZ0A 5T1DH 4XBPA 1EX0A 5I1GL 2KZ1B 3ZDYF 5ALCH 4QRTB 3HPJB 2GUOB 1UH2A 3OAZH 4MX7A 1AP2B 2BMKA 1OM3L 1ZLWK 4M02A 4XPBH 5BJTB 3DXAB 1YY9C 4NUJA 1JPGA 2JK5B 1Q9WB 4Q0XL 1CD9B 2D31A 1U0QA 4JM2A 2AEWA 4YNYB 3V7AE 1ZEAL 4HJGA 5GPRA 3CFCH 1JF1B 2ARJB 5BZWB 3HZKA 2Z31B 2GEEA 3QNYB 1CYGA 1Q9OB 5EZOL 1OAKL 5C0CA 4GKSB 2OI9C 4GBXD 5L2KB 4OCSL 2OP4H 1GHFH 2NR6C 5KN5A 3OJDB 5GS1C 4PGJA 3RVXD 2BSSA 3DXAD 1S7WB 5J12B 4QHUA 4XXCC 2HH0L 2Q7YA 2ESVE 3GM8A 2FEDC 4KMLB 4HUMB 5FO9A 4S1RL 3OGCB 5ID0A 4GQ9H 3SDXB 1OCWL 1YA5A 2H9GA 5HYFA 3C5JA 4WO4C 5JPMB 1LD9B 2Z31D 1IQDB 3HKFA 3T3PF 4BFGA 1CLYH 4EN3B 4AENB 3TBVA 4AM0A 4IOSD 2ADGB 3GZKA 3TBSA 5L2KD 2C3GA 5GSVB 2DYPB 1DCLA 1W72L 4MJ6B 5I16B 4HHAB 4P5KB 1L0QA 4MQSB 1JV5A 1NCTA 4UTAH 3LQAH 5IFHL 1NC4B 4I3GA 3UTPD 2GT9A 1KYOK 3IDJA 4ZODA 1CLYL 4HPOH 4K2UH 4MAYB 1GGBH 3JTSA 4MXWH 1P84K 1A1NB 4GRWH 4R7NB 4EN3D 3ULVC 3GRWA 1CVRA 5ICYA 4YHLL 4QRUA 3LCYA 3QO1A 2DYPD 4LKXB 5D9SB 3UC0L 5LXGH 3ZYOA 5F7EH 4P99A 5JQ6H 2EDQA 4JFFE 3CNKA 2AJUH 3BMWA 4XP5H 4XP6H 4EOWH 1Y6KR 3ILQD 1NC4D 4HPOL 5F7UA 2XN9E 4K2UL 1A6TB 4JPKL 5GS3A 3DO7A 3JV4A 1F58L 4AYFA 3DGGA 5HHME 3LKNB 4TSCL 4JZOB 2YRLA 1TTGA 1W8OA 1X5ZA 5J11B 4TTDC 1M1SA 5ACZA 4NO2B 5HYQB 4L9LB 4HXBH 5JQ6L 4O5LL 5F8RC 4OTXL 5FGBC 3LKQB 4XP5L 1AGEB 1WBYB 5AEAA 4FFVC 2IAMB 2OR7A 1Y0LB 2J7LA 3BEWA 3JWDL 2VUOA 4XNUL 2AJXH 1R3JB 4G8IB 1BPVA 4Q9RH 5TFSL 2A77L 4WUUA 2JIXD 4N8PA 4W4OC 4LRIA 1CFVH 1EUTA 3D0LA 3VH8A 4D0DA 4JJ5B 2R2CA 1J05A 1FLTX 4UQ3B 2R2BB 3D9AL 4JO3H 2P5WA 1U2HA 2C1OA 2X40A 4HS8H 3TA3C 4RA0C 3S3JA 4FG6D 4U6VL 1B9ZA 3OKKB 4OFIA 3TVMB 3B3IB 2IAMD 3DJ9A 1F4WH 3MYZA 3D18A 1T0MB 5CBAB 3D87B 4X6CE 1FNEA 1RUKL 3ARGC 4XTRD 3T77B 5D7SH 2A73A 1NL0L 5D1ZC 4AEIH 1UA6H 2YMXH 2ARWA 3OX8B 4FQQB 4U3HA 3U9PL 4X8JB 1KTRL 5DT1H 4F7MA 1J8HA 5DXWA 1KEMH 3AY4A 5CJOL 3FQXA 4KGLA 5FA4B 4PJXF 4BSVA 1EVUA 3CD4A 3SJVB 1FNLA 1NFIA 3TFKC 1P7KA 2K3TA 3RNQA 3SPVB 3TVMD 5CD3A 4UV4H 5DI8A 4WFFE 3FT4B 3P4NB 4FZ8L 1SYSB 3UP1A 5CGYD 2R9HD 1UA6L 3I02A 1YDPB 1ES0A 4IDJH 3FFCE 4F15C 4K8RC 5E7BA 2XY1A 5T3ZH 4P2QE 1RZJC 3T0EE 1UWXH 2VDLH 4FFZH 3EYSH 4YH6A 5LGKA 1KT2B 4M5YH 3TBYA 3DUUB 2VLJA 1E6JL 3DECA 2G9HB 1L0XA 4O2FA 2ZPKL 1KJ2B 4UV4L 3S34H 3SJVD 2AJSL 4A6YA 3CAFA 4OCYL 3F8UB 4KU1A 4R8WH 5DD5H 5JIIA 3M45A 3ABZA 3MRGB 4Y4HB 3CCHA 2VL5A 4Z7QF 1G9MC 5JXEC 3LEYH 4QWWC 3VXNB 4L4VA 5F3BB 1IGYB 1MCOH 2VR5A 4B7IA 3THMH 4ZFFA 4LCCC 3QPXL 4IHOB 2E6QA 2XFXA 3VXRA 4WJ5B 4DUVA 1N5AA 2ENYA 5D71H 4Z5RB 4PJHF 5ETUB 3S34L 1X44A 1A14H 5E1AA 1MUJB 4LU5L 5B38G 1ED3B 2IQ9L 5EBGA 1MHPH 3A6CH 4E5XA 1BECA 3GMMB 5ICXA 3HS0A 4LSRH 2IBZY 5EFIB 4LLWA 4Y4HD 1IQWL 4FOMA 3LS5H 1ZGLP 2BY0A 2RCSH 4MNGB 4E42B 3O6MH 4PJEA 3BPNB 1QFOA 1HZHH 3NTCH 3VD4A 3GIZL 3C08H 3O8XC 1TETH 4Z7WE 4AQ1B 3RZWA 3MOAL 4LLVA 2BRQA 3KLDA 1J0HA 4EI6A 4HJ0C 3QIBA 4LSRL 3O3EA 2GCYB 5F7HA 2G5BA 4X5WB 5ABDE 4IS6A 2P7TB 4OIBA 3CFJA 1K6QH 4X7DC 3ARBB 4TOYH 3GMLB 5MENA 1LO0L 2OJZL 1E4WH 1K3ZA 1TZHA 2ID5A 1H0DA 3O6ML 5SWSE 4XI5D 6CGTA 4GG6A 2DM7A 3NTCL 3I6GA 4NKOA 4XCNA 5JW5B 4K3HA 3NPZB 1DUYA 4JKPL 1QVOB 3C08L 2MKLC 1J0YA 1TETL 2ZKHL 3FRPG 3O2DH 2CK0H 4JN1L 5GRJH 5KSAB 3U0TB 5C0JB 3TCLA 2GJZB 1NGWB 5BQ7B 3UPRA 3C09C 3MO1A 1ZHNB 1XCTA 4M1CD 1U8JB 5IHBA 4OI9A 3ZT6A 4TOYL 3UJIL 5TF1H 5GHWH 2HVJA 3QCVH 1JPTH 4X6BA 3ARBD 3TYFA 1EFXB 4XPGL 2MQ3A 5I1AA 3QZWA 4HSQA 2VDRL 4OLWL 3VD7A 2PTUA 4G8GA 4ZO6A 5DF0A 4YHYB 3TIDB 4LCYB 5DJCB 3RVTC 1A3RL 2DQHL 3KGRA 1NCCL 3LZFH 2BXZA 5KSAD 1HDMB 3SOBL 2FIKB 5FV2A 4MAUH 1CG9B 3GMNA 3TO4B 4FXKA 3CDCA 5FYLE 5IUSA 3IDYB 1L4IA 4QRRE 2W9DH 5FUOL 1V5JA 1EFXD 4PV9A 1U3ZA 5FK9A 3MROB 5EIIB 3LSOB 1M05B 2V7HB 1TFHA 5T5FL 2H26A 5HD8D 5F3HB 5I2IA 1BBDH 2FGWH 4GAGH 1I7ZB 4WGWB 1WZLA 5HHVH 3B8YA 4KI5F 1P1ZB 2EC8A 3IAQA 1FVDA 3TO4D 4BZ2L 4DCQB 2EH7H 3KNBA 2R0LH 1YMHB 1IAIH 1GGTA 2JTDA 4JY4A 2ADFL 1EAPB 4GW4A 3RIFK 3C9NB 3S6CA 3U4EB 5CJXA 3WFBH 4XNXH 1BQHB 1RZ8A 4GG8A 4Z7UA 5BMFH 1Z9LA 3VG0H 5IV2B 4BFEA 3QWOA 5C71A 4LARH 3JSSA 5JR1L 3WXWH 4DVBA 5C9JB 1BVZA 1DQQB 2EH7L 2R0LL 5T33L 1TDQA 4KK5C 3O9WC 1AO7E 5CILH 4PRDA 3NPSC 5EO1A 5HDQL 5EC1B 1IFHH 3D39E 5FXCH 2YC1B 4OFDA 2OR9H 4R4FH 3NAAL 1NDGB 4K23L 1BIIA 1JNHB 4WI9A 4XNXL 5B22A 2ZCLL 5ESVB 5MP6L 2DDQH 2QSTA 5J1SC 4S1SH 1PKQA 3BQUA 3BDYL 4OGAC 4MJ2A 1WITA 5DMKA 2NY6B 4W6XB 4H1LB 1ZWIA 3GHBL 2CRIA 3OG4B 3JWNC 4HKJB 5JIKA 3FN9A 4DKEL 3RVWC 4R4FL 1B2WL 1A9BB 5L88H 3S9DB 2OCFD 2QQLL 3FO2A 3VRLF 3MPCA 3KS0J 2JCCB 2E7BA 2LAGB 1WTGT 3UPAA 4YO0A 5DURB 1RAMA 5IWLA 2NZIA 4NWTL 1CBVH 3QO0B 4JRYB 4QHKJ 3KPPB 3CDGA 5LBSH 3OXRB 5CUSL 4OCWH 5EC2B 1CFQB 5LKNA 1KTDB 3RWJA 2NY6D 3C60A 3IU3B 2BVPB 4OCXL 2UV3A 3DVIA 4KC3B 1DBAH 1XIWA 4JZNB 5I8KH 1UB5A 3BP6B 4WV1A 2IPUK 4KTDL 4HEME 2B1HL 1SJEA 3O2VL 4PJXB 2W65B 3K8KA 4HBCH 1JJUA 4NWUH 1CBVL 5DURD 4PS4L 1KTLA 3GK8L 3L3KB 1ITBB 2VNCA 3ZYZA 4JRYD 3ULUH 2DQGH 4HH9B 1A9EA 3VRIA 2FL5A 3P0GB 1TZIB 4OZIA 2IALB 1WF5A 5D2LF 2F5BL 3EZJB 43C9B 5C0DB 3RWHB 5I1KH 1BFVL 4HBCL 3RTQA 3CVHH 5DO2D 1V8HA 4GUPB 2C5DC 3QDHA 2HLAB 1CT8A 5DEFB 4PJ9C 1A6AB 4IMKA 5CSGA 3KPTA 4PBWD 2WW8A 4J8RB 1T89A 5LQBL 4RAUA 3OR7A 1XF1A 3R0MA 4WWKA 5CEZD 2XG4A 5IMLA 4ZPTB 2RAMA 1KPRB 1QYGL 2KPNA 4JHAL 3VXUA 4WW2A 5E8PA 3WJJC 4PJHB 3BZDA 5J56B 2P44B 4HAGA 1YPZF 1N4XL 1KG0A 3QQNA 3UBXB 1INDH 4Y5VC 1N0XL 2R2HA 5EU3B 2OI9B 3CPLA 4WNQA 1M71B 3FT3A 1SY6H 4MDJB 3MRKB 5A3IC 5EU5A 1HILA 5DJYB 1TLKA 5IJVB 4NNXB 5C7XL 5GS1B 1FH5H 1WZ1L 1YY9D 4NCC2 3EJYC 5I6XC 2YHGA 1S3KH 1QBMH 2YWYA 3EYFA 4BELD 4ODWA 4TSBH 3ZHKA 5KVMC 1EIBA 3QWRA 3V6FB 1KFAH 5GS0C 1EMTL 3P4OB 2AV7B 3JWOL 3HI5L 4JJHA 4WO4B 5LCVH 2V2XA 1TXKA 1H3PL 4P9MH 5A2LH 3U7YH 3SGEH 4NSKB 5DK2A 3IS1X 3W0WA 1B0GB 4AT6A 1LO3L 4DAGL 5DQJB 2HFEB 5E6ZA 2YD2A 2NR6D 3K2UL 2GK2A 4HK0B 4QCIB 1DQLH 4MHHI 1BMGA 1VENA 2YUXA 4X83A 3BRGC 5EBLB 3FO9B 3O2DA 4LGRB 2FEDD 3GSNA 4DFHA 5EBWA 5LCVL 1JFQL 4P9ML 5FM5O 1LO2L 4RZCB 5DA4A 4LQFL 4NZJA 2ATPA 2F8OA 1BWWA 2AXFA 4WO4D 3MCKA 1IEBA 1AR1C 4JPVL 5IQ7H 2Q20A 4HBQA 2BNQB 3MLSL 2DQEH 3X13B 2IGFL 2C1PA 3ROOA 1CE1L 1Q9LB 2NMSA 5K59E 4DOHE 1UM4H 3MLWL 5C0BB 1BQHG 3GSQB 3O4OC 4XCEB 1U91A 5BXFA 2YOCA 3WUWA 3LQMA 4I8DA 5K9JL 1T03H 4CMMA 3VD9A 4YDIH 4Y4KA 43CAB 5CLWA 4OD1L 1FLRH 1FAIL 1CFSA 1F6LL 4MA8H 3BKCL 1KCRH 1JCKA 2CUIA 3KYKL 4PJAE 3SBWA 4DGYL 2VLRA 5DK3A 2KZWA 3DTXB 3ULVD 2BNQD 1QSZA 2XQBH 3UDWC 3LRSB 4IOIB 3FB6B 2IMMA 5AZ2H 2HFGL 5C0BD 2LU3A 3VD3A 4M4RA 2VDNH 4HKZA 4HXAL 1DBJL 4H1LG 4MA8L 3RL1B 3DVFA 3QT2A 4L3EB 4QXGL 4N1CA 4V2CB 2HJKB 5FHAH 2BVEA 2W0PA 1P2CB 1UQSB 2AJYH 1I85A 3A67H 5BVJA 2BOCA 4K71C 5IMKB 4HLJA 2DD8H 3RIAK 4TTDD 1T20A 3T8XB 4JEGB 1MI5E 3I50L 4JGJA 3HI6L 3B9DA 5HI4C 4UTBH 1SEQH 5IOPB 1WFNA 3FMGH 1FBIH 5J3HC 3RGHA 2R4SH 5ENWA 3OJ2C 3TA3B 4ZOEA 2R0KL 3O81A 4QRQB 2GI7A 1A0QL 2XZCH 4FFVD 4GW1B 4L3ED 3VRLE 4F33B 1I1CA 3GMRB 3IXTA 1T21B 3Q1SL 4LEXH 5TQ2L 1A6UH 1K5NB 1D5XB 1EO7A 1QRNA 2MPAL 3ARGB 2M8XA 4F9PC 4PJ8C 5IK3B 1I4FA 1E6OL 4NKIL 5D1ZB 1FBIL 4KKBC 4ZPVA 3RRQA 1YMMB 3QUMB 5JORB 5T3XD 2R1WA 1R3KB 5TE4L 4FNLH 3TA3D 2Q3AA 3GSUB 2P46B 3MA7B 4PRAB 1NMAH 4MDIA 5E6IA 3LPGA 5KOMC 1U42A 2BNRE 4HWNA 4QGTA 5E99H 3OSKA 2I26N 2JB5L 3ARGD 1I8KB 5E2VL 2FZ3A 4Y2DA 3RY6A 3CX5K 5K9OB 4F15B 5D1ZD 2GKIA 3MZGB 1MLBA 2FJGA 1VKXA 4HK3J 1UG9A 1YMMD 2YN3A 3MYJA 5DRNB 5F9DC 1C12B 3TFKD 1KJ2L 1Z0NA 2W91A 1WEJL 4YXLH 1FYTE 3F5WA 4X98B 4QXUH 3OKYA 4N0YH 1OAUH 2ENSA 4FZEL 5J9PB 4N0UE 1A6VL 4RBPK 3UBXG 4MXVE 5DGQA 3DHMA 4K8RD 3QNZB 2X7LB 3F7QA 2R29H 1MAMH 3KDMB 2AEIT 2J88H 4PRIB 3KPRA 1MCPL 1S8DA 1S7QB 4N0RA 1QEWA 5DSCA 4HG4K 1DEEB 4PB9H 3T0EC 4OIIL 5GGUA 3GEWB 1KLGB 2RQ8A 1LP9E 4JY6A 3CVHA 4HIJA 1E4XH 1XCQB 5I1DA 4MA3A 1MFAL 3CUPA 5FM8A 2XOTA 3IFOA 3DSFH 2BDNH 4H0IA 3ME0A 1JNLL 3HE7A 4O4YL 4CNIA 4PRID 3VI4F 3MRCB 1FVEB 1EHNA 3W82A 5ANMB 5CCKH 1L9MA 1R5IB 5EBMB 5LAXB 4HS6A 1G7QA 1T80A 1KNOB 2Z93B 4OLYL 5D1XA 5E03A 5CFHA 1YPZB 2AKRB 1TVBB 1HI6B 4KDTC 4I0CC 1UJ3C 2DB8A 1T7WA 4MNHA 2EECA 3PWLB 4LGPB 2VQUA 1SY6A 1R3LA 3MLXH 3MRDB 5CMAB 1U8QA 1AE6H 1YY8A 3IFNH 3TBWB 2O61A 8CGTA 4U6HA 1W0WA 1AI1H 8FABB 3KXFB 5BRZA 1HCFX 3PJSB 5D93C 5FYKL 2AJZB 5FYJL 3FQTB 3HE6B 3QXDA 3IVKB 5DEZA 2XTJB 2GYSA 1VESA 3BPLC 4UV7H 1OP5H 3PWVA 4YHNA 1ZLUH 2XNAA 3UO1H 4N1HB 5T1KA 3SKJH 3V0AC 3VJ6A 4LASH 3GHEH 1JHKL 3NCJL 5IVZB 1KENH 1I8IB 1MFNA 2Z8WC 4BZYA 4PRPB 2W0LA 1YEJL 3KPMA 1OSZB 4H26B 5CEYA 1U8OB 3UTSE 15C8L 2P45B 3KXFD 4UV7L 1J0IA 1ZGLA 3QFDA 3WS3A 3HE6D 4L8DB 5EZJB 4M43L 3ULSB 2XTJD 3MRJB 3MLVL 3SKJL 3O4LB 2AJVH 2EE9A 4ZOCA 2R0WL 1KENL 4ZOAA 4TULH 5FKAA 5KSVA 5ICZB 4ODHL 4YPGA 4XCCH 2DRUA 3IJSA 3A6BH 3QUZB 1ZLSH 3RVTD 5I9QC 3GSRB 4OF6A 4RGOL 1G7IA 4KY1H 4JAMA 3TN0C 3H9HA 4PRPD 4K3DH 1UWEH 2DQTL 4JZJA 4N8VA 4JDTL 1FZJA 1K4CA 1OGAE 1WWBX 3LKRA 5FOJA 2FHCA 3V79C 2C7UA 4Q7DA 2G75B 5F1SA 4FQXA 4D9RD 1HOCA 4KDWA 5DJAA 2ZP0T 3O4LD 2PYFB 2I9TB 1K2DA 2VIRB 2FHBA 4PP1C 3R1GH 5IF0B 2UWEF 2X1OA 5ITFA 4KY1L 4L8BB 3RIAF 3DYPA 1MCNA 3QUZD 4KDVA 2MCG1 3MV7B 1EXUA 1XF2A 1ZA3B 4YHIB 5F71A 4E0RB 4M6OL 1HINL 3O9WB 5C0AE 5TE7H 3WEXB 3NPSB 1IAII 1MFBH 1MH5B 3RNKA 4X7FC 2V2TA 2VXQH 4XPAH 1G1CA 3JTTB 5JW3H 4WUUE 2BOBA 2IADA 5I66B 3E8UH 3WXVH 1RZIB 3S4SB 4ZDHA 2ITCA 1UWGH 3IU4H 4XP1L 1AHWA 4NN7B 3BZEA 4DGIH 1TNNA 4MNQB 4K9EH 3T2NL 3MV7D 2CLZB 2D4DA 4KWUA 2UY7A 3QEHA 5TE7L 1JBJA 1XF4A 4LPUA 4R7DB 2OTWB 4YDKL 3O9WD 4QTIH 5DWUH 4D0BB 1A7RH 1HH6A 2X42A 1AC6A 4JRXA 5KANG 1BAFH 5D7JA 1AIFB 3FQNA 4JVPA 3WN5A 4I18C 1KCVL 5D8JL 4P2RE 1BBJB 1J8HE 3G6JF 2ADIA 1AGCA 2VDOH 4UB0H 5I8EA 4RNRB 4EIGB 5IMOB 4HV8A 4M8VA 5I1HL 1UH3A 3EYOA 5E4EB 4G6JL 4OGAD 4MNQD 4S0TD 1FZMB 3FO1B 4P57A 4P4RB 5DC4B 4FABL 1EHXA 3TGXA 4ZTPL 3RVWD 1BAFL 3ECBA 4Q2ZA 4LSQH 4PREB 1BVLA 3D25A 4PJFE 1KB5H 3EGSA 5C08B 3GMPB 1GGCL 3O6LL 2P8PA 4N0FB 2VZ3A 5FCSH 5C6TH 5IB4B 1FC2D 3HNVH 3ZL4L 2VLJE 5C09B 4LFHD 1T1WB 4A2LA 1CK0L 2SEBB 3F12B 3MA9H 4I13B 5BOPA 5ERWB 5CEZL 5IM7A 4NUGH 1TVHB 4JDVA 4KK8C 3QQ4B 3EBAA 4ISVB 4EDXB 2N7BA 3I3BA 5JIHA 5LVEA 1DL7L 3RWFA 4FQ2H 1KN4H 4PJ9B 5DUPH 1RUQL 3FL7A 3U46A 3HNVL 1P4IL 2W9EL 5C08D 5LG1A 25C8L 1U93B 4PJBB 3QHFL 4ONFH 3CC5A 4PLNC 1JYXA 1ORSA 1X5KA 2EC9T 5C09D 2V9RA 1FSKC 3TBTA 1OL0A 4P5TA 5IBLC 3RBSA 1RHHA 4ZXBA 4HKBB 2R69L 1XGYH 4JFDA 2WK2A 3GJFH 4OLEA 4G8EA 5EA0L 1T7VA 5HDBE 4PJ9D 2JJSA 5IHUH 4PJEE 5IT2L 2ICWA 3RHWF 1ZS8B 4I77H 4Y5VB 4QY8B 2R4RH 3GBNL 3WD5L 4YIQB 1Q9KB 1FGVH 3MRQB 3WBDA 1IGFH 1JGUH 4LK4A 2BVOA 5EUOE 5CSBA 5MENE 1QSEA 4WVRA 4J3VA 3CFIC 4KJPC 4YQXH 1TIUA 1G0YR 1IAIM 1ND0A 3M1BB 1HHHB 5L2JB 3LN4B 5T5NG 1U95B 2ICCA 2FR4B 3NH7H 1JPSL 3WL9B 1JF6A 1CICB 5JNYB 5CBEB 3AS2A 2YEZB 3ULVH 2RFXB 1FVCB 3EJYD 4UDTB 1HYRC 1QLEH 3B2VL 4XMLL 4KPHL 3OF6A 4UIMA 3BAEH 1QFWL 2Z8VC 4QXWA 4ONOA 3SGEI 4G8GE 1XGQA 3NH7L 3KG5A 1FFOA 1MJJB 5DZNA 2ESVB 2Q6WA 4L8SC 3VXQA 1ODAA 2OJEA 4W70A 5DMYA 4PJ5A 1CDIA 1CICD 3QRGL 2XRAL 4Q6IA 5FOBA 2H45A 4MCZA 3O4OB 4GSDL 3B6SB 3OMZA 4BQ8A 1MIEH 3P9LB 5DUML 5EZIL 2VDPL 1NGXB 3MRRA 4DEPC 1NBYB 1NH6A 1J0ZA 4J3OC 4NQSA 5EWIH 3GDBA 4K7FB 1G7JA 4C58B 1CXIA 1AR1D 3ZTJG 2AK1L 4DJMA 3HHRB 1VADB 2AAVA 1KUMA 2ESVD 3GBML 3T0XA 4EDWH 3REVA 4CVZA 4PRHA 4RMSA 4AIXA 4HGWB 3SDAC 3WIHL 3MRNB 3S4SG 1YJDC 2HA1A 1JWSA 1CFBA 3DROB 35C8L 1ACYH 2X89A 3ARFC 1HCVA 2OSLA 1FO0B 3GKWL 2XWJA 1OGTA 3MRLA 2VDKH 5T3XH 3GBLA 4OLUL 1J1OH 1U8PA 3AREC 3EDKA 3SDDA 1BOGA 4LCUA 3LKPB 4RRPG 4Z7UE 4JFFB 2EIZB 2DQFB 3MV8B 1L7IH 4KHTH 4XCYB 3MRPB 4ZG1A 4MQ7A 4NQCA 3NFPA 4ZTOH 4GXUN 3VXMB 2XN9B 4DK6A 1A47A 4HS3B 5HHMB 4NNPH 1R24B 2IH1B 1I8LC 4GKZA 2CLRB 12E8H 1OD7A 5CJBA 4Y7MA 1EA9C 3NA9L 4LFHG 4NQDB 1BLNA 2Q8BL 3MFGB 1BGXH 3X14B 2E7LC 4KKLC 4ZFOA 3L1OH 3QUMH 5F9WC 3MUZ1 2WZPD 2IANE 5KTEH 1N64L 1QHOA 4NZRL 2AV1A 1KPUA 3MCG1 4JFFD 3JZ7A 3MV8D 4HCRA 3PWPB 3FO0L 5EO9B 1IM9A 3VXMD 2XN9D 1MCJA 1LK3L 3BESR 3VGFA 4ZFGH 1JRHL 3SQOL 4HWBH 2ZJSH 3P9WB 2IPUG 2FB4L 5HHMD 5HI4D 3FB8A 4GFTB 4CN4A 5IJKC 1MHCA 3U0WH 4X6EA 4V1DA 4Y2OA 4NQDD 2XQYK 1KELL 1PZ5A 3OAUH 4N8CL 2EYRA 1I7RB 1QQDB 2WWKT 4QEGA 3VFWA 2C3VA 2CKBB 4LQ1A 4E9LA 1ONQA 4LIQE 1J5OL 4XPFL 3PWPD 3RAJL 4APQC 2D3VA 2EDXA 1G9MH 2ICWJ 4K8RL 1RIUL 4KKBD 4JO2H 4X4XA 1UADC 3OXSA 1RZJL 5AYUH 4BH7A 5BW7C 1CXLA 3D2UB 4AEHH 3X3GH 4P4KA 4C56E 3RWDA 3KPSE 5FHBL 1UM5H 3QEGL 5F7DB 1KIPA 4XWGL 3RZCC 1T4KB 5JHDE 5D6DC 4X80L 4XXDA 2F54A 4OZIE 4M8QA 4QYOB 2WAHA 5F21B 4OI8A 1U9KA 5TDPA 5IB1A 4DQOL 1ZT4B 4QGYA 3LAFA 3S5LA 1SYVB 4I3SH 4PJIF 3EHBC 1U8KB 3ROLA 3FFCB 4XZUB 4PPTA 3D2UD 2YN5A 4NPYB 4P23B 3T0EB 3WMSA 1T83A 4CN6A 4G7YL 1OT2A 3QUYB 3CFBB 3EYUH 3FQWA 3OKOA 5CGTA 2GK0B 5MHSE 3FAXA 4PB0L 1PFCA 1EBPA 3NFSL 3IFLH 3QJHA 3FFCD 1O5DT 1JGVL 5AAWA 3CZFA 2FX8H 1JZ2A 2IC2A 5B39G 5B3JF 4U1NA 1Q94A 4I4WA 4YGVA 4P23D 4ENEC 4PJGA 3T0ED 3X3FH 4HIXH 4R4BB 1CD1A 3H7LA 4UT9H 3D0VA 5ISZB 2DWDB 2AGJL 3GJFA 3NIGE 3QI9A 3QUXA 4LMQI 1E4XI 3EYVA 2MTPA 3QUYD 3H2WA 3UTZA 4OBRA 4OZGE 4X6DA 3BFOA 3B83A 3U9UB 3MMEB 5DMIH 3V4VL 3ZDZF 3V6OA 2CMRL 4WGVB 3CJJA 1I8MA 3MLUH 1A4JB 3HG1E 3STLA 4XT1C 3MGAA 5CJQL 2HN7B 5ADOL 3WHXB 3QULB 1U92A 1VHPA 1KJMB 1LILA 3QNXA 3PABA 4JM2C 3W0WE 2NNAA 1INEL 4PTUB 5D93B 1NUDA 2PTTA 5ISZD 1W72A 4G43B 5IB2A 2YA2A 1F4XL 3BPLB 1P6FA 2FJHB 3IJYA 4KI1A 4Z7VA 5E8NB 3NFNB 4U49A 4KFZC 3RU8H 3FAWA 4LEOB 4Z77A 4PJCB 5C2BH 1DLHA 2CDEA 3BD4A 2LTQC 3GSWA 3LQZA 1JTTA 1SBSH 5E2WH 5GQBA 5SWSB 9CGTA 1MRDL 2QQNH 3KPQB 2VYRE 1RURL 3ARTA 2HT4C 4ELME 3QEUB 2VO5A 1U58A 1J7VR 2ICEA 4OKDA 2FWOB 1I1RA 2A1WH 1DQJA 3G9VA 5TE6H 1WK0A 4LKCA 1EGJH 5F6HI 1MFDH 5I9QB 2J6EL 3I2CL 1AY1L 5SWSD 4OB5H 1S7TB 3WFZA 1NFDE 3TN0B 1S9YB 4J3WA 4PJ7F 4LSVH 2DJUA 2DS4A 1KV3A 2VZ1A 4O2CB 3CGTA 2JKXA 4I9WD 1JPFB 3QDMA 2D7TL 2EIBA 3S3PA 1HWHB 2W38A 1LO5A 5D72L 1J1XH 4Y19A 1FFNA 3BX7C 3F58H 3VXPB 1NCUA 1RZKC 1T5WA 2CGRL 4F7PA 1A7OH 4JFPA 4OSUL 4QRRB 3WKMH 3V8OA 4FP8L 1AXTL 4OFPA 4D2NA 4JFZH 1JUFB 1A6WH 1LEKB 3Q5YA 3VRJA 1N5YH 3ELAT 2X4QB 3TN0D 1PBYA 5EO0B 1B0RB 2EYTA 5KJRH 1FL6A 3O3DA 3BGFC 4PR5B 5TQ0L 3CMOL 1YQVL 4D9LH 1D5BA 1T3FB 3T0DA 4LSUL 3V6ZB 3U36A 1QA9A 4EIZC 1P4LB 3MUGA 1A6ZB 4QHLA 2D0GA 1NSNL 4OZHA 1HEZA 1U8IA 3MBEB 4TUJA 3H9SB 3L3IA 2H41A 3STBA 4PP1D 1JNJA 1IVLA 5LGHL 3AM8A 5JDSB 4QRRD 4IJ3C 3EFDL 3B5GA 2P8LB 4PLJC 3WLBB 3EOTL 4RFOL 2EE6A 2OTUB 1QRNE 4KZDL 3ZSTA 1CGSH 3BH9A 5D5MB 4XPTL 3SCMA 4DW2H 5HHXH 3QAZC 3FHAA 3OGOE 1KIQB 4P3DB 3T1FB 2RR3A 1VEMA 1CGYA 1P7QA 2VDQH 4I18B 2I25N 5GSRA 2XKUA 4WTZG 2VE6A 3LKSA 3E2HC 4HX1A 3D39B 3H9SD 3RKPA 3F6LA 1RI8A 2Y5EA 3GSOA 1AR2A 4HWZB 3QISA 1YC7A 2BVUA 1CL7I 3AMKA 4LRIC 1CFTB 5TDNB 1IT9H 3QG7L 3E0GA 3KVQA 2Z35B 4RMUA 2VKWA 4OGYL 5HHXL 1DDHB 2Y07H 4LPWA 4ODBD 2Y72A 2VMFA 4FQHB 4MD4A 1D9KA 1C5DB 3Q48A 5F1OB 4G6MH 4KRLB 1YYMH 2FH6A 1JP5A 2XY2A 1F4HA 1R3IL 1PG7H 4ZS6C 2AERT 3D85A 4TQEL 4ZYKA 3D39D 4V2BA 1FL5A 3ILPA 1CIDA 4RIRB 3AROA 3G6AA 1XH3B 4JRWA 3BHBA 5DD3L 2QL1A 4KHXH 1RZGA 1DQDH 2D0HA 2EDNA 1RUML 2ZNXA 3AY4C 1M7XA 5KVEH 1MCRA 3E6HB 1UJTA 1GGYA 4JY5H 4J1UB 4LCCA 2PYEE 1E28B 4G80A 4M3JA 1A64A 4TVPD 1AD0A 2A9NH 3PQYE 3IGAA 4P3CL