1FBIH

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
221
structure length
221
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQGPGQGLEWIGEIDPSDSYPNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCASLYYYGTSYGVLDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/antigen)
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
total genus 31
structure length 221
sequence length 221
chains with identical sequence Q
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiH02
2EDJA 1RZIA 1DUYA 1KXTB 5ID1A 5GS2D 3N50A 5F89A 4YJZL 5IBLD 4XNZB 5A1AA 1MI5E 1G9MH 3IDUA 3GJFA 3G5ZB 5C0AB 3IVKA 5D2NB 3WV0A 1XR9B 4XNMB 3TCXA 1VADB 1I7UA 5T3ZL 1BBDL 1DQMH 4Z7QF 4H26A 4GQPH 3IKKA 1WITA 2CXKA 3WFCH 4Z7WB 4FOMA 4WFFE 1FNEB 3TO4B 2AEQH 1F42A 1QG3A 1BIIA 1F4WL 1Q0XH 1MFAH 2FIKA 1CIUA 5JLZA 4JG1H 2VDKH 1GGCH 5DD6B 1VEMA 1CG9B 2ICWB 3LN5A 3TYGL 1I9JL 5KS9F 4JHWH 4K8RD 3EFFB 1W8NA 1I1AC 2NY1B 4B5EA 5HYFA 3UC0L 3BO8A 1CFQA 1DBAL 2F58L 3RZCA 3DX6A 1CDGA 4QRTB 4C59B 2R56L 4PJCB 2GAZB 2EIEA 3OWEA 3D0LA 5JQHC 3D3VB 1NC4D 4P2RA 3M1BA 1I3RB 4AENB 1JV5A 3PQYD 1AI1H 4HIJB 3R4DA 5T1DL 4OI7A 4OZFA 4JZJA 4MNQE 4ELMF 3D87B 5FOJA 2IGFH 5TDPB 3X11B 2HKFL 4R0LB 3B2UD 4P2RD 4QRSA 3V6FB 1FGVH 3EHBD 4X9BA 5TQ2H 4BQCA 1NBVH 3B6SA 1WC7A 3PWLA 3ULUE 3VH8B 3FRUA 2BX5A 2DQDH 4OZGE 1FIEA 3VFWB 3WFEH 3T3ME 2MQ3A 5FYKD 4GAGH 4LCWA 3FONB 5F6IC 4XBPB 3VFGL 3QNYB 2FATH 3D5OF 4OZIA 5F3HA 3NCJL 4LEOB 3RJQB 5IR1A 2WUBL 3G5ZA 4IMKC 2HJKB 3GIZL 4IBLT 2DLTA 5D93C 1JZ5A 4WEMB 1I75A 1VFMA 5LQBH 5I1KH 2DQTL 3BGAA 4P23C 1YEIH 3PV7A 5BVPL 4XCFH 2ZWLT 1T1XA 5J1SC 1HOCA 2M1KA 3SKMA 2D3VA 1ZGLP 4EI6A 3SDAC 4PLJD 1BD2D 3L3KB 3GB7B 4H20H 3S36X 5FHBH 1DTUA 3P0VH 1J0ZA 3GSVA 2XTJD 3EFFA 4QHKJ 5FYKL 3OQ3B 3F7YB 3T77A 5D5ME 5J1AA 5BS0A 3RTQA 3DVGB 1YY9C 4WFED 4LGSB 4Y19D 1S9WB 4IRJD 5FYJE 2AKRA 4NQXA 4NWTH 1RUAH 1HILA 2A6KA 4UV7L 4NPYA 3DIFA 4BFIB 5DUBB 1PZ5B 2YZ1A 2CR3A 3MR9B 5IG7B 3C5ZA 3ILPB 1MLCB 1RUQH 2OJZH 1OW0A 4L1HA 2ZCHH 2HTKC 4QO1A 4M4PA 1B0RA 3PWJA 4BKLA 1G9NL 2PW2B 4RQQB 4OZ4B 5E56A 3RWCB 3O8XD 5I75B 2Y7QB 1D5XA 1K5NB 3TYGH 4KHTL 1BVKA 5E2TH 1DBAH 2F58H 3RIAF 3KS0J 4P2OA 4GAJL 4I5BA 2W65A 5DQ9B 3KAAA 1DN0A 4XPBH 2EEBA 2Y6SC 3BQUA 5DMYA 1RK1B 5F9AC 5DJ0B 5BW7C 3HZVB 4GRWF 2H9GB 3FCTB 1S9YA 5E1AB 4Y0GA 4Y1AB 5BXFA 4P3CH 4CVXB 3MACL 4W6WB 3OAUH 5FYKE 3L7EA 4LSTL 2E5EA 3UJJL 4GRLB 3L3DB 2A9ML 3WL9B 5C0CB 4RIRA 1QBLH 1RSFA 5KSAB 4Q58C 1JZ4A 5IMOB 4QTHB 1XF2A 2VKXA 4UNTA 1S3KH 2EYSA 4OD3L 2IAMC 5MEPB 1IAIL 2A77L 3UJTH 4AT6A 1I3VA 1KC5L 4X7SL 1PAMA 5E5RB 1WEJH 1J8KA 1FNSH 3DXAA 3BP6A 4X98A 4ZDHA 3DI3B 5DEZA 2NYYD 1CR9L 4H5SB 3P4NB 3UPRA 1JUFB 3CFBA 1N5AB 1BFVH 3PABB 3B5GA 2FD6L 4LPVA 3S97C 4M61B 1FYTE 4YXKH 4WWKA 4QT5A 1NBZA 3U7WL 4AEIL 4D3CL 3P9WB 3GEWB 2EKSB 5FHBL 1WFTA 2DKUA 3QPXH 4KU1A 4PV8B 4N9GB 3DXAE 4Y5XB 4TNVK 5C6TL 2PF6A 4PLOB 3GUTB 2FHCA 4Z7WA 5D70H 4LBEB 4I48A 4RRPA 4U1NB 4PJFB 3KG5A 3WLBB 4WUKL 4MNGE 4TOYL 4TUOB 5C9JB 2R1WB 1A6ZA 4Z78A 1CD1A 1YC7A 2XYCA 4HBQA 1MCCA 2ZP0T 4ZTPH 1RHFA 3S4SB 4GQ9H 3ZE2E 3TESA 2HFFA 3BJLA 3VRLF 1ORQA 3ULSB 5LGJB 4AEHH 1NDMB 3UTSA 3P9LB 2CDGA 5C08A 2DQHH 1FYTB 1URLA 3IJSB 1B4JH 4P59H 4QGYA 3BIAX 5CGTA 2FDBP 4PJEF 1PG7W 1ZTXH 2VITB 1NC4A 1YZZA 1D5MB 2EDBA 5EN2A 1C5BL 3CSPA 4ZDHB 4BJLA 5HI3C 3F8UB 2VR5A 3U0PA 5D5MB 4I13B 1A4KB 4NC0B 5A3IC 5J12B 3I6KA 3SBWC 1RK0A 2A83A 1BX2A 1KTRL 3H9HA 3QO0A 5BMFH 2X4QA 3F6LA 1EHXA 1EV2E 1CLZH 2ZUWA 2UUDH 5EOTB 3SO3C 4LOUD 1OP3H 4F8QA 4JY6A 4KAQL 3HI6H 1QRNB 4P5TA 3VXMB 1GIGH 3VXTB 43C9A 2MMXA 3R06A 1KCVL 2H8PA 4HSQA 1NCBH 2N7BA 5IOPA 4JFFE 2CRZA 2UYLB 3BXNB 4QHKI 2EYRB 1YPZF 3A6CH 5TF1H 3SJVD 2EH7H 2ZUQB 3ETBF 1MAML 1Z0NA 4I1NB 4OGYL 3LS5L 3NOIA 4L1DA 4K23H 4YXKL 2VL5B 4OFYA 4UU9B 4KQ4L 4QY8B 4KRNA 4YHMH 5JQ6H 5F7KC 4NSKB 4KVCL 4KZEL 4GOSA 1MNUH 2EO9A 3EIFA 2JB6A 2OJEB 1QA9B 3MO1A 1SM3L 3FT2B 1EXUA 1T4KA 4IM8A 3RGVA 1CFNA 1QSVA 3MRBA 4ODHH 2XTLA 1K4CB 4IRZL 1M7XA 1P4IL 4LFHD 4W4NA 1PZ5A 1Q9LB 2VLKE 4LCWE 2AQ2A 4K3GA 5D1QD 5F1IA 1IEBA 4JY5L 5DTFA 3S9DB 1FN4B 3E6HA 1TJHL 2J6EA 2F54E 4KUCF 1ROWA 5JW3H 3G5XB 4LSRL 5TE6H 1JFQH 4ISVA 3WIHA 1HH9B 3OPZH 5DJZB 2IG2H 4HLZG 5E94B 1MRFH 3FOMA 4FG6C 5E08H 3TT3L 1D5BB 1LEIB 4PJEE 4HUUB 4C56A 4P59L 1JVKA 4LCUB 4NT6A 1OB1B 3ZKSD 1INQA 1A8JH 5FXCH 1GSMA 1S78D 4XBEH 5F7NC 2NY2B 4FTVE 1QO3B 5GHWL 1S5HB 5KZCB 4HC1H 3ZHKA 3WUZA 4IRJA 5EZJB 3QEQE 1AC6A 4MHHG 3GIVB 4LCIH 4B7IA 3MV9B 1OSZA 4YO0A 1YEJL 3BMVA 3ZDYF 4AYFA 3L3IA 4S0TD 4L29B 1NSNL 3ZE2F 3RI5F 2ZUXA 2R4SL 5GGQH 5E99L 2AEIT 4PLJC 2Z4QB 3OB0K 1UM5L 1HQ4A 3KPRE 3QH3A 4HPOH 1QA9A 4BZ2L 1KTLB 5ALCH 3T0ED 3Q5TA 2Y72A 1G9MC 4PJXB 5CSZA 4OTXL 4HIJA 3O9WB 1FYHB 4LLUA 1CFTA 1HYRC 3NABH 3W39A 2JJUA 5AG9A 4FQHA 3ULVL 5IVXE 2BSRB 4R0LA 1A6TB 1BQHG 4GS7B 4ODVH 4YHOL 4M5YL 2XFXA 5BV7C 4Y19A 3FO2A 5D7JA 5FYKU 2XZQL 1A1MA 1NEZG 1XIWB 3CVIH 4DUVA 1SY6A 2YWYA 3LD8C 3MNZB 4JDTL 1CGTA 3GZKA 3ULUD 4G80B 4X5XA 4AG4L 4ZNEA 4GT7A 3NN8B 2KQMA 3QT2A 5DD3L 2XV6B 1E4WH 5T1MA 3FFCA 2IQAA 3ZKMD 1A1OA 4NKIH 1D9KA 5ENWA 4LRIC 1QO3A 5HHNB 4ZXBD 3TEUA 5GGVY 4WENB 3GNML 4EI5C 3AAZA 3QRGH 3QR2A 2BNRB 4KXZH 4YR6B 1CFBA 3EW3B 2MSPA 1CT8B 4IDLA 5C3LD 1R3LA 2CLZB 4WW1B 3QEQD 4XP6L 3ZLQC 5C07A 4PB0L 1OD9A 2I26N 1FO0B 2X4OA 1JIBA 1RIVH 1JZ6A 1BD2B 1DUZB 2FECL 4FABL 2Z31D 2DLHA 3UTSB 3VRLE 3O11A 2BCKA 1VENA 2BXZA 4G43A 2IG2L 3D85B 3NFSL 4PGBA 5EBGA 1KPVB 1GGIL 5D72H 4XCNB 3CVHH 1A0QH 5IMLA 2P8MB 4RA3A 1BOGA 1B9ZA 1P4BL 4PJCF 1KELH 1UACH 3MMEA 3CDCA 2VXSL 2XWBA 3BEWB 1FFPB 3NIGF 1TZIB 4XBEL 1OARL 4Q0XH 2K7PA 3RU8L 3DJ9A 1FDLL 5GXBB 2JE8A 2UWEF 3RBSA 5FV2A 2GY7B 1WQVT 1P6FA 1NC2D 3QNZA 1UH3A 5ADOH 2XFXB 2F8XC 1NBYA 4I3SH 1ZWIB 2IAMD 2AJYL 3S37X 1NCAH 3NPSC 4C83B 4KROC 1U8JB 3HZKB 4WI8A 3M45A 1N3NA 3QUKB 5HHOE 4XNMA 1GGTA 4P23B 2R2BA 6FABL 2I5YH 3B83A 1FORH 4G3YH 1E0OB 5K9JH 5IWLA 1NCDL 4RBPK 3J8F7 4RGND 5HHNA 1UC6A 4OTXH 1YQ2A 1OOAA 5DD5H 3C60D 3MA9L 1JZ7A 3BPNC 4JFOB 3F58H 3HUJA 2Q7NA 3PIQB 3ZKND 2NY0D 2D7TL 2O5ZL 4URTB 2HVJB 5DVNA 5JPNA 3TYFB 4D8PA 4J12A 1G7QA 2UUDK 4NZTL 4NYLB 2I9TA 4G6MH 4NKMA 4NQDA 1MHPH 3REWA 2XNAA 2F53E 1IC4H 1NPUA 4WTZA 1RVFL 2FH8A 4XMLH 3VXSE 1SBBA 3PWPA 2VRAA 4I18A 2C1OB 3BD4A 1BFOB 3H9ZA 2A38A 2OJZL 2IPTH 1YECL 4KKNA 5FFLA 4L4TA 5KN5A 4X7DC 1PG7X 4OCLC 4PV9B 3RP1A 3CK0H 4M7ZC 3U2SB 5EC2A 5SX5H 1I9IL 5KSAC 3NCYS 4CJ0A 2DIBA 2HH0H 1FN4A 3RVWD 3G6AA 4XXCC 5HGGS 5J3HD 2JELH 3VGAB 1KGCE 2WZPD 3MROA 5E94A 4CDHA 5KS9B 4QEGA 4XMPL 3TN0D 3ZDXF 5IB1A 4N9GA 4Y5XA 1WBXA 5F7YC 1A0QL 1U8LB 1S9VA 3BN3B 2QKIA 2RFXA 4Y2DC 4B0MM 3JTSB 1JNHA 1TQBC 5KANG 1NUFA 1XF5A 2X42A 4AM0A 1CFSA 4LHJB 1IT9L 5EO1A 1ETZB 3JXAA 2YBRA 2R69L 4Q9RL 2I9LB 4PP2B 4JFOA 1S3KL 4P9MH 2IFFL 3K1DA 2J6EH 3RPIA 3HNTH 1ORSA 1LE5A 4P2OD 5IUSA 3C5ZC 2X41A 3MNVB 1KNOA 1OT1A 1QVOA 2AQ3A 2AV1A 4G6AD 1J05A 3WS6A 1N6UA 5C2UB 4MNGA 1U2HA 2P8PA 1D9KD 1J0JA 5F71A 1TDQA 4NPYB 3HLAB 4LNVA 4XX1G 3P0GB 4L4TB 3JWOC 2QQLH 1MFEL 5F7DA 4X6EB 4HXAL 4Y1AD 4I9WE 3LKRA 1BBJB 1NL0L 1Q1JL 7FABH 3TH3T 2JK5A 5D7IB 4PJEB 4KRPC 1V3LA 2ICES 3I6KB 5IMMB 4HS6B 2X09A 4J3OC 3NFNB 5KVGL 4G6FB 1E6JL 5BRZB 1WZLA 2NY7L 5J8OA 1FSKC 3HE6B 4CN6A 3ULUF 1IAOA 3OAYK 4GKOA 4XAKD 3NA9L 3BPCB 5ACMA 2EH8L 2H2SD 1DN0B 4H0HB 3FFCB 3K8LA 4FQQB 4OF6A 4Y4KC 2V5RA 4YDLC 2CQVA 4HS8L 1GVIA 4PJXF 3VFSA 1MFCH 1NKRA 4OIBA 4EI5D 1Q38A 2BXYA 4YFDB 1RZ7L 2I9LA 4PP2A 5C8JA 4APQB 3U7WH 4HMEA 4CW1B 5FKPA 3E3QC 2IALB 1II4E 1MJJB 3ROOA 4C55A 1HHGA 2OQJA 4YFLF 2C5DC 1B0WA 4JRXB 5EORH 5GSRA 2C3GA 1KPVA 4HLZH 3HNVL 1QLRB 4GKZA 1YA5A 4XHJD 4NQVA 2D2OA 4MAUL 3PDOA 1BM3L 2J5LC 4PJ5E 3UO1H 5E8NA 1J11A 2HTLD 2ZG2A 3LMJL 1CE1L 3WNNA 2W0PA 5C0IA 4ZS6C 1OP5H 4IS6A 2CK0L 1CBVH 1U8NB 3ZKMC 4Y4HD 3G6JF 4FFYL 4CADA 2VQ1B 1KF9B 4QT5B 4NFCA 3I02A 5IKCA 3ECBA 4UV4H 3MRQA 5EA0L 4RDQF 5FK9B 1MFNA 2AP2A 4NQDD 3RJDA 5EUOB 1U8KA 1B4JL 5DVMA 5HSFA 2WWKO 3L5XH 2QR0A 5BRZD 4JDVB 1JYXA 2ZZUT 4U1GB 1A7PH 4DQOH 5C7XH 2W91A 5GSVB 4DZ8B 4PJ8B 1OB1A 4LHUD 3MLSH 2QQQA 3G6JE 4Y16C 1OM3H 4LCWD 3F12B 2E8YA 4LKXB 2Q6WB 3I6LD 3BAEH 4I48B 1VFBB 4F33B 2VDLH 3BH9A 1UKTA 1L7TH 3TVMC 1KCKA 4DGVL 2YD7A 3Q3GB 4S1SL 4YAQB 2GIYA 4U1JB 1I85A 3G5YA 3OZ9H 3QIUC 4DGIL 1ZK9A 3NGBC 4NO0D 3PWPE 3BDXA 1MJJA 3BIBX 1CZ8L 4OGZA 1DBBH 3EYUL 2XQYK 3TO4D 4OI8A 4LU5L 1RMFL 5I18H 2Z8SA 1QSEA 3OKKB 1HYSD 2JJSA 4PJAA 3SDDB 4FQCH 3K2UH 4KV5E 1KEMH 4NM8H 5KN5B 1KB5H 5GQBA 3ULVC 3AU1A 4BQBA 1X44A 3N1PC 4JB9H 3SKOB 3RDTA 3QBTB 4S2SA 4FA8A 1QPPA 1G9ML 5H37H 4ZXBB 2ADGB 5CZXD 4G7YH 4BQ6A 1ADQA 2BOBB 1FGNL 1PYWB 4G6KL 3ARFD 3MBED 4F7CB 5CP7A 4NM4H 2Z8VC 4U6YA 2X4QB 2QR0B 1BJMA 2IANE 3X3GH 4X5XB 4PY7B 3QEUB 4CU8A 4MNQA 1BREA 1AGEB 1JGEB 4Z6AT 4YZFE 3VXTA 43C9B 2EICA 2RIKA 3LQAL 4HJGA 5E5MA 3ARVA 2MQ0A 3B8YA 2JF1A 2ORBH 2AEPL 3W0WE 1R3JA 4JHAL 5EIVA 4FFYH 4YHKH 2BY0A 3RPIB 2ZJSH 1QUNA 2HMID 2NTSP 2R1XA 4WFFD 4EDXB 1JWUB 3UJIH 4DJMA 4Z7VE 1DBKL 4I0PD 5J9PB 3PL6C 1G6RA 4QHNB 1HINL 1T21B 2DJSA 3CPLB 1I7TB 4ELKA 2I24N 2H6PB 4PJIE 1FCCA 4I77H 4D9QE 5CZVL 2CO7B 3STLB 4TUJB 2P8LA 3WFEL 4HMDA 3B2VL 3LZFL 3C6LC 4FQ2L 1NFDA 4HX1B 4QHLA 3RL1A 4EI5A 3IU4L 4HC1A 5DTFB 1R24A 3ME0A 4ZO7A 1R5VB 3SO5A 5E0QA 2NCMA 5D7JD 2VUYA 3C09C 1FQ9C 4MJ5B 4TRPL 1IEAB 4DGVH 4LLVB 3QDGA 2ILLA 3KLHC 3ELAT 3QEHA 3PHSA 1I8KA 3CFDB 2DQGL 3MBXH 2P5WE 3HZKA 5E99H 3HE6A 3HC3L 3RVXC 3K7UA 1PLGH 4C56B 4H25A 1KT2A 5GGTA 4RRPG 4NNPL 4M7JH 4H20L 4D0BA 5L8JB 5ILTL 4QGTA 4R2GC 2H2SC 4KK5C 2NLJB 3HRZB 1UEMA 1ZANH 1IZKA 4NQEB 3QFJE 1TPXC 5D2NE 5CP3A 4UQ2B 3BMWA 3OXRB 5D7LB 4G7YL 4XNXL 4P5KB 2VLJA 4YDJA 1YEDB 3NFSH 1SMOA 4QWWD 5EZOL 1IM9B 5EOCL 1HHGB 3MSPA 2A2QT 3VH8G 2PO6D 2RGSA 4NGHH 5BO1L 3TZVA 1I3GL 2HG5A 4TSBL 1EHNA 3EO9H 4M1GH 2YPLE 4XWGH 3SGJA 1HXMB 4ZYKB 3S6CA 3WMSA 1ZXQA 3UTTA 3IFNL 3LHPH 1GGUA 1PY9A 5DC0A 5E4EB 3SKJH 4QHLB 4MSWB 3PQYA 3HMXL 4M4RA 3U2SA 4JREB 5EC1A 2PTTA 1DQLL 4LRNL 1RURL 1J1PH 1ZLSL 4EUPG 4QRRA 2Y06H 3MBEB 3TBYB 5CD3A 5IKCB 3PP4H 4C56E 1R5WA 1BZ9B 1VPOL 1FZKA 1J8HB 3MOQA 3U46A 1DBKH 4OFYD 2AGJL 4ENEC 3MACH 5EO9A 2OZ4H 3GSWA 4G80A 1N0XL 3Q6FA 1P4BH 4D0BB 4PRPD 2ICCA 5KVFL 5TJWK 3L5HA 3HAEG 5E2VL 1OGAE 3KPSA 5B3NA 3IDYB 2VC2L 3O2DL 2VLKA 2H2PD 3LQAC 4X0KB 3BE1L 5HVHB 3KXFB 4K9EC 3IFLH 2XPGA 2X1XR 5KS9E 4U1SB 5ESQA 2IJ0C 3VXME 2R2HB 3FZUD 2RB8A 1BD2A 1DUZA 5L6YH 3GI8L 4IRSD 1KNOB 4U4BA 4UQ3A 4Y2DD 3MXWH 1IQDA 3W11D 1MPAH 1CF8L 4OLXL 2G5RA 2P8PB 3HB3C 1FVEA 1HK6A 3K4AA 2BSTB 3AU1B 2NY2C 5A43C 3T2NH 3MV7B 4EN3B 4PJHA 3BUYA 4HGMA 5GRUL 3ARBB 1GOHA 2EIDA 5J06A 2BSSA 3VRJA 3P0YL 5I16B 3FFDB 5ICZB 4AJ0A 3T3PE 4X4MA 1F11A 1MWAA 1TLKA 1DP0A 2EIBA 4HUVA 1AGDA 4IHOB 1CGSL 4X8JB 2BNUA 2GTZB 3CFEB 3QUKA 3GSNB 2C1PA 3F7VB 3TO4C 1OAXH 3KYNB 1LO3H 1N7MH 2R69H 1JHLH 1H15B 4M6MH 4ZUWA 4Q9RH 4QHMB 5A2FA 2IFFH 1I1FB 4R9HA 2KBGA 3X3FH 5K59E 3QUMB 4MMXC 4P9HC 5F9DC 3ULVD 4PJCE 2J7LA 3UC0H 2FWOB 2XA8H 1ADQH 4EKXA 1JGVL 4HEPG 1L4IA 15C8H 2VLJD 1NJ9B 2I9TB 1NAMA 4NHCH 3TT1L 1MVUA 5B39B 5DFVC 3L9RB 2HT4D 5KW9L 1G9NC 3G04A 3QI9B 4OD2A 4HWEL 4I2XE 4NOFA 4EBQH 1JWSB 5CBEB 2EDTA 5MEND 3GSQA 3OHXA 3VGBA 3TCLB 4ESKA 1NFDB 2DL2A 4HKJB 3O3BA 4AH2A 4DK6A 1P7KA 3BKMH 4IS6B 2DQDL 3RL1B 4EI5B 4N68A 1MAJA 4XNQB 1S7UB 3RAJL 3FO9A 3VXMD 2EDDA 1JRHL 5I16A 1JHTB 2NPLX 3D2UA 1OGAD 4JDVA 1T6WA 2LVEA 4HFUL 3S37H 3QCTH 5T33L 2I07A 4LVNB 2PW1B 3ZZ1A 4PRPE 5TDPA 4KROD 2A1WL 2RJMA 4LLQA 5FUCC 2R1YB 1NMCB 1IC5H 4KHXL 2PTVA 2CLVB 1RZFH 3VH8A 5DJXA 1XF5B 4LPYA 1YN6A 3D0VB 3MLXL 5I1LB 1ETZA 1MCPH 25C8H 3LRHA 1WVZA 4J6RL 3L3OA 2VLRA 4JQIL 4HWZB 2P45B 3Q3GA 4JKWA 4F7EA 4KVNH 1FRGH 1M7DA 2RCSL 2NY1C 5DRNB 3RY5A 2VN7A 5HGBB 1IARB 3QA3B 3DVNB 3LB6C 5EBLB 3X14B 3QCUL 3EJYC 1A6AA 5I0ZA 3OGCB 5IJVB 1LILA 4RFEB 1ZLUH 2NX5A 1BHGA 1VGEL 3DURB 1YJDH 2PR4L 1EGJA 5H35A 2O93L 1YNTA 1QRKA 4J23A 1HSAA 1H3UA 2MPAH 5DJCB 3GHBH 5ISZE 4RAUB 1TZGL 1CXLA 4AIXA 5I19H 1G9NH 1S7XB 3GSVB 3JWOL 5AEAA 5FO8B 3ROLB 3WIIH 3RVXD 3X13B 1EFQA 3BQUC 2VDOL 3MBEA 3BHBA 1Q0YH 3G08B 5F7HA 4HK3N 3VXUE 1S7VB 1A7OL 1OAQL 5DO2C 5GHWH 2P7TA 1OWRM 5SWSE 4OJFH 4XPBL 4XXDB 3TT1H 2WWMC 3S88L 3TF7C 3E0GA 3IDMA 3BPLB 5I74B 2KDGA 3T0EC 4D2NA 3EOAA 4LCCA 5MP6H 5E1HB 3MRHA 1JE6A 1ZVSB 2R1YA 1AY1H 1L7TL 3DX8B 4EIZC 4PP1D 4BA8A 3MRDA 4S1SH 5F7FA 1QYGH 4UT6H 4QRUB 4YHIB 4F9LA 2FJGA 1KCLA 5TDOB 2RR3A 1SHMA 5F7MC 5I30H 2E3VA 2ZUUA 3AREB 5C0CD 2HJLA 1V3KA 2DTML 3BVNB 2IMMA 1WCQA 2R2HA 2NY0B 4X7SH 1UM6L 4ODSL 4MD0B 1C5DB 5EU3B 5DD0H 3O8XC 4N0UA 4PGCB 4WJ5B 3R0MA 5EU7C 4YC2C 3RUGE 3O3EB 4EVNA 4I3GA 1S9YB 4O02H 2CIIA 1EO8L 2WLYA 4U0QB 1KN2H 4ZFOA 3ZT5A 4KKCC 4ODVL 5F7EL 4Z8FH 1NEZA 1T0NB 3FQNA 5GS0C 3EDEA 5TE4H 1HCFX 1L7IH 3QXUA 2E7LC 4HXBH 3VDAA 4HWNA 4MXQD 3L7FB 3X13A 4FP8H 2W38A 5DD3H 2P1YA 4RMUA 3PWVA 2GAZA 1Q94B 4P2RB 2I60H 3U30C 1KTKE 2XTJC 4NZUL 5DQDL 1KIQB 5DHVH 1LEGA 4JFDB 2BNUB 2ZCLL 3P4NA 2V2WA 5KSBB 5GSVA 4DZ8A 3F7VA 1EK3A 2R9HD 5DMIL 1ES0B 3VWJC 3CX5J 3HC0B 1NMBL 3LKNB 2P5EB 4FABH 4AL8H 2JIXA 2NY0C 1IC7L 4N1HB 4X4YA 1IGYA 1AXTL 2JCCE 5T5NG 4Z95L 4HWUA 4UQ2A 5FCUL 4KI5C 4DEPB 2VLJB 4YDJB 3BPOC 1EAJA 1YEHL 5EH1A 4UUJA 3MLZL 1LHZA 4QF1A 3QJFA 3GRWA 3Q2CA 3SDAD 4XC3H 3RHWK 4H1LG 5F9WC 5KSBF 2XXMB 1I1AA 3L9RA 1KTDB 1U2CA 1T89A 2Y25A 3A67L 3BOVA 3ZTJG 4TVSa 4Z9KB 1VEOA 3MV8B 1FNFA 1ZS8B 3BPLC 4G8IB 1ZLWK 1NGZA 4J3XA 3MLYL 1MEXL 1Q9OA 1AFVL 3S4SA 4KTEH 4KJWC 4BQ9A 4JHAH 4WUUE 4XPHL 3GMOB 1M05B 1MCEA 2DYPB 3IF1A 3PXHA 2YA0A 1OAUL 2WMPA 5C0FA 3QHZL 1J1OL 2AAVA 3C2AL 4OSUH 1SJVA 1YEFL 4NWUH 4BSVB 4Z18A 2O5YL 1GIGL 1ZKAA 3MA9H 2BFVH 3X12B 3SY0A 1CD8A 1NCBL 3GSWB 5SWZE 4UIMA 3RNKA 3ZDXE 3GBNL 4HJ0D 1KN2L 3QCVL 4TULH 1IZJA 2BVQB 5D7KE 4YC2B 4HV8A 1T0MA 1A2YA 1A14L 2A6IB 3SGDH 2YZ8A 4LF3B 1YEKH 4JZOB 5E9DD 2J8UB 5BOZG 2F53B 1KCRH 1P1ZA 3KLAA 1ZGLM 1Q0XL 5FEBA 4KK6C 1RK1A 4D9RE 3VWJA 3GJFH 2H8PB 3EOYG 5FA4B 4FFZL 1N2RA 1T5XA 3D48R 4KY1H 2QADC 5IOPB 3SKJL 1PZUB 1KACB 2EE3A 1YY8A 1HE7A 3BZFB 1DFBL 5B8CB 1P7QA 3RUGB 4RIRB 5IB5A 5HY9B 3B4NA 3ARBA 3H7BA 3OPZL 4K2UH 5IWLC 5J11C 4GUPA 4OLWL 1NLDL 4Z7OF 3DBXB 4UT9L 1YMMD 3CFJA 2DQJH 3TT3H 5EZOH 3P9MA 5E8DH 1N6QL 1MCJA 1EVTC 2JB6B 1FP5A 3QDHA 5JXAL 5MENA 5DRWA 2VZVA 2CKBA 2CKBH 2DDQH 5LXGL 5D71H 1AGDB 4EOWH 2BMKA 2UWEA 3DVFA 4UIMB 3UPRB 5DSCA 4Y4FD 5CEZD 2ED8A 2APBA 4XP4L 5CINH 2KZ1B 2B4CL 1DDHA 3SCMB 3WLWC 2V17L 1JNJA 2J88L 1SJXA 3N85L 4QTIH 5L6YL 1ZLSH 4LVOC 3IJYA 5DJ8A 3V0WH 1SVCP 1DVFB 1LEIA 5DMJB 3RGVD 3UXFA 4JGMA 4HK3J 2V5YA 2A9NL 3U4BH 1VA9A 2UZIL 1K4DB 5DT1H 1IM9A 1J1OH 3QHZH 2C4FT 2GJ6B 5ALCL 4L3CB 5HHOB 5JHDA 5SV3A 4RCAA 1FNHA 3DYPA 3SOBL 1IFHL 4PJFA 4IJ3B 1DQDL 5D8JH 2BC4B 1FC2D 5SV4A 2MKLC 1X5AA 1C16B 4MJIE 1CK0H 3V8OA 4JM2B 1T1YB 2HMIC 1ACYL 1T2JA 1N8ZB 1S9XA 1WWBX 4JPKL 3RWGB 3MBEC 2W0KA 4F57L 1B6DA 5BS0B 3GSRB 3EUUA 3RWJA 3BP7B 3WUWA 2VISB 5E4EC 2X4TB 5DRZB 4I2XB 5EULV 3BKYH 4QRQA 4E0RA 1R0AL 3MZTA 5GRZA 2HLFD 2X40A 3SDCA 4KTYA 4YHLL 3PP3H 1UH4A 4OD1H 5C08D 3OF6D 4L3ED 2HN7A 4KHTH 3GSUA 4JRXE 4WIQA 3P0VL 5KJRL 2YD3A 3D69A 4ZPVA 4V1DA 2AJXL 4WTWA 5FYKH 4ELME 4X4YB 1OCWL 3PF2A 4WW2A 3RNQB 1MCHA 1PKQA 4LEXH 3MRFA 3FQWA 2JIXD 2Z35A 4ODWA 4GW5A 4LPUA 4RAHA 1KEGH 4NHUB 1R3IL 3O3AA 3O45A 3NN8A 2X1QA 2OTWA 1AE6L 5IGXH 4OQTH 4R90H 3T2QA 4F2MB 3D25A 4UIKL 3ZKQD 5DJ0A 3MLTB 1NGXA 2QHRL 3L3GA 1OARH 3BKML 3LKQA 4LDLB 5C0JA 3DSFH 1FDLH 2XICA 4P2QE 1CLYL 3FTGB 1G84A 1QBML 1ZHNA 4HCRL 4UU9A 4LKCB 2B5IC 3IDGB 5FA3A 1QLFA 1F3JA 3OKMB 1B3JA 4JN2A 1H3PH 3CFCL 4NO0A 5IW1A 3PDDA 5GJSL 3ZO0A 1KBGL 4IOSD 3CZFA 5JO5B 1INDH 1MWAB 1YMHB 1JGLH 2GT9A 1UVQB 4ZUUB 5TF0A 3RA7L 2YD2A 3DETD 3H9SE 2VDLL 2GTZA 2VH5H 3MLRH 2DM3A 1NAKL 1YEGL 3GK8H 3QDGD 4KKBD 2UVEA 1K6QL 2BVPA 1JJUA 2D7TH 2PYFA 5FUOH 1INEH 4WW2B 3RNQA 1RHHA 2EKJA 4OD3H 2BNQD 3B9DA 3BP5B 2DM2A 5CJ8A 4AIOA 4NRYB 4DN4H 2ZUYA 5JOEA 4XC1H 3T0WA 3DRTB 3TBSB 1PJ9A 5J6GA 1TXKA 3IJHB 1VERA 5C0RH 3CLFH 5GISL 1RZKC 4EN3C 1DQQB 1PX4A 4JFEB 4XZUB 5B39A 4MQ7A 4PJBA 1HHIB 3IS0X 1WIUA 3D39A 5F9JA 5I19L 4RX4D 3H9SD 2LAGB 3CX5K 4QRPA 1BPVA 1T0NA 4EI6B 3ZDYE 1CD1B 2IADB 2ADFL 4LHUB 4H0GA 1VFUA 4TSCH 5EUOF 2PNDA 1YNLL 4U1MA 3L3JA 1U3JA 1KPUB 4PRBA 2QSCL 1K9TA 1FAKT 1JTOA 1BQHB 3UAJD 3WDHA 1Z5LA 4GRWE 3G9AB 3QDMA 4X6CA 3TO2A 1HSBB 5JORA 5CD5C 5D2NC 3R8QA 3T09A 3BPOB 1UVQA 2EDLA 4ZUUA 4Q9BA 4POUB 4GW1B 1KIQA 3OBAA 1S7TA 1QEWB 4LLWB 2AEPH 5C0BB 1SYSA 3C5ZB 2GSIA 1T83A 2RQ8A 3WNPA 4AIZA 2MCG1 4MCZA 3ZTJH 1I85C 2ZJSL 3RWHB 2XKSA 5DZNA 4X7EC 4MQXC 1G6VK 2DI7A 5JR1L 2J8OA 1RZIB 5ID1B 3KGRA 5FGBA 1D5XB 1KCVH 3MRIB 5JW5B 1UZ8B 1BVKB 1CU4L 2XTJB 1Q8MA 4RNRA 5T3ZH 1FG2B 1T2QH 1VKXB 3B9VA 4P2OB 1ZT1A 1XR9A 4KJPC 4NDMA 5E9DA 4XPFH 1S9VB 2IQAB 4JGJA 3QYCA 2WINB 3S5LG 1PSKL 4JO3H 4JKLA 4KQ4H 4NO5B 4X6BB 3TO4A 5IJKC 3A6BH 5CSBA 2ICEB 2YEZB 4Z77B 3DX7A 2IBGA 1QYGL 5AZEH 3L3DA 3WL9A 4OFDA 4JHWL 3VJ6A 3ARGC 4KJYA 5DURD 3MBXL 3W2DH 1LE5B 3FB6A 3GJEA 1WTLA 3D39D 2Z9TA 3AUVA 3IF1B 4PJHF 2QSQA 4S1QL 1HHJB 4E41A 1F8TL 2JB5L 2OJEA 5JORB 5D6DC 5HYJA 4XCCH 5DUMH 3M1BB 1GC1H 2AABL 2FIRT 4PRIB 4DEPC 1K8IA 1WICA 1KIRB 4IOFC 4Q74A 5JW3L 3SGJC 3VXOB 1RU9L 4FTVD 1A6VH 4OZFB 2B39A 2ZSWA 3IYLW 4NUGL 5HHME 4HHAA 2YSSB 3C8DA 2NY6B 4IDJL 2HN7B 4PJDA 2ZOKA 4L3EA 1FLTX 3ZE1E 3B6SB 3QIUD 5EOCH 4F7MB 5IMMA 3RX5A 3VFOA 1V05A 3DROB 2F74A 5DJ2B 4LL9A 3KDMA 2WUBH 5KSAD 1BWWA 1DBJL 2HJLB 5IESH 4GW5B 1D5BA 3U48A 3I85A 4WHTB 5E9DB 3B9EA 1NANI 3QNXB 3ARBC 35C8L 1HWGB 1UA6H 2C3VA 5DFWH 4LBEA 5FA4A 3C6LA 4XB8A 5IBTH 4KZDH 1EJ6A 4OLUH 2K7QA 4NZJA 3WLBA 2JJWA 3CAFA 4RZCA 4PRHD 2AERT 2EXYD 4U1GC 5EU5A 3V7AE 5LWYH 2XZAH 3HE6C 1XF4B 2QEJA 1HEZA 2OR9L 4G9FA 1OAUH 5INCB 4C4KT 1MRFL 1JBJA 2KL6A 1ORQB 1JZ3A 1ZA3B 2P49B 3DO7A 3K0WA 3HKFA 5HHVL 4IIQC 2CDGB 4ZO9A 4HIXH 3MFGB 1QSZA 4NQDB 3JV5A 4J1UA 4BZ1H 1UFUA 5TH2A 1CDBA 4KQ3L 2VE6A 3CZFB 5JO5A 5H8DA 2FX9H 2VDML 1JYNA 4OV5B 5B22A 2P43B 1J18A 3VFRB 3JTTB 3MRLA 4LSUL 3O9WA 4LLUB 4PGEB 5C0IB 3E8UL 1T22A 4Y88A 1AKJA 5L2KD 1MIEL 4AZ8A 2BVYA 2AQ1A 4I4WB 5F96L 5ESVA 4WO4C 3VXPA 4R7NB 4BUHA 1CGWA 1FE8L 5LJYH 3V0AC 5DJ2A 2FO4B 1BECA 4HPOL 5HD8D 1AGBA 3U30B 4MA7L 3RL2A 4POZD 1FZOA 4I5BB 4S1QH 1F02I 1U8OB 4PREA 2RFXB 3NBNA 3HZVA 4PJBB 3ZSTA 2X9XA 1KIPA 2MNUA 3GI9L 3DMMB 4N0FA 5CJ5A 5EO0B 4HW6A 2DWDA 1C16A 3ESUF 3CSYA 3H3KA 1A14H 2P24B 4H8WL 4XVJH 5CEXA 1WK0A 4QY8A 2R15A 3UBXB 1W8OA 3T4YA 4KTDH 2E6PA 4ODUA 1GL4B 4DKAA 1NEUA 1F90H 5D71L 4PD4K 3SDCC 4XP5H 5IW3A 1N7ML 1HSBA 1IGJA 4M6ML 1Z9SA 4UTBL 5BVJB 1U42A 4BSVA 3MRLB 3FO0H 1ZA6B 4FN0A 4OF5A 1V7MH 1QRND 4CAGA 1TZIA 2LQRA 3BRDA 1MQ8A 5I6XC 4KPHL 3FOLB 4X6FB 3ULUC 1D5ZB 2XA8L 4KRPD 2OSLB 3TV3L 3VXRE 3TJHC 3QQ4B 5CIPH 5F1NB 5L7XL 3P4OB 1I1YB 1CFVL 4JAMA 4B41A 3NTCH 3UX9B 3INUH 1MQKL 3MRNB 5BS0D 3UJIL 5E6ID 4AEFA 4G6JH 5D72L 1UWGH 2X05A 4QNPE 3RKPA 1JMZA 1OD7A 4PLKC 1DQDH 1A3LH 2VZTA 2XRAL 3CC5B 5E2UL 4XVSL 4Y16A 4UI2A 2WINA 4QNPF 1KFAL 2CDEB 3OR7B 1J88A 2X2YA 4ZO8A 1XF3B 1X4ZA 3TGXA 5C9JA 1EGJH 4PD4J 4XMLL 2Y6SD 1FC1A 2W92A 4FFWD 4CW1A 3QWOA 1BAFH 2BSED 2PYEB 4TTDD 4JHBA 2IPTL 5ID0A 2MWCA 3MLWH 5LCVL 1BFVL 1T21A 4RAVB 3VXRB 5IP4A 3LN9A 1J8HD 4MQTB 4NN7B 2BHUA 3L6FA 3VWJD 3SJVA 3MOAL 1CXIA 2ERJB 4J3VA 1P2CB 1MCNA 2EIZA 2IPUK 3REVA 1HILB 2A6KB 2FX8L 4M48L 5EBMB 2XZZA 4M5ZL 1U95B 2WUCH 3IB4A 3HMWH 1OCWH 3O9WD 2OR7A 2R0WH 5JIHA 1S5IL 1K8DA 4C4KO 1E4KA 1IBGL 1YUHB 3H2WA 3GSXB 1X9QA 4LAJH 4MXQC 1A1NA 4DFHA 2HT2C 1DQML 3MV01 4M6OL 4E42B 1IQWH 3FB8B 1KCUL 1JPSH 3H0TB 4M8QB 3VRIA 1T1WA 3R8BB 1NUDA 1YECH 2HVKA 3EGSA 1WWWX 3QNXA 4TVPD 1TTGA 1OQXA 3U7AA 2P44B 4L3CA 4P9ML 3KPMA 4Y2DB 2X4PB 4U2YA 2H1PL 5H94A 1HHIA 5L2KA 3VMOA 1VFBA 1XT5A 5BXFB 2E27L 1JN6B 5JPMB 5DJDA 1BEYH 3L7EB 4QRPB 3BYYA 1M4KA 3DHJA 3MLUL 4BSWB 1KENH 4LEXL 4U1JA 2XWJB 1E4KC 3VGAC 3DO7B 4MQSB 2X9YA 3RA7H 3B9KA 4NSKA 5E6IB 1AQKL 1UM4H 4N8PA 1AY1L 2EEAA 2EE6A 2HFEA 3S96B 5EBWB 4Z0BH 1Y18A 4DTGH 1EEYA 3VMPA 5DK2A 1F3DH 5F21B 1INEL 1N5AA 1ZLVH 1CYGA 4YQXH 4ZXBA 2DICA 2NY7H 3GSUB 1WFOA 1S7RA 5TGBB 1ZV5A 4QOKE 4K3EL 2PN5A 4P2CG 2B20A 2EKSA 1Y6KR 2AJZA 1FZKB 2XQBL 4ETQB 3LEYL 4OZIB 3UPAA 4KXZI 5M95B 1WV7T 5DHYA 3MXWL 1I8MA 1PGRB 4OCSL 1INQB 3BPCA 4Z5RB 5FCSH 5IROC 1OF2A 2C9AA 1S7QA 3QFDB 2XT1B 4BK5A 2KQNA 5FM5O 3MV8D 3DWTA 2HWZH 1ZHKB 3W5MA 3ARED 4KVCH 3PDGA 1IRAY 4M03A 2K3TA 3HUJB 3LH2L 1L6ZA 4NRZA 4P57A 3R1GL 3P0YH 2D31B 3U9PH 3ZTNL 2WP3O 1FZJA 4DKEH 1T3FB 1F3JB 2LTQC 2UVFA 5DMGD 3OKLB 4K7FB 3TA3C 4KGLA 1KTLA 4KUZL 3NA4A 3KPNB 4XNYL 3DIFB 5JDSA 5C1MB 1K8IB 1CFTB 1KIUA 3W39B 1N26A 3VG9B 4HX1A 1JHKH 5I2IB 1TPXB 3HPJA 4S11A 1LDSA 3S4SG 4PTUA 1E4XH 1CE6B 5HD8C 3CXDH 3H3PL 5F97E 3L5XL 3MLZH 1HZHL 4HUKB 4TSCL 4DGYH 1YPZA 2Y5EA 3FO2B 5D7JB 1JTPA 1TTFA 3QDMD 3VFMA 2IH1B 1BX2B 3RWCA 3NMEA 3QEHB 2AV7A 5ETUB 1ND0B 5AWNH 3DRTA 4H25B 2C1PB 3EYVB 4FMKA 4JO2L 1Z9MA 4ZSOB 4GBXC 1RPQA 4R4NC 5LGHL 3R06B 4TVPH 4DZBA 1JNHB 5IEKA 2FBJL 4XAWH 2DMCA 4M1DL 2HRLA 2EE9A 2GUOA 4YHZH 1OGTA 2APFA 4LSSL 3BZEA 2VDNH 2N7AA 4NQUA 1T6VN 2VXQL 4NRZB 3PGFH 2AJUL 1LDPH 2F53D 3EDKA 4W68A 2O61A 3QQ3B 5ANME 4NM8L 5LBSH 4WWID 2OXGA 1RJZB 1S78C 1C5CL 5DEFB 2OS7A 4HD9A 5J12C 5DXWA 5TH2B 4YDKL 3BPNB 4W6YB 1A6VL 3VXNA 3FT2A 5IMLB 4PJAB 1AHWB 2H32H 2VXSH 5IVOA 4OCWL 4GW1A 4FXKB 5E4IA 2GFBB 5DS8B 3TCLA 4BH7A 2MTPA 5FKAB 5C0BA 4OM1L 3MREB 1P7HL 1ZHBA 4D3CH 3IDNA 1ZGLA 2ZNXA 3OZ9L 4R2GB 4Y4KA 3UZEA 4GRLC 5FYLD 2F5BL 3LAFA 1NBZB 1ZWIA 2HYMA 2FLBT 3Q5OA 4U3XA 5MEOB 1F4HA 4FFZH 1BZ9A 2HTKD 3VCLA 2EDNA 3GNMH 4QXGL 3HAEH 1NGPL 3QI9D 4YHYB 4LEOA 1VKXA 3K2UL 2I07B 2XQYG 1D6VH 1VGEH 3DPBA 1RULL 3VFUB 2R2BB 4MA8L 5EWIL 1TCMA 4MX7B 2NQCA 3VD9A 1RU9H 3KPMB 1NUNB 4YHKL 3MUGB 2JCCF 4LLYB 5IHLB 1V3JA 4MMZC 2Y9RT 3D0VA 4JO1H 4HEME 2DL9A 1U91B 5IK3B 1R3JB 3QDAA 4HIXL 3WFDH 5EO0A 3PNWA 2J5LB 2CGRL 4WWKC 4DWHA 4WDIA 3WE6A 2KH2B 2DQIL 4H8WC 4Q2ZA 1OSZB 2CUMA 1CXHA 2XWJA 5HGBA 5GS0L 3O2WL 4NYLA 1DBJH 1E4JA 3SPVA 5I1GH 3REWB 3C5SA 3O8XB 1RJZA 5GZNC 3AM8C 4N0YL 4U05A 2ZUVA 5FGCE 3QIUB 3QG7L 2B4CH 4DCQA 1MIEH 1AHWA 1HSAB 1KV3A 4PRIA 2V17H 1IGMH 2G2RA 2D0FA 3N85H 4UTAH 4OLVH 1S7XA 3G6DL 4F9LC 4V2BA 1OGAB 4PP1C 5FO8A 4JN1L 2VXUL 2DRUA 2Q3AA 1I8IA 2X4SB 4FQXA 1HI6A 2YN3A 4FRWA 5ICZA 4OZ4A 5GIRB 3H9HB 2AJZB 3SOBH 1BFTA 3SDXE 2F19H 1IGIH 4JDZB 2F54B 3V4PH 2QV2A 5CS7A 5L88L 1RZJH 4OGXH 1QBAA 5CZKA 3LRSB 3QULB 2A6DB 3HTLX 5D93B 1T20A 4FQXC 3CSBA 4JPIB 1OF2B 1GYAA 1DBML 4GW4A 3BQUB 4DAGL 3QIBB 1PEZA 5KAQG 1WT5C 1MHPL 4NQEA 3ARDC 5F96H 4ZUTA 2BHZA 3OAZH 4PJBF 2BVUA 4G8FB 1XF4A 1XGRB 2G9HB 2XACC 4WDIB 1MLBB 4L5FL 3KYKL 3G5YB 1R0AH 4GAYA 4K3JL 4Q9CA 2R39A 1P7QD 1EEZB 4WO4B 2BCKB 4N8VB 4MS8C 4NNPH 5CWSB 3MJ8B 2QSVA 1P2CA 5DLML 3KWWA 4ZFOB 3VFTB 3DARA 5F6HI 1CFNB 5CGYD 1HXMA 4ZYKA 4KI1A 3OHXB 2F5AH 3QDME 4YGVA 4GO6B 3GO1L 5IVXB 5I2IA 4GSDH 4DFIA 2Z31A 2WBJD 4XNXH 1RZKL 5IBLC 3MRCB 1K8DB 5DJYB 1NBVL 5I1EL 1UZ6F 1MCDA 4IIQB 3HUJF 2W9LA 3BKCL 5LGKA 1RUPL 5BCAA 5HI5C 4YBLC 5GJTL 4JPWH 4ZUVB 3KYMB 3Q6FB 3QEUA 2A6DA 2PW1A 3BZ4A 2VWEC 1J1XL 4XI5C 2RBLA 3T4AA 4X4XA 4XVTH 2DLFL 2DQTH 1S7SB 3QIBA 4QXUL 1LP9B 2Q20A 3DXAD 1DQLH 3U9UA 5KSVB 2H32A 2R56H 1U9KA 4U0RB 4OF3A 3G6DH 4X0KA 4AEEA 1AO7E 4Z78B 4R3SB 1T03H 1ONQB 2X4UB 4WI9A 1JGLL 4L4VA 5JUEL 3GRWL 2NY6D 1SVZA 3PGDB 3QDJD 3QA3A 1T7YA 4NKDA 2OQJB 4K71B 4JZJC 5C08B 2IANB 3U1SL 1KLGA 2UZXB 3WS3A 1MOEA 2HKFH 2YR3A 3H9SA 4KI5D 4LPWA 1IGIL 1FGVL 4L8DB 2MQCA 3VGGA 4U0RC 4MAUH 1U3ZA 1FNAA 1XCQB 3RVWC 1CIDA 3SGEH 1OLZA 1FVEB 4JFFD 1Y6MR 1IBGH 3I84A 1KJVB 5D1ZC 3LOWA 3TN0B 4PV9A 1YY9D 2SEBB 3BUYB 3DUUB 5DURB 4WHCA 5CHNA 4J8RB 1PG7H 4FXLA 3VGFA 2R0ZL 4ONGH 5FDWA 1KJ2L 5CLTA 3G08A 5T1KD 1QLEL 3ECBB 4UDUB 2ATKB 1S7VA 3MLWL 3KYKH 2LFGA 3MRNA 3W9DB 1AKJD 1YEIL 2B0SH 1A7PL 3TZVC 4P3WA 4J2XA 4GKNA 3I6GA 5JNYB 1MJ7L 3VFUA 3RNKB 4P9HH 2OK0L 4XNUL 2ADFH 4PS4H 1N5YH 3QEGH 2BVQA 1LO5B 1PQZB 2Y1VA 4XTRD 2ZOLB 5ACLA 4CU7A 3O6LL 3OR7A 4MXVE 3GBML 5DUPL 5KSVA 1WTGT 4G5ZL 1WCBB 4TUKL 4DUWA 4JZOA 2M2DA 4U1KA 5I1EH 1ONQA 1MWAL 2EDKA 3BVNA 3TVMD 2ARWA 1F6AB 1MH5A 3TPUB 1IM3B 1W2KT 4UOW0 4KC3B 1BJ1H 3FN0H 4X9HA 4U7MA 1ZT7B 2Q8AL 3HZMA 1MHEA 4R7DB 3V95A 4HAGA 1OHQA 2P8MA 4YQXL 3SDDA 3GSQB 1NEZB 4EUPB 1LMKA 5FO7B 5FDYA 5F7DB 2FZ3B 4UILL 3MRJA 4U1LA 5ALBL 1KC5H 4HPYH 4Y4FB 5EU4A 3HPJB 2DQUH 3PQYB 1XGPA 3QXWA 1AR1D 1KN4L 1F4YL 4AY0A 2C4XA 2IAMB 4GUPB 3U7YL 4QRRB 12E8H 3PJSB 1T03L 3IT8D 3ARYA 4NRXB 3U4BL 3BAEL 4JM2C 5GGVL 5T5NF 2AXFA 3O0RL 2X10A 3U0WL 4AEIH 4F7TA 5DQJB 2KZWA 2OM5A 3CSGA 4NUJB 5TFSH 1L0XA 4YUEL 3C6SA 3RFZC 3ARFA 3WXWH 1MRCH 5HDLA 1ES0A 3MOBL 2VYRE 5HHQB 4PJGF 3NCFB 1HNFA 2B8OT 3CLEL 5IEKB 2IEPA 5DVLA 3P11H 3NCYP 5D70L 4G8FA 2BOCA 3JWDH 4K3EH 3QIWA 4JFXB 3AROA 4OBRA 4XCCL 2HA1A 4YO0B 5JPNB 3BX7C 3KPTA 4QRRD 2NXYD 3ARDD 4KUZH 4ODTL 1MAKA 5J9PA 4M93B 1YQVH 4NJ9H 4Z7NF 4YGAB 3VWKA 1O0VA 1X4XA 5HXMA 1QFUL 1D3CA 3BRGC 4I9WD 1A9BA 3KPPB 5D6CA 4PGJA 4ZNCD 4HMCA 3NH7H 2BRRL 4DGYL 1W72L 4LSPH 1I4FA 4MVBC 3UTQB 1IJ9A 5FECA 5C2BH 3MA7A 1NQBA 1CD0A 4W4OA 1E6OL 5MHSE 4ZTOL 4XMPH 2DYPA 1JNNH 1L6XA 4UZGA 3MJ9H 4U7KA 5DVOA 4P5TC 4PJ7A 3K3QA 2F15A 2YUWA 5I75C 1J0IA 2W60A 3GSNL 4OCMC 2OL3A 1FLRH 3AY4C 3EFDL 4ZUVA 5A2KH 3EOAB 4LCCB 2J12B 1JGUL 2VSDA 1CGUA 3VG9C 2DQCL 3C09B 4LSSH 4OZFG 5JW4N 4XRCA 3G9VA 3FN9A 1GJIA 4FQLH 4F33A 2OTUB 2YS4A 3T65A 4NQEE 5SWQA 5JMRA 3QG6B 2P46B 1MAMH 3O6FB 5EUKB 3WS6C 4MD5B 4JJ5B 1H3PL 1YEDA 4JM4L 3B2VH 3LZFH 1XR8A 4OJFL 3A6CL 3RWFA 3D18A 1G7JA 2CJUH 4CJ1A 3C9NA 3K74B 2NR6D 3LDBC 3VW3H 4JKKA 3WN5C 4K7FA 1G0YR 4KMQA 3C5ZD 1QOKA 2NZ9D 3KPNA 1FIGL 4FP8L 2ZUQC 3NFPB 1MNUL 3SE9L 3BEWA 1SM3H 2HLAA 5GGUB 4AMKH 2ZCKH 4WUUA 5F8RC 1LP9F 3B9AA 3WD5H 3QNZB 5BZWB 4PRIE 2BOBA 1YPZB 4XC1L 4PJ7B 3RWEA 5HYQB 1T1ZB 2EH8H 5GIRA 2CKBB 4N5ED 5C0EB 4IRSC 3QUZA 3SO3B 4P2QD 2BZDA 3WKNA 4OLYH 4ODTH 4LSRH 4M9PA 5TE6L 3EO1B 3MJ6A 3QWRD 2NY3D 4M93C 4Z7VB 5HPMB 4PJDF 2BRQA 4EDWL 1T20B 2LAAA 2W07A 4PTTB 5E08L 3EJJX 5DWUH 4JM2F 1PQZA 4MNQD 2XKNA 3VMNA 1KYOJ 4OCXH 3NZ8A 1CTOA 4X7TB 1CLCA 1AO7D 1F90L 4UT7L 2WNGA 4KZEH 1DUYB 2BNQA 2YWZA 3T0VA 4GRWB 3HE7D 3L3OB 4HC1L 2XIDA 1U8PA 4NKOB 3GJFB 5C0AA 2DQEL 5IVNA 1IGFL 4FQ1L 4NQTA 4RMQA 2FJFA 3RWFB 4KI5E 4B50A 4IMLB 3IFOA 5D1XC 1G1YA 4KPHH 3CH1A 4L3EE 3NZHH 2V6HA 1MHEB 1J1PL 5K9OB 2VMFA 3WBDA 2VAAB 3VI3E 2ESVA 5IB3A 5IB4B 1UB6B 4NOBA 3IXTA 1JGDA 4IRSA 3MRJB 2OBGA 4U1LB 4BZ2H 2HLAB 1QFWM 2Q76B 3DUSB 4HS3B 1LO2L 2OZ4L 2WV3A 3ZT6A 3HHRB 4ZS6D 3ET9F 3GM0A 3K46A 4MXWL 4BZYA 4XVSH 5FB8A 1T7XA 1F11B 2NY4B 4JDTH 1RI8A 3ILQD 4KMTL 1A7RL 1S7TB 2X44D 2CJUL 5IB1B 1KB9J 1S9KC 4XPTL 4JZJB 3Q5YA 4PJ8A 3MRHB 4OFIA 4PTTA 2VQTA 4QOKB 4NCC1 4XPAH 2FH6A 3V4UL 1BAFL 4HJJL 1WAAF 5TDNA 4D9LL 5E7BA 5J7CC 4JFPA 4ZAKB 1MFDH 2ED7A 4RDQG 2EDOA 3THMH 1VFAA 4L9LA 1CFSB 1GGYA 1FH5H 1XF1A 3SDCD 2ZCKL 4HIHA 3C2AH 4GAJH 4OSUL 4QXWA 2J8UA 3J7HA 1K85A 3S3JA 4GXVL 5HYSB 4NWUL 3QAZC 4G8EA 3JV4A 3O3AB 1SEBB 4C57C 1ORSB 3RX7A 2BDNH 4LCCC 4QOKD 2WIMA 3I75A 1MVUB 1MI5B 1UH2A 1RZJL 3SN6N 1A7NH 1SYVA 1WZMA 3EKCA 4JY4B 5CMAA 1Q72L 4CDGC 1DLHB 4Z77A 3BFOA 1UJTA 4BM7A 5HYIA 5D1QB 4XGZB 4AH2B 32C2A 4OAWA 4HIEA 3BGMA 4O2EB 2A77H 5LXGH 2L7JA 2VXVL 1O7VA 2EC8A 4JANA 3RTQB 4JN2B 2X4SA 1EBPA 1IKFL 1BQLL 5SWZB 3JSSA 3L1OH 1OPGH 2PYED 2BMKB 4O51A 4WY7H 1GOFA 1NCAL 4M00A 1CL7L 5DSCB 2OLDA 2FEEI 2WQRA 2APVA 1U93B 2DS4A 4FQQA 4YH6A 3EJZC 4HJGB 3MLVH 1A9EA 4PPTA 2WM0A 3FQTB 1RHHB 5EFIA 3VFSB 3HPLA 2Z93B 1HCVA 2UY6A 1OL0A 5KW9H 3NAAH 1UB5B 2Y7QA 4PJ9D 3FHAA 3SDYH 1Q9WB 1MFBH 3KXFA 5T1KB 2BJML 2CKBL 2DDQL 5FYLL 1UACL 3TPUA 3JV4B 1VESA 3CXHK 1XCTA 4A6YB 4PRPA 2GJ6A 4WUKH 8FABA 5GGRA 1RY7B 4JFQB 4JE4B 5H2BA 5GS1B 2R8SH 1PKOA 3FFCD 4UB0L 3V79C 2XN9E 2PXYA 4KKAD 2NY3C 4GRLA 1KYOK 3L95A 1QFWL 2E9BA 3V0WL 2DQHL 5IF0B 2HH0L 2E7BA 2VLRD 3RWGA 1WT5A 1UGNA 4XNZC 5IT2L 2CXGA 3IDXL 3BZDA 4OD1L 4W6XB 4OB5L 2DD8H 3MRPB 3WO4B 1NC2B 5C0EA 4I2XA 3AC0A 3DXAB 1U8HB 4LQFH 4M7LH 4F7TB 3P4LA 3IRPX 1C7TA 3Q48A 1QACA 1JUFA 3BSZH 3BT2L 4OQ1A 3E2HB 5DR5H 3AGVA 4QCIB 2AXGA 1T5WB 4HKBA 4ZUWB 3S8WA 1A9EB 2XWTA 4EEEA 5D1XB 3IGAA 1SY6H 3OKNB 4RMTA 5I1IH 1IC1A 4LVHB 5IM7A 5ITBL 4MDJA 4KDTC 1DSFL 4BFGA 3AREA 2WLZA 2FX7H 1B2WL 3EO9L 4M1GL 3CZJA 4OZGF 4L8SC 1YN7A 3ESVF 2DIAA 3RVTD 1VFOA 3DNKA 3FO0L 3VWKB 3ES6A 1I9IH 5FGSA 3WNKA 1NGXB 2XN9B 1OPGL 2DJ4A 4HPYL 3QEGL 4EZMA 4NQCA 5CBEA 3KPPA 5D6CB 4HWBL 4P99A 2V2XB 1RURH 3HAEA 3FTGA 1NCTA 3CUPB 4YDIH 7FABL 3E1F1 4OI9A 5HDQL 2NZIA 1CFVH 4TUKH 2J3SA 3BESR 4J8RA 3PGCB 4F3FA 3O0RH 2H2PC 3U0WH 4P5TD 2YD5A 1ITCA 2I60L 1QFWI 2X4NA 4K55A 3MLRL 4TVPL 2IFGA 2YXFA 4OCRL 3GMNB 5TQ2L 1DQJB 5HI3D 2IBZX 1MCLA 2OMBA 1D5ZA 2J6EL 1W0WA 5INDA 4HCRA 2R8SL 4DN4L 5E5MB 1EGJL 4UB0H 5JOPE 4ORZC 1OSPH 1AXSB 1C5CH 1E27A 1QFPA 3QO0B 4D0CA 5C0DB 4WU7A 3JUZA 2QQLL 2ADJA 5GGVH 2CIKB 1Y0LB 5FUZH 4GXUN 3GMQA 4HT1H 2V5MA 4HIIB 1UJ3A 4KUCD 1QSFA 4R4BB 3WXWL 1H0DA 1XF3A 3ILQC 2F5BH 2PO6C 5BQ7B 1UCBL 5SWSD 1JWMA 1JYWA 4OZHE 1BIHA 4LHUA 4O58H 4NWTL 1B88A 3DETC 4X99A 1HWHB 4HJ0C 4U1MB 4ZXBC 5IBUG 3ULUH 2C7UB 4LPTA 3LMJH 3VFPB 3CCHA 1X5YA 1CGSH 4CGTA 3GSNH 3TNMA 1D9KC 1AGFB 3C8KA 3L6FB 5KOMC 1I1RA 3MXVL 2FX7L 4JFYA 1AH1A 2V9QA 5BZDB 1JK8B 1KJ2A 3VDBA 1MELA 3WXVH 3WN5A 3CMOH 4X6DB 4XB7A 4DQOL 5C7XL 3I50H 5A16B 1X5KA 2H1PH 3CFEA 5E70A 3GKWL 4K7PH 5KVDL 3KYNA 4M5YH 2E27H 4FNLH 5GZOC 4PG2A 1JPFA 2E7MA 4MJIB 2VDQH 3QRFM 1T2QL 4WWKB 4E41D 1YUHA 5MI0C 3T8XB 5C2BL 2JKXA 4QRUA 4YHIA 1XGQB 1I1CA 4JM4H 1YEKL 5EFIB 3SGKA 5CFHA 2IMNA 1JNNL 3FQWB 3QIWB 4PV8A 3ZYIA 4WU7B 1X5GA 5IFJB 3KYOB 3UO1L 4AQ1B 4LSTH 2BERA 1P5UA 4MD0A 3IFOB 4PREB 1T66C 3CH1B 5DK0A 3MLTA 3H42L 5HHMD 4RFNC 2P5WA 1G0XA 2DLEA 1CD9B 2PCPB 4GLRH 1T1XB 3MCLL 3DX7B 3DMMA 4N0FB 2Q8BL 2W0FA 4WCYH 3IETB 1P7KB 5HY9A 2HFFB 4LKCA 3QPQD 4KH2A 3IDGA 4P2OC 3TFKC 5IIEB 1U8MB 4U1IB 1BZQK 5IROA 3LV3A 4NUGH 2Y5TB 2NNAB 2VZOA 1R5WB 2FSEB 4ZFFB 4L9LC 2VDRH 3ARBD 4PJIA 2XOTA 3S96A 1ZA6A 1RZFL 3BUTA 4PRHB 2B4CC 3FN3A 4GFTB 5HVFB 1FVDA 3MC0A 1A6TA 3HR6A 5J6HB 5KSUB 3X3GL 1DANT 3O4LB 4KVNL 2KPNA 4W70A 3R1GH 5GS0D 2CMRH 2PW2A 4L9LB 1ED3A 4ACPA 4JFED 3HA0A 5DLMH 4K3HA 4KZDL 2DBJA 1KJMA 4HKXA 5EZIH 2H3NA 3RGVC 4CVZA 1XR8B 3QUXB 3KXFD 2JCCA 2X1WL 3V0VB 3WIFA 4H26B 3D18B 4DUXA 2MPAL 2GI7A 3I75B 4JFEA 1FHGA 1JNLH 5I66B 4V2CB 3I50L 1CI5A 3F58L 3MV8A 3MFFB 4PJ8C 4Y1AA 5DWUL 2DQJL 4G8IA 1P84K 5JXAH 1CT8A 3ALPA 5I1JH 2BSTA 1Q9OB 1RUPH 4G9FB 2XZCH 3W9EB 2IBBA 1ZA3A 3PV6A 2BVOB 4HZAA 4JPWL 3VFNA 3PGCA 3O11B 3V52H 2BSSB 1I1AD 3DGGB 3VRJB 4R97B 3DX6B 3EBAA 3QDJA 2Z8WC 3ZKNC 1BGXH 4RMVA 2ADIB 3P2TA 3BP7A 1BP3B 3WUWB 4NP4H 3MRKA 4EIGB 3QUZB 1I3RA 1LWRA 2DI9A 2WBJC 4AENA 3CK0L 4XPAL 3V4UH 4YHLH 1D5IL 4X8JA 1JPGB 3JUYA 4NN7C 5TQ0H 4LLWA 3FHQA 5B38A 3TIEA 2NXYB 1MVFA 5DRXA 3GSNA 1DLFL 4I0PB 1ZSDB 2OL3L 1A5FH 4M3JA 4BELD 3EJZD 2VNCA 4M1DH 4MA1B 1CLZL 1AIFB 3TIDB 1PLGL 1ZANL 2ZNWA 5D2LA 1X5IA 1M71A 1WC7B 5HHVH 4R7NA 2AJUH 4KAQH 3QQNA 3DHMA 3QXDB 1AXSA 1HH9A 2Z93A 5ILTH 4RWHA 4WV1C 3BN9C 1KLUB 3NCBB 2BDNL 4QHUA 4WI5A 1Q9WA 3Q1SL 2DQFB 1KG0B 1XZ0A 3IAPA 4ORGB 1IMHC 1CLOH 1XGYL 4N9OB 2JCCB 5IFHH 1CTNA 3QHFH 1DL7H 1NAMB 2VERN 1P84J 3EDDA 1E28B 4Z7UB 1RUKL 1T04B 3G04B 2NW3A 4MAYB 4WFHD 4OM1H 4KTDL 1JN6A 5JPMA 4PG9A 4NGHL 3MODH 5IB4A 1P6AB 4NN6C 1L0YA 4NNXA 4KRPB 3T0AA 1T7WA 5F44A 1IKFH 4Z0XB 3ULSA 1G7QB 3E6FB 4LFHG 4BH8A 2VDPH 1AR1C 3K4ZA 4QXGH 3GSOA 5A2LH 3DBXA 4PJ5A 4LVOB 1PY4A 4LLDA 2OR8A 3MRKB 1CICC 5D4QA 2QQKH 1U8QA 3TV3H 3VXUD 4LIQH 2QSTA 4G5ZH 3RKDC 3U0PB 5B38B 1ZHBB 3NTCL 1K2DB 5CCKL 1F97A 5IEHA 4EQ3A 5KVFH 2V7NB 2AXGB 5I1AA 3LKNA 1WBZB 4QRPE 4F7MA 3T8XA 4Y19B 4B7LA 3F5WA 1MHHB 2J2ZA 3OKNA 2XZCL 4PRHE 2OI9B 4MCYB 3DSFL 4YXHH 3DI2B 3MGOA 4WFGE 4F37F 2VC2H 3KJ6H 5DHYB 1CLYH 1M7DB 1K3IA 3HG1A 1RFDH 1YN7B 4PJ8D 2A0LD 2NW2B 3FB7A 3QJFB 4TNWF 1BVLA 4LHUG 2NX5B 3MJ9A 1T04A 3ZKXC 1M6OA 3BD3A 2R0LL 3CFCH 5EO1B 2BNRA 4EXKA 4PGDA 4YHYC 3PNWB 4RAUA 5DGQA 4GS7C 5C0CA 1OT2A 3EAKA 3IAGC 4LSDA 3GMMB 3G5VA 4OB5H 3L3JB 3SDYL 4BH8B 1T3FA 5I8OL 4L8SB 4WW2F 4ERSL 4XTRC 2F19L 3MNVA 3O8XA 1KPRB 2OZ4A 5IFAH 5GRVK 3V4PL 4J1UB 4FZEL 3D3VA 3MO1B 5E2VH 4DCQB 3HZYA 5L2JB 2CK0H 1CBVL 4PYHA 2MJWA 1DBMH 4X5LA 1R6VA 2G2RB 3NCCB 2LV4A 3SDCB 1F4XH 1Q9LA 3SHSA 3V6OE 3UMTA 4G9DA 3TA3B 2CO6B 2DAVA 1FVDB 4J4PC 3GMLA 5IB2A 3MYJB 3ZHDA 1H3XA 5J6HA 1P5VA 5I1AB 4KKLC 4ALAL 3ARGD 5HHPA 5B3JF 4JKMA 4FG6D 4HS6A 4RGMC 1IGTA 3V5KA 4WGVB 2CUHA 5HGDB 5C9KA 3QWRA 4LCWB 3TC9A 4TSAH 1U41A 5F3BA 4XPFL 1N3NB 3X3FL 3CVHB 1MY5A 4ONHB 2CIKA 2VABA 3V0VA 1WLHA 2BRRH 3UTPD 1C5DA 4YXLL 4MXVF 4GMSL 5D1QC 2Y36L 4EVNB 1EVUA 1N2RB 1T5XB 2I25N 1OAYL 1RIVL 5JIIA 3UJJH 3VI4F 4WV1A 1HIMH 5C0JB 4OZHF 2EC9T 4PY8J 5AZEL 2IPKB 4PFEA 2R1WA 1DEEA 4V1DE 2NZ9C 4M9OA 1CZ8H 1ZHNB 3NPSB 2K9UA 2P24A 3L5IA 5I1IL 5FKPB 2C3WA 1FLRL 3EZJB 2R2EB 4K3DL 2W9EH 4HDIB 2V7HA 1B6UA 3WKML 4PJ9C 3WEXB 4F9PA 1S9WA 2B7DT 2DYPD 5I71B 4JRYD 3RAJH 1IILE 4ZOCA 1RFDL 1U58A 2RHEA 2VITA 5BOPA 3QISA 2GYSA 5CJQH 3MREA 1I7ZB 5EUOE 3GDBA 1FAIL 1MLCA 5EC2B 3EHBC 4Y5VB 4AQOA 3RHWF 4MJIA 2OSLA 3DO3A 4HKBB 5C71A 5D2LB 4PUBL 2DBLL 5KVEH 4GRMA 5DD1L 4HK0B 3MV11 3H3BC 3V5KB 25C8L 1WAAA 4LARL 4N1CA 1VGKA 3CH8A 2EDWA 5EUOA 1IC5L 3FT3B 4ZFZA 1F45A 4J3WA 5KS9A 1R3KB 3QUZC 3BGFB 4OCRH 5EOTA 2VR9A 3KYOA 3AS2A 3CVHA 3LQAH 4PJGA 4PYGA 3W2DL 5HHOA 4MS8D 1A1OB 3B43A 2YC1B 1S7SA 5D1ZA 5DZOA 1I1AB 2P5WB 2AJVL 4F80A 5SWZD 3V6ZB 3QCUH 1N64L 5IK3A 2E7HA 3HAEB 3EJYD 4P46D 4TOYH 4R2GD 4NFDA 3BD5A 4ALAH 3QWOB 3DYMA 1XFPA 3UYPA 5ID0B 5I8KH 2CDFB 3QQ9C 1BQHA 4RAVA 3VXRA 3HN3A 4EN3D 4TPRH 5B38G 3L3HA 3AREC 1F13A 4NZDA 3LV3B 2IF7A 4KDTA 4G9FD 5K9KB 4OZIF 4ONOA 2Y5TA 4P9HL 4OZGB 3BP6B 5T3ZE 2AJXH 2FLRT 3UTTE 5HTSA 5ABDE 3LKRB 1ZTXL 3RDTB 2YPLA 3GHEH 1FRGL 1OTUC 5I1CH 2ADGA 3V6FA 1IGFH 4FQ1H 5C07E 1KEGL 4P4KA 3F62A 5CKGA 1U3HB 5ICXA 2ATKA 2A6IA 3GKZA 1AQDB 4FXGB 3V6OA 3UTZA 2W9EL 2D4DA 3U36A 4M7JL 3DGCR 2EXWD 4HUUA 4U49A 3RL2B 3LRSA 3QULA 2HJKA 4NBXB 1Y0LA 4K7PY 5FYJH 1U8OA 8CGTA 2OX5A 1AGEA 1NCWL 4D0DA 3CU1A 3D25B 1E4XI 4XCEB 3S34L 2YC1A 3MGTA 2COQA 2P4AB 1EHAA 5TF1L 4GJTB 2Q7YB 1CDCA 3SQOH 3LS5H 1A64A 1BMGA 5TE4L 2GUOB 1FAIH 4Q6IC 3QFJD 3VI3F 1A7BA 3O2VH 4M62L 4HXBL 1XIWC 3W9EA 4LSUH 5CEXB 4GH7B 4OF0A 4P46B 5JMOC 3E8UH 4L29A 4L8SA 4PRNA 2VDRL 1Z2KA 4ODHL 1H3GA 1B90A 2IBZY 2YKLH 3KXFE 1HKLL 5IW1B 1RJLB 3RWIB 3PWPB 4HG4J 4HJJH 4D9LH 4CNIB 3MCG1 1RQ5A 4YUEH 3O9WC 3QIWC 4RGOH 2FZ3A 3RIFK 4IRZH 5CZXC 1UXSA 3MCLH 1V3MA 5IHUL 3ULVF 5L0QC 4HHAB 2Y06L 3UTPE 4RWYL 2BSRA 3TNNA 3MYJA 5L7XH 2E8ZA 1CXFA 1NGPH 2OP4H 5D9SA 3S3PA 4YWGL 4WHYG 3PHQA 4XH2A 4OF7A 3SDAB 4PBWD 3PWJB 1B0RB 3HC4L 1EO5A 3NA9H 5B4MD 1IGTB 3QXDA 5ICXB 2PO6A 3KPQA 4TNVF 2G5BB 1A7NL 1KLUA 4QHUB 4ETQA 1DVFD 4FXGA 5F89B 2CKNA 3OMZA 4NRYA 3VXQA 4OCYH 2DQFA 4FFWC 5HVWA 5F7EH 5EPMB 1MFCL 1KT2B 3MV9D 3TBTB 1QRNA 4X7FC 3BEVA 1E28A 2V9RA 4YPGA 1YYMH 1ZLWH 3U9UB 2B1HL 5DC9B 4CVXA 1DN2A 2OMNA 5JLZB 4AK1A 5E8EB 3NACH 3BP4A 3C8HA 3TBWB 1R3LB 2CLZA 4JQXA 4WW1A 1HEZB 1DE4A 4P57B 3WLWD 3ZL4L 4X5WB 1KGCD 5ANMB 1FL6B 2AJ3A 3KPOB 3RPKA 3PGDA 5LCVH 1AJ7L 4HG4K 2IPUG 5IMOA 5IQ9A 2IQ9H 4UINL 2YUXA 1MEXH 2EYSB 3PE9A 1WJ3A 3GSOB 4N0CC 1U3YA 3MNWA 1TTUA 3S3SA 2IAND 3B3IA 1QZ1A 4CBPA 2FSEA 1V7NH 1UYWL 4ZFFA 3DTXA 4M43H 3MMEB 1U95A 3AXLB 4Z95H 2XI9A 1YEFH 5HYJE 1NGYA 4R6UA 4MSWA 4TULL 2SEBA 2ATPA 3WCYA 4PB9L 4GBXA 4ODXA 3VXSD 4E41E 1QSEE 2ZUTA 4U6TA 4KJQC 4M61A 5ESVB 3FT4A 1HKFA 2XRAH 3PHQB 3G5XA 3OTTA 1GGBH 4TQEL 4XHJC 4YBQD 3ARGB 5HI5D 5EOQL 1DL7L 4ELMB 4ZFZB 1RUQL 4WEBH 1LO3L 1N4XH 5EO9B 5EPMA 3CVIL 4MB4A 2H3NB 3MLYH 1JHLL 3HG1B 3BEVB 3PWPD 3QDJE 4ONFL 4AG4H 2FHBA 2D7QA 2V2TA 4DZBB 4HQQH 4ZFGH 1MCOH 5E9DE 3EYUH 2OTUA 3T65B 3SE4C 1RMFH 2LU3A 1OP9A 2OI9C 5E00A 1NAML 5CEZH 4GAYB 3FQRB 2HJFB 1GC1L 3GJEB 2BVOA 3QQ3A 2F5AL 5J1AB 1W72B 3TH4T 2FHFA 4ZG1A 3DGGA 3B9KB 1I7TA 1S5IH 4ELKB 1KPRA 1ZT7A 3VWKD 2CSPA 2AEWA 4Q9QL 3QHFL 2VLLB 2R4RL 4GKZB 3VXNB 3RVUD 2J1KA 3PUCA 5HYJB 1YMHA 1YNKH 4NQVB 3LB6D 1MCRA 2FCBA 4PJXA 4W81A 5DS8A 2FYYB 5F1SA 5MERB 2XA3A 1ZSDA 4I0PA 2YPLB 1NMAH 3MODL 3KPRB 4XP4H 1XGPB 3SEPA 4EOWL 5D7KD 1F6FB 3GBLA 4LMQE 1B4RA 2PXYC 1RK0B 4LDEB 3MRQB 4PJ5D 1A3QA 3MROB 2YPVH 2G60H 4WTXA 2AJYH 4RFNB 1C8PA 2DKSA 2G75A 3MNZA 3LEVL 3BH8B 3ARWA 4G3YL 1SEQL 2BVTA 4B53A 3L5JA 4F7PB 1I7UB 4OIAA 4PJBE 4X4XB 1BF8A 4GSDL 2HWZL 5ENWB 2FB4L 4Z7UA 5JUEH 4LLYA 2H9GA 3KLSA 3TWCH 2NW3B 4AM0B 5J57B 4OFKA 4Z76B 4NFBA 4UMGA 1F4AA 2EYRA 1MJ8L 2B2XH 4JPKH 3QZWG 3WE6B 1SQ2N 5E00B 2APWA 4L4VB 1U8PB 3I9GH 4NCC2 4NKOA 5FAAA 4DK3A 2R0KH 5D8JL 2O5ZH 1FJ1A 4TQEH 3BO8B 1YJDL 2PR4H 3KPSD 1CDJA 1AGCB 1JZ2A 3WNMA 3OKEA 4XNYH 5CUSL 5GRJL 3QIUA 1EAPA 1P4LB 3CMGA 3CIQA 5E2WL 3QAZB 4HUXA 2GTWA 3VI4E 4KV5F 4M8VA 4TRPH 3TVMA 4QTIL 3GGWA 4HKJA 1BQSA 1T22B 2GSIB 4N5EC 1HNGA 3OL2A 3UTQA 5FECB 1QR1A 2ARJB 1X5FA 1MUJB 1Q0YL 1ZLVK 5EC1B 5D9SB 3P3YA 1QR4A 1VCAA 4GRMB 4CVWA 4HT1L 3F5WB 2IH1A 2PO6B 3KPQB 2L0DA 2MCPL 5I1HL 4P2QA 1R3IH 5HDOA 1ND0A 1J86A 1R3KA 4NN6B 4MZ3A 3BH8A 4NC1C 5J3HC 3EGSB 4PJGB 3GI9H 3W11C 1W0YT 3SKNB 3WJJC 2PUQT 5D1ZB 2ZOLA 5J0BA 5I30L 5SWQB 2GITB 4YHPA 4PGDB 1OGTB 1I7RB 4O9HL 3PIQA 3GIVA 1RIHH 2DWDB 4C56D 4X5WA 3EOBA 1PKQE 2X1OA 3BWUC 1EO8H 5GJSH 3T3PF 3CXDL 4JRXA 4Y89A 4GKSB 2OK0H 4HKZA 4XNUH 3HZMB 2XY1A 2Z4QA 1HZHH 2C1OA 3OKOB 1CXEA 3KWWB 5K9KA 3B2UC 5CMAB 1QQDB 1MCWM 4GMSH 5DHVA 5CGMA 5I8CB 1RUML 4JFHD 4EUPA 2A0LC 5EN2B 4O5LL 1NLBH 5E24E 5I1DA 5D5MA 1RIUH 3U79A 4X6FA 4RSVA 3TA3A 2ATPB 4PJGE 1MQKH 1QR1B 5LAXB 4G6JL 1MFBL 3UZVB 3QUYB 5HHPB 5CBAA 1CQKA 5EB9A 5K93A 4BKLB 4P46C 3ZE0F 3H42H 3S5LB 3TA3D 2F74B 5CKAA 4ZUSA 2FBJH 5AYUH 2J4WL 5F9WB 4YHZL 5HHXH 3WYRA 1DQTA 5DK3A 4LP5A 3F7RA 1QBMH 4HCRH 4MD4B 4PJFE 4P5TB 3VXMA 4UILH 5CUSH 4Y4FC 1P9MA 3VGDA 1FV1B 1VSCA 3DX8A 4LLMB 3SKNA 3ALWA 2MFNA 3F12A 4NJAH 2Q6WA 1A6WH 5C0RL 3NZ8B 1OY3B 1ZVHA 3FQTA 4BQ8A 4HH9B 4U6XA 2H32B 1QFOA 1UB5A 2CGRH 3EYSL 4XBGB 3EO0B 5KTEH 4FQJH 1U6AH 4RFOH 5I17B 1GPOH 3FQRA 3S36L 4PRPB 2AK1H 3EDJA 3GJFK 1FVCB 3SPVB 2QLVB 2JTDA 3OKDB 1KLGB 2OTPA 4XT1C 4G43B 3QG7H 1PFCA 1QSEB 3OKKA 4KKBC 5DZLA 5I1CL 3HLAA 3FQUB 3QP3A 1RUAL 1UZ6E 5DMKB 4ZOEA 3PP3K 5GGQL 4I4WA 3SE3A 4ETYA 5EA0H 3DX9A 1I8IB 4R26H 2J8HA 1NGWB 5EU7E 3AB0C 4TPRL 1QFUH 5E8OB 3RIAK 5CP3H 3U82B 4LSVL 3T0BA 2Q86A 1VACB 1I3UA 1H5BB 4X9FA 5CIPB 4CKVX 5IW6B 1YNLH 2VLJE 4GW4B 4JO3L 4ZO6A 1WWAX 3WHXA 5H94B 5DJXB 3S35H 3CXHJ 5HDQH 3HNSL 2W9DH 2X1PA 1TJGH 1BZ7A 3JV6A 3VD7A 1IKNA 3BP4B 3TBWA 3U6RA 4XPGH 3LQMA 1DBBL 1F6AA 1MH5B 1LK2A 1SJHA 2D03L 2F9BT 3TYFA 4MA1C 2IALA 1YDPB 5IQ9B 3UDWC 5I18L 3LPWA 5MI0B 3OJ2C 5IQ7L 4DTGL 4LPXA 1F8TH 5FOBB 3ES6B 5I73B 2AK4B 1TNMA 1AO7A 1AGCA 5DYOB 1HQ4B 2BNRE 2DQCH 1NCWH 1ZT4A 5HHXL 3VFTA 1P4LA 1QFHA 3S34H 3GO1H 3F7QA 4YBHA 4UNVA 2P8LB 3KS0H 5LG1A 4QKXB 4FQHB 4LLAA 4IOIA 4X80H 4GBXB 4ODXB 5F70A 1X5XA 2VN4A 4NCDA 3C87A 4Z7UE 3FMGH 3S37L 3EYSH 1YEEH 5CJXA 3FFDA 2C3HA 2C26A 1UXWB 4FQJL 5GJTH 3A6BL 1NCCL 4U7SA 1NDGA 1HQRA 3ARPA 3T0DA 3UTSD 3KYMA 3IDMB 5JW4Q 4Z7VA 4OT1H 3TZVD 4WU5A 3QEQA 3P40A 1TJIL 4L5FH 4HBCL 2H45A 3SCMD 1Q9KA 4JQIH 5I9QC 5JTWA 1H15A 4HV8B 3CX2A 5K59F 3BIKA 4P3DA 1A2YB 3U9PL 4X7TA 3W0WA 2YPKB 3ZTNH 3GFUA 5ACZA 3LKPA 1A21A 2FJGB 2BNQB 4YWGH 2BK8A 4YZFF 1RZ8B 5EDXA 5JW4M 4PJXE 2QHLA 3DRQB 4JVPA 4YAQA 2FL5B 4LP4A 3EOBB 3O3UN 2DMBA 3STBA 3CDFA 1FO0A 1FZJB 1CS6A 2HKHH 1QKZH 5DVKA 5DD5L 5I74C 5IV2A 2IANA 1QNZL 4I77L 3VWJB 3AS1A 5FOBA 3D85A 8FABB 4Y16D 2HG5B 3C08H 3C60C 1I9RH 3ZYJA 4L4VD 5E5UB 4LSVH 3WIIL 1PVHA 1CK0L 1QQDA 5IB3B 4NBZB 5BQ7A 3FQNB 4BZ1L 4R8WL 4R4ND 5SWSB 4G6ML 1TCRB 2GK0A 4UNUA 4YIQA 3O3BB 2FX9L 1IEBB 2O5XH 4X99B 5F7UA 5IF0A 1CE6A 5MHSD 5I8EB 2PTTB 3D3VD 4JG0L 4N8CH 7CGTA 1GC1C 1IM9D 1IAKB 1FL5B 3WDIA 1JP5A 3N1GC 1Q94A 3WFBH 3RY6C 2DQGH 4Y4HC 2YXMA 3NFNA 4QXUH 3VFVB 5DJZA 3WN5B 3TJEL 5DEGB 1NDGB 2V9TA 1NGQH 1T1WB 4JFZL 4HFWB 4HQQL 5BV7L 4OFPA 5D2LF 1KLFA 3TBTA 2AS5M 1FH5L 4DN3H 1MJUH 2DTMH 5A3ID 4CMMB 5EU6D 1F58H 2XWTB 4E5XA 4MVBD 2JIXB 2YPKA 3WFZA 2MOVA 4ZUTB 1FBIH 1GZQB 3KJ4B 5E8EA 1TITA 3IU3B 2VLRB 1L9MA 2P47B 3G6JA 5IGXL 4RISH 4KK5D 4Y5YA 4UUJB 1SEBA 2Z91B 4KMTH 4YX2L 3MUY1 4DW2H 3DVNA 5EBLA 3X14A 4JVUA 4XP5L 4NKMB 1WBYB 4Q7DA 4QHNA 1EEZA 4WO4A 2GSGA 5DK0B 4XWGL 4GG6B 3ARZA 3B3IB 4GAGL 1GGCL 1GCFA 2P5WD 1BFOA 3T0EA 4Y1AE 5I0DA 1I3GH 2HT3C 2QQNH 3PDOB 1CDUA 1NKOA 3DTXB 5DJCA 3TVMB 5SWSA 2AI0L 2ZSVA 4JFEE 3WSQL 2ZKHL 5DMKA 32C2B 4OAWB 1T7ZA 3VXUA 2D7OA 4Z7OE 3K8MA 2ARJA 1A02N 1WF5A 4P0DA 5LQBL 2X89A 4CADB 1MRDH 4TYUA 4JRXD 4JY5H 5I76A 5JA9A 1FCGA 5C08E 3MUHL 4MJ5A 4IIQA 1QRNE 4L8CA 2VOTA 5HGAB 3ARGA 5F1OB 1LEKA 1NL0H 5DUPH 2VH5L 5KG9A 3C60A 1QBBA 4IHOA 5I15L 1JI1A 4Q9QH 3GK8L 4S1RH 4OKVA 4LCYB 5TE7H 2D0GA 5CILH 4DKDC 4PLNC 2IGFL 1TZHA 2NTFA 4YK4B 2E9WA 3ORJA 1JRHI 1T0MB 2P42B 4O2FA 3PHOA 1AHWC 1ED3B 5E2UH 5FM5M 5DJ6B 3QUMA 3P30L 1X5JA 2NY5L 2IH3B 3TN0C 4D0CB 3OXRA 3AM8A 5C0DA 3SDDC 2FGZA 1G1CA 1GAFH 1HDMA 3O4OC 4Q2ZB 5FGBC 3O45B 2ADJB 3QFJB