3RWIB

Rhesus macaque mhc class i molecule mamu-b*17-gw10
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
b'IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwiB00
2Q86A 4JQVA 1KB5H 2NW2A 4R4BB 3DXAA 4G6AC 5F96H 1VEOA 3HCVB 1LO2H 3QEUA 1FLRH 2WK2A 1CICC 4NQUA 2E8YA 2Y72A 5C0RH 4IRZL 4CJ0A 1NUFA 2IQAB 3LRSB 4MAYC 3X3GH 4G8FB 1DL7H 3GK8H 1U8LB 3KWWB 4XNQB 2QQKL 3PWPA 2GEEA 1T20A 3HNTH 4CNIB 4JFXB 1P5UA 4MMXC 2PYEB 3TN0C 4WO4A 4MCYB 2P47B 3KPQA 1FAIH 3VGFA 4RGNB 4GLRH 1I75A 4S1RH 5T5NF 2IBGA 4U1IA 1S8DB 4QHNA 1I7TA 3B6SA 4DOHB 1CDYA 1MCHA 1S7TB 2LQRA 5DFWH 2JCCF 1T7VA 1PBYA 3WN5A 2ICEA 1C12B 1Q0XL 3D0VA 4X7TA 1ADQH 5DJXB 4XPBH 2MQ3A 5EU5B 3U6RB 3GSNA 5E6IC 3DTXA 4C57C 3PNWB 4APQA 1EJOH 1Q9KA 3AGVA 3QWOA 1HYSD 2YD8A 4MJ5B 2VDML 4ZO6A 3RI5F 3HG1D 3FFDA 3LEVL 5K59E 4E41B 4JFFE 1NC2A 3EYUL 3WBDA 4OLUH 4PRBB 4ONFL 3FQWB 1EXUB 4XVUC 1DBBL 2XN9A 4BFBD 1CVRA 3EHBC 4P9HC 3IU3B 2H26A 4UBDD 3SCMB 1U2CA 3VXTB 1HQ4B 3DV6B 5IFJA 3VI4F 4HWBA 3R8BB 4LU5H 3WXWH 3EFDH 5TQ2H 4PLNC 5ALBL 1IJ9A 1U3YA 4UT7H 1WFNA 1A7QL 4OZIF 3GHEH 4OZHE 2V6HA 2AJYL 3HI6H 5C08A 1C5CH 2HLFC 3MXWH 3VFOA 4PYHA 3CDCA 1MFEH 3G6JA 1A6VL 1NLBL 5IB4A 5FUOH 2F58L 4JR9H 3I6GB 3BEVA 1JGUH 1HWGB 2OX5A 3B3IA 3AM8C 2BX5A 4UV4H 3N1PC 4RMSA 2YZ1A 4JG1H 1PG7X 3S3PA 2G5BB 3WJJA 4P2QA 1PQZA 1ED3A 4X9FA 1B4JH 1IGIL 2Z35B 1N0XH 1OD9A 3OG4B 1R3HB 3T2OA 1L0YA 3SY0A 2DQDL 2BSTB 2VXUH 3TPKA 4UMGA 1NEZG 4R0LB 1IVLA 5GS1B 4JDVA 2IH3A 5TFSH 3WFEH 1A4JA 4WHTA 4GRLC 1TTUA 5JXED 3A6BL 4FMFA 3M8OH 2P1YA 4XCYA 3KYOB 3W39A 2YPLB 1XGPA 1DEEB 2J8UA 4X9IA 3ARBA 3Q5YA 5C07A 3RNQB 1U3HA 2OR9L 1A1OB 2WWMD 1T7ZA 1ZHBA 4G9FA 4NQSB 1FIGL 2X05A 3U4AA 1U8NA 4KK5D 4MSWA 5KS9B 5E03A 4XPTH 2NZIA 5ESAB 3KXFA 1KPUA 5GGUB 4LLDB 5GXBB 4LLAA 1WTLA 4HQQH 4Y4KB 3LS4L 3VGEA 4XX1E 1E4XH 2DL2A 3IS0X 2AJUL 3MREA 5EU4A 4YHKH 5CHNA 5KVFL 2PW1B 4P4KB 2XWBA 4EOWH 3VMPA 3ROLB 3CU1A 1MFAL 4G6KL 5CJXC 1D5MA 2Q3ZA 43CAA 4JJ5A 3D18A 4OT1H 1U8MB 4NZRH 3QHTC 1MY7A 1XIWD 5F9JB 1KACB 2DBJA 5IGXH 1SM3H 4K94H 2VLLA 1KN2L 5KVGL 2VXTH 4M93C 3PL6D 5ETUB 1NDGB 1FZJB 2DI8A 4LVHB 4O51A 4OF3A 3HR6A 1NFIA 4XRCB 1JUFB 4Z7OF 3QZWA 3MV9B 1NFDF 2J88H 1URLA 3RGVD 1SBBA 1HH9B 3HN3A 4JHAH 4AL8H 1KIQB 3HG1E 1WBZA 5CP3H 1T83A 1QEWB 3STZA 4U6VL 5T3XE 4UIMB 3V6FB 32C2A 4IS6A 2BXYA 3BAEL 4PJ5A 5CEXA 5GGTL 7FABH 3Q6FA 3DO3A 2I9LA 5DUBB 5BXFA 1ZWIB 2ZSVB 1QFWM 3BJ91 1LE5B 3O6ML 2FR4B 2APTA 4Y19B 5DD3H 1CLZH 2KBGA 2EDBA 4HIEB 5FV1L 4F80A 1MLCB 4G8EB 1B88A 3E3QE 1KJ3L 4WI3A 3R06B 3NIFE 3K8LA 1XFPA 1MVUB 2X9YA 4RQQB 2CRYA 3L9RA 3MOBL 1JRHI 1DANU 1UG9A 1QBAA 3EZJB 2B39A 2CK0H 1BJ1J 5DSCB 1F58H 1P69B 4QOKD 3OR7A 2X9XA 5IW6A 2P8PB 1IEHA 4O2EA 4IIQA 5SWQB 4CVWA 4QRPA 3QUML 2OTPA 3SDCD 1FZMA 1CU4H 1BJMA 3HB3C 5F7MC 3VFPA 3OB8A 4OQTA 4JFED 1LK3L 5C3LD 5KSBE 1KELH 3LKOA 3BGMB 1LK2B 2FL5B 1KCRH 4RX4A 1QBLH 5F9DC 5DO2D 3VGAB 3LZFL 2F53B 3CIQA 5A16A 2OJEB 1N4XH 1UKQA 2HKHL 2R8SL 3WEXB 3C2SA 4X5LA 1CWVA 3HAEA 2VNCA 1YNKL 4JHZA 4RBPK 3ZDXE 4PRDA 3WLBB 1AGFB 5DURB 1W8NA 3BN3B 2BOBA 2VQUA 4OTXH 5DK2A 4HLZG 4OCMC 5DR5H 2JIXD 3RUGB 3TZVA 1HIML 4KHXL 4WW2C 3EDFA 3LH2H 4LIQE 4GAJL 3BKMH 1I1YA 1ZHKA 2NY3C 1SY6L 3OR6B 1MHEB 3MRKB 4ORGB 4ZPVA 4HIIB 1D5XB 3TYFA 4JRYB 3O4LD 4Z7VE 5CSGA 2Q8BH 1C1EH 3DXAD 4WGWB 4M62H 3GGWB 4YO0B 1R3KB 4Z7WB 4RMWA 1XGTB 5LGJA 4UU9A 4LRIC 5CINL 4MNQB 4ZS7L 1TITA 5IB5B 3CFCL 3PWPD 4MD0A 5FUCC 2AK1H 4MJ2A 4PGEB 1VFAA 2HT2D 5D9SB 5HVHC 2B0SL 2P49B 4ZS6C 4KK8D 2H9GA 5TE6L 4Z0XB 3UZEA 3PIQB 2DWDB 2UY7A 1J1PH 4M61B 3BXNA 4ONGH 3VFUB 4QYOA 3IFOA 4TOYL 2A6IA 3E6HA 1WTGT 4FQHB 4GOSA 4MA7H 4ZNEE 2OM5A 3HR5B 3FKUS 1CFNA 1T1WA 3WNOA 1NCBL 3UX9B 3VRJB 5DUMH 2VZUA 3O0RL 5F89A 3BP7A 5I73B 5FCUL 3BE1L 4TULL 5F1NA 5JOFB 1DVFB 3U4BL 1SJEB 1P4IL 2LVEA 3BN9D 1Z9SA 4B41A 3DPBA 4HS6A 5C9JB 4X4YA 3V79C 2A83A 3PP4L 3KNBA 5C09A 4FZEL 3ROOA 5HHVH 3W81A 4G7YH 3CFEB 4NDMB 1NC2D 4N8VG 3TP4A 3REWB 1MPAH 3REVA 3ZSSA 2XN9D 1MJUL 4LARL 3NFSL 3V0VA 3QQNA 3FQNB 4WI7A 1Q1JH 3CSPA 5GGQL 4X7SL 4Z77A 4QHUB 1KCUH 4O4YH 3QWRA 5F7DA 5GSRB 1ORQA 3NCMA 3EDDA 3RY6C 4PRPE 5C08D 1KIPB 4QOKE 4YGVB 1KCVL 3V5DA 1UJ3C 1X6NA 4RAVB 4WWKB 5IHLB 3T3MF 3O2VH 3TBVB 5IQ9A 3UJTL 3O3AB 1ZSDA 2V2XB 4JFEE 4K23L 1UCBH 1KJ2B 3INUL 1IL1A 5EB9A 5TDNB 3UPAA 5J9PB 3SO5A 5L7XL 1F00I 4P2QD 1MLBB 4YX2H 4NNYB 2CKBL 5ENWA 2IADA 1OD7A 3VFVA 3U30B 4R7DB 5FYLD 5I76B 5E9DB 1HNGA 5ICZB 3DVIA 2OJZL 3QG6A 3UJIH 4P59L 4W81A 3C8KB 4WENB 4Z7QE 4RDQF 4RMQA 1FE8L 1AXTH 1X44A 3FMGH 3VGGA 5D96B 1FL3B 4GH7B 2GY7B 3ARBD 5I30H 4LK4A 5FYKU 5IHBA 5C07D 1U3HD 2B20A 4KKBC 2AGJH 4NHUB 3BO8A 3LS5H 1RUPH 1PGRB 4G9FD 1E0OB 2EZ0C 1OP5H 4NQCB 1W2KT 3O4LE 3VD3A 4L29A 3HNSH 4IJ3C 1CLOL 3DXAE 4YHPB 4NSKB 3KXFD 3NFNB 5HHPB 3QO1A 1TCRB 4Z9KB 3KPPA 4HEPG 5SWZA 1RI8A 2WP3T 2VAAA 1M05A 3IGAB 1HKLH 2FJHA 2F8VA 4PB9L 4H20H 2RBLA 2WW8A 3GHBL 3F12A 4ZUVB 3V8CA 1CDIA 3GRWH 5SWSB 4HV8A 5F3BB 2UZXB 2YWZA 3QWQB 4YXLH 1I8IB 1H8SA 1I85C 3QT2A 5L6YL 4H1LH 5C70A 3MLVL 1H15A 5DRZA 3H3PL 3VFRA 5BJTB 3HE7C 3SE8H 4MJIB 3WFBH 1XF4A 1GZPB 1KCLA 1QFHA 4V1DB 4JZNA 4DKAA 4HKXB 3U46B 3GDBA 4AEEA 1ZLUK 1EHAA 3HPJA 1ZLSH 1CN4A 4XX1G 1G9NC 5ADOH 2IPTL 1CF8L 4XWGL 3L3DA 3BP5B 1CL7H 2XN9E 4DW2H 2Y36L 3UPCA 3CFDB 3GSNH 3BYTA 3DNKA 4PJ5D 1NAML 4JVUA 5JW3H 1TZIA 1WITA 4XCEB 2DQUH 3L95A 4NZTH 2FECI 3X3FL 4JM4L 1KCKA 2UY6A 1JPSL 1W8OA 2JJSA 3C6SB 4M7LH 3MCG1 1EBAA 4EXKA 1DQLH 3G6JE 3FT4A 5B38G 4QXWA 2CR6A 5EZIL 4DGIL 1OPGL 2X1XR 3MRLA 5HI3D 4NUGH 2R1XB 4HWBH 1UA6H 3KS0J 4C59B 1MWAH 2LU3A 4QRQA 5J3HD 4P2QE 5IVOA 2NY4B 3BQUA 2V7NB 5JDSA 3NH7L 4J3UA 3TVMC 4IDLA 3S97C 2GK0B 3CZJA 3S4SG 4DUWA 1A1MA 4JZOA 5EO9B 4X6DA 4JFOA 4AIZA 1KLGB 4QRRA 2O93L 3CD4A 4R8WL 5GGVY 3C6LA 1O7VA 4URTB 4M1GH 2XOTA 4EVNB 3N1FC 4DN3H 4RX4D 1J7VR 5I8EA 2R39A 2J8UE 2ZKHH 2BFVH 4LSQL 5FYLH 4M8VA 3VDBA 5C07E 2WUCL 5BQ7A 4GG8A 3KPOB 1NMAL 1A2YB 1MCIA 4WCYH 4G9FE 4AH2A 2PO6A 1L7TL 5DHVB 5I71B 1N6QL 4EZMA 5TPWL 4ZUTB 1LDPL 2EEDA 5D7IA 2GJZA 1DQDL 3MRGB 5E24E 3HZVA 2CIIA 1G7IA 5IBTH 2FGWL 3KXFE 4Y4FA 3A67H 1MF2H 2BJML 5CEZD 1Q38A 5C0AB 4U2YA 5B8CC 4E42A 2VQTA 5DEFB 3TZVD 3PHSA 5IIEA 5JR1H 4LCYB 3IJHB 3P0VL 2GTZA 2OZ4A 1FNAA 3P0YL 3RBSA 5FKPA 4I5BA 4DAGH 1Y0LA 2ATPB 2PETA 2EYTB 1V3KA 3GMMA 2VN7A 5MHSD 1P1ZA 4NFBA 1S9YB 2F8XC 2CRMA 2LTQB 4Q2ZB 4XH2A 4B53A 5ITBL 3W9EA 1HYSC 3WLWC 5F3HA 4HMCA 4O58L 5CILL 1XGRB 3H9ZA 3HC3L 3M1BA 4LPUA 5BVPH 4PGCB 1D5IH 5J1AA 4P2CG 3BH8A 4QRUB 4R3SB 3TBSA 4NUJA 1C5DB 4PJDA 3T3PE 4Z76B 4FP8L 5BV7L 1UT9A 5D2NA 4YDVA 3OGCB 4AMKH 2EKJA 1UM6H 5BS0B 1S5HB 2AKRA 1NEZB 5GS0H 3C5SB 4RFEA 2X42A 1MFCL 2CDGB 1QTYT 3U82B 3V6ZB 1HILA 2X4UB 4OLZH 1JI2A 3GSXB 4NO3A 2F5BH 3E3QC 3WFZA 4WTWA 4J8RA 3ARGB 1OOAA 1S9VB 3CSYB 4D0BB 5F6IB 5JPNB 3PQYB 2NY7H 1A0QH 4FG6C 4YXHH 4K3EH 5C09D 4ZFZA 2UUDH 3HI1B 1EFQA 1QLFA 5T1DL 4LSVL 4ACPA 3TO2A 3LEXB 1HHIA 2VIRA 4Z7UA 5CP7B 4XXDA 2IAMC 3RVXC 3BKYL 3VFSB 5K9KB 2ERJC 5EU7E 4L3EE 3UYOD 1KEML 1KTLB 4K8RD 4DKFH 3QWRD 4UAOC 4LSUH 4Y2OA 1OVZA 1JF1B 4IDJL 1R5IB 4LEOA 5FOBA 3L6FA 5SX5K 3ZT6A 1FFNA 3HMWH 2QEJA 3EJYD 5I17A 5D2LE 2VDRL 3BZFA 4QT5B 4OV6F 4PJ9C 1WWCA 5CS7A 3OHXB 5EOCH 3G6AB 2R2CA 4D9QD 4JM2A 1LP9B 5HVGB 1CZ8H 3QHZH 1T4KA 1QFPA 4KDVA 4P4RA 3WFDL 1FLTX 3EDKA 5EIIB 1UKSA 3GI8L 4MQSB 3WL9A 3JV5A 4OQTH 4F15B 1N26A 4GAGH 4FXLA 2YA1A 3PWJA 2UVEA 1SJHB 3OKOA 5KOVC 4OLVL 5I1EH 2NLJA 5ILTL 5CEZE 4LCCB 5D70H 2WP3O 3ESUF 4D8PB 2H2PD 3QUMA 1FL6A 2GYSA 3R0NA 4JG0H 5C6TL 4O2FB 2W0FA 3IETA 4JKPL 1G7HB 4XP9L 1KN4H 1EFXB 4JZJB 5DEGA 4R6UA 1ZA3B 2HRPL 2EC9U 1NGXA 4HJ0C 3IKCA 1MIEL 5CEZH 5MHSE 1FVDA 1FVCA 3D3VA 3KLAA 1BD2B 3UTPD 5ISZA 2YD7A 2V5RA 3Q1SH 4U3HA 1LWRA 2AV1B 2HVKB 1G7JB 1HSBA 2AJVL 3E1F1 3NZHH 4AQ1B 5B39A 1V7NH 3FT2A 1VHPA 5HYIA 4JE4B 5E8DL 1AD0A 1XT5A 5E6ZA 1QUNA 2VZVA 4R96A 5MENA 4KQ4L 1QLRB 1D5BA 4PJEF 4U1GB 4J4PA 1S5IH 5HGAB 3BD4A 5CSZA 3BSZH 2E8ZA 3Q5OA 1ZAGA 1JF5A 1TETL 3K80A 1NGYA 2R29L 3NN8A 1CGYA 5KSVB 4ODUB 4PJFB 3RWJA 5CFHA 3RKPA 1DJSA 2G2RA 3BT2H 1F4YH 1ZGLP 1FBIL 2V7HA 4Z78A 3TIEB 4FQXA 3RZCB 4XCNB 3SJVA 5FIEA 3DECA 4LVOC 1BM3H 4L4JA 2RB8A 5GGVL 3L7FA 5IUSA 1QR4A 5HGHA 1OTUD 5HPMA 1U8QB 4OGAD 4MXQC 2AXFA 1WT5C 5C09E 4Q9BA 5E2JA 4N0YH 3TF7C 4H1LG 4PGBB 3SKOA 1WV7T 4XPFH 1U93A 4WTXA 3SDDC 5DXWA 4NBYB 4D94A 3LKNB 6FABL 4LBEB 5DDHA 3SDCC 1C8PA 4TVPD 4Y4HB 4S1DC 4L5FL 2VABA 4MD4B 4DGVL 4TSAH 2RR3A 1T2QL 4OQ1A 4UZGA 1GC1H 1W72B 1BFOB 5M95B 5DO2C 4HF5L 3QQ3B 2VN4A 4KJPC 2VR9A 3HI5H 4FQCH 1JZ6A 4P5KA 1V7MH 4KPHL 1GGIL 2FB4L 4XNMA 3RZWA 2BY0A 3HRZB 4N8PA 3N85H 4K8RH 3GMRB 4D9QE 3BGFC 4F7TA 4DKEH 2B1HH 2X4NB 4LRNL 5TE4H 1REIA 3BQUD 1JHLL 1AQKH 2O61A 4PY8I 3QH3B 5DD1H 2UWEF 1AGBB 3SKJL 4HJGB 1HXYB 4NC1E 4ZFGL 1E28B 1EGJA 1SJVA 2EXWC 1EUTA 4LASH 4QRRD 1UM5L 1KB5B 2CDFA 5IEHA 3C6LD 5CBEA 4QO1A 1I1AA 3L5WA 4AK1A 1INDL 2AI0H 3DVGB 1GYAA 3QUYB 4TNVK 2YD2A 2GSIA 1D6VH 2ZUVA 3BP6A 1QSEA 1MAMH 1IC4L 5E94A 2VMFA 2Z31C 3MUGA 3QG7L 4KTDL 2FH8A 2PO6D 1JWSA 1YEKH 4HCRH 1QACA 1NBVL 1N6UA 3BVNA 5JW5A 3QXAB 2A6JA 4KK8C 2PF6A 1I8LA 3UTPE 4Y4FD 3ULVE 4QNPE 3FCTA 5H8DA 4N8VB 3BEWA 2F15A 3CVHL 5DLMH 1E6OL 3JZ7A 4HKZB 2YUZA 4ELMF 4M6OH 1CK0H 4ZXBB 5ACLA 3ULVH 4FTVA 1MNUL 3MACL 5IMLB 1J5OL 3DX9B 3OX8B 3ESVF 4Z5RA 1DR9A 3OTTA 4U1NA 1XZ0A 4YBQC 2VZTA 1KJVA 2H3NA 4HX1A 4N0UB 2DIAA 2X6MA 4TSCH 4R4ND 1JN6A 1S7UB 5I8OL 4JFPB 2VDNH 1I8KA 2J6EL 2VISB 4HGWA 4MCZA 3QPXL 2K1MA 3WIHH 5KVMC 4BFIA 3ARDC 3VH8G 3MLSH 4EN3B 5KZCD 5DD5H 1PY9A 5FGCE 3OAYH 1OF2B 4YZFF 2EDTA 2HG5A 3L5IA 1MFDL 1S3KH 4W4NA 5GGRA 4Q97A 3GJEB 4OZHB 1DN0B 5JUEL 1CFSB 5HI4C 1PSKL 4KK6D 4KROD 3VG9C 3CSBA 1G84A 3ARWA 1D9KB 4LNVA 3PWLA 2VR4A 2HKFL 2YKLH 3T04D 5I19L 3UJJH 4HPOL 5TH2B 1NCAL 3UBXA 4ZAKA 3BHBA 3BPOB 3CVIH 4TVPH 2DQTL 4JAMB 3L1OL 4UT9H 1HDMB 2HYMA 2R23B 2PXYA 3QZWG 4X5WA 1MQ8A 3S37H 1A3LH 4ZYKB 4MDIB 2MOVA 5D6CA 4QXGL 1LO0L 3ARBC 3EO1B 1A7PH 1MCPH 1CDCA 5JQHC 1YEEL 4QRRE 3GI9H 1P5VA 2MPAH 4JREB 4Y5YB 1PX3A 2JCCA 1RZGA 2G9HA 4GQPH 2R4RH 4J3WA 4N1CA 4JM2D 3UCRA 4Q9QL 4JLRB 5GRVK 3H7BB 4K9EL 4MQXD 4GG6B 3QIWD 4JFQB 3ME0A 1IC5L 1KLUB 4YUEH 4BH8A 1S7WA 2GIYA 3NA9L 4K71C 1TVDA 1VEPA 3S36X 3LQZA 3OF6A 1LO4H 2XPGB 1RQ5A 4U1HB 2O5YL 3F7RA 5HDBF 3HLAA 1OAZH 3MRQB 4UOJA 3CDGB 1BOGB 1QOKA 4HZLB 4XP6L 3ILPA 1LNUB 1MREL 3FN0L 5E4EC 4CU8A 2MSPA 3QCVL 4P2OA 4FQ2L 3O3BB 2K9UA 4OZIA 2XACC 1HSAB 4X9GA 4BQ9A 4BSWB 4K7PX 1FNSL 4YK4C 1PX4A 1IAKA 2DLFH 1QBMH 1U8JA 3I75B 4ZFFB 4RMUA 4MNHB 4PJHF 1C16A 3MODH 3D3VD 1O5DT 5ISZD 5LGKA 1S7XB 2B2XL 5I1AA 2R2HA 1K5NB 1U58A 3HAEG 3OJDA 1KFAH 2B4CC 2BP3A 2OZ4H 2YWYA 5MEND 4WI5A 1MCKA 4AIOA 3FB8B 3MRDB 4PJDE 1L0QA 4WJ5B 1N64L 4J4PD 1VGKA 5D2NE 5C0CA 3HG1B 2A6KA 1CGVA 3LOWA 1FIGH 4QXUH 4AEFA 4L8DB 1CFQA 3VRLF 5DGRA 2QL1A 2AW2A 5KOMC 1NLDL 4OLYL 5IJKA 4WEBL 4M48H 5C0BB 1FAKT 1DQML 1RIHL 1FP5A 3NCJL 3P40A 2FIKB 4FQIL 4Y5VC 1CDBA 4FQXD 5IMKB 1A14H 1DQJA 1P4LA 4U0QB 3SJVD 4XMKH 5DRXA 4MLIA 2DDQL 2G75A 3LS4H 5I15L 4Y8DC 1QA9A 3GMNA 1RIVH 2VOTA 5EU7C 1XF1A 4U1KA 1WZLA 2HJLB 3EYOB 1ROWA 3MYJA 5HGBA 4IRJA 1WICA 2AEPL 1S7SA 5IB3A 2KPNA 4LQ1A 3KPMA 2X4OA 5I1HH 1A9BB 3ZTNL 5AUMA 3L3KA 3QNXA 2VITA 4UQ3A 4BH7B 1EHLL 5K9OB 3JUZA 4PS4L 5LQBH 2IMNA 3MOAL 3BIKA 2AJZB 4KFZC 1T21A 1JPST 4U1LB 1J11A 1DLFH 3BRGC 1T1ZA 2PCPB 1PG7H 4R90H 3IJYB 1TVHB 3GSRB 3EYSH 5FXCH 5IMMA 1ZT4B 4YFDB 4GW4B 3GMPA 1PZUB 5BRZA 5I1IH 3SE3A 3WHXB 2VLKA 1K4CB 4PG9A 2FJFA 4XNXL 1RIUL 4Y2DD 3AMLA 1GAFL 4E0RA 3JWDL 1A6TB 2GFBB 3MRJB 2ZPKH 3V5HB 3MJ9L 1VADA 3HKFA 2D7OA 1WSST 1EPFA 3V0WH 5HVWA 1MHCA 5CLTA 3TZVC 1EX0A 1H9VA 5EDXA 9CGTA 3QDAA 5AAWA 2NR6C 5J7CC 5CBAA 4LVNC 3L3HA 5D1XC 3TPUA 3MJ7A 1BZQK 1NMCB 1ZT1B 3UROR 5JW4N 3QNZA 1I1AD 3IDYC 3O8XA 2NTSP 2E7MA 3I2CH 5JO5A 4HXBH 4FFVC 3V52L 2ZOLA 3SKMA 5MEPA 4GW5B 5ID1A 1TPXC 3CPLA 5GGSY 2ADJA 3WO4C 1QSED 1XGUB 3BPNC 2HN7B 5L2JA 1W0WB 1YJDC 2RAMA 3LDBB 4Z7VB 3X12B 4GXVH 5DRNB 2Q87A 5DTFA 3VMOA 3PGFH 5MERA 1Q9WB 1WBXB 3IDIA 5C2BL 5JA9A 3IDGA 1XIWB 4C54A 3D3VE 2BY2A 5KW9L 4LPTA 1S7RA 3M45A 5F9OL 4YFEA 3DV4A 4WDIA 3O81A 1FPTL 3PL6B 5GS3A 3CDYA 5L8JB 4KXZI 4MA3B 4U6HB 5MENE 3RWFB 1QNZL 3F6LA 3X14B 4WTZA 3RGVB 4UUJA 4YEEA 1OAKH 3KPRB 1OARL 2AJXL 1U6AL 2F8OA 2OSLA 1EO8H 5JQ6L 4FTVD 4LSRH 4EDWL 3RTQA 4CVXB 3I6KB 3MJ8B 1LDSA 1F6AA 5BMFL 1JRHL 2HVJA 3LV3B 1E4KA 2W9EH 3KHQA 3WIIH 1QQDA 3DIFB 3AREC 4AT6B 3SJVE 1YEFH 5IK3B 5I8CB 4F7EA 5HGDB 4NN5C 5ALCH 1RJZA 5L8KB 4GAJH 1N8ZA 3RIAF 2X1QA 2QR0B 5IHZA 1BJ8A 3L5HA 2E27L 1KTDA 4KGJA 4I0KA 4M8QA 2GT9B 4XP1H 1M4KA 4NFCA 4NT6B 1S9KC 5AZ2H 4W4OA 2D0HA 3FQUB 4XVJH 1XF2A 3OWEA 5AAMA 4HBQA 4TNWK 2RCSL 2V9QA 3T77A 3GIVB 3BP4A 2GUOB 1CD8A 1OWWA 3MGTA 2VDPL 5E5MB 4G8IA 4NPYB 5D1ZB 5C0FB 1BOYA 2VXVL 5B3JE 1NCDH 3C60A 2CLVB 4PTUB 1JK8B 3H7LA 1NPUA 5C71A 2NY6B 3QCTH 2PR4H 4RISH 5I6XC 3FQRB 4NC1C 3CMOL 1T3FA 5MP6H 3X13B 5JHDA 1ZOXA 3SOBL 3MC0A 3MNZA 4PGJA 1X5ZA 2PXYD 4KUZH 1MFBH 1YNLH 4ERSL 4MLSA 1GGCL 5FCUH 5C8JB 1OAQH 3FT3A 5LG1A 1DUYA 5DJAB 2H2PC 5AG8A 4LVEA 2Y07H 1JYVA 3T2NH 3GSQA 3CNKA 3L5XH 3ARZA 1YMHA 3MLZL 3MR9B 5FO9B 5GRXG 4R7NB 4FZEH 3TCLB 1U8KA 2JIXB 4HHAA 2UZIL 1HXMA 3MXVH 1GJIA 3WE6B 3BZEB 2JK5B 3LIZH 3HFML 5CGTA 2F5AH 1G0DA 1EGJH 4NHCL 4S1QH 1QSEE 3SKNA 2AXGA 2BMKA 2Q86B 2NW2B 1A5FH 4YDIL 4P2YA 1F3RB 5BOZG 3QEUB 4MD5A 2EDNA 1JNNL 4H8WH 1N2RB 4JY5L 1INEL 3E6FA 3OF6D 2I5YH 1DBKH 1CXIA 4KJYB 1A6WL 2V5SA 4BUGA 4YE4L 1ONQA 4H1LB 3MUHL 3PWPB 1WCBB 1DBML 1II4E 3KPLA 1T20B 5KVDH 2YPKA 4WO4B 4PP1D 2ESVA 3PP3K 4P2OD 3TT3H 2FX7L 1OCWL 3K0WA 4MS8D 2CUIA 1I7TB 3B6SB 5KVEH 1UXWA 4Q9RL 1J0HA 1FIEA 2W65A 3VFNB 4FTVE 2M1KA 4KMQA 2OJZH 1AXSA 3WN5B 4P3CL 3DI2B 4JO1L 4P59H 3D0VB 2H6PA 2DL9A 4X7TB 5FFLA 5HBBA 3GSNB 5DC4B 2IGFH 3DTXB 4HPYH 3UTOA 4U6XB 4APQB 2DMCA 2DM2A 3QWOB 4PJIF 2SEBA 5C0CD 4XCFH 3FFDB 2IMMA 1PEWA 3GMOB 1UFUA 1NC2B 4ODVL 2OR8A 1IZJA 2ZCLL 5A2JH 3QXVA 2XN9B 5DFTA 3VDCA 2Z8RA 5INDB 1ZXQA 3WSQL 2H26B 5DMJB 5IFAL 5IFJB 3H9HB 4JY6A 2WM0A 2C3GA 1MWAB 3AU1A 3BJLA 5C08B 3DSFL 1FN4A 5TQ0H 4LCIL 3RKDC 3SO3B 1AY1H 3P9WB 4Y16A 4NO2B 1MCBA 1DTUA 3F7YB 4IRJD 2I9TA 3GJFK 3J7HA 1XMWA 5JW4M 2H1PL 2J6EA 5J57B 4HFWA 2CK2A 4I3RL 4M6ML 1BWMA 1B0RB 4XXCC 1PQZB 1EDQA 3QEGH 1IRAY 2L4OA 5LAXB 3C6LC 2A6DA 3SY0B 4C56A 4HD9A 3QDJE 3LSOA 1PZ5A 4PREB 5GJTL 2IH3B 5EC1A 1NUNB 3CC5A 1GOFA 1H0DA 4ZG1A 4XCYB 3W39B 1Q9OA 4NZUL 5I1DB 5BRZD 3ZMRA 2PO6C 1XCQB 2JCCE 2J8UB 4I48B 4JJHA 2VLKD 1U3HB 3KYNB 5C0DB 3DROB 5I1GL 1T1YA 1R0AH 5K9JH 1ZHBB 3OKMB 4G9FB 3VRIA 1E6JL 1U8NB 4FFZH 4PJ7B 3ETBF 1FYHB 2R0ZH 1ZVYA 4XC3L 2DYPB 2EDKA 4MAUL 4LLYA 4JM4H 1A7RL 3KXFB 1XF5A 3QULA 1DCLA 4BUHA 3VH8B 5FYJH 1F6FB 1CE1L 2GKIA 3O8XD 5JW4R 4IRSA 3MLYH 4IMLA 2VLJD 3U1SL 2WMPA 3P9MA 5FGBC 4D0DB 3MREB 3VI4E 3QAZC 2OTWB 4A6YA 2GJ6A 4OZIE 1RZJH 3W11C 1AIFA 1MOEA 3FO1B 5K9QG 4AG4L 4H0HB 3S5LA 3TA3B 5D2NC 5HY9B 3NCYS 4RGMC 4JCLA 2VLLB 5L8LB 2ED7A 4X8JA 4KKAC 2VSDA 5HHXL 5F7HA 3LEYL 4O51B 3MRMA 1GGYA 1RULL 4L4VA 5C0JA 5IHUL 4LSQH 1EEUA 4QXTB 4FOMA 1TJIH 4XBGA 2M2DA 5JORA 3N9GL 5C0CE 2JF1A 1WBZB 2RGSA 3STZB 1JZ7A 3D39B 4LPVA 4RGOL 32C2B 5CZKA 4HUKB 1LDPH 1QKZL 2G5RA 1HHJA 4PJ5B 1WLHA 4KY1H 2YMXH 1S9WB 1U8IA 1M6OA 2I9LB 1DLHA 1TCMA 1M7DA 4V2BA 4XTRD 4HAGA 4K55A 2Z4QA 1AI1H 4U1JA 3GSUA 4OFKA 5D72L 3MMEA 1I1FA 3SQBA 2E3VA 3G5XA 3QIUA 5B39G 3VXPA 2GITA 5KG9A 1CE6A 4WI8A 4U3XA 1AP2B 1IGMH 1BEYH 1GL4B 1NMBL 2CDEA 3GO1H 4FQ1H 5D7SL 3L9RB 4PJ8B 2HJKB 2VDOL 3T0EA 3MRFB 4M3JA 5JTWA 1K3ZA 1H5BA 1MQKH 3BH9A 1FORH 5D71H 4HMDA 2J8HA 1F4XL 3LPGA 3OR7B 1YEIL 1IQDA 4KK9D 4JM2C 5E7FA 4O2EB 4IIQB 2DQIL 4ZUWB 4JPVL 4QRPB 3C60D 3LAFA 3TO4C 1FZMB 5F7UA 1JGVL 3UAJD 4I18A 8FABB 4XI5D 2DAVA 3QIWC 5HGGS 3SGKA 3LKOB 4XMPL 4FQLL 5BRZE 2DTMH 1NL0L 5E2UH 1G6RH 2VLKE 1FNLA 5JHDD 4GMTH 4C4KT 4Y8AA 4DTGL 1UZ6F 1GCFA 3B9KB 1FGVL 2QQLL 4CN1A 5DQ9A 2GSGA 1RHHA 2F19L 5GSVA 3K1KC 2P43B 1ND0B 2UV3A 1BFVL 4OJFH 2VL5A 2APVA 3E0GA 5C0GA 2XFXA 5GISL 4Z7OE 4FABL 4PRDB 2Q7YB 1NFDE 4OB5L 1CD9B 3PV7A 4HIXH 3TBYB 3LN4A 3RQ3A 1DUZA 2BOBB 5DK2B 2PNDA 2QJDA 3RP1A 2A1WL 5EBLB 1J1OL 2P44B 4CVZB 4LSVH 3BDYL 1NJ9A 4HJJL 2VLJE 2APFA 2NTFA 4PLKD 1CT8A 4CUCA 4I3SH 4P5TA 3S88H 1KEMH 2ADIA 3L7EB 4K7FA 4H26A 5LKNA 4LOUD 4OM1L 4NWUL 2XQYK 2XTJE 4UU9B 5F44A 4F57H 4BZ1H 2IG2L 3NFPA 1NAKH 2R15A 3MLPA 2BCKA 5CGMA 1TNNA 5TF1L 1VFAB 1J1XL 1S9XA 5AZEH 3VD5A 2ESVD 5ADPL 4XPGH 5IBLC 4RZCA 1H3PH 1J8HD 2BDNL 2FBOJ 1R3JA 3BXNB 5J1TC 4QYOB 3IFOB 3E6HB 2UZYB 1NBZA 1TJGL 1E27A 25C8H 1CFNB 1T1WB 1X7QB 1QLEL 1I3UA 2ICES 3GI8H 3GNMH 3MLTA 1FDLH 5F1NB 2Y1VA 1FFPA 3EO9H 2J4WL 3QFDA 2W59A 4X4YB 5BW7A 3OQ3B 2EH7L 3U48A 3O6LL 2MCPH 5DQDH 1IKFH 2P8LA 2FGZA 3KNBB 4NYLB 5C09B 1LD9B 3MV8B 4XAWH 4KZDL 4XVSL 5C6TH 5D1QA 3RUGF 2DQCH 4CMHB 2ICWI 4XP9H 5IT2L 3REVB 1KSRA 2BHZA 2HRPH 1A21A 3ISWA 3MRCA 3FOMA 1MIEH 2BZDA 2I27N 1JYNA 2Z8WC 5ACZA 5F7DB 4AQOA 4UIKL 3DRTB 4PJGB 4PTTA 4Z7WF 3L3GB 2Z8VC 2BSRA 4YPJA 4BZ2H 5IEKA 4FN0A 1KCSL 3V5DB 4X99A 4Y2DC 3B2UD 1JGLH 3MUZ1 1RZ7H 2CLRB 1HI6A 3N1MC 4Y16D 2BRRL 3QI9A 1F4HA 4M5ZL 3SE9L 4DCQA 3O2DL 4P2RA 3HZMB 1QR1A 3HMXL 2EH8H 5T1KA 4J3XA 1BGXH 3ZE1F 4KTEH 5JHDE 3BKCL 3WJLA 1GIGL 2IADB 3VFVB 2VZ1A 3O9WC 5DJ0A 1FBIH 1FQ9C 4PJEA 2FSEB 4C56D 3U36B 3QG6B 1LQSR 1VKXA 3SPVB 2WWKO 1NC4A 4UILL 5HI5C 1F3DJ 3Q6GL 4PLJD 2NY0C 3QHFH 5IROA 2AJ3A 4G80A 1BJ1H 1BF8A 3ARRA 2NX5A 4M1DL 4XBPA 3C09C 4AJ0A 5F9WC 5AYUL 2XQBL 2MHAA 3VJ6A 3P4OA 2R4SH 3DETD 2DI9A 1RMFH 4EQ2A 1QFWL 4JHWH 5T1MA 1YEJL 5J11B 1BZ9A 4GLRI 2Y7QA 5SWZB 5FM4A 1CQKA 2VAAB 1M05B 4IRSD 2AXHA 4JPIA 2FJHB 2XKUA 1CD0A 3UPRA 4MAYA 3NCBB 3ULUH 1AHWA 5T5NG 3F12B 1J8HE 4G6JL 4HV8B 2GJ6D 3JWOL 5BZDA 2EKSA 4X80H 3SKJH 1NGZB 5IBUG 3LD8B 3T3ME 1H15B 5DRZB 1IEAB 4OKDA 4NNXB 3DHMA 4KJQD 4GRWH 4KJWD 5LBSH 4PG2C 1XF4B 3LVEA 5FGSA 4JZNB 5EO1A 2XNAA 5TF0A 3L3JA 5EBWB 3WKNA 1AGEA 2D31A 4L4VD 4PV8A 2AEQL 2UWEA 1JYXA 5DS8A 2ZUYA 3HPJB 1CIDA 1DP0A 3SDAA 1N7MH 3L3DB 3K2UL 5F7YC 5F1IA 1GH7A 1W0VA 4OD3H 2ZG2A 4KI5F 2WQRA 4KGLA 2BVTA 2V5MA 4MA8H 2NXYB 3A6CL 3GB7A 5E2TH 1RUAL 3V7MA 4OIIH 2PXYC 3QIUD 4J3VA 5C92A 4YHML 1E6OH 3KPSD 4HFUH 3UXFA 3EAKA 5F97E 1BQSA 1KXQE 1OB1B 4HKBA 5EZLB 4HXAL 4BM7A 2XI9A 4NRZA 4HG4J 4QRQB 4NN6C 1P6AB 3BQUB 4I2XA 3T0ED 1BBJA 4PJCB 5CLWA 4WU7B 3H3BC 4DK6A 1JWUB 1UWGL 1VPOH 5I9QC 2YD3A 1A1MB 4JZOB 4XNUL 4C56E 4X6DB 4JFHE 4AIZB 2C3WA 4K2UH 5HDQL 5I8OH 4ELMA 2J6EH 2VC2L 5E99L 3TT1L 3MO1A 2E9WA 1HWHB 1LEIA 2RHEA 4QTIL 5EUOA 2CXKA 1LEKA 3AS3A 3FRUB 5IVXF 5IESH 3W9DB 4UINL 5BQ7B 4GRLA 3V4UL 4GG8B 5A40E 3RX8A 4U33A 3FB6A 5A2LH 1S78D 5FF6B 1MCWW 2YEZA 1I9JL 1U8HB 4AH2B 1GOGA 4NQDA 4JPWL 2C26A 2QQNH 4GAYB 5D7IB 4ODHH 2GJZB 4X5XA 4G5ZL 3HZVB 4PP1C 3S7GA 1AFVH 2CIIB 1VESA 2OLDA 3H42L 4P2OC 4Y4FB 4LDOB 1U8OB 4OGYL 3QEQA 1F90L 1BF2A 2Q8AL 2EIBA 2VJXA 1FFOA 1OP3K 4MS8C 3T4YA 3GFUA 2G60H 2FBJH 4AEIL 5IIEB 1XR9A 3E8UL 3ULSA 5F9AC 4K3JL 3WFCL 1ZS8A 4WY7L 2NCMA 1A1NB 2EE9A 2YBRB 2E7HA 5D2LF 5DK3A 4YDKH 3WNNA 1G7MB 1KJMB 2GJ6E 3GMMB 3QUXB 1L7IL 4NP4H 1KTKE 5FHAL 4WRLA 4QHMA 2B7DT 1LO0H 4OGXH 4JGJA 4XH2B 3W9EB 4D3CL 5FEBA 3U2SB 4QTHA 5F3HB 4BK5A 1QVOB 1B3JA 4KU1A 1RD6A 4ZD3L 4K7PY 1ZA6B 4F7PA 1UB5A 2W9DH 3D25A 4YEFA 3VXMA 5J1AB 3TBSB 4NUJB 4A6YH 4F7MA 2CPCA 1BQHA 3VFWA 4D9LL 5A2FA 4X4ZA 5JPMA 1ZTXH 4L4VE 4YDVB 4ZTOH 2EIEA 5IJKC 2R9HD 3QPQD 4PY7A 1XH3B 2AKRB 1CFBA 4ZDHA 3N1GC 4XT1C 5DA4A 3T0XA 3VW3H 3T0BA 1HILB 2IQ9L 1J0IA 2P5EA 2MKLC 4UTAL 3C5ZC 2O5YH 3IFNL 3B5HA 4H88H 3MX0A 4IRJC 4KROB 5H94B 2IFFH 3D9AL 1WEJH 3KYAA 5BV7C 4RWYH 3VE0A 3O11B 1MREH 2W60A 2DKUA 4QGYA 3FB7B 3G08A 4O02L 4PR5A 2HT3D 3BPLC 4ZFZB 1P7QA 3I02A 1BQLH 5D1QD 3KPSE 4BSVA 4DWHA 1ZK9A 3NGBC 4CBPA 2EDLA 1HHIB 1AR2A 3CZFA 4Z7UB 2EXYD 4XXDB 4YBHA 3LPFA 4WTZG 1DEDA 1KPRA 1PKQA 3T0EE 1WCQA 4JRXA 5KJRL 5E1AA 4NC0B 2NY5L 4NO5A 2HWZL 1EEYA 5EZOL 5FOBB 4TUOA 3OAUL 1FFNB 2DQGL 3PJSB 1MCOH 2UYLA 4QRSA 5I17B 4TUJB 3BZFB 3QI9D 2N1KA 4X6BB 5T5FL 4PJHA 3KLDA 5EWIL 1MCEA 3V4PL 2NY2C 3LMJH 3HHRB 4ORZC 4P2RD 5JZ7C 4M6NL 3AS0A 5T1KD 4DQOH 4L1DA 1YMMA 5M7QA 4X4XB 2O5ZL 4KI1A 4HBCL 3QUKA 2ITDA 1T4KB 1C08A 4OLYH 4WEBH 4J7RA 1DQMH 5I74B 3LRHA 3AS2A 4YHYB 15C8L 3WL9B 1WAAF 4HWZA 4P48A 1X5AA 4KZEL 2DDQH 1NDMB 4F58L 1NC4D 3PWJB 5L88L 3OKOB 5H2BA 3NIDF 3ZKMD 2NLJB 3IJSA 1RFDH 1CS6A 3KS0H 1OAYH 4X6FA 4GT7A 4EI5D 4GXUN 3PABA 1F97A 2LU4A 1T5XA 2XTJC 1LO3L 4F3FB 4TUKH 2W0FB 1KIUA 2NX5D 1WIPA 1U0QA 5DEGB 4JFZH 1BVKA 5D7JB 4G6ML 5IB2A 1QSVA 3RPIA 1JGEA 1FVDB 1FVCB 5E70A 3TFKC 2OQJA 3D3VB 3KLAB 2OBGA 4K3DL 5L9DL 5T3ZL 4W6XB 1MJ7L 3S35H 5ISZB 3O6KH 1A7OH 1HSBB 1UWEL 1WWWX 1WBYA 4PFEA 5B39B 3FT2B 2XRAH 1CG9A 1SYVA 4G6AD 4P57A 4GAFB 1AD0B 3EOBB 4R96B 3TA3C 2XA3A 4I77H 5I0ZA 1D5BB 4LRIA 4MAYD 3T1FA 3RX5A 5E8PA 2CD0A 1ACYL 5JIIA 5CSZB 4KVNL 3GSWA 1PFCA 1LP9F 1NGYB 4JN1H 3NN8B 1IBGL 3RWJB 43C9B 2G2RB 1NGQH 4ZMAT 2V7HB 4Z78B 1CYGA 4FQXB 4UV7H 1FCGA 1RUML 5ERWB 2VH5H 5DMKA 3NPSC 4EDXB 2P4AB 1E4WH 3MLUL 4N9GB 3L7FB 5HGHB 5HPMB 4Z8FH 2DN7A 3V52H 4W4OC 3RU8L 3F58H 1L9NA 5CJQL 4ONHA 4XC1H 3SKOB 3SDAD 2E9IA 2ADFL 1U93B 4HIJA 4KK9C 4P3DA 1AJ7H 3VGHA 5IV2A 2BXZA 5CD3A 3C60C 3SGDH 3SQOH 2Z92B 5FYKL 3RWEA 4C83B 1CGTA 2VXSL 5DMGC 4Z95L 5E56A 3UO1L 5KW9H 4RMVA 4WEMB 4XVUD 1OAXL 5F9OH 4Y88A 5F93C 1F13A 3EHBD 1QBBA 5DWUH 3S9DB 1FPTH 3GSOA 4MA1B 3AAZA 5FA4B 4XPAL 4WFED 4P5KB 1L4IA 4XNMB 2HFEA 4X0KB 4LHUA 2GTWA 4JB9H 3RY6A 3SBWC 3S36L 4OV5A 3D6GA 4B7LA 3CCHB 4NJAH 3C9NB 2H45A 1OGAA 1UJ3A 1P2CA 4F7TB 4G6FD 1N5YL 5F8QC 2X9WA 4ZODA 4ZUSA 4FNLL 1BBDL 1BAFH 2Y06H 5D7LA 5GJSH 3HZKA 3WKML 2FD6L 5GZND 1V3MA 5MEOA 3ILQD 2IBZX 3QJFA 4PJEE 3LQAL 4RDQG 5GGSB 1I3GH 3V95A 4ODWA 3CFKA 1KG0A 4K7PL 4XMLL 2CDFB 4PLKC 5IEHB 5CBEB 1I7UA 1I3RB 1KTRL 1I1AB 3L5WB 1KEGH 2OXHA 5DFVC 3RJQB 4JKMA 2XXCB 1MCJA 4N0RA 1A4KA 3CXDL 3GSVA 3RGHA 3UTSE 1YY8A 4LGSB 2GSIB 1CLYL 5JDJA 3FONA 3MA9L 4LOUC 4GRLD 3BP6B 3TWCH 3U0WH 5E94B 1MRDH 3K1DA 1Z9MA 3O2DA 3MUGB 1D6EB 5INCA 3W82A 1JWSB 5SX4I 4NQDD 4YXKH 2QSCL 3BVNB 5JW5B 2FJGA 4WV1B 4DEPB 2A6JB 3BRFA 4AZ8A 3QDMB 4NO0A 4LEXL 2PN5A 2VB5A 1Z3GH 3PDOA 3EOAB 3QEQD 2GW5A 3BMWA 3ZLQC 4JGMA 3MFFA 5CD5C 4FXGA 1P9MC 1EBPA 3SOBH 1RPQA 3P4LA 2YSSA 2HH0H 4I8DA 1ES0B 4Z5RB 4PB0L 1FCCA 4U1NB 3F62A 4HS3B 1KJVB 2H3NB 4OCYL 2OTUB 1I85A 2BHUA 2P7TA 3KYMA 3VXMD 1JN6B 4WI6A 4XNYH 3U9PH 3MROB 5EN2A 1A02N 2HAZA 4HGWB 3HE7A 5CMAA 1CL7I 3NA4A 1JI1A 2DJUA 2HRLA 2UWEE 3P4MA 3OZ9L 4HC1A 4N0FA 1IMHC 1IAMA 1OSPL 1I9IH 2A73A 1OT2A 4KRLB 4M43L 4MVBC 1KOAA 4MGXA 1KJ2L 4HS8L 4OM0L 2P5ED 5LCVH 2XA8L 3NCEB 3VXOA 3MRBA 2JJWA 5FHBL 1QSFA 3VWKA 3DVFA 2XWJA 3S3SA 3D0LA 3S5LG 1ZGLB 4PRIE 2GQHA 1HCVA 4R2GC 4WFEE 1P7QD 1OWRM 1YA5A 1CFTA 2NXZD 1YEDB 4ZAKB 5EBMA 4Y1AB 4OZGF 4QCIB 1GHFL 1BIHA 5DQJA 1F4WL 4YPGB 2D7TL 5H35A 4X5WB 3ZSTA 4P9HH 3H9SA 4GXUM 3G04A 4I2XE 4JRXD 4U6YB 2FO4A 3GKWH 5IQ7H 4OCRL 4OI7A 5E6YA 2FZ3A 3QRGH 4DVBB 2A38A 3I50H 2BRQA 5HHME 1WZMA 4RNRA 1UVQA 2A9ML 5J13C 2A9NH 5L2KA 3TVMA 4ELME 3WDHA 1Q72H 2HFGH 2KKQA 2QHLA 1N59B 2JCCB 4U7KA 4IOSD 1MCRA 1RZGB 1U95A 2PW2A 5E4IA 1KV3A 5IBUB 1K8DA 2Q76A 1YMMD 1V5JA 4RBPH 1ETZA 5ICXB 6CGTA 4OF7A 3SGJA 2A74A 3QIBD 4BH8B 1S7WB 3NCYP 4PJIA 4NQDE 3Q3GA 5J6GA 3HUJF 4G9DA 4LCIH 2IPUG 1LHZA 1ZLVK 1M7IA 3HLAB 3QEQE 4POZC 3VXNA 1QRNA 3WXVH 4LSDA 3ILPB 3RL1A 1FZOB 4YZFE 4R4BA 4M6MH 4K9EC 1CGWA 4KJQC 2R56H 2WUBH 4XP4L 3IDJA 5ECJE 3HNVL 5DJ2A 5B8CA 5D5ME 1JCKA 3LRSA 2R69H 4M7ZB 1IAKB 2JELH 1YQVH 3FO2A 1U8LA 3GBML 1CFVH 4XNQA 2FATH 3PG2A 1C16B 4G8GB 3NZ8B 2QBWA 5T1LA 4JFXA 2NY1C 3LKPA 5IW3A 3RDTC 2E6PA 5I1AB 2R2HB 5CSBA 5C6WH 1U58B 1RHFA 2X89A 3VXME 1U9KA 5JHLL 1Q94A 3EDJA 4EIZC 1NFKA 1VGKB 4RAUA 4HZAA 4F9PC 2A6KB 5I66B 5EG6C 1C12A 5KBNC 4MB5A 1IM9B 2DQEH 1CFQB 1Q0YH 4ZS6D 3LN5A 4YQXL 5EU5A 5EH1A 2P46B 5I75B 1T5WA 2QSVA 4GG6F 2D03H 1AC0A 4GMSH 3VG0H 5LGHL 1EEZA 1AE6L 4OFDA 3QIUC 2P5EE 4QGTA 4M7JH 5EORL 3ULVD 3NABL 1DQJB 1CE1H 1A6AA 4E41A 5DVKA 3GMNB 3FQWA 3F7VA 2VLRB 4L9LC 3ZKXC 2FEEI 4YHLH 5DD0L 4P49A 3O45B 3SCMA 3MZTA 1S7SB 4LLQB 1EHNA 5K33A 3KPMB 2X4OB 4L8SC 2W91A 5AUMB 3L3KB 5LWYH 1AKJA 3QNXB 2VITB 4UQ3B 5EU3B 5HDBE 5CUSH 5F21B 3RWIA 1G6RB 3TJEL 1PKQE 4LLWA 4JRXE 1CGSH 4OD2B 4FA8A 2Y25A 2IAMA 5DHYA 1T1ZB 2Z93B 1NGPL 5IMMB 4ODTH 3CX2A 1I9RL 5IHUH 3TBTA 2BVPB 2YK1H 2P5WB 3DBXA 5FA3B 3THML 5BRZB 4LHUD 5D93B 4PJHE 2FJFB 4LAQL 1OGAD 4RGOH 2BSTA 3BFOA 1OQXA 2R2BB 3GBNL 1VFOA 4R4FL 4E0RB 2PYFA 4PJ9A 3OSKA 5D7LD 5DUPL 5HSFA 4NM4H 4RRPA 4QF1A 4ZOCA 5HTSA 4TQEH 1NCWL 4YHOL 1MHCB 3KYOA 1KXTB 1ZVHA 1DEEA 5CBAB 3RNQA 3TPUB 3MJ7B 4S10A 3CFJB 2KQMA 1A1OA 3QNZB 2L0DA 3O8XB 4Q58C 2AQ3A 5JO5B 4WUKH 5MEPB 3MLRH 3SKMB 3SN6N 2I60L 5ID1B 3CPLB 4WVRA 3VXSB 2J8OA 2ADJB 3JWDC 5FYJU 4CADA 3IXTA 1ORSA 2AJSH 3IF1A 5KSUB 5GGUA 4LQFH 2QHRL 3S98A 4KKBD 2B5IC 3IDIB 3CLEL 1F4XH 3IDNA 4K3HA 5JNYB 4RSVA 3P11L 1CDJA 1MIML 1RJYA 4NO0D 2DQIH 2EE2A 1HEZB 2AABL 3ES6A 1S7RB 4U1SA 4P9ML 2VERN 3DV4B 3SGEH 5FB8A 4P4KA 2QADD 3WD5H 1PEZA 4XMPH 1VFMA 3RWCA 3PE9A 1A9EB 3UDWC 2OL3A 4HH8A 1HNFA 2FWOA 4UUJB 1U8MA 2RQ8A 1B4RA 1FGVH 2IF7A 5FUCE 2OSLB 4FQJH 3D1MC 3RTQB 2Q7NA 3SDXF 3R1GL 3KVQA 1JFQH 4QHKI 1F6AB 2HVJB 4FABH 1NDGA 2FYYB 4LSPH 1ZLUH 4YFLI 2NMSA 1DANT 1JUFA 1QQDB 1RU9L 3EFFA 1KIQA 4F7EB 3EOTH 2NZ9D 3GIZL 3HE7D 4LLVA 5IFHL 1F8TL 4UIMA 4AENA 5IHZB 3C5JB 4YNYB 1KTDB 1IAII 3VXRB 1FO0A 4M8QB 3KJ6H 3QUZC 5DUBA 1WT5A 3RWDB 5JOPD 4CW1A 2FR4A 1AGDB 3T77B 4YWGL 3BP4B 4ZFOB 3IFPA 3MGTB 3QI9C 4PRPA 1YN7B 3SDDA 4G8IB 1MLCA 1FJ1A 1QSFD 3VWKD 2L7UA 4FMKA 3SDCA 3S37X 1IGYA 4RQQA 35C8L 4ODSH 2B8OT 1RAMA 1FSKB 1T3FB 3W2DH 3WS3A 4HLZH 1I7RA 4JY4B 5CCKH 2HT4C 5JHDB 2PTUA 3MNZB 3NCFB 1IM3A 4KMTH 4JO3H 2P8PA 2VDKL 3H9SD 4LLMB 1ZGLM 1PLGL 1EMTL 4NWTL 2R0LH 3MBEB 5D7LE 1TLKA 2IPUK 4OFYA 2WBJB 3FT3B 3ZDYF 3GMQB 4F2MB 3KR3H 1YEGL 2J4WH 4YH6A 5ITFA 4FXKA 4PUBL 2IH1A 3BGMA 3GSQB 2FL5A 5IROC 4EI5C 1MCFA 5L2KD 3TVMD 1YMHB 1TQBC 5HHOB 5E95B 3QQ4A 2F53A 1HHHA 3TBWB 5GRUL 4HHAB 3TNNA 4M5YH 3VD7A 3WEXA 2R1YA 3LB6D 4DN4H 1QO3A 1SYSA 4POYA 2AXGB 2BMKB 5JIKA 3STLB 3UC0L 4DFHA 2CLZB 4MD5B 3H0TA 2EDHA 3E6FB 3P4NB 5KN5B 3RUGA 1KCSH 3Q48A 4EI6A 2Z31A 1AHWC 1ONQB 4HSQA 1A6UL 1DZBA 5ICYA 3ZT5A 1T22B 4IOFD 1QRND 4GRWB 3OR6A 3MCKB 1MHEA 3MRKA 2YPKB 3OKNB 2A77L 1D5XA 2ESVB 3O2DH 1I3VA 1YYMH 4CMMA 4UB0H 5LXGL 2EE3A 4P46C 3GGWA 4EKXA 4YO0A 1IT9L 5I8KH 4Z7WA 3RWGA 1UXWB 1MRCL 1IFHL 2W65B 4TSBL 3RA7L 1RZKC 5MI0C 2YHGA 2VYRE 3MYZA 4BFGA 3ARQA 1AXSB 4DZBB 2DLIA 5D9SA 5T1LD 2H6PB 1G9ML 4UILH 5B21A 3I9GH 4HWEH 1ZANL 1X5KA 4Z0XA 3SDAC 1J10A 1RV6X 2X89D 4W6WB 2DD8L 3DUUA 3VFMA 1UM4H 1VB9A 2DBLL 3WLWD 4KKLC 4EQ3A 4PD4J 3VRJA 2SEBB 1FH5H 3CK0L 4YAQA 1W72L 3L3IA 5T3XD 2BNRB 3U9UA 3W0WE 3G5VB 1NKOA 5AYUH 3MV01 3R0MA 5E08L 3IFLH 3M07A 5JOPE 4FRWA 3ARDA 4ELKA 4JY6B 3C08L 3AU1B 1BVLA 5MEQA 5DMIH 1ZLWK 2XZQL 2KZWA 3CFEA 1BZ7B 4HC1H 4NDMA 4E41D 1QSFE 4MB4A 4BA8A 4PGZA 3REWA 3KJ4B 4LNRA 5I1JH 4Y16B 1XGYH 5GZNC 2I9TB 4NQEA 5IB1B 3SCMD 1QPXA 1HE7A 3ILQC 4BQCA 1KB5L 4FG6D 5F96L 3IU4H 1G9NH 1BQHG 1LO2L 5GSRA 1FLRL 1AKJD 5SX5H 4IHOB 4NM8H 5C0RL 2OK0H 3OKLA 2CGRL 3X3GL 3BIAX 2A6DB 3H9SE 1DL7L 4R97C 3GK8L 4IM8A 3TBVA 3O3AA 4C56B 3RVWC 2R0WH 4DGYH 3HNTL 1FYTA 2IAMD 3RVXD 3LSOB 5E2VH 1KJ2A 1PZ5B 5EC1B 5J9PA 3VD9A 4FQQA 3CC5B 5L2KE 4R9HA 1H0DB 3P73A 1MHPH 1F5WA 1FAIL 4F33B 5DI8A 1Q9OB 1JHKH 1QPPA 4S1RL 2X1WL 2XYCA 4X6CF 4R7DA 1WISA 5I76A 1T1YB 5ICZA 3K2UH 1SBSH 3RHWF 1R6VA 4PJ9D 1ADQL 3D48R 1EO7A 4XPBL 1DQQA 2H2SC 1UB6A 3DMMC 4PJIE 4X83A 1U92B 1EJOL 3QULB 4JFDB 4Q6IB 5J12C 5ESQA 4YHMH 1AQDA 1B0GA 1VFBB 4GS7C 4IRSB 5HPOA 3QO0A 1QRNE 3LHPH 4WUUE 5F71A 2ZUQB 5J06A 4NN7C 4NQCA 5FV2A 2QSTA 4YJZL 4A6YB 2GJ6B 2CIKA 4NSKA 4L4TA 4LU5L 1AIFB 3NFNA 5HHPA 3WXWL 3EFDL 5TQ2L 4UT7L 1HH6A 4NKOA 3GHEL 4PJAF 2VZSA 3QXUA 2XTLA 1TQCC 1C5CL 3PHQB 4HGMA 1MFEL 3ARFC 2C3VA 2FCBA 4JKKA 4JR9L 1J8KA 4HJ0D 5IKCA 4RAHA 1JGUL 4P4KD 2ENSA 3B5GA 3B9DA 4UV4L 4RGNE 3MRMB 2CJUH 2RJMA 4DOHE 4XBGB 2Z9TA 3MNWA 5JORB 1NBYB 1B4JL 3PF2A 1N0XL 3HE6B 2FNBA 1I9JH 1OQOA 5F1KC 2EO9A 2WSKA 2N7BA 3BZDA 2H32A 3IAGC 4V1DA 3OKYA 4O5LH 4PJ7F 3U46A 3QEHA 5TFSL 3WFEL 2B1AH 1T89C 1M6OB 1DLHB 2R1WB 2NXZC 4OGYH 2DJSA 3DURB 5IVXA 4XBEH 1ZEAH 3OL2A 2Z4QB 4U1JB 4S2SB 1JL8A 3GSUB 5T3XH 4E41E 4HUWB 3MMEB 1I1FB 4Y5VA 5EOCJ 1DFBH 3IDXH 3RL2A 4K3JH 4ETQB 3V4VH 2GITB 3VXPB 5KG9B 4JPKH 1OM3H 1ZHNB 4DUXA 2DOCA 1L7IH 4MXQD 4XPTL 4L3EA 1UYWH 3T0EB 4KH2A 1H5BB 1DE4A 4RWHA 4PRPD 4HQQL 4NQVA 1TIUA 3SDDD 1IQDB 4ZOAA 4XB7A 1E4XL 2CSPA 5D2LA 1I4FA 3EBAA 1JPTH 5DVOA 3SDYH 4I18B 4YHKL 4S1DD 3TEUA 4EOWL 1KF9B 4XNZB 3QIBC 1O7SA 3GKZA 4KJPD 4AEHH 1YYLL 5HD8D 3VWJB 1CLCA 2GK0A 4OT1L 3O2WL 4BJLA 4NZRL 5K9QI 3RAJH 3OXRA 1RHHB 5GSVB 4XVTL 5IGXL 1SM3L 4K94L 1YN6A 2ZUUA 4JKLA 1T0PB 2ITCB 4OFYD 2VXTL 3IB4A 2VL5B 1VGEH 2XFXB 5A2KH 4DFIA 5FYKD 4NBXB 2YPLE 1DBAH 3TIDB 3P30H 2QKIB 2J88L 2LAGB 4JHAL 3KPOA 2F53D 3PV6A 4AL8L 1A2YA 2EXWD 2VKWA 1WZKA 4QHLA 4LGRB 5BVJA 5D1XA 1CT8B 2DQHL 5CAYB 3U7YH 4P5TB 7FABL 4LHUG 1PYWB 5EUKB 3DUSB 4H26B 5L0QB 3NTCL 4GBXB 1UH4A 4F9LC 5EZOH 1OLLA 4PRNA 3V2AR 4LIQH 2YN5A 4M7ZC 3K4DA 1W0YT 1CLZL 2IANA 2Z31D 2DQGH 2BCKB 2CRZA 3PGDB 3NACH 5T5FH 1KBGH 3E2HB 2EYTA 3TJHC 5CGYC 1GGBL 1R3JB 3S3JA 4LKCA 4YC2B 2FEDD 2EIZA 2VZOA 3CUPA 2CK0L 4Q2ZA 1E27B 3ALWA 3BWAB 1T0MA 4XP5H 4X7EC 3JSSA 4R3SA 3MLTB 4JO2H 4Z76A 1CU4L 1LEGB 1FFPB 2OL3H 5DC9B 1KELL 3BZ4B 3MV9E 4PJXB 3EKCA 1KCRL 4NC2B 5BS0A 5IMOA 1S5HA 1QBLL 1IQWH 1UZ6E 4YBQD 3GJFA 3UTTB 3C5SA 4OCSH 5HYJA 3AREA 5D1QB 1WAAA 3MLWH 3ZYIA 2X4UA 3ZYJA 3V6OC 1DVFD 3MRCB 2VUOA 1J0KA 3SEPA 3S34H 4D0BA 4F7CA 1SMAA 3ARDD 3PQYA 5ACZB 4ZOEA 2OP4L 5I1KH 4YDLC 5KSAC 4PTTB 5DR5L 4LF3A 2BSRB 4MQ7A 2VO5A 4PBWD 5IEKB 3IXAA 2KDGA 2ZCKL 1FO0H 2X4RA 3C8DA 1DBJH 3BKML 3LEXA 1SEQH 4HH9A 3QJHB 4Q74A 1HI6B 1IZKA 4QRTA 3VFSA 3LKRA 5HI4D 4Z18A 3EYFA 4DCQB 4NQED 1JPFB 3A0OA 4LSSH 4P2RB 3AB0B 1RUKL 2Q8BL 3CFBB 1C1EL 2AAVA 1XF3B 4M62L 4KRPC 4WI2A 4PV9A 3ZL4H 2E6JA 4EUPA 5ID0B 5DJ0B 3FJTA 4OCLC 4JANB 4YFLF 4I4WB 3Q5TA 3VFTB 1IAOB 3QXTA 1KC5H 1FYTD 3DJ9A 1EV2E 2EC9T 1N0LA 3MCLH 3G6AA 3O6FB 1NC4B 5EA0H 5FYKE 5AWNL 1ACZA 4ISVA 1J1PL 4XPHL 4ONGL 2IBZY 4OSUL 1KIRB 5FECA 2F53E 4MA7L 4R26L 3FO0L 1H8OA 1QZ1A 5DUML 4G80B 5EOQH 3DYPA 2CMRH 3UEZA 4U0RC 1L0XA 2NX5B 4G42A 1RVFH 5JXAH 1GOHA 2QADC 1EVTC 2MHAB 1T7YA 3VJ6B 4KC3B 1MRFH 3P4OB 4OLXL 1T04B 4LCCA 1FZKA 1CGUA 3ZKQD 4D8PA 2V5YA 3RUGE 1FC2D 4PJGF 5SX4H 1BZ9B 5HHVL 1F4AA 3ARYA 4G7YL 4O2FA 1CICB 4I0PC 4PBXA 4EBQH 3PXHA 2A2QT 2NW3A 2EECA 1EFXA 1MPAL 4JZJA 4MAYB 4NQCD 2Z91B 1Q1JL 3T08A 1KYOK 1UH2A 2YZ8A 4CKVX 1YY9C 4L4TD 2YUWA 2EKSB 4Z7WE 3V7AE 5BZDB 1JTOA 4O4YL 3TN0B 1G7JA 5KTEH 2Y5EA 4MNQE 3IT8D 1T0NB 1HINL 2NZ9C 2NYYC 2OMNA 1QLRA 4P23C 1UCBL 2XNAB 4PRHB 4Y5XC 3ZE1E 3G9AB 1AGEB 3WUWA 4RIRA 1UZ8B 4PV8B 4CAGA 1WQVT 2JB5H 5DS8B 4YX2L 3VFGH 5E8NB 4JN2A 4P3WA 3JWOC 2GAZB 5E6IB 5LVEA 3K74B 3TIEA 3QNYA 3RZCA 3VWKC 4DUVA 4V1DD 5FO7B 2LABA 3UJIL 3RY5A 1G0XA 1AXTL 1EVUA 5IVZB 2C5DC 3FMGL 2ZG1A 4PGBA 1AH1A 1WGOA 3GB7B 3DOSA 2AK4B 1GSMA 1IKNA 2AGJL 2MMXA 1IGJA 1RUPL 1K2DA 5M94B 4LBEA 4HKBB 4NQEE 4NRZB 1I8MA 3HNSL 4G6FB 3O4OC 2IEPA 1BWWA 1MCQA 2HLAA 4L3ED 3UBXI 2XWTB 4PB0H 1G7PB 1Z9LA 4S1SH 1A3QA 4XXCA 1K4DA 2WANA 1HKLL 1FYTE 4N5UA 4ZQKA 3AS1A 3LB6C 5F7EH 4H20L 3SHSA 3GMRA 3MO1B 3GRWL 1YEHH 4L8BB 1LEIB 1FVEA 3SGJC 2NY4D 4GSDH 5EUOB 1XR8A 1LEKB 1JWMA 1VACB 4YXLL 4KUCF 3QH3A 2Q6WA 5TDPB 5D6DA 4GRLB 3TCXA 1E28A 5E9DE 4YBLC 3IDMA 4M43H 3FB6B 2YEZB 3RWHB 1KJ2H 4OM0H 3BRDA 2P8MA 1KB5A 3WFBL 4IOFC 3MRPA 1B90A 2MNUA 1QRKA 1RZFH 3DVGA 3CLFH 2GY5A 1JTPA 5CEYB 3T4YB 2VWEE 3MRRB 1ZLSL 4GUPB 5C7XH 2AS5M 4IBLT 5ADOL 5EO0B 2NR6D 3ULSB 4LCUB 3ZYOA 4HUUB 1CL7L 3N50A 4KI5E 4NQCE 5D1XD 5A2IH 3GSNL 1ZS8B 1ZMYA 3DVNA 5JW3L 4NGHH 4FFVD 4L4TE 2BNQA 4NZTL 5FGBA 1A7BA 1U41A 4OCWL 4RGNC 3V5KB 2X4TA 4N8VA 4PJCF 1B0WA 5C0AD 4M7LL 4W6YB 1F3DH 3IDUA 4QTHB 3RIAK 4WW1A 3OMZA 1DQLL 2IAND 4OZGA 1TTGA 4F7PB 1UB5B 4RRPG 3D25B 3FOLA 5A1AA 1YECL 1T7WA 2AVGA 3O41A 4F7MB 1BQHB 3FFCB 3HC0B 4NUGL 3VFWB 4HWBL 1UA6L 5JPMB 1K8IA 2XZAL 1MWAL 5DVLA 4B50A 4PY7B 3MRNA 3OX8A 4M93B 2VDLL 4M03A 4D0CA 1R24A 4PGDB 4WHYH 4N1HB 5DJZB 2XZCH 4ZDHB 1R3IH 4XGZA 5BOPA 3ZHLA 1WFTA 5DF0A 1S7UA 3WFHB 5ESVA 4V1DE 2P5EB 4JFPA 2VISA 3MTRA 5D7IF 5F1SA 4M1GL 1B2WH 2APXA 1Y6MR 2C7UB 4KHTH 3SCMC 5IVXE 3VI3E 4DN3L 5BS0D 3DRQA 4WFGD 5EU6A 4KVCL 2B4CH 2YXFA 2ZKHL 2W60B 3UTQA 1RSFA 3OPZH 5FYLL 3VMNA 3FO9A 1P7QB 1T66C 2A0LC 3I02B 2H32H 5HYJD 3ARED 5E8EB 1OF2A 1TVBB 4BSVB 5IWLC 3HUJA 3SE4C 3KJ4C 3GJEA 3CZFB 3DX7A 4G7VH 1CFSA 3FQXA 1KPRB 5IBTL 4JRXB 3PQYD 3A67L 4NNPH 5E1AB 1MF2L 4OD1H 1TZGH 2YS4A 3QYCA 4TUOB 3BOVA 2DJ4A 5GGTA 1M71A 5JR1L 2UYLB 4OUUA 4R0LC 4JAMA 1HDMA 3X11A 1WFUA 2Y6SD 2R23A 3CU7A 3J8F7 5GS1C 4UDTA 4DAGL 4H5SB 4DK3A 2IALA 1YMMB 1R5WA 4ZYKA 1CR9H 1EEQA 4MDIA 3TO4A 2ITDB 2V17H 1RK0A 4GKZB 5CZXD 3QIWA 1C08B 1JNLH 2NY5C 2VLME 3BKJH 3U0PA 1AE6H 1Y6NR 5BVPL 1U2HA 2D9CA 4IMKC 1Y18B 1D5IL 4HWZB 1MY5A 4WHDA 3MBXL 5J6HB 1J05B 4AMKL 4JLRA 5JLZB 1UM6L 1GPOH 3IJSB 2C1PA 4GG6A 3F65A 4X6FB 3HAEH 1IGFH 1HOCA 3CH1B 3PABB 3QCUH 4Y4KC 5GS0L 1T5XB 1JZ3A 4OLZL 2XPGA 2F5BL 4WW2B 4Z7UF 1BVKB 4JDZA 4PLOB 4P4KC 5IB2B 4GRMB 3KYKH 4DKDC 4Z0BH 2NY3B 2NY7L 3PP3H 5C0AE 4HZLA 1A0QL 4YXHL 2C4XA 4K3EL 4TPRH 3IAPA 1H3TA 1WBYB 3TYGH 2IANE 1CG9B 1SYVB 3B9AA 1I9RH 1D5ZB 3DX8B 4LPWA 3BI9X 3THMH 3OKEB 1EFXD 2DIBA 4LAQH 4BKLA 1I1RA 1JVKA 4ZFFA 3VCLA 4Z7NF 1AD9A 4AM0A 2FEEL 1UACH 3GSWB 4LVHC 1P4BL 5TGBA 5HVHB 4U6TA 5JIPA 3G6DL 1YJDH 4M7KH 4DKFL 4LSUL 1K5NA 1ODAA 1SY6A 4MZ2A 3HMWL 2X4QA 1G6VK 3MRDA 1BVZA 3VXQB 5DMKB 4WJ5A 3JXAA 2EDEA 2EEBA 4TRPH 3T1WA 4WNQB 5EOCL 2ICWB 5BS0E 4WFGE 5I16B 5GHWH 4L8DA 4RFOH 1CZ8L 3QHZL 4MXWL 5C0BA 4LPYA 5HYJE 3EGSB 1WAAE 4I9WD 3M17B 4UTBH 2FIKA 4OLWH 1EIBA 3RZCD 4P3DB 1MAKA 4OQTL 4WHCA 5IV2B 3NIDE 1IAIH 3P11H 4GAGL 4DVRL 1MIMH 3MRHA 2AABH 3PQYE 5I1EL 3HC4H 3GJFH 3EYOA 5D70L 1A47A 3GSOB 4HUVB 5HD8C 4ONOA 1IGCH 1A9BA 3PWVB 3U79A 3DO7A 5CWSA 4JG0L 3T65B 2HFEB 4BH7A 4LHUB 2GTWB 1KN4L 2X1PA 2OS7A 1OGAB 1UJ3B 1KXVC 1P2CB 4GKSA 4Y2DA 4Y4HD 3RKDD 4ZUSB 3VU2A 4O9HL 5I1CH 4FFWC 5E2WH 3Q1SL 3VGAC 1AGCB 3NZHL 2PCPA 1V7NL 1TVHA 1ZT4A 4M00A 4KAQH 3QJFB 4RA0C 3PHOA 3C2AH 1MFNA 3CFKB 2V9TA 1KENL 3RBGA 3O9WA 1I7UB 1LP9E 1S5IL 3K3QA 4LDLB 3SDXA 2ZJSH 3BSZL 3QISA 1UJTA 5HXMA 1KULA 3HZYA 1F6LL 1A4KB 2GFBA 3GSVB 4EUPH 3V5HA 3LCYA 1YY8B 3TNMB 2DQFB 4LFHD 2YOCA 1EHXA 3BT2L 5E8OA 5INCB 1DSFH 3KDMB 1FRGH 4J3TA 5H37G 3IKKA 3AVEA 3LQAC 1ZT1A 4TTGA 5EULV 2CKBA 2FJGB 4O2CA 3UYRH 3K8KA 4WI4A 4KRNA 3GMLA 2D7QA 1KUMA 3PDOB 3FN9A 1ZVSB 3DSNA 4N0YL 2FEDC 2HN7A 3BW9B 3MFFB 5E7BA 5IVNA 1W0WA 4XPFL 3X12A 2R0KH 2VXQH 1RUQH 2WINA 2EO1A 2C3XA 1OGTB 3OAZK 1OL0A 1ZT7B 3ZTJH 4YIQA 1H3WM 5EC2A 3ZZ1A 3E2HC 1X4ZA 2YD4A 5JMOC 2BNQD 2VE6A 2O5XH 4TSAL 1OY3B 1GC1L 4QY8B 4BK4A 4PUBH 3HI5L 2F9BT 4FQCL 4U6HA 1YDPA 3W11D 3RWFA 1JGDB 2VDQH 1EO5A 1V7ML 2W9LA 3X14A 2P7TB 4O00A 5I73C 1F3JA 1NSNH 3AY4A 3KPRA 1DVFC 5GRUH 3N85L 1MI5A 3FAXA 3HE7B 5CMAB 4DKEL 2B1HL 4WI9A 3L3OA 4L3CA 4PG2A 4JFFB 4CVXA 5TE4L 2DQJH 3P4MB 1AQKL 3ZDZF 4KKAD 1IEBA 2FX8H 1IC7H 5FDYA 5DD1L 3FHAA 1QHPA 2A73B 4I9WE 2C9AA 3D2UB 3UC0H 1MJ8L 4QWWD 3T8XA 1G7LB 3DIFA 4LASL 4IRZH 4N68A 5I8CA 3RVUD 1UADC 5D5MF 2QQKH 4HK3J 4ZOBA 5F70A 4AIXA 1A6UH 2AI0L 2LFGA 1QSFB 5DZOA 4RCAA 5EU6D 1P7KB 1KB9J 2GT9A 2X2YA 2ZUTA 4NT6A 4LKXB 2A77H 1D6VL 4WHYG 4EN3D 1VCAA 1MAML 1O0VA 4WWKC 2YA0A 3WDJA 3GUTA 5F88A 2QTEA 1YEKL 4HCRL 3BUYA 5B22A 2GUOA 5DQJB 1L6ZA 3ARSA 2DTSA 4NPYA 3G5ZB 5D1ZA 3BGAA 5B4MD 5IM7B 3OXSA 1Q0XH 1D9KD 1K6QL 3MUY1 4HKJA 2CLVA 3KPNA 1B6UA 4Y89A 3QDJA 5HVFB 1J88A 3FZUD 3DYMA 3F7QA 1NAMA 3U30C 3WIFA 2JJVA 4OKVA 3TVMB 4OBRA 1G9EA 3DLQR 3X13A 3P0GB 5DLML 2YUXA 2VDMH 5BO1L 3LEVH 1KYOJ 4M6OL 2PW2B 1CK0L 3EYUH 5KAQF 4ONFH 1K8DB 3ULVL 1DBBH 2FIRT 1ETZB 3TO4D 3Q0HA 5D96C 5JA8B 4BELD 3P2TA 5DJAA 3GEWB 2XIDA 2A74B 2VWEC 5ALBH 1EZVX 4TSCL 1A7QH 4PJIB 4R7NA 2AJYH 3KPTA 3Q3GB 5J6GB 2R2EB 2VDNL 4KI5C 4X7DC 3B43A 4G9DB 1A6VH 5IR1A 1NLBH 3T4AA 3WIHL 1M7IB 1Y6KR 2CO7B 3WE6A 2F58H 3BZEA 3S35X 3RL1B 4UDUA 3NIGF 4MXVF 4ZPTB 4EIGB 3ARXA 5DD5L 3EUUA 3CX5K 1AR1C 1K9TA 3JV6A 1N5AA 5E5UB 3GRWA 3IDJB 5DJ2B 4UQ2A 1IGIH 1N2RA 1S3KL 1Z0MA 5B8CB 2CGRH 4KJYA 1C5BL 1KNOB 2DQDH 3LRGA 3FO2B 1VERA 4WEUD 4H1LA 3PDGA 1FC1A 2BNQE 5SV3A 1WCBA 1JZ2A 5TDOA 2OI9B 1HQRA 1NUDA 5T1LB 4OI8A 3LKPB 5B38B 4MDJA 2YKLL 2ZOKA 1LVEA 4NKDA 3UJJL 3RNKB 3A6BH 4OZGE 1U91B 1NANH 1CD1A 4NRXA 3ZYZA 3CVIL 1Q94B 4TVPL 2OR9H 3VFNA 4UT9L 4RAUB 3ZKNC 3S4SB 2BVOB 3S37L 1A3LL 2JJTA 3U0TB 3LN5B 5IBLD 1T5WB 4N0UE 2YD6A 1A7PL 1MCPL 5B3NA 1TNMA 2JTDA 1WIUA 4U6XA 1EEZB 2Q20A 3GI9L 5IG7A 2BVQA 3WS6C 2MPAL 1A6ZB 5AG9A 4X6CA 1YUHB 4ODXB 4MX7A 4ODBD 1A6AB 2R4RL 3GMOA 2AJUH 5EU6E 3F7VB 1LO5B 5I2IB 3C87A 3C5ZA 4ALAL 5INDA 1YNTA 5KVFH 5C0BD 2H8PA 2RFXB 3H9HA 4YUEL 2NNAA 1MFAH 3MGOB 4G6KH 3ECBA 1UWXK 3HUJE 1AKJB 1MWAA 2C3HA 4UNTA 2AEIT 1LO4L 1R5VA 3RWIB 4LLWB 3MGAA 1X5FA 1KN2H 5KVGH 2NY4C 1OAZL 4LLUB 4N5ED 4NO2A 4NFDA 2IAMB 5DHYB 2ERJB 3F7YA 2XKNB 5KSBB 1B0RA 4UAOB 3TBTB 1RJLA 3DBXB 3RX7A 4PJAA 3FQTB 2QLVB 5LAXA 4U6VH 2DLFL 2NQCA 1QBML 4NRYB 2P45B 2DB8A 4HAFA 3MODL 3BAEH 5DJ8B 5EZJB 2FHCA 2PYFB 4PJ9B 4X6EB 5GGTH 4PREA 4U7MA 4QF1B 4HUXB 1NFDA 1KFAL 2OZ4L 5I1DA 1ZHLA 5BZWA 2WBWB 1XCQA 3O6MH 3LKQB 4I48A 5I71C 2C1OB 3O9WD 4X9BA 3KYNA 3QXDA 5C0DA 3DROA 2J12B 3OKMA 5DT1L 1KJ3H 2VLJA 4QXUL 2J5LB 5ELIA 4PJ7A 3T0VA 3IRPX 3QQ9C 2FDBP 2DWEB 4OI9A 4GG6E 3D69A 3BPCA 2C4FT 4M02A 5HI5D 2DYPA 3MOBH 4CADB 3IXTB 4M48L 1ORSB 3IF1B 3ZE0F 4OFPA 1OHQA 5FDWB 2NY0D 1A14L 1JF6A 2X5PA 1RZ8B 2F74A 3G9VA 3VH8A 2FRGP 4XMKL 3IDNB 2M8XA 1RK1A 1RJYB 2ADGB 5GQBA 3K7UA 3QUMH 2EYRA 3ES6B 1RIVL 4EUPG 4U1SB 4D0DA 1QYGL 5C0IA 3O3DA 1LK3H 2LTQC 5FB8B 2OTWA 1FNEA 3RWCB 5I1HL 3FO1A 3EYQD 2OL3B 4DZ8A 1YYLH 4H0IA 5FK9A 3LZFH 2FWOB 3O2WH 5LQBL 2HKHH 2R8SH 1E4JA 1I7ZB 3TA3A 4CGTA 5HY9A 4XVTH 2ARJQ 3KGRA 1X6LA 5HDOA 2CKNA 4NQXA 1YNKH 4M7LT 1HHGA 5CKAA 1DLFL 2ZP0T 1PG7L 4R90L 3EYSL 3N0PB 4QXTA 1WK0A 1MEXL 5I1IL 3EFFB 5C1MB 2YD5A 3ZTJG 1NCCL 3KPRD 4HWUA 4LPXA 1HIMH 1OW0A 1MI5D 4KHXH 3D39A 5DJYB 4LLVB 3ARGC 3S96A 2YD9A 1KPVA 3SGDI 4AENB 5F6IC 1JV5A 1SY6H 4PRAB 2DQHH 1FO0B 2ZPKL 4HWNA 4LVOB 4XZUB 5C0BE 5ABDE 3MNVB 1S9WA 3V0WL 5IP4A 4MWFB 4CW1B 3NTCH 4W68A 2DKMA 4X98A 5CINH 4ZS7H 4UNUA 3X17A 3DGGB 1NCUA 3IFPB 4PRPB 2Y6SC 3CFCH 4QOKB 3SDDB 3TV3L 2MKWA 1FJ1B 3I2CL 4PY8J 1TXKA 1F42A 4HXBL 2WIIA 2B0SH 3SDCB 1AP2A 1IGYB 4MMZC 1WZ1L 5CZXC 5TE6H 2IPKA 4JFEB 2V2WA 5GGRY 4PJ8A 2HJKA 1GGBH 4TOYH 3MRFA 4KDWA 4GXVL 5DJDA 3WS3B 1I7RB 3PGFL 3PWUB 5C0EB 1NCBH 3WUWG 3O0RH 3GM0A 5D1ZD 1IM3B 5I1LA 4BQBA 1INQB 3SBWA 3BE1H 4ZUWA 4TULH 1WC7A 3U4BH 5E5RB 3BGFB 3EIFA 3QDJD 8FABA 1P4IH 1JPGB 4U1MA 2NY6D 5ITFB 3QDGA 4OGZA 4FXKB 2IH1B 4M6AA 3PP4H 2BSSA 2XY1A 4F15C 1OAKL 2ENYA 3QQ4B 3B9KA 1HHHB 3MPCA 4S0TD 5IF0B 3SDXE 2ZSWA 3TNNB 3MZGB 1EO8L 2R1YB 1LE9B 2V2TB 4NBZB 4LSRL 3MQIA 1ND0A 2OMBA 1MJUH 4LARH 4LCCC 1QO3B 3NFSH 3F7PC 1SYSB 5GGQH 4X7SH 1FNGA 2Q7YA 3O4LB 2W9EL 3DXAB 3WIIL 3TBYA 1OP3H 2CUHA 5KANG 4HG4K 5C0NC 3F8UB 2OP4H 1PAMA 1MJJA 1YPZF 3H0TB 5DC0A 1JHTA 1RZKL 3QFJA 5EBLA 1YEFL 4CVZA 3ARTA 4JZJC 1KCVH 3JV4A 2ZCKH 4EI6B 5ALCL 2Z31B 3UJTH 3NBNA 4YHNA 3DI3B 3ZO0A 3STBA 5ICYB 4FZ8L 4K23H 3INUH 4XP1L 4J3OC 5L7XH 5AZ2L 4KKNA 3KPQB 4CMMB 1RUKH 2ZZUT 4YHIA 1J8HA 3L7EA 4XVJL 5F7NC 3IAQA 2X40A 4PJBF 2E6QA 2CKBH 4U1IB 3RWGB 4QHNB 5IW1A 1WUNT 4U1GC 5I0DA 1J0JA 1BFSA 2ICEB 1P9MA 1X5YA 1OTTC 1NCDL 1NGWA 4LFHG 4WO4D 2EDRA 1FE8H 5AWNH 1U42A 3QCTL 4XPHH 2PR4L 3HS0A 4RISL 4ENED 2EE6A 2XQYG 3DUUB 4OSUH 1Q9KB 3VFMB 4GQ9L 3RZCC 5MP6L 3KPRE 4R26H 1MI5E 1X7QA 3FO0H 4M1CD 1MVFA 4YAQB 4KUZL 1MFBL 1YNLL 3L3IB 5EPMA 3ZDYE 4JDTL 3LQMA 3U9UB 3CVHA 1CLOH 1OAQL 2DM4A 5C6PB 2Y07L 3T2NL 4OLXH 1G9MC 1IKNC 1EERB 3ARDB 4ELKB 3L5XL 4APQD 2W1NA 3LKSA 3ULUF 1MHHA 2QSQA 12E8L 4NYLA 1LD9A 1BVLB 5MEQB 3MV8A 3VFOB 3G6JB 1LMKA 3MXVL 4Y4HC 5IB4B 4PB9H 5DJ6A 3LIZL 3C5ZD 4LNRB 2F5AL 3GHBH 3BEVB 1EGJL 3JTSA 4S1QL 3VG9B 4GRWF 3B3IB 3ZT7A 4NQEB 2QV2A 3EO0A 5LJYH 1A5FL 3IS1X 4P2QB 5L6YH 4AY0A 3MJGX 1ED3B 3DRTA 3MLVH 4PJGA 3H3PH 3L3GA 4H8WL 1HINH 2I5YL 1DBKL 3OKLB 3FTGA 1UQSA 3DUHA 2BY1A 4OLEA 3HTLX 2CLRA 1FYTB 1BFTA 1P6FA 4XWOD 5KVDL 2ZG3A 4JDVB 3HZMA 1A4JB 4WHTB 5D6DC 4FQQB 3P73B 3TT3L 3JVGA 1M7XA 5DI8B 1XGPB 3HPLA 5TE7L 3ARBB 3SKUD 4X4MA 5C07B 5KVEL 2IPTH 1CF8H 4XWGH 2FSEA 3U36A 2Y36H 4GW1A 1XCTA 3QUYC 2Q3AA 3MLXL 3SPVA 4MSWB 1NAMH 3EW3B 3RVVC 4U3CA 2NY2D 4HCRA 5JZ7D 1DQQB 1UB6B 2XICA 1HHKA 2IGFL 3X3FH 4HPYL 1JPSH 2WWKT 1DDHA 1KPUB 3UYPA 5ESQB 4XCFL