3RWIB

Rhesus macaque mhc class i molecule mamu-b*17-gw10
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwiB00
1P1ZA 2WBKA 5HPOA 3MCG1 1VERA 3LKPB 4WV1A 1NQBA 5KBNC 3ULUL 4OIIH 1I7UB 1J0KA 2EZ0D 4XPTH 5I0DA 3GBNH 1R5VB 4PREA 4TUJA 4HK3N 3AREC 1KSRA 5DR5L 3WNKA 5I76B 1HYSC 3UTTE 2Z0BA 4UNUA 5DVMA 3TO2B 2B1AH 1KTDA 3VMOA 2VUYA 1FG2A 4ZXBA 4HDIA 4UNVA 1IZKA 3KJ4C 2IAMC 4U7KA 5DK2A 3PWJA 4BSWA 1B4JL 3SDXE 3SJVD 1LO4H 4N9OB 5L2KD 3ZKQD 3AS3A 1QRNA 1MFAL 3CFKB 4P3CH 3SJVB 5JA8B 4PJ8C 1S9VB 3VFTB 3B4NA 5DJDB 3RAJL 4HJ0C 2LTQC 4F7CA 5HGAB 5I1DA 2E6PA 5L2KB 5I8OH 1D6EB 5DC0A 5CLTA 3F6IA 1H15B 4U6XB 5E08L 3D1MC 5IBLD 3I02A 4OV5B 1X4XA 3GMPB 4GW4A 1QFHA 3G5XA 3TIEB 3WJJA 1ZOXA 3AY4A 1AFVH 2XI9A 3JUYA 3RL2A 4KXZI 1CICC 5E95B 3ES6A 1A7PL 4AT6A 1BVZA 1Q38A 3NIGE 1OM3H 3ULVL 4X6EA 2YWZA 4XCNA 4O2FB 4I0PD 3P0YH 3HUJB 1MHEB 4Q6IB 1MIMH 1K8IA 1NL0H 1JTTA 4Y5YB 4C57C 4ZFGL 5SWQB 4YBLB 3KLHD 4OFDA 4CADB 1BGXL 3KPRB 4I0PB 2VDNL 4I9WD 1YEFH 3LKRB 4PJ5E 5BV7L 2UZIL 2PTUA 4U1NA 1FH5H 1IVLA 5AEAA 3U46B 3MNVA 1V8HA 3REWA 3CSGA 1KCLA 3V5KB 2H1PL 3B9KC 1C16A 3CSYB 4MA8L 1NCAL 2O5ZL 4XPBH 3RQ3A 4IOIA 3VXSA 3PP3K 4JANA 1IQDA 2R8SH 3B9VA 4LNRB 4K71C 1R3HA 4NQCE 4UDUA 4GW1A 4LGPB 3PWPB 2N56A 4JZOA 4HF5H 3QNXB 4ORGA 1OGTB 1QO3B 2NYYD 3GKWL 4GBXD 5F7EH 2HRPL 2BJML 4NNYA 3G6DL 3VW3L 3DLQR 5FIEA 3UAJD 4X4YB 3OKDB 3C5ZA 2E9BA 2CLZB 2HT2D 4GBXB 5FECA 4PG2A 3KWWA 4BH8A 3FN0H 4UTBL 4HULB 3HG1B 1E4KA 4LSTH 3VFVB 4QEGA 1DL7H 3DX7A 5GGQH 1R3KB 2HJFB 1X9QA 2FGWH 2GITA 2H41A 3GSQA 4XCEA 4HK0A 2ZSVA 1EHXA 3KPSA 3PXHA 5DRNA 1BOGB 5FGCB 4KAQL 4R4NC 2XACC 4XB8A 1C08A 4AEHH 3V5DA 3QUML 1CFVH 3F12B 4QT5A 2Z93A 3MNWB 4XRCB 3VGEA 1XIWA 1GPOH 2LE9A 3MRGA 3C9NB 1IM9A 5KZCB 2PNDA 3D9AL 4YGAB 4ONOA 1CBVH 2GAZB 2HVJA 2JCCF 4G6ML 3PL6A 2RBLA 2NX5D 4G42B 4NGHL 3QDGD 3W81A 3AROA 3V4VL 2IPTL 3LN9A 3VMNA 4RRPA 4GRWH 4CJ0A 2BC4A 2QLVB 2YKLL 3ALPA 4PGCA 5K93A 1L9MA 5DHYA 4GXVL 2DLEA 3KDMB 2NX5B 3QDGB 2P24B 3BDYH 4UIMA 4N90E 1J7VR 3EDKA 3K46A 4HS3B 5IVXE 2MFNA 4L8SB 5K59E 4LCCA 3KR3H 4KXZH 2NY4B 1Z3GL 2N1KA 1DVFC 3RNKB 4H0IA 1J1PL 3O6FA 3X14A 5JW5A 2EXWC 5SWZA 3VJ6A 3U30C 4JFDD 4IRSB 2WIMA 2X1QA 4I2XB 1GJIA 1H8NA 1W0YT 1CT8A 5DEGB 4JPIB 4MVBC 5EBLB 2OMNA 4X9HA 4ODSL 4NUGL 4U0RB 5L6YH 2K7QA 2WM0A 5A40E 1VA9A 2R9HD 2AAVA 4WV1C 5LGJB 2FYYB 1T1YA 5DUPL 3PHQB 3PV6A 4FTVA 4MJ2A 4HC1H 1WZMA 3OKNA 4RQQA 1EERB 2PW1B 4DZBA 1HXYB 1LDPH 1ZGLP 1V05A 1LO0L 4PD4J 3QCUH 2ZG2A 2VR5A 1ZS8B 2XPGB 4OZ4B 5D1ZA 1AKJB 3QG6B 5LKNA 1KJ3H 2JLLA 2AJUL 1M6OB 3MRNB 1X4ZA 2E8ZA 3MOAH 3NCBB 4HBQA 1JWSB 2OCFD 2EIZA 3RVTC 4TVPH 3ULSB 2F74B 4M5ZH 3IKCB 2AV1B 3WLWD 1XCTA 3TCLB 3VU2A 5T3ZE 3UTTD 3OKEA 3NN8A 2MWCA 5HHQA 1WBZA 1EZVX 2V5YA 4U1KA 3GK8L 4CAGA 3FQXB 1PBYA 4Y2OA 1N5YH 5BVJA 3UTTB 5GS0C 3DX6B 4GKZA 4DGYL 2OL3L 1JMXA 4OZGE 3WO4C 1W0WA 1BFSA 3WJJC 5GISL 1ZA6B 3AY4C 1G9MC 4JRYA 4FQXC 4I3GA 4OI7A 3SDXB 5I1GL 1MWAH 4X83A 4YHLL 4FABL 4L5FH 1NBQA 3MPCA 3ZDXE 4F2MB 2WLYA 3OAZH 4JG1L 4EOWL 3O3EA 3NA4A 4KJWD 4KRNA 1QBBA 1FZMB 3GSXA 3S97C 1EPFA 2C4FT 2JJVA 3S3PA 4MXQC 2YRPA 4TULH 3C6LD 4A2MA 1IAKA 4DQOH 1WT5A 1UC6A 2Z9TA 5GSRB 4OAWA 5DMKB 5D70L 4NN5B 1A9BA 3C6LB 5I6XB 3B3IB 4CMMB 1MEXH 3NCEB 3OKLB 4I3SL 2R0KL 4YBQD 3X13B 4NWUL 2DDQL 1Y18B 1VKXB 4WUUA 5BQ7B 4MLSA 2HTKD 4Z78B 4HG4K 3WLBA 2EDTA 5E4IA 3CUPA 3EFFA 3P9LA 4LLUB 4NQTA 3P0GB 5FHBL 3IETB 3KPPA 4PJ5D 2FBOJ 4M61B 4ERSH 4XPHL 5EU7C 35C8H 1JF1B 2P8LB 4WENB 3RWEB 1TTFA 4PJ5B 1G6RH 4I4WB 1BD2E 2R2BB 2J12B 5ISZA 1V3MA 5DUBA 4HMCA 4NQCD 4HH9B 4LAJH 3BGFC 3DRTB 4JG0L 4DZ8B 4JGMA 3PJSB 4PG2C 1JTPA 4MA7H 4LSSH 4HIEA 1E4KC 4NQCB 2EDJA 4M93C 2Q1EA 2DQJL 5DGQA 4R4FH 4OZFG 2NY3D 4K8RH 1R5IA 4NFDA 2FJFB 4DW2L 1KJMA 1NJ9B 1R0AL 1M7DB 2YUWA 4IDJL 4LSQL 3BJLA 3K1DA 4MA3A 3LKNA 3E6HB 1AXTL 1L6XA 2AQ3A 4JO3L 5IHZB 1HHGB 1IBGH 2G9HB 3EOBA 5HI4C 2CKBL 3QQ4A 4Y19E 3FT2B 1QA9A 4U1IA 2DD8H 1T7VA 2QTEA 4JAMB 2Y23A 3D0LB 2ICES 1JGDB 4Y5XB 4ZOBA 4LHUA 1XIWC 1FL3A 3HMXA 1YDPB 3BXNB 4WY7L 5ILTH 5HHOE 2G5BA 2KQMA 2FLRT 3QBTB 4WI5A 3KS0J 3IAQA 4PY8I 3SE9H 5FK9A 4HIJA 5IR1B 1JPGB 1ZA3A 2YC1B 1PG7W 3UDWC 2DQHL 4HV8B 2AJVH 4FFVD 4YIQB 2MQ0A 3NCJL 1QR1A 4HLZG 3QUZC 5JDSB 3WFHA 3S3JA 3PWLA 3QNZA 1ZLSL 2EH7H 5LAXB 2OI9C 4OCSH 1OP5H 4P23D 3NBNA 1H3PH 4JFXA 1QLRA 3OKMB 5B3JE 4YXHH 4E41D 1TQCC 3CU7A 3KJ6L 5TDPA 1CDYA 1UWEL 1JWMA 4JHWL 4P23B 5IF0B 3U0TA 3L95B 2V7HB 3HR6A 4FXGB 2ENYA 3GJFA 2N4IA 5AZ2L 3IJSA 1FCGA 3LRSB 1OAQL 3D85D 5I71C 1PG7X 2CSPA 3AAZA 4QRRE 5JXAH 5E2TH 1FNEB 5E6YA 2YRZA 2VLRD 3VXTA 4LCWD 3MLWH 5IVXB 1P84K 1LK3H 5C7XL 3SGKA 5FOBA 3V4PL 5EUKB 1H5BA 3R4DA 4LCWB 5JPNB 3FTGA 3C87A 1F4WL 1U0QA 2G75B 4LLMA 4P46C 3QISA 5D1ZC 3ZKXB 5CCKL 3EDJA 5CMAB 2X4NA 3WN5B 4GRMA 3TBTA 1DQDL 3CLEH 1ES0A 4WIQA 3WCYA 4K3JL 5DRXB 5CEYB 3VDAA 2XQBL 3L1OL 4R7DA 1Z5LB 2BHYA 3BZEB 3UTQA 3RY4A 5EWIH 1G7QA 4QHMA 3LKPA 3RA7L 1BX2A 2CIKB 1I7UA 3EHBC 3C2AH 2DWDA 5A2KH 1R5VA 3EJZD 1RIVL 4NP4L 3C08L 1A6VH 4Z7VA 1L7IL 4NO0D 4ONFL 2JJUA 4JY5H 4NC1C 4U1LB 4GKSA 5FHAH 3DRQB 4HIIB 1DE4B 2EYSB 4XWOC 3SE8L 2R0WL 4G6FB 4DAGH 4ZFOL 3CFKA 1QZ1A 1NLDH 3BESR 3CFDB 1NMAL 3VFTA 5DJDA 1WC7A 1CE6B 1WT5C 3GSNH 1RUPL 2A0LD 4FQPA 4OZGB 2Y36L 5HGAA 1D6EA 3QWOB 5FM4A 4Q9RL 4JM2D 1KXVC 1DQML 4U6XA 4PLJC 4PB0H 5EOTA 3CFEA 5DF0A 3BVNB 5CWSB 1UJTA 3GMPA 2W07A 5HI3D 3LN5A 3RI5F 3TIEA 1CL7L 1A6UL 3GRWA 1C5CL 4JM2B 4X9GA 4WHYG 3RNQB 2N7AA 4NN7C 1J1OH 1IAMA 5IOPA 5IHLB 3T04D 4IEFB 1OLLA 2A9ML 5CJ8A 2CLVB 4G9FD 2NY0C 3QA3A 1MHEA 1JV5A 2JB5H 2NY6C 4Q6IA 3RX5A 3CMOL 4O58L 2BNRA 1U58B 5SWQA 3RBSA 3SDDC 1JHLH 1WWBX 2IANE 1GC1H 4XAWL 4YLQT 1MVUA 3KPRA 4I0PA 1NGQL 4TNWF 1ZHNB 2PR4H 3EBAA 1FYHB 1EO5A 1FZKA 1MCRA 2YD1A 3KNBB 3KPQB 4WWKD 25C8H 5H2BA 3KPLB 3UTSA 2YSSA 3K3QA 3ARUA 4GS7C 4WDIB 4X6FB 4WWKB 5IESH 3QUKB 4M5YL 1MRCL 1BD2D 4MJ6A 4LNRA 4UT9H 5CSBA 1BFOB 2JTDA 1CZ8L 1U8JB 5I1EH 3P4NB 1ZK9A 3PWPA 1RJYB 3L6FB 1OTSD 2HT4D 1BD2B 3FZUD 3SDAD 1QO3A 1KNOA 1NCWH 3SGJA 2BNUB 1D7FA 1TVBB 2KL6A 2M2DA 2APXA 4PRNB 4MB4A 2P44B 1U91B 3EYQD 3ZDYE 5D72H 3OKDA 3QJHB 4F37K 3DJ9A 1HH9B 3MYZA 4L9DA 3MGOA 3HRPA 3N0PB 4WTZG 5IMMA 1Z0NA 2CKNA 3HG1A 3VFVA 3U79A 3DVNB 3CVHH 1S5IL 2X4RA 1NC4D 3C5JA 3BPOC 3M07A 3WHE0 5FO9A 2BRRH 1R3KA 2ZPKL 2DIJA 3AMKA 3CK0L 4Y4HD 2AEQL 4Y5VA 4LAQH 1JRHH 1N6QL 1V7ML 4KHTH 1NC4B 1E6JL 4JKKA 2DWEB 5I0ZA 5I66A 3BIAX 1KEGH 4Y4HB 3O3DA 3WS6A 3BRDA 2A6KB 2VLLA 2B0SL 4R96B 1BOGA 3QHFL 4R9HA 4F15C 1I9RL 4ZNEE 3BP7B 5CD5C 1MRDL 4NKOB 1T2QL 3FB5B 3OAUH 4ESKA 5HHOB 3TJEH 4KUZL 3F12A 2QR0A 3MNWA 3BX7C 1HQ4B 3MXVH 3C9NA 4N0FA 1FE8H 5F7LB 2GAZA 3UTPE 4Z6AT 3D48R 2HVKA 1AQKH 5E8EA 1L0XA 4LDOB 1U9KA 4OKDA 5B22A 4JFPB 1J1XL 1RPQA 2CUIA 5KS9B 4KK5D 3O6MH 2NY2D 1BJMA 1CK0H 4NFCA 2P24A 3SGKC 3WMSA 5DWUL 3HUJF 1CLOH 4L8SA 4F9LC 1H5BC 3EYSL 2NY2B 4OGAD 4P9MH 3K4ZA 4WFFE 2BVUA 4WO4D 3TA3B 5T5NG 5E1AB 5B38G 1XGQA 1A7RL 4QRRD 5EZIH 3RNKA 4HJGB 2QQKH 3G5ZB 1NMBL 5E6IA 1N7ML 2IG2H 5IFAL 2D31B 1UB6A 4XCCH 1PG7L 4JLRA 4JO4L 4IRSA 3HAEG 3ESVF 4QRRB 4HD9A 5ID1B 2NNAB 1NCTA 1IAIM 1XF4B 4OZFB 5DEGA 4C4KO 1U8LB 2W0LA 2R56H 3TPKA 3FMGH 5IT2H 1QPPA 1V3JA 1FLRH 1XGYL 4JQVA 3PHQA 1DZBA 4S1SL 4MD4B 5F1NB 3WE6A 5LBSH 4C55A 4TRPH 1F58H 1OSPH 2PW1A 4Z7NF 1JNNL 1ND0B 5DEZA 1FORH 1P6FA 2EZ0C 4X6CB 1G84A 1QVOB 4K7FB 3BRGC 3ZSSA 1ZS8A 2XPGA 4OZ4A 1AKJA 3QG6A 3RGVA 3THML 1MIEH 2PO6D 3MRNA 2FZ3B 3LS4H 4LFHG 1JWSA 3MRKB 3ULSA 2F74A 3TCLA 3OGCB 2GY7B 5CLWA 4MXWL 4AIOA 3IDJB 2VXUH 1Y6NR 5GZND 3X3FH 1G6VK 2F9BT 3HI6L 3BPNB 3IDYB 3MUGB 4XC1H 5D1QD 3UTTA 1MREL 2O5XH 1A4KB 5HGHB 3BKCL 2EDNA 3DX6A 5EIIB 4EDWH 4A6YH 4QTIL 3E0GA 1A3RH 3MV01 4ODHL 5HY9B 4JDTH 4HAGA 4YUEL 3W0WA 1PZ5B 5DJ6A 4WI7A 5E2UL 5FM5M 5HHXH 2KZ1B 1B0RB 3CZFA 3OAYH 3OKYA 5IBLC 2VABA 1I4FA 2IALB 4JO1H 4Y4KD 4WHDA 1PLGH 3ZYZA 1P9MC 3ARXA 5JIKA 4Q6IC 2NXZD 2V9QA 1FZMA 3M8OL 3OR6B 5DRWB 3V6ZB 4Y5YC 1JGLH 2B7DT 3BHBB 4YBLC 4PYGA 2NR6D 4I0PC 4MA1B 1KLGB 1KCUH 5GSRA 5J1SC 1BVLB 1K2DA 3BN9C 4PJ9D 4YPJA 1KB9J 5DMKA 3KLHC 2AVGA 3C6LA 3LKQB 1NAMH 4QF1A 3B3IA 5T3XL 1C7TA 3OKLA 5CILH 2EIBA 5DJXB 3UXFA 3ESUF 3X13A 1NEZG 4PJ9B 1Y18A 5F6IB 1VKXA 3LEYH 1Q0YH 2WINA 5D8JL 1I3UA 2IAND 1CFSA 2R0ZL 4Z78A 1AQDB 3EO0B 1F4XL 3M1BB 3OL2A 1YYLH 2NLJB 1TJHL 2ARJQ 2IANB 1D5MB 3U6RB 3K1KC 2P8LA 1A7OH 3SCMA 5IW6B 1ZVYA 4NO3B 2R2BA 2HKFH 2Z91A 2ADJB 5F88B 4ZFFB 3C8HA 4NQEE 3S35X 3MCLL 4QYOB 2NYYC 3ZE0F 5I8KH 4HH9A 4GBXC 4OGXL 1MUJB 1P4BH 2QQNL 4DZ8A 3T0AA 4D0DB 1HE7A 1RVFL 4BSJA 5GS0L 3L3IB 3WXWH 3F7VB 1JPTH 3UAJC 3OKKB 3BP6B 4CVXB 2ATKB 4JE4B 2HT2C 1IM3A 3LSOA 5TPWL 1CLZH 2J4WH 4GKNA 4TQEL 3PIQB 3QZWG 4EDXA 1B88A 1TZGL 4MCZA 3TGXA 5C70A 1FFNB 2VDOL 3RWJB 1NJ9A 1G9ML 1M7DA 4P5TA 4AQ1B 1YEIH 3QCVH 1FLTX 1DLFH 3T2QA 4HUUB 1KFAH 4K3HA 3WHXB 1FZOB 4X9IA 4ZUUB 4KZEH 2HP4A 1EO8L 4QRPD 5L7XH 4XPFH 1CIDA 1HHGA 4PJDE 2G9HA 3VFGL 5DO2C 3ARQA 3S7GA 4JAMA 3SE4A 4WI8A 1JGDA 4G7YL 1YDPA 3BXNA 5GGTA 2VXQL 1KBGH 3QFJE 4K2UH 4TSBL 4R97B 3QYCA 3BRFA 3OSKA 4P4KD 2APBA 5ACLA 5C8JA 4Z8FH 2HYMA 5FCUL 3ILPB 4HV8A 3D18B 3I9GL 3SDXF 3WV0A 1ZVSA 1RU9H 2FJGA 5GGVL 2DMKA 2CIIA 4NQXB 5LAXA 4L8SC 4N8CL 2NY4C 1WIUA 3SQOL 4OLYH 4DKFL 4WJ5B 5HYFA 4JCLA 2WUBH 4ZUTB 1EAPB 3ARBD 4WWID 1FC1A 5IF0A 4QXGH 1WV7T 4FXGA 3ILQD 1KENL 3GSOB 5E2WL 3UJTH 1T2XA 2H2PD 4KRLB 2FSEA 3NIGF 1FNEA 2ZUQB 4U0RC 5JUEH 1X44A 4UT6H 1IFHL 3QWQB 4GH7B 2JELL 3SKJL 1N4XH 5EOCL 5EUKA 1Z0MA 4TPRH 3PGDB 5JPNA 1A6PA 2R9HC 4L3EE 2EDQA 4XNXH 4FQLH 4WFHE 2X89D 3Q48A 3UJJL 4XMKH 1L7TH 1F4YL 4J2XA 5CMAA 4RDQG 3I50H 1OD9A 5DRXA 3G9AB 5CEYA 3DETD 4F7PB 3EDEA 3ZO0A 1Z5LA 1SJXA 1GAFL 1ETZA 5TJWK 3BZEA 3LIZH 1Z9MA 1QSFE 3MCKB 2W9EH 1JL8A 3WLWC 1QFUL 2IQAB 1SJHB 3BW9B 3CPLA 4UB0L 3E1F1 3CFJA 1AHWB 5F96H 4M1DL 2PTTB 1YMME 4RCAA 2PCPA 1DN2A 5CJQH 1DCLA 4RFOH 3UP1A 3ZDZE 3UYOD 4OV6F 5ESQB 4PGZA 3C5SA 5CSZB 2XICA 4KJQD 2AJXL 2P8PB 4YHZH 4XC3H 3LMJL 4AZ8A 3HE7D 3O6KH 4U2YA 4WGWB 1FNLA 1GHFH 3DRQA 4HIIA 5I1JH 1KTLB 3RDTA 3FT4B 3K8KA 1QBAA 5E2VL 1CTNA 1K5NA 1MSPA 3KXFD 1L6ZA 2IH3B 3BWUC 2AP2A 3CFDA 5I30L 3QULB 1CE6A 1RJZA 3S3SA 3D2UD 5JR1L 5A2FA 2ZCLL 4KU1A 3QWOA 1IGTB 5D5MB 4NN5C 3VFRA 5B39G 3C6LC 3VXMD 5I6XC 4JFOA 4JY6A 1A1MA 5C07E 5MP6L 4FQJL 3D2UB 2EC8A 1RUQH 4JRXD 2YN3A 7FABH 4IMLB 3KLAB 3RNQA 3IDIB 1WFUA 4R26L 1BP3B 4YZFE 4YBQC 3HAEB 5FGBA 2CMRL 4JRXB 3S36H 1QSEE 4NM4H 2GY5A 1PKQB 4QXUH 3VWKD 5EN2B 3VXOB 2HTKC 5FV2A 4PRID 3ZHDA 2Y06L 4QRUB 4DUWA 5HHNA 1C5DA 3L3OA 3VWKB 3F7YA 2XRAH 4OLZH 4YJZL 5GSVA 4PRIB 4QHKI 3KPQA 2O61A 4L4TD 4Z7WE 5C6TL 1I3VA 3OXSA 5IVXF 5K59F 1JNJA 1GGCH 4WDIA 4LIQE 4X6FA 4WWKA 1BQLL 4TOYH 2D0HA 3QUKA 4XBPA 1BFOA 3HZKB 4JO2H 4O02H 1U8JA 5TFSH 1G7LB 2MSPA 4NQED 3TBVB 4DVBA 2HH0L 1TJIL 3V6OE 5HXMA 3LY6A 3EYFB 1RJYA 4LQ1A 1BD2A 3TT3H 2NY3C 5HHPB 1MJUL 2YK1L 3S35L 2E5EA 5CZVH 4NQEB 5BMFL 1GCFA 5TE7L 1P5VA 5EDXA 1VB9A 4PJGE 4OCWH 1QD0A 2ITDB 5CUSL 1U91A 3P77B 3QJHA 1S9YB 5EU6A 5C2UB 1WVZA 5FA3A 3SE4C 4GMTH 4Y5XC 5IROA 1HSBB 4LCIH 3EZJB 2CGRH 3WEXB 1BF2A 3GI8H 4LGSB 1NDMB 1XF3B 5EPMA 2D7QA 1U8QB 3CMGA 3ZHLA 1RUML 2XG5A 3PWVA 2XIDA 3PDOB 4OB5L 5DURD 2ZSWA 3IF1A 1S5HA 4JFFE 1K9TA 2DWEA 3QR2A 2X70B 4YDIL 4OCRL 4CU7A 4PJDB 4RWHA 3A67L 5DURB 4R96A 4PLOB 3QFJD 4Y19A 5BS0E 1T20B 4RAVA 4TVSa 4ODBD 4KRPD 3BEVB 3W9EA 2A73B 3G04B 5TDOB 4EBQH 3QXUA 3FB5A 5HHOA 3QFJB 1PQZA 4NZTL 2GUOB 3O41B 4OZGF 4P23C 1RZKC 1HQ4A 2OTUB 1NEZB 2Z8WC 3EGSB 4GRLD 3SEPA 3B43A 3PDGA 1FN4B 5HGDA 4P3WA 3DOSA 4CW1B 2NW3B 3FN9A 1WGOA 4NZUL 4GRLB 4YFDB 3ZDXF 1MVFA 5CIPH 4J3OC 4QRSA 4LPUA 1I3GH 5FYKL 1T7WA 1KPRA 4KHXH 1JHKL 4F57L 3JWOH 1J5OL 5IB5A 3IU3A 3QSKB 3WFZA 1UH4A 2XZCH 2AXHA 3TA3A 5E1AA 4XXDB 1H3TA 2X4UB 5I1LB 5DDHA 4HJGA 1QP1A 4OD3H 2VR4A 4LSVL 3ZKXC 3UZVB 1CDBA 1DUZA 3WN5C 3MRJB 2VUOA 4Q0XL 2CPCA 2VDLH 3GB7B 4F7EA 5ID1A 5KSAB 1RIHH 2NNAA 3OJMB 3ZL4H 1G1YA 1XF4A 1MQKL 4OZFA 1P7KB 3STLB 1HILB 5HYIA 1U8LA 3HMXL 3JUZA 2J88L 4ZTPH 4X6DE 1Q9WA 3IFPB 3TIDB 5LXGH 1QFWH 1RZGA 1ACYL 5F1NA 1NLBH 4L3EB 1KCRL 3UC0L 3SDYH 2FRGP 4CDHA 4NKQB 4GXUM 3BZ4B 4K7FA 5BOZG 1TVHB 5FA4B 4F80A 1Q72H 1ZAGA 3EJZC 2XA3A 4F37F 3HI1A 4KMQA 1YPZA 2FZ3A 3O8XD 2JKXA 5IB4B 1WIOA 4ZDHB 4K3EH 3ZSTA 1QSFB 1UXWB 1G7PA 2DQDH 2NXYB 2G5RA 1A8JH 1T6VN 1S78D 4ZOAA 4E0RB 2BVYA 3LQMA 1YMMB 3MUGA 3FO1B 3QRFM 5CKGA 3IYLW 3FO0L 1D5XB 5HGHA 2HKHL 5EIIA 1BBDH 2ZJSH 2OR9L 4BH7B 2V2WB 1A6TA 2CUMA 5HY9A 2A0LC 3WDJA 1F8TH 4ZSOE 2OZ4A 5F1OB 4RGOL 4PP1D 5ALBH 2Y25A 4JM2C 1JPSL 2DQTL 3KYAA 2X05A 4PP2B 2FJHB 2ZG3A 2IALA 3CDFA 3ULUH 3DI2B 4KDTA 4WEMB 3T65B 5DR5H 1KB5B 3OR6A 1UFUA 3JTSB 3V6ZA 3QWRD 2R1XB 3WNOA 2W0PA 1I7TA 1KLGA 4LARL 1X5YA 4XPAL 5C07B 1BVLA 4FMFA 4FQCL 4D9LL 4EZMA 3QUXB 5J1AB 3LKQA 3QPXL 1B4JH 1QSED 4JQXA 4U6YA 2AKRA 5C6WH 4XCFL 4AEIL 5DJXA 5C0RL 2DQIL 3DSFL 2D7TL 4L1DA 4WWKC 4HFWA 1MFAH 5B3JF 1FNSL 4OM1L 1QSEB 4NJ9L 2Z31D 1AQDA 3RAJH 2EYTA 3M1BA 4MJ4A 5JXED 5ACZB 1EMTL 4OFYD 5IG7B 2VQTA 1D5MA 5E08H 2Z31B 5B8CB 1CD1B 5IW6A 5A2IH 5JNYB 1QNZL 2NW2B 4RISL 1OTSC 3ULUD 4ZAKD 2MPAL 3HZVA 3FZUC 4Z7WB 1A7PH 3JV5A 5F9AC 3B2VL 1CI5A 4QYOA 1CD0A 1VESA 3KLDA 5I9QB 3WNNA 3ULVH 4YHPA 3WUZA 3SKNB 3PHOA 1LO5A 4D0DA 2C3GA 5IROC 1QLEL 3B6SA 3F7VA 3L3IA 3EYQC 4KKNA 4LU5L 2AXJA 4U6TA 3OKKA 1MPAH 1BZ7A 2ATKA 4ZFGH 1NUGA 4XNMA 4Y7MA 4YO0A 3KPOB 2GTZB 1BGXH 3HPJB 4NWTL 5F3HB 5HHMD 3PIQA 4X6CF 3L5HA 1FFNA 5BV7H 3MFFB 4X80L 1J05A 3GRWL 2UZIH 3KHOA 3TBSB 4N5ED 4PJGB 1CIUA 3N85L 1AGCA 1CDCA 2H1PH 1T21B 2DBJA 4Y4HC 4MA8H 1NCAH 2O5ZH 3KVQA 2H32H 4KH2A 1RJCA 4WI2A 2BDNL 4WNQA 3WIHL 1R5WB 1HHHA 5B39B 3W39B 4Y1AE 1CF8L 3VXQB 5E5RB 3GDBA 4P2QE 3IU4L 1A02N 3LPWA 3GKWH 3LS5L 3TN0D 2HRPH 1BWWA 2BJMH 1KEML 4JFFB 2W59A 3ULVD 5IEKB 3G6DH 2EO9A 3D87B 3VW3H 1ZANL 1TENA 4NJAL 3TN0B 1Q8MA 4MDIB 2PN5A 5BS0B 3TV3L 2FB4H 4UTBH 3RWGA 3L7EB 4ZODA 3ALXA 2NY2C 5F89B 4WU7B 3TA3C 1VPOL 4HGWA 4WJ5A 2WUCL 5EO0B 4ZO8A 43C9B 5FDWB 5E5MB 1FZJA 4ZUTA 4OGAC 1EAPA 1JYNA 1C1EL 4G6JL 5C0JB 3D39D 4HUWB 1WUNT 5J1TC 4C59B 2LAAA 1UJ3B 1BJ8A 3GSOA 4KAQH 2HN7B 3OJVC 3GHEH 3O45B 1U8NB 4P59L 1AI1L 3QUMH 2X4QB 6FABL 4UTAL 3JTTB 5GHWL 5IQ7L 4G6KL 4ODUB 3ZKMC 2YPKA 3PWNB 4QWWC 3IDGA 3D9AH 1BIIA 5DHXB 4G6MH 2QSQA 5L8KB 3H0TA 1UM4L 4NGHH 3WL9B 3V4VH 1CXHA 4FQQB 2IPTH 2VB5A 3QRGL 2J8UE 2YKLH 4JB9L 2BOBB 2PXYB 4WTZA 4GXVH 2Q86B 5E5UB 2IBZY 1FCCA 1ZHBB 4LSRL 3D25B 5HD8D 2VQUA 4X6DB 3P9WB 1Z3GH 1DANU 3BPNC 1J1PH 3IDYC 2IQAA 1RHHA 1SJHA 1UEYA 4RMRA 2PYFB 4OZHE 1ZWIA 2ZCKL 1UCTA 2WZPD 3QEQA 5GZNC 2FHFA 2Z92B 5JOEA 4J12A 2VMFA 2GFBB 4KVCL 3MV11 4Z0XA 4J3XA 5CSZA 1OWWA 4HMDA 4Q97A 4ODSH 5ETUB 4NN6B 2P8PA 5ANME 3IDNB 3ZLQC 3QDMA 3OBAA 3QUMB 1KG0B 5DUPH 2X1OA 3RKDD 4PV9A 3NIDE 3MBED 4KDTC 1KTLA 3FT4A 1LO0H 4NOBA 4QTHB 5IV2B 1WBXB 1U42A 3MBEB 4XP5L 1HHKB 1HXMA 3QULA 5F3BA 4LPTA 4MA1C 2C5DC 2ZWLT 3CDYA 3DVGB 1MCLA 2AJUH 1XF2B 1IGTA 4ZSOB 4KI5E 2NR6C 4F7MB 4LRIA 1VFBB 5B38A 1MJJB 4PJ9C 5F6IC 3KLAA 4HKBA 4JCMA 3IDIA 3ROOB 1OTUC 3GK8H 3O3AB 4QHUA 4YC2B 2I26N 5HGBB 3QP3A 3HAEA 1B0WA 2IJ0C 3FB6B 3LDBB 4MYWB 4V1DD 4PGDA 5EN2A 4DGYH 2OL3H 1AE6L 3RPIB 3S37X 3IGAB 4G8FB 4QRUA 1NSNL 5GISH 3VXUE 2QJDA 5I1GH 3C8DA 3C8KA 1I1CA 4YHLH 4FABH 3EOAA 3BP4B 4JG1H 5ELIA 2EDOA 4EOWH 5A3ID 4X7FC 1U93B 1JYWA 1FFOB 5T1LB 4NT6B 4KJPD 3H7BB 3EYVB 1B0GB 3HZKA 4XP9L 1G7LA 4XNUL 2ED7A 5FYJE 2DKUA 3EYFA 3BMWA 2EDXA 5D70H 3U9UB 2QEJA 4XTRD 4I3SH 4JJ5B 4JY4B 3T3MF 4O5LL 2R0KH 4NWUH 1B9ZA 4X9BA 1FVCA 5ALCL 1C8PA 4JQIL 2AJYL 2OX5A 3P77A 1S9YA 5FHBH 2X2YA 4WEBL 1HEZB 1UZ8B 4OSUL 5JO5A 3N50A 1CGYA 3GIZL 3MO1B 4XPHH 1HSBA 2V6HA 3K2UL 3DTXB 4L29A 1NDMA 5LGKA 1XF3A 4R97C 1YC7A 2FO4B 1U8QA 4PRPD 1KYOK 2W60B 3PDOA 4MCYA 5DTFB 3V8OA 4JG0H 3NCYS 3CIQA 1ZKAA 4PRPB 4Y1AD 2X70A 4Y2DD 1JYXA 1BPVA 4H1LB 5GQBA 4M48L 1T20A 2DQJH 1JGUL 3MJGX 4L8DB 4Y1AB 3OXRA 2XV6B 4Y2DB 1ADQL 2NY1B 2D4FA 4OLVL 3OPZL 4DW2H 1PSKL 1RZIA 1ZHLB 3QFJA 2VRAA 2GUOA 2VLKE 1OP3K 3TC9A 1R0AH 4ETQB 3O41A 4IDJH 4LSQH 1YN6B 2OTUA 3JZ7A 1NEZA 5D5MF 3EGSA 5FYKU 2XKSA 1FN4A 1GSMA 3G9VA 4LQFL 1AXTH 4X7EC 5T5NF 4CW1A 4JO3H 4AH2B 2NW3A 2ZUQC 2CKBH 4DK6A 4Z5RB 1F11A 3ILQC 2B5IB 5L88H 1D9KD 3O3BB 1DBML 3ECBB 2H2PC 1XH3B 3LQAC 3GJEA 1OCWL 1UVQB 4WY7H 1BHGA 1NBYA 4HCRA 1D9KB 5ENWB 2AS5M 3O0RL 2ZNWA 4XXDA 5EBMB 1QQDB 1CL7I 5I1LA 3OHXB 2DQHH 2HJLA 3QO1B 1IZJA 4UAOC 3DXAD 2CRZA 3L9RB 5BRZD 3IAPA 3FOMB 3BKML 4KQ3L 3NCJH 3GB7A 4JFYB 4M8QA 5KSAA 5DMJB 1HOCA 3DXAB 3T09A 1ZLSH 1P7KA 3HZYA 3IFOA 3RZWA 3QZWA 5BRZB 3ZTNL 2V2TB 4Z9KB 4BUGA 5GGTL 5TH2A 2YPLE 4RWYL 3IFPA 3TIDA 4HUVB 1UWEH 2Z35B 4JHWH 1AHWC 4L3EA 4QCIB 1VGKA 3TNMB 5J6GA 3IT8D 5AZ2H 2R4SL 4Z77B 1OAQH 1I85C 2J8UB 3MLRL 4TUKL 1ERNA 1TVHA 5FA4A 3H9SD 5HVFB 3W5NA 2VAAA 1CD8A 1F42A 2ADGB 3DO7B 1YEGL 5C7XH 5F7UA 3H9SB 4B5EA 1LQSR 2PUQT 4ZDHA 2W9DL 1QSFA 1UXWA 3V4PH 4M6OL 1RZKL 4NQSA 1F4WH 3UTZB 4OZHB 2I9LA 3FKUS 4E0RA 1YMMA 2MQ3A 1J18A 5CCKH 2J3SA 3FO1A 3E3QE 5I75B 4Q58C 2JJTA 4X7SL 5F9OL 3FO2B 1D5XA 3O6LL 3RIAK 3AS0A 3F5WB 1DQDH 5D1XB 4K3JH 3RTQD 4LCYB 1KPUB 2V2WA 5KJRL 5C9KA 1NKRA 2WLZA 4OKVB 2XQBH 1ED3B 3L1OH 4BK4A 5ANMB 4PJDF 5INDB 4JFZH 5D7LD 3RTQB 4PP2A 2DRUA 2FJHA 4Y4FA 3JV6B 3RA7H 2K1MA 5ADPL 4GT7A 2PF6A 3X11B 5KSVB 3P4MA 1LILA 1YJDL 4BUHA 1WJ3A 4DWHA 3T65A 5GS2H 1RIVH 4NP4H 1KB5A 2RQ8A 3C08H 1AR2A 4FXKB 1F6AB 3K81A 3VWKC 3T4AA 4FFYL 1KIQA 1F02I 1L7IH 3CX5J 4ONFH 5EIVA 5C07A 4PR5A 1FL5B 3VD9A 3I85A 3QUXA 5J1AA 5KANG 3MYJB 5DD3H 4LSDA 4RIRB 3AS2A 4YAQB 5E7BA 3SE8H 2R0WH 2ERJB 1TZHB 5FUZL 1LDSA 4FQ2L 2FD6L 1QSEA 4IRJD 4HEME 2EDDA 1NMAH 3U2SA 3S37L 1RUPH 2Y36H 1CQKA 5IG7A 4Q9RH 4IRJB 1DQMH 3QQ9D 2Z31A 3VXUB 5B8CA 4KFZC 1CD1A 2ATPB 2I07A 5T3ZL 4EI5A 4CDGC 2O93L 5JNYA 5JXEA 1CL7H 1A6UH 1C5CH 3NGBB 1DBJL 4LEOA 1IJ9A 1K4CB 4Z7WA 4R3SA 5F70A 5DK0B 4OCYL 2GSIB 5GS2D 4KMTL 5K9OA 2A9MH 5FYJD 3VG9B 5H35A 4FP8L 1UWXK 2H9GB 5AYQA 2Q6WB 1J8KA 1ZT1A 3X12B 3SPVB 1R3LB 3VWJD 1MCIA 3CMOH 4O58H 4YXLL 5IB1B 4TTDC 1CDJA 3KPOA 4I18B 3JV4B 4XAWH 4MAUL 1NGQH 1OTTD 5FDYA 3VWJB 4FQ1L 3GMLA 1IGFL 3P3YA 3SN6N 1MFDL 1XGUA 1Z9LA 1LEKB 2GK2A 1YN7B 1T21A 3RL1B 4PJEE 1KCKA 2BXYA 4M5YH 1BFVL 1MRCH 5I8CB 1CZ8H 3G08B 2VQ1B 2WK2A 2C3XA 5B39A 1MAJA 3MODL 3W39A 5DEFB 5J7CC 5C92A 4PRHD 2ZUTA 3ZDZF 2VTFA 5D2NB 3ZTJH 1X5AA 4JFFA 3CNKA 1WCBB 1MH5B 2YD4A 1FC2D 3QG7L 4GRLC 3QXTA 5IKCB 1VEPA 1KB9K 2OMBA 3MRQB 4WI3A 1TCMA 3KPTA 5BS0A 2VLKD 4D9RE 3L7EA 5HDBF 4X99B 4GMSL 4KPHL 5E8DL 1S5IH 3WIIL 4H5SA 1I1AB 4DCQB 2VLKB 2Y07L 5EO9B 2ZPKH 1MNUL 3CK0H 3VFMB 2AEQH 3LD8B 43C9A 1N6QH 5E5MA 1V7MH 3P30L 3Q6FB 1E6JH 3ZMRA 5T1MB 2A9NL 2DQFA 5FB8B 1OQOA 4HUWA 1FIGL 3STZB 5KSAC 2A6DB 1HYSD 1G0XA 1UJ3A 2C7UA 2J8HA 2B0SH 5EBWB 3SY0B 1QRNE 5DD0L 3QHFH 3MXWL 3O45A 2LU4A 4YZFF 3BGMB 1KCSL 1I9RH 5DT1L 1MRDH 2IAMD 3K4AA 2X4QA 4TSCL 1T2QH 1YNLL 1BLNA 4RDQF 4KUZH 4L4JA 3FJTA 4ODUA 5KSUA 3VFPA 3PWNA 1LVEA 4PRAB 5C3TA 4MMZC 3PQYD 4PB9H 3QI9D 4NQDE 1VENA 2VIRB 4X5LA 1NC2D 4PJ8D 2D9CA 3VH8G 3D3VE 1J1XH 2YPLD 5D9SA 4Z7WF 1MLCB 3IS0X 1IC4L 1NBZB 3PQYB 2PXYA 3QI9B 1NC2B 1SYVA 1ZHBA 3ULUF 5L9DL 2YPLB 2NXYC 5DWUH 4X6DA 3EYSH 1II4E 2ESVA 4BKLA 3CC5A 1CICD 3MJ8B 1A7RH 4U1HB 1KJVB 1N7MH 1E6OL 5IFAH 2PYFA 1S78C 1FNGB 1AXSA 1PG7H 4UV7L 4JO4H 4YDVB 4PJGF 4QY8B 2GFBA 1P4LB 3QJFB 4WFED 1X5HA 5DMIL 2K7PA 4XP4L 1R24A 3HC4L 4RZCB 3H6JA 3ZYIA 4AEFA 4YR6B 1T04B 1J0JA 3IDNA 1UM6L 3QXWA 1XGYH 3PV7A 4QXTB 1OSZA 4ZUSA 4PP1C 3AFLA 4S1SH 1CDUA 3FB8A 2EDEA 1JNNH 3DV6A 4MGXA 5J9PB 1OT2A 4DVRL 3PGCB 2HJKB 5IV2A 1WBXA 4LKCB 3UMTA 4M43L 3THMH 2CLRB 4FFWC 3ARFD 4GLRI 4AMKH 1TVDA 5EA0L 4FHBD 3QUXC 3MV7E 3BH8B 1NFIB 2NPLX 4F7MA 3MRLB 4MD0B 1I7ZB 5GGUA 3ARFB 4MXWH 5EU4A 1MJJA 3VG0L 3MV9D 1FL6B 4LASL 3HI6H 4BJLA 3FFDB 4CU6A 1FPTL 2CO6B 4JZJA 1QLFA 5HGBA 4FG6D 1MREH 3FB6A 5DD5L 3MREB 4MNQD 3MV9B 1A9EB 3BKCH 4X8XA 3KPSE 1JMZA 4QTIH 2Z31C 5B8CC 3IGAA 5C0FB 5D7KE 4ODHH 3WUWG 3IJYA 5DQDL 5JXEC 2CK0L 4YUEH 2DKMA 3GKZA 5E2UH 4B0MM 3O4LD 1EUTA 5I9QC 3BPLB 2Y6SD 3OZ9L 3ULUC 2XN9E 1OPGL 2OTWA 1E28B 3FFCD 3O4LB 5DJCB 4Z0BL 1U8OB 1XCQB 1U93A 3M8OH 4H20L 2Z4QA 4PGEB 1AGBB 4LLQA 5T1LA 3RHWK 3H7BA 3EYVA 3V6OC 3KPMA 1B0GA 4S1DC 1MCCA 3FFCB 3MRBB 5CINL 1E0OB 3CGTA 3F7PC 3PXJA 3RWCB 4HHAB 5T3XH 4RMUA 1Q94B 3CDGB 1VACB 3MRHB 4KV5F 4ZOEA 4CMHB 4X6DF 5D8JH 2R0ZH 1R6VA 2R23B 1FO0B 3MUZ1 3STBA 1F4XH 3K8MA 3FQWA 1UZ8A 5BZWB 1V3KA 2ILLA 1YEEL 1TJHH 2JJSC 2E7CA 2HRLA 1XZ0A 4OIAA 5DJ2B 1DQJB 3OF6A 4PLNC 2W60A 3MCLH 5HYJA 4JPVL 3LKOB 5DA0B 3A6CL 4OGXH 4PJEB 3TN0C 2QQNH 4JFQB 1RVFH 5GS0H 2DL9A 1XAUA 3T2OA 4IS6B 5EULV 2VOTA 4L8DA 4Y1AA 5TPWH 4MVBD 4TQEH 3GIVB 4P2QA 1D6VL 5IBUG 3BP5A 1TZGH 1RV6X 4NSKB 3RVUD 2VDOH 1ZHLA 1X5JA 4CU8A 1G9MH 4ETQA 2P7TB 3FRUB 4JDZA 1GOFA 1YN6A 4LSPL 1SY6L 2ZOKB 1DQLL 4D9RD 1RULL 1UJ3C 2DB8A 1EO8H 5F97E 5C0CE 4XB7A 3BIBX 5D96B 5GGRY 4ZXBD 3I6KB 5IHBA 4AH2A 1P53A 4PREB 4TUJB 1WAAE 3VFGH 4XNZB 1KTDB 3O3BA 5BO1L 4OLUL 4ZXBB 3ECBA 1XH3A 2FL5A 4HDIB 4G7YH 4HS6A 2VXQH 1W8NA 5AWNL 3KPNB 4RX4D 5DHVH 1QRND 1QQDA 1Q9KB 3PWJB 4BSWB 3OHXA 5ESAB 5FCUH 3BZFB 4EUPG 1EFXA 5F7DB 5GS0D 3I9GH 3FOMA 1FNHA 1QRNB 5B4MD 3LB6D 4W70A 5GGVH 43CAB 3F7QA 5I1DB 4N0YL 5I1CL 4HKZA 4N8CH 1HDMA 3SQOH 3Q5YA 1URLA 2R2HB 4DKFH 2WBWB 1S9WB 2ZCHH 1EEYB 2F54E 5HD8C 1CXLA 4GW4B 4HUVA 1KF9B 2BY1A 4NOFA 1N6UA 3RL2B 4QCIA 4YBHA 3ES6B 4AT6B 1BZ9A 3T3PF 4Z77A 5E2WH 4GQPH 4U31A 2DL2A 4ZTOL 1XGRA 4EKXA 4QNPE 4NN6C 5D7JB 1IFHH 2ADGA 5C9JB 3MJ9A 1TIUA 3CVHA 3SKJH 4IDLA 1KXQE 1KN2L 4BZ2L 3DX9A 1FV1A 5EOCH 5J13B 1ZSDA 3RKDC 2H3NA 3VXSD 3JBG7 3MNVB 3MBEC 4PV8B 3REWB 3UJJH 2EKJA 3MBXL 2D7OA 3WNPA 2F8VA 1CFQB 3FO2A 4OBRA 2ITCA 4NHCL 5D1XA 3S6CA 4LCYA 1KPUA 1R3HB 4UDUB 4OKVA 5ANMA 1NGWA 1OT1A 3LQAL 1SEBB 1GAFH 5INDA 4JZOB 2E3VA 1CU4H 4D3CL 4ORGB 3JV6A 3ZZ1A 4YC2C 1KGCD 1QFUH 3BI9X 3C5ZD 4U1JA 4UB0H 4GFTB 4M1DH 3NIFE 3VXPA 3TBWB 4UDTB 1QHPA 3C5ZB 3DYMA 4R8WL 4FXKA 1F6AA 1NDGB 1EBAA 1AD9A 5F6HJ 2C1PB 4H0GA 2VZ3A 2AJXH 3G6JE 1NCBL 3LMJH 2F5AL 5JW3L 4X98B 3TH3T 2PKDA 3MYJA 4HIHA 2GK0A 4RIRA 1JZ8A 1JJUA 3KPSD 1TZHA 1UWGL 4J7RA 4ODVL 4XCEB 4CN4A 5E2VH 2VDPL 2ZSVB 1RK1B 3VH8B 1W2KT 5I30H 3KPSB 5JR1H 4HWEL 4MAYD 5DRNB 5FUOL 2Q20A 5J11B 5IHUL 1DEDA 3LEVL 4MNGA 3VXUA 1XIWD 5MP6H 1C08B 4FQJH 4MAYB 3VGDA 3GSWB 3PL6D 2BY0A 1S7TA 3BQUA 3MRGB 4PLKD 2XN9B 4XTRC 5JIIA 5DK0A 4UV4L 1OAZL 2PETA 4UBDD 4CBPA 2HVJB 1FGNL 2CMRH 3QQ3B 3PL6B 4XI5C 3BD4A 1WZ1L 4JFHE 5CFHA 5GGRA 3X12A 3SPVA 5IQ9A 2I9TB 2Y06H 5IB1A 5BJTA 3TH2T 3P4LA 4I18A 3U82B 4PGCB 5DHYB 3ARPA 1A3QA 1RJLB 2ARJB 3VWJA 2J8UF 4UIMB 2HWZL 3O6FD 4YNYB 5SWZD 4LCCB 4UOW1 1LWRA 3RY6A 2HLFD 1ORQB 5C6TH 3RWIB 5D71H 1RZ8A 3X14B 3O6FB 5JW5B 2R69L 4GKOA 1BQLH 1F3DH 4M7LL 4RMVA 2ADFL 5I8CA 2FH8A 4Y2DC 4OZHF 3FRPG 3GSVA 3GI9L 2HH0H 1TJIH 2NTFB 1T83C 4A6YA 1FFPB 1CT8B 3AB0B 5I18L 3RIAF 4QGYA 1KN4L 4FTVD 4NZDA 3MC0A 2YK1H 3S35H 4Q74A 2RAMA 4ZO9A 5BMFH 5TE7H 1F3DJ 5DUML 1B4RA 3PV6B 4FTVB 5IK3B 1WCBA 5CUSH 4HLJA 1MH5A 1HHIA 5D1ZD 1NEUA 3C60A 4DKEL 5IKCA 2XT1B 4DZBB 1QRKA 1T22A 3NIDF 2B5IC 3MRQA 4WI6A 4OZIA 3WUWB 4X99A 1M71B 1F5WA 1T0NA 1D9KC 1I1AA 4JN1L 2EE2A 1DLHA 1RUMH 2EIZB 3VFMA 4OB5H 1NCUA 1NAMA 3UEZA 3MSPA 1JYVA 4KI5F 3Q6FA 3VMPA 4I77L 4ZPVA 3VI4F 5AG8A 5C0CB 4OCNC 4YDIH 1D5ZA 5FB8A 4U1KB 3STZA 3VI3F 2A6DA 4LLDB 3BDXA 3A67H 1CXEA 2EIDA 4K23L 4V2CB 5K33A 5DFVC 2A74B 5I74B 4Q9QL 3BGMA 4GKZB 5CJXA 5E70A 4JRYD 3BJ91 2DMCA 1WFNA 2VZSA 2GJ6E 4NZTH 3B2UD 3MLTB 3FQRB 4I0CC 1J0ZA 4XWOD 3P73B 4PRAA 1RZ7L 2GJZB 2APTA 4RBPK 1D5BA 2KKQA 4ZMAT 4NZUH 1W72B 1MLCA 3NFPB 1NBZA 3VFSB 2E7HA 5FYKH 5ABDE 3NCYP 5T1DL 3FL7A 1JHKH 4F57H 1INQB 5CGMA 1H3WM 1IAKB 2RHEA 1J5OH 2YPLA 2BNRE 2F54B 4OAWB 3MOBL 2CDEB 3T0BA 2EC9T 3NABL 1A9BB 3MJ8A 4WUUD 5IP4A 1AFVL 4U1HA 1KJVA 4P49A 4LSVH 5I75C 3UTSE 3GMNB 1OM3L 3VGBA 4Q0XH 2DTSA 4WUUB 2V7NB 4YDVA 5D1XC 1MCNA 2NY6D 3CCHB 4QY8A 3P9LB 4ODTL 1MIML 4P5KB 1MQKH 1H8OA 1N3NA 4RZCA 4YHOL 3HMXH 2J88H 3RTQC 3PHSA 2XYCA 5ISZD 2YBRB 4HCRL 1OD7A 1OARL 4QXTA 4S1RL 1A2YA 2AJSL 1ACYH 4C56E 1KCRH 2FHBA 3UC0H 2AABL 2DJUA 5EZLA 3T0XA 5J9PA 4OT1L 1MCWM 3KYMA 1Q0XL 4S1QL 2RB8A 2R39A 5FYKD 4KI5C 1ZGLM 2FATH 5DRZA 2I24N 3BH8A 2M1KA 4X5XA 3MRLA 4MD0A 3WFCL 1I7ZA 4MLIA 4NDMB 8FABA 1MJ8L 2ERJC 3Q5OA 3S9DB 1OAUL 1A6ZA 1FL6A 1FRGL 4EUPB 1UCBL 3FFDA 2CRMA 3SKMA 4QRTA 2HFGL 3FO0H 3MREA 1A9EA 4IRJC 2OR9H 5DQ9A 3EOBB 1PX3A 1UA6L 4U1IB 3G6JB 1HINL 1BFTA 1JGEA 1B90A 2VWEE 4RGOH 3NGBC 3QQ9C 2DQTH 4W6YB 1J0IA 1FL3B 5EZJB 3MLVL 2C1OA 1E4XI 3ARZA 1SEQL 4HIJB 3VG9C 4OCMC 1E28A 2P43B 1AH1A 4Z7OE 1LGVA 2N7BA 5E94B 1YEDA 1AGBA 3LQZB 4JFEE 3K74B 4I18C 3MRBA 1QR1B 5CD5D 3H8NA 2DI9A 1HKFA 3VWJC 4LARH 4OBSA 2XXMB 3QNZB 4FQCH 4D9LH 3RY6C 3QPXH 4HHAA 4XCFH 1OTTC 4AEIH 1QLRB 2E9IA 5C0RH 1D5IL 1Q94A 2D0GA 2DQIH 3DSFH 3FQNB 2D7TH 1FGVL 3H3BC 1VACA 3MRHA 5TDPB 4HUKB 4Z76A 3I84A 1FNSH 4OM1H 3FN3A 4NJ9H 1KB5L 3HB3C 1PEZA 2R23A 1FO0A 4E42A 4YHKL 4YQXL 5L0QB 1WCQA 3GJFB 3JWDC 4E5XB 1QEWB 1EEZB 1RD6A 5BZWA 5IB3B 3GJFK 1EMTH 5TQ2L 1IGCL 4QO1A 1G9EA 5DJ2A 5D2NC 1QNZH 1DQJA 4RISH 4URTB 1B6DA 3VE0A 1GGIL 3HPLB 2MPAH 1YECL 1RZJC 3LN4A 3LH2L 3B2VH 5ADOL 3I6GA 1JGVL 3LKOA 2E7MA 3VFOA 5DFWH 2BSTB 4PJEA 4JFQA 4LLMB 5EUOE 1X6LA 4S0TD 1HZHL 1QLEH 1W0VA 3AM8C 4IS6A 3OJ2C 4LU5H 4P5MA 3WFDL 9CGTA 1S7WB 3QIBA 4NM8L 2X4NB 3QO0B 1I1AC 3VA2C 4P2CG 1MHHB 4NWTH 5FEBA 4JVUA 1N26A 1A47A 15C8L 1X5ZA 2EE3A 3U1SL 3QEHA 1DFBL 4X80H 3LD8C 3GRWH 4R7DB 4M9PA 3H9HB 1WIPA 2CRYA 4FZ8L 2EECA 2P7TA 5MEQB 3UTQB 2OXHA 3MLSL 1G7QB 2ZOKA 3N85H 4QHMB 2VDQL 4LIQL 2GT9A 5I15L 1BX2B 1KTKE 4NCC1 5CBAB 3I6LE 3QCUL 2DWDB 3I6KA 2DMBA 4I1NB 3Q2CA 2BDNH 5CJXC 3WIHH 4ZQKB 3D0VA 1N0XL 1CF8H 3W82A 1KCVL 4Z7VB 3IU4H 1GGTA 5F1IA 3TZVA 4M5ZL 3EW3B 5E9DE 3KPNA 4G8EB 3LS5H 5BZDB 3UCRA 4GKSB 1HIML 3W0WE 3TYGL 1MI5E 1Q9KA 1KEMH 1YEJL 3U7WL 4LMQI 5ESAA 1C12A 4M7KL 3BZFA 3PP3H 5F7DA 1YMHA 3NAAL 4AJ0A 1ZANH 2XG4A 4NJAH 3WO3B 4RX4A 1MLBB 3QI9C 3TV3H 2LFGA 3M45A 4I0KA 4F8QA 3M17A 43CAA 4BFIB 1WC7B 4RFEA 3RHWF 2GJ6B 1H0DB 2R2HA 1VPOH 4MJIE 4HWZB 2WUCH 1S9WA 5EOTB 3CFEB 1EEYA 4HXAL 3G5VA 1EGJA 1XR8B 1IC5L 3LN5B 4LEXL 1C1EH 4L5FL 4G6JH 4X9FA 3U4AA 4NQDA 3IRPX 4AENB 3MMEB 1QOKA 4UUJB 5IOPB 2FR4A 3D3VA 4RNRA 2BNRD 2VISA 2VN4A 3KPRD 4P59H 5CZXD 5IMOB 1MFNA 3LPGA 3QA3B 5IIEA 1JV5B 2XA8L 5D7JA 3S5LG 1RUKL 3BN9D 4N1EA 3UJIL 4DQOL 5C09E 6FABH 1OW0C 2BNRB 4UTAH 5C9JA 4MQ7B 5GHWH 5IQ7H 3UTSD 1MVUB 3MA9L 4G6KH 5GJSL 4P2OB 3KG5A 1FZKB 4HAFA 3NFNA 4PG9B 1PW3A 3E3QC 5H2BB 4D9QD 4XMLL 3UTSB 3FONA 1UM4H 2YSSB 4PV8A 3WKNA 3QRGH 3N9GL 3SBWA 3HR5A 1CFQA 3PWPD 4JB9H 4ZG1A 2PYEE 2DQCL 2G2RA 4MJ6B 2UVFA 4PJEF 1GL4B 3SGEH 2R1WB 4H88L 4LSRH 4NFBA 4QLRA 5C0DB 1UYWL 3E6FB 3OWEA 3ARFC 1GZPB 1S7XB 1SEBA 2OR8A 3QDHA 3MLPA 2BOCB 3IDXL 3BKJL 1KNOB 1WBYA 2D9QB 2ZCKH 3FO9A 5HTSA 2H8PB 1TITA 3HG1D 2BVQA 3TBWA 4UDTA 3MUHL 4KVCH 4FG6C 1CLYL 4RGND 1NDGA 3MGOB 4Y89A 2YWYA 1TTGA 2C1PA 3MV7A 5F9DC 3VFUA 5IMMB 2R29H 2AXFA 4K3DL 3CDCA 2X4RB 4RGNB 4X98A 5I16B 3U7AA 3C5JB 1ZVHA 3IDUA 3BPLC 4M3KB 5FO9B 4ZUVA 2UUDK 4Y5VB 3O4OB 1RK1A 2Y6SC 4YH6A 3VH8A 4QOKE 5JHLL 4XP5H 5I66B 3O3DB 4WCYL 1BZQK 2VLLB 4PYHA 4J1UB 5DO2D 5GRVL 1EH9A 4FN0A 2EXYD 1DDHB 2VO5A 1IARB 3TT1L 1IGYB 1P6AB 4GG6A 5KZCD 4K94C 2RFXB 4MAYA 2WBJA 1OB1A 1AGDB 3GSWA 4O2EA 3UYPA 1JPFA 2QR0B 3ETBF 3IFNL 1RI8A 2XN9A 1AD0B 4N0FB 1N59A 5ECJE 2FLBT 1T03L 1SVZA 3QQ3A 4J3UA 1INDL 5CD3B 1JHTB 2D03L 2HVKB 2FX7L 4N5UA 5E8EB 1AE6H 2A1WL 2A83B 5LCVL 2VKXA 5I19L 2I9TA 5H37G 5DD6B 3RVXC 1NSNH 2EH7L 4Y88A 2NY4D 4IIQB 3HNVL 5CEZE 1X5FA 1RJLA 2ARJA 4UI2A 5KVMC 5E6ID 1ZEAH 1BWMA 4YNYA 4KK8D 1JZ5A 1MCBA 5IJKA 3WNLA 1ORQA 4IRSD 1XGQB 4XWGL 4JR9L 2PW2B 1QSVA 1S7RB 5D6CA 3RWIA 5E6IB 5T33L 4KTEL 1UB6B 1XF5B 4ONHA 4JLRB 3B9EA 4XP9H 3B5TA 4XNUH 4P4RB 4LVHB 2NTFA 5I73B 1FFPA 4MHHG 4NO2B 1INEL 3W9DB 5HDQL 3S4SA 4O5LH 3RVUC 5C2BL 5ALCH 4PS4L 3U9PL 3RZCA 5D96C 5IK3A 4H8WC 4JQIH 3WE6B 2AJYH 3CX5K 1REIA 1QYGL 1TNMA 2OS7A 5J8OA 1AKJD 5JTWA 3RGVD 4WEBH 1N64L 4OSUH 5KVGL 4XNZC 4LPYA 4NRZA 4ZXBC 3SO5A 5EC1A 3WUWA 5I1IH 3K2UH 1M71A 2V17L 1T4KB 3L3JB 3RGVB 2B1HL 3WXVL 4MD5A 1UQSB 1R3IL 3HC0A 3OX8B 3HA0A 2OLDA 3R8BB 1IEBA 3I6LD 4GQ9L 1NMCB 1BVKA 1F00I 2P8MA 3E2HB 5D93B 1IGIL 5C0CA 4OD2B 3DSNA 3CXHK 1BQSA 4LLDA 4M1CD 4N9GB 4M48H 1WAAA 2A74A 2E6JA 5LWYL 1JGUH 2VSCA 5B4MC 3W0WD 4PJ7E 3LB6C 1G7MA 1ADQH 3BPCB 2A77L 4HGMA 4OLVH 3OPZH 1PSKH 4HG4J 3EUUA 5E9DB 3H2WA 3MLTA 3FQRA 3W0WB 1JZ4A 2YXFA 5DJ6B 5LJYH 3CZFB 3P73A 3JWNC 3JSSA 4TUOB 2VABB 1I4FB 3V6FB 5DJZA 4LQFH 4XMPL 2GJZA 3X17A 1EAJA 1KC5L 1W72A 1B2WL 1QBLL 5D7JC 1EIBA 3NFPA 3VFSA 1SJVA 1DBMH 4M6NH 1CGSL 4XVSH 1INQA 1OCWH 1CN4A 5GS1B 5J13C 1K2DB 2F54A 4RSVA 1CFNB 4G8GE 1RUAL 2CDEA 3DVFA 3O0RH 4MDJA 1CGVA 4QF1B 3VD3A 1UADC 1I1FA 4WTXA 5JW4Q 3OG6B 3GMNA 4MZ2A 3BKMH 4PJFA 4KQ3H 2V7NA 2WINB 4X0KB 3CCHA 1CFSB 1AO7E 4P2RE 4P5KA 3SCMD 4S2SB 1MHPL 4MJ5A 5C09B 4NYLB 2W38A 3ZTNH 4XP1L 5GGTH 3V7AG 1U2HA 2YBRA 4RWYH 3HC3L 3U4EB 1KIRB 3SCMB 3ARDA 3QDJA 5JQHC 4YEFA 3CFBA 2Z91B 4KMLB 4GUPB 3QUYB 3C09B 5MEOB 2R4SH 3S96A 3C5ZC 4YHML 1QFOA 4OCLC 3MLRH 4TUKH 2EEBA 1ACZA 3S34L 1HNGA 2PYEB 1DN0B 5EU6E 4MHHI 3WNMA 3SOBL 5EH1A 1IM3B 1YEGH 3ELAT 3LSOB 4P5TD 1ZLWK 2CXKA 3OB0K 5GS3A 4FZEL 4GKNB 4NDMA 3V8CA 1IQWL 2W9DH 4MCZB 3N1FC 4EDXB 3OTTA 4YPGA 4M6OH 3RWFB 1RZKH 4HWBA 4P5TB 3QCTL 1MCHA 4EUPA 1NFDE 2EDHA 5EO1A 3ME0A 5EB9A 1ZV5A 4X7SH 5F9OH 3O6LH 1HN1A 5J11C 5KJRH 5FO7A 2VLJE 4MAYC 3G6JA 3MJ9L 1TDQA 3RUGE 1MOEA 1WAAF 4ENED 1E4WL 5F21B 5EZJA 5ADPH 2XNAB 4M00A 2O26U 1T0MB 3O2VL 1YJDH 1BM3L 3PL6C 1CFTA 2GQHA 5C8JB 4PLKC 5E94A 3LQZA 4UBDC 3T1FB 2ZUWA 1U8HB 4FFYH 4R0LA 1ZVSB 1TZIA 2DAVA 2FJGB 1O7VA 5HYSG 3P0VL 4W4NA 1A22B 2CIIB 3V7AE 2X4TB 5AYUL 4LCCC 5IJKC 3CXDL 1CGXA 4F33A 5KG9A 3FQNA 2JE8A 5FUZH 3O6FC 4UMGA 1IILE 2BP3A 2IADA 4FQ2H 2HLFC 2FD6H 3K8LA 3N1PC 1J87A 4YHNB 1X5GA 5IW3A 4GXUN 1AQKL 3S37H 1LE5A 4YHIA 1LO2L 4E5XA 4N90D 1QEWA 1EEZA 1SQ2N 5IB3A 5TDNB 3AB0C 3O6ML 2FSEB 1OAXL 4OLEA 4N1HB 4WVRA 4IMKA 5T3ZH 5KW9L 3EAKA 4QNPF 3X3GL 4U3CA 4UT7L 1T80A 1RURL 1DBJH 2LU7A 3HPLA 3RX7A 1K4DA 1BEYH 4OCYH 3TLRA 4KMTH 2BSTA 5IVZA 4Z7QE 1TMCB 2CXGA 3NZ8B 4FP8H 2HFEA 4P3DB 5JHDE 5CHNB 1HSAB 1S7WA 5DD1L 3QO0A 2VXSL 5FM5O 1LNUB 1MHHA 4MAUH 4X7DC 1KIUA 2Y9RT 4FQ1H 1IGFH 4DJMA 1MQ8A 1YPZE 1PVHA 3H9HA 4OIBA 1MFDH 1TPXB 2OR7A 1ETZB 5MEQA 3O11A 5DJAB 5LBSL 5DZLA 5CBAA 1YEKL 2LQRA 3CPLB 3CFJB 5I74C 1BFVH 5HJ3A 3V0AC 4L8BA 3QFDB 1M7IB 1G1CA 2PCPB 4ZQKA 1FDLH 5FYJL 2X40A 3NIFF 3MODH 4MQXD 5EZOL 1P7QD 5T3ZD 3C5SB 4NNXA 5KVEL 3LS4L 1XFPA 5DVKA 1IEAB 4DN4L 4G6FD 3RDTD 3IXTA 5F6HI 4LNVA 4G8EA 2OYPA 1P7QB 5BZDA 3B2UC 4K55A 1WICA 3G6JF 2L4OA 2CR3A 5FFLA 3RDTB 3QG7H 1OAKH 2DF3A 4PUBL 5CZKA 2NY5C 1K5NB 2ED8A 4AIXA 1MLBA 4ODWB 2P5WE 4M6AA 1QKZL 3JWDL 4PJ7B 4LKXB 2X1WL 4BFIA 1RJZB 4GMSH 4KPHH 5E8DH 5E24E 3WIIH 5DS8B 2GJ6A 1H0DA 5L2JB 2Y07H 3VFRB 4JFOB 4JY6B 4HWZA 1A1MB 4N8VG 1MNUH 1JIBA 5JLZA 1MCEA 3SDCA 5L8JB 1FYTA 3EO1B 1XR8A 2W65B 3P30H 3T0DA 4XPGL 1A7BA 1RZJL 2A9NH 1UG9A 3F6LA 1FIGH 4AENA 3MMEA 4UUJA 2W1NA 1ZHKA 1HHJA 3LRHA 5DD0H 3FRPA 3N06B 5IMOA 2B4CC 4POZC 5DT1H 4PY8J 5IMKA 2F53E 4TSCH 1YNLH 3P40A 4MQ7A 5HHNB 1C5DB 3L3OB 5DC4B 3T0EE 3F7YB 5T1KB 4RAUA 1EZVY 4P2OA 3ABZA 5GSVB 4DFIA 4XP6L 4NC1E 5A16B 2XY2A 4PG9A 4GAGL 4HH8A 2UYLB 2O61B 2C4XA 1S7VA 3K0WA 3OXSB 4PJCE 1IC4H 3T1WA 1YYLL 4XBPB 2R1WA 5ACMA 3B5HA 5C0DA 3E6FA 3L3GA 5L9DH 1I9JL 4DVBB 4J4PA 1GZPA 1S7XA 4UZGA 5BW7A 4ZS7H 2BOCA 4NBYB 4C56A 1EJOL 3U36B 1E6OH 5EU6D 1RIUH 5I8KL 4UV7H 1IGML 1S8DA 1VADB 2H8PA 2MTPA 2VDKL 5EU6B 3QEGL 4OF3A 5DMIH 1QPXA 5FA3B 3BZDA 3T4YB 4XP4H 3HC4H 1PFCA 3BOVA 4HX1A 1UM6H 3MRMA 2I60L 3T0WA 5I16A 5DSCB 4GAJL 5EPMB 4XNQA 4GW5B 4D2NA 2MQCA 4JZNB 1ORSA 4FQIL 4OUUA 3PWVB 4DTGL 4Z7VF 3IJHA 1IT9L 2ZSWB 2VLJD 4Y19D 3IF1B 4DVRH 1S5HB 5CP3H 4LP4A 4M43H 4OZFH 4POYA 2X1XR 4JN2A 2DQGL 4J1UA 2UZXB 2VLJB 4Y19B 5HHOD 5EA0H 3RUGB 4RAVB 2FGZA 1E27B 3JXAA 1DDHA 3W9EB 2E6QA 4KTDL 1IGYA 3VRJA 3TO4B 3VGAB 2RFXA 3QEUB 5AAMA 2EYRA 1AGDA 4WI9A 3BD5A 2EO1A 1PQZB 3VG0H 4LASH 4CGTA 4U4BA 1AD0A 2IBBA 1FPTH 4EIZC 5FF6B 4HUNB 3VXRE 1DJSA 3WKMH 4NNPH 5L0QC 3DROB 3GSRA 5HGDB 5CD3A 1JHTA 5DD5H 2P5EA 4JFEA 1CXFA 5I1KL 3T8XB 3REVA 2A83A 4KJYA 5C0GA 5JOFA 4YXKL 5DD6A 3P2TA 4QRSB 3HS0A 5KAQF 5CJOL 5DQDH 3BUYA 2CK0H 3TA3D 4IIQA 1KPRB 4NKMA 2E7LA 1HK6A 4HJJL 3MRIA 1U3HA 5IBTL 3KYNB 5IB5B 5MENE 3IU3B 2KDGA 5F44A 4YE4L 3OZ9H 4B53A 4HWNA 1I8KB 2PW2A 1OPGH 1S7RA 5ID0B 5DDHB 1T2JA 4Z0BH 1EUUA 5FYLE 3KAAA 4ZFZA 4H20H 3DUUA 4K7PX 1JVKA 1XF5A 1X7QB 1DUZB 4F7TA 2WMPA 3UJTL 1ZLVK 5CINH 2VLME 4F7EB 4P4RA 4WI4A 3GZKA 5JIPA 2LABA 4NO2A 2WIIA 2BXZA 1LK2A 4L4VE 1EO7A 1ZT4B 3W9DA 1XGPA 2FIKB 3NA9L 4LLVB 1F3JB 3ZKMD 4PJHE 4QWWD 2ICWJ 1ZGLA 4AL8L 1L0YA 3ZHKA 1Q9WB 4BELD 3V5HB 3MGAA 1RZGB 5FGSA 3WJLA 3OJDB 1Y0LB 5EUOA 4OLWL 2MCG1 5ERWA 2ZOLB 2AGJL 3AU1A 2X41A 4NO5A 3QEQE 1YEEH 2QHRL 4X5WB 2ORBL 5HGGS 3GO1L 1QBML 1T4KA 3L3JA 2XTJE 1UQSA 3HI1B 3OX8A 4U1GB 2OI9B 3HRZB 1YPZB 4K94L 1U3JA 2HMID 2VERN 32C2A 1G7PB 4JPVH 3QDME 1OOAA 3A6CH 4CN1A 1U8PB 5A43C 2FIRT 4OD2A 1NCCL 1FO0L 4P2YA 4N9GA 1L0QA 3C2SA 5FKAB 4APQB 5DMYA 1CYGA 5ESVB 1D6VH 3BPCA 4RGMB 1A6TB 3OGOE 3RVVD 1HWHB 5E9DA 2UV3A 2X44D 2F19L 3NH7L 1MI5A 1SBSL 2X4OB 3ARGA 4LSPH 1SY6H 4TUOA 1DQLH 2K3TA 1RULH 4XHJD 3V6FA 4ZNCD 4OJFL 1HCFX 2YUVA 3IXAA 3EYUL 4P57B 2P5WB 3MROB 3CH8A 1MCFA 4I5BB 4LF3B 3MLXL 3BUTA 4NPYB 5MERB 4XVJL 3CVIL 5BO1H 4OLUH 2Y5TB 4Z7OF 1N8ZB 2FNBA 5D6DA 4YDJA 1I7TB 4EQ3A 5CZXC 5K9JL 3FT3A 3FAWA 4MJIA 4P2OC 5GS1A 4D8PB 1IKNA 5AWNH 3DWTA 1CFNA 2ADIA 4HPYL 4U6YB 1OTUD 3INUL 2AKRB 4H26A 4Z7UE 4EVNA 3VGGA 4H8WL 4HFWB 2VDML 5KOMC 4X0KA 3AREA 1A6WH 1VEOA 2EYTB 2DIAA 4S2SA 5L2KE 5AZEL 5C09A 5I1CH 4NYLA 4LDEB 1V5JA 3KYOB 3T0EB 4KQ4L 1EHLL 3U4EA 4WHYH 1KIRA 4ALAL 3SGJC 5GRUL 1GIGL 1QHOA 4GUPA 2F5BL 1X5LA 3HZVB 3R1GL 4ZUWB 5DI8B 3QUYA 4PJCB 5MEOA 2ID5A 2HLAB 2VKWA 1FVEA 3UZEA 2A6IB 4EJ1C 4OCXL 4YHPB 4ZTOH 4ELMA 2PYEA 3ARTA 1LO5B 3PHOB 1DN0A 3HUJE 2OTPA 3B6SB 1OGAE 5GGSY 3SQBA 1BZ7B 1HQRA 4Y16D 4RGNC 4XNMB 4LPVA 4YO0B 1F6LL 1IEHA 1KN2H 1EGJL 4BZ2H 1IAII 4Y5VC 2XZQL 1J05B 2V5RA 3O4OC 4Y16B 3RWFA 1BF8A 4I9WE 1JBJA 1AGCB 2CDGA 2HFFB 3WS6C 3T2NL 4NHCH 3QIWB 2VWEC 4UNTA 2EICA 4WNQB 2GHWB 5DLML 1HHHB 3LQAH 4NZRL 1CQYA 4N8VB 5IW1A 2MCPL 3U7YL 1GH7A 2EXYC 3MX0A 4D3CH 2XNAA 4LLWA 4ZS6D 1T0MA 1F3RB 2Y72A 3WBDA 1WF5A 3L3KB 4LHJB 5F72S 2Q8AL 4MXVE 3VFNB 1IMHC 4QOKA 5DXWA 3B9KA 2FWOB 4ZPTB 3BH9B 4R8WH 3T1FA 1U8HA 3SHSA 3W2DL 1OWRM 1OP9A 3S5LA 2E7LC 3RWGB 1NCBH 4CVZB 2QSVA 1LE9A 1EEUA 2F5AH 2X4TA 3V52L 3UTPD 1WITA 5D2LE 4HGWB 2QSTA 1MJ7L 5E6IC 4UINL 1UWGH 3I3BA 2BY3A 4ODVH 4KK8C 1FZJB 2CJUL 4I13B 3MJ7B 4IRSC 1KT2B 4YHNA 1A4JB 5KVFL 3H3PL 4HWEH 4LVHC 1N6VA 2YZ8A 5I73C 5FUOH 1PDKA 5TE4L 5TDNA 1DUYA 4QRQB 1FBIL 5IHUH 4WFFD 3LEVH 2KPNA 3A0OA 3VGFA 1IAOA 2AW2A 2BVOB 5FYLD 5EIQA 4MWFB 3EOTL 4JQVC 1P4IL 3RPKA 2YPKB 2ARWA 1OAZH 4I3RL 3IDGB 4UV4H 4K7PL 1BIIB 3CZJA 1GVIA 1FGNH 1F2XK 1O0VA 3DGGA 4L4VD 3NZ8A 3H0TB 1WZ1H 4P3DA 4UU9B 4TN9A 3BD3A 2RCSL 5CHNA 1HSAA 3RGVC 5GGVY 2UY7A 1LNUA 3RJDA 4L4VB 4KZDL 5IM7B 2NX5E 3R06A 4W6XB 3QDGE 2YUZA 5E8OB 4CVWA 1NMCC 4PJHB 2HWZH 1VFAB 1VEMA 1JF6A 3E2HC 1S3KL 1T7XA 1R3JA 5D93C 3QEQD 5FYJU 1ITCA 5DJAA 3HAEH 3GMMA 1RHHB 2R69H 1NAKL 1TJGL 4M7LH 2XTJD 1ZWIB 2ADFH 5I1AB 3QEQB 4LLAA 4CL7A 2XWTA 1U3YA 2NY7L 3QFDA 1M7IA 3W11C 2LAGB 1I8IA 4M1CC 3GI9H 4Z0XB 3LZFL 3QDMD 5ITFB 3ZKSD 5I18H 2XTJB 1KN4H 3RWHA 4JFDE 5C0NC 3BN3B 1IEAA 3ZKNC 5DUMH 1P7QA 4PTUB 3QDMB 3R0MA 4PV9B 1H3XA 5F7YC 1DBKL 4JGUA 1DVFA 1PKOA 1WEJL 1KELL 4DKEH 2OP4L 1LEIB 4ODWA 1MCPL 3SKOA 3GMOB 2DI8A 4PJ7A 1HXMB 3ROLB 4LKXA 5F3BB 5GS1C 2YD2A 5C0AE 5IB2B 1GZQB 5DS8A 4JN1H 2YS4A 4D0CB 5L2JA 2NQCA 4GRWE 3V0VB 5AG9A 4X7CC 1LHZA 4BQ9A 3EO1A 2W65A 5B38B 4FQHB 4I77H 3K4DA 4HKBB 5E2JA 1A5FL 1A3LL 3OKOB 4QHUB 4U6VL 1K6QL 3G5YB 4OI9A 4LVOB 3VD7A 4K23H 4M7JH 1I9IL 1Z9SA 1TQBB 4NKDA 4Q9QH 3QAZB 3NOIA 4PGDB 4OF0A 1DSFL 2WSKA 4G6AD 1T5WA 3SCMC 1LO3H 4G8GA 3ZYOA 3L5JA 5T1KA 4BSVA 1JWUB 2DJSA 3HFML 5A16A 3QUYC 3C09C 4Z7UB 3C8KB 2UYLA 5DK3A 1RZ7H 3S98A 1XR9B 5BXFB 1YNKL 3EOAB 5F9WB 4LCUA 1AO7A 4Q9BA 4YWGL 4P2RA 1M05A 2CUHA 4LFHD 1UENA 1A7NL 2VL5B 5T1DH 2E9JA 1OF2B 3V0WL 4U6HA 2C4FU 3ZE1E 3LV3B 3V95A 2XZAL 1PYWB 2JCCA 2WWKT 3QQNA 3MOBH 4XZUA 2VXTL 4DEPB 1FJ1A 3IFLL 4P5TC 3NABH 5IFJB 4FQXA 3U36A 1DEEB 1K3IA 4TVPE 5KSBE 1OGAD 2GI7A 1MRFL 1FVCB 2J5LB 1K85A 4F8TA 4XBGA 5EU3A 4JHBA 1VADA 1W72L 4L3AA 4HK3J 4Q2ZB 2NY5L 4ODTH 1OGAB 5ICYB 2UZYB 4TTDD 5JO5B 1MPAL 3T4YA 4P9HC 1F2QA 2W0KA 4YHOH 2C3VB 1XF1A 1SJEB 4NZJA 4HCRH 3FB7A 1A14L 1OARH 4L29B 4S1RH 5DSCA 2AJSH 5C0EB 5J89A 4GW5A 1S7SB 5CS7A 4JZNA 4ENEC 2VDRL 5DHVA 1NFDA 2AABH 3MLYL 4MCYB 2V9RA 4OT1H 1G7JA 4V2BA 5HPMB 1CE1L 1Q0XH 4S1QH 3MV8E 3Q0HA 4H25B 4O9HH 3QPQD 1J8HA 2VLJA 3RFZC 2AI0L 4O4YL 3RUGA 2B4CL 1E27A 3OXRB 4AIZB 3WFCH 1QFPA 3TO4A 1Z6JT 1MJ8H 1O5DT 3QEUA 1OAUH 1RZIB 1BQHG 1UZ6E 4PJ7F 1HKLL 4LRNL 1FRGH 3A6BL 1UCBH 3WYRA 4JPKL 3V4UL 5D7IE 5FF6A 1VFOA 3DROA 4I8DA 2HFGH 4ISVA 3S88L 4OQTA 1NBVL 3T8XA 1UB5B 2FB4L 3MZTA 2DYPA 4HKXA 4PJIE 1UA6H 1F11B 1HINH 3TNNA 5DYOB 4DGIL 4OLXL 3BE1L 3GJEB 3VXNA 5D2LB 3MLVH 3KYNA 4OD1L 4HWBL 3DMMD 5B21A 1NBYB 2FX9L 1SEQH 3EYOB 1I8KA 3UX9B 5ID0A 1YJDC 1L4IA 5KSAD 2HJLB 5AD0B 3DMMB 3BDBA 5FKPB 1X7QA 4YDLB 1UACL 2BNQE 3GHEL 4KY1L 4M8QB 3DGCR 1HOCB 2VNCA 4FRWA 2D7PA 2ICEB 1BAFH 3HZYB 3IFOB 1IGJA 1AY1L 1ZT4A 3QZWB 1TPXC 2FIKA 4LLVA 3GM8A 4L3ED 1F3JA 4U49A 5TH2B 1D5IH 4WFHD 2DJ4A 2DM7A 1FGVH 2ESVE 3V5HA 4BQCA 2GCYA 3OJDA 1Y0LA 1KB5H 1VGKB 5J6GB 3UDWA 1TLKA 4E41E 2ZOLA 4YHKH 4YQXH 1AR1D 5JHDA 1MCWW 3FHAA 3TJHD 2IGFL 5TQ2H 4X5WA 1IGCH 2NZ9D 1NCDL 4QHKJ 5CP7A 3QUZA 3T0VA 4YFEA 1QSFD 2NXYD 2IPUG 2VAAB 4MQXC 3NFSL 3HRZA 1F6FB 4RMSA 1GGIH 3H42L 3ZYJA 1AIFB 1YECH 5IFHL 1KJ2A 1WWCA 3LH2H 5ADOH 1C5BL 1YMMD 2VLRE 3RDTC 5GZOC 1JGVH 4LCWE 1IKFL 4NQSB 1U8PA 4F58L 3BIKB 2I9LB 2KZWA 2JK5B 3SO3B 2HAZA 1HZHH 4M02A 4CVUA 3BO8A 3WFDH 2XWJA 1IC7L 4ZO7A 1BECA 2X5PA 4NM8H 1NFDF 5FKAA 4APQA 5HYSA 1G0DA 4NHUB 5ESVA 4JFDB 15C8H 3Q1SL 4Y4FD 3F62A 4XNYL 3U1SH 4M8VA 1DFBH 4G8IA 4GAYA 2MJWA 4FZ8H 4LSUL 2X4OA 3MLSH 3GEWB 3RUGF 4Y4FB 1NKOA 3VRIB 3QXVA 2VDQH 4LIQH 5I15H 5C08E 4DK3A 1JN6B 5C0AD 2FDBP 3P4MB 4JJHA 5FGBC 1Q9LB 4P57A 3S8WA 2P5WA 3MROA 4KK9C 4G9DA 4I5BA 4LF3A 4P46A 5C07D 4FFWD 2C26A 4NPYA 5MERA 5C0AB 1N0XH 5TGBB 1CR9L 3GMQA 3ARSA 2Y5TA 5CBEB 1N8ZA 3QUXD 4KKBD 3RY5A 1KCVH 3T4AB 5EORL 5JPMA 1KIQB 4GRWB 4MB3A 3L5IA 12E8L 4D8PA 4IOFD 2KQNA 4PR5B 3FQUB 4K9EC 3MACL 5E1HB 1HIMH 2DS4A 4KKLD 3TBYB 3TYGH 1O7SA 1YEJH 3U7WH 2AEWA 3QH3B 4M7KH 1S7QA 3MA7B 3NAAH 1A6AA 1ONQA 2B8OT 1JZ7A 1N5AB 1PY9A 1I1RA 3U2SB 4H0HB 4EI5D 4L3CA 2F53A 2X4PB 2BCKA 4C54A 1T1XB 3UYRL 3KYOA 3T0EA 4P48A 2YD5A 5SWSE 2APWA 3MRDB 4G80A 4HXAH 4WGVB 4PD4K 2I07B 2QADD 4X6BA 4EI5B 1IC5H 3NMEA 4LEXH 2VITA 4LEOB 4W6WB 2VZVA 4ZUWA 4R3SB 5DI8A 4PJCA 2QADB 2HLAA 5K9OB 3TPUA 2XY1A 2A6IA 2MKLC 3MOQA 5H35B 4S1DD 1EHAA 1ZT1B 2APVA 2XA8H 3DBXB 1RUKH 4Z7QF 3UJIH 2ED9A 1S9XB 4TVPD 1ZXQA 3MA9H 4LOUD 4MB5A 2VDNH 4G9FE 5GJSH 2B20A 1EXUB 4UIKL 3GMLB 2A6JB 3UZQA 4Y16A 5KSBB 1XGUB 2ZP0T 4KKAD 4XMLH 1EA9C 4MS8C 5IJVA 4WW1A 1YPZF 5HYJE 2HFFA 1RFDL 4HBCL 4PJXE 3N9GH 2W9LA 3E8UL 1WZLA 2DQCH 4OTXL 3QIWA 4PTTB 4H88H 4IHOA 4P0DA 3TO4C 3VGAC 1UYWH 3ALWA 1P2CB 2AEIT 3SDDA 4N8VA 5J06A 4JFFD 3IDXH 3MV8D 3BKJH 2APFA 3L3KA 1MWAB 5BS0D 3VFNA 1IL1B 4J3TA 3MV8B 2FWOA 4M7ZB 3BH9A 4ZPTA 1CLYH 1A1OB 3OAZK 3D69B 2OSLA 4S11A 4BZ1L 5DJYB 1JZ2A 3V79C 4CVZA 1G9NC 2VYRE 4K3DH 4H5SB 4Z95L 4AG4L 3HLAB 2NY3B 3PP4L 2RJMA 3VXRA 1E4XL 1WWAX 5D7IB 3KS0H 5JHLH 3MJ7A 3ARRA 2DQFB 2GEEA 4ELKA 1KT2A 4N0UE 2DQEL 3EOYG 1A4JA 1U8MA 4WCYH 2EDLA 1BMGA 3U0PA 1PX4A 1J10A 2C7UB 5SX5H 4PJIB 4QRQA 5L88L 1OVZA 4KUCD 3TT1H 4HQQL 2SEBA 3IVKA 3CH1B 2BVOA 5MENA 4MWFA 1NGPL 1BLNB 4HT1L 4XT1C 3IFNH 5KSUB 1G6RB 3VFPB 1T6WA 2BNQD 4NKIL 2FO1A 1KLFA 1T03H 4KKCC 1DBBL 1INDH 5LVEA 2PXYD 2D03H 2XKNB 4DUXA 4UU9A 2FX7H 2A1WH 5LCVH 2BNQB 4L8CB 5I19H 5GJTL 5D9SB 4K8RD 1RMFL 5KS9E 5FO8B 2ESVD 1OAYL 4PJCF 4U1GC 4L4VA 3P4OB 3HNVH 5IM7A 5E8OA 1SYVB 4HXBL 4PJHA 3F58L 1VFAA 4CJ1A 4I48B 5JW4M 2ESVB 4BKLB 2X4SA 1KV3A 3CC5B 4XWGH 2B39A 4JR9H 2YMXL 4JKPL 4JM4L 2HMIC 4R6UA 5T33H 1RZFL 4FS0A 3B8SA 4KTEH 4E41B 3KYKL 4HPOL 5I17B 2JIXA 4JRWA 1AXSB 4APQC 4BFEA 5I1AA 3H9YA 4ACPA 3MRFA 2LU3A 3ORJA 4RGMC 1GYAA 2W91A 3PABA 1YY8A 4OFVA 5ITFA 1INEH 1JK8A 3HNSL 1LEGB 5HDQH 1EV2E 3D85B 3ZDYF 1YZZA 1R24B 2GSGA 1XT5A 4NUGH 1BQHB 5GRVK 5SX5K 3RVVC 5C2BH 2BFVL 2VLRB 3DUSA 4PTUA 4F9LA 4PS4H 5KOVC 3U9P