3SY0A

S25-2- a(2-8)-a(2-4)kdo trisaccharide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-2 FAB (IGG1K) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0A01
5SWQB 5I71B 2P24B 4XP9L 1HSBA 3UTTD 5CMAB 4YFDB 1T3FB 4UTAH 3P0VH 4L8BB 2FEDD 2D4FA 5I8KL 4MDIB 5DO2C 3T08A 3VFPA 4LRNH 2Q6WA 1MREH 2CIIB 3FTGB 4MA3A 5EOQH 1JTPA 4NZDA 3FT2A 1BVKB 1X5FA 4IDLA 3KYAA 4LVEA 1FNGA 4KXZH 2Y6SC 3L3IB 1MFDL 4HXAL 1WAAA 4NRZB 3H3KA 3REWA 1SY6L 2HYMA 4PRIE 3B5HA 3ULVD 1EMTH 4R0LC 4LQ1A 5KJRL 4CBPA 1BD2A 1FYHB 1HHJA 4IOFD 4XPTL 4GXVH 3BZ4B 2R9HD 1ETZB 3HCVB 4XX1E 4O02L 3KLHC 3CJJA 3BH8A 1GH7A 5IQ7H 1KXVC 5F7EL 4NP4L 4I0PB 3T0XA 4OM0L 3VFGH 2DBLH 4F37K 1URLA 3KLAB 3BRDA 3U0TB 1ZANL 4JDTL 5IUSA 5HYQA 4LFHG 2XZZA 1KELL 3TESA 4KC3B 3UTTE 4I18A 1YYML 5BV7B 1W72B 1F97A 1V3MA 2E7CA 4QRQB 2BMKB 3MSPA 5J11B 2IG2L 2YUXA 4XPFH 3NCYS 3LMJH 3GIZH 3QO0A 5JLZB 2P4AB 1YPZF 4ORGB 5DEFA 3RWCB 4EXKA 5HHPB 4ELMF 4ZODA 4KJWD 2XN9D 3IU3B 3GBMH 2DDQH 4ZQKA 4I2XB 4JFYA 2DQHL 3RIFK 4X6CE 1UH2A 3LKRA 3TNMA 3WCYA 5FO8A 3JUYA 1CZ8L 1A7PL 3ULVE 1QYGL 5DZOA 1UM6L 3VGAB 1BZ7B 1VKXB 4HH8A 1L9MA 1IC7H 5HHOD 1IE5A 4Z77A 3HMXH 4NIKB 3UTOA 3R06B 4HJ0C 5DRWA 2J5LC 3FQXB 4HULB 2NQCA 2BOBA 1U92A 4UAOB 2DQEL 5HI4D 1AP2B 4LLUB 1JMZA 2QSTA 2JCCA 2X4TA 4QHMB 4X4MA 1HXYA 2GJJA 5C0BA 5KVEH 3F5WB 1MCFA 2V17L 2R2HB 1C7TA 4KMTL 3V5KA 4OIIH 1FN4B 2HRPH 1DQDL 4JLRA 5E00B 4XVTL 1QLFB 2AP2A 1KCLA 2W0FA 3O4LB 1S9YB 1K85A 4YXHH 2BSSB 3ARRA 3HNTL 1CF8H 2HRLA 4NKIH 1VADB 5DJ2B 1FQ9C 2VQ1B 4ODXB 2DWDA 3BN9C 3H3PL 1C5DA 3L5XH 2F15A 5HI3D 2XN9E 1Z6JT 4MSWA 5TQ2L 1RURH 3K2UL 2XQBL 5ECJE 1G9NC 2QR0B 3F7VA 1J1OL 3VI3E 5KSVA 4F7MA 3FQUB 2PXYA 4G42A 4PRPB 1KULA 1U8MA 4LAJH 3QB7C 3D87B 3B2VH 5CD5C 1LD9A 2Q7YA 1NJ9A 4GT7A 4Y4HD 3GJFB 4BZ2L 4Z7WE 2YR3A 2XQYG 2ZPKH 5EZLA 3KPRA 4ETQA 4JRYE 5HHOE 5C0IA 5HDQH 3TZVA 3BGMB 3FQTB 2NW2A 5ITFB 1QSED 4R4FL 5J57B 1HILA 2A2QT 5SWSB 3DETD 4Z7VE 4KJYB 3SGEH 4EBQL 2XXCB 3HTLX 4ZFOB 1D5ZA 2FX8L 1Z5LB 4A6YL 1ZV5A 3G6AA 2AJYL 5ISZD 4EUPH 4P2RD 1YY8B 4Y5VA 3QUXA 1NFDB 1IL1B 3EYFA 2VXTL 5HXMA 3V79C 1HINH 2Q1EA 3T1FB 2FNBA 1T20B 3S34L 3TCLB 1H3UA 4BUHA 2YS4A 4IMKA 3A67H 3RGVD 3EYVA 4P2QD 5EIVA 3QEHA 1XGPB 2D7TH 4Z5RB 4Y5XB 1AI1H 5BCAA 4X98A 4URTB 4X0KB 3ROLB 3BO8A 3QH3B 3GMNA 2BVEA 1FE8L 3SKUD 4HLZH 5J4MA 5KSUA 4ETYA 4XNQA 5TDPA 1INQA 4OLVH 5K33A 1BWMA 4K8RH 2F54B 1QSEE 4XGZA 1L0QA 1F3RB 2MKWA 4Z7WA 1OAYH 3JTSA 3IDIB 5HHXH 2EXWC 4JRYA 5HHOA 1H15A 1MCOL 4P23C 2DL2A 4KUZH 2YN3A 3AS1A 1TJIH 1MI5A 3MOAH 5D1QB 5HGGS 3VD5A 2FIKB 1JZ5A 5ISZE 3RWJB 2EIBA 2AJVH 3WDJA 4JPVH 4RMUA 3QPQC 1G0DA 1D6VL 3PQYD 1RZJC 3MRLA 2XZCL 5F89B 1GOFA 2B2XL 4OSUH 4PB0L 5T5FH 3P0GB 4HBCL 5DJAA 3I6LD 3NOIA 2F74A 3VRJB 3FN9A 3FL7A 3MNZA 4Z7UE 3ARFB 4P2QE 2SEBB 3QBTB 1EHLH 1YA5A 2FB4H 3MREA 3MNWB 5KZCD 1EBPA 3W2DL 1S3KH 5IJVB 2CKBB 4F58L 1TZIB 3QDGB 3QIUC 5J1TC 1X5JA 2CDGA 4RDQF 1WICA 2EZ0C 4HX1B 1I1AD 1N5AB 4Z7QE 3GMQA 2E8ZA 5K9OA 2IF7A 2OMBA 3I6GB 5CD3A 4WI5A 5I74B 2KPNA 3QUML 2RR3A 4YEFA 3HI6H 4PJGB 5C0EB 1MFEL 3FT4A 5GGQL 2MQ0A 5DS8A 3CLFH 2FBOJ 5B8CA 4ZNEA 4YBHA 5EUOB 2NY5H 4U6XB 3BDYL 3SDCD 2AK1L 4E41B 3T0ED 3UEZA 3X11A 4NKQB 5F7WC 4H0IA 3P9MA 3PQYE 3SKNB 3OR7B 4H0GA 1KIPA 3D85A 2BSTB 3SQBA 4TTDC 1D5BB 3U46A 3I6LE 1MCHA 5IVNA 2FX7L 3W9DB 1KOAA 3HE6B 5EZOL 3ZE0F 5I1KH 1DBJH 4R6UA 4YDVA 3STLB 4NQED 4YBLB 1FVCA 2Y36L 1NGPL 4X80L 5D1XB 1CE1H 4GBXD 5C0JB 1KIUA 3ARDB 5IHZB 2EDKA 3HNSL 4HIEA 3IFLL 2IC2A 1U8NB 1AFVH 1KT2B 3VFSA 1S8DB 1UT9A 2DD8H 3QAZC 3TN0B 5C07D 3MV8E 4FFWC 5JHDD 4DCQB 4UV7H 1LO3L 5BRZA 3MUJA 3RVUD 1BM3H 4AMKL 5EUKB 3TP4A 3ULVH 2BK8A 4G6KL 3BH9A 2DQFB 1TVBA 3FONB 1NMCB 3SDYL 1T66C 3NBNA 3T0EE 4DN4L 4DKEH 2E9WA 1FVDB 2I27N 2J8UB 4MNGB 4U3HA 2FR4A 4X4YA 4WI2A 4WI9A 4PJ8D 2WK2A 3S96B 4DOHE 3EZ8A 2F8XC 5KVFL 3V7MA 3BP4B 1I1CA 2C26A 2NR6C 1DSFL 5DK0B 4JY6A 3VCLB 3BZEA 5TQ0H 5L2KD 4B5EA 4NQEE 1PG7X 3KR3H 1XR8A 4DWHA 5IVXA 4JDZA 4XP1L 1KLGA 2XWTA 2G5RA 3RTQC 4TN9A 3W11D 5HYSB 2W9EH 3O9WD 1UZ8A 1YC7A 5LCVH 1N2RA 3SCMC 1BFVH 4Y5YC 3KPMA 2NX5A 1B6UA 3QWRD 2X05A 3CPLB 2EO9A 3B3IA 1JE6A 4N0FA 1H0DB 1JVKA 5C07E 5FKPA 5K59E 4HEPG 4QKXB 2DTMH 2X6MA 3CFBB 2W9LA 4PRHA 3TIDA 5CGTA 4XC3L 1LEIB 3OR6B 3I50L 3QFDA 1UJ3A 5ALCL 1EV2E 5DJXB 3JXAA 4RMVA 2KZWA 3MV8A 2MWCA 3O6FD 3MXVH 3O45B 4NGHH 5AZ2L 1UVQB 3RVVD 4WDIA 1NH6A 3W0WD 4DVRL 5MERA 2E3VA 1DDHB 2NXZB 2ZG3A 4GAYB 1CK0H 3M17A 1QLEL 4Y16B 3BZFA 4MS8C 3S5LG 3L3HA 3QFJB 1Q8MA 3TYFA 4XBPB 1V5JA 2DI9A 4XVJH 1PKQE 3SHSA 1UFUA 5L2KE 2DLFL 1RVFL 5DURB 3RL2B 3EYOB 3TH2T 1K8DB 3RRQA 1U3ZA 1IKFL 3WFCH 1KENH 5E24E 3PGFH 3KJ6H 1EHXA 3EJJX 1U3YA 2F58L 2KQNA 1KTKE 2FO1A 4PLKC 3EDJA 1WT5C 2Z0BA 4NO5B 3RX7A 5EBLB 5EO1B 4LEOA 3RU8L 3CFEA 4CN1A 4E5XA 4L9LB 4ALAL 3QUZD 5E95B 1IM9D 4FZEL 4PGCA 3MRGB 5C0GA 2BY3A 1VFBB 4Q6IC 2EH8H 5EO0B 3TIEA 5EH1A 3C09C 4H25A 2XA8L 5JPMB 4G8GA 3L3JB 4F7CA 2CRYA 5E4EC 1F4WH 1HZHH 1I7ZB 3ZTJG 3Q3GB 3F58L 4BH8B 5IHUL 1NCNA 3W0WE 5T1LD 5JDSB 3D18B 2Z9TA 1GPOH 1MFDH 3E6FB 5MEOB 4NFDA 1CLZH 3MRHA 4LQFL 2OTUB 2VAAB 3VD3A 3IXAA 2PF6A 1IEAB 1D3CA 4F57L 4KJPC 1F11A 5I75B 5I9QC 1QRNA 4XNXL 2P8LA 4GRLB 1CFSA 3F65A 3OJMB 4Z0XA 3KNBA 2WBJC 1XF3B 4NO0A 1KEGL 3E0GA 2VJXA 3OJVC 1WJ3A 4L8SA 2P45B 4M93C 5KSBA 3DV6B 3B2UC 1A14H 3TCXA 3BPCA 4WHDA 1DEEB 4K55A 1HIML 1SMOA 2VO5A 1CWVA 3PABA 1WZKA 4Q0XL 3WSQL 4PJCB 1CFBA 4JCLA 4XPAL 1MCJA 4PR5B 2WP3T 1RIHL 4BH7A 3OJ2C 1RZIA 4KQ4H 4LCUB 3NMEA 4OFKA 1MRDL 3DUSB 1U8OB 3FMGH 1OP9A 2UZYB 4Y7MA 2VISA 5TE6H 4LSSH 4JG1L 35C8H 4MA1C 1UCBH 3T3PF 2R4SH 3EJZC 1PLGH 4G43B 4QT5A 3C6LC 1WWAX 4MZ3A 1T2QL 4G7YL 5GGVH 4JN2B 4PJ9C 3P4NB 2YRZA 1C8PA 4FTVA 3QXWA 4HV8B 3HZYB 4EUPB 1NEZB 2QADB 32C2A 4C58B 2VIRA 4KZDL 1HSBB 5C9KA 1YNTB 5L8KB 3C5JA 4PLJD 4KMTH 2W60B 5C0RL 1YN7A 4JPIA 4Y4FD 4NUJA 1R24A 4XVTH 4MJIA 4MA3B 4ZTPH 3KPLA 5F1IA 1UEMA 1PYWA 1FNGB 1QHPA 1I7RA 4I5BA 5TQ2H 4XX1G 3REWB 4UV4H 2XQBH 4FN0A 4LCCB 1IAOA 4FFVC 3RNKA 4P46C 4HKJB 1R3KA 4POZD 5KVDL 1E6OL 4K7PY 1HHJB 4U1IA 25C8H 2JELL 3OTTA 4LSTH 4M5ZH 3QHTC 4FFZL 3U4AA 2DQTL 4D9LL 2VC2L 3BH8B 1EJOL 3O3AA 1JIBA 2N7AA 4U1GC 1XMWA 5ITBH 4NFCA 4XVSH 2GTZA 1WCBA 5E1AA 1SJHB 2H3NA 2BVTA 4N9OB 5HYQB 3TNNB 1AD9A 4YDKL 5KANG 1V7MH 1E0OB 5DTFA 2HLFD 4I18B 1D5IH 1B6DA 2B0SH 5LJYH 4QHUB 1YPZE 3MCLL 1DQJA 4ELME 2CRIA 2VDNL 3QO0B 3NFNA 1G6RL 5DEFB 3VFWB 4LNRB 4J3OC 2H8PA 4JY5L 3RA7H 3B9KA 4ZQKB 3SGKA 3TVMA 1DBBL 2F19L 4JFYB 1BVLA 1UH4A 1FAIL 1FAKT 1AE6H 4EIZC 1JF1A 4WY7L 1X5LA 3LKRB 2PR4H 4PS4H 5SX4I 5FO8B 2BNQD 3JUZA 1FSKB 3KS0H 3MOBL 4X9BA 4NWTL 1HEZA 2DLIA 5CCKH 5HHVH 2FO4B 1NUNB 4TRPL 5FDWA 3LD8C 1FE8H 4PRIB 5DRWB 2BOBB 1U92B 4K71C 5EU6E 2JCCB 2X4TB 1HXYB 4JFFD 3PJSA 5D8JL 5C0BB 2QL1A 2HKFH 1WIOA 3V5KB 5E8DL 4WWKA 2V7HA 5GS1C 2Q8BH 2EEBA 4JLRB 4X9HA 1CTNA 4P3DA 5IMOA 2W0FB 5CJ5A 1GZQA 3KLDA 1EEZA 5M7QA 4MLIA 2MMXA 2DWDB 2V5SA 1C5DB 4OZHF 3UTTB 1A2YB 2WM0A 1XCTB 1KGCD 1U42A 4JFHD 4XBGA 3IDNB 1FC2D 1GRWA 2XZCH 3F7VB 2B2XH 4Y2DC 4M1DH 4F7MB 3QEQD 5KSVB 4G42B 4XBEL 4R97B 2G75B 3T4AA 2VN4A 1U8MB 2BNQE 1LD9B 2Q7YB 3A6BL 1QBLL 5KSAD 4MDJB 4Q9CA 1RU9H 3KPRB 4PJFF 4ETQB 4G6MH 3TZVB 4JREC 2X70A 2NW2B 3MJ8B 4NNYA 5I15L 3VE0A 4YHOL 2B7DT 4UILH 1JUFA 1HILB 4BKLA 2OXHA 1KLUA 5CJBA 5F7YC 3WIHL 4M4PA 3NPSB 4PGJA 3QUMH 1YYLL 3G6AB 4RWYL 4AIOA 1MFEH 4G3YL 2FECL 3NACL 1Z9SA 2QEJA 3GNMH 4U0RB 5EU6A 5DFVC 4ZOAA 2WWKT 3QUXB 1MCQA 4L3ED 2AK1H 2VZVA 5IV2A 2BSRA 3V4UL 3SKJL 3EYFB 1FCCA 3VFTA 3U9UB 5AUMA 1KGCE 4JFHE 4NZTL 3ZT7A 4CW1B 3OZ9L 4JB9L 1DANU 1U0QA 3QEQE 1QEWA 4QRSB 3EYVB 3QEHB 1YEFL 5C08E 1JZ6A 3P77A 3K74B 3UYPA 2FX9L 4X98B 3O11A 4Z9KB 3IKCB 4LSRH 3BO8B 3GMNB 2W59A 4XNUL 1MQ8A 4CMMA 4KI5F 5KSUB 5KW9H 5TDPB 3CX5J 2XZQL 2EH7H 4XGZB 1MCWM 4NCC1 1SJEA 1KEMH 3KXFA 2DYPD 4Z7WB 3JTSB 5IBTH 4JRYB 5HHOB 4BFIA 1UYWL 1H15B 4EOWL 5JQHC 1FDLH 3QQ9C 1H8NA 2R8SH 3MBXL 2D7PA 4QXGL 5I30L 4AT6B 5LVEA 2EDWA 4Z7VB 3E6HA 5D7LA 3NH7L 2XRAH 2R0LH 4L3EE 2F5AL 2VZOA 2EICA 5DSCA 4M3JA 1GC1C 5C86A 2BNRD 3HI1A 4OT1H 5DJAB 5E8PA 1ZLVH 2F74B 2P5WA 1NPUA 3ZE2E 4OZIA 1N4XH 3MNZB 2N56A 1JGLH 1HHGA 4WHYH 3MREB 1X4XA 1OD9A 2GTWA 5I1AB 5GS2D 2QJDA 4WWID 2YBRA 3M07A 4PY8I 3D69A 1U6AH 2CDGB 4XHJC 3EUUA 1JN6B 1OHQA 2CUHA 5FYLL 5HVWA 3QEQA 1BBDH 3QIBA 5C08A 3B6SB 5CZKA 5E7FA 4FHBD 4PREA 3QG7L 5I18L 3FRUA 3TWCL 1PD6A 4TYUA 4C56A 4FQCH 4P5MB 2P8MB 2CGRL 3V0AC 3VFNA 3MPCA 3DRQA 2AJSH 4Q7DA 4X6FA 3QNYA 1H5BA 1OQXA 1CYGA 3ULSA 5B39G 1MLCA 4HS8H 5FB8A 5BW7A 3I50H 3NZHH 4I8DA 5ALCH 1MCPH 1R3HA 5CAYB 1T2JA 3QXAA 4PJAA 5AZ2H 3ZE0E 1U8JB 3DSNA 3U46B 2BNRE 3TFKD 5FGCE 3PUCA 4OV6F 5ISZB 4DUWA 3MMEA 3OQ3B 4OLUL 1XIWC 1YJDL 4NRXA 4TUOA 5K9JL 3VWJD 1X44A 2XY1A 5DR5H 1FVCB 4M48H 4TVPL 4ZAKD 3VRLF 3GI8H 4HIEB 4P2QB 1LO0L 2LFGA 3ZKMD 4AQ1B 3EO9L 1UG9A 3VFSB 5J0BA 1QSZA 3QEGL 4ZSOE 1FJ1A 2C1OB 4OCRL 4HPOH 5BRZB 4HHAA 5HJ3A 5JOFB 3VFMA 1A22B 3BH9B 1O7VA 3OKOA 1TVBB 3V4VH 4WEBL 3OG6B 1EZVY 2FR4B 4QLRA 4DKDC 4ZFFA 4X4YB 1HHIA 4XMPH 2VL5A 1CGSL 4UT6H 4FFYL 2RHEA 4QEGA 1NEUA 3LSOA 5TF0A 4JHZA 4ONFH 4NYLB 4GO6B 4JY6B 3BZEB 1TVDA 3QDMD 3K4AA 5INDB 1XR8B 2AGJL 5IVXB 1XH3B 3STBA 5C0DB 3GI9L 1KLGB 4XPGH 2XWTB 3DVNA 3NIGF 1V8HA 4G6JL 1AO7D 3IDJA 2AEWA 4MJ5B 1UZ8B 1N2RB 1JPGA 1HWGB 3NTCL 5I76A 5AG8A 1YEJH 2NX5B 3KPMB 5T3ZD 4NJ9H 1VFMA 3B3IB 3SEPA 4N0FB 1UACL 4JFEA 4M03A 3UJJL 1OGAD 2P8PA 2AK4A 5FKPB 1AHWA 2CD0A 1B90A 3HC0A 5FECA 4N0CC 1DVFA 1MFBH 3CD4A 3BMVA 4PRHB 4PB9H 5GSVA 3TIDB 3QFDB 1UJ3B 2Y5TA 4U6TA 1BOGA 2ED8A 4JKLA 3MV8B 3CK0L 1PG7L 5FYLD 2X4SA 1KV3A 3ECBA 5DQJA 5EORL 4QRRD 4MHHG 5MERB 2K1MA 3GRWL 4X6BA 4P9ML 2O5YH 2C7UA 1RIHH 3M17B 3UZEA 3HAEA 2IAMC 3QRGH 4PBVC 3GSNH 1W0VA 5E6ZA 5I17A 2JLLA 1CDIA 3TYFB 3OAYH 1G0XA 3K4DA 1UWGH 1MRCL 3QDME 3QI9A 2R23A 4LDEB 4HDIA 4DOHB 4JG1H 4YXLL 1NCDL 3N1PC 1LK3L 4WENB 5I1IH 3DI3B 4P2YA 1OPGH 1IQDA 3GSUA 1ZE3C 2CK0L 4LVNC 1AO7E 4LCIL 4N68A 1P69B 3N0PB 2ZOLB 4NBXB 2W38A 4LEOB 3IJSB 2D31B 3CFEB 4NQEB 5T3ZE 1HN1A 2WIIB 4E5XB 3CLEL 5F88A 1J8KA 3JTTA 5EBMA 1OGAE 5L88L 2A1WH 3SKOB 4PGCB 5C0GB 4YK4C 2H6PB 3BESR 5D2NA 1T83C 1RJLB 3TIEB 8FABA 4H25B 4G8GB 4TVPD 3TT1L 1UJTA 1LO5A 4MD5A 2ZNWA 3T4YB 5FYLE 3D39A 2IADA 4DEPB 4X5XA 4QRRE 1F2XK 1AQDA 3UJIH 1ORQA 5DC4B 5GGTL 4H5SB 1SBSL 4OM1L 4ZOEA 3M45A 1X5ZA 3REVA 1E6JH 3VXNB 3CSYB 1P9MC 1NAML 2BNUA 1NGXA 4J3VA 5GRUL 1U2CA 4S10A 1F11B 1A7NH 2DQDH 3B9DA 2DJUA 3MCKA 4L4TA 4QXWA 2ARWA 1G7HA 1QRNB 1DANT 3D48R 1ZS8A 1CFSB 1UQSB 4HWZA 5I0DA 4Z0XB 3KNBB 4NQXA 3T2NL 3DTXA 3O8XA 2ICWA 2VZSA 3OB8A 4NO0B 4RMTA 1DLFL 3IXTB 4L8SB 2FYYA 1S5IL 2OSLA 1YZZA 1RZKC 3LOWA 5ERWA 3RX8A 3GSQB 3BPCB 2JF1A 5FO7A 1DQQA 5A3IC 4Y4KC 2DM3A 1KPUA 4I13B 3PABB 1YN6A 4BSVB 3H9HB 4YBQC 4TVPE 2DM4A 4GSDL 1F90H 2GI7A 2O26U 1G6RH 4NM8L 4PJBA 1RZIB 4OCXL 5ESVA 4D9QD 4X5LA 2AV1B 2HT2C 3ZYJA 2CJUL 3QA3A 1NCAL 5CP7A 2YMXL 2G5BB 4JRWA 2VISB 4Q9RL 1O7SA 3T3PE 3INUL 4BSJA 4V1DD 1FLTX 2A6JA 1XAUA 3O6FB 4XCCL 5F1NA 1F42A 2QKIA 2H9GA 1CGXA 5EA0L 5L9DL 3C9NA 3DOSA 4PJ7F 3V6ZA 3MRNA 3OKMA 3QIWD 3GBLA 3QISA 3LQAC 4FTVB 4FQ1L 5E6ID 1XZ0A 3RVXD 1E4XL 4KU1A 4G9FA 3JVGA 2G9HA 3LPWA 3MV11 2R0KL 4PY7A 5C0FA 3C5JB 3RNQA 4UBDD 4HT1L 3L5IA 4JPIB 3QJFB 3DUUA 3U0WL 2HKHL 4MAYD 4NUJB 5GS2H 3MRIA 1R24B 4G6AC 4KK6D 4MJIB 3EDFA 4WO4D 3MJ7A 3RZCC 4G8FA 43CAA 1YNKL 5F1IB 2A6IA 1PYWB 2FD6L 3FN3A 3NIDF 1I7RB 3SGDI 1MH5B 1U8PA 4I5BB 5LWYL 4K3EL 5CBEA 5A2JH 4GG6A 1IAOB 3RNKB 4PP1C 2I25N 2ID5A 4U3XA 1R3KB 5EU3A 4GKSA 4V1DE 4YHNA 2V9QA 4EN3A 4U1IB 1QBLH 4KI1A 3HAEH 5T1LB 2OM5A 1QQDA 3ZTNH 5BZWA 1MHEA 1I9RL 3O3AB 1JV5A 3O3BA 5GGRB 2H3NB 3L95A 3QJHA 5DTFB 2BVQB 3WKML 4F3FB 4NQDD 2VUYA 1DQJB 4XCYB 3DX9A 1K3ZA 1XF4A 1N5YH 4I48A 5IP4A 5H35B 3NFNB 4EVNA 4M7KH 4JFQB 2AJXL 2H8PB 2FHFA 1CDBA 3B9KB 4XCEA 3TVMB 2BY0A 3THML 3HC4L 3EDDA 1BVLB 1OW0C 1LO2H 5JORA 1U2HA 3T04D 1JF1B 5SX5H 4J2XA 4XP4H 2GITA 5IFJA 2QQLH 4M6OL 3FO1A 4KMQA 2B4CH 4LU5L 1IC4L 1N6QH 5DHVA 5ICYA 1YEFH 5I71C 3BRFA 4DUXA 1HEZB 1CLYH 2J6EL 2ZSVA 5FDWB 2MCPL 4HBQA 4KPHH 1KJVA 2C3WA 3P9LA 4P5TC 1E4JA 2VLRD 5D7SH 5CZVL 4V1DA 4APQA 3HZMB 1YUHA 1NGQH 1E27B 1JPFA 4WWKB 2V7HB 5D7JA 4F7EB 4ODVL 4B53A 2GEEA 3EOAB 1UYWH 3OKYA 4JQXC 5IMOB 4P3DB 4NQDE 2XZAL 3DHJA 5I1GL 1GZQB 4KTEH 3ME0A 1EEZB 4OD3L 4OZHE 3MBXH 3MLSH 4LCWD 2VXUH 5I30H 2PW1B 4MAUL 3NFPA 3UDWC 4JFOA 1J1XL 2GY7B 3WN5C 5JO5B 1OT2A 5GJTL 4Y1AA 1L6XA 3RGHA 4XBGB 3ZKXC 1YPZB 1SVCP 3HC3L 4ELMB 1IAIH 5FOBA 4K94H 3T4AB 5T3ZH 1UB5A 1E28A 1MRFH 3NIFF 4XZUA 4YWGL 1VEOA 4D0DA 4PJFE 3K80A 4P5KA 3K81A 4KI5D 3RI5F 5BV7C 3U1SL 1IAMA 4UOW1 4ZD3H 1BJ1J 2X70B 3AUVA 3BHBA 3HN3A 3QDJA 5J11C 1YEIL 1JUFB 4YFLI 3AROA 4PD4J 3ZE1F 4IRSD 5DF0A 1SBBA 2VLRE 5DD3H 4XWOD 4WNQB 3RVWD 2I26N 4AZ8A 4P9HC 1Z3GL 1L7IH 1MJ7H 4OZFG 1R5VA 3HMWH 4OB5L 4YDJA 5EU6B 1RIVL 1AQKL 5IW1A 1RUQL 4LCWE 4DGYH 5AWNH 5IV2B 2BSRB 2Z31A 3C2SA 2APTA 2E5EA 2RAMA 4N0UE 1EHNA 1PZ5B 3QUYA 1YQVL 4JQVC 1QEWB 1IBGH 4HAFA 2JJVA 3WFDH 3BKYH 4HQQH 4LPUA 3BKML 3P77B 4JO4L 3Q6GH 5HHMD 3TJHD 3ZDYF 3GKWL 5B38G 4KI5E 5KS9E 5L2JA 4KDTA 3O11B 2NY6D 3CVHL 3U7WH 4CMMB 1W8OA 2AKRA 4J12A 5GRZA 3GK8H 4R7DA 4Q9QH 1EHAA 1SJEB 3IJYA 3KXFB 4LSQL 3EO9H 1SY6A 5CBAA 2JB5H 3QEGH 2XKNA 3QCVL 3C5ZC 4R26H 1E4KA 4J6RL 4GUPA 3BDXA 1CGVA 2VSDA 3F7YA 5F8RC 5SV4A 5TE7H 3IDUA 5DWUL 1KCVL 2JJSA 3MLUH 3E6HB 3QZWG 3GSNB 2QQNH 4RDQG 4I3RH 4PGZA 4F8QA 3VWKA 4XAWL 5DSCB 5IBUB 3HI1B 3PHOA 5E8PB 2P5WB 1CGSH 3TM6A 1FGNH 4FFYH 4OZIB 4HUMB 1IKNA 3EYSL 3QQ3A 5C8JB 4MB4A 5F1OB 4U0QB 3UX9B 2APFA 3BKJL 2GTWB 5HHME 2YBRB 3MBEC 4DQOH 3D69B 4J3WA 3NZ8B 3HRPA 3N06B 2LABA 2AGJH 2OXGA 3BP6A 1FL6B 3SE4A 2WMPA 3LKQA 3QEQB 3GI9H 3QIBB 1VESA 5DHVH 3D6GA 5C08B 1CFTA 3SGJC 2DQJL 1I9JH 4PREB 5BS0A 5AZEH 4EI5C 2Z92A 1K6QL 5J12C 4C56B 5H37H 4PGBA 5DMYA 3L3GA 3VFNB 2YRLA 4P48A 3S3PA 4PFEA 3DRQB 1NC4D 4X6FB 2CUMA 3EAKA 3ULSB 1MVUA 3ILQC 1MLCB 1ZVSA 5FB8B 1T5XA 2QHRH 3MRRB 3DX7A 1R3HB 4PJAB 3B8YA 3CXDH 4HJGA 1WBZA 2EEDA 5E2JA 2R0WL 3HFMH 2YPKA 2C3GA 5B39A 2GW5A 3MMEB 3WFBH 4KQ3L 1NAKL 1KIQA 4L3EB 4NRXB 1HWHB 1OGTA 4LOUD 1EPFA 1FZMA 1P4IL 5IHLB 1S7UA 4QOKA 3VRLE 1NCUA 3IU4H 4GRWB 5I8EB 3UO1H 2ZSWA 5F9WC 2WZPD 1HDMA 3KYNA 1V7NH 3EHBD 4Z0BH 4ZTOL 4PJEF 4XT1C 3LQMA 3V6OC 3B83A 4HUUA 4MJ2A 3PGCA 4YC2B 1JBJA 5ID0A 3TYGH 1M1SA 3MA9L 2WV3A 4KXZI 3ISWA 1JYWA 4HHAB 3H8NA 5HJ3B 4O58L 3VFMB 2OL3L 1EH9A 4CGTA 2O5XH 2QLVB 4ODTH 5IW6B 2A73A 2Q3ZA 5CZXC 3TA3A 4ZFFB 3SO5A 1HHIB 1JZ4A 4YQXL 3N1QC 2VL5B 3ARGD 5C09D 3BIBX 2D2OA 1F02I 2GHWB 4LRIA 3LSOB 1EX0A 1NBYA 3GSOA 1SBSH 1GHFH 1JHLH 3IDMA 2AXFA 5DZNA 4P4KA 2X4UA 3AREC 3NIGE 3DYMA 1U3HA 1BPVA 4XNMA 2BNRB 5FGCB 3DVNB 5FHAH 3IDJB 3C6SA 1OP3K 2EE9A 1JPGB 4PRBB 5I76B 1JGDA 4N5UA 4NWUH 2VDKL 3C5SA 1MVFA 2AQ3A 5HI5D 3N1MC 1FNAA 2AK4B 2P8PB 5E5UB 4BQCA 3WUZA 4PG9A 3HC0B 1PBYA 1S5IH 2WUCL 4I77L 5FGBA 1DVFB 4LLYA 4M1GL 4NDMA 4Z76A 3N85L 2Y5TB 1BOGB 2DJ4A 1G9MC 3ECBB 4BZ1L 4EQ3A 4JPKL 3GHBL 1JGUL 3J8F7 4WI8A 2OZ4L 4TSBH 5C6TH 4S1QH 1BX2A 3ARDC 3CZFB 3X3FH 3HAEB 4G7VL 3A6CH 3VMOA 3MROA 5FA3B 4TQEH 1NC2A 4D0CB 2M8XA 1W0VB 2VDLH 5I17B 5JW3L 2NY3B 3LEYL 3LRHA 3LY6A 4X6DF 3SBWC 2WBWB 4HDIB 3GMPA 5F97E 4QGTA 4YIQA 3F6IA 4JO2L 4R8WL 4UB0L 3GSUB 1IQDB 3F12B 5L9DH 1R3JA 2EC9U 1MNUL 3LAFA 2DQGH 3SPVA 1C5BH 2JB6B 4JN1L 4CU6A 2HJFA 3VWJB 3UYRH 5F88B 4W70A 3ZKND 1T2XA 3JTTB 5EBMB 4FQQA 4NM4H 1Y18A 2BRRH 3S4SG 5AAMA 2WINB 5K9KA 5CS7A 2NY0D 4NC2B 3VA6A 3UP1A 3MRFA 4J4PC 4NHCH 8FABB 3ES6B 4KHXL 3T0BA 2HKHH 1JWSB 4XMKH 2MOVA 1LO5B 2F5BL 2YKLL 2VE6A 3RDTD 5F72S 2H2SC 4FQ2L 2GFBA 3D39B 2IADB 4X5XB 1G7JB 3BX7C 5L6YL 1T7WA 1G1YA 1ORQB 5LGJA 4FQLL 4EIGB 4B0MM 1KCUH 1MHCA 4QXTA 3MXWL 4P59L 4ZO6A 2EXYC 3MLXL 1KB5L 1XF1A 4K3EH 4XC1L 4X9FA 1A7BA 3SGEI 4JKPL 2BNUB 1NGXB 5T1DH 5E5RB 1IGJB 1BMGA 4G8EA 1WFUA 1JWMA 5DD1L 4UI2A 5IFAH 1TZHA 3MCKB 3CSGA 2UZIL 4L4TB 4LHQB 1G7HB 2V5RA 2VLME 1PQZB 1ZS8B 3ARBA 3IAPA 4FXKB 3L1OL 2H2PD 1F3JA 4OI7A 2Y07L 4UT9H 4NQXB 1YEEL 2WWMC 3DTXB 3O8XB 2ICWB 4JQIL 4RFOL 3R4DA 5L0QC 4OLZL 2FYYB 3CVIH 2JIXD 2OSLB 4C59B 5JW4Q 5ERWB 3VG9B 1J0HA 2R69L 4Y16C 1DQQB 1A5FH 15C8H 1KPUB 4GW5A 2ESVA 5DD6B 4WU7A 2YA2A 1BFSA 2WQRA 3DVFA 5ACMA 1C1EH 4FQPA 2V5MA 1OGAB 4PJBB 2FWOA 5ESVB 4LLVA 5IVZA 3THMH 5LXGL 1OTSC 5GS3A 2VXVL 5CP7B 5CILL 1J9CT 1NFDF 3HRZB 2EEAA 3T0DA 1DTUA 3UZVB 4MD4A 4LU5H 4L9LC 4YDLB 1RJYA 5F1NB 4J3XA 4QRRB 3BJLA 4HG4J 4PJ7E 2QKIB 2H9GB 1ES0A 3C9NB 3P4LA 5IJKA 5EU7C 1JFQL 3H42H 1W8NA 2MCPH 3MRNB 3OKMB 4KH2A 4QHKI 4QRPD 2A83A 5DK2A 1JNNL 3M1BA 4FXGA 1AR1C 5JIIA 4G9FB 3RY4A 4HIXL 1RZKL 2G9HB 4PY7B 5C0FB 1QFUL 4GW1B 4RGNC 2IAND 3MA7A 1QSFD 3C60C 3RWDA 4CU7A 4GQ9H 3QPXH 3ZYIA 2P49B 1MCLA 3BPLC 3DUUB 3R0MA 2R15A 2AEPH 2NY4D 4ZXBC 4OCLC 1KNOA 3MJ7B 3NIDE 4G8FB 43CAB 3LH2H 2NTSP 4OD3H 1Y0LA 5CEYA 1BQHG 2A6IB 2OI9B 4AM0A 4WTXA 1U8PB 5JMRA 4YAQA 4ZS6C 1KPRA 5CBEB 2B5IC 2O5ZL 4GG6B 2DLGA 4KRPD 3MUY1 5EU3B 3HG1D 4GKSB 4YHNB 3EZJB 1HCVA 4M8QB 2XTJE 1F4XH 3ARWA 4EN3B 1FNHA 3HLAA 1CXKA 2IH1B 6FABL 2HWZH 1QQDB 3MX0A 5BZWB 3LQAL 1MHEB 4YR6A 5BXFA 3ULUC 3BQUA 1UM5H 1JV5B 4MXVF 3CDGB 4PBWD 4YZFF 3D9AL 2D9QB 1YEIH 4QRPE 3O3BB 4HGWA 1RUKL 3PIQA 4PUBL 1JMXA 1NFIA 1IGIL 3L95B 5GRJL 4OFYA 1M71B 1J0IA 3BOVA 4K23H 1NGYA 4FQXA 1NSNL 1IGYB 2IANE 1QSFE 3MRBB 3ARVA 2R1YB 3DX9B 5T1KD 3WL9B 4Z7NF 1XF4B 4I48B 4OKVA 3H9SD 4EVNB 1KJ2L 3WDHA 5A2IH 1A6ZA 3S8WA 4ZS7H 1CICC 1C16B 4PJGF 4XCEB 1RUQH 5LQBL 4RISH 5EUOF 5JORB 4XP6L 5DJ0A 3S88H 5F96H 5B4MC 2AXJA 1BWWA 2GITB 3AM8C 1CLOH 3FO1B 2WUBL 4WTZA 1A9BA 5BO1L 3WNLA 1QFWI 2NY2B 5DHVB 5ICYB 1FFQA 1OAZH 1JGVH 3K4ZA 1ROWA 3HG1E 4KK5D 1JRHL 1UKTA 3LHPL 2GYSA 3EYUL 4I3SL 2VDQL 3IDXL 4JM2A 4HF5H 3SDDA 4F15C 4QNPF 3P9LB 4LDLB 3SE9L 3NVQA 4TSCL 3I2CH 4V1DB 4APQB 4GAJH 1R0AH 1JPFB 4U1LA 3SOBL 2XV6B 5TFSL 4FQIH 4IDJH 2UUDK 4LCCC 4PJHA 5E6IB 2Y72A 1LVEA 3PL6A 5KVGH 1WF5A 2IEPA 1BJ1H 1LK2B 1MHPL 4K8RC 3H9SE 2BVPA 3PWUB 3NFPB 5IBLD 1FYTA 4JFOB 3DMMA 3PDDA 4ZFGH 1INEL 1UB6A 4NRYA 1FLRL 3NIFE 2J88H 5FOBB 4WI6A 1TLKA 3N50A 1UB5B 1E28B 4XZUB 3P11L 2J8UF 2VKXA 4LSPL 1CU4L 1YEHL 4OD1L 3RJQB 1QA9A 4ORZC 3TO4A 3ZE1E 2PYED 1RMFL 3BHBB 1EBAA 3QDJB 4JHAH 2ORBL 1DLHA 3A0OA 3ARYA 4JM4L 1IJ9A 1NMAH 5IK3A 5CSBA 5CJXA 4HC1L 3QRFM 5J3HC 1GGCL 3VFVA 4S1RH 5LGHH 4P2OA 2ENSA 2EC9T 4UNVA 1T4KA 2ZZUT 2VR5A 3SDAC 1R5VB 2GKIA 4YDJB 5C6PB 2ICES 1FSKC 1JZ7A 3GUTA 4F80A 4F7PA 4O9HH 2ADGA 2Z31B 3QYCA 3K1DA 2B1HL 4U6HA 4JO3H 3IFNL 4OZFA 2DS4A 3FB5A 2XFXA 5GHWH 2GAZA 2R0ZH 3BE1L 4IOSD 4NQDB 3ZDYE 4ZFZA 5HY9A 2R0WH 3D2UD 1GGUA 2NY5C 1FG2A 4BQ9A 1EFXD 2NZ9C 5AYUL 5BV7L 1NAKH 1W72L 2P7TA 4IOIA 2NY1D 3KYMA 3OF6D 3ABZA 2PYEE 4XH2A 1NKRA 3Q2CA 4MB5A 3TEUA 3IJYB 5B38A 5GRVL 2ZJSL 2RB8A 3VGDA 1T89A 1A3RL 2GCYA 1MWAH 5D1ZA 4P9HL 4PIRF 2XKNB 2R2BA 3GMRA 4AH2B 3BYYA 1VHPA 2FEDC 3MA9H 4GUPB 2CXKA 2L0DA 4GW4B 5LBSL 4O58H 3F7YB 3BKCH 3TV3H 2ZKHL 4PGDB 4JPWL 3AU1A 3Q0HA 4LARL 1R5WB 3EO0B 2D9CA 2VL4A 3VWKB 1M7XA 4WUKL 2NW3B 5F44A 1EEUA 1S5HA 1X4YA 2FBJL 3FQRA 3ULVC 4JJ5B 2VLKA 5CWSA 3ZMRA 3G5VA 3VXQA 2NXYD 1OAUL 4IOFC 4YX2H 4OGZA 2R9HC 4NT6A 2DWEB 1XGYL 3I9GL 3SE3C 3EDEA 3GMOA 2DMBA 3LKQB 4H1LG 5GRWA 1W0WA 3FOLA 3QXDA 3V7AG 5DC0A 2PO6D 1CFTB 3HE7D 3IRZA 5CUSH 5JA8B 5BS0B 2CSPA 2Z92B 5E03A 1VEPA 2HTLD 3MRQA 2VDKH 4PGBB 1QRKA 4M9OA 3RAJH 1HHKA 3L3GB 4R0LA 4KTDL 2CDEA 1T04B 2H26A 4X5WB 3AS3A 2WAHA 5F9OH 5FM5M 2VABA 3QP3A 4U1HA 2CH8A 2FJHB 4IRSB 4H8WC 1MVUB 1ZVSB 4F7TA 3NGBC 1DBKH 4KJWC 3DX7B 2VSCA 4LLDA 1F3DH 5D6DC 1WBZB 4JPKH 4JFPA 1H3GA 1WWWX 1YY9D 2YPKB 5CGYD 3NCJL 5B39B 4ZFOL 1RZGA 1KIQB 1Q9WA 4O51A 5EIIA 1SHMA 4N8VG 1JI1A 4AL8L 1S7UB 5H8DA 4B7IA 3JWDL 4O2EA 3T09A 4PJEE 4YHPA 5FUCE 2ZSWB 4BFBD 1HDMB 5CSZB 3KYNB 4QHLB 5GJSL 2A9MH 1OAQL 4TSAL 5HI4C 3RIAK 4KMLB 3PGCB 1OB1A 1T7YA 5ID0B 4I0PD 2LU4A 4C4KT 5L8JB 2BP3A 1P7QD 4MXQD 3BXNA 1BFOA 1B0WA 2A77H 4ELKB 4GAGH 3K3QA 1OAKL 1L0YA 1VB9A 5ICZA 4AEIL 4PRAB 2ENYA 1XT5A 5EBGA 2A73B 2HLAA 1J7VR 3RBGA 5HI3C 3OBAA 4WCYL 2X9YA 3MC0A 1XFPA 1ZVYA 1H3XA 4U6YA 1A7OH 1CR9L 5I8OH 3GSOB 4M43L 1MCDA 1YNLL 3WIHA 4OFDA 5CSGA 3BPOB 3IDMB 2AXFB 4Y4HC 4Z95L 4P4KB 2X4UB 6CGTA 3MLTA 4XC1H 4EDWL 1AD0A 1U3HB 1WAAF 2HFGL 1UM4L 5HVHC 4GAFB 1LO4H 1A6UH 5EZJA 2YD4A 3CZJA 3G5YA 4MA7H 5EO9A 2ATPA 3MRDB 1ADQA 4QF1B 3N9GH 4PJ5A 1JGDB 3DETC 2XIDA 3T77B 5ABDE 5E2WL 1OARH 3U4EA 5HPOA 3MGOB 4U1NA 4FQHA 1DBAL 3EFFA 1AXTH 3TPKA 4JG0H 3Q1SH 5IT2H 5EWIL 4N0YH 4NN6C 4NDMB 4Z76B 2E7HA 5MI0B 2CKBL 3E8UL 3KPQA 5C2UB 3OPZH 4OAWA 2AEQH 3LIZH 1KFAL 2ZOKA 4I9WD 2HT4D 3RUGA 3MLYL 5FYKL 5C2BL 1NC4B 3HNVH 3OKLA 3RGVC 1NC2B 4X6DE 3VH8B 4PRPD 1VACB 5I8CB 3GMPB 4JFDA 1RZFH 4YIQB 3ZSTA 3LS4L 2DN7A 3S7GA 3HPJB 2D0HA 1R3JB 3ARSA 2YSSA 4MHHI 4QXUH 4QRTB 3KPSA 1FV1A 1MIEH 3LN9A 3SPVB 4TPRL 4ZPVA 4HFUH 4RIRA 5J9PA 3HZVB 2HJFB 2UVFA 3D3VA 1MAML 4FP8H 3L9RA 1KC5L 4WI7A 4F9PC 3U0PA 1FG9C 4M7JH 2FH6A 3VXUD 3MRFB 2JCCF 1G9ML 2WWKO 1JPSH 2VE6B 4J1UA 2YPLD 3PWPA 1Q0XL 1YMMA 4HFWB 4OCYL 2BHZA 3L3OA 2WLZA 4I9WE 1MHCB 4NUGH 4QXTB 1I9IH 43C9A 5IESH 4CMHB 4DZ8A 4P23A 1PW3A 4L29B 4OLXH 3P4OA 4G8EB 3EJYD 4GKNA 2CMRL 5IB5A 1P53A 4TUKH 1I1AC 4KAQL 3BEVA 3KJ4B 6FABH 3LKSB 3ARBB 4LK4A 2R1WA 4X6DA 5M95B 1F3JB 3MRJB 5JR1L 4AEHL 2F54D 4LIQE 5FKAA 2HVJB 1RUMH 2F9BT 3CFJA 4PUBH 4Y8DC 5BQ7A 1IGIH 2UVEA 1BBJB 1B2WH 1FIGL 1FH5H 3SDCC 2C1PA 1GYAA 4N1EA 3VXUE 3V5DA 4GW5B 5D1QD 1TQCC 3T0EC 4WU7B 3HUJA 5K9QI 1J5OL 5D5MF 1IAKA 4ZOCA 1HKFA 3NCBB 2YPLE 2FWOB 4PJDA 1BAFH 3MJ6A 4PTTB 4LLVB 1NFDE 5GGSY 2Y25A 4UTAL 2VQUA 2ARJA 1NBVH 4HWNA 2I24N 4FABL 2MFNA 4UOJA 1FPTH 2VTFA 3ZYOA 4LRNL 1MREL 2Q8AH 4MD4B 4JR9H 5EOQL 3ARFD 4DZBA 4U6VH 5I1CH 1RJYB 3V0WH 1FL3A 1MPAH 1Q0YH 2AI0L 3KWWA 4PRDA 4GBXC 5DJ8A 2H41A 3EOBA 4D3CH 3AVEA 3QDGD 4BUGA 2EDEA 5C0AD 4WGWB 5DVMA 2FJFA 1T21A 2VDQH 1QFWM 3IDXH 5SWZE 2A83B 3L5HA 4OFVA 2ERJB 3M1BB 4FXGB 5DK2B 2JJUA 1EMTL 4ZUSA 5FYKD 1DCLA 2F54E 4DEPC 1NDMB 5E2TH 4GXVL 3RVUC 4YHKH 3MA7B 3RWDB 5EU4B 1JHKH 1G9NH 5IQ7L 1CGUA 2YZ1A 1RAMA 4KROB 5HYEA 1ED3A 3VFGL 2DBLL 1Y0LB 5CEYB 4PBXA 4E41D 4PJ8C 3G6DH 4AM0B 3VDBA 2I5YH 1MEXH 5KN5A 1QP1A 3ROOA 4YAQB 3VXRA 2NY0B 1KPRB 3VXUA 3DGGA 5E2VH 1RIUL 3BGFC 1GL4B 5DQ9A 2EDLA 2Y5EA 3LMJL 3GIZL 3TF7C 3UTQA 3HE6D 5DFWH 4U4BA 4QTHA 3HLAB 3FN0L 3GBML 2DDQL 3MRPA 4OD1H 4MXVE 3W11C 4YZFE 4JO1H 1CVRA 3O9WC 4YR6B 5CEZL 3Q6FA 5C0AE 5D1XD 1AGBA 3GRWA 1JTTA 5F3BA 3TBWA 1QPPA 5ID1B 2DB8A 5E8OA 4HGWB 4HC1H 4HCRA 1NFIB 5GRVK 4MQTB 5FYKE 4Z7NE 4MXWH 1NGYB 3TN0D 3HMXL 4FQXB 3ARZA 4NN5C 1MCRA 4ZUVA 2UV3A 3PP3K 2BC4A 12E8H 2OJEA 5SWZA 4PJGE 4OKVB 1GGYA 3UXFA 3WXWH 4KJQD 3RTQA 2GJ6D 4XXCC 5DDHB 3O6FC 5EUOE 1A6ZB 1XF2A 3RVVC 1QLRA 4MVBD 3SCMA 5KVEL 4X8JA 3CC5A 4Y5YA 4E41E 5DJ0B 1K2DA 1QUNA 5HYJD 2HRPL 4MCZA 3RWIB 3GB7A 4MQ7A 3S36H 2V5YA 5DVOA 5GGSA 2IPKA 1A9BB 5HD8D 4YXHL 1ZGLM 1CF8L 5EFIB 2D4DA 1ND0A 2XG4A 3L5XL 2JJWA 3BWAB 4NQCA 4QNPE 4ZNCD 4JM2B 3SDDB 4YPGA 2PW2A 1OWRM 1GXEA 3NABH 5DRNA 3B2VL 3TBSB 4LP5A 2XTJB 4KRMB 1AXSA 3QUZC 2ZPKL 1RZJH 1RHFA 1KCSH 4U1LB 3AXLB 5JXAH 4LSVH 4N5ED 5HDQL 3FQWA 2FSEA 2HFFA 4WJ5A 1HYSD 4JVWA 4PJHB 1QBBA 4U7SA 2HA1A 5EDXA 3ZT5A 3GJFK 1FYTB 4FMFA 2GJ6E 4XTRD 3RPKA 3DMMB 5C70A 1WT5A 2MKLC 3O2DH 2DQCH 1PGRB 4JRXA 1UB6B 3VGFA 4NRYB 1WFOA 1QSFB 4M6AA 4WUKH 5HYJE 2J8UE 4MNGE 4AY0A 2NY4B 2VOTA 3UTSD 3DGCR 2NXZD 3VFOA 1G7MA 3WNOA 4Q6IA 3SQOL 4PV8B 1QA9B 1RY7B 1EO8H 3TO4B 3DX8A 1HINL 1K8IA 2V5TA 4MWFA 5D70L 5DURD 1DLHB 1FO0A 2EDJA 5IK3B 3HZKA 4XVUD 3A67L 2CLRA 4X7TB 3G08A 3DIFA 2MSPA 5DLMH 2D7TL 5IVXF 4KVNH 3VFVB 1AI1L 4PPTA 1O0VA 4GFTB 4P2OB 3OSKA 5IKCA 4J3TA 1FNFA 1T4KB 1NFKA 4PG2C 4OLVL 2APWA 4NKOA 1JYXA 2XWJA 2EDFA 3GUTB 2HVKA 3RHWK 1OAYL 5CEZD 2ADGB 1CVSC 4WV1C 4YDIL 5HHXL 4U6HB 4ZUWB 1PKOA 1PAMA 2WBJA 1X6LA 3FB5B 2XFXB 4KUZL 2GAZB 1TJIL 4V2BA 2VXSH 2EECA 3MOAL 4R2GB 3MJ9A 4KGLA 4LIQH 4ZFZB 5T1KB 5HY9B 2Z8SA 3KAAA 3UTSE 3DYPA 3H9SB 2AJVL 4YH6A 4JPVL 3C8KA 1BGXL 1QZ1A 3DARA 1XEDA 2P7TB 4IOIB 4I3GA 4OSUL 5T5FL 5HYJA 4XH2B 4ONHB 2NLJA 4GRMA 4HUWA 1FIEA 4NC1E 3CSPA 1UWXK 3KHQA 1HKLH 1WC7B 1WGOA 4GRLD 1EHLL 2FB4L 1S3KL 2GCYB 4X7CC 5D1ZB 2J4WH 4XWGH 3PWNA 4Z78A 3GO1H 1H3PH 4OCSH 2R2BB 5BZDA 3GMRB 3MV7D 1AGFA 4PLJC 1IRAY 1IGMH 4Y4FC 1DQTA 2D0FA 2X5PA 4OF3A 4JEGB 1P4LA 1RHHA 3VXMA 3C6LA 4OJFH 1QBMH 4PJ9A 3FCTA 5E8EA 3ALWA 2N4IA 5CEZE 2X4PA 3DX6B 3WO4C 1S5HB 1T03H 5EC1A 3UPRA 3CLFL 5D2LF 4Z8FL 3VDCA 2NY5L 1QKZH 3UC0H 3X12A 2VLKB 5CWSB 2VRAA 3R1GH 4POZC 4RBPH 3IFOA 3G5VB 2HP4A 1FNEA 1J12A 3VXQB 1DL7H 1PEWA 5J1AA 4Z95H 1OWWA 4NT6B 4TNWF 2DMCA 3IJHB 4UIMA 1X5KA 3QHZH 3GMOB 1UM4H 3QNZA 1W0WB 3QXDB 5I1KL 1DBJL 4IMLA 4UINH 3G04B 4BA8A 3MRQB 4YEEA 2HLFC 2QADD 4P46A 4R0LB 1HOCA 4KVCH 5DMIH 2CDEB 5E8NA 3MV7E 2H26B 1CE1L 2VABB 4U1HB 1G0YR 3IDGA 4WI4A 4MQXD 3WFHA 5KSBF 1RFDL 4F7TB 1T1ZA 1AFVL 2DD8L 5TF1H 4LLDB 2PNDA 2BHYA 4UV7L 2E7MA 2HMID 4JFPB 5GIRA 1DN0B 2E6QA 3ULVL 1CGTA 5JHLH 5D72L 5FYKH 1LMKA 3WJLC 4O2FB 1R3LA 4OLWH 2X9WA 1Q9WB 4YO0A 4O51B 4EI6A 3QUKB 5ESQA 4DKEL 1RK1A 1F5WA 3C08H 4O2EB 1Y6NR 2V9RA 4GMTH 5FYJL 5GS0L 2BCKA 1BD2D 1X6NA 3L3DA 4YHPB 5E56A 2FHCA 5A40E 3EGSA 4PLNC 4NCDA 1XGUA 2ITDA 5I2IB 1FFRA 1FRGH 3D2UB 4N8VA 1EFXB 1BIHA 1OB1B 2JE8A 2NYYD 2ZUTA 3UJTH 5TQ0L 4RA3A 3BXNB 1FO0H 3KR3L 3RP1A 4OF5A 4HGMA 2F8VA 1MAMH 1ZLSH 2ITCA 5LCVL 1CGYA 1BFVL 4AG4H 4C57C 3PWJA 4UQ3A 4KHTH 4KRLB 5KAQF 1KF9B 4NZRH 2DTML 4OCYH 1SVZA 4LAQH 4XCFH 5GS1A 1EAJA 1WAAE 1S9XA 5KSAC 5EG6C 5T5NG 3KYKH 2IMNA 3MLTB 4NGHL 1AD0B 3MXVL 5BMFH 1IGCH 3MJ9H 3JZ7A 5EZJB 1BD2E 3PP4H 4YUEH 1FFOB 5EBWB 2CMRH 4G5ZH 3G5YB 1BQLH 1CK0L 1YMHB 2ATPB 3T0WA 1I85C 2O93L 5EULV 4PJ5B 1V3LA 2ZUWA 1VA9A 2FECI 4Y2DA 3LV3A 5CLTA 1YDPA 3U4EB 2EDYA 4U1NB 4XVJL 1M7DA 4CVUA 5FK9A 1WUNT 3P4MB 4FQHB 4NZUH 5JQ6H 2VDOH 5C0BD 3BD4A 3EFFB 3WFCL 1KENL 2BJMH 1OVZA 3KJ6L 4XMLH 4KK9D 3KYOA 4IIQC 5EZIH 3PHQA 3OB0H 3UBXB 1JNJA 3KPQB 1A47A 4OAWB 1J5OH 2P5EA 1FL5A 2ZOKB 3RUGB 4UMGA 3OKLB 3GSXA 4P3CH 2EH8L 3FRPG 4YC2C 2PXYD 4FABH 2YK1H 3O6MH 3CU1A 2VUOA 1F4WL 1HZHL 4L5FH 4ERSL 4JFDB 1Y6KR 3X17A 1NUDA 3KPRD 2AI0H 2YSSB 3MR9A 1GPOL 3CFCH 3TZVD 1FV1B 4RAVA 3BW9A 3PXJA 5F3HA 1CLZL 4ZPVB 1Z9OA 2BERA 4CJ0A 4RIRB 5J9PB 4NQVA 3IVKB 4F2MA 3D3VB 1ONQA 2JCCE 4BSWA 4QTIH 4X4ME 2J7LA 5C0BE 3O2VH 5TE4H 1IAII 4R3SB 3BMWA 1P4BH 2A74A 1JYVA 1ITBB 5GS0D 3FHQA 5FYJD 3RJDA 1JZ8A 3ZDXF 4OQTA 4ZUUA 4J1UB 3PWPB 4FA8A 4HH9B 3FJTA 3QUXD 1YMMB 1P7QB 4D2NA 2NNAA 5JTWA 3L3OB 1A14L 1TTGA 1MQKH 4EXPX 4CAGA 4DZ8B 4P23B 2X09A 3WEXA 1QFOA 1RIUH 4OCWH 5D71H 1KXQE 4M62H 3S98A 1BQSA 1PSKH 1NCBH 2I9TA 1MHHA 1HSAA 3L5WB 4GKNB 3GIVB 5IB5B 1N59A 2K7QA 4KQ4L 3FN0H 3BPNC 2W9DL 1CXHA 2VDRH 3KPRE 3LVEA 3VMPA 1OQOA 2R1WB 2ADFH 4X4ZA 4X6DB 3SKMA 3FMGL 5CEZH 1ZGLP 4JGJA 5TE6L 1J0ZA 3ALXA 4LSSL 4OTXH 5FKAB 3IGAA 1GAFH 35C8L 5C3LD 2X7LA 5BQ7B 1UCBL 3HI5L 5HSFA 2R4SL 2DLTA 1PLGL 4JRYD 1E4WH 2C1PB 2YOCA 2W0KA 3MYZA 4RQQA 5GGVL 4U1SB 5D5ME 3G6JF 3V5DB 1MI5D 3EW3B 2EIZA 5FYJE 3HUJB 3LCYA 1OOAA 4PJDB 3MV01 4I1NB 2AJZA 3TFKC 3C2AH 1N3NA 2DF3A 2ARJB 4P4RA 3T65A 4P49A 4QO1A 2BY1A 3KS0J 3MJGX 2HJKA 1DFBH 3VWJC 2OJZL 1DUZA 3O2WL 1FL3B 4X9IA 4ZTPL 3KWWB 1I8LC 2R2EA 4PRDB 3WHXA 1KG0A 4ZAKC 2RIKA 1I1YB 4UV4L 3ZKMC 1T21B 1CE6A 3DO3A 4U05A 1EXUA 3TBYA 3L7EA 2B4CC 2IBGA 4HWEH 4IHOB 3MV9A 4Y2OA 25C8L 4LSTL 1XIWA 4M5ZL 1EEYB 5HGAA 2XOTA 4JCMA 5IG7B 4OZ4B 2DQIH 4FMKA 1NKOA 1I3RA 4M7LT 5ITBL 1CBVH 4KKCD 4AJ0A 1ED3B 1MI5E 4XVSL 1L7TH 5F9DC 3U30C 1U8IA 4X7SH 1UWEH 1EZVX 1V7ML 5KN5B 4XXDA 2YPVH 3AAZB 1D5IL 1EERB 2B0SL 3VXUB 1IZKA 3DGGB 5D5MA 3D85D 2Z91A 2FL5A 3JBG7 2DMKA 3VXSA 3UTQB 4AENA 2YPLB 4QTHB 3RA7L 3SQOH 2MHAA 3MRPB 2LTQC 4OZIF 3FB6A 1AE6L 5F8QC 2PR4L 4PS4L 5D70H 4XRCA 1AGBB 1NBQA 1HNFA 2OZ4A 2XKSA 4K94C 3MFFB 1V05A 4LEXH 5CCKL 2EYRA 5HHVL 2W65A 3OJDA 2DBJA 4ZUVB 5BRZD 2BC4B 2OJEB 5SWZB 3RTQB 4ZNEE 4HMDA 1XF2B 3ET9F 3VDAA 3MACH 3VFRA 1QLRB 1INDH 3SCMB 1PY9A 5C9JA 2VNCA 2P47B 3CUPA 3DVGA 4X8JB 4OGXH 2HKFL 3CC5B 2YUVA 3AFLA 4YDIH 2Q8BL 4JZOA 3GB7B 1IT9H 4MQ7B 2O61A 4DN3H 5C0CE 4YHLH 5GGSB 1X5XA 2IPKB 4FOMA 2UZXB 4PJAF 3IF1A 1KJMA 1Q72H 2IGFH 3HR6A 1P5UA 1ND0B 3U9PH 4RGMB 3QO1A 2DLHA 4NQCB 3UAJD 1BGXH 1A64A 4M1DL 4EJ1C 4YPGB 1SM3L 5FF6A 2PW2B 4M6NH 2XT1B 5D96C 3DBXA 5DRNB 2IAMA 3WLWD 2ZCKH 4GRWF 2OI9C 5SX4H 1AXSB 3BISA 3TBTA 2NX5D 1RU9L 4KKAD 1YJDC 1GC1H 4G6ML 3FQWB 4MGXA 5C0AB 1ZT4B 3IAQA 5BRZE 5J13B 2FSEB 2HFFB 4UILL 5ANME 1CFVH 3BSZH 4U31A 4LSUL 1Y6MR 4PRHD 4F33B 1CFQA 2BVYA 5DVKA 4BM7A 3JV4A 1ZHBA 1LP9F 3MV8D 4JRXB 4OLYH 3U7YL 2B20A 4UOW0 5C7XH 3V4PH 1MCCA 3EFDH 2R2CA 3FB7A 3B43A 4XP5H 3U82B 3VFOB 2Q7NA 3GNML 4Z8FH 1G7MB 4NHUA 4O2CA 4Q6IB 2HAZA 5HYSG 3C09B 4XCNA 5JPNA 4LKXB 1MAJA 1P2CA 3DX8B 4KDVA 4PJXF 1ZA3A 1A6AA 1K5NA 5C0CA 1FO0B 4ZDHA 5IVXE 3FAWA 1EDQA 3HZKB 2CLRB 3G08B 1JP5A 1CS6A 3DIFB 4RMRA 3CCHA 1VPOH 3MLVH 2FEEI 4YPJA 4LSRL 4GJTB 1P9MA 4CVXA 2NX5E 5IKCB 1BHGA 4KY1H 1KTDA 3WUWB 1BF8A 1QOKA 1SYSB 1UENA 5KW9L 1DZBA 4LLWA 3IYLW 4JANA 2EH7L 4MCYA 5I9QB 1VFAA 4MNQA 1AGDA 2DKSA 1LNUA 1KEML 2HVKB 2PTUA 4KV5F 4PRHE 1RFDH 5IBTL 2X4QA 4G8GD 1P84K 1IGFH 2A6KA 1RUPH 1U93A 3B5TA 3AY4C 1FDLL 2R8SL 5ANMA 1KN2H 1JJUA 3E1F1 4K9EH 5D72H 3VI4F 2GJ6B 4U2YA 1JZ2A 2XRAL 3C8KB 2R0LL 4Y4KA 1E4XI 1MFCH 5ADOL 5DEGA 1VDGA 4WW2C 5HYJB 4NBYB 2KL6A 2NLJB 4FNLH 4GRMB 5FYJH 4BQ6A 2CK2A 4OT1L 4HUWB 5GS0H 3QIWC 2KKQA 2AEIT 5E6IC 1WFNA 1JTOA 1N4XL 3VXTA 1JGLL 1RD6A 1QRND 4UT7L 3SE8H 1HQRB 3RVXC 1WEJH 2AJ3A 4D0BA 4X99A 5ACZA 4Z78B 3GMMA 3PWNB 3LN5A 4NO0D 1U6AL 1AGFB 2FDBP 1IZJA 5ESAA 3WNKA 4UBDC 1G7LA 3RIFF 4MA1B 3I3DA 1LEKA 5DZLA 1BBDL 4KFZC 2F53A 4MAYC 1BFTA 1RHHB 3CDCA 5DD5H 1M05A 4KK6C 3VXMB 1OCWL 3C6LB 4WO4C 1XR9A 4BJLA 1XCQA 3FCTB 5E8EB 5IROC 2X4PB 4FQCL 4G8GE 4S2SA 5D2LE 1WWCA 3KLSA 1BLNA 5IMKA 5EC1B 4NSKA 3UPRB 3MGTA 2AJSL 4QCIA 1Q9OA 4PGEB 3LB6D 4D94A 3IFOB 4HS8L 1IQWH 5J1AB 3NZHL 1MCPL 4NO2A 1JI2A 3RZCA 4UIMB 4ZPTA 2VLJD 3HR5A 3QNZB 4LHUA 3UTSB 3W5NA 3H7BA 3AC0A 2EDOA 3RVTD 1QRNE 3BP7A 4FTVD 5JOEA 3CX2A 2D7QA 5GQBA 4P46B 5DR5L 2QQQA 1ZXQA 3S3SA 3ZDZF 4PV9A 4M48L 1NANI 5KSBE 2AXGA 3GI8L 3IDGB 3WFHB 5FEBA 4IEFB 1OTUD 4RMQA 3H0TB 4NNXA 4U1GB 3SDXA 2XG5A 4HPOL 4MJID 4F8TA 2Z4QA 3P73A 4HXBH 5GIRB 3OKKA 1TENA 4LPYA 4V2CB 3K1KC 3V4VL 1R3LB 1K4DB 1BECA 4PJBF 3CH1A 5I73B 5MENA 3S37H 5ESQB 4EI6B 1JGEA 4XPHH 5D2LA 4DW2H 2HFTA 1J1PH 3U4BH 4XMPL 2BCKB 4ERSH 2ZCLL 4UT6L 1NEZG 4EUPG 2FGWL 3EGSB 1XGUB 2VLJE 4LHJB 1OW0A 1A6WH 4ONFL 1A7QH 1VGEH 4N8VB 1BQUA 4CADA 2ICCA 3ESVF 4FTVE 3RKPA 3ZHDA 4XPGL 3QDAA 4LGPB 2OMNA 5CMAA 2A0LD 1T3FA 3WNMA 2CDFA 4WIQA 3K0WA 4L8BA 2LQRA 2Y7QA 3V5HA 4UIKH 1YEJL 1IEBB 1TCMA 1HH9A 4P5TA 2J3SA 4NJ9L 4HLZG 3PWJB 4LFHD 4MJIE 3MV7B 3SE4C 2XI9A 1IAIM 3B9KD 3QEUA 3TVMD 1BVKA 4PJIA 2RBLA 1MFBL 3GMLA 5I1EH 4PB9L 5GS1B 3L3IA 4RFEB 1S9XB 1IVLA 4JQXA 4KI5C 4N9GB 3VA2C 2IPUK 1M6OA 4TUJA 4OUOA 4GG6F 2O5YL 3UDWA 3WN5A 2BDNL 5DUPH 3LRGA 4IRSC 4ODSH 3QRGL 2W9DH 3GSNL 5H2BA 1TZGH 4Y2DB 2AW2A 3LV3B 1GSMA 4XWOC 1UWGL 3RVWC 3QR2A 5FK9B 4OI9A 1FFPB 1G7IA 4JY4A 5I1IL 1OPGL 2V6HA 2VLJA 3HI5H 4WWKD 3KYOB 4E42A 5IB4A 1KACB 4JREB 2DTSA 3PHQB 3E2HC 4KKNA 3IETA 2VLLA 5IB3B 3D25A 2P5EB 1FL5B 2A1WL 1DE4A 4YHZH 4NOFA 5FAAA 3GHEH 1WZ1H 3GSXB 2D3VA 5EOTA 1RZ7L 2Y23A 3O0RH 5A2KH 3TJHC 2NY6C 4OIBA 3VFPB 3ZL4H 2Q6WB 4G9DA 1S78D 5DMGD 3AMKA 2OJZH 3FT2B 5J89A 3O2WH 3UJIL 3FRPA 5F6IB 1AKJA 3MR9B 5DRXA 4IRZH 2NY7H 3BW9B 4RAVB 5F3HB 1S7WA 4DKAA 1E6JL 2E7LC 3OV6A 2ZUYA 2C5DC 3FQXA 4HUXA 4JQVA 4NQVB 4F2MB 1ONQB 1S9VA 1MY7A 2J8OA 4BSWB 1BD2B 4OFIA 1A7NL 2DQDL 3F5WA 3I6KA 3ZDXE 3UPAA 1U8LA 1QNZH 1H8SA 3BPOC 3RQ3A 2UWEF 5E00A 3SJVA 1QLFA 5DQDL 3O4LA 2VWEE 4MJ4A 5EU6D 4ZUUB 2BSSA 1J18A 1A1NA 5DJ2A 2NNAB 2K7PA 1DQLH 2P48B 3TT3L 4ODXA 4JDVA 1T80A 2WIMA 4WUUA 3C5ZA 1F4YH 3BYTA 4CU8A 5D6CA 1F90L 5I6XC 2I9TB 1MHHB 5ILTH 1CDJA 1II4E 3OAUH 1CL7H 2VZUA 3SKMB 2EIDA 5MI0C 3FQTA 3TNMB 2B1AH 4LASH 1W2KT 3IGAB 3TC9A 3KPOA 2X7LB 4JKWA 3KXFD 5SWSA 3ZZ1A 3G6JE 4JFZH 1ZEAH 4Z77B 3MBEA 3KHOA 4RQQB 1GGIH 4GMSH 4XNZC 1TETH 5T3XD 1SJXA 1F13A 5D7LD 5EN2A 3SGJA 4JHBA 5FCSH 4Q97A 1N3NB 5I1HH 4EI5A 4FQJH 2QSVA 4P4RB 3CMGA 3T65B 1GOGA 4U1MA 1T20A 5IMLA 2P5WD 2HJKB 1G9EA 4LOUC 2IBZY 1DUZB 4J3UA 4M00A 1XGPA 1CTOA 3AS2A 2R2EB 4Y19A 2ATKA 4MA8H 3WHXB 4CNIA 1L9NA 4N8CH 2I60H 3EHBC 4MSWB 5HHQA 3PV6A 3ROLA 3QH3A 3WIFA 5HYIA 4K7FA 1WZMA 1CE6B 1EXUB 2DOCA 4N1HB 3TBYB 1SM3H 2PXYB 1MOEA 3QIBD 3TPUA 1T7XA 3L7EB 5KVMC 5C08D 4M7ZB 4UTBH 1NJ9B 1XIWB 5DEZA 3KXFE 1QSVA 1KSRA 1D7FA 4C56D 1Q1JH 3NAAH 5EZLB 3ZTNL 1X5GA 2ICWJ 5C0IB 2YD5A 4X7EC 5T3XE 3ILPA 4LSUH 4WEUD 3RWJA 4M5YH 3G6JA 2IJ0C 4XXDB 5D7LE 3BGAA 3ARGC 3KJ4C 3MZGB 1TVHA 4IRJA 3VRIA 1D5ZB 3U7YH 5F89A 3UPCA 5D5MB 4X7FC 1WK0A 1ZT1A 2Z91B 2FL5B 4KRNA 2GQHA 1N5YL 5BVPH 5FFLA 5CJOH 3VRJA 2P5WE 4M7KL 1P6AB 4JFXA 4OZIE 4Y5VB 4YHMH 4N90D 3OHXA 4YHYB 2SEBA 2MHAB 2GT9A 1ZA6A 1LO2L 2DJSA 4ZUTA 3FB6B 3DUHA 4XP4L 3VW3H 5JXED 2QQLL 1RULH 1ZLVK 4XRCB 4POYA 5IFHH 2B4CL 1N6QL 4HZLA 5HI5C 4C4KO 1U91A 4FG6D 1MJUH 3NCFB 5DUMH 2CRMA 1CLYL 2W65B 1H3VA 2LE9A 3OJDB 3I85A 4L3CA 5DGRA 1BREA 5ALBH 3AREA 3P40A 4C56E 3DWTA 1I75A 4KPHL 3DXAA 3DSFH 4XNQB 2D0GA 1INQB 3BEWA 5D7SL 3HHRB 5KTEH 5C9JB 3CUPB 1NGQL 1YEGH 2C4XA 3WIIH 1CT8A 3EOYG 3CFIC 4LCYA 4JZOB 5I16A 1QHOA 3SKNA 4PJAE 4RFNB 2O61B 3OR7A 3CNKA 5F7KC 4KTEL 1MI5B 2MJWA 5AD0A 3MLSL 3IF1B 5FCUH 1KJMB 2VXUL 5T1MA 3RWHA 5D93C 1ACYL 3BZDA 4N90E 3MRLB 5ADOH 3G5ZA 1T1XA 5DYOA 1IAIL 5FF6B 4K94L 4GRWE 5T3ZL 5DJZA 1MRFL 1OT1A 4MQSB 1I8MA 4ODUA 1A6PA 4UT7H 3ZKNC 4EDXA 3OWEA 2FATH 3TBTB 3GKZA 1S8DA 2Z8RA 4UQ2A 2NY0C 3NA9H 4JFED 2X1QA 1F2QA 4ZD3L 3SBWA 1GGTA 2AK4D 4DCQA 1A0QH 2RJMA 1DVFD 2CO7B 5EUKA 3MFGB 2XPGA 3GMQB 1C08A 3RKDD 2BFVH 1JK8A 1LP9E 2YD3A 4LVNB 3RDTC 1I9EA 1CFQB 1OCWH 5K9OB 5DD3L 3LS5H 4GG8A 2VDPL 1ZHBB 1JPTH 5CD3B 3BVNA 1L7IL 1JNLH 3T1WA 1MJ7L 1A3LH 3IS1X 3MOQA 3V6FA 3RZWA 3FB7B 3FT4B 5CJ8A 2Y06H 3HMWL 5DS8B 5B8CB 4NHUB 2XQYK 4YK4B 4U7MA 2X42A 4PJXE 3BP4A 4J4PA 4P2CG 4DGYL 3KPNA 5AWNL 4OKDA 5BJTA 5JPNB 2NY3D 2HTKD 3OXRA 3X11B 1P2CB 4PYHA 3QI9D 1SEQH 1ZA3B 3P9MB 1K5NB 5C0CB 4G80A 4ZDHB 1H3TA 1KIPB 2H2PC 3D85B 1F45A 1IBGL 2IPUG 3WFDL 1CXLA 5HYSA 3BKYL 4HQQL 1CLCA 2ADIA 4LF3A 3Q6GL 3CCHB 4YDVB 4CVXB 4R4BA 3I75A 3U7WL 1KTDB 1NCCH 3OKEA 3W5MA 4JFEE 5IOPA 1J8HA 4KV5E 2AK4E 2NZIA 4LLWB 3GK8L 4JANB 5JXEA 4Q9QL 2IPTH 1VFAB 4MNQB 3IDYC 3KG5A 4RGNE 1LNUB 1TJHH 2WANA 4JAMA 3SN6N 2X4QB 5HGHA 4GKOA 2JB5L 2A6KB 1U93B 4TOYH 3AGVA 4R26L 1UVQA 4K7PH 5F7DA 3D39D 1LEGA 2OR9H 3VI4E 5ANMB 5TE7L 1EVUA 4OGAD 3MLUL 1ZWIA 4PP2A 1LP9A 2Q86A 4Y16A 2XTJC 3DHMA 2QQNL 4K07A 4Y4KB 4I3RL 1FORH 3RBSA 2JJTC 3QFJA 5CKAA 1TJGH 4M6MH 5DEGB 2VERN 5ETUA 1ZTXL 1WBYA 3QSKB 5JZ7D 2ZCLH 2ZNXA 4L4TD 1FGNL 2FGWH 4CDHA 3VXTB 4CVWA 3SO3B 4OGYH 4PJXA 4D0BB 1AH1A 4LGSB 1Q9KA 2X89A 3OAYK 3GMMB 3LN5B 3O81A 3O8XD 2X4RA 4DQOL 3OGCA 2Z8WC 5ESAB 4A2LA 1G7LB 1ZHNA 4KKLD 4L9LA 4XNYL 1LEKB 4JDZB 2NY4C 4MZ2A 2F53B 1M05B 1ZOXA 3QHFL 1XR9B 4S0TD 4MYWB 5EO0A 5D2NE 3RY6C 1I9JL 5AZEL 4RGOH 4AEEA 4S2SB 1BLNB 5IMKB 3Q3GA 1UADC 3D39E 4KRPC 1Q9OB 3D18A 3C60A 5C3TA 2QHRL 4ZXBA 1D5XA 2OTUA 2VAAA 4HW6A 3CXDL 4NO2B 3RZCB 4P3WA 4ZPTB 4WDIB 1IEAA 4GS7C 1JYNA 3HR5B 3HFML 4LHUB 5T3XH 5JDJA 2BDNH 4L4TE 3WFBL 3BZFB 3H3BC 4AIXA 5MHSD 3L3HB 3ZDZE 4RRPG 4PRNA 2X44D 1UA6H 1EUTA 5E08H 3IU4L 1N64H 4PV9B 4DAGH 4G9FD 3UO1L 2AXGB 1LQSR 2W0LA 1V7NL 4Z0BL 4DJMA 1OAXH 3S5LA 3WXVH 3HS0A 2PKDA 1I3GH 3QWQB 4S11A 4S1DD 3TYGL 4W6YB 1U8KA 1YECH 2WNGA 2Z4QB 3W82A 3P73B 1JRHI 4PR5A 1CQKA 3OKKB 5FHBH 4PJBE 2O5XL 4ODTL 5FDYA 4R4ND 1RZ7H 3DUSA 3VXOA 3CH1B 3O3DA 4KK5C 4TNVF 1JGEB 2HN7A 5D2LB 4F7CB 4HPYH 1ZMYA 2R4RH 4EN3D 5E9DA 1CICA 1CQYA 3MUGA 1TQBC 4PLOB 2NPLX 2ICEA 4G43A 5AEAA 2BY2A 1GHFL 5DMKA 2XYCA 1JHLL 2WLYA 4CADB 2EC8A 3AM8A 2VXQL 5MHSE 3MRHB 5KAQG 1BIIA 1NLBH 3IXAB 3P0YL 4L8CA 5IQ9A 1WTGT 1DN2A 4NKDA 5FHAL 1YNTA 4G9FE 3WFEL 3UBXI 2AQ1A 2CDFB 2UY6A 2W60A 5K9QG 2Y7QB 3V5HB 5IBLC 2P8LB 4NWUL 2Q87A 1P7KA 1HH9B 3MRMA 4P5TB 4RX4A 1OP5H 5DQDH 2QQKH 3IS0X 3WS6C 4GRWH 3MLPA 5KSBB 3QEUB 2XACC 1TCRA 4PJIB 3O3EA 3GMLB 2QSCH 3TT3H 1C7SA 3K2MC 3VGGA 4GG6E 5B3NA 5JUEH 1ZAGA 4LCCA 1JNHA 4IS6A 1KTLA 1EK3A 4HKJA 1M6OB 2NY2D 4TUJB 1BJ8A 1HCFX 5DXWA 2FEEL 4TSBL 3WN5B 5C6TL 1IEHA 4S1QL 4BH7B 1ZVHA 3X3FL 1B4JH 3A6CL 4TQEL 3DV4A 5H2BB 4OIAA 3ZKXB 2VDLL 1X4ZA 2OK0H 3MLZH 1P5VA 4NJAH 2DIBA 1NMBH 1XGTA 3LEXA 4APQD 1SJHA 2E6PA 1G7IB 4FXLA 4Q74A 4JY4B 5HYFA 4U3CA 3TNNA 2VLJB 4IJ3B 2VDMH 5D7JD 4WHYG 4E42B 2DQGL 4QT5B 5IB4B 4QHUA 1MJ8H 5I19H 1C5BL 2FHBA 3O6LH 3VMNA 2E27H 5J06A 3ZO0A 3IETB 4S1SH 3UYRL 2VLLB 3D25B 32C2B 3MTRA 1A6VH 4LNRA 3VFWA 4NM4L 2VIRB 2BRRL 1DE4B 4Y1AD 1WLHA 4Y88A 5FUZH 4DGIL 2H32A 4XI5D 5EOTB 4NHCL 1YN7B 1IGTA 3CGTA 5HGBA 1FZKA 3IB4A 4XMKL 1L6ZA 3SDAA 1KPVA 1XGRA 2D03L 1QR4A 1YC8A 3WE6A 4G9DB 2NY1C 3AMLA 3KPLB 4KZEH 3J7HA 2VZ3A 1KCUL 1AKJB 2FO4A 1U58A 5DRXB 5CLWA 1DQMH 5SX5K 2UYLA 3QDJD 1S7WB 4PRIA 4HUXB 5T1DL 1LILA 1S9VB 4JM2F 3FB8A 5IFAL 3ELAT 4K2UH 3I6KB 2UWEE 3WV0A 1KLFA 1U8LB 4UT9L 4LP4A 3SJVB 4I0CC 3NCEB 2GTZB 4CJ1A 1WCBB 5E1AB 5E6YA 1A1NB 3L3KA 3CVIL 5EOCH 1MF2H 1AD9B 4JDVB 2Z31D 4PJHF 3UTTA 1A2YA 4WUUB 3O4OC 4Y1AE 1XCTA 3ULUH 3C5ZB 3G9VA 1A5FL 3IDNA 4GH7B 3QUYD 4HWBA 15C8L 5LGKA 2P44B 2G75A 2NXYC 3DPBA 5D6CB 4I4WA 4JZJA 1C1EL 2AV7A 1B9ZA 5TGBA 5FUCC 3ORJA 3R8QA 1B0RA 2B8OT 3FOMA 4MDJA 3VGHA 2CRZA 4HMCA 2PO6C 4X6CA 3HE7C 3MJ8A 3QDJE 5A2LH 3WNNA 2HTLC 5GZOD 3KPOB 2GJZA 3ETBF 3D0VA 4ODHH 5CKGA 3WHE1 5FV2A 4E9LA 3MBEB 1FBIL 3H42L 4CVZA 4WEMB 2RQ8A 3SE3A 3ZTJH 3V52H 2R1XA 2K3TA 2A6DA 3I3EA 5EN2B 4MX7A 3PJSB 2N7BA 2UWEA 1GIGH 3VWKD 4EI5B 4ENED 1YY9C 2WW8A 5J12B 1C5CL 4GQ9L 4HEME 3QPXL 5CGYC 3U9UA 4U1MB 2AEPL 4AYFA 5IMLB 4CW1A 3Q5OA 4L1HA 4QRSA 4UU9A 3LH2L 3CX5K 4Y19B 3BWUC 2ATKB 4CNIB 4TULH 1ACYH 2XN9A 3IKCA 1Z9LA 5HHQB 3M8OL 3PV6B 4K3JL 1KYOJ 1EGJA 3DROA 3WIFB 5D6DA 4K7FB 3BUTA 2R29H 5FA4A 2AS5M 4YGVA 1QPXA 4KDWA 3TPUB 4I0PC 3OL2A 2G2RA 5E1HB 1F4XL 3RY5A 3VD7A 4MXQC 1V3JA 3TJEH 1CN4A 5BS0D 4DKFL 2OP4H 3NPZB 5M94B 2HWZL 3O6KH 2EIEA 4BQ8A 4NZJA 1UM5L 1FGVL 1F58L 5IBUG 3S36X 4NNYB 1TPXB 2AVGA 5F9WB 3VE0B 1F8TH 3GFUA 2IQ9H 1QBAA 1KJ3H 3MLWH 3T2QA 3ILPB 4W4OC 4AT6A 5TJWK 4Z7VA 4P2RE 3G6JB 5DUBA 4BKLB 1I7TA 4K23L 1KLUB 1TVHB 2VDPH 4IRJB 3VRIB 5DK3A 2ARJQ 4ISVA 1ZGLA 1ZT1B 2VR9A 3FZUD 5GGVY 4JFXB 1ZHKA 4LMQE 4ZS7L 3OHXB 3VGAC 2BHUA 2GT9B 1ZA6B 3ZE2F 4ONOA 5E70A 2H32H 4RISL 1T0PB 5I1AA 4ZUTB 3S88L 4JVUA 4QOKD 3KDMA 5F96L 2DQUL 5GRYA 3VFTB 5AUMB 1CLOL 2HT3D 1VSCA 1JN6A 2C9AA 4UDTA 5T33H 4YXKH 4MB3A 1MCNA 3CU7A 4UAOC 3LKNA 2OTWA 4HZLB 3BIKA 1OAZL 3HA0A 1JGVL 1U91B 3QCTH 3B6SA 2PTTA 4ODBD 2H45A 4Y4HA 5BS0E 1BEYH 4L3CB 2IFFH 1N6VA 3AREB 4P5MA 2P8MA 3DXAB 4HF5L 1UZ6F 3VG0H 3BEWB 3I2CL 1QSEA 4GAJL 4HS3A 1CCZA 3SY0A 1YEKH 1R0AL 1CT8B 4OBRA 4LCYB 2HT4C 3TA3D 4GQPH 5I16B 4BFIB 4FQIL 1MJJA 3NFSH 4IDJL 4P57A 1AY1L 1U8JA 5KVGL 1J86A 1S9KC 5AD0B 1J05A 5ISZA 2EE2A 2YRPA 5T1MB 5FUOH 3RWHB 3Q48A 4P2RA 4F9LC 4UNUA 5DI8A 1GOHA 2CUIA 5D7LB 4P4KD 2AABL 3P3YA 4ZFGL 4HWBH 2M1KA 3G5ZB 1U3HD 5DA4A 1RZ8A 1NGWA 1T1XB 3QG6A 4QOKE 2J88L 1GZPA 5DYOB 3FO0H 1V3KA 4J8RA 5EIQA 5KBNC 1ZTXH 4DTGH 2X2YA 4J3SA 5DJZB 1PDKA 4Z7UA 1I8MB 4ODUB 1HHGB 4N0RA 4P2QA 3RGVA 4EDXB 1AJ7H 1QFWH 4UQ2B 2C1OA 3RWGA 1FNSH 1CDYA 4JHAL 4NN7B 1KN4H 3JWDC 4XNYH 1NMAL 5JOFA 5K9KB 2XPGB 3DI2B 1C08B 5GISH 1JK8B 3VGEA 3ZHLA 3I02A 3QHFH 5CINH 4QHNA 4GG8B 3PHSA 4S1RL 5LGHL 3FRUB 3BVNB 4RSVA 1D9KD 3V6FB 5IWLC 1FCGA 4XPBH 5DD0H 4F9PA 4RMSA 1KTRL 3QNYB 1H5BB 1N0XH 5F6HJ 1NC2D 4OFPA 5BJTB 3KPNB 4NYLA 4DFIA 3EJYC 4O9HL 3OXRB 3DURA 4Y5XC 5K93A 4JO3L 3PQYA 3QXAB 4R9HA 1KCKA 5GHWL 2VMFA 2R0ZL 3OGOE 5INDA 4G80B 1XH3A 5C0DA 2IFGA 1NL0H 1WQVT 2ZCHH 4MJ5A 4H8WH 2ADIB 4LF3B 3WS3A 3RWEA 1IFHH 2VZ1A 3WMSA 4TUOB 5TDNA 4R4BB 1EGJH 2BVUA 3I75B 3LZFH 4QY8A 1IC5H 3OKEB 5JHDE 5IOPB 1J8HB 4GXUN 5D1QC 1J0YA 1I1AA 3IAGC 1GGBH 4YFEA 4JAMB 3HAEG 4RGMC 1KUMA 5HGHB 1F3DJ 1MWAL 2XICA 1EEQA 1FJ1B 2R56H 4TVSa 5L0QB 3BAEH 5F7DB 1LEGB 3E3QE 2FZ3A 4WI3A 3TV3L 2BXZA 3BKCL 1S9WA 4KWUA 1ZWIB 4PP2B 1LP9B 3OKOB 5MP6H 2Q86B 3P30H 2RCSH 3SDCA 3ARFC 3FKUS 4U2ZA 3T0EA 3RUGF 1A02N 1NCTA 1U9KA 3GBNH 5ETUB 1WBYB 5J13C 5H94A 3JWOH 1F4AA 2LU7A 4Q2ZA 3U48A 3TBVA 4ACPA 3GSWA 4PJXB 3ARBD 1Q9KB 2FCBA 2NTFA 4YX2L 2ZOLA 2X4RB 2VXQH 3OGCB 4A6YA 3IJSA 2ZP0T 2D31A 4NQEA 2IMMA 5I74C 1ZHNB 2WIIA 3P0YH 5IF0A 1CD1A 4XP9H 4GBXA 3SKOA 1O5DT 3WFEH 1NCWL 3QULA 2H6PA 1RJLA 5CUSL 4H88L 2ESVD 5I8KH 4BFEA 3RAJL 5C07A 4KKBD 4JFEB 3T4YA 5JHDA 5FIEA 2VN7A 5F9OL 1AHWB 5FECB 3FAXA 3HB3D 4RGNB 5E7BA 3QWOA 3GGWA 4O4YL 3C60B 4H5SA 3C87A 4LPXA 5IEKA 3HE6C 5GSVB 3BPLB 4HXAH 4B41A