2P5EE

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE02
3DRTB 3OJMB 1MWAA 4NM8L 5I8OH 4X9HA 2BMKB 1YMME 3R0MA 4D8PB 4M7LL 5EG6C 4O5LH 2PXYD 4WUUE 5JORA 2VQTA 3QI9A 1CD1B 4HKBB 4PTUB 3AB0C 1YNKH 3MODL 5E94B 1JV5A 5SX4H 1N7ML 1T80A 5CIPA 1MSPA 1JYVA 2CK0H 4PJBF 2R2HA 4X6EA 3HMXA 4GT7A 3VXRD 3OAUL 1HQ4A 3C6LD 2LU4A 4Y5VB 5BS0A 4PYGA 5HGAA 3MGOB 4M93C 2CMRH 5DYOA 5EIIA 1OSZA 1R5WA 4NO0A 4BSWA 4FZ8H 4H5SB 3MJ7A 3RWJA 5DC9B 5SX5K 1WK0A 2X4QB 2OJZL 1CLYL 2EECA 3IDJB 1QVOB 5B39G 3TO4A 2YPLA 1ZLWK 3LQAC 2GY7B 2ITCA 3I6LD 4HK0B 1PKQE 1QFOA 3FN0L 4GS7C 4YBLB 4YHOH 5I1LB 1E6OH 2C1PA 1ZHKA 2X70A 1S5IL 5CLTA 3QEHA 3MXVH 4R3SA 2MWCA 3QFJB 4BM7A 1A6VL 3WXVL 4LVNC 3QO0B 4XP9L 2PYFA 4JO1H 2V5SA 1ORQB 4MAYA 3MV7A 1LDPH 4IRJB 4EOWH 3JWOC 2GSGB 2YD7A 4M48H 12E8L 2BZDA 1LE5B 5HI3C 3CH1A 3AY4C 1QNZH 2ADFH 4P9HH 1KF9B 3GSOA 2VDNL 3I50H 3QT2A 4PBWD 1OAYL 2VLLB 5C6TL 1B0WA 5A3ID 1MHEA 3DURA 3TZVD 2YBRA 4PJHB 5JLZA 4LOUD 3VGAB 1PY9A 1YMHA 1RIVH 4JPIA 4U1LB 4QXTA 4LK4A 4HKJB 1NCUA 4XCNA 2HJKA 2MPAL 4Y2DA 2NR6C 2DDQH 2XTJC 4C55A 5HHPA 1DR9A 3LN5B 4N0CD 4C56B 5GPRA 4F7MA 1AC6A 1U8NA 2ZSVB 3IAQA 3L3OB 4LAQH 3GIVA 4BELD 1O5DT 4Z5RB 5C0CD 3O2VL 2YPKB 3BRGC 5F72S 4D0CA 3DARA 1NCWH 2DWEB 3ZDZE 1DBAL 1P2CB 4U6XA 3U7AA 4KMLB 4TQEL 4NNYB 4GOSA 1UC6A 2VC2L 4GAFB 1C5BL 3TBSB 2FHCA 5FV1L 5IWLC 4PLKC 3MLSL 4XPGL 3IAGC 2COQA 5SWSB 3V6ZB 4TNVK 3MV9A 4ENED 2AJYL 1JZ6A 1S9WA 4NQDE 4JZNA 3NIDF 4FP8H 3WIFB 4H1LG 2E9WA 3ZTJH 2FZ3B 1Z9MA 2F54D 3OKLA 1MHHA 5D7JA 3HMWL 3SCMB 1X5AA 2A77H 3D69A 4HX1B 3LS5H 1HINL 3JV4A 2BSRA 1FPTL 4HK3N 5TDNB 1B6UA 1HDMA 5D72L 2F53A 5EBLB 4TVPE 3S96A 5IK3A 3V6FA 1OGAB 2HYMA 3HC4L 4XBGA 4QT5A 1NGZB 4GBXD 2BNQB 1U3HB 3GMQA 3MX0A 1NGYB 2DM3A 4WW2C 1ONQB 4YXKH 2H6PB 2BFVH 4EI6B 1GOGA 3JV0A 1ZANL 4UIKL 2BDNH 4UILL 3VD5A 4KMTH 3E8UL 2QSCL 3HG1E 3WFEH 4DQOH 4TOYH 3ROLB 2BNRD 3PHOB 3RTQB 5K9OB 3HC0B 5KSUA 4JO2L 4X9FA 1MCFA 5C0RL 4FQJH 4PGBA 3QXWA 3SJVA 2C7UB 1KBGL 2ATPA 2WIIA 3TO2A 4OKVA 1JNLL 4KUZH 4OBRA 1L7TH 2BC4B 4P5MA 5BQ7B 3CFJB 5HHXL 1ZVHA 1EFXD 5DUPH 4K07A 1MWAL 4NHCL 1DBML 5FUZL 4R7DB 1A0QH 1S9YA 4OLZH 5GGQH 4HHAB 4PLJC 3MLPA 3LDBB 3BP4B 3SN6N 3S36X 4W4NA 2NMSA 3MRIA 1F90L 5AWNL 2E7CA 1RFDL 5DS8A 5FYJD 4LLMA 1MCBA 4TN9A 1N6QL 2ZNXA 3IGAB 2FL5B 4KQ4L 3G5ZA 3CVIH 2VLRA 5I9QB 4NWUH 1U8IA 2VLJA 2FBJL 1OAZL 1BECA 3WIIH 2NPLX 1G7IB 1CE1L 4ONHB 3HKFA 4QRQB 1IILE 5EN2A 5INDA 4XB8A 3DLQR 1QLEL 5F7UA 4LCCA 4KRLB 3WD5L 5DMGD 4E0RA 1OQXA 4CRPA 4QRUB 4FFVD 3QUYC 2V2WB 4XVJH 4LSVL 5KVEL 4G9DA 5DT1H 1F6AB 1ND0A 3BEWA 4KKCD 3VRIB 4YDLC 4YHYC 1NDGB 3ARRA 2G5BB 2FD6L 1S7SB 1RZJC 2BNQD 4YQXL 3LEVH 4KGJA 4TNWK 3MXWL 4HS8H 2A83B 2AEIT 4LMQE 3OQ3B 2H45A 2ICEB 2QHRL 3IETA 1KEMH 5I1JH 8FABB 4KJYB 3R0NA 2W92A 5AAMA 1U8HB 4JDVB 3CVHB 2JB6B 4BZ1H 3KS0H 1H9VA 1U95B 1G0XA 3WFBL 2VXTL 2RIKA 4QHUB 3LCYA 4OM0H 2BXZA 1MCSA 2Q86B 1AGDB 1J8HB 1RJYA 1WBYA 5IR1A 1B0RA 3IDMB 5HHOB 4U7SA 2NY5C 3C8HA 5ETUA 1KIUA 5D7LE 4HQQH 4UV7L 1MCRA 4RFNB 1P6FA 3LKPA 3QHZH 1PSKL 4GKSB 4M6ML 5AUMA 3GSQA 1AJ7L 1TETH 4XPHH 4D3CL 2UWEA 1T7YA 5GS0H 3MPCA 1ZLSH 1EHLH 3S8WA 2RFXA 1DQQA 1KCSH 3BUYA 2AK4A 3NCJH 4PJ5E 4LEXH 1KT2B 5I0DA 1BX2A 4GW4B 2NY6C 1MLBA 2YA1A 1IFHL 3X12B 1OP3K 3J7HA 5CINH 1KN2L 5JUEL 4MA1B 4YDKL 5CD3A 2BSTA 3QJHB 4Y4FB 4JANA 1MJJA 3MCLL 3VGDA 4PJIA 8CGTA 5IIEB 5ALCL 4U3XA 3TA3D 1A7OL 1T83C 5BJTB 3MRJA 5MEQB 3KPRB 1KPUB 3ECBA 4PJAA 1YDPB 2F5BL 4V1DE 3CMOL 4AMKL 2FSEA 4P46B 1J1PL 2C26A 4XPTL 4AH2A 3K2UH 4QTIH 1E6JH 3FFCD 5E2UH 3WFHA 2ZOKA 1GC1C 3DV4B 4PJHF 4N0YH 4BFGA 1GYAA 3D3VB 1X5JA 2R0KH 2BRQA 1KJ2L 2OQJA 3QDMB 1T5WB 4Y8AA 1QRND 4HJJL 2AEPL 1P4LA 3UTSA 3V4UH 4PLKD 3JTTA 2E7LC 3V52H 1P4IL 5LGHL 5EIQA 5KVDL 3G9VA 4E5XB 4G8IB 1Q1JH 2R29H 2VAAA 1KB9J 1KIRA 3ARQA 2ZJSH 3RNQA 3NACH 4NQXB 3X11B 5D96B 1QYGL 1J8HD 3ARGB 4GSDH 5JZ7C 3RVWD 1PG7X 4ODUA 3PWNA 5CAYB 5IP4A 4JZJA 1YPZB 2APWA 1KTDA 2C3VA 3G9AB 4MXQC 5F89B 4W6WB 2VWEE 3AU1B 3TBYB 1TCRA 3O2DH 4NKIL 3SO5A 3O0RH 3WN5A 2Y06H 4IDJL 2FEDC 1QA9A 4PJFE 4PJEA 4FXKB 2WQRA 4MJ6A 4KVCH 1ZEAL 3O45B 5CP3A 4GG6A 1AY1L 3G6JB 4XH2B 2D4FA 3ARFA 2NY1B 2YRLA 2CDGA 5CEZE 4ODVH 2XICA 3PQYA 1GJIA 1EGJA 3PGCB 1S9KC 4UQ2A 3BEVB 3QQ9D 1T04B 1WISA 1MJUH 4LVHC 4E41E 3T0WA 3GJFK 3X3GL 3CUPA 4LARH 2EO1A 3BWAA 3WXWH 1AIFB 4PJ8C 1P69B 3GBML 2DKMA 1M4KA 3U79A 3KPRD 4KQ3H 1INEH 4JFHE 4YDJB 1UB6A 5E8OA 3P0YL 3T2PA 3QIWA 1OTTC 3OKMB 2QLVB 1XF5B 2OR9L 1WBXB 3FKUS 3JVGA 3X14B 2R23A 3AREA 3B83A 1RZ8A 1BVKB 4LSTL 3T65A 2DBJA 4A6YH 3O8XC 5TFSL 3H8NA 3QCVH 2LAAA 2ZUTA 2P1YA 3D3VD 3HNTL 4PLJD 4HGWB 5CBEB 3KYKH 1EJOL 4UNTA 4JB9L 3QSKB 3INUH 1SBBA 3FRPG 2X10A 3RX8A 2Y5TA 3HNSL 1J9CT 1DSFH 3CGTA 3S6CA 2FATH 1MCEA 1NGPL 5BMFH 1JYWA 4MZ3A 5EOCL 1Z9SA 3STLB 1RIUL 4U6VH 2YA2A 3VXNB 1MCOL 3QIBD 3ARGD 1I8KA 4WI2A 5IOPA 4JHWL 1CR9L 1C1EL 4DUVA 5GGTH 2HWZH 3SQOL 4XHJC 1AP2A 3V4PL 4K7PX 3MLYL 1UZ8A 2V2XA 1Q9WB 1E0OB 1BEYH 1NBVH 4YE4L 5F1KC 1AGEA 3QUYD 1AKJB 3JXAA 5HDQL 1MELA 4XC1H 1ZA3B 4OD2B 5FKAB 3S37X 5CZXC 4JFEA 2Q3AA 4E9LA 5DI8A 1WTLA 1ZHLB 1IBGH 3KNBB 4WDIA 2NY1D 2WK2A 2DD8H 4YGVB 1JGDB 5E8DH 5DHYB 1G9ML 3P4OB 1Q0YH 1D6VL 1Q94B 4XVSH 3ZHDA 2QKIA 2WAHA 2AGJL 4BFBD 3EFFB 3LHPH 2HKHH 3OKYA 1SY6A 4L4VB 5ECJE 1I1FA 3ARDD 3GKWH 1A1OB 1TTUA 1NBZB 3PHQB 2WSKA 5FXCH 1XH3A 4IRSB 3DVGB 5D1XB 3BMVA 4UQ3A 3WHE1 5CJXC 4IRZL 4YH6A 1CDGA 2DYPA 5IJKA 3BP6A 3GIZH 1T1XA 5GGVL 3S35L 4YHML 5IQ7L 4I18A 3AS1A 5C7XL 3O3BA 3BQUC 4PJ9B 4NQCB 1T20B 5DD3H 1TTFA 1VFMA 1FBIH 1X3DA 4HIEA 3TO4C 3JSSA 3Q1SH 2GAZA 3L3GB 1A7QL 1D5IH 2B4CC 1BLNA 2VLME 2PCPB 2JELH 3EUUA 5E1HB 2Q6WB 1T6WA 2IFFH 5DJDB 1E4JA 1R3KA 4I3RL 4WWKA 3D5OF 5BVPL 1H0DA 5KAQF 4QGYA 3HPJA 1DN0B 3QZWG 4GAJH 4UT9H 2NY6D 4TTGA 5C0NC 1HHHB 3LS4L 4YO0B 4YXLL 1I3GH 4K94C 2IBBA 3KPOB 5FO9B 2MQ3A 2EYSA 4PJ7E 1FORH 1NMCB 1WSST 1AKJD 3DETD 2NX5B 4WFGE 3EOBB 1NJ9A 1IM3B 5GXBB 1U8MA 4ODXB 3LV3A 3RGVC 3N1PC 5I1GH 1RURL 4WNQA 2AJXL 3P73A 4PJDB 5DDHA 4JM2A 1U3YA 5C86A 4MD4B 4PJFF 2BVUA 4GRLD 1DL7L 5FYLD 5JW4M 5IEHB 1I7RB 1TJIH 4U1JB 4U6HB 2XRAH 1IAMA 4JO4H 4OZ4A 3OKNB 1BF2A 1S78D 1AXSA 2NCMA 4XI5C 4F33B 5M94B 2PTTB 3TBTA 4L4VD 4OLYH 3GHEL 3T1FA 1D5MB 1K4CA 3ZTNH 4N1HB 3IFLH 5DRWA 2YK1H 2A9NH 3WO3B 4NPYB 4AT6A 4UTBL 4IRSD 1GAFL 3L3DA 4JPVL 1XGYL 2I07B 1ITCA 3AS2A 4KMQA 3REWA 3SQBA 1UJ3C 4M02A 2OX5A 3L5HA 2IQAA 1UM5H 1FRGH 3JUYA 5JZ7D 3HCVB 4D0DB 3PWPA 2MQ0A 4LDEB 3CFKA 3MGTA 4PJ9D 4NC1E 2ARJB 3B8YA 2PO6C 5LQBH 3QAZC 1H5BA 3I85A 1L7IH 1OF2A 2DI9A 2FEEI 5ISZD 1JPTH 2ZCHH 1S7QB 1T7WA 3OAYK 2FEDD 4MDJA 2P24A 2IEPA 4OGXL 4IMKC 3NFNB 1OLLA 4L9LC 5D7KE 5HYSA 3VMOA 5I2IB 2BY2A 4DOHE 1T1YB 1OAKH 2Q8AH 3KLAA 5KANI 1MIEL 5KSVB 3MOQA 2DQIL 4PS4L 4JY4B 1VKXB 2NXYC 4IJ3C 4RNRA 4RA3A 4EUPA 2O26U 1MWAB 1X5FA 4U1SB 1IC4L 3CZJA 4K7PY 4M5YH 2OZ4H 4L1DA 2VLKA 2NY7L 4OKDA 3W0WA 5JORB 3U2SB 3QI9B 2A1WH 2IAMC 3I02B 5D8JH 4GMSH 5IFJB 4P4RA 3EJYC 5ESAA 2QQLH 3BKCH 1S7UB 3L7FA 5L6YH 2NYYC 3OBAA 3NAAL 1EAPA 3KXFE 4HS6A 1YYML 4M1DH 1OTTD 3MROB 3PV7A 4HMEA 1GGTA 1QFPA 2XA3A 1HQ4B 5BS0B 3BGFB 1MLCA 4XP4L 3BD3A 6CGTA 5DYOB 1OSZB 2BY1A 5I73C 4X6DF 2R0ZH 4U05A 3MJ7B 4ZFGL 4RGMC 5FOBA 5HHVH 3FO0L 2ILLA 5FA4A 4KU1A 3IJSA 1WV7T 1OP9A 1CWVA 1CICB 4B41A 3ZE2F 4Z8FL 4ESKA 4V2CB 2C1PB 1ZHKB 4X6CE 1LO2L 5J9PB 4WY7L 3E6HB 1MCJA 2GT9A 4DVBA 5TE7H 1GGCL 1OAQH 1SY6L 2FLRT 3OV6A 4MAYB 2UZXB 1FNAA 3G5YB 5FYKL 1CLCA 4F7PA 3HI1B 5F97E 4IDLA 4CADB 4BSJA 3O3EA 1JHKH 3GMLB 4NQED 3ZKQD 5F7DA 2A38A 4X99A 4F9LA 1RVFH 5FHAL 3MJ8B 2IALA 1OCWH 3CDFA 3GSOB 4ZSOA 4KRPC 3NFPA 2EYTA 4R4FL 5JR1L 4KH2A 3GJEB 1G1YA 3VG0H 2EKSB 3LQAL 2ORBL 4F9PA 2HJFA 5E56A 3ULVC 2FIKA 5L88L 1ZT4A 3U7WL 1IAOA 1YMHB 1N4XL 2XWJB 4JPIB 1UJTA 3KPTA 4G43A 3NIGE 3REVA 3QI9D 5E6IA 2HJKB 4I77L 3SKJL 5JOPE 2CO7B 2P46B 4JFYA 4QRPA 4XB7A 2GHWB 2ICWJ 1I1AA 4F7MB 1U8NB 1NCCH 4M7KH 4LLYB 1TVHA 3LN4A 4JKPL 3OXRA 1OT2A 1KOAA 3D18B 4ORZC 3C60A 2NTFA 4D0CB 4NO0D 4JY6A 5CD5D 5H35A 1MRDH 5I66B 1VHPA 4MLSA 5GISL 5CJBA 3QXDB 2Q3ZA 3TO4D 2YPLD 5C0JA 2K7QA 1JPSL 5C2BL 3MRNB 3MV9B 1P1ZA 4WI7A 1UYWH 1YJDL 1S9WB 4K3JH 4KI5C 5DFWH 1AHWB 3KPLA 5I8KH 3FQTA 1CL7L 4LEOB 1QLRA 3OKLB 1MHHB 2YUZA 5I1CL 1S7XA 3BXNB 2CIIA 4M43L 3D69B 4LLUA 4OB5H 3DROA 1JHTB 3MV7D 2FJFB 2BHUA 3UTPE 1NFIB 4JFQA 2L7JA 3OX8B 5GS3A 4RGNC 4R0LB 3FQXB 3X13A 3CIQA 3VFUA 2O61A 1KJ2B 1AFVH 5F1OB 3S96B 1MAML 4XZUA 3V6FB 3W11D 3MO1B 2XACC 4XBGB 4QT5B 4D9QD 1JVKA 3BIBX 3BKYL 5I8CA 3KAAA 4AYFA 4BQ8A 1A4KA 2CR6A 3M1BA 4JCLA 5BOZG 4RAHA 1CGSL 4LP4A 5EU6A 4I5BA 5HPOA 1VSCA 3W9DB 4KWUA 1IQDA 1ADQL 1YN6A 3LIZL 1EO8L 1NCNA 1LGVA 2E6JA 3DO7A 1BFSA 5KSUB 4Y2DD 1AR1D 2FH6A 1QP1A 3VFPA 2WIIB 5KJRH 4NHUB 3CCHB 1RK1A 3GI8H 5F7NC 3VXTB 3QEQB 6FABL 2ICWI 2YN5A 5ACMA 4MNHB 1K5NA 1RJZA 1RHHA 3DBXB 3DIFA 3LH2L 2Q7NA 5JPNA 1XZ0A 4WHYG 2GK0B 2DB8A 1S9YB 2NTSP 4NKOB 4RMQA 4X83A 5I18H 4MDIA 3FCTA 1MRFH 1VERA 2WBJA 4G8EA 5E99L 5TDPB 1PEWA 3QB7C 5ID1A 2JTDA 5DS8B 3WE6B 2Z31C 3PUCA 4LLMB 2R8SH 1A7RH 1KJ3L 3HAEH 4MD0A 1YYLL 3MV9D 3G5ZB 5GRJH 4IOFC 2J1KA 2VLRB 4Y5YB 1U8IB 2J12B 5T3XE 4CJ0A 5A43C 5GRUH 3I75A 3UBXG 5D7JD 5J12C 3MGAA 5CZVH 5EN2B 1B2WH 5D2NC 2GTZA 5B4MD 1FLRH 5DRXB 2CXGA 4LCCB 4X6CF 4E0RB 1VADA 5I16A 3WN5C 2ZOLB 4WHCA 4JRYA 3NFSL 2F53D 5E03A 1CU4L 5CGYC 2D7TL 3D9AH 2UY6A 1SVCP 4RISL 3EJYD 3MACL 4JM4L 5FIEA 3VXME 1IAIL 2NYYD 5BZWB 4NO5A 3ARFC 4KZEL 5T33H 4DKFH 4B50A 1JN6B 4YPJA 1CD0A 3CXDH 2IPTH 2C3HA 1A1NA 3GMOB 3HNVH 3GJFB 4AIOA 5L2KA 1A7BA 2HT4C 1MCNA 4G8GA 1F4WL 1TJHL 4FTVA 3QULB 1MFAL 2ZCKH 5L9DH 3G08A 4Z78A 3VXUB 4CW1B 4S1QH 4Q9QL 3G5XA 4MVBC 3SJVD 5FEBA 4ALAH 3LKSB 5CEXA 2ZZUT 1EBAA 5CSGA 3MRQA 1LEKB 2HRPL 4O58H 3M17B 5B38G 3HZYA 4N0UE 1CLOL 3C9NA 4F58H 1EZVX 1R5VB 2PNDA 3KYNA 3RU8H 1XCTA 3KPSE 4YPGB 5JIHA 3T4YA 5EBMA 3NZHH 1OWRM 4I0PA 1N2RA 5IROA 3A67H 3V0WH 4Q9RH 4MA7H 2DM2A 3LKPB 3V6BR 1FYTA 4KTEL 3GSQB 3MRBB 5E6ZA 1LEIB 2UWEB 3OPZL 2VLJD 3GB7B 5DEGB 2RFXB 1DQQB 1TZIA 2AK4B 3RZCA 4K9EL 1Q9KB 3HUJE 4FZ8L 3B4NA 1BX2B 4RA0C 3JWDH 3RVUD 4GH7B 4XPBL 3LB6C 1U8QA 2C4FU 4TSBH 4HWBA 5FM5O 4RMTA 5T5FH 3B6SB 4J3UA 5EA0H 2AI0L 3HFMH 5CD3B 1WT5C 1YNTA 5ID0A 4HT1L 4HG4K 1D5ZA 2HJLA 5GIRA 4PJIB 5GGVY 3MUGB 5D7SL 5ICXA 2BVYA 3OB0K 1E6OL 1INDH 4X7TA 1O0VA 5BVJB 3MXVL 1AE6L 4D9LH 1V05A 2BK8A 4HSQA 4X7SL 1ZVSB 4L4TA 4XNUH 4AQ1B 1WFTA 4QXUL 3F58L 4JO1L 3QR2A 5CILL 4KDTA 3WFHB 1FC1A 1TDQA 4G6KH 3VXRE 4K3EH 4M48L 5JHDA 1A3LH 5HYJA 1FLTX 2OTUA 1VA9A 5GS1A 2O5XH 4QTHB 1QNZL 2EIZB 2OQJB 4P9HL 4PRAA 1FHGA 3IS0X 1F4YL 4HZLB 5T1DH 5DUML 2AABH 1P4LB 3W9EA 5HGDA 4JLRB 5FGCB 1QBML 1CT8B 1V7NH 2AAVA 1AH1A 2A9MH 3CMGA 1JGVH 1JTOA 3RNQB 4KI5D 1ACYL 3I6LE 3QG7H 3RWDA 2QSTA 4I18C 5J1TC 1RIVL 5T3ZL 3GRWA 1RJLA 4ODUB 4KROC 4CL7A 2Q76A 3K0WA 1TCRB 2X4SB 3O6ML 4HK3J 4UT7H 4U1HA 4HDIA 2HN7A 1JL8A 1K85A 1QA9B 3P77A 5B3NA 4MA8L 1IGCH 1KB5H 1D5XA 4KUCD 4JVUA 4WWKC 4MJ6B 4LAQL 2O5YH 4GG6B 2B7DT 3MMEB 4JE4B 4YHLH 1NCWL 4TPRH 1G7JB 5MP6L 2AK4D 5DJYA 1P53A 43CAA 3BZ4A 3ZLQC 5D1ZB 1CFNB 2BHYA 2WIMA 4G9FB 4PG2C 2VB5A 1IT9H 3QHFH 3CUPB 1PQZA 1WAAE 4QXGH 1I7UA 5DTFA 1DE4A 2X7LA 4YHPB 5E08H 3ALPA 2EH8L 1HKLL 5IB3A 1JPFA 5J6GB 1YEEH 5B8CC 5F3HA 3U4EA 3WUZA 2XA8H 1UQSA 2BVOB 3QIWB 1FL6A 3EYUL 3VXQB 4F3FB 2MHAB 4QWWC 4YEEA 3AREB 1L4IA 1DJSA 1RZ8B 1CDHA 1FZOA 5I6XC 4AEHL 1IGTA 2XXCB 4O51A 5C0CE 3DRQA 5GSRA 2OJEA 3MUY1 4QHNA 4PB9H 5E8NB 4GFTB 5TQ2L 3UTSD 4P99A 2Y5TB 2L0DA 4CVXA 5GRZA 4BH7A 1Z3GH 3T77A 4NFBA 2JIXB 4JDZB 2LQRA 4K23L 1F2QA 3H0TA 4HMCA 5FDWA 1EZVY 1BOGA 1I8KB 2CJUL 4N1EA 1X6LA 3PP4H 1M1SA 5ANMA 5IOPB 1ODAA 1AP2B 2F54E 1KLFA 4PJGA 4ZPVA 2V17H 3O2DA 1UZ8B 1BFTA 5D5MA 3IFPB 1JZ4A 2W0FB 3OSKA 5CGYD 3GNML 4KUZL 1DQTA 1MI5B 3ULUL 3VWJC 5IHBA 1Q0XH 5DI8B 4MZ2A 4WDIB 4MX7A 2NZ9C 2R69L 1LD9A 35C8H 2IANA 1NBYA 4KKAC 5DK2A 5DUPL 3V7MA 1R0AH 1YEFH 5LG1A 3ARFD 3OL2A 3BISA 3D85B 3EYVA 4OLZL 1BBJA 3PQYD 4OUUB 3ZDXF 1MVFA 3P30L 1TJGL 3F7QA 4LRIA 1WZ1H 4P4KC 2HT4D 4DZ8A 4O2EA 2OLDA 3FQWB 2OK0H 4ZOBA 4W70A 1OSPH 5DD5H 1LP9E 3WSQH 2Y9RT 4GKOA 4YNYB 1C12A 3V7AG 2BNRE 2NW3A 2IADB 3QIWD 1ORSB 1MVUB 5ERWA 5FUCE 4UQ3B 5HGGS 1L9MA 3QYCA 4JN2B 2DLEA 4JZOA 3ARED 4HWBL 5IT2L 3BP6B 3FRUA 1T1XB 5J89A 4N9GA 4Q0XH 4JHAH 15C8H 1FFRA 3L5IA 1CGYA 4ONFL 3MJ9L 3RQ3A 5C8JA 4HUKB 1NUGA 4OD1L 3SDYH 2IH3A 4Z9KB 1I1YB 4XBPA 1BLNB 1XIWA 2AJVH 1B4JH 2P42B 4IOIA 3I6KB 5IEKA 3GSVA 5FYJE 3MLVH 1A6UL 2QJDA 4DGVL 3O4OC 1OPGL 1UM6H 3BPLC 4YWGH 3DXAD 2AXGA 4NQUA 5GGTA 2VNCA 4V2BA 1FDLH 1T0PB 2XZQL 5CMAB 1KIQB 3LB6D 1KSRA 5INCB 3W5MA 2EYSB 2ICES 1YA5A 1CFTB 1HH9A 3IXAA 4LDOB 1NJ9B 3NIFE 4OLVH 1U8MB 5DVLA 4ETQB 1OD7A 4JFED 4J23A 1U93A 3QUXB 2EE3A 3PV6A 4Z7VA 4JM2B 4AIZA 4KKNA 1QFWH 3GRWL 4MSWA 3P3YA 5KS9A 3F7VA 2BNQE 4BZ2H 4OZ4B 4OAWA 4BFIB 1AXSB 1R3HA 3QHZL 4M61B 3TBTB 4HUWA 3P4MB 1Z5LA 4C4KT 3TN0A 3T1FB 4GW1A 5IVOA 1OB1A 5D71H 1K4CB 1DBBL 2LE9A 4BSVA 5L8KB 1I1AC 4K94L 1N64H 1BQLL 3CDYA 1KCSL 3IDNA 4Z7OE 1PAMA 3L3DB 3NCJL 1F3DJ 3CFBB 4LEXL 1VFBB 4JPWL 4QRRA 1RUAH 2BJMH 2DYPD 5M95B 4I9WD 2IQAB 4NNXA 1VFAA 2W9DH 4ZO7A 1QSZA 1ZHBA 4NN7B 4LSUL 4L5FL 1H5BB 1OF2B 4WU5A 2P8LA 2IMMA 4JREB 3KDMA 2DQDH 5A2FA 3N06B 1I7TA 4G8FA 3MYJA 1V7MH 1UT9A 5HYSB 4WWKD 4NP4H 3MV8D 4PB0L 4PTTA 1E6JL 3AAZA 2BRRL 2D7MA 3EOAB 2FR4A 5A2KH 1J12A 4N0YL 4LPWA 1P7HL 1GGBH 1XGPA 4KAQH 4RNRB 1SJEA 5DA4A 4HULB 3VU2A 2D31A 2VLKB 4U1GC 3W0WB 1BPVA 3BZDA 4WW2B 1EO5A 2IGFL 32C2B 2R29L 3LY6A 3N1MC 2ZJSL 3BKMH 4M3KB 3UXFA 1EAPB 4LHUA 3VD9A 1LO3H 4P5KA 2VDRH 2DQGH 1QRKA 3QPQD 4XP6L 3RUGB 1FCGA 1DQLL 3LOWA 1IJ9A 1QD0A 4RZCA 4UIMA 1A6PA 4QWWD 3TH3T 4NRZA 1MLCB 1KACB 4UINL 2J8UE 2A74B 4PRIE 3DWTA 4U1MA 2CDFA 2Y06L 2J88H 1I3VA 3U9PL 1G1CA 3L95B 3FFCE 4NIKB 4Y2OA 3S9DB 5FA4B 1IGFL 5DJZA 1I3RB 3RBSA 3FTGA 3IJSB 3U83A 2XQYG 4U2ZA 1GZQA 1AD9B 2G75B 1RZFH 2W0KA 2HG5A 1QSFD 1QRNE 1LP9F 4P57A 3BN9D 3K80A 3NTCH 4OQTH 3BO8A 3TJEH 4WI3A 1SMAA 2DQTL 2G2RA 3PG2A 4DVBB 4LARL 1MRCH 5C08B 5MERB 3PGFL 3PWPD 1IEAB 2WBJC 5E2WH 3TV3H 4JQXA 2QADB 1BQHG 4KQ3L 3GBNH 1INEL 1I9RL 3GSUA 1FP5A 1MJ7H 4X99B 4ZTPL 5BO1L 1IGMH 2IALB 1F58L 4FZEL 4EUPG 4PY7B 4ZSOB 2DQJH 3KVQA 3NFPB 4KKAD 2V7HA 2EYTB 3H9ZA 4NWTH 2P7TA 1QKZL 2HJFB 4YBQD 2JK5A 5JMRA 1I8LA 1HXMB 2CRMA 1L6ZA 4FQIH 1K6QH 2IBGA 1XF3B 1U8JB 3DYOA 2AXFB 4G43B 3W0WD 2IF7A 3REVB 2CLZA 3HE7A 2XN9B 1EHNA 3BH8A 3QFDA 4GQ9L 3TC9A 5BMFL 1LK3H 4N0FB 2X40A 4Y1AA 4ZUUA 4Q6IC 1JGEA 1WWAX 2XWTA 3CVHH 4JFDA 1DLHA 5J3HC 4P2OC 3KPRE 1KG0A 1Q72H 2HP4A 4P23C 3OXRB 4R96B 4KJPC 1Q38A 3F12A 4JVWA 5DJ6B 3C60B 3TT3H 2L4OA 5H35B 5ICYB 1HCFX 4W6YB 1UGNA 2X4TB 4F7CA 1QBLH 3NH7L 1OM3L 5I1EH 3ULVL 1IBGL 3E2HC 5C0JB 2OTWA 3RI5K 2G5RA 1PBYA 1A3QA 1AQKH 2FJHA 1PD6A 4YHIA 3RY6A 2J5LC 3WKML 5AZEL 5EC2A 4UB0H 4JHZA 3PWLA 3KPLB 2Y1VA 4MGXA 4YHKH 3MRMA 2VUYA 1KB9K 2JCCA 4Z7OF 1N0XL 1S7XB 5HBBA 4MXWL 3WNOA 4LLUB 3RPKA 3L7EB 1T21B 1ZK9A 2GITB 3C08H 4XCCH 1HH6A 1NDMA 4PRHA 3WLBB 2BY0A 3GKWL 4JFQB 3X13B 3HZMA 3VFUB 1RQ5A 2O61B 4OZGE 2YD8A 4QOKE 4Y5XC 3VE0A 2UUDK 2VL5A 4HJGB 5LCVH 5FO8A 1ZV5A 2WINA 1E27A 3GIZL 3H9HA 2NY3B 1B0GA 4R26L 1QG3A 3HZKA 3M45A 3C2AH 5JIKA 1CVRA 3QZWB 2HFEA 3QH3A 1J5OL 4I5BB 5FO7A 3G6JE 4F8TA 5C1MB 4R4BA 5F6HJ 5C70A 2AKRA 3MLTA 1FJ1A 1YN6B 3Q1SL 5ALBH 4P9ML 3DO7B 2JELL 1WCBA 5E6ID 4NCDA 2IFFL 4MJIA 3EYOB 1E28B 5HHMB 3D87B 3DUSA 4JFFA 4QRPD 4LLVA 4U1NA 1I1AD 1M71A 2IPUG 1MFDL 4M5ZH 2R56H 4R97C 1I9JL 1N3NA 4OZHA 1CGWA 4UDUB 2Z8WC 1K5NB 4ZYKA 1CXLA 1RJZB 3R8BB 1RHHB 4Y4KA 2J7LA 3O6LH 1EO7A 1I3GL 4TUOB 1YEIL 3BIAX 2OR7A 2X4OA 5JPNB 4PJCE 4FABH 4M62H 3T3MF 5IBUB 4LBEA 5FAAA 1PKOA 4JKWA 2YXFA 3SGJC 4ZG1A 2E5EA 4MDIB 3FCTB 2GEEA 7FABL 1YECL 4PV8B 1ACZA 3E0GA 3HS0A 5I1GL 5ID1B 5GRVK 4JRXB 4P2RB 2VJXA 3T8XA 2P5WE 4MD0B 4C57C 3EBAA 1BQSA 3O11A 2F19H 3BRDA 3TCLA 1RHFA 1AD0B 4EI5A 2XRAL 4JO4L 3CFCH 4KFZC 2MCPH 4DK6A 2GTZB 4A2LA 1A6WH 1K8IB 1LHZA 4OLYL 5CLWA 2OCFD 5KSBB 3QRFM 4I0KA 5EOQH 1LO4L 5F96L 2DTMH 3DI2B 4OZFA 5C09A 3ZTNL 2PR4L 4YLQT 2N7AA 2YK1L 1ZLUH 4YFLF 1WEJL 1CGUA 3K4AA 2VR9A 5E8EA 3V79C 4LHQB 5J06A 3BIKB 5GS0C 3BN3B 4NO5B 4N8VA 1AXTH 2QQKH 1Z0NA 3VW3H 4G42A 3LN9A 5C0AB 2PF6A 1A1NB 4UT6H 1WFUA 5EU6D 5LQBL 5KVFH 3CSGA 3I9GH 5GRVL 4OZIA 1UFUA 5L2KB 4GRWB 1I4FB 1JPTL 4G8GB 3LKRA 3Q3GA 2Q1EA 4X8JA 1FV1A 5FYLE 3IRPX 4FTVB 5IB2B 4U0RC 3U7YH 1T0NB 4NM8H 1MFEH 3DX9B 1XGRB 1RIHH 3PDDA 2OTPA 3IJYA 4WV1C 2GCYA 5GJTH 5SWZB 5L0QC 5J56B 2Q8AL 2ERJB 3G5XB 5K59E 4L4VE 3O8XB 3OKEA 2QEJA 3NCCB 4WI5A 1T1ZA 5FF6A 3VH8G 1EBPA 2A0LC 5CEXB 4AEIH 3MODH 1N7MH 4TSAH 2FJGA 1FH5H 3BD4A 1U8KA 2EO9A 3C9NB 4M5YL 5IMLA 2AW2A 5IW6B 3KYNB 3NPSB 3U0WL 2YA0A 3OAUH 5D8JL 3T4YB 5EBMB 3GMPA 3BYYA 3F62A 2WBJD 5ESVB 3MRKA 2XZAL 3DMMC 4I0PB 3OR6A 3ZTJG 4AK1A 1N2RB 1YEGL 1QUNA 3HAEA 1TPXC 1FYTB 1I9EA 1YUHA 4PJBA 2OJZH 1OARH 5ISZE 1CLYH 1D9KB 2GW5A 4L3EE 1CVSC 3LQMA 4J3VA 4KK9C 2EE6A 1WFOA 1BVLA 2R0ZL 3FN0H 1P4BL 2QTEA 3HE6A 2Q8BL 5I1HH 4F37K 1CD9B 1S5IH 1U8QB 2A6JA 5FM4A 4C83A 4OI8A 1OOAA 3EDEA 5HGBA 4MQ7A 3S97C 3WXVH 4JRYD 4XP9H 5C0BB 3LPGA 5D2LE 5EO9A 1D5ZB 5GIRB 5ICXB 5TE4L 3UPCA 3BH9A 1UH4A 2GKIA 2IH1A 4HS3A 4X7TB 3NCYS 5B21A 2GJ6A 1AXIB 12E8H 1MY5A 5TPWL 4OZGF 3MA9L 2LABA 4LIQH 5E2VH 4E42A 1OAQL 5J3HD 2VDNH 3G6AA 2FEEL 3GGWA 5IHLB 1X5IA 4MA3A 2UYLA 3Q5YA 3T0XA 5I1KL 1OAYH 4G8GD 5JHDB 2EDFA 5SX5H 2PYEB 1EEQA 1XR8A 5HYJB 2OTUB 2DI7A 3C87A 4PP1C 1JHKL 2NQCA 3BP5A 2BSSB 5GS1B 1SJVA 4OBSA 5KG9B 2AJUL 1ZLWH 5TGBA 2DIAA 2YEZA 1MHPL 1R24B 1A14H 2ICWA 1G9NH 3VXOB 3O3DA 1U36A 1SMOA 2MPAH 3EKCA 1XF4B 1Z9OA 5EO1B 5GGRA 4M8QA 5GGUA 1O7VA 4RX4A 3RJDA 3T1WA 2MCG1 1NGWB 4H8WH 5EH1A 3UTTA 4P3CL 2X4RA 3CXHJ 5E9DA 4JN1L 3TT1L 1NEZA 5MEPA 3O2VH 4PJCF 3WLWD 4U1HB 4HDIB 5C07A 1DBAH 5K9JL 4FQCL 5FFLA 1XIWC 3KHOA 1MCPH 5DJ0A 5TF1L 3GBLA 5HDBE 1C5BH 4K8RC 4YZFE 2VXQL 2VQ1A 3FOMA 3TYGL 1IE5A 2DQHL 1YEJL 1LK2B 4NQEE 1NLBL 3RZCD 5I1DB 1D5BA 3C8KA 1MRDL 2AJYH 3LRGA 43CAB 4K3DH 3STZA 2YD4A 2P8PB 5AD0A 3ZYJA 3I3EA 5I71C 4O2FA 2BVTA 3VA2C 2F5AH 3LVEA 5DTFB 3GM0A 1E4KC 4JKMA 4LLWA 1HINH 5IB3B 2B1HH 2YD2A 3WDIA 5F3HB 4YAQA 2NW2A 5I8KL 5D72H 5F88B 1ZA6A 4L4TD 4R2GC 2H2PC 1GHFL 2YUVA 3QDGA 5CUSL 4OB5L 1KPRB 5IV2B 3HC4H 3LQZA 4LCWA 2E7HA 3B43A 1KLGA 1FZOB 4CGTA 5JHDD 5FECA 3PNWA 4Y19B 2IQ9H 2WLZA 3DRQB 1P5VA 2YUWA 2OJEB 1ZANH 4QHNB 1XCQA 1CF8L 1DEDA 3BOVA 4UIKH 4UILH 1DFBL 2QSCH 3E8UH 4F2MA 1WIUA 4HPYL 4BH7B 4JO2H 4HWNA 1BD2A 2YPLE 2HVKA 3NZ8B 3T77B 3U6RA 5C0RH 3H6JA 5JXEA 5T5NG 1PX4A 1YNLL 2MJWA 3QAZB 1CGXA 1C7TA 4ELMB 5K59F 3H0TB 1JNLH 1NBQA 2ZP0T 2L7UA 5L2JA 5HHXH 5MI0C 3UTQA 4ZPVB 3ILPA 2H2SC 4WU7B 1MWAH 2B2XL 4NHCH 3ZHLA 4L9LB 1N26A 1DBMH 1T22A 1OP5K 4CBPA 3Q2CA 3MV7E 3C6SA 3F8UB 3NCMA 4IIQC 1MEXL 3HRZA 4ZTOL 3SDCC 1II4E 1BFVL 1F90H 1KB5A 1WBZA 2LVCA 4HUUA 4TVSa 4UV4L 5AWNH 1RFDH 5GS0D 2IANB 5DK2B 2ADIB 3HI6H 3O4LB 4KZDL 4X9BA 1N6QH 3EYVB 4KQ4H 4GKNA 1BBJB 2IAMB 3HHRB 4CNIA 4D9QE 5I18L 3QXAA 1FO0L 1H8SA 4NT6B 2AS5M 5KSBF 1W72A 2AJ3A 1CE1H 3OXSA 3WYRA 4XP5H 2Z9TA 1DQJB 2R8SL 1KPVB 1QLEH 5F71A 3WD5H 1NC2A 1OD9A 4EVNA 2V5YA 2NZIA 2EDEA 3STBA 1FGNL 2J6EL 3FT4B 3VMPA 4OCLC 4LSVH 4PRPB 5KVEH 5GJSH 2JLLA 4PBVC 1CQKA 3MBEB 1DEEA 3IDGB 4JZOB 5FKPB 4N8PA 5IVXB 1PY4A 1VB9A 3MXWH 4GRWF 4NBZB 5FA3B 1A9EA 2WP3T 2J3SA 4ZUTA 2P47B 5TE6H 3AROA 4JDTL 3D2UA 4I2XA 5TF0A 2IH3B 5FGBA 5T33L 4XBPB 1KFAL 1GPOH 4Q2ZB 1EH9A 3DUHA 5CBAA 4L29A 4IOIB 1ZS8B 1U92B 5BRZB 4BQBA 3VFNB 2OSLA 5B38B 4QLRA 1ES0A 3EO9H 4KK9D 3DX8A 2BCKB 4NZTL 1LWRA 2BVQA 2ZCKL 3DRTA 4Y88A 4YHZL 2PUQT 1F11B 4B5EA 5E2TL 4D8PA 3K74B 5DQJA 3IXAB 3QIUA 4ALAL 4PTUA 4WIQA 4O58L 4HLZH 2F53E 3V8CA 2IAND 1JPGB 4Z7VB 3TJHC 4F15C 4FXLA 1PSKH 5F9WC 3RU8L 4MSWB 4M6MH 1CGVA 1AJ7H 3HPLB 4K7FB 1I8LC 4YZFF 1N6UA 3GK8H 3MGOA 3V0WL 4OAWB 1FL3A 5DJXB 3LSOB 5ELIA 4HUWB 1IFHH 2X4QA 3HE7C 4PGEB 1N5AA 1NC4A 3IDJA 1QVOA 1DQDL 4ORGA 1KN2H 3P9LB 4MMZC 5JUEH 5CSZA 4YDKH 3JTSB 3IDNB 1UXSB 3MCLH 2C3XA 4CKVX 5I1LA 3SJVE 2F5BH 4NC1C 3SY0B 3CMOH 5DJCB 5EA0L 4NNXB 4AMKH 3QO0A 1J1PH 2Z8SA 4XPTH 3SKOB 1ZHBB 4WHDA 2BX5A 4WI8A 4ZDHA 3OWEA 4IRJA 4BA8A 2F74A 4X4ME 5DHXB 1D7FA 1QSEE 2G60L 3I2CL 3TWCH 1OL0A 4D9LL 1GIGL 4BH8B 1CDIA 1LE5A 3GUTA 4WFFD 3RY6C 1XIWD 3BT2H 3BUTA 1KJ2H 1I7TB 4G8FB 2AEPH 3AAZB 4XP1L 1H8NA 1P4IH 5LGHH 4M6OL 4GLRI 2CH8A 1I8IB 1XGPB 2VLJE 1OP3H 2D03L 2O5XL 2LVEA 4PJHA 4O9HL 1QYGH 1EXUB 2GUOB 3PWVB 5E00A 5A2JH 1HILA 2AABL 4U1LA 4IHOA 3RWHA 2P5EA 5DR5L 3GMNB 1P7QA 4PRDA 2ADGB 3LN5A 3QG7L 4C56A 4IDJH 3O81A 4R2GD 1FNFA 2H2PD 2ZSVA 3MBXL 3JV6B 4HJ0C 3L3OA 1ZEAH 1U42A 2XWBA 4Z5RA 1AY1H 2YXMA 2YPKA 5DC0A 2CDFB 4UT7L 1T4KB 1BF8A 2DWEA 2ED8A 1V3LA 3BVNA 2JKXA 3TN0D 1IGCL 1T6VN 3RDTC 1KB5L 1JTTA 3X3GH 4W4OC 1GZQB 3H3PL 4FMFA 5SWSA 5KBNC 1W0YT 4J3TA 3V6ZA 2HG5B 1PGRB 3GBMH 2R2CA 4JEGB 2W0PA 4QRRD 1G0DA 3WIFA 3DNKA 2FZ3A 1A3RL 2UY7A 4M00A 1W72L 2EC9U 2Z31B 3IF1B 1SEQL 3MLRH 4KI5E 5E08L 4MS8C 1G84A 1MIML 5GSVA 4LSTH 3D0LA 3NGBB 5TFSH 5C2UB 5AYUH 3GSUB 1WWCA 3KPMA 1H3XA 2V9TA 3HNTH 3FQUA 3I6GB 1ZGLB 3SDCD 4G5ZL 1OGAA 3MNVB 1FNSH 1GSMA 2X89A 4JB9H 4EI5C 1X9QA 4GLRH 1NGZA 1AO7D 3HNSH 1U3HA 5J4MA 4OLEA 3RKDD 2IFGA 1NGYA 1ONQA 2EDHA 2GJZA 1NGPH 2H6PA 4QEGA 4EI6A 1GH7A 3GJFH 5I75B 1RIUH 3Q6FA 2AK4E 3SDAA 1MCOH 2WBWB 1FFPA 4PB9L 4PGCA 1NFKA 1VEMA 4JHWH 3ZKXB 1CR9H 4HUVA 4BKLA 4J3XA 3RTQA 3V4PH 5K9OA 1M6OB 2EXYD 3BH8B 4YE4H 1EEUA 4LHUD 4Y1AB 2IMNA 5HDQH 1DLHB 3RWCB 2K9UA 2BC4A 5CS7A 4PJAE 5BQ7A 3CFJA 1F4XH 5FCUL 1FFOA 2HTLC 1NMBL 2JF1A 3WHXB 3V2AR 1KLUB 3MA7B 2ESVB 4WCYL 3BP4A 1QPXA 2CIKB 4RMVA 1D6VH 4ODTL 1FZMB 2AGJH 1K8DA 1HN1A 4Y4HC 1TQBB 1GVIA 2OTWB 1BGXL 1YEFL 5D7LA 3PHSA 4YHIB 2HA1A 4M4RA 4BZYA 2FL5A 3EIFA 3LKNA 1ITBB 2OI9B 3T2QA 4OQTA 5DJAB 2H32B 3PWLB 1CDJA 3EJZD 5DHVB 3UTSE 2E3VA 4HMDA 3QNYA 3MRMB 5JOEA 2JCCB 4JG0L 2EYRB 4MAUH 1G7IA 1WZ1L 5J6HB 4QRQA 4HD9A 2H1PL 2QQNL 5IVXF 4IRZH 4PYHA 4WEMB 3S35H 4PRHB 4YHMH 5IQ7H 3H9SD 1OHQA 1I1CA 5C7XH 4L8SC 5D2NE 2W65A 2V2WA 3VE0B 2VL5B 5D6CA 3WJLA 1F6AA 3QWOB 4DZBB 1QO3B 5EUOB 2X05A 1E27B 1FFNB 1NDGA 3GSNL 2G5BA 5LWYL 2DL2A 4HGKC 1S7SA 2R0LL 4LQFL 3HE6C 4PJEE 5AG8A 3LRHA 4I3RH 3QH3B 4GG6E 2A83A 5BVPH 4F7TB 3MLTB 1FJ1B 2ICEA 4OIIL 3PQYE 4TUKL 1A6AB 1WCBB 5JNYA 4UTAL 1B4JL 3LS4H 3O9WC 4YXLH 1CD8A 3HE7D 5D70H 4KJYA 8FABA 4UBDD 3DUSB 4TVPL 4B7LA 2N56A 4X4XA 4LLVB 4JDVA 4Y1AD 3G04A 3ULVF 1UM6L 2NY4D 3CVHA 2VO5A 4PP2B 4JFDD 4OZHB 4ZYKB 4QHUA 4Y4KB 2J8HA 1RURH 3DECA 5F1NA 3E1F1 5HYIA 4LBEB 5FM5M 1VGKA 3VFRA 5HHOA 1DL7H 4M03A 4ZOCA 3IVKB 1HK6A 4Y16B 3HS0B 4POUB 4OD3H 3ZKMC 4EJ1C 4M6NL 3T8XB 5H2BB 4Z7UF 4N68A 5ITBL 2VZVA 3AM8A 3HTLX 4LRNL 1NQBA 4GKSA 1T3FB 3GHEH 2IWGA 4TSCL 2OL3L 1H3GA 3O11B 3VMNA 1X4XA 1YY8B 4EN3B 2P43B 4H1LH 5CP3H 4PJFA 1JUFA 7CGTA 4UTBH 4PRNB 4XTRD 1GAFH 4JPVH 1XGYH 2DQCH 4YC2C 2VZTA 4FG6C 4XC3L 3PJSB 3FHQA 3X12A 2VAJA 2ZWLT 5KANG 4OZFB 4PRHD 4XRCB 5F9AC 4P5TC 1VCAA 2DJSA 3DXAE 4Y4FA 3U4AA 4KI5F 3RI5F 3BDXA 3C5ZA 5IIEA 1R6VA 4KHXL 5BJTA 4KK6C 4NQTA 4YDIL 4P2QB 1XMWA 3T0DA 4N8VB 3MQIA 4G42B 2EDBA 4X8XA 4P46A 3V5DB 4JFEE 3GSRB 4OGXH 3JWDC 4C54A 1MIEH 4X4YB 3DV4A 2Z35B 4PS4H 1FV1B 4KUCF 1J10A 4KJWD 1V3MA 4HCRH 1P84J 4MJID 4NC0B 4NN6C 3QDMA 1IC4H 4ODHH 2GCYB 4JFFD 2Y36L 5HVGB 1I85A 2NY7H 4Y8DC 2V7NB 3OKEB 1PZ5A 2FH8A 5FF6B 3EAKA 1QZ1A 4CU7A 4ZUVB 1NFDB 1A5FL 2E9IA 1VDGA 3MNZB 3NAAH 5D4QA 4Y4KD 4QNPF 4NQXA 3X11A 2IJ0C 3HR5A 4MNGB 1YYMH 1KYOJ 1KEGL 3N0PB 4KY1L 5HVHC 4PJAF 3S34L 3QBTB 2W60B 4R4ND 5F89A 1FO0B 3AU1A 4WI4A 1IQWL 4I9WE 3MRKB 5DJ2B 2FX7H 3SEPA 3TBYA 43C9B 3OR6B 4U3HA 3BKML 3OAYH 3OF6A 4NOBA 2X9YA 3L3IA 3B9KC 4ZFGH 2Y25A 3WFDH 4NM4L 3ARBA 3MRCB 5TQ0L 1YUHB 3FO0H 4G6JH 4PJBB 4EXKA 5EIVA 4HF5L 4FXKA 5JXEC 1UKQA 3O45A 4POZC 4EI5D 5KSAA 4XH2A 2J88L 4Z8FH 4JFXA 2AV1B 3MV8E 4X6DA 3DVFA 3BEVA 3VWJB 1LO2H 2M26A 4C83B 3UAJD 1QLFA 4MQ7B 5C09D 1CL7I 4Y0GA 4CU6A 3H42L 5EO9B 1GGCH 4OQ1A 1AIFA 1SY6H 2JB5H 3W2DH 5IM7A 1ROWA 5FYKH 5F3BB 4OQTL 3RWGB 2GJ6B 5DK0B 1XAUA 3OKMA 4U7KA 5F6IC 1QACA 4KKBD 5FHAH 1MFBL 3MFGB 3G6AB 2QL1A 3GGWB 5E2WL 1CDBA 4MA3B 1BVKA 1E4WL 1J1OL 4R4FH 5JR1H 5TDOA 3LQAH 3SKNB 3HC3H 4PJEF 4XPAH 3EOYG 4GAYA 2WV3A 2XYCA 2NY0B 5L88H 2DQJL 3H7BB 2YEZB 1JBJA 2ICWB 2P44B 5MEND 3QEGH 3O3DB 4K3GA 4I77H 3SKJH 1WUNT 3MTRA 2CD0A 2P45B 2QV2A 5GGUB 3JWOH 1KCRL 1QSFE 4JFZH 1I8MA 3HAEG 4JKPH 4WJ5A 1U91B 5GGRY 1QHOA 1NEZB 3NBNA 1CXFA 1Q9WA 4Z7QE 1LK3L 2XQBL 2D9CA 3MLXH 1OAXH 4O4YL 3T0EB 3PWPE 3BPLB 4KPHL 4QY8B 4OD2A 1DVFA 4WEUD 4DK3A 5GISH 1J7VR 4OCXH 1Q72L 1ZHLA 3KNBA 3QDHA 3L6FB 2VQ1B 3FOMB 5DO2D 2CGRL 2NY2B 5C2BH 1ZLVH 5A3IC 5E70A 3C8KB 3HE6D 4YGVA 5D7IE 3M8OL 4EKXA 2ZUXA 1MAJA 4ZUSB 3VRJA 3IDIA 3P4OA 4EDWL 4LOUC 1CL7H 4GKZA 3VFTA 3QDJB 3K8KA 5I1CH 2Z93A 4M43H 4OGAD 5HPMA 2ZUYA 4OLWH 5LKNA 4UB0L 1C16B 4YAQB 2NW2B 1HQRB 4MNQB 3K4ZA 1FG9C 4N0CC 2GJ6D 1QEWA 1A1OA 3TIDA 3DVGA 5D1XA 3S98A 1MAMH 4ZXBA 4APQA 4Y5VC 5CEZL 3LQZB 4H0IA 4F37F 4XCCL 3BKYH 2EEBA 3EYQC 4K71B 5IB5A 1S9XA 5F7LB 1RMFH 4NQCA 1XF2A 1T20A 2RJMA 2NY0D 3A0OA 1VENA 4ZFFA 1ADQH 2YD6A 1EO8H 3L3GA 4I3SL 2PCPA 2Q6WA 4F2MB 5C3TA 3SDXB 4YBLC 5DJDA 2X5PA 2DLGA 4DN3L 1BD2B 2HVKB 3U6RB 3SDDB 2HT3D 2DM4A 4RX4D 1DN2A 3L9RB 5GS2H 2PTUA 3QWRA 6FABH 3UTTD 4P2YA 5E9DD 1A7PL 1HHHA 3UTQB 5DMYA 1F2XK 3ILPB 4YO0A 4IRJC 1T22B 4X9GA 5C07D 1ZKAA 4RMWA 5DJ8B 5F9JB 1YMMB 1QOKA 3UJTL 3C6SB 3HRZB 4WUUB 1KB5B 2RB8A 5E99H 1WBZB 4HUUB 4XNXH 2R0WL 1KXTB 1KJ3H 3L3JB 5D1QB 1ZGLP 1QBAA 2K7PA 1YYLH 4IMLB 3ZT7A 4MD4A 4GKNB 3UPAA 2BOCA 3QXAB 4OF8A 1JZ3A 2PTVA 5IEHA 1I7RA 4U6HA 1JF5A 1W72B 2AJ3B 3BZFB 3VGAC 3WUWG 4NBXB 1UKSA 1IC7L 1K3IA 1W0WA 2MKWA 4F33A 2PTTA 5IBLD 3QP3A 1RZIB 4YJZL 1NC2B 5FUCC 4KRMB 4LCUA 4EVNB 1D5MA 3D1MC 3EDJA 3VXSA 3NFSH 5GZNC 4HXBL 3CFCL 2D7TH 3NA4A 2I07A 4RISH 1HZHL 3QDGD 3MACH 4JM4H 4QRPE 1A21A 1PKQB 3WNLA 5MHSD 4DTGL 4LCWD 4KZEH 4MXVE 5EULV 4X6CA 4HLJA 3LKOB 3HCVA 5CGTA 4D0DA 1SEBA 4OFPA 4X9IA 3D2UB 5DRNB 5D6DA 4LPVA 1NAMH 1F4WH 3S36H 1TJHH 1S7QA 5JDJA 1MFAH 1FQ9C 3RVVD 3VH8B 5CBAB 2Y5EA 5FHBL 3NFNA 5EU7C 2SEBB 4BQCA 5EBWA 4QRTB 2OSLB 5JXED 5I74B 5I2IA 2Y6SC 4POZD 1ES0B 3KWWA 4ODSL 4NQSB 3SCMC 1VKXA 4H26A 4JQIL 2ED9A 5DF0A 2HRPH 4WO4B 1J0ZA 3U7YL 5DMGC 1DTUA 1MFEL 4U1SA 1W0VB 1Y6NR 1CLOH 1RIHL 1OY3B 3FONA 4FQLL 5EU4A 4FFVC 5GJTL 5LXGH 5E7BA 5DQJB 3U2SA 3QIUB 3VFOA 2YWYA 3I02A 3N1GC 5IFJA 3SHSA 4JKLA 5JW4R 4AEIL 4UUJB 1S7UA 3EGSB 4KKCC 4TSAL 1FH5L 4XGZA 2I27N 4PV9A 3X17A 3MSPA 1U3HC 3MROA 4OFYA 2DMBA 4KTEH 4W81A 1YY9D 3BZEA 1F3RB 3OPZH 1SQ2N 3BFOA 5CJOH 1FL3B 4K9EH 5D7IF 1TITA 2DS4A 4Q6IB 4XAKD 5EU6E 1XGTA 3F7RA 4XPBH 3K81A 2E8YA 1NSNL 5IMMB 4G6AD 2MFNA 1OARL 1N5AB 3V6OA 1NC4B 1RUKL 1NC2D 4P23B 1PG7W 4ORGB 1L9NA 3MCKA 2AI0H 5CSZB 4XCEB 1CICA 4HT1H 1WCQA 3FO2A 4FQHB 5K93A 5D7SH 3RIAK 5GZOC 2EDYA 3N9GH 5I1HL 4PJXE 3QXUA 5J9PA 1AE6H 3GSNB 4X7SH 4NQDB 3C09B 3H9YA 4QXWA 3E6HA 2HTKD 5D93B 3VA6A 2DKUA 1JYNA 4QXUH 3F58H 3OZ9L 4ZDHB 5CILH 3G5YA 1M05B 2F74B 4YK4C 2ZSWB 4ERSL 3HI1A 1KELH 1IL1B 4CADA 4ZNEA 3KJ6L 3GUTB 1RY7B 3GMLA 4LIQL 2Z8RA 5E2VL 3MJ8A 1F4YH 3ZE1F 5DUMH 2CXKA 4QF1A 5DVMA 2CR3A 2XKSA 3EW3B 4HH8A 3GJEA 3UCRA 2EKSA 4Q6YA 5F9OL 1QBMH 2VZUA 3LEYH 3ABZA 5DVOA 1KCLA 4Q9BA 4Y89A 1ACYH 1EX0A 4HUXA 5E00B 2VXSL 1HILB 3QQ3A 1A14L 1Z9LA 2XWJA 5JDSA 4J6RL 5T3ZH 4IHOB 1G9NL 2AXJA 3KGRA 3RWHB 1T1WB 2P5EB 3QIUD 1BZ7B 3OB0H 1P7QB 1H3TA 3TA3C 3RHWF 1R3IH 3O6MH 3L3HB 3HG1B 4JRYE 4PRDB 1BP3B 2FHFA 4PUBL 4H8WL 2OL3B 4MA8H 4LLYA 4WTZG 1HYSD 1FNEA 2XWBB 3D18A 3NABL 5HI5D 3IFNH 3K2MC 3ORJA 5MP6H 1F02I 3EYQD 3BVNB 3FB6B 1MCPL 5FGSA 5I66A 3OGOE 1MPAL 5I15L 1NC4D 4OIAA 4G8GE 5CZKA 1UADC 4IBLT 3QXDA 2DQFB 2ITDB 3MUJA 4LGPB 3LPFA 3OJVC 2I24N 2ARWA 2R2EA 3MRNA 2EH8H 1HKLH 1BIIA 4K3DL 2MNUA 3S3JA 2PETA 1AHWA 2C9AA 1UM4H 3JUZA 4LEOA 2DWDA 5AAWA 3OKDB 1WZLA 1FL5A 2VN7A 3BXNA 2F5AL 3EYUH 3QFJD 3RIFF 5I30L 3RVWC 5IB1B 2W0LA 5JOFB 1CIUA 1JHTA 1SBSL 2B1HL 5GSVB 5I19L 3D0LB 3P11H 2FJFA 4IRJD 4QHMA 4MXVF 1IEBA 1NFIA 3OX8A 4R0LA 3FQXA 4AEHH 4RFNC 3KPMB 3CX2A 1KJ2A 3FQUB 1UWGH 1J87A 3MO1A 1MCDA 5EZOL 3R1GL 3TNNB 3SDXF 2DQUL 3ESVF 5TQ2H 3VXMA 2M2DA 2R1XB 1WWBX 4CMHB 1CE6A 3V0VB 2IQ9L 2GJZB 1OT1A 1MHCB 3QQ9C 4X80L 4XNMB 4YX2L 2R1WB 3WJJA 5F7HA 4K23H 3W9DA 4D0BA 2VR5A 3Q6FB 3SDAB 1FFPB 4GRWH 3ARVA 3KLSA 2CJUH 4MA1C 4PGCB 3DJ9A 3AMKA 4Y4FC 3BE1L 4HUVB 2APXA 2P5ED 4BKLB 3FT3B 5ADPH 3FZUD 3S5LB 1YEDA 1UA6L 2VL4A 4WI9A 1EHXA 1J0KA 3IKCB 4LKXB 3VFWB 3BPOC 5GZND 4C56D 4NHUA 3CCHA 3GNMH 2MKLC 4P46C 3VXTA 3QEQA 3WKNA 3ULUH 4HAFA 4MNHA 1VEOA 2FX8L 4HIXH 3DBXA 2B0SL 1FFOB 2R69H 5IW1B 4L4TE 5GHWL 2GK0A 1LDSA 2EDKA 4NKOA 2X09A 4GRMB 4BJLA 4JY5L 4C59B 4YHNB 4L3AA 3P30H 1TJGH 1K8DB 5TDPA 5EZJB 3KPSA 3WE6A 3JWNC 3ELAT 2CRZA 3HI6L 1M7IA 5D7LB 2BSED 3P0GB 5SWSD 2R4SL 2A6KA 3LKNB 3BHBB 3CFDB 2R2BA 3VDCA 4Y5YA 4ZAKB 2JJVA 3QNYB 5D96C 2Y6SD 2WUBH 3QIBC 3ARGC 5HVWA 4XP5L 4QHKJ 3SCMD 4PJXF 3UPRA 5DRXA 3O6FA 4PJ5B 2AK1L 3CXHK 1R3LB 4ZD3L 4HWBH 5IT2H 4IS6B 2ZOLA 5IW3A 2W65B 4ONFH 3MJ9H 5I1IH 1I7ZA 2CLVB 3S3SA 1H3UA 5GJSL 2XY2A 3V4VL 5D6CB 3SE3A 1F8TL 2CLRA 3ALXA 3MYZA 4OD1H 1OGAD 5FK9A 5BZWA 2NY1C 4ZOEA 1JN6A 1U3HD 5J0BA 2XOTA 3T0VA 3BKJH 1V3KA 4RFOL 3GMOA 5IQ9B 1KIPB 3QCUL 3TLRA 4DWHA 3GJFA 1A6UH 5EBGA 5TE6L 4DGVH 1OPGH 1G7PB 2ENSA 4ODWA 3QULA 1GPOL 5JNYB 2XZQH 3RTQD 3ARDC 4EBQL 3C6LA 4G6ML 4X7EC 4ELKB 1TMCB 5HHNB 3VXUA 4CW1A 4X4XB 4MHHG 3G04B 3EO9L 1AGFA 3LKSA 5DSCB 5BV7C 2IPKB 4HBCH 5KOMC 4IM8A 1LEKA 5GZOD 3NVQA 4XVUC 3M17A 5AYQA 3UTZA 4M6AA 3NN8B 5F1NB 1R5VA 3RL2A 1YQ2A 3O3AB 3GRWH 1VGKB 5EU3B 2B4CH 3VFRB 4YPGA 1IGJA 5E5RB 5B39A 4S1RL 3ZDZF 4HIJA 1TCMA 1GOFA 2GY5A 4LLDA 3MRBA 2Z4QB 4Z7WE 4X5LA 4XWGL 3BJLA 4XXCC 1LEIA 2HT2C 2Y23A 1DBBH 3GK8L 3DGGA 3GB7A 4U6YA 5DEGA 4PJFB 1JUFB 3FO9B 4K94H 1BQLH 5IJVB 4M7ZB 3SPVB 1Q9KA 2Q20A 3UBXI 4JPWH 1N0LA 5HYQA 2X4NB 4WEBL 3DPBA 5DXWA 1N6VA 3B6SA 1X5YA 3UEZA 4DUWA 3DETC 1FG2B 3GZKA 4QHLB 4DKAA 5ANME 4E41B 4PBXA 4RGOH 4PJGE 3C5ZB 4LSUH 3MUGA 1JWSA 5IGXL 4L5FH 4N90D 3WIHH 5D5ME 1EJ6A 4HWEL 1I75A 5BVJA 1K4DB 2MMXA 5I71B 2DOCA 4J12A 1ZVSA 5T3XL 1F4AA 2VSCA 4DCQB 4G7YL 4GRLC 2IANE 4PB0H 2HLAB 2BRRH 3WL9B 4GXUM 2DJ4A 5FV2A 4AM0B 3U0PA 2VXVH 4R9HA 1WIOA 1S78C 1JGUL 3TWCL 4ZFOL 1DBKH 1G6RA 1E4XI 3BT2L 3KLDA 3W81A 4CVUA 1JK8A 3IJHA 4QTHA 2EIZA 3N50A 2YUXA 5IFHL 4HZLA 4Z7NE 1U8LA 3DTXB 4MQXC 2HRLA 3V0AC 1T5XA 1PZ5B 4HAGA 4IRSC 4JLRA 1JIBA 2VH5L 2BHZA 2YR3A 2MTPA 5ITFA 1CT8A 2IGFH 3KYAA 4AQOA 3HR5B 5E5MB 3RVTC 4XP6H 1KTRL 1V5JA 2UV3A 3L3KA 1DQLH 4WHYH 4OCRL 1EEYB 5EPMB 4PJ9C 3EDKA 5HHOD 4UINH 2VITB 2X4SA 4PPTA 1NCAL 2PW2A 3L3IB 3U9PH 3MRLB 3ARBB 1SJHB 3NCEB 4FQXA 1IGFH 4H1LA 1YEHL 4CVZA 4WFFE 5DVKA 5KSAB 3TNMB 3MMEA 3QUZB 1CI5A 1G7JA 4JFXB 3B5HA 4URTB 3SE4A 4X6DB 5CEZD 5D1ZA 1CFNA 4G9FA 2DQTH 4I48A 1QLFB 2WZPD 5A40E 3O41B 1XGUA 3PGFH 1VFOA 4Y4FD 4DW2H 4YHPA 5IM7B 3QNXB 5DMKA 5J6GA 5F8RC 2KBGA 3CLFL 3N1QC 4NCC1 1I9RH 2BVOA 1LP9A 5F44A 1EERB 1RK0B 4ZTPH 3VXQA 5T5NF 4P46D 4F3FA 2MHAA 5BO1H 3MLRL 3C5SB 1F58H 4FZEH 5ADOL 3KHQA 1B6DA 4WHTB 1AGBB 4Z18A 4NDMB 4RRPA 1JNNL 1KJVA 1TXKA 4MB3A 4U0QB 4YGAB 5AYUL 5TDOB 1OW0A 5KS9E 1QKZH 3TESA 4GAYB 4HCRA 1RUPH 3QDMD 4DGYH 1FNSL 4XPFH 5E8NA 3IT8D 4RWYH 3VJ6A 1CYGA 2YD5A 2HFFB 1IVLA 4I1NB 2M8XA 4GQ9H 4O2CB 2JIXA 3EYFB 4JDZA 4U31A 2J8OA 3K7UA 2YWZA 2DN7A 4QYOB 4M1CC 3SBWA 4P48A 4QRRE 1I8MB 3VI4E 5TH2A 4WJ5B 1T89A 5F7KC 2XPGB 3DX7B 1A7NH 3OF6D 3IFPA 3CSYA 2W0FA 3EZJB 1DVFB 1MI5A 3ARBD 3NH7H 3MLWH 1OM3H 3ULVH 1F4XL 2KQNA 4ZFZB 1BJ1J 5KSAD 1T66C 3D85A 3WKMH 5AZEH 1MF2L 3CH8A 4Z7WF 3UROR 2FB4L 4OUUA 3IDIB 3VRJB 2BVPB 5DD1L 1AO7E 4GKZB 3A6CL 1X5GA 3VFTB 4MJ5B 1N0XH 2Z93B 4MXWH 3VWKB 3FQWA 2VTFA 5HSFA 3QI9C 5HPMB 3X3FL 5ACLA 2I9TA 5K9QG 2EIBA 1BOYA 4YNYA 1QEWB 3AMLA 3ET9F 3TIDB 4MAUL 3UO1L 2IADA 4PJGF 1ORSA 1MVUA 2C3WA 3U82B 4ZXBB 4APQB 1XF1A 4XVUD 4JJ5A 3BGFC 4JN2A 1WLHA 2J4WL 5EWIL 4NGHL 4R26H 5CD5C 5IB5B 1S9XB 2PN5A 4F7EA 2WWKO 3FQRA 1XF2B 1J5OH 1TVBA 3PL6B 5DQDL 1XEDA 3IDYB 4ZFFB 1UB5A 3MRPA 4PLNC 1SHMA 3V5KA 1I1YA 4P9MH 4FNLL 2FIRT 1IAKA 3OJDA 5J1AA 3I6KA 1RUML 2Y7QB 4Z7NF 3HLAB 2VQUA 2HT2D 1C5DA 1MFDH 3FB8B 1I9JH 2DMKA 3IU4H 4DOHB 2E6QA 2A2QT 2QSVA 5J13B 1G6RL 3AY4A 4MAYC 3WDJA 3ZE0E 5CMAA 2VUOA 1KIQA 5D70L 3DI3B 1YEIH 2GK2A 2NXZB 4LPYA 5INCA 2XT1B 2XG5A 1CFTA 1HXYA 4JJHA 5C0FB 5C9JA 5L8JB 2UUDH 7FABH 3W11C 1YECH 4ETQA 3H9SE 2VDML 3QUXA 4EDXB 2BOCB 3PABB 1ZOXA 2AERT 5C0GA 1UXWB 1FAIH 3VGFA 4OD3L 1S7WB 3BW9B 4BFIA 1W0WB 4PRIA 4M61A 3P4MA 4NZUL 4Y2DC 3D39E 1I3UA 1LO4H 2GFBB 1AR1C 5F96H 3Q5TA 4EQ3A 4LCUB 1T2QL 2PR4H 3VXSB 4MQXD 5CFHA 1WEJH 2FO1A 4XMLL 3CFBA 2DQCL 5D1XD 2AXHA 1VFBA 4ZXBD 2N4IA 4Y1AE 3RDTB 1QRNA 1EUUA 4JFDE 3TGXA 3RVTD 4WWID 4X6CB 5E1AB 1ETZA 1SEBB 4NQCD 3SE9L 5K33A 3TVMB 4BK5A 1ADQA 4NZJA 5KS9F 1KCVL 1A8JH 1J1XL 4OLUL 2AQ2A 5EBWB 4HIIB 4S1SL 3BP7A 3KWWB 3EOAA 3DV6A 5D7JC 4EIGB 5BCAA 4PR5A 3E3QC 4XWOD 2LU7A 4H26B 3QWRD 4UOJA 3B9AA 5B4MC 4DGIL 4HCRL 2JCCE 3FONB 5EU4B 1FVEA 1IM9B 4ODHL 1G7LB 5KW9H 4R0LC 1FSKB 1IC5L 3VI4F 3U0WH 3VFOB 1A2YB 1NUNB 2NX5D 5F21B 1SVZA 4N5UA 4WW2A 2YD9A 4PRHE 32C2A 2XZAH 5FUOL 2EDOA 2OYPA 1MFNA 2Z91B 4XGZB 4KK5C 4PV9B 5LGKA 1G7MA 1YEGH 4ODBD 5FYJL 3RUGA 3ULSB 2HFGL 1IZJA 1M7DB 1BHGA 1DCLA 5DZOA 3BZEB 3NMEA 1MQKL 2FX7L 2A74A 4NBYB 4X98B 3TPUB 4U1KB 3OGCB 3AGVA 5EZIL 1P4BH 4R90L 2FECI 1QFWM 5EUKA 5I1AA 2Q8BH 1RZKC 1XGTB 4G6FB 3WFDL 3L95A 4G6JL 1QQDA 2RQ8A 1I3RA 2BXYA 3MCKB 4CAGA 1PJ9A 3VXSD 1AD9A 4LNVA 2G75A 3LRSB 3CDCA 3FO2B 4MJIE 4Z77A 3QA3B 5TE4H 4JFFE 3DVNB 2H32H 5DHVH 4AENA 4Y4HB 5TPWH 3MA9H 4M1CD 1N5YL 5C08A 2ZPKH 3OR7A 5MERA 1KCKA 1GZPB 3K8MA 2JB5L 3W2DL 1IEAA 1QPPA 2YPVH 5JQHC 5I1KH 2YD3A 1NAMA 3ZSSA 2OP4L 4HKXA 5J11B 3A6BL 4KJQD 4UDTA 4PRBB 3VXPB 3VG9B 2AJUH 4PY7A 4OZGA 2F8OA 4Y5YC 4QOKA 5FCSH 1MHPH 4QF1B 1CDYA 1T66D 4OFDA 2JE8A 3HC3L 4XPAL 1ZLVK 1U41A 4NKQB 5DUBB 3U9UB 3JV5A 3RL1B 3RVUC 3BPCB 4POYA 1HXMA 4LCCC 4HUXB 2FGWH 5IUSA 1XF3A 4TUJA 1U8JA 3QQ3B 5JDSB 2AXFA 3MRDA 4FRWA 4P3CH 3QEGL 4JN1H 3TT1H 3ZE0F 3C2SA 4ZS6D 3UDWA 2XN9A 4M4PA 4NO2A 5C09E 3SE3C 1RZGB 4QCIA 1X5XA 3EFDL 4PJ7F 4N0FA 4UAOB 3JWOL 5FGRA 4GAGH 5K9JH 4FQCH 1J8KA 4CVWA 4JFZL 3T0AA 5TF1H 4OFYD 5KZCB 4DJMA 1FNEB 3O9WB 2VXQH 4R96A 3TYGH 4DEPB 5BS0D 1BM3H 2DQHH 2FCBA 1YEJH 5DJ6A 4LVOB 1NLBH 1OAXL 3MLXL 5CEYB 4KVNH 3V5HB 1UCBL 5ICYA 4OI7A 2X4TA 4OZIE 4K2UH 3U46B 4OCXL 2BP3A 3CZFB 3MV11 1P84K 3MUZ1 1D6EA 5IB4A 1CICD 3P4NA 1LNUA 2R2EB 3TIEA 1BIIB 1JFQL 2P5WA 5MENE 1HSAB 2DWDB 4GMTL 1FL5B 3ARUA 1DDHA 1GHFH 5CUSH 1KYOK 1G9MC 3D48R 3L7EA 1T21A 5IKCA 4OT1L 4OLWL 4MAYD 2GITA 4YIQB 4QHMB 4OZFH 1IEBB 3WLBA 4ZFOB 3S4SB 4ZS7L 4LVEA 3UTPD 3S35X 3B9VA 1EPFA 4HJGA 3RIAF 4HFWB 1CF8H 2MOVA 3FHAA 3VXMB 1DFBH 1BQUA 4PJBE 4PREA 1X6NA 1CE6B 1RMFL 4HPYH 3QZWA 2F58H 4YEFA 1X5LA 1U8PB 4D0BB 1YNLH 1UWXK 3TBWB 4GXUN 3LEXB 2FO4A 4LSQH 1YQVH 3GMMB 4NJAL 3EYOA 2B2XH 1ZTXL 1YEDB 1E28A 4FA8A 1EAJA 4NC2B 4S2SA 3PDGA 2NNAA 5A1AA 1CCZA 4I4WB 1MEXH 4ONOA 4LKCB 4ZTOH 4BFEA 4UDUA 1BFVH 4UV4H 2AV7A 3CLEH 1UACL 2CUIA 4TUOA 4KZDH 4N0UB 3RY5A 2E7LA 4S11A 1J0IA 3BDYH 1FO0H 4PV8A 2Z8VC 3EOTL 3QDAA 2AQ1A 3KPSB 4JRXA 4P2RA 4OUOA 1UZ6E 1M7IB 2A6KB 2B5IC 1DUYB 2CKBB 2R2BB 4KI1A 1FIGH 1AD0A 3WNPA 1Y6MR 4EZMA 3MLZH 1SYSB 4JGJA 2HFTA 4OIBA 1FGNH 5F7FA 2J6EH 4L3EA 3KLHD 2A6DA 5JXAH 4JZJC 3B9KB 2YN3A 3FAWA 3P9MB 1JZ8A 5KSBA 1K8IA 3UPRB 2I25N 3O6FB 1F45A 1OP5H 4KK8D 3KPPA 2FWOA 1SM3L 3UTTE 1P5UA 5E9DE 2F8VA 5HHQA 4XNZC 1I7ZB 2R1YB 4M1GL 4AG4L 1LE9A 4JDTH 2CLRB 3B3IB 3BIKA 5C07E 5IESL 5FK9B 4KK5D 4W6XB 1KFAH 2PXYB 1FNGA 1XT5A 4G80A 4XAWH 5IG7A 5C0AA 1RAMA 4PJ8A 4N8CL 5F7EL 4U1IA 3F5WA 1PYWA 1JRHL 5SX4I 1I4FA 4NZTH 1NAML 3S36L 4ODWB 5IB2A 5GGSB 5F6IB 3QJFA 4YHZH 5HDLA 3C6LB 1T0NA 3DX9A 1XGRA 4HC1L 5E4EB 5SWZA 5E2TH 3T08A 4LSDA 3CAFA 3NIGF 3O8XA 2O5ZL 3QIWC 3OTTA 1NGQH 9CGTA 1AGFB 2VE6B 3QEQD 3JVGC 2DI8A 1DLFH 2XZCH 1V3JA 3AREC 3QPXL 3UTZB 2LTQB 3L1OL 2D9QB 3RL2B 5IW6A 3QDGE 2VZ3A 5LXGL 4KTDL 1RI8A 5MHSE 4TTDD 1RZJL 4LCWE 1IGJB 3U30B 1H3PL 5ESVA 4BQ6A 2FYYB 3AVEA 5B39B 1OTUD 3KPSD 4PG9B 1KNOB 4HIJB 1J0YA 2ZUWA 2DBLH 4OZIF 1PX3A 4LLDB 1D9KA 2VLRD 1DQDH 2KH2B 2V2TB 4U6YB 3DGGB 1JI1A 2A73B 1WVZA 5F7YC 3BSZL 5CJOL 1BJMA 3HZVB 5HYQB 5H94B 5ENWA 4LSSL 3O6FD 3UZEA 5C6PB 3LKQA 3TP4A 4MYWB 1J11A 3DX6B 3MJ9A 5C0BA 1KV3A 3GFUA 2K1MA 1BWWA 3TZVB 1JWSB 2GTWA 2W59A 3N9GL 1HSBA 3FB5A 5LGJB 4AIXA 2G60H 3I2CH 1XR9B 2NY5L 1GIGH 3L5XH 1RU9H 2VZ1A 4FQ1H 4NSKA 1QR1A 3WEXA 4OCNC 5BW7A 1JF6A 3L5WB 4PLOB 5FDYA 4ZO6A 3K46A 2VDPH 4XP1H 5DRZA 3T3PE 4UI2A 3U0PB 1KELL 4M6OH 2PYEA 4CMMA 1G6RB 4WUKL 2BY3A 1JK8B 2BSSA 2D03H 5CHNA 2M1KA 1LEGB 1U8OB 3IJHB 4O9HH 5KG9A 5CJXA 3UC0L 4NKMA 3PIQB 5C0CB 1U8LB 3ZL4H 3DSNA 1R24A 3VXUD 4XAKE 5H8DA 4NN5C 1T5XB 3QCTH 3VXOA 5DR5H 4HH9B 3BQUA 4RIRB 5ITFB 1ZXQA 3LEYL 3WO4B 3T2NL 3AXLA 1XF4A 1FFQA 5EO1A 5IJKC 4AEEA 4DVRL 4L8BA 2ZG2A 3L3KB 1NGWA 5KTEL 2CUMA 3MBXH 1ZT1B 4UU9A 5E5UB 2WWMD 3CC5B 1R3IL 5FYLL 2EEDA 3D25A 1KJMA 1WICA 2F54B 1BWMA 1URLA 2PW2B 3SO3B 1MCWW 1GC1L 3UZVB 4JFPA 4I2XE 4FQXB 4HUMB 2BNUB 4H1LB 4CVZB 1UZ6F 3H3PH 1LK2A 3IFNL 5I1DA 4AL8L 1X5HA 1ZT7B 1F5WA 3DO3A 2P8PA 3ESUF 5JW4N 2D7PA 1T03H 3RGVA 4I48B 1A3RH 1W72H 1XGUB 4GBXB 1SEQH 3D6GA 2A6IB 3B5GA 1MIMH 3WIHA 5DMKB 2VDKH 1S8DB 1UM4L 3QUXC 5F88A 1LP9B 3MOAL 3MZTA 3QPQC 4JM2C 1MQ8A 1RUQL 1LILA 1YJDC 2X9XA 1LO5A 3RX7A 3PGDA 2BNRB 4G5ZH 1KPRA 1YC8A 5IV2A 4OJFH 1YEKL 5IVNA 3P11L 2XKUA 1PG7L 3LD8C 4WTWA 4XBEL 1KJVB 1X4YA 3OHXA 4LASL 4RCAA 5L7XL 3KS0J 4Y19A 1GGIL 4DKEL 1CG9A 1UWGL 1I9IL 4Q97A 4GUPB 3U36B 2ZNWA 1EFXB 2X1WL 1UJ3A 4HIHB 3VJ6B 4LF3B 1H15B 3FB7B 3LMJL 3BN9C 1F3JA 2I60L 3NZ8A 3VFSA 4BUGA 2PO6A 2RBLA 4ELMA 5DD0H 4GXVL 3EDFA 5AEAA 5TH2B 4NN7C 3OJ2C 4IMKA 5FCUH 5ADPL 4G7VL 1PEZA 4WU7A 4CJ1A 3QFJE 1H5BC 4ZO8A 4L9LA 1NMBH 4JREC 1PW3A 3A6OA 1BFOA 3CSYB 4WCYH 2KKQA 4ODTH 4FQXD 2YC1B 1FZJA 4HIXL 2EDWA 1BGXH 3VDAA 5C92A 2ADIA 1TVDA 3UBXA 5C9KA 3O4LA 1NUDA 2R9HC 3TYFA 4YBQC 3U4BH 2IAMA 4HXAH 4H25A 3AB0B 3HI5L 3QUML 1FZKB 5D1ZD 4G9FD 4NT6A 4JG0H 2DQEL 3SKMB 5I17B 3HUJF 4LU5H 1DQJA 2H1PH 3U48A 2QQNH 1KPVA 4PJHE 2I9TB 4P0DA 5A16A 3QHTC 4ONGH 4M93B 2P5EE 5GRYA 2WUBL 4RRPG 1Q8MA 3FT4A 4YR6B 3EDDA 2KDGA 4PRPA 5CJ5A 1L6XA 2FX9H 3MBEA 4JJ5B 3IDGA 4C56E 5FKPA 2BERA 3GSNH 5AZ2H 5LWYH 5IVXA 3VFGL 1TQCC 2R0LH 1IRAY 4LQFH 3K3QA 4F7EB 5I1IL 3MJGX 2V9RA 4K7PL 5SV4A 4GS7B 5FA3A 3FQRB 4BQ9A 3CU7A 1TVBB 2YHGA 3T3PF 4OIIH 1UB5B 4UNUA 3MRPB 3ARZA 3V5KB 4TUKH 5DEFA 2DLTA 3S37L 4Q2ZA 4X4MA 4LVNB 1QSEA 1IAKB 3OJDB 4UTAH 3BKJL 5J1AB 3QUKB 3RWEB 1J0JA 1ZS8A 1U92A 5BRZA 4TVPH 2JIXD 3VFNA 4YK4B 5B38A 1C5DB 3BESR 5SWSE 2DLHA 4NRXA 2BCKA 4U4BA 5EU7E 1ZHNA 3HMXL 3CK0L 1Q9LB 3B2UD 3RNKB 4XCFL 1KENL 2QADC 1F11A 1QSVA 3C5JB 3GEWB 3WV0A 5FM8A 3E6FB 4OF3A 1HXYB 1CLZH 4F9LC 5C9JB 1FN4A 1W8NA 1MI5D 4HBCL 5CGMA 4LMQI 1LO0L 4X7DC 5C0EB 4M6NH 1ED3B 5ITBH 5ABDE 1PZUB 1JPGA 2P48B 4LRNH 4UOW0 3VI3E 4TSCH 3ROOB 4F9PC 2OL3H 3D85D 3JZ7A 1OGAE 2B4CL 2B1AH 3HPLA 4K7FA 5C0GB 3TA3B 4H20L 2JJTA 2XTJB 1AR2A 25C8L 5DJXA 3LSOA 4S1DC 1TZGH 2J8UB 2XFXB 4PRIB 4XC3H 3ZKNC 5E6IC 5T1KA 1JMZA 1TLKA 4Z7UA 3UDWC 4PGEA 1S5HA 4NQVA 2YRPA 5FYKD 3P9LA 3FFCB 1WAAF 4OCSL 3JTSA 1UXSA 5JIPA 2WLYA 4KHXH 3WCYA 4HKZB 1QRNB 4YDIH 3SY0A 2IG2H 3C60C 5DJCA 4K9EC 1BZ9B 4B0MM 5IHUH 3SKOA 1ETZB 4RGOL 1CQYA 4KTYA 5KOVC 3WIHL 4K3HA 2O93L 1DQML 1VGEL 2CO6B 2Z0BA 4BH8A 2EH7H 1BMGA 5HYEA 3FN3A 3VFMA 2X1OA 1ZSDB 3DHMA 3CSPA 2Y36H 3BP7B 3DV6B 5EO0A 2AEQL 2VXVL 4PR5B 1JZ2A 1DBKL 1I8IA 4XXDB 1A5FH 5HI3D 4RMSA 1FVEB 1C7SA 1EXUA 2GUOA 2VISB 3PWVA 4D2NA 1KEGH 4KY1H 3S34H 3GMNA 4P9HC 4RDQG 1IQWH 2ADGA 3KJ4C 3R06A 3QUXD 1G7MB 2NY3C 3N85L 4JM2D 4N90E 4NM4H 3BJ91 1KN4L 5TQ0H 3JV6A 3MNWA 4HF5H 3CFIC 1Y0LB 4DFHA 4NNPH 4JG1L 4LCIL 1FAKT 5JO5A 2NR6D 2CQVA 2XTJD 1DBJL 1T4KA 3V8OA 1A9BB 1PVHA 3BPOB 5EUKB 5I1AB 3F7YA 1NPUA 4PRID 1WFNA 1QQDB 1UENA 1HI6A 4ACPA 1N59A 5GQBA 3H42H 5E6YA 1U3JA 1X5ZA 4Z77B 4M8VA 1CXKA 1OAUL 4LGSB 2HLFC 3MR9A 3CJJA 4F80A 1BBDH 4OCMC 4AENB 1NL0L 1JYXA 2P8MB 2Z31A 3IF1A 3OR7B 5F1IA 4DW2L 1MFBH 1TENA 4NFDA 5EB9A 2VDQH 3B2VL 1E4WH 1J8HE 1WZKA 1T2JA 4JO3L 5HYSG 4UMGA 1J1OH 2Q7YB 1NAMB 4HKXB 3TM6A 4UDTB 3QIBB 5M7QA 5HHOE 4WENB 5IMOA 3PWUB 1T0MB 3I6GA 1KTLB 5D2NA 1B88A 3ZDYE 1ZGLA 5ACZB 1RZKL 4OZGB 1T2XA 2Z92A 3MNVA 4QOKB 2EDQA 2VIRB 1NMAL 4G3YL 1EMTL 1AQDA 3QQNA 2DMCA 2K3TA 3QUYB 5GS2D 1E4XL 4HGMA 1ZE3C 2R9HD 2FDBP 4WRLA 1BJ8A 3CDGA 4JQVA 5KN5B 3PP3H 1RUPL 4DGYL 1KCRH 3TFKC 4TUJB 2EDLA 4YDLB 4XPFL 4YHYB 3IDXH 4RWYL 3CU1A 2VLKD 3MRDB 4NJ9H 3SE8L 2FGZA