2P5EE

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE02
4KI1A 4XNYH 2NLJA 5ESVB 1QHOA 8FABA 3GMLA 2DM4A 1REIA 5ADPH 2AK4D 4PRAA 2C3VB 1DQLH 2WSKA 5ANMB 2Q8BL 5E2VL 1FAIL 4URTB 4Z95H 1KB5H 3CLFH 1FG2B 2QSCH 1ERNA 4KKBD 1F42A 2ICCA 3MGTB 2ADGB 1D5ZB 2Z8WC 4QXTB 1TJIH 5IVZA 3RVWC 2HYMA 4OLZL 5DS8B 1VEMA 5DEFA 1GXEA 4UBDD 2ICWJ 3HE6C 1FVCA 2Y23A 5IVOA 5TE4L 2D9CA 2OR9L 3CVIH 3TZVD 5FIEA 3QDMA 3QG7L 2VH5H 4YDLB 1JPSH 1Q9OB 3EFFB 3W9EB 3MNZB 2V2WA 1FH5H 4K7FB 3I9GL 4Y5XB 3LN4A 1H5BC 4D0CB 3RNKB 3ROLB 3NA9L 5TDNB 4OI8A 5LGKA 4Y4HA 3FFDB 4CVXA 1Z6JT 3I75B 4L3AA 2ED8A 5LXGH 3NN8B 2YRZA 3DX8B 5DJ2A 4XNMB 1KACB 4LCYB 1FHGA 4UT7L 3ZE2E 3ULUE 3EJZD 4Q9RH 1RSFA 1V3JA 3J8F7 3O3AA 2HWZL 3MJ7B 4JFOB 32C2B 4MD0A 3FTGB 2XN9A 1A7QL 2H26B 4HW6A 4LEOB 1IGJB 1C12B 1Q9WA 1HQ4A 1UQSB 1DEEA 3O9WB 4NKMA 4XCYA 4XH2B 1EAJA 4AZ8A 1JPFA 2VERN 4X6FA 1QSFB 3OPZH 3NZHH 1ZLUH 3F7QA 1K3IA 1NMAL 2NX5E 3B2UD 7FABH 3MUJA 2DLFL 5DD0H 3DVFA 3N85L 2XWJB 5C6TH 1Z5LB 5IVNA 1IAKA 2CO6B 2H6PA 2B1AH 3GRWA 2BP3A 4IRZL 2CJUL 4XPHH 3O4LB 4XXCC 4P5MA 1EFXA 4TULL 3BGFC 4EXPX 2QQKH 5FECB 5LBSH 3FRUB 5EDXA 1FL3A 5CP3A 4I2XA 4YXKH 3O45A 1N5YL 2BRRH 1FVDA 4JFPB 3NFNA 2BVQA 3MR9A 4JY5H 3R0NA 3KR3H 1A0QL 1OTTD 2EZ0C 3BUYA 1YQ2A 1OCWH 4CVZB 5HGAB 2KBGA 4GW5A 4P3WA 4YUEH 5CS7A 1EJ6A 4F7TB 5E6YA 5IWLA 4WHTA 1B0GA 4MB4A 5IIEA 3IYLW 1NC2B 4KI5E 5A3ID 1DE4A 3GNMH 4ZFFA 1X5ZA 3LEYH 4CNIB 2YKLL 3W11D 5FOBA 1T04B 3QDMD 5I76A 1DQDH 4HK0B 4MDIA 3TBTA 2X42A 1WC7A 3B2VL 3ZYIA 4MX7B 3GI8H 4WW2C 4PJGB 9CGTA 1DBAH 3FZUC 4HPYL 5ID1A 1IRAY 3RWEB 2WP3O 3VXSB 4C4KO 3DBXB 5CEXA 1NKRA 3GSQA 2D7TH 4Y4HD 1ZTXL 2APFA 1K4DA 4DN4L 1MHCA 2HRPH 1MVUB 1QPXA 2EDDA 4M7ZB 4NQEA 3RQ3A 4PLKC 4Q6YA 5EZLA 5F7DA 2PO6A 1AD9B 2WBJB 3GSUA 4P99A 3LRSB 4NFBA 2XN9D 5B3JF 2J8UA 2F74A 3ME0A 1ETZA 3H9SE 2QR0B 2IBZY 4ZUTB 4BA8A 3S5LA 3L7EA 5EO0B 1OSZA 4OZGA 2YC1A 5AD0B 2WINA 1FO0A 3RVVD 4OZ4B 2HTLD 4OI7A 2ITCB 4P2QB 1ZWIA 3R4DA 1CE1L 1NGZB 1U8QA 2HT4C 1CT8B 1OAXH 5F7FA 1V3KA 1H15B 3B9EA 1JI2A 3M1BB 1CXLA 4N90E 5JQ6L 1UJ3C 5BMFL 4XP6L 1HHHA 2EEAA 1IQWL 3MBXH 2HTKD 4MNHB 4GKSA 4RA3A 3E6FB 2ARWA 1Y18A 3CH1A 5C09E 1H3UA 5C0CB 1EFXD 2VZOA 3MMEB 4KRPD 3GMMA 1NSNL 4NHUA 1RUAH 2YD6A 4NHCH 4OD2B 4OQTA 1GYAA 1CFQA 4OCWH 4QTIL 3MZTA 3SKMA 1IGTB 4KTDH 2VWEE 1S78D 3BOVA 1ZHNA 2FO4B 5IFAH 5ICZA 4HKBA 4V1DB 1JYXA 3S88H 3RZCB 3S36X 3I3EA 4N0UE 3HFML 1HXMA 5GS2D 1INQB 5K33A 1UWXK 2NX5B 5DI8A 3UYPA 5L7XL 4YBQC 3HB3C 2Y07L 3S35X 1I9RL 1OAZL 3BYYA 4U6TA 4LPCA 5ERWB 3WUWB 5BW7C 1KELH 3WJLC 2EYSB 4EI5A 1PYWA 2YXFA 3LMJL 1XGQA 5FGBC 3TH2T 4L8DB 3ZT6A 4WEBH 4RSVA 3HPJB 1J0HA 4K8RL 4G7VH 5HYJE 2Q76A 4RMWA 4AM0B 3UTSA 5C7XL 3WNPA 5DQJA 1WBYB 3QBTB 4NQED 1H5BA 3PGFH 3TIDB 3MV7B 3SPVB 2PO6D 5BCAA 2WIIB 3UPRA 2ENSA 1MY7A 3VFTA 5IB1B 4FZ8H 2DM2A 4LLMA 2D7OA 1A3RL 2AK1H 4RGMC 4FFZL 2JB5L 2NZ9D 3AVEA 3BWUC 3QH3B 2J6EL 4GMTH 4OKVB 4X9FA 1EO8L 2KPNA 5DK2A 5I18L 1GOFA 4EIZC 3EO1A 1A22B 4PPTA 4OAWB 4JY6B 1I8LA 3QT2A 4QT5A 3K2MC 1KN4L 3DGGA 5D96C 1ZV5A 3H7BA 3HZKA 5J06A 2N56A 4O2CB 5I1KH 4L29A 4H1LB 3O3BA 2AV7A 4OBSA 5HHQB 3EGSA 2A83A 4I13B 2FJHB 5GGTL 3V0VA 1CZ8H 4PJ9C 5H8DA 2V7NA 4O5LL 2YPVH 1G9NL 4NCC2 4FXGA 1KTRL 1E4XL 5B21A 5BVPL 2YMXL 5DJAA 4PLJC 1FNHA 2I60L 5I6XC 2ID5A 3TO2B 3TBVB 4PYGA 1MUJA 4M6NH 4H20L 5CGYD 4HD9A 3CSYB 3OJDB 4L4TB 5E03A 4DTGH 5E6ID 3BGMB 1GPOL 5I2IB 1CF8H 1CYGA 1QRKA 5A16B 5J6HB 4BSVA 4U1JB 3AXLB 5DRZB 4GRWH 3HI1B 3MLUH 3FB7B 1BREA 1YEFH 3UC0H 2F15A 1HILA 4Y16B 5EC1A 2EDWA 4X6CF 1F8TL 3NAAH 4K3JL 3RVWD 4DWHA 3V6BR 5TF1H 1FSKC 1X6LA 4OFDA 1ZA3B 4EI5D 1MHHB 3L3JB 3TBYB 4YR6A 1CDHA 1NFIA 4LCUB 1X5GA 3PWLA 4M7LL 4EBQH 5JXEC 3CMGA 3ARXA 3UTSD 3LQZA 4FQCH 2VDOH 2CK2A 5HHXH 4HUXB 5FCUL 3X12B 1VFBB 1WFTA 2PTUA 4A6YB 3OKMB 4RIRB 1I3VA 2R1YA 2X41A 2I9LA 1F6FB 1C1EH 1KXVC 1MAJA 1I1YA 3TBSB 3VGAC 1KCVH 4MXWL 1NCWL 4XPGL 4ZS6D 1KEGH 4HX1B 4RMQA 5GRUH 1FLTX 3LB6C 3IAGC 1OGTA 1Q0YL 1RV6X 4Z7VA 3EYUL 4XP4H 5FOJA 1YEGL 2VXUH 3H9SA 2VDLH 4OCMC 3VFNB 3MRFB 5E8DL 3ULUL 2XI9A 5F7MC 1YDPA 2RR3A 2Z91B 1GGBH 5EU4A 3BPNB 4PP2A 5D2LF 1MCSA 3QIUB 4RGND 4KVNH 5JPNB 1CG9B 4PB0L 2BNUB 1OM3H 1WZMA 3E1F1 3KPNB 3KYMA 2P5EE 1UT9A 1IMHC 1M7XA 1VEPA 4PLOB 6FABH 2W9EH 2VITB 5DTFA 1WF5A 1RZ8B 2YSSA 2UVEA 1VDGA 4GFTB 1T20B 2MNUA 1URLA 4ONFL 5F1NB 3BDYH 3I6KB 3PHOB 3BKJH 2K7PA 1CFNA 3EYSL 5K93A 2PNDA 4JPVL 2X4RA 3TESA 5CSGA 3FB6B 1AIFB 5F6IC 3H0TA 2VE6A 3ALXA 3NCMA 4N8VB 4N0UA 3GM0A 1UWEH 1F3JA 4KI5D 1MPAH 1UFUA 2MCG1 2VLLA 5IG7B 5GRWA 4BQBA 1CLZH 4K9EC 3QUZB 1I8MA 4Z78B 1JYNA 1SY6L 4PJHB 4R9HA 5TDOA 3WJLA 5M95B 4NZUL 1JGVH 3EHBD 2YA2A 4Z77A 2FCBA 4X6CE 1F6AB 2LU7A 4OFYA 1QEWA 5DUBA 1BFOB 4LBEA 5C9KA 4NNPH 1VFOA 5SWQB 3UXFA 5FUZH 1RZKH 5HYJA 4FXLA 3MA7B 4LDEB 4XAKD 2EDYA 5FHAH 3IXTB 4Z18A 4PLKD 2NW2B 1CVRA 5BZWA 3WHE0 4F7CB 2NY5H 4EEEA 1TVHA 3MNVB 4BH8A 1EZVY 3CDYA 1T3FB 2ZUUA 2FDBP 1NGPH 4I0CC 1MAML 4PJFF 3VD9A 3FB5B 3H9SD 3WNLA 4LSVH 4OBRA 1NAMB 4LQ1A 3MV8E 5T3XD 2G5BB 3QQ9C 5F1SA 4XBEL 2R0LH 4I8DA 3DX9B 4WW1B 2YEZA 3IU4L 3QDGB 3X14A 3VMPA 1XIWA 4DK6A 4OFVA 4QXGH 1AGBA 1N59A 3IU3A 4M43L 2YN3A 4JDZA 2CDFA 2A6DB 4NJ9L 4N90D 4QRTA 4PJ9A 3W39B 2AERT 4HXAL 1RHHB 1JWUA 1U3HC 1HEZA 4JFQB 4FQJH 3ECBB 1GZQB 2GAZB 2AP2A 3MCLL 1BGXL 1A5FH 1NBQA 4KJPC 1FFNB 1V7NH 4PY8I 5D2LE 3HAEG 3RDTB 3IRPX 2A73B 3PL6C 4E5XA 2NY3C 1J05B 4P3CL 1D5BB 2OSLA 4X7CC 3V6OE 1CIDA 2F54B 5IHUL 5CP3H 3NZ8B 3RVUC 4PLNC 3G08B 1KB5B 1KLGA 3VGFA 2ZG3A 4NM8L 1SEQL 2MTPA 1UH4A 1JGDA 4U1IB 1NDMA 1D6VL 1GC1C 4U05A 4A6YL 1D5XA 1PBYA 1TNNA 4H5SA 1IGIL 3PP4L 5GGSY 4NBZB 1V5JA 1INDL 1UH2A 3IS0X 3VW3H 4ZFZA 1TPXB 2WK2A 4LHUA 4OFYD 4PGCA 5SV4A 3WJJC 5HPMA 2HFGL 4Z0XA 5LAXB 3GMOA 5DVMA 1JPGB 5JXEA 3E6HA 2ZPKL 4QYOA 1AGCA 1ES0A 4Q74A 1QD0A 3L5IA 5HYJD 3C09C 3RFZC 3HS0B 4UV7L 3BN9D 3SJVE 4HKZA 3QCUH 2LAAA 3NABH 3MRMB 4WI9A 5EZJB 4PRDB 1CFBA 4X4YA 2EDLA 5JW5B 3GSVA 4LMQE 2Y9RT 1C16B 4XNXH 4PRNA 5AG9A 2WZPD 2R2BB 1EHLL 1F3RB 4CW1A 2F53A 3EOAB 4K3DH 5TDPA 2Y6SC 1OP3K 5DEGB 2OQJA 3OR6A 3RTQC 1TTGA 5IQ9B 4O9HL 4X6CB 1XIWD 1AY1L 2P1YA 2VXQL 3VE0A 4HEPG 3D0LB 4BH7B 5KN5A 1IC7H 4UOW1 3X11A 1DBBL 4PJ9D 5B22A 2R2EA 5EN2A 4OZFA 4BELD 5D1ZC 4ODWA 4X0KA 3U30B 4YWGL 5DLML 4PJFE 3LS5H 4NC1E 2X70B 2XG4A 5J4MA 5BS0A 1T5XB 1ZHLA 1NMCC 4TNVF 1KG0A 1MRCL 2R1WB 3MYJB 2HG5A 5BO1L 2AS5M 2ZG1A 3SHSA 2W60B 3GK8H 5FKAA 2KZWA 4PBWD 1OGAE 4HXBH 4OF6A 2HKFH 3MV8B 2VISA 1PKQA 3PF2A 1NCBL 3BP6B 1MOEA 1QO3A 4LLQB 1ADQA 5DO2C 4NQXB 1CLYH 3VXMB 1X5HA 4HUWB 4W4NA 2VDQH 1WSST 4GAYB 3K4DA 1SVCP 3JV5A 1OB1A 1BQUA 5FYJH 1UWXH 4LLDA 1NDGA 2IFFH 2VSDA 3LKQA 4JRXA 1T66C 5HDBE 4MJ5B 4MA8H 2EIDA 4LHUD 3FQNA 4PY7B 2CK0H 4X8JB 4F15C 3CDGA 1CGXA 1IM3A 1DQTA 1P2CB 3ZT7A 5JXED 1JTTA 4JLRB 4EIGB 4HLZH 1G7JA 5D2LB 4LSTH 3WLBA 4LEXL 1EGJL 3QUMB 4JHZA 5CSZA 1NAML 4OLWL 3P0YH 3QXAA 2EDJA 3MRLA 3U6RB 4NRZB 4EKXA 1JGLL 4L4VB 5IK3A 3SDCC 4ZAKA 3F12B 3EO9H 3OHXB 1R3LA 2I07B 4AH2B 1Z9MA 2BFVL 2F53D 3BP7B 4OUUB 5J9PA 5GGQH 1XF4A 4LCCC 4Y8AA 3JWDL 4N68A 1EAPA 1HN1A 1OARL 1TJGL 4RMRA 4NQSA 3MNWA 4JDTH 4PB9L 1G6VK 1PAMA 3QG6B 5JXAL 2XY1A 4JFXA 2GJZA 3EUUA 5ADOL 3DVNB 3WFCH 3MACH 3PP3K 3QFJA 2WANA 4LVNB 4PJCF 3MLYH 4XRCB 1MLCB 4OGZA 4Y1AB 3PWJB 5IW6A 3KPOA 3TT3L 3QQ3A 1WUNT 5BS0D 3ARFB 1HH6B 5IBLD 4KRNA 1FC1A 3SCMB 3BMWA 1FL6A 1DQLL 1FZMB 1W0VA 2C5DC 5E1AA 5CZXC 4DGIH 4IRSB 5CINH 5LVEA 5I1GL 3MRKB 4OZIE 2HVKB 4Z95L 1KB5L 5HHOB 1K8DB 5DMGD 4QF1B 4F2MB 1MJ7H 4F33B 2ZUXA 3KPPA 1GGTA 3KXFE 3C6LA 2DD8H 1TJIL 3L3GB 3S36H 4WI4A 1CGWA 4WJ5B 3QPQD 1DANT 3PL6A 4JB9H 5GIRA 43CAB 2FATL 3BQUC 3V6OA 4DGVL 3CVIL 4JRXD 3T0EE 1BBDH 1JPSL 4NNXB 4GS7B 1NAKH 5DRWB 2OJZL 1ZT7B 1FH5L 1QSEA 3UJIH 3MLRH 2EIZB 3MROB 4MD5A 1R5WA 4NBXB 3BVNB 4M5ZH 2NY1B 4R0LA 3DUUB 5LXGL 4L3EB 1KCUH 3RJDA 4NCC1 5J12B 4JKPH 5EU5B 3JTSB 4D0DA 1OOAA 4IRJC 2XA3A 3SJVA 1JHLL 4ZAKD 4EXKA 4HV8A 1FNFA 1M71B 2VZSA 1TQCB 3INUL 3UTPE 4I0PB 3D2UB 1LEGB 3OPZL 4S2SB 2QADC 5AG8A 1N3NB 2FH6A 2C4FT 5DUML 2ZOLB 1RUKH 4G42A 2D31A 3IF1B 3QFJD 1XCTB 5C6TL 4Y5YB 1KCSL 2X4TB 3PWPA 1BAFH 2P45B 4L9LC 2X4SB 3RTQA 4ORZC 3FO2B 3TO4C 1ZSDA 2B1AL 1QFOA 4L3CB 3WDJA 4XPHL 1S9XA 5J1AB 1S9VB 2A6KA 2QQKL 3BIBX 4GRLB 1XEDA 1G84A 4NKOB 1YNKH 4L8CA 1G7IB 1IEAA 4OB5H 1B0RB 3HE7B 5T3XH 4YXKL 4HFWA 3VFOA 1QFUH 1Q94A 2MKLC 5CP7A 2EKJA 3TFKD 5JW3H 2F58H 1KTLA 1OCWL 3C6LD 5CEZH 3MRHB 4OM0H 4PJCE 4KJPD 5C1MB 3KLHD 4U1HA 3T3PF 4HIHB 1CBVH 3IFPB 1OGAA 3PL6D 5FKPA 3LPGA 5D72L 2NY3D 1KENL 4K71B 3LEYL 2CR3A 3VWKC 5T1KB 4OIAA 4GRWB 1DQDL 1F11A 3RGVB 3U1SH 3QUML 3JWNC 3GI8L 3OKDB 1HI6B 4XVSH 4AEFA 3MOQA 1XF2A 1QSED 2XKNB 3GHBH 1DVFB 3NCJH 1T5WA 2W9DH 5DMKA 4HWZB 2V17L 1WVZA 2Q3ZA 1LEIB 3DURA 5ISZA 2HRPL 2P48B 5D70L 3DUSB 4ZTOL 4MVBC 5FDYA 1W72L 4YIQB 2OMBA 2O5ZH 3BIKA 3GGWB 5HDQH 3RWDA 5CMAA 3SJVD 5KVGH 2W0FB 3STZA 1T4KA 3OBAA 1IBGH 1CU4H 3L5XL 4M02A 3HC3H 1SVZA 3DMMB 1I9EA 4LLWA 1M7DB 4JVUA 2Q1EA 4MSWB 4EUPG 3SDCA 1RZJL 3G5XB 4G8FB 4ELMA 4ERSH 3REWB 4CN4A 3RPKA 1J18A 2HH0H 3MRPB 4ZUVA 4Z76A 4XPTH 3BXNB 1DBJH 1FCCA 4LCCA 3PWPD 1S7VA 3RTQD 1GZPA 2X4OA 2VC2H 1S8DB 3MBXL 1VGEH 5J13B 1UWGL 3P2TA 3HLAB 5E08H 2VLKE 5DRNA 1UACL 1QP1A 2DMCA 1FNSL 1RIHH 3OZ9H 1RK0B 4HUMB 4NHCL 1EHNA 4O2EA 3IFNH 4MHHG 4HAFA 3D85A 2P8LB 3V6ZA 5MP6L 2R15A 1E6OL 1J5OH 5B38A 3SE4C 3AS3A 5FO8A 5IFAL 4P4RB 3RVTC 2HVJB 2EDRA 2BHZA 3KJ6L 3IDJB 5I1DB 4OZIA 1XGRA 1I3UA 1ED3B 3TNNA 4OV5B 1XGTA 3UBXA 1OGAD 2KH2B 2J5LC 5CD5C 5DYOB 3X3FH 2AJZA 1UM6H 4NNYB 4JHAL 3L9RB 5DC9B 5T1LA 1KELL 1QACA 4Y8DC 5DO2D 4U7MA 4C56B 3HUJB 3T3MF 1OF2B 2QLVB 1ZLWK 1JZ6A 4OGYH 6CGTA 1ODAA 3GMLB 2P24B 3RY6C 3T3PE 4P4KA 4Y4KC 5EBMA 5HDOA 4G7VL 4DCQA 5GS1A 4P2OC 2OZ4L 2BZDA 4JFFE 5MERB 4DUXA 4P46A 5JO5A 3WUZA 2NXZC 2YD3A 4FNLL 3ARGA 1WAAF 3ALPA 4PJCB 5C2UB 1AQDA 3ZHLA 4NN5C 4WO4C 3CFDA 2ZCLH 2D7NA 4CDGC 5EO9B 3HMWH 4GMTL 4TVPE 3BKCH 4LPXA 1VPOH 1FVCB 3DVIA 1NUDA 1DQJB 3CZJA 5C0RH 1P6FA 1T2QH 4QOKE 2ZCKH 3BPOC 4RX4D 1EV2E 1BP3B 1NJ9A 2Z92A 3MLTA 4PTTB 2V2WB 2DQIH 1EEZB 3T0XA 3OX8A 1T03H 1D5IH 4OCXL 4UUJB 3RIAK 3CX5K 2O5YH 1IE5A 1CICA 3UTQA 3H9YA 1FDLL 1CZ8L 1HHGA 3D39A 3VFRA 4AK1A 5IFHH 5CHNB 3U4EA 1I1FA 2YPVL 1F4XH 4IHOB 4PJ8A 4AMKH 4WFHD 3GKWH 4APQC 3UJJH 2PXYB 1G7HB 3KNBA 3QWQB 4XXDA 5GGSB 4ZYKA 4XPAH 1KIRB 4L9LA 4ZUSA 1GCFA 3O6FD 2HN7B 2BHYA 3D85D 3TO4A 1X44A 3ZDYF 4PGZA 2L0DA 5K9JH 4XVTL 2XZCL 1B3JA 1S5IH 2KZ1B 2XN9B 4LAJH 5D7LE 2IMMA 4R7NA 2QSQA 1Q9WB 1LQSR 1HQ4B 5DQDH 1CD1A 1WIPA 5KJRL 4EN3C 1A4JA 4LSRH 5FYJE 1YEFL 4Q2ZB 1B2WH 2BY0A 4GJTB 3IFOB 5F6HI 3B5TA 1QHPA 1S7UA 4X6FB 3EYFA 3K8LA 3PWVA 4PS4L 1R3HB 1MLBA 1ZVSA 4WW2F 5E99H 4NO5B 4KJWC 3WKNA 5TF1L 5T1LD 2XZAH 1XH3B 2VLKB 5F7YC 4GLRI 1A3QA 2NY6B 5I1CL 2HT2D 3RKPA 4NQVA 2DLHA 4EBQL 3MV9E 5DJZA 3K80A 4P4KD 3P4NB 1WWWX 3L95A 1ADQH 5T1DH 3ZYOA 1YEJL 3O45B 3BW9A 1DDHB 2VDOL 4P46D 2BVQB 3MR9B 3UJTH 5HHXL 4DKFH 3ARGD 4ONGH 4XB8A 5I73B 3VFUA 4N1HB 4AENA 3CXHK 1C1EL 5EC2A 4G6AD 5IFJA 4WHTB 1B0GB 1BJ8A 1G9ML 5I8EB 1KCVL 5FO9A 3PXHA 5IV2B 4K9EH 1LDPL 1KEGL 4NZJA 5GRUL 4ZFFB 3G6JF 4YBLC 1GOGA 3MRDB 3OB0K 4ZXBC 1KNOB 2OI9B 1WC7B 4POUB 2EH7H 1WAAE 1KPUB 1UM5L 1CICD 3UTPD 1LHZA 5HHVH 1T22A 4X6DA 3WHXB 3D39D 3QUYA 3F6LA 3L5WA 4PJ8D 3GSQB 3MREA 2OYPA 3BPLB 3VMNA 1PX4A 1J8HE 1TCRA 4X9BA 4JFFB 1A9BB 5A2FA 2Z31C 1UG9A 1OM3L 1D9KC 5FDWA 3JSSA 4XTRD 2GJ6A 3N9GL 1OL0A 3TO4D 4TQEH 6FABL 5KVMC 1MCNA 1HYSD 4HH9B 1MFAH 2W9EL 1DR9A 3PP3H 2CKNA 4WFFE 1A7PL 2J8UB 3MUY1 4UV4H 3IDMA 5EZOL 3QIWC 1CXKA 2AI0H 2X10A 3SDAC 2DTMH 1OWRM 5LJYH 5FYKE 5H94A 2YC1B 1RIVL 1K8IA 2WINB 3VWJA 4TYUA 3BKJL 1EBPA 4P2RE 4YHML 2C7UA 2LTQC 3ZDYE 3MLSH 1BOGA 1N2RB 4L4JA 3TVMC 4MB3A 1OD7A 4LKXA 3PXJA 2CLRB 3QIBB 4EOWH 5CILH 3TT1H 5LWYL 3VD3A 1GVIA 4KK6C 4QWWD 2FLRT 1AR1C 4ZO6A 5DMYA 5LQBL 2I26N 1QA9B 3KJ4C 3JWOH 1CFQB 3CMOL 3SKNA 3TPKA 3HNVL 4NQCB 1G1YA 1C08A 2BK8A 3GMNB 2PYEE 4E0RB 1JK8A 5GS3A 3FB8A 3S9DB 5HVGB 5ABDE 5FB8A 3BHBB 3NIDF 2HJFA 1RZKL 4U49A 4PYHA 3LKSA 3VCLB 1VACA 1N26A 5DI8B 1HHIB 1GC1H 5C0DA 5ID0B 4UOJA 4WO4A 5IESL 4JO1H 4UQ2A 1EEUA 1NGPL 3WEXB 3DRTB 1J10A 4I5BB 1WEJL 1PYWB 1T0NA 4LSVL 4OIIL 4G80B 3MV9B 2AJSL 2UWEF 3QUYD 2R0ZH 4G8IA 4X5XB 3BE1H 1LP9F 4MNGA 4NSKB 3ILQC 1WZLA 3G04B 2GTWA 1E4JA 4QXGL 3OGCA 3BKYH 1Z3GH 2GJ6D 1H5BB 1T2JA 1CFTA 3TP4A 3CUPA 3FQWA 4MA3B 3O3UN 4JCMA 5BV7H 5HYSG 5IGXL 2H3NB 1JNNH 4FQJL 3MA9H 2J4WL 2BRQA 1AHWC 5I1IH 5CJQH 1A5FL 4LVOC 3BYTA 4BZ2L 4GQPH 3F8UB 4WNQA 3VWJD 3KLAB 3IAPA 3HZKB 3WS6A 5CD3A 4L29B 4EN3A 5T33H 2A83B 4HS6A 3RU8L 4JGMA 1S9WA 3EOTH 2OXGA 3OTTA 3QUXA 1J8HB 1IL1A 4FQ1H 5F1IA 4HUUB 4KK8C 1RZ7L 1OVZA 3Q2CA 3SGKC 4E42A 1K9TA 2ZZUT 4PY8J 1HWHB 5T5NF 3ZSSA 4JRYA 4YXLL 1MUJB 4M61B 4X9GA 4KZEH 2APVA 1F4HA 3EYOA 4XCFL 4MA7H 4LSPH 4QEGA 1ZAGA 3BGFB 4BSVB 2YZ1A 1MREH 4GLRH 4XX1G 1HILB 3QCUL 4F9PC 3O3EB 1DUZB 3NABL 1KEMH 4D9QE 5KW9L 2QKIA 1QLFA 3MLXL 4QHKJ 5EC1B 1BBJA 1I3GH 4P2RB 3LEXB 2P5WB 5FF6B 3JTTA 4WO4D 5DRXB 1OLLA 1N7MH 4XNXL 5EH1A 4KTYA 1C5CH 4R4FH 2MPAH 2BX5A 4TVPD 4HCRH 2PF6A 5E56A 5IHZA 4KDWA 2XWTA 4QHMA 4Y5VA 1NFIB 2MQCA 2FEEL 3NIDE 2FYYA 3PDOA 2ZUWA 1BLNB 2PW1B 5D9SA 3Q1SL 2VDNH 1MNUH 1BX2A 1W0WA 1P4BH 5K9KA 4GAJL 5E2TH 4WW2B 1YY8A 2J2ZA 2AXFA 5BXFA 1IC7L 2N7BA 4R4BA 1R3KB 5CZKA 1F02I 1KCRH 4G6JH 4ZFOL 4IOIA 5EU6B 2A77H 3QB7C 1KN2H 4H25A 1FNGA 4DJMA 1I1YB 3F5WA 2DLIA 4LSQH 2P49B 2UWEE 3L3HA 3TNMA 5KOVC 4GBXC 1UKSA 4F7MA 1LP9E 1QLRA 4JY4B 1J86A 3GK8L 3QULA 1NBYA 1LEKA 4Z7VB 4HSQA 4HXBL 3MUGA 5CKGA 3U9UB 4WUUB 2H8PA 4EN3D 5F88B 1I3RB 3CSGA 4DKDC 2ZKHH 3QUXD 3BIAX 2HLAA 5EU4B 2C3XA 1CLYL 3DVGB 4HKXA 3T1FA 2NY0C 3E3QC 3G6JB 4HWBL 5FYJL 2RHEA 2IFFL 4NUGH 3EYVA 1KIQA 1PY4A 5INCB 4KV5F 4JRYD 3FONA 3P9WB 1UJ3B 4MA8L 3MRCB 1NPUA 2CK0L 2NR6C 5HYQA 2FBJH 2GITB 5DTFB 1R3JA 3FCTB 1VA9A 1F4YH 2JJWA 1CFSA 5E4EC 1OW0C 1YQVL 4LSTL 5JOFB 4J3WA 1ZLWH 4OF7A 4FP8L 3KYNA 2AXJA 2J12B 4ODTH 3WUWG 4HS3B 1N0XH 1T1YA 2X4RB 5I8KH 2CQVA 3WNNA 2GEEA 2XA8L 3KPMB 4PV9A 2VE6B 5JOEA 1QR4A 3EO9L 3GSWA 2H1PL 3ZTNH 4M5YH 3HZVA 3VI4F 3U0PA 5GHWL 3U4AA 1A1NA 3V4PL 3UTZA 1RJLB 1IZKA 3D3VE 43C9B 4ETYA 4MXVF 5FK9A 1I8MB 2JB6A 5B3NA 2FH8A 3NPZB 2O93L 4XBPA 3FT4A 3N1MC 2EDFA 1XGUB 5HI3D 3PV6B 3V5KB 2JKXA 4Z77B 3C60A 1KF9B 4N0YH 2IANE 3WFCL 3MACL 4LBEB 5DUBB 4XNQB 1SJHA 5KSBF 3MLYL 1MIML 4W6XB 4PR5A 4X7SL 2BOBB 4DGIL 4P5KA 3GIVA 1TIUA 1ZGLP 4H1LG 4U1LA 4J1UA 5BZWB 1TVHB 3F7PC 5F7EL 5TE6H 4RGMB 4WFFD 4XZUA 3MJ9A 1MJ7L 3NFSH 1ORSA 3ZDXF 3S96A 5F9AC 2AEIT 2Q6WA 1BZQK 2DQTH 1JHKH 3DV4B 4MLIA 5FYKD 5CBAA 3T2PA 2EIEA 3S36L 4Y7MA 1U8PA 3HR5A 5D96B 5B8CA 1IT9H 1MEXL 5FM5O 1ZLSH 3KVQA 2BMKA 1AGBB 1NGWA 3FAWA 1RZIB 3S35L 5ELIA 2CDFB 4ZOAA 2VXSH 4QRTB 3MYZA 1BBDL 4PJ9B 1NAKL 3WFBH 2EC9T 2FWOA 3KPRE 3FT2A 4YJZL 3VGDA 1HEZB 3HZYB 2BY2A 2Z93A 2G75A 5TE7H 2YWYA 3KPSE 2IH1A 3LH2L 1I1RA 5I6XB 3FO9B 2DQFA 4M5ZL 1LP9B 1I7UA 2FJGA 5E9DE 4M1CD 1YY9D 1KCUL 4F8QA 3IVKA 1O7VA 2QQNH 1CL7I 2ZSWA 1NCAH 4JKPL 4E5XB 2P43B 4PJDA 2OSLB 4KV5E 4JPWH 4BQCA 3S4SB 3QFDB 4HFUH 4F9PA 2EKSA 1KLGB 2R2CA 2GY7B 5F3BA 2W0KA 5JHDA 1N6QH 4DZ8A 4OSUL 4XI5D 4YAQA 5T3ZH 3CPLA 3JUYA 1RD6A 3LQMA 1FSKB 1LK3H 2AJ3A 1F00I 4LVHC 1WGOA 4ZFZB 3C60D 1MFBL 1RUKL 4BSWB 4OJFH 2EO1A 5HPMB 4U6HA 2RCSL 4IMLA 3GMOB 3MBEC 1CR9H 4QYOB 1AGCB 4LRIC 4BUHA 2E9WA 3FFCA 5KVEH 1JCKA 2VLJE 2YD4A 3VI4E 4HKZB 2DJ4A 3E2HC 4Q7DA 3VGBA 4OLXH 4J4PC 5FGSA 5T1MB 4MXVE 1JFQH 1YNKL 3LKOA 3FMGL 4ODUB 4OB5L 1F2QA 2DQEH 4G43A 1RJZA 2JK5B 2X4PB 2Z8RA 5JW3L 2ZSVA 3VGAB 2MMXA 5CEZL 2F53B 5EBWA 3K4AA 5KS9A 1EVTC 5DJYB 1HWGB 4U6YB 5KSBE 2BSED 5TDPB 5E8OB 1DN0B 1KPVA 2OQJB 3OR6B 4PP1D 1H3VA 3RRQA 3IDIB 3TV3H 1BF8A 2C3GA 2HLFC 2Q3AA 5JUEH 2OX5A 3VE0B 1T7YA 3QA3B 3EJYC 5BRZA 2VLRE 1R5VB 3V7MA 1TZHB 1I7RA 2R2EB 3PNWB 5EN2B 2R1XA 2QQLH 5I1HL 2XV6B 3QZWG 3ZDXE 4XVSL 1JMXA 4PRBA 4XWOC 3K81A 1UCBH 5BS0B 3GHBL 1EPFA 5L9DH 1ZE3C 3NCJL 1KG0B 2ATPA 4HJ0C 3VDCA 4HJJH 3T2QA 1LK2A 4OFIA 4RNRA 1CDYA 1MQKH 1C8PA 3OKLB 1DCLA 1ZVHA 4N8VG 2Q7YB 3J7HA 2VISB 1NLDH 1CD9B 1HNFA 1PKQB 5ALCH 5KTEH 5HDQL 3OJ2C 3MXVL 3B9KA 4D9QD 1AD0A 1IBGL 5JHDD 1FCGA 3TPUB 3HC3L 5DFVC 3CXDL 1H8OA 4S1RH 4PREA 5D5MF 1OB1B 3GSNA 5F6IB 4W6WB 5TQ0H 4YDJA 2FX7H 4K3GA 5AZ2L 4ERSL 3U83A 3X3GL 3FQNB 4OD3H 5D8JL 3QEUB 4XPTL 3CDGB 3KPSB 1U8LA 3VGEA 1KIUA 2E7LC 3D9AL 4JM2A 3FFCD 3WLBB 1VGEL 2DLGA 5FA3B 5HI5C 2CIKA 1RIHL 3WIFB 3I84A 3OZ9L 5CSZB 1CDCA 3M07A 3IFNL 3W0WE 2DI8A 4UILH 3P11L 5IK3B 1J5OL 5J1TC 5L2JA 3QPXL 2OCFD 2N7AA 3O2VH 1XF4B 3GSXB 4PJ7F 2ARJA 3QXDA 3UROR 3MNWB 4N0RA 4YPGB 1FJ1A 4JN1H 4TOYH 2BSSA 5SWZA 5DJ8A 2GJZB 3X3FL 3BSZH 5BRZD 1Z0MA 4GG6A 1K3ZA 2BC4A 1NEZG 3QFJB 1YN6A 3IDUA 4W68A 4LAQL 4D8PB 3MXWH 1J1PL 5EBLA 3VFGH 4PGBB 4ZS7H 3AUVA 3KPOB 2HJLB 1A7OL 3HPLB 2LV4A 4CUCA 4RFNC 1Y6NR 1LGVA 1BVKA 4FQPA 2XZZA 2C1PA 3IKCA 4ELKB 5IMKA 4MS8C 3ZLQC 2EYRA 2NR6D 3KPRA 2NTFB 4YQXH 5E24E 3RIAF 2QL1A 1T89A 1TQBC 1V8HA 3H42H 4GAFB 2XTJE 1SBSH 5KSBB 2HT3C 2YBRA 4KKLD 2ZCLL 4P59H 5E9DA 1C5BH 3B9KD 1WQVT 1UXWB 2VABB 1ZGLA 4WI6A 3BKCL 1N8ZB 3CVHL 2YUVA 5FUOH 3PL6B 4HPOL 4FZEL 5GIRB 2NY3B 5C0RL 2VLRB 3OKNB 4NZRH 3WN5A 5JNYA 2ZCKL 2E5EA 1RPQA 4P23C 3BRDA 1CL7H 1R3IH 2VRAA 5ENWB 5IROC 1KT2B 2DQIL 2O61A 1T03L 3WMSA 1L6XA 4YEFA 2O5YL 1IGCH 1QSEB 3O2DH 5DJ6A 1I7TB 1ZK9A 4MD5B 4QKXB 4NDMA 1NCDL 4NO0A 4JM2D 3T0BA 4AMKL 5GSRA 3H3PH 3H7LA 4HGWA 3MBEA 5D5ME 2Z8SA 2MCPL 2VDKH 1YEEH 4KROD 1M7IA 5K9JL 3C09B 2MOVA 3SOBH 2VLJA 3BGAA 1DLFH 3AMLA 4HV8B 3WDHA 2FGZA 5DQDL 2DLTA 2IG2H 3P40A 3QEQA 1QVOA 2H2PC 5DUPH 2VL4A 4FQLH 2IGFL 4LHJB 4ZDHB 4DZBB 1OPGH 3PUCA 1A6UH 3G6DL 1NCCH 2AJXH 3PJSB 2BSTA 3I50L 4LLVB 5SWZD 3S97C 3AU1A 3C9NB 4O2FA 2ZUTA 1FGNL 1PDKA 4PJIF 1QRNA 4UMGA 1T83A 3RTQB 4K94L 1G6RL 1UVQA 2UVFA 4O51A 4NWUL 4C59B 1F45A 3T4YA 4LCIL 1AO7E 2A6KB 2FEDD 3W0WB 3NTCL 4Q9BA 4UDUB 5T1DL 1Z2KA 1XGYH 5D1ZB 3IGAB 4WFEE 4HFWB 3KPRD 3HMXL 4OT1H 5ACMA 3OKEB 3QQNA 2FIKA 5GZOC 4DKFL 3NH7L 4HZAA 4XHJD 1YUHA 5CP7B 4QY8A 1NMCB 3RVXD 4RDQF 1KB9J 4GKNB 4DKAA 2R29L 5E9DD 3QXVA 5HYEA 5GS0C 4AQOA 4M03A 3UAJD 4U1HB 2GT9B 2H32A 2YPLA 3ORJA 1BJ1H 2JELL 1HE7A 3AMKA 4JFYA 4HUNB 4E41A 2B4CC 3BRGC 3I02A 1MHPL 2E7CA 3X17A 4YDVA 3V0AC 1AJ7H 4GKZA 2XNAB 1RU9L 3W2DH 4MCYB 3VRIB 1CGVA 2DJSA 3NA4A 3TEUA 3U7AA 3N1FC 4WI2A 3DETC 5HHVL 1CDJA 3WIHA 1BVLB 2XZQH 1QUNA 1DBMH 4NO0D 5A2LH 4QHLB 5C0BA 4HF5H 5DMKB 1FRGH 3PQYA 2AJVH 3O8XC 5ISZB 2R0KH 3NFPA 4F15B 2VDML 3MBED 2XQYK 2CPCA 3BZDA 1MFAL 3JV0A 2KDGA 2VLJD 5LGHH 2QJDA 5CMAB 1DJSA 4XCCH 3RPIA 3QCVH 1RMFH 1T4KB 4UV4L 1G7QA 1FYTE 3D6GA 4MLSA 5KSVA 3EYQC 5C0IA 4LNRA 1Q72H 2AI0L 3QEQD 4JZOB 5D6CB 4AEHH 5D2NE 4LLWB 1MCIA 5JR1H 1J9CT 2Y7QA 5IMOA 1WT5C 3SDCB 2R23A 3OKYA 3IDNA 2EE2A 4ELMB 4L9DA 1LO4L 3I85A 4LCCB 1L0QA 1QRND 3I2CH 4C83A 3LS4H 1KPRB 1SJVA 4XCEA 1YMHB 1ITCA 5CILL 1NEUA 2EC9U 3MJ9H 3O6ML 4PUBH 3TT1L 4N5ED 5DRNB 3ARBC 3OKKA 5D5MB 5IHLB 4N5UA 1JZ5A 2IQ9H 4O2EB 4N9OB 2X9XA 3C5JA 5DJDA 3QP3A 2NCMA 4YC2C 4B7IA 1A02N 5B38B 3ULVC 2CLVA 1GIGH 3FQRA 4WI5A 4PJIE 2NW3A 1UKTA 4ZOBA 5IW1A 5FO7A 2YPLD 5L2KA 2DMBA 1TVBA 4PD4K 4E41D 5HHME 4HC1L 3OQ3B 2B39A 2AJZB 5TGBB 1A3LH 1MHEA 4JO2L 5I1AA 12E8H 3RL1A 4EI6A 2ZOKA 3FN0L 1Y6MR 3LKRB 3BQUB 4PJ7B 2R0ZL 4LOUD 4QGTA 5BZDA 3UP1A 5C0BD 3BE1L 3IJYB 5C08B 3PQYD 3P4OA 3PHQA 5IROA 3CX2A 3MGOB 4MCZB 1FGVH 1FPTH 3BZ4A 1AGFA 4LLYB 4O58H 1Z3GL 4UIMA 5AWNH 1KJ3L 2FB4H 4YE4L 1K6QH 4PJAE 3CFDB 1JZ3A 4KC3B 1JNNL 1GGUA 4LKCA 5HI5D 3MA9L 5K9OA 1S7SB 4S1QL 3NACL 3KGRA 5I1IL 5CJQL 2ZNWA 4JR9L 1JUFA 4ALAH 4OF3A 3A6CL 1D5MA 4IRJB 4P48A 2EXYD 4UT6H 2I9TA 4MQSB 3MLTB 3QQ4A 5DD3H 5K9QG 3SGJA 3QI9A 3D39B 3EOTL 1T7VA 3U4EB 2QADB 4GRMA 4JN2B 3QDJE 1KOAA 1G7LB 4GG8B 1LE9A 3V5DB 3HNTL 3KNBB 4ZYKB 2Q8AH 4L9LB 4OCSH 2CDGA 5AYUH 3TO4B 4LARH 3TWCH 1FYTB 5JHLL 4D3CH 4MA7L 1EO5A 2E8ZA 4W4OC 2H9GB 2A9NH 2BVPA 1IAIM 1EUTA 3NOIA 1OQOA 4H26A 4JPKH 4N1EA 3H9HA 4HULB 2ZCHL 1A4JB 1MREL 3CU7A 4MS8D 4PRHE 1S7RB 2EIBA 3W81A 1IAII 1L7TH 4OZHF 5L2KD 4Q6IC 3V4VH 5MENA 2XTJD 3QRGL 4WV1C 1I3GL 3STBA 2FJFA 3ZKNC 1MLBB 5HSFA 1A47A 4M62H 5HYFA 3LN9A 4ZO8A 2VR5A 2PTTA 2P8PB 4HCRL 1S7QA 1LWRA 2V7HA 4WGVB 1U8MA 4X98A 3VXUA 3G5YB 4D9LH 4EDWH 4NQVB 3LN5A 3VFMA 3VWKB 4JFDB 4KJQD 5DJZB 1MNUL 3AM8C 3WFHA 3ZE1F 1P4BL 2ED7A 4PJEA 3OB8A 3BW9B 1QPPA 1VADA 3C2AL 3CCHB 1NL0H 1QBML 1KCRL 2MFNA 3U7WL 5MEQA 3GSNH 4G6JL 3VFUB 3BZEA 2A77L 4TNWF 1KN2L 1YYMH 1A21A 5DA4A 5IFJB 1IILE 4WWKA 4NJAL 1HKFA 1PY9A 4X5LA 3RHWK 1U6AL 3NGBC 5IBTH 2DL9A 1P9MC 1ULVA 1MH5B 2CRIA 3K0WA 1RIUL 4X6BB 3ARDA 4I77H 3QI9D 4YHYC 5D2NA 3HAEA 2VDRH 4X6DB 1MCWW 2DQUH 1E28A 2Y72A 2LU3A 3ZKMD 3WXWH 1AXTH 1OP5K 1J1OH 3RL2B 2FR4A 5D7KE 3GB7B 3TA3C 4PJBF 1HIML 5FDWB 1V7MH 5B39A 2GJ6B 4QRRA 1LDSA 4UDTB 4DFHA 2V2XB 4MZ3A 3U0WL 2BY3A 2Y5TA 4YX2H 4PFEA 2FBJL 4GKOA 5IF0A 4H88H 2DS4A 3WLWC 3U4BH 3MRNB 4DAGH 4MJIE 1I4FB 3RIFK 1K8IB 3VWJB 2C4XA 3MOAL 1BD2A 3CFBA 3DSNA 3H3BC 2MQ0A 5JMRA 5TFSL 3P0VH 3WIIH 1UXSB 3CLEH 3D87B 4WU7A 2C7UB 5GS0D 2ARJQ 3GMQA 2PR4L 1BOGB 4CADA 1DSFL 2BOCA 2DQCL 3ZTNL 1S5HA 3UTTB 5KANG 3VXUD 2HFEB 2GFBB 2OK0L 2F5AH 1PQZA 4YHIA 4ZNEE 2WWMD 3CFJA 1XCQA 1CGYA 1BPVA 4QTHA 4OZHE 1QYGH 4RZCA 1NFDE 2YWZA 4R7DA 3L3KB 4N0YL 4Z5RA 4QRUB 4UU9B 4L8SC 5CIPH 5HDLA 3IRZA 2HJFB 4D0BB 3VXTB 5GRXG 4UZGA 2VL5A 4P2OB 2YPKB 1CQYA 1GGIH 2NXZB 4WWKD 4DUVA 3TCLA 4G9FE 3VXPB 4NN5B 4WO4B 4PJAA 5ACZA 1JZ7A 4QHNA 1IFHL 1CCZA 3ARVA 4FFWC 3NFSL 5DD5H 4DVBA 3MRBB 4ODXA 2DBLL 1A6ZB 2ZWLT 4LF3A 2ADJB 2DQTL 3ARDD 1Y0LA 3VU2A 1L6ZA 4WCYL 4Z0BH 1VGKA 4YH6A 5DHXB 2CD0A 5EIQA 4ONOA 1BQLH 3EJJX 3BPOB 4G8IB 3TJHD 1JZ8A 1FLRH 4MNGB 4TTDD 1ZLSL 4Q97A 4F9LA 3K8MA 3LV3A 3VD7A 1FFPA 1UA6H 1P7HL 4CMMB 1T1ZB 4JO3H 3GIZH 4QRRD 3RUGF 2CKBH 1JGEA 3HNSH 3G9AB 3WFBL 3BEWA 3FQWB 5IT2H 3C87A 4I4WA 3SDYL 4APQB 3QDJA 3MLWL 2PETA 1TENA 3VRJA 5C0ND 4F7EA 2GSGA 1U3JA 5D1QC 5MEPA 2DI7A 4XVUC 1NBZA 3FOLA 4U6XA 1YEDA 1BD2D 3ULVD 2QQNL 5CD3B 4PJBE 3MCKB 1U8JA 1NCAL 5L8LB 4WUKH 4EN3B 4XC1H 3HZMB 5INDB 4XP9L 4JPWL 2ZJSH 4FXKA 4PRHA 3PWNA 3QUKA 2OL3B 4HFUL 3F62A 5IQ7H 4HJGB 3ZKXC 4WV1A 3TBWA 4RFOL 3GBNH 2BCKA 1N6QL 4N0CD 1IKFH 1IAIH 5DT1H 1GGCH 4XBGA 1LK3L 3RY4A 4JRYB 3TYGH 3O0RL 4OJFL 3TF7C 1U0QA 3O2WL 3GUTB 1JNHA 1I1AA 1MCEA 1WTLA 3VA2C 5JORA 2CRZA 3LSOA 5BQ7B 5IB2A 1XGPB 3I6LE 4OLXL 4Y0GA 1QLFB 1JFQL 1BBJB 4I3SH 5I0ZA 5I16A 3P9MA 5F9OL 1CD0A 5DFWH 3JTTB 3CU1A 3E0GA 2NXYC 2RB8A 2O5XH 3QHZH 2A38A 4U6VH 5CJOH 3RWCA 1MJ8H 2XWTB 4MAYA 4QHMB 1QKZH 4ORGA 1FNAA 3HG1E 1FZJA 4AIOA 1G7PA 4YBLB 3W82A 1O0VA 2GK0A 4ZXBB 3T65A 5CBEA 3TV3L 5JUEL 4EJ1C 4Q9QH 1JYVA 5IEKB 1AP2B 1EXUA 2FX9H 5BXFB 5KSAA 5C2BL 5I17B 1ZLUK 4ZQKA 4P2CG 5F1KC 3RWGA 3T2NH 2QQLL 4P57B 4IOIB 5FUCE 3OAYK 1XF1A 3KS0J 3QDJD 1YMMA 4JHWL 3S6CA 5I15L 1T6WA 3P9LA 2Z31B 3TA3A 4H25B 1D9KB 5L9DL 4Z8FH 3WNMA 4Y4FA 3TNMB 2IQAA 5JW4M 2FHCA 1P4LA 4A2LA 4JQXA 1HCVA 1QLRB 3AREA 3WFZA 1MQKL 3QNYA 2H2SC 1LEKB 1MRFL 1ONQB 4GW1A 3VFSA 3QIWB 1XF3B 2H8PB 2NY7H 2BSRA 3SDAB 3MX0A 1NLDL 1MJUL 3RUGE 3G6AA 4PRHD 1CE6B 2EDQA 5DK3A 5E8EA 2YUZA 3EFDH 4OLUL 3OXSA 5F89B 5HGGS 5DJXA 3ZKND 2Z35B 4LCWB 1C5DA 1N5AB 4S1RL 2LTQB 2J1KA 5DMIH 3PABB 5TQ0L 4KKBC 3TVMB 4GAGH 5E5MA 1DLHB 3U48A 3QNXB 5IVXE 4YHLH 5HYQB 4MDJB 4N9GA 4HS8H 4UBDC 1AE6H 1I1AD 1CFSB 5DK0B 4OLYL 5IMLA 3QJHA 4ZNEA 1PLGH 5C0JA 1DBKH 4OZHA 3KJ4B 3HC4L 1NFDA 1SJEA 3TZVC 2FZ3A 3L7FA 4DQOH 3EAKA 4BZ1H 4QRPB 2X4QB 1TJHH 2ADFL 1NGQH 2E27H 4L8SA 4NKIH 1ACYL 4JRWA 2GJJA 4UILL 3ZKSD 4PV9B 3X13B 4HBCH 5F7WC 3T2OA 2A9ML 1YPZF 1EA9C 2W65A 1MCPH 4MAYD 4MNQB 3HZVB 2F19H 3KPLA 3O2VL 1Q9KB 1A1NB 1B0WA 2Q86A 5JDSA 1RUPH 2PKDA 3JXAA 3U82B 3EJZC 5E8NA 2WQRA 3FT4B 4M00A 5E7FA 5DA0B 3T0WA 1X7QB 2G2RB 4JN1L 4TOYL 2JCCF 1ND0B 2VTFA 3BT2L 5KSAD 4XT1C 4X5WB 3MXWL 4G8GB 5IJKC 3WE6A 1YMMD 1QZ1A 3CFKA 3TA3D 2J88H 4OLVL 3RI5K 4L8BA 3ABZA 3B2UC 4Y4FD 4P5KB 2CDEB 4U1LB 2OL3L 2Y36H 4UQ3B 5KVDH 1S3KH 2CXKA 1A1OB 4DOHE 3ARED 3HRZB 4Y19E 4PGEA 4YQXL 3IETA 1U8HA 1ORSB 1SBSL 1AHWB 3HG1B 3LY6A 4RAUA 5CUSH 5GSVA 1VHPA 5ITFA 2R4SH 3VXNA 4P59L 3RBSA 4LVOB 4OF5A 1C5BL 1YEKL 4KJYB 1JWSB 2C1OA 3HR5B 3PGDB 4LLUA 2OTUB 1HSBB 5FUOL 2AKRB 4FTVA 4OD1L 1OTTC 2BMKB 1VFMA 3SQOH 4EVNA 4YO0A 3BZFA 1MWAA 1P84K 1CL7L 1R3IL 4YHZH 5JW4N 3FT2B 1IGCL 1A6WH 5DD1L 3O2DL 1TVDA 2Z93B 2G75B 4EUPA 4ZTPH 2HMID 5GS0H 2D0FA 3QJFA 3DO3A 4GMSL 5EUOF 2FJGB 4G7YL 3W11C 1A1MA 3K7UA 4NUJB 5E00A 2FECI 2VDKL 3LKPA 5HGBB 4PJDB 2VQ1A 1MCWM 2HA1A 4FABL 4DW2H 4KVCH 4HEME 3T8XA 3RAJH 4KZDL 1KJMA 1L4IA 3VG0H 4Y4HC 4PG2A 2EKSB 5F3BB 5DUPL 5JHDB 4U33A 2OP4H 4QHUA 4FQLL 3WO4C 4ODSH 4YAQB 3MLVL 1EEYB 4FFWD 1OPGL 4XP5H 1WZ1H 2B8OT 4O00A 3R06A 3QWRA 5KG9A 1NCCL 1TZIA 4LPVA 4LL9A 5AEAA 1DTUA 1U95A 4LSSH 4U6HB 4IMLB 1OHQA 3B4NA 4NO2B 5I1EH 3FAXA 4QXUH 5KVFH 5C0GA 3RVVC 2HTLC 4QCIA 1KJVA 2B2XH 1QQDA 1SYVA 4KMQA 1ZA6A 4PJGF 1JMZA 4WDIB 4KQ4H 1OP5H 1FL5A 4GXUM 1XGYL 5AUMB 4G43B 4J3VA 1KJ2B 5L88H 3L6FB 2JCCE 5FAAA 1FBIH 2HTKC 2ZSVB 3OR7B 4TSBH 5EBWB 5KS9B 1YEIH 4XVUD 4KRPC 4GBXB 2VIRB 1KXTB 5IB3A 1KPVB 5D93C 5DHYA 4K23H 4MJ2A 1F58L 1ORQB 1YYLL 4CU6A 4FTVD 1EZVX 1S78C 3MO1A 3RWFA 5BRZB 1AJ7L 1WFNA 1TLKA 2QHRH 2OM5A 3RJQB 1TTUA 3GSOA 4NN7C 3MLPA 2RIKA 4ODVH 3ZHKA 3EO0B 5IWLC 2IADB 4NIKB 3ULVH 4NP4L 2ITDB 3GEWB 2NY0B 4LSDA 2DKUA 1DBML 3ZE0E 1FRGL 1LK2B 3KPQB 4M48H 2CLZB 4TPRH 3MTRA 4X6EB 5IVXA 2KQNA 3WFEL 5HXMA 4K8RC 5I19H 2NY2D 2B7DT 5K59F 4KK9D 2KUTA 4J8RB 1F3DJ 4JZNB 2SEBB 3DTXA 5LGHL 4PG9B 4QO1A 1A6TA 1J0ZA 1RMFL 5F96H 1QSFE 1AD0B 1E4WL 1K5NA 4LFHG 1OAKL 4DN3H 2X4NA 5I1LB 1U8NB 3ARWA 2PO6C 3JV6A 3QDHA 1HSAA 2VJXA 2EDBA 3WL9B 5SX5H 5E8PA 3QWRD 2GTZA 3V6FA 1TZGL 2L7UA 2NZ9C 3O4LE 1DEDA 4NQDE 1M6OA 2I24N 2IAMC 3CFCH 4G5ZL 4CL7A 3LS4L 1AKJB 3MODH 2XFXA 3GJFK 4IDLA 2YRLA 5JLZA 1G9NC 3DSFL 1VCAA 2FGWL 2IQ9L 4JVWA 1EHXA 3Q48A 3LZFH 4NT6A 5IJKA 1IAOB 3ELAT 2VKXA 1HXYA 1C7TA 5E94A 5L2JB 1VKXB 2XQBH 1GIGL 4ONHA 1N64H 4JAMA 5SWSA 1JRHI 2G9HB 4DFIA 5EFIB 2IALA 4D9RD 1G7MB 4QRSA 1YJDL 2IPTH 3K1KC 3MRJB 1NKOA 4Y19A 3DO7A 4CKVX 3WXVH 4BQ9A 5CGYC 3OSKA 1QFPA 2AJYH 2W9LA 5F7HA 4PJGE 5E6IC 4NKDB 4GG6B 5F7NC 3VXSE 1YPZB 1HDMA 12E8L 4JFZH 5EBLB 4H8WL 4GXUN 3P4MB 4ENED 1YECH 3QHFL 5T5FH 3VXQA 4NCDA 5FA4B 5I8CA 2B0SL 3U9PH 5IMKB 1KIPB 4ZSOA 2JCCB 2EYRB 2D4DA 1FPTL 5GJTH 4R96A 4EI5C 3S4SG 4AQ1B 2FB4L 3DRQB 1K6QL 4HDIB 1RZGB 3H3KA 4WRLA 3S3JA 2AW2A 1WCBA 2RFXB 3K1DA 3L3DA 1GH7A 5L8JB 1ZGLB 1G0YR 4CDHA 3TLRA 4P2QE 1F4WH 1FIGH 1TCMA 1JTPA 2AV1A 5CIPB 3T4AA 4MHHI 4UT6L 3V5HB 1OTSD 1NMBH 1CXIA 1OY3B 3BP5A 1JN6B 3BPCA 1H8NA 4JDVB 1Z9LA 4QRQB 4ISVB 4M9OA 5DD3L 5C0CE 3D5OF 4JFHE 5KAQF 5DJ6B 4ZS6C 1LO3H 2DAVA 3ULUC 1BQHB 1I8LC 1XF5B 1KJ2L 4NO3B 5T5NG 4UI2A 4JFEE 4LVHB 5HGDA 5HGHB 1J88A 4XPBH 3GMRB 5ESVA 3THMH 4OCYH 3MBEB 4OCSL 5IB5B 1U2CA 4V1DE 2C3VA 1EH9A 4WU5A 3IJHB 5ANMA 5FCSH 2Y06H 2QHLA 4D3CL 1QSZA 3E2HB 4G9DA 2A9NL 1FG2A 2W38A 4RGNC 1FFRA 4Z7QF 4CAGA 2JIXB 3OAYH 1FV1B 5SWSD 5EUOB 2HKHL 3NIGF 2CKBB 1D5ZA 4Y19D 2DICA 5DS8A 4XMLH 1BFVH 3VJ6A 4X83A 4NQDB 5IMMA 4NQUA 4M62L 5I75C 5DC4B 5SV3A 3CDFA 5JMOC 1UVQB 4B53A 5HJ3A 1Q9OA 1IGMH 3EFFA 3GBLA 4K55A 4RGOH 2UZIH 4PRPB 4D9LL 2ICWA 1QFHA 4Y5XA 3RHWF 4AEEA 3B6SB 4JZJA 3EDFA 3PIQB 3B3IB 3MV7E 1ZS8B 4D0CA 3ROLA 5TDNA 2LABA 3FFDA 2X44D 3D18A 3I75A 3NN8A 2FIKB 3DX8A 4XNMA 1YUHB 4KI5C 4QY8B 3SDXF 4WY7H 1LE5B 3WS3A 4FFYH 3MJ7A 1NCNA 4JFOA 32C2A 2YPLB 3FTGA 2P4AB 1X6NA 3EHBC 2H26A 4E41B 4LEOA 1IGJA 1C12A 2X1OA 4N0FB 3I02B 4KUCF 4JM4L 1UQSA 4YDVB 3ZL4H 5HYSA 3O9WA 2D0HA 3ARQA 1H3PL 4XH2A 1F90H 4LQFL 4GKZB 3PWUB 4ZNCD 4GQ9L 1I1CA 1Q1JH 1VFUA 2PCPB 3IAQA 3IJSA 2J6EA 3FT3A 3RIFF 4OM1L 1W8NA 2XWJA 3D69B 4R2GD 3N1QC 1Z5LA 2A0LD 2AQ2A 5C0BB 2P46B 5FYJU 1AXTL 5I66B 4KK5D 3HCVA 3SY0B 3NFPB 4L4TE 1MI5B 4HK3J 3O4LA 4CGTA 2IAMA 4Z7OF 1MRDH 2VYRE 5FECA 1MCFA 2EICA 3FRUA 2Z8VC 5GGTA 4YX2L 3N50A 4BFEA 3GKZA 4JFPA 3BWAB 4PJHF 4ZPTB 3RPIB 1G7QB 4H88L 4N8PA 4O4YL 5J8OA 5KSVB 2R4RL 5C0IB 4LNRB 3U4BL 2QSTA 4DAGL 4HMCA 4R26H 4CVZA 2BJML 5HGAA 1JNLH 4OGXH 4C58B 5HD8D 1INEL 3B9AA 5JOPE 2FRGP 2VZVA 4F7TA 3IDNB 3U0TB 2APWA 1UB6B 4HQQH 1P5VA 1NC2A 3CLEL 1N0LA 4JANB 4CNIA 5DQ9A 4JFEB 5EU3A 4XCEB 5FM5M 1JRHH 3DXAE 2NY4D 4RQQA 5E6IA 3ZSTA 2D03H 1SJXA 1QFWM 3NIGE 3BKMH 3QWOB 3VXSA 4PD4J 2EEDA 1QFWI 5C3LD 2YD5A 1K2DB 4PGDB 5I8OH 4ACPA 4JPIB 1MFEL 1RULH 1MVUA 4RFNB 2DN7A 3SEPA 5ALBL 4KKAD 1M1SA 4Z7UF 2WBJA 4R4NC 5FO7B 1MWAH 5F3HA 1U8IA 4K8RD 1Q0XH 3K74B 5L2KB 1TQBB 1TVBB 4Z7WB 1LNUB 5ESQA 1ZEAH 4PTUB 3O9WD 2DWDA 5EO0A 1MHEB 5AD0A 5DD5L 5EO1A 4OZ4A 2ITCA 4UIKH 1Y6KR 3BN9C 5H2BA 4BFIA 3SDXE 5IKCB 1CT8A 4U1KB 4I18C 5D6DA 3VFWB 1BQLL 2X89A 4P23B 1H15A 3VXOB 4I3GA 4MD4A 3B8YA 3WFDL 1FLRL 5FYKU 3E6FA 1IM9A 1UA6L 1AGFB 3BZ4B 1P4IH 3MCG1 3O4LD 5C0CA 5L0QC 2EYTB 2IAMD 3MMEA 4UIMB 1KLUB 4MAUL 4OTXL 5FM4A 5J56B 2CKBL 5C0EA 3U7YH 2EDTA 1ROWA 1OSPH 2O26U 3VXRE 4NM4L 1QNZH 4LKCB 1KBGH 3MC0A 1OAYH 1XIWC 4J3XA 1PSKH 2FO4A 4N8CH 1JUFB 1PKOA 4LDLB 4YDIL 5C0AB 3RZWA 3Q5OA 1U91B 4JKWA 5B3JE 5FYLE 2Q20A 1INQA 3O11A 1KFAL 4BJLA 2NX5A 1NC2D 2R69H 4P0DA 3EOBA 4YK4C 4XC1L 4XNZC 2DYPB 2AEWA 2ZJSL 2BNRB 3ARYA 3STLB 5ERWA 3WUWA 4PJHE 3U2SA 5EUKB 4LIQE 1U3YA 1MVFA 1IAIL 4GXVH 5DT1L 3DROA 4L8DA 4TUKL 1GGCL 2ICWI 2QBWA 3VXSD 2WAHA 1JPTL 2CDGB 3TYGL 3E8UL 4AM0A 4U3XA 1WBYA 5HTSA 4CMHC 4H26B 3MV7A 4M93C 3SPVA 2WBJD 2VDPH 2WIIA 1N6UA 5IB1A 5HYIA 1SY6A 3CZFB 3LPWA 3NCYS 5FFLA 5MENB 3QH3A 4OKVA 3V52L 2FJFB 4YFLI 2DQHH 2Z9TA 2VQTA 2WNGA 4TSCL 1CLOL 4OAWA 2O5XL 3QHZL 5CJOL 5TE4H 4U31A 5TPWH 1RJYA 2PTTB 1QBAA 1S7QB 4P2QD 3QG7H 4O2CA 1QKZL 3DXAB 3QDGE 4H1LA 2W92A 4G6KH 4Z7UE 3QEHA 4I1NB 5FV2A 5HHQA 4KMLB 2X89D 2FJHA 2P44B 5IOPB 3A6OA 4IS6B 2AGJL 5B4MD 2QV2A 15C8L 1IM9D 3SE3A 1VADB 4X4ME 3P73B 5C0CD 4JFHD 2VR4A 1LMKA 4KTEL 3T2NL 3ULUD 3O6LH 3TBVA 4UT7H 3GJEA 3BZEB 2X4UB 1ZOXA 3C6SB 3O8XB 1AGDB 4FQXA 3CSYA 1X4YA 2HWZH 3GI9L 2ADIB 5J57B 2H41A 2WWKT 1CTNA 3BGMA 1A7QH 3LPFA 1FVEB 5I2IA 3GJFH 5A16A 5DRZA 4GUPB 2NNAA 1E4XI 2F54E 3FN9A 3FB7A 4R90L 5DGQA 5JTWA 2R56L 4Y16A 4EZMA 4EDXA 3SDXB 2NX5D 1OAQL 3P3YA 1NMAH 5A1AA 2A1WL 3QXUA 4PRIB 4P9MH 5IBLC 2DLFH 3N85H 3EFDL 4FQHB 4FQQA 3TN0C 4ZD3H 5LGJB 4GW4B 1ZA3A 2DOCA 1I7ZB 1MHHA 5C09A 4HIJA 5DMGC 4ZFGL 2FR4B 2MKWA 4IRZH 4LCUA 5EZIH 5DMIL 2C9AA 4TULH 1T1XB 4GAGL 4QRRB 3VXRB 4M4RA 4YHLL 5I71C 3AROA 4YGVB 1NH6A 4Z6AT 4BQ8A 1N5YH 2XXCB 3ARBB 4U1MB 5DJCB 1AE6L 1S9YA 3QPQC 2YHGA 3ULSB 4HUXA 3X12A 3MV7D 4UINH 1PLGL 1VFBA 1DBKL 4A6YA 4RIRA 3CFIC 4DQOL 1NANI 4YC2B 1IJ9A 3CFBB 1RZFH 3TBSA 1PZ5A 4H0GA 4NKIL 5JIKA 5C9JA 4HX1A 5LCVH 1QFWH 3PE9A 3KDMB 2YKLH 2EDHA 3DX6B 3WD5H 3JZ7A 3RI5F 2BOCB 3DGCR 4WI8A 3Q6FA 1S5HB 3VFNA 3MRFA 1A4KB 2Z4QB 1RUPL 3SO5A 5D7IF 1UCTA 4HPYH 1JVKA 3CFJB 4B0MM 3T0DA 1XCQB 3FQXB 2Z91A 3FHAA 1RK1B 4PJXF 3WCYA 4ZAKC 3QIUA 4R7DB 3R8QA 1ZTXH 4DN4H 4I18A 5EOCJ 5ESAA 3KPNA 2EE6A 1PEWA 1U8OB 2IPKA 4FQXD 3ZO0A 2VXTL 4CRPA 3ISWA 2J88L 2VITA 3MJ8A 3BAEL 3FO1A 2FHFA 3B83A 4RWHA 3DV6B 1RZ8A 3NCFB 1V05A 4OGAD 2IBGA 1R0AH 4KH2A 1PGRB 1T20A 2Y36L 5CEYB 3F7YB 3QZWA 5KVDL 1S3KL 2R39A 5F1NA 4QHNB 1AFVL 1ZT4B 4Y16D 3PHOA 4S1SL 5DEZA 1P1ZA 4RFEB 4ODXB 5ICYB 5CUSL 3VXME 1LD9B 1Y0LB 4M8QB 4Z7UB 3FB6A 2FL5B 1AIFA 3KG5A 5J6GA 5IB4B 2DBJA 1MJJB 5JOPD 3T77B 4N8VA 5JQ6H 5BMFH 1GSMA 4XP6H 5C09D 5EIVA 1B4RA 5IG7A 1FFPB 1ZMYA 3GO1L 5DR5L 3TFKC 3LD8C 3QUZA 2DMKA 4Z78A 3C6LC 1NSNH 3KLHC 4MQ7A 4YHPB 3EOYG 3JWOC 2ESVE 4JJ5B 4MJ4A 3GRWH 4QTIH 3VH8B 3KYOA 3VRJB 2BNQE 1BFOA 2CMRH 4ZUWB 2AEQL 3V6OC 4KFZC 5B39G 4L4VE 2G5RA 3MA7A 2B4CL 5DD6B 4M7KL 1QBLL 1U8JB 4UB0L 25C8L 5L7XH 1T21B 2NW2A 1HHKB 2Y07H 2IJ0C 4R4ND 4YNYB 4F7CA 4FXKB 4DW2L 3RAJL 2VZ3A 2YOCA 3Q6GL 3VG0L 4Q6IB 1MFDH 4R0LC 4HZLB 1EGJA 1N4XH 5GS2H 4WV1B 3FB5A 1FN4A 3C5SB 4KHXH 4FRWA 2OP4L 3LMJH 3LEVL 1NAMA 3LRHA 2G5BA 4Y2OA 4ZO9A 3EZJB 4UTAL 4XP5L 1CVSC 2BVEA 4CJ1A 3DX9A 2WQ8A 3ES6A 3QIUD 1RZJC 4K8RH 4WW1A 4Y1AE 4R3SA 4LSSL 3IDXH 5CJXC 5GGUB 4XWGL 1JNHB 4QXUL 1YNLH 2A6DA 1OT2A 1Q9LA 4JHBA 3U36B 3W39A 4GRWF 5BV7C 2R8SL 3LSOB 2XRAL 1NCTA 4KU1A 5HHOE 5I1JL 1KTDA 1A3RH 1RHHA 1NEZA 3ECBA 1GZQA 3AFLA 5D7IE 2J6EH 4KQ4L 2GAZA 2BVOB 3P9MB 3SKJH 4RDQG 3LDBC 4JQVA 1QR1B 1J1XH 5L88L 4H0IA 1FBIL 3ARUA 1U58B 1I85A 1XT5A 1W2KT 1D5BA 4P5TC 1BEYL 2F54A 2GK0B 3NGBB 1FZKB 3T65B 1FO0H 2ORBH 3G08A 2YK1L 1KXQE 4NC1C 1KB5A 1P7KB 1G9NH 2IPUG 2WUBH 3WBDA 1EXUB 3QNZB 1E4XH 3QUZD 4YHYB 2YMXH 1DL7L 4HWEL 2I60H 2QHRL 2P5EA 3TN0A 3V4UH 3DHMA 5FYLL 3RX5A 3IS1X 3F58L 5HI4D 4L3EE 3BO8B 5IJVB 1KGCE 3TA3B 4Y2DC 5LAXA 4WHCA 3Q3GB 5H35A 1GPOH 3O4OC 3FN3A 5D71H 5E5UB 1EDQA 4M48L 4OQTH 3HS0A 4LIQL 5I19L 4HUVA 3BUTA 4K7PX 3MRMA 3VFSB 1VFAB 4PRDA 1F8TH 5JW5A 5ETUA 3G6AB 2OR7A 5ILTL 4K3JH 1C16A 5F96L 3MRGB 2GY5A 4DN3L 1SEBB 1WBXB 1OT1A 4MQTB 1NANH 5DEGA 4M7LH 4NFCA 2ESVB 1UB5B 5IQ9A 5L6YH 4X6CA 5EA0H 3D0LA 4BH7A 2BNQB 1B6UA 1IKNA 3H8NA 5EOCL 3GMPB 4HH8A 2X9YA 4J23A 1CK0L 4XGZB 1ZANL 2IMNA 1RHFA 2FZ3B 1Z9OA 2X70A 1JV5B 1B4JL 3LZFL 4L8SB 5C07E 1GL4B 3HUJF 3QO0B 4FN0A 4JREC 2IF7A 5EWIH 1G0DA 4XPGH 3MQIA 2WWKO 1D7FA 2V9QA 1Q0YH 1SBBA 2AXHA 2XYCA 2XQBL 3VFVB 1O5DT 1YEGH 3MV8A 1LO0H 4FG6D 3ULUH 2F54D 3MZGB 1EMTH 4GRWE 3O6FC 4LLQA 5DURB 2PYFB 4NQXA 2AJYL 4XNYL 4GAYA 4AJ0A 1NGYB 4PB0H 5ADPL 2P5ED 4F8TA 3TN0D 4NPYA 4JFZL 1JF6A 3JV4A 3CLFL 4MJ5A 2QSCL 4X8JA 2OBGA 1YECL 3K46A 1P2CA 5D7IB 5T5FL 4L8BB 1NUFA 4Q0XH 2J3SA 2A6IB 4JLRA 2VAAA 3SBWA 4PJXB 1H0DB 5D2LA 1GAFH 2HAZA 3IETB 5GGRA 5IEHA 3EDEA 1HQRA 3B8SA 3QUMA 1P84J 3EYSH 2HT2C 3TM6A 4JPVH 5D1QB 4BYHA 3U6RA 1D6EB 4NRZA 2PW2B 4U4BA 1J0JA 4I3RH 3T0EC 4P4KC 2VH5L 3I6GB 3UMTA 2DRUA 3AS2A 5GS1C 4MQXC 3LIZH 1F4WL 4P46C 4AH2A 3BP7A 4OUUA 4FTVB 3REVA 3ARGC 3CDCA 1G9MC 4IMKA 1W72A 1HHJB 1X5XA 4OI9A 4BQ6A 4EVNB 1MWAB 1SY6H 3ZKXB 2EH8H 3QG6A 4NZUH 5C8JB 5GRVK 4G6AC 5F9JA 4PBXA 1K4CA 4XMKH 3LKNB 3DVNA 1P69B 3IXAA 5GQBA 1LO3L 4Q9RL 4CN1A 3KWWB 1WBZB 4XRCA 1MLCA 2X09A 4Y1AA 5J11C 5C71A 4I48B 5CJXA 3ARFA 4OCYL 5CKAA 3SCMA 1CICC 5A43C 2VQ1B 1FZMA 5E70A 2Y06L 3MRKA 3NZHL 4PJ5B 2HVKA 4PJ8C 5HHOA 1K8DA 4QF1A 4F2MA 7FABL 5DD0L 3CFEB 3MV8D 4YHNB 3T04D 1KCLA 2NXYB 4QHUB 4XTRC 5JIHA 2ICEB 3L3GA 1CS6A 3R1GH 1HYSC 4XMLL 1BFVL 1IC1A 3R06B 3R8BB 4C56E 3HUJE 1IZJA 1R5IB 4MJ6A 43CAA 1A2YA 1JI1A 4P5TA 5LBSL 3JVGA 3QDAA 2NYYD 4ETQB 2BRRL 4PJFA 4NNXA 5C0GB 4JY5L 5DRWA 1ZT7A 1HOCB 3OAUH 1SQ2N 2DQDH 3KR3L 1IGYB 1UZ8A 2UY6A 4NRYB 1M4KA 2VUOA 4HXAH 5C07B 3MROA 4ZPVA 1ZA6B 3G5VB 5FGCE 3BVNA 4YUEL 4KAQH 1BGXH 2V5TA 1AGEA 4P49A 5CWSA 1S9KC 4Y2DA 4P9HC 3GNML 4QWWC 5DMJB 5EU5A 3JTSA 3R0MA 5F9WC 4ZMAT 4K3HA 3BEVB 5IHUH 3QDME 1YEHH 5IBUB 2OZ4A 1M71A 1DBAL 4NKQB 1FYHB 2J8UF 4I0PA 3D2UA 3RWFB 1D6VH 1LEGA 4X7EC 2D7TL 2AK4B 3W9DA 2CUIA 4S2SA 1Q1JL 1N3NA 1IGIH 2E3VA 1M05B 3GSOB 3L3IA 3PP4H 4OZGF 2ZOLA 2V9RA 4X7DC 2QEJA 5C6PB 1PW3A 1S7TB 2R2HB 5KOMC 4Y5YA 2X4TA 2X4SA 1MCRA 5KSUA 2D7PA 2ZPKH 1T0PB 3D48R 3LRGA 2OJEB 1BIIB 4Y1AD 4JQIH 2B5IC 1U42A 2WIMA 3ARFD 5J1AA 1S9VA 3GM8A 2XN9E 3SCMD 4LSUH 4NKOA 4M1DH 1ZKAA 3HE7A 5M7QA 3QUYC 3TZVB 3F6IA 4RX4A 5HHOD 5MEOB 1S7WA 3RP1A 4CU8A 1RY7B 2X4NB 4B50A 1OAXL 4IEFB 4R26L 1ZVYA 3MRHA 1JNLL 4OGXL 4RAVB 4X7TB 2R0WH 4HIHA 4TTGA 4HQQL 3ETBF 2GTZB 3IFPA 1IAMA 3KHOA 2WUCH 4O9HH 5DZNA 2VXQH 1RUAL 4P5TD 1M6OB 2D0GA 3GJFB 5T1KA 4BKLB 1PG7W 2K1MA 1DBBH 2Q87A 3O6FA 4N1CA 4OCWL 3RGVA 4OF8A 4I2XE 3MRIB 4UOW0 3VWJC 1JRHL 4IBLT 2XFXB 4KTDL 2D03L 4U1SA 2XKNA 1DVFA 3S88L 4HWZA 2NY1D 5I8OL 4L3ED 2E6QA 1LEIA 1KGCD 1RULL 2LQRA 1HXYB 4Y2DD 4ZODA 4AIXA 3DUSA 3KXFA 4ONHB 2EEBA 4X4XB 4YIQA 5SWSB 1NCBH 2F5BH 3GGWA 3DO7B 1H9VA 2W0FA 1I9JH 4KRMB 3V0WH 3TH3T 2NLJB 1ZEAL 8FABB 1NGXA 1A9EA 1X5LA 3D2UD 3DMMA 4I0PD 4WEBL 1M7DA 4OQ1A 3T0EA 4PRAB 4MSWA 4TNVK 5JW4Q 1HDMB 3ZE2F 3AY4A 4F37K 3G5XA 4G8FA 3REWA 3PGFL 4QGYA 3BXNA 4NQEE 1WWBX 5FGCB 4FZ8L 1S8DA 5IVZB 1YNTA 2AK1L 4ZSOB 2JJVA 3QXWA 5DEFB 4KDTA 3HLAA 4LEXH 4WFGE 2J8UE 2RQ8A 1RK0A 1IVLA 3V8OA 1XAUA 4OLWH 3HE7D 4RMVA 4DEPC 3KLSA 2P8LA 4NZTH 3QDMB 4LMQI 3L3DB 5CGMA 5I1KL 3F7VA 1OWWA 2HP4A 1PSKL 4N8CL 4P4RA 2BFVH 3LN4B 2HVJA 2E9IA 2GI7A 5F7UA 3IDJA 5I1DA 1ED3A 4Y4HB 4CVXB 4OV5A 3OKOA 4PB9H 2R69L 1F5WA 3BPCB 5DJ2B 3HHRB 5DYOA 4POZD 3WO4B 5T1KD 3EIFA 5ADOH 4NNYA 3L9RA 3VDBA 2A6JA 5I74C 1PG7X 4M6NL 3RGVD 3QISA 3O3AB 4S11A 3ARSA 4MD0B 4DTGL 4C56A 3HUJA 4NQCE 3WS6C 3TT3H 4GXVL 1OF2A 1CF8L 5HHPA 1DVFD 3UPAA 4KI5F 1C7SA 1DEEB 2A74A 2P24A 3MLUL 2QSVA 4NKMB 1SHMA 4XCYB 1U36A 3UC0L 1H3XA 4OZFH 5BOPA 4WU5B 1JPFB 3NCYP 3QUXC 5I1GH 5F70A 4PV8A 4G9DB 5MERA 3GHEH 3KXFD 3NAAL 4JCLA 2VDPL 4PJCA 1IAKB 2XTLA 2FLBT 3LHPH 4MMZC 1TXKA 2H6PB 5EO9A 3U79A 2FSEA 3VJ6B 3UZEA 2DQHL 5IMMB 4P5MB 1EFXB 1DQJA 3DMMD 2FATH 4KRPB 3T0ED 3HI5H 3T0AA 5D93B 5TPWL 1FL3B 3OF6A 4DGVH 4DUWA 4V2BA 4I2XB 4MQXD 3SKUD 1FVDB 4FS0A 1FFQA 3NFNB 4FQCL 3NCBB 5HJ3B 4G6KL 2OJZH 4PTTA 2ICWB 1EEZA 3UTSE 2NY4B 4Z7VF 4UUJA 3BUYB 3O6KH 4JZJB 2OMNA 2JJTA 2IEPA 4GW5B 5CHNA 4R97C 4IHOA 1T1WA 4NN7B 3D18B 3T3ME 1OD9A 2PXYA 5I30H 5IIEB 1U2HA 4Y5VC 5C0FA 1G7HA 1WTGT 5GGSA 1DE4B 5K9QI 1KIRA 1V3LA 5FHBH 3O6LL 3WS3B 2MWCA 2HN7A 5FOBB 5I76B 2F8VA 4MDIB 3TBTB 1MCDA 3KLDA 5HI3C 1JHLH 2K3TA 4XP4L 2VXUL 2VDLL 3TJEH 3AB0C 2V9TA 2NPLX 5ID1B 5HVWA 5HYSB 3INUH 5CEXB 4Q2ZA 3OXRA 3IFOA 1GGBL 1WV7T 2E8YA 4KVNL 1K4DB 1R3HA 1MHCB 5DUMH 3ARRA 4RGNE 4P9ML 3IJSB 4NQEB 4QNPF 4NO5A 3FT3B 5EZLB 5F7DB 2PO6B 1KCSH 4ZD3L 3GSUB 1XH3A 1OLZA 3T1WA 2VLKA 4C56D 1H3WM 3HCVB 4Y88A 2F74B 5EZIL 1J0KA 1ETZB 5C86A 2IAMB 3S5LB 3BDYL 3L7EB 3P4NA 1OSZB 4OZGB 1FO0B 1DDHA 1ZWIB 4UINL 1U8QB 4HMEA 3UBXI 2WLYA 2P5WE 5D4QA 1BJMA 2YA0A 2GKIA 1HHHB 1UWEL 1RZFL 5DHVA 1MPAL 4GKSB 1Y18B 5I8EA 3CH1B 4K7PH 1CLZL 1WISA 5IV2A 5D72H 1KENH 3LOWA 1QFWL 5LCVL 3GMMB 4NHUB 3MRDA 3OF6D 3WD5L 5DQ9B 1JGVL 1KNOA 3EW3B 4M1CC 5EU3B 4CVWA 1YY9C 3QUMH 3SKMB 1KPUA 4RQQB 3LVEA 4NNPL 5E6IB 1ZHNB 4G8EA 5ICZB 4HKBB 3WHXA 5FUZL 5EU6E 3TGXA 2WBWB 5FHAL 4JFFA 1A9BA 1HXMB 2V17H 3WHE1 2PXYD 3WV0A 4XAKE 3HR6A 4XP1H 2ZUVA 4TN9A 5D70H 4ZTOH 2EDOA 2NY5L 2J8OA 1W72H 4XI5C 4XNUH 5DFTA 5D1XC 4HH9A 3FQUA 5F3HB 4KKCC 1U8IB 4EI5B 4BK4A 1PEZA 4Z7VE 3C60C 3VD5A 1R0AL 4WUUE 1XGQB 3MV01 5ESQB 3L5XH 1GOHA 3MRRA 4QOKA 3UDWA 2DWDB 5T3XE 2R0LL 1FNEA 4ZFOA 5EO1B 2Q76B 1RZJH 1BQHG 5H2BB 4BFIB 3UTSB 5DQJB 2DB8A 3G6JE 5CEZE 3UPRB 1N2RA 4K7PY 2WLZA 3VFTB 4MD4B 4LLMB 2CLRA 3QIBA 2VLKD 1UWGH 1IM9B 2NY6D 5F9DC 3CSPA 1UACH 5DK2B 1FNSH 5GGRY 3EO1B 1T7ZA 5GGVH 5C0EB 1V7NL 3NPSC 4QT5B 1QA9A 5EPMA 4PP1C 3DGGB 5B8CC 3GRWL 5MP6H 3H7BB 5D7LA 4NQCA 5KANI 4E0RA 2YR3A 3GMNA 1E6OH 1I8KA 3N1PC 4QNPE 3O3BB 2CMRL 1JZ4A 1I9IH 2AV7B 3BHBA 3EGSB 4HWBA 2GCYA 3V0VB 3SE9H 2V7NB 3KJ6H 4P2YA 3TCXA 3VCLA 3O11B 4RGNB 1A7BA 4FXGB 1HHIA 5DJAB 3EOBB 5ID0A 3MGAA 5TF0A 3VGGA 4F3FA 4JHAH 1MFDL 3WEXA 3DRTA 5MHSE 3U2SB 3VW3L 1N4XL 1TETH 4I5BA 3ILPA 5FM8A 3HI6H 4KHXL 3HE6A 5DSCA 4G80A 3QO1A 5I75B 1J7VR 3MV9A 3DROB 5E2WH 4X5XA 1L7IH 1W8OA 4YHKH 4JFFD 1DQMH 2OXHA 4NSKA 3ET9F 3IDXL 1T0MA 2XPGA 4IOFC 2OZ4H 3G04A 4F58H 2VN4A 4FNLH 1YNLL 4XVJH 3UYRH 4MA3A 1QG3A 5DJ0A 2H3NA 3IT8D 5GGVY 4WFGD 2Q7NA 4YR6B 3SKJL 4K3DL 4NRXA 2VNCA 4KRLB 4QOKD 3PWLB 5I0DA 1J1XL 3G5ZA 1RJYB 3KLAA 1JYWA 1WAAA 3LQZB 1OP9A 1X5IA 2XQYG 4OCXH 3QEHB 1SMAA 4KGJA 1EJOH 4KQ3H 4HAGA 1FDLH 1FO0L 2ORBL 3TH4T 2R1YB 4LGPB 3LS5L 1J8HA 2I9LB 3QIBD 2WUBL 4HUUA 4IDJH 5EB9A 1Z0NA 1ZXQA 4WI7A 2X1WL 4HHAA 1HH9A 1H3TA 3V4UL 1BOYA 3GJEB 1OGTB 4M61A 4FQXB 5D7LD 4XVTH 4NQCD 2XZCH 2MQ3A 2HKFL 4XXCA 3DUHA 2JJUA 3H9SB 5D71L 1UEYA 5FYJD 1HNGA 4X80H 2LE9A 5KJRH 1YDPB 4OQTL 2NNAB 2RGSA 3RWIA 4PP2B 1CGTA 4EDXB 3O3EA 1DUZA 2AQ1A 2VDQL 4PS4H 4P2RA 3LEXA 2P5WA 5F21B 5FF6A 1DUYA 4KHTH 1U41A 1RUQH 5DRXA 3KYMB 4FQQB 1F4AA 3S3SA 4M7LT 3HE6D 5C09B 4HIJB 2YSSB 5ITBH 1BZ9A 3MV9D 5I1CH 2XACC 1BLNA 2XKSA 2PW1A 4KKLC 3P77A 3B9KC 4U3HA 5L6YL 5EA0L 1YEJH 2PYEA 4WW2A 1CFNB 4Y89A 1S9YB 1XFPA 3P0YL 1R3KA 4MMXC 4WEUD 3C5ZC 5EOQH 4ZUUA 4LDOB 2FEEI 3H0TB 1NUNB 5EU6A 1P7QA 4N0UB 3KPTA 2J7LA 5D7JC 1F3JB 5GGQL 1X3DA 1PZ5B 2VLLB 1X5YA 5HY9A 1G9MH 5C9JB 5EWIL 1B9ZA 5HVHC 1TFHA 2F53E 1LDPH 5D1XA 1T2XA 4JDTL 4JM2C 5TDOB 4JY4A 4LVEA 5D7SH 3Q6FB 3U9UA 4R8WH 4WUUA 1QEWB 1NQBA 1LO0L 1UM5H 5F88A 4IJ3C 1EMTL 1I3RA 4UAOC 2ILLA 4KROC 3SGDI 1J8HD 5HYJB 5GJSH 1AXSA 2FIRT 5E2UH 4AL8H 4F80A 3DVGA 5BVJA 3AAZA 5BS0E 4I18B 2AABH 3G6JA 1KC5H 5CINL 4GT7A 5ESAB 5INCA 1CWVA 1EHAA 3N9GH 4BH8B 1EUUA 1UJ3A 2IPKB 3MRCA 4K94C 4FFVC 3MJ8B 2GITA 3FO1B 5L0QB 3CH8A 3FCTA 4J3TA 1A7PH 1F13A 4Q0XL 3S8WA 3AS0A 2VO5A 3BDXA 4G3YH 5EZOH 2DD8L 5IHBA 3QZWB 1BMGA 1PKQE 1GAFL 3O81A