2P5EE

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE02
1DL7L 4NO3A 4H0IA 4C83A 4KXZI 3ECBA 4ODWB 4XTRD 1FORH 2WIMA 1JL8A 4RMRA 3UTSE 4M6NL 4KAQH 5CILH 1FFPB 4FFWC 1P69B 3ULUL 1LO5B 3MJ9H 3FO9B 5DD6B 2ED9A 3BP6A 1BBDH 3B5HA 3O2DA 4M7LH 1YEGL 3VDCA 2IC2A 4QHKI 5JIIA 4P59H 4ONFL 2Q6WB 3ZYJA 1P7QD 5EUKA 1FG2A 3TBYA 4KC3B 3OPZL 1FNSL 4OCYH 4OUOA 2MCPL 1I8LA 1CT8B 1XCTB 4MWFB 3QFDA 4IDLA 3HA0A 5HI4C 2R1XA 3OAYK 5KSUB 3TBWA 1IEHA 1DE4B 5C07E 4U1NA 4JM2B 4QHUB 3NAAH 4J3VA 1JHLH 4JFZL 3CFDB 3S35X 2ADFH 4PB9H 3RWFA 4C55A 4APQD 5C6PB 1G9NL 2D31A 4NKQB 2CK2A 3O4OC 1NBVH 2YPLD 3ARBA 1GGYA 4FZEL 3MCG1 1BFVH 2AEPL 4KI5D 3WIHL 3QH3A 3TBVB 5C7XL 3B83A 3S8WA 1FFQA 4Y4HC 5FDYA 1NGXB 3WFDH 4IS6B 5IW6A 2X4QB 2XTJB 5EN2B 1S9YB 1DLHA 1FFPA 1IEBA 2AJZB 3CXDL 4GT7A 1BZ7B 1A47A 5HDLA 1AXTH 1TENA 1YPZE 3FO9A 5K9JH 1JV5B 3PV6B 3MRQB 3B3IA 1V7ML 2Q6WA 2HFGL 4Y4FD 4PJ5D 3RWDB 3O2DH 5F7HA 5GISL 3QIBC 1F6FB 4YHYB 3HCVB 1CT8A 4DAGH 3GDBA 1SM3L 5MENA 3SBWC 1DE4A 3ALXA 1AD0A 4QHUA 3QDJE 3GMNA 1Q1JH 3CFDA 1P6FA 1IM9D 1I9IH 1Z0MA 4UQ2B 1P4IH 3ETBF 1N64H 4FQCL 5IESL 3LY6A 3CVIH 2YD5A 4CMMB 2H2SD 1HXMA 4H0HB 5CKAA 2Z8WC 2QJDA 3CSYB 2N7BA 1JHTB 1NGXA 3TJHD 4IS6A 1UB5B 5CWSA 1UZ6E 4KZDH 1R24A 2BSSB 1I7RA 3CLEH 1S9YA 3EJYD 3LH2H 4WTXA 5I71C 2V9RA 3SDCD 1U2HA 5CHNB 2AJZA 3RL2B 1BQLH 2DLFL 4Y16D 2WBKA 5H8DA 4IRSC 4PJGA 3PP3K 4ZXBD 2DI9A 1CFVH 2EDEA 2YN3A 4X6FB 3RWDA 1KIPA 3D69B 2D7QA 3PDOB 2AV1A 4S0TD 3BMWA 1GVIA 4JY5L 4N68A 3IGAB 4ONHB 2R0ZL 3IS0X 4WW1A 5C3TA 2VDRL 4OF6A 5C8JB 5BJTA 3CH8A 3WKNA 4PTUB 4ZFFA 4F80A 2EXWD 2JJWA 4QLRA 2DM7A 1S7VA 3HMXH 3L5HA 2D03L 3R0MA 4GRLC 5CJXA 2JB6B 4P46D 5D1XD 4K7PH 1NGYB 3UO1L 2N7AA 2G75B 2H32B 5KS9E 5DD3H 1EEYA 2FGWL 4XPAL 1Z9LA 1BVLA 2BSSA 4L8SC 1T03L 3TO4B 5CHNA 3S37L 3OF6D 2JJUA 4NUGH 4K2UH 1T0MB 5FUOH 2IANA 2Q87A 3RI5F 1FZOB 1QSFE 2RCSL 4GFTB 3RVTD 1BD2D 3F12B 3P3YA 3D69A 1AD9B 1F2XK 4NZRH 5ADOH 2VO5A 4FABH 4ONHA 4N8VG 3VWJC 5FOBB 5EC1B 4HPOL 1RHHB 1TVDA 3QDAA 1U6AH 1I9JH 4HKJB 1NC4A 5BOZG 5KVDL 3QUKB 4MMXC 4JFDE 3SJVD 3QPXH 2I9LB 2WWMD 1M71A 4I5BB 4QRSA 4JFXB 3ZKND 1NGYA 2P5EE 3U36A 1CBVL 1HHKB 4PGBB 2H32A 2QSCL 3QI9C 2DI8A 1T7XA 1TJIH 5HGAB 2QKIB 4TOYH 5GGUB 1EHXA 3MLUL 4OFYA 3LD8C 2IBZY 3NABH 5DD5H 5T5FH 4NQED 1PLGH 3TO4A 2EDXA 4DOHB 1IAIH 2GUOB 2OX5A 5I66B 1A2YA 3K7UA 5D6DA 4AQ1B 2QQKH 4K3DH 2ZNXA 3GBNL 2MHAA 3TA3C 2ICCA 1NQBA 3F12A 5E2WH 5IMMB 3F7VB 4L4TB 1CXIA 1KCUH 4PYHA 2PO6D 3ARED 5KZCB 4NFDA 2B0SH 1FHGA 1A3RH 2MKLC 1RHHA 3OZ9H 5EIQA 4IMKC 5F96H 2ARWA 3DX7B 4RAVB 4HKJA 3RJDA 2VIRB 1OP3K 3UTQA 1L0QA 5CZVH 4K94H 4FZ8H 1JF5A 3H9SA 3G9VA 4OB5H 4NPYA 3QIUB 4PGBA 2DIAA 1MCWW 5HGAA 2DWEB 4WI5A 5GGUA 4JZJA 4LBEA 5DHYB 3VXOA 4HHAB 2H32H 1KLUB 2BFVH 3ILQC 2ZJSL 1UENA 1CGSH 3BKYH 4EUPB 5HHMB 3QUYC 4NN6B 1MAJA 1NUDA 1VSCA 5DA4A 5EB9A 2XWTB 3B5GA 3GIZL 5DZLA 3BN9C 5E6IB 4G6AC 3BJLA 1TZIA 4LSTH 2ZKHL 3BH9B 5IMMA 5EU7E 1DBJH 1J8HB 3F7VA 1EBPA 5AZ2H 2LVEA 4J4PD 3O3EB 2F54B 1KPUB 2XXCB 3CD4A 1J0ZA 1ORSA 3MUGB 4HMCA 1UACL 5MENE 5KJRH 3QQ9D 2B20A 4EI6A 3DX7A 4DW2L 2WUCL 4RAVA 4XP4H 4K7PY 5ILTH 2R4RH 2BXZA 4X4YB 4XVUC 3CXHK 5E94A 1I3RB 1NCBL 2ESVA 3VI3F 5M7QA 1DANT 1DUZB 3BQUA 1ZTXH 4NUJA 1HZHH 4WO4B 3ZKMC 2E7LC 4Y19D 3QIUA 3CSPA 4GLRI 4OM1L 3CVHL 1EK3A 4WDIA 1KCRL 1OSPH 5FDWA 1MRFH 5DHYA 5CEXB 5E2VL 3OB0H 4YXHH 3OKMB 1XZ0B 4Q9QL 3O8XD 4Z7UF 2XXMB 2XTJE 5J11B 4H1LB 4EUPA 3HNVH 2BZDA 2YPVH 4FN0A 2XWTA 1YUHB 3BZEB 3MRRB 5E0QA 3GSQB 4NKMB 4NCC1 4PJGE 5E6IA 4O5LL 5JHLH 1RUPH 4JG0H 4MQ7B 5C0IB 4OZHF 4P2OA 1A9EB 3O3EA 3FN3A 2HA1A 2I60H 1A6TB 5FM8A 4DVBA 1QD0A 4F3FB 4MDIA 3FCTB 4XRCB 3DX9B 4LLMB 4ODHH 1EHLH 1ZVYA 4X4YA 4GG8B 4WFHD 4E5XA 4JDTH 4MAUH 4ZNCD 4G7VH 3JXAA 1M7DB 1A7NL 4WO4A 2DL9A 2W0LA 1G7JB 1P7KA 5HVWA 4HMDA 4YDJB 4QGYA 4RNRB 3IETA 5D9SB 1OQXA 1X7QB 1YEDB 1ZT4B 4NWTH 3X13A 1N5AA 3KLHC 3WFEH 1YUHA 4KMTH 3PQYB 4I3GA 4D9QD 2IANE 4EUPH 4YBQD 2MFNA 5EUOF 2VZ1A 5AWNL 1LWRA 4DEPC 3W39B 1MWAL 3H8NA 4ZMAT 2Y4SA 3MRPB 3GMLB 4HIXH 1LP9A 4RIRB 4GMTH 5SWSD 1LNUA 5IMOB 5I8CA 2GFBB 1PKQA 2R9HD 2BNRD 1BQHG 5TE6L 1ZHLA 3QCVL 3GHBL 4MXVE 4DZ8A 3PWLB 1IQWH 3K0WA 1VHPA 4YDJA 4NP4L 2B1HH 5D9SA 5DMJB 1GOHA 2VLRD 1YEDA 3EYOB 4J3SA 4ZFOB 4BQ9A 2DQIH 1EHNA 4IOSD 3KYAA 3RZCD 3FN9A 1IC5L 3UYRL 4CDGC 2X4UB 4ETQB 2UWEB 5E24E 3KYNB 3PQYA 3ZMRA 4H1LH 1INEH 4NZDA 2XQBH 1FL5B 3BYYA 5I74B 4PRHD 3ZTNL 3KPSE 5ICZB 2DWDA 3IAPA 4X80L 4J8RB 4HIHA 3STBA 4OCSL 1JF1A 1MJUH 4NM4L 4OLZH 4P23B 2EIBA 5IMOA 4UT6L 5D2LF 4JHAH 4KJPC 2GFBA 1YEIL 1CI5A 4CVXA 3BDYH 1CQKA 3D2UD 2F5AH 2IG2L 4RCAA 3QEHB 4LPUA 2IAMA 4OGZA 3LKRB 2YOCA 3H9SE 3PWLA 3NFNB 1CE1L 2VXUH 3MLZL 2V5MA 4LSVH 1I4FB 4ZSOA 1DCLA 2K7QA 2ZCHH 2OJZL 4Y88A 3VXSB 4O58H 4UT9L 4HXAH 5EFIB 3JV6B 4L3EA 4ZFOA 1NL0L 3P0VL 1PZUB 3BKCL 1T7ZA 4DOHE 2X4UA 4OF8A 5JIHA 3TPUB 4JRWA 5CGTA 1NGWA 2AJSL 1OM3H 4XCEB 1LO2L 3GNMH 5HHNB 3AU1A 1CDCA 2DLEA 1BBJB 1CD1B 4V2CB 4AEEA 4TSBH 1OAZH 3L5XL 4OD3H 3WHXB 2WBJC 3HE7D 1NAMB 3EOTH 1NCCH 2D7MA 4OZIF 2G5RA 4P23A 5LCVL 2KBGA 1ND0B 4KV5F 5DF0A 3BI9X 4RGNC 4AQOA 4NN5C 5DJYA 3RZWA 3QUXC 2ESVE 1KXVC 4QRUB 2YD9A 5GS2D 1UADC 3LKRA 3NFNA 3L3IB 2ZSVA 3LKSA 1KC5H 1B88A 3TVMB 3ZE2E 1BX2A 3JWDH 3MRFB 5C0FB 2PF6A 4JQXA 1YMHB 1D9KA 5I1EL 5HHME 3TPUA 4X7TA 4BM7A 1BFOB 4UIKL 2F8VA 3MODH 1RFDL 3WO4C 4WW2B 4NBXB 2WP3O 5C09B 1QPPA 4WHYH 4HT1H 5HHNA 3QUMB 5F70A 5ACZA 5I17A 1PAMA 4HLZG 2NY5L 4I4WA 1UCBL 1L7TL 1F6AB 3HNSL 4O4YH 3LRSB 4JJ5A 1WF5A 2BVOA 5JOFA 5CP3A 5BV7C 2EH7L 4XHJD 5ALCL 2YD4A 1ND0A 3SE9L 4KPHL 3SKJL 1YY9C 4JR9H 3IKKA 1MFDL 4CVWA 4QWWD 4IRZH 4LSRH 2M8XA 3CMOL 3OL2A 4KTEH 1MCPH 1MIML 1FDLH 2BVPB 5T5NG 4OLXL 1JN6A 5IGXL 3KLSA 5L2JA 1KLGB 3JWNC 4HUUA 3VDBA 1BFOA 3O11B 5FYKL 4KRMB 4NKIL 4KK6C 3K80A 4XNQA 1H3VA 2X4PB 5J3HC 2B2XL 2HTLC 5IW1B 2YEZA 1Q9LB 3QXDB 5GGRA 4A6YB 1XF3B 1QBAA 1TQCC 1F6AA 1I7ZB 4Z7OE 1K4DB 3B9AA 4YBLB 5E5RB 1LP9E 4XCFH 1S9XB 4OIBA 5D1QB 3LEXB 1G7QA 4MB5A 1ZLSL 3LQAC 5DS8B 1S7SB 4XWGH 2QADC 5CP3H 5CJOL 4XXDB 3CSBA 4KJWC 1R5VA 1PKQE 4KUZL 4P4RA 3VGFA 2MQ0A 5JTWA 4UV7H 2R8SH 5LQBH 3D25A 4BFGA 3EOYG 4NRZB 3L3OB 5DK0B 5D1ZC 3WLBB 3ULVH 3BD4A 1AQKL 4XH2B 2VQ1B 4PJCA 4DWHA 3VRIA 2L4OA 4XX1G 5EA0H 3DX8A 5K9KA 3UDWA 2OTPA 5I1LB 1KTDB 3Q6GH 1AXSA 1YYLL 2ICEB 3RNKB 4RFNC 4P3DA 2IH3B 5KTEH 1JCKA 2BC4A 4OZGB 4JQVA 4JN2B 1XF3A 2BP3A 3SDAD 3KXFB 3MLSH 1FPTH 2E9JA 3K4AA 4LCWB 3MUY1 4Y5XB 3QUMH 4LLAA 3LQMA 3TCLB 3BP4A 3ARGB 2FHFA 3M1BB 5C86A 1H3TA 3PL6C 1S9XA 4FP8H 4P99A 3LEXA 2WIIA 5DS8A 1CFSB 1S7SA 4PD4K 3FO2A 5C0AD 4ELMF 4EN3B 1JNLL 2DI7A 2AXFB 4GAGH 3LN5B 4JFHD 4GW5A 1JWSB 4XXDA 5D7JA 4GAJL 2LV4A 1FVEB 4ONGL 5CD5D 5JIPA 2HFEA 3SDXB 3IDNA 3QO1B 5TFSL 3ZO0A 3BZFB 5GIRB 5ANMB 4YHZL 5C0RH 4XVSL 1QBLH 2F58H 5TQ2H 3WLBA 2BNQB 3O6KL 4XH2A 4ZSOE 1HCFX 3UJIH 3JZ7A 5DR5L 5CUSL 2YUXA 1J88A 2NY2D 1IMHC 5C08B 2X40A 4L3EE 4X4XB 5E70A 4M7KL 5GGQL 3U4BL 5I1LA 1RU9H 3MMEB 4JFFD 3K4DA 1FZKA 2VITB 3H3KA 4R26L 3J7HA 2IQAA 3BUYA 4GMSH 5BMFL 3WUWA 3AFLA 5FKAB 4NHCH 2VZ3A 2JCCB 1X6LA 2RQ8A 3E8UL 4A6YH 2DQCH 1KTLA 3M1BA 4OJFH 1Z3GH 4D9LL 3RDTB 5JW4R 1QRNB 1PQZB 3QEQD 5CKGA 4EN3A 4XNMA 5SX5H 4YHKL 3VXNA 3RVXD 4P9HC 2AXFA 5IVNA 3LN5A 1U8LB 2EDNA 3HR6A 1K8DA 4U1SB 5DUMH 1FVEA 3SDDB 1C8PA 5DJ8B 2R2CA 3TT1H 2UVEA 1UKQA 2ITCB 1UA6L 4P2RB 2HYMA 3I75A 4HF5L 5GIRA 3HC3L 4QY8A 2VUOA 3NIGF 3DVIA 2BNQA 3TZVD 4E42A 15C8H 5C08A 3TIEB 3SO3C 2ED8A 1UH2A 4X4XA 4XBEL 2NLJA 1FNEA 3MMEA 4OTXL 4MB3A 1ZLUK 2AGJL 3TLRA 4MA3A 5HPMA 3MV8B 2VITA 4UQ3B 4G6JL 4JO1H 3DWTA 5KSAB 2GJ6D 4IM8A 3MRDB 5E8NB 5FKAA 4XTRC 4OF5A 2A2QT 2Q8BH 3UZEA 2FBJL 2WLYA 3RDTA 1PQZA 4B50A 1ZLVK 1SMOA 1MI5D 4Y4HA 3V5DB 3MRHA 2DD8L 3OKLA 3TWCL 4U1SA 5DJ8A 3CH1A 3HG1D 2FHBA 3ARRA 3DUUA 4PRDB 5I71B 5AG8A 3MV9B 1IC7H 3IDGB 5LXGH 1D6VH 3ULVE 4ZDHB 4MGXA 4JHWH 2UZIH 4Y1AD 3ULSA 3DXAD 2CUHA 4X8JB 4LCCB 4K07A 1G7LB 2VXQH 3D5OF 1HQRB 3FMGL 3GRWA 3TIEA 1AFVH 1TDQA 3KPLB 4X98B 4HWZB 4JG1L 3UBXB 3QIBA 2ORBL 4APQC 1MJ8H 3T04D 4PGEA 1VFAA 4LAJH 3SDYH 1W0YT 5E9DB 1JGUL 3NOIA 4PJBA 3MV8A 4UQ3A 5DMIL 3O6ML 3SBWA 3MRDA 2Y72A 2OBGA 4H88L 5EZOL 2AV7A 1CD8A 1AHWC 2OK0L 2CDGB 4GRLB 1H5BB 3TYGL 3RWCA 1RIUL 3EZJB 3NACH 3VFOA 2BRRH 1PSKH 1V3KA 3PDGA 4PJXF 3V5DA 4EJ1C 5EU4B 5K9QG 1BOYA 4Y4FC 5CGMA 5J0BA 4PR5A 2A6JB 3BAEL 4PRDA 5LGHL 1V05A 1FGNH 4L8SB 5DUBB 3IDGA 2VE6B 5EZJA 2EH8L 4X9IA 1CF8H 3DV4B 4IRSA 4F58H 1IAKA 1T04A 3O2VH 2XG4A 4U1JA 3D1MC 1HQRA 2ARJQ 2DTML 1DZBA 2KQMA 4PJCE 4QRPD 3KPLA 4PRAA 4X98A 3UBXA 3V5HA 1DVFD 5CBAA 3GRWH 3OX8B 5E9DA 5DQJB 1FL6B 2H2SC 1YQ2A 3MOBH 1YZZA 1HDMA 5KG9A 4ZUWB 2WLZA 3TJHC 4BSWB 2A6KB 1RSFA 4R8WH 3EJYC 5IB4A 3SDCC 5C6TL 4GRLA 1RZ7H 4Y16C 3GKWL 4ZXBC 3V79C 1SYVB 1EVTC 2IFFL 4XVJH 1SEQH 4OFDA 2K9UA 1OT2A 5JPNB 4L8SA 5DUBA 4YDVA 3QQ4B 4AL8H 3MLXH 4LLVA 2ZUYA 4PJHB 4AT6B 5IVZB 3BDBA 4FFVD 2VQTA 1D5IH 3BISA 1BEYL 1SY6H 1YN6A 5GGTL 2EXWC 3TT3L 3S37X 2C3VA 3QULB 3LEYL 4HWBA 5CAYB 4GKNA 3VE0B 4U6XA 3SGEI 2JB5L 4P46C 5D1XC 3VWJA 5HHQB 3U0PB 5DQJA 1FL6A 4NQDE 5EBLB 5TE7H 4MLIA 4WY7L 3P30L 3VFSA 5F44A 2E9WA 4BSWA 5E99L 2NY3B 1IGCL 1NEZB 1KF9B 5GS3A 1Y0LA 3VWKD 4GAFB 3TN0B 2C1OB 4B7IA 1MNUH 4IHOB 1QLRB 3RX7A 3QI9A 5I75C 4FFZH 1CR9L 2KKQA 3RVTC 1TXKA 5IQ7H 1QKZH 3GI8L 4RRPG 5D71H 4Z95L 1R3HB 2X70A 5JPNA 2VERN 4N90E 2VDQH 4NM8H 1N4XH 2Z9TA 3QFJB 2IJ0C 3C5JA 5F9WB 5DHVB 1JNJA 2VKXA 3VFVA 1OAUH 5DVLA 1G6RB 2DF3A 5KAQG 3TA3A 4ZTOL 4G8EB 5C2BL 3PE9A 3VFPB 2XPGB 3VE0A 2WWMC 5AZEL 2Y36H 4JGJA 1A7PH 3ZKNC 4HWBH 4EZMA 5ID1A 1OWRM 5EBLA 1NGZB 1WTLA 1R3LB 1HNGA 4IMKA 4PJAA 2E6JA 4PY8J 1NEZA 4Q9CA 3FKUS 1BJ1J 4YR6B 5JDJA 1HYRC 1KEML 1H0DB 3QNXA 4U1IA 4IHOA 5IBTL 2FATH 4P3CL 3G6DH 1OLLA 2ADJB 5ADPH 5ITFA 5E4EB 2PO6C 3AREC 5JW3H 3QUYA 3QFJA 3EDJA 4YDKL 4F7PB 4D8PA 4KRNA 5DHVA 5CEZH 1WFOA 1G9MH 1CIUA 2VXSL 5KN5B 5TDOB 5FGRA 1YJDH 3I6LE 4ZUSB 5GJSH 5HYSG 5C0BB 4J3XA 1UJTA 4XP9L 3UYOD 5CSGA 4CBPA 3OSKA 5A2KH 1QFWH 2P8PA 4NSKA 1IL1B 4FTVB 1DLFL 5DI8B 2YA1A 3QUZD 1R3LA 4PJBE 3MV8E 2LE9A 3GSRA 5IVXF 5JQ6H 5EO9B 4S1QH 2MSPA 1OY3B 2PR4H 2E7LA 5LKNA 3B9KD 5DWUH 4HUKB 5FHBL 5B39B 3C8HA 5HYQB 4B53A 2ADJA 4BK5A 1QVOB 1RZGA 4HSQA 5E95B 4PRIA 1QLFB 4LCYB 5E5MB 4TULH 3P4OB 5E8PB 3MRBA 4J4PC 2W60A 2AEQL 3ILPA 4F7PA 4JB9H 3QQ3B 1MEXL 3QAZC 3V8OA 1F42A 5KN5A 3QQ9C 3LEVL 3TJEH 5F72S 4ZUSA 1X44A 2X42A 5DHVH 5C0BA 3NN8A 5MI0C 5CLTA 1KNOB 1XCQB 1G6RH 3FHQA 4S1SL 4R4ND 3MGOB 1I8MB 2AK1L 2RB8A 2ZG2A 4XCYB 3KPMB 4UV4L 4Z7NE 4FTVA 4KVCH 5E9DE 4NT6B 1T1ZA 4BQCA 2DM4A 3VRJB 3EO1B 1U41A 5EO9A 4NQSB 1OGTB 3O8XC 5T1LA 2A9MH 4MJID 1EV2E 3IFNH 4PGZA 4QCIA 5IFJA 1MCRA 5EOCJ 5T1KD 5B39A 4YQXH 2HVKA 1MFEH 5BXFA 3ZSTA 4XB8A 4ZG1A 4XZUB 2XFXA 4QOKA 3SGDH 5KSVB 1NCUA 4HGWB 5DEFB 5DJDB 3WE6A 2CXGA 2HLAB 5E8PA 2LABA 1SJVA 2C3GA 5M94B 3BPLC 3QQ3A 2OTUA 2YZ8A 4KKLD 5L2KB 4QXUH 1KT2A 5ICYB 5ID0B 3LIZH 5IHLB 2BMKB 3GSNL 1KNOA 1XCQA 5H94A 4KROB 3ROLA 1SYSB 4XCYA 1RIVL 3CZFA 4BH8B 2FX8L 5BO1H 2DQUH 8FABA 4UB0H 3EO1A 5FCUL 3EOAB 4N5ED 12E8L 4KTDL 1OGTA 3CLFH 1NANH 5EIIA 4JRXB 3IDXL 3PP4H 5ITBH 2B7DT 1TITA 3I3DA 4OI7A 4YBQC 2V5TA 4Z7QF 2E9BA 4JHZA 4ZAKD 3T65A 1NFDE 4BZ1L 5CEZE 4LGRB 4OM0H 1ZEAH 5J56B 1XGUA 4D0CA 4IOIB 2O5XH 3EO9H 4HZAA 3U1SH 4LRNL 2BMKA 3QP3A 2EDWA 2R9HC 2O5ZH 3O3DA 2VLLB 3CXHJ 3OBAA 4L1DA 3VGBA 5FIEA 1SYSA 4F33B 3L6FA 2WBJB 4MDJB 1LD9B 5F89A 3WFBH 2A83B 4J3UA 2DM3A 4PJAE 1NLDH 1DSFL 3QQNA 3OR7B 1OHQA 1B6DA 3LPWA 4ALAL 1MHPL 3RZCC 3BSZH 3GMQB 3WS6C 4OCMC 2OI9C 3B9DA 5ERWA 1IFHH 3UCRA 1AGFB 3K8MA 3VXUB 5F3BA 4WV1B 5FECB 2HT2D 4TN9A 1C7TA 3QFJE 2WBWB 3WO4B 3P11H 1K3ZA 3LSOA 4W68A 3LHPL 1A7RL 2PCPA 5A40E 4TRPL 4QYOB 5HYJD 5D6CA 4L4VB 1KOAA 3VGGA 4P5MB 3X3GL 5KVGL 4Z8FL 2VLLA 3VGEA 3Q3GA 2VXTL 1VADB 1RUQL 3KPRB 3RL1A 4F33A 2WBJA 2BHUA 1EFXD 1FAKT 1LD9A 2BHZA 5I76B 1CD0A 4YBHA 3WFCL 3HS0B 4NJAH 5C70A 5HY9B 1U8MA 1YECL 2GSGA 5AUMA 3NCMA 4CADB 3OR7A 3ARDD 3QUXA 1VKXB 3TIDA 3VFGH 3GMQA 1UWXH 1C16A 1FSKC 4LHUB 5HJ3B 4UTBL 4IMLA 2PXYB 3ZHLA 4JM2F 5FECA 1NAKL 5FGCE 3M8OH 4PRIE 1CFNB 5C92A 3I6GB 4U1MA 4G9DA 2F74B 1AO7B 3HE7C 4WWKB 2RIKA 4AEIH 4KTYA 4QHMA 4L4VA 1X5XA 5DO2D 1QBML 1QHOA 5C0BE 2W92A 3V5KB 2GTZA 5DK3A 1A6WH 1OAXL 4HUWB 5DJAB 4TNVF 3GSOA 5I76A 2AABL 3SKOA 3IJYB 5DFVD 1L9NA 3HS0A 3D48R 4KHTH 3VXMA 4ZO9A 1U2CA 3OKEA 4FFYH 4JO4L 5DDHB 1U8KB 5CBEB 1VKXA 1NGPH 3ZZ1A 3GI9H 4UUJB 1QYGL 4HS6A 5AG9A 1C08B 4M5YL 3F5WB 1TNNA 1QOKA 1ZVHA 2AXGB 1UWEH 2EEDA 4LHUA 5HJ3A 5IHZA 5IG7B 3R8BB 3DURB 4QOKE 1XGRB 1OAYH 3IU3B 4XNYL 5F6IC 5DMYA 3NCYP 1CFNA 1MJ7H 2J2ZA 3RU8H 5CD3A 4QRQB 2IH1B 5E8OB 1WZ1H 4X6CA 4RFNB 4U4BA 5T3XH 2A6DB 2EYRB 1Y6MR 4J23A 2BY3A 5J8OA 4NNPL 2DMCA 3VH8G 1F11A 4QWWC 2O5YL 5EU6E 3DO7A 1Q72L 3OXRA 4HUWA 3RIFK 3LB6D 5F7EL 2J1KA 5F1NA 1KUMA 5HYEA 5BV7H 3CCHB 1EUUA 4QTIL 3IFLH 2FX9H 3Q2CA 5A2LH 4LSPL 3ARSA 1IGYA 4C57C 3UZQA 4HKZB 1JPTL 1LO4L 1JRHH 1SEBB 4GS7B 4P2QB 4TNVK 4ISVB 5D1ZA 3NFSL 3A6BL 4TPRL 1OVZA 1RZIB 3IU3A 4KQ3H 1OPGL 2CLVB 5IFAL 4JRYE 2HP4A 1G7MB 2DKMA 3O45A 5HYIA 2UY6A 1I7TB 3ULUH 1CE6B 2A6DA 2YRPA 5ISZD 4Q97A 3RRQA 3KNBB 2HN7B 1YEGH 2GJZB 2FHCA 2E27L 5F7KC 5T5NF 4MA1C 3MR9B 1KFAL 4F37K 3MX0A 1TQBC 3PL6A 2P4AB 4NN7C 4G8FB 1AXIB 3VGHA 1A9BB 1NMBH 1FGVH 5KVEH 1LK2A 3EDDA 3GMPB 2V2XA 3PXHA 3G5XB 4G7YL 2VDPL 3CCHA 3KS0H 4XC3H 3LQAH 2ZCKL 3BEWB 4R97B 1QA9A 3MV01 5E8DL 2KPNA 1SEBA 1G9NH 2P1YA 4P2QA 3ZDZF 3QDMA 2BNUB 2VYRE 4ISVA 2UYLA 2ENYA 4NO0B 5TQ0L 1H3UA 2AEPH 5DC4B 4GRWB 2CKBA 1KCLA 4JM2D 4N0RA 1XFPA 1T0NB 2CUIA 3SDAC 1RZIA 5IHUL 4QHLB 3SO3B 3S88H 2CLVA 2XWJA 3GHEL 3PABA 1G7MA 3BRFA 4CVUA 3CU7A 3QZWB 4PIRF 2AJXH 4R0LB 1JHKL 3MLYL 3U83A 3U30C 2NZ9D 2A6IA 3QXWA 1I8IA 1P7HL 1CVSC 1V7MH 1OP9A 5CD5C 3M45A 4LPYA 4P49A 1JPGB 4WHDA 2GI7A 4G8FA 5C0CA 3CDYA 1A9BA 4PY8I 1CU4L 5HVGB 2D7TH 2B4CC 4RGNE 5D7LA 2NY2C 5F9AC 3EFDL 4LPTA 5IF0A 5J1SC 1XGQA 3W2DL 3VXRD 4HZLA 4U3CA 1U8PA 2M1KA 4M1DL 3ZYZA 2BNUA 4LMQE 4LVOC 1XF2B 4WTWA 1JFQL 2NW3B 3SEPA 4IDJH 4URTB 4NO0A 3FO1B 4UT7H 5JZ7D 1T0NA 1S9WA 1J1OL 2G9HB 1BWMA 3T3PE 3HC0B 3UTPD 1BM3H 2CKBH 1EHAA 1D6EB 2N56A 5T3XE 4BYHA 2YPLB 4XCCL 5C9JB 2DLFH 4K3JL 1LGVA 3C5SB 4L4VE 2D0GA 3QRFM 1C5CL 2A73B 2V2WB 4DVRH 4LSQH 3S36X 3VRLF 3UZVB 5MP6H 1CLZH 2GCYA 3OB0K 2VDRH 6CGTA 3LPGA 3VXME 4NNXA 3S98A 1FYTD 5F21B 4PJ5B 1P7QA 5CSZA 2DBLH 4P9HH 1F3JB 3RWIB 5JOPE 3WS3A 4EXKA 3KJ4C 1T5XA 3K1KC 3PUCA 1WT5C 3UO1H 3WHE0 1WFTA 1D5XB 1KYOK 3KYMA 5CINL 5HHPB 1IM9B 3DMMB 3T3MF 1E6JL 1MHCB 4MX7B 1FNHA 4APQA 1R0AH 2PW1B 1D6EA 1I1FA 4NBZB 1TJHH 2BY0A 2YPLA 3T0EB 1SVZA 4X6CE 4U49A 1RJZA 4LK4A 2XZQL 4PD4J 4KUCF 5I8KL 3JV4A 5H35B 2FDBP 2AQ1A 4N1EA 4YHNB 4Z7WA 1QRKA 1MFNA 2A73A 4LIQL 2V2WA 3IJHA 1AHWA 1Q9KA 4TVPD 3U7YH 3W0WD 3ARFD 2HKFL 2VXVH 4WFGD 1GAFL 2Y07H 4R2GD 3BE1H 3AS0A 2OLDA 2J6EL 5BQ7A 5BRZB 1U95A 1CLYH 3LS5H 4Y4FA 1YEEH 4PJ5A 1QG3A 5B4MD 1PEZA 1AE6H 4WI3A 4LQFL 4Q9RH 1A7OL 1S7QA 3CVHB 5CZXD 4ZS7L 35C8H 5F7LB 1U36A 5B21A 1NLBH 2E5EA 1D5XA 5I1DA 5B3JE 2IADB 4H8WC 3MLUH 4UILH 2E6QA 1IM9A 4HIJB 4OZFB 1F4XH 2ZOLA 1MHCA 1WBXB 4YO0A 3EOBB 4P46B 2Z8VC 2DN7A 4M02A 2VDNH 2XY2A 1KACB 1VPOL 2DJUA 2V7NA 3CGTA 1FJ1B 4PG2A 3HHRB 2NY7L 1EEZB 4YHNA 5GRYA 3FN0L 4XMLL 1A6VL 2DQEL 1ACYL 3QCTH 1KXQE 5DVKA 5EOCL 3SDCA 3IFOB 4GKZA 3L3DB 4HV8A 5FYLD 4Y16A 1ZK9A 3HNTH 4ZXBA 5I75B 1H3PL 5FYJL 2PETA 1MUJA 1BD2B 4LCUB 1S3KL 2AJUL 1KTRL 1BZ9B 4GOSA 1N5YH 5CS7A 4PJ7B 4L4TD 2VSCA 1DVFC 4OD2B 4ZUTB 1LDPL 2W9DH 3QDME 3BP7B 1CDYA 3PWJB 5J7CC 4V2BA 1RMFL 1F4YL 2Y1VA 2IADA 3DYPA 3AGVA 3EOBA 4P46A 3EJJX 5D1XA 1PYWB 3PWPE 4RFEB 3ZL4H 5DQDL 3F7PC 1MWAB 5FO8A 3KYKL 1B0GB 4J2XA 1ZANL 3GGWB 3HZMB 3Q1SL 1HINL 1JPFB 1QO3B 1Q0XH 3MA9L 1F13A 3DVGA 4U31A 3RVVD 2R1YB 5L7XH 4ZO8A 5A3IC 3IFOA 3OF6A 1ETZB 5C0CE 2UWEF 1HHJA 4G5ZL 4LF3B 1I3VA 3VD4A 2A9NL 1MQKH 1OAQH 4KJYB 4FFVC 3BKJH 5AAWA 1BD2A 1RURH 1YEJL 4LCUA 4Z76B 4PJDB 4NKDA 3JSSA 4HH8A 3ZKSD 5D7LE 1BZ9A 1J8HD 3L1OL 4PJ7A 2P5WB 3HMWL 3N9GL 4DN3L 2DQGL 3REVB 3HE6D 2XZAL 3PWJA 3MRLB 4HD9A 4MCYB 3B2VH 5DJZB 2PTTA 3EKCA 2BCKA 5E2VH 4NCDA 3SJVA 1OF2A 3VWKC 3MRNA 2DMBA 3MJ7B 3ISWA 4OZFH 4R4BB 4DTGL 4RQQB 3V7MA 3F7YB 4M6OH 5FCSH 4KUCD 5TF1L 3R06A 2F19H 3GGWA 2FJGA 3EYQD 3JWOC 4NQEA 2R1YA 1B4JL 4NJ9L 1W72L 4UAOC 1ETZA 5T33H 3HUJE 3D18A 5DJ2A 2YC1A 4HK0B 4LF3A 5MEPA 4G6MH 2A0LD 1GL4B 2XZCL 3PF2A 4MZ3A 4HUVA 1S7XA 4PRBA 3INUL 1NCDL 2AI0L 2P8MA 3OKKB 2PO6A 3AREA 3FZUD 1AGCA 4HKXA 5SX4H 1I8KA 4OSUH 3REVA 1A7NH 2DKUA 1AGDB 5D7IF 3NCJL 1MIEL 4XBPB 5DJZA 1LEGB 4HS3B 4X6EA 3L5WA 1AJ7L 3RGHA 3MJ7A 3ZKQD 1WIPA 5I1AB 4K3EL 3FRUB 4JPWL 4RQQA 5IT2L 4Y19B 1E4WL 1ES0B 5B8CC 3P9MA 1HOCB 4PB0H 1BF8A 4HWNA 5AWNH 1MWAH 4LKXA 4Z7WE 2CGRH 2PTUA 2XICA 1VACA 4ODSL 4OT1H 5J9PB 4U2YA 3W11D 4RMTA 3S34H 1WEJH 2C7UB 4WW2F 4XVTL 2HJFA 3QG6A 1MCLA 5GGVL 4AENB 4D0BB 3SPVA 3RPIB 1IQDA 1FZJB 1IT9L 5FAAA 4YE4H 4U0RC 4JVPA 5F71A 4PJ5E 3OKKA 3WFZA 4J4PA 1ZMYA 5TE6H 1MLBB 3MACL 2Z31D 2CUMA 1H3GA 3RVUD 5D2NC 2R2HA 2J4WL 1JZ5A 2C26A 1JTPA 1JNNL 1ADQL 1CLOH 2EC8A 2HG5A 2AJVH 3DYOA 5I8OL 1NUGA 4HS3A 1HHIB 4OCRH 1FO0A 3MTRA 4U7SA 3UYRH 3O41B 4Y19A 2NY6B 3B9KC 5ESVB 3O81A 4OFKA 2AXJA 2Q86B 2QHRH 1CL7L 1HOCA 2NTSP 3HC4H 3O8XA 3DGCR 3C5ZD 2X4SA 4NCC2 4D0BA 3DHMA 4LSUL 3TGXA 1LVEA 1ONQB 4UT6H 1HH9B 3RHWF 4XPGL 1YEIH 3REWB 4U7KA 1D5BB 1MAMH 4LNVA 4N0UB 5EZLB 3GSXB 2YXMA 3ARYA 1ORQB 1EPFA 1OCWH 2CMRL 2NX5D 3DI3B 4Y7MA 2I5YH 2C3XA 2OJZH 1HHIA 2ADIA 3VD9A 4Z77A 3O41A 4AH2B 2ICWJ 4WWID 5ESVA 2I07A 2AKRA 2Q86A 4YXLH 3OJMB 1WBZB 5DLML 1R3IL 4ONOA 1JBJA 2AJSH 3U0WL 3VXSD 3MBXH 3PXJA 2FO4A 2D7NA 3QJHA 4RGMC 2UZYB 1UJ3C 2NYYD 4J3TA 1GZQB 4YHMH 4G3YH 3CFIC 3DUSA 5JPMA 5GJTL 2PKDA 4LSSL 1MHHB 1BD2E 1HH9A 4OZGF 1MLCA 4PRHB 3TH2T 3BT2L 5T3ZL 2XA8L 1D5BA 3FRPA 3SE8H 5EZLA 2DL2A 1L6XA 4RFOH 5GS1C 5SWSA 5INCB 1ORQA 3V6OC 4HQQH 3RKDD 3BJ91 3ZHDA 3FB6A 2WW8A 5ECJE 5I1KL 1GC1C 3BPNC 1I7UB 4N5EC 3RHWK 3C9NA 2BNRA 5I30L 4X4ZA 4K9EL 3WL9B 3DROA 1M6OB 1KIQB 2XOTA 3SDXF 3SJVE 1N0XL 2JIXB 1PJ9A 5SX5K 3TO2B 1S5IL 3OAUH 1XGYL 4WCYL 4EOWL 4UIKH 1WBZA 4HEPG 3UROR 5KSBB 4ZAKC 1AP2B 3BZDA 2VLRA 1F58L 4EIZC 2SEBB 5I1HL 3TVMD 1REIA 5JHDB 4NQEE 5E6ZA 5BVJA 1L7TH 3RZCA 3G9AB 3I50L 3MRCB 2HFFB 5F7YC 3WS6A 1SJXA 4OQTL 1YMMD 4RDQF 3D3VB 3K74B 3PDDA 5C09D 4HFUH 4Q9BA 5JR1L 4KPHH 1F3DJ 3GZKA 4PRHA 1T1YB 3O3AA 5ETUA 2ZOKB 2JCCF 3D9AH 1MFDH 3DTXA 2DS4A 3MQIA 1S7RB 3HE7B 1HKFA 1DBAL 4NFBA 5INCA 4QXTB 4YC2C 5DD0L 5I73B 5IR1A 3D2UA 4NQUA 5IGXH 3WL9A 1NFIA 2Z92B 5L8JB 3QRGH 1C5BH 5D7KD 2EO9A 5KSBA 4ODUB 1MCOH 1AP2A 4TQEL 4Y8DC 2DQFB 1HWHB 3TBSB 1YYML 4AY0A 5JOEA 1QSZA 4GW1B 1X5JA 2HT2C 2BSTB 5JW4M 1O7SA 4HAGA 2XACC 2IBBA 3T0DA 1MCWM 1FFOB 5EUOB 3L3GA 1EAPA 3QG7L 3L95A 1I9RH 3K1DA 5LWYH 5A16B 3UPCA 1EEQA 2HRPL 5IMLB 1T1YA 2VLJD 2ZOKA 2DQJL 4OZHA 3QJFB 1WAAF 3H9HB 2QQNL 5EZIL 5FHAH 1S7RA 3HE7A 1DQLH 3MXWH 3V6ZB 1IZJA 3C60D 4QXTA 3R8QA 5D1QD 1QEWB 5D8JH 4MNHB 1MHEA 4XBGB 3GJEB 4J12A 4JKKA 1BJ8A 2PYFB 5F7MC 3C6LD 4OKDA 4R96B 3OV6A 4PJIB 2WUBH 1IC4L 1XAUA 1U8JB 4LLYB 4K23H 4OQ1A 5EPMB 3LKOA 4TYUA 1NMAL 1FNLA 3BPOB 4P5TD 4ODUA 1QFWM 5FYJE 3RY4A 1JMXA 4I77H 2BSTA 1CGTA 1JZ8A 4FQJL 4L1HA 1QSEE 1P6AB 4ZOBA 3FQXA 3U9PL 4ZYKB 1U8NB 4YXKH 3UJJL 1FFOA 3MFFB 5EUOA 1G84A 4JM4H 5DO2C 2AQ2A 3AS1A 3BRGC 1A6ZB 3KXFD 5I18H 4LCWD 5I2IB 5DVOA 4XMKL 5B38A 3H9HA 3DV6B 3ARGD 4LVHB 5IEKB 5DFVC 4YHZH 1QEWA 3DPBA 1IAOA 4MNHA 4XBGA 3GJEA 1NKRA 2EEAA 4WFHE 2OTWA 3D85D 4HWEH 1U8JA 2YMXH 1A4JB 3U4BH 1IGFL 2HFTA 2C5DC 1CS6A 3FB5A 5GS2H 1DQJA 1MFCH 4GAYB 3OJDB 2YUZA 2BX5A 2VLMD 5CMAB 1NSNH 4DGIL 4JO3L 3E8UH 4ZYKA 4Z7VF 3C2AL 3MFFA 4X6DF 4J6RL 3V6BR 3MOQA 4LVEA 1PEWA 3DVFA 3ARUA 4JQIH 2R69H 5I2IA 4NQVB 5L6YL 3DV6A 5IEKA 2XKNB 3DGGB 2VC2H 3H3PL 2CDFA 1QRND 1ZKAA 3LB6C 4FQHA 4M3KB 5D2LA 5SWSE 4YIQB 4JO2L 1EZVX 1GZPA 3SDDD 2BNRE 3TNNA 3CUPA 2XZZA 4N8CH 3S35L 1FIGL 4RISH 4OZ4B 4PJHF 1UM4H 2AGJH 1EGJA 4I18C 4R7NB 5TDNB 2H6PA 4G6JH 2VLRE 2AJYL 4IJ3B 2W07A 1RZ8B 4PJFF 4C4KO 3RWGB 2H3NA 4LEOA 4N9GB 1T2JA 2X4NA 1IAMA 4PG9A 3TPKA 2M26A 2FBJH 2R2EA 4JFFB 1Q0YH 3D39D 4LVOB 4JCLA 5DEGB 1I1AC 1NCAH 4JGMA 5MHSD 5KSAD 3SDAA 4S10A 3TWCH 4PRHE 2NY1D 3EYFA 1D5ZA 1UVQB 2XKNA 3QDGA 3FO0H 3DGGA 1AGEB 4OZIA 3QEQB 1HILB 4WI2A 5C0AA 2EDLA 3DX6B 5FK9B 2RFXB 4YIQA 3MLWL 1SHMA 2YPKA 5FA3B 2J88L 3FMGH 3IJSB 4X8XA 1FAIH 2W9EL 1AY1H 2GJJA 4YHLL 3VI3E 4HWUA 5DVMA 4BH7B 4JG1H 3TNMB 5I1GL 4LLWA 4XPHH 4ORZC 5D96B 2H8PB 1X5YA 3BGMB 5IUSA 1J11A 4OZ4A 1A6UL 1JGUH 1R5IA 3TZVB 4GXVH 5DQ9B 5DMIH 4JM2C 3RWGA 5FM5O 4Z7UE 1EGJH 2ATKB 1J1XL 2R4SH 3KJ4B 1DQQB 2FECI 4JFFA 1KCKA 1KPVA 1V7NL 4I3RH 3BH8B 4QRRD 2Z91B 2NZ9C 3HR5A 5ESQB 1NPUA 2NY0D 1VGKA 4OZHE 1HXYA 3A6CL 3QEQA 1CK0L 2GKIA 2RFXA 1WGOA 4FXKB 1U8HA 2HJKA 3GK8L 1BGXH 1IM3B 4OUUB 4YHPB 2IGFH 3VW3H 3HG1B 3GMOB 3UEZA 2AERT 4BH7A 3OKNB 1OWWA 3TNMA 3TV3L 3PWVA 3VJ6A 1FFNB 1GGUA 1YY8A 4YHYC 1BPVA 1K5NA 3KJ6L 3DRTB 4EQ3A 2FECL 4C56B 5F1IA 3TZVA 5HYFA 4MXQD 5DQ9A 5JZ7C 4NC2B 4J1UA 2W0FB 4PRPB 1EBAA 1K3IA 2JELL 2ATKA 2ZCLL 5MEQB 4WGWB 3DNKA 3VI4F 4XAWH 1DQQA 3CPLA 5C6TH 1IBGL 3H9ZA 2Y06H 1JE6A 3FQTB 1C5DB 1WT5A 3BH8A 4KKBD 1ED3B 5EUOE 3U4EB 4M4RA 3WNNA 1TJGL 2GJ6A 3MO1B 3QEGL 1CCZA 5F9OL 2BHYA 3F8UB 5IKCB 2CK0L 4ZD3L 4R4FL 1CXLA 2YWZA 3MNZB 4M48L 3BXNA 4RGOH 4MSWB 1DQML 1MI5A 5JW4N 5DK2B 5EO1A 1KN2H 1U92A 2P7TB 1IM3A 1B6UA 4V1DA 2Y23A 4OUUA 2B5IB 2DDQH 3HG1A 1T2QL 3U9UB 43CAB 2OCFD 3MLRL 4YHIB 5DFWH 3M07A 1IGTB 3TH3T 3DRTA 4Y1AA 3DXAA 2GYSA 2R2BA 2JJSC 3PWNA 4P4KB 2W0FA 1D3CA 3KR3L 5E99H 4ZOEA 4PS4H 2VDLL 3UPRB 1XF5B 4MJ5A 1J0JA 4WHCA 4HJ0D 2CLRB 3A67H 3RIAF 2APVA 3FQTA 1C5DA 1MRDH 5HHXL 2CO6B 3UJTH 5DRNB 3FT3B 3LZFL 3TBTA 2FSEA 3MO1A 1RK1A 1PBYA 4XNUL 3QWOB 4WEBL 4G6KH 1NKOA 5I1JL 4OV5B 3VFNA 2ZG1A 2X1QA 4L29A 3TN0D 1IJ9A 3MNZA 4OCWL 3ARFC 4NWUL 3QDJD 4ELMA 2EYSB 3DSNA 3LKQB 4R2GC 1T4KA 1RY7B 5D2LE 5D6DC 1ZVSB 4ZTOH 3LDBB 2ICWI 3U9UA 5E08L 5B4MC 4FS0A 2FCBA 4M7ZB 4YHIA 5IWLC 1UB6A 2L0DA 1IGTA 5TDPB 2ZPKL 1A7QH 5IB2A 5HI3C 3ZDYF 1KIUA 1FVCB 1PG7W 5EOQH 5HHVL 1BQSA 4QRPA 4H5SB 4O02L 1EXUB 4DGVH 1E28A 1YEKL 2ZUVA 5ENWA 1JGVH 1R3KB 1DVFA 4X7SH 4GSDH 2I9TB 1XF5A 1KEMH 5IBTH 5F9JA 5DRNA 3L7EB 4TUOA 3MJ6A 5GRWA 1NH6A 2KL6A 2E7BA 3G6AB 4TSAL 2EIZB 1NGQH 4JKPH 4OV5A 4E41A 4QHKJ 4MNQB 5INDB 1EO8H 4H8WH 4HIIB 5EIVA 4M8QA 3WXWH 4IEFB 3QDGE 4ZTPL 4OZIE 2AVGA 5C0AE 3GSNB 1SJEB 5I9QB 5F88A 5J1AB 4KV5E 4JFHE 1B2WL 1MH5B 1K8IB 1Z0NA 3KYOA 5GS0D 5DYOA 3QWRD 3P4MB 4YWGH 1U0QA 1E4XH 4UAOB 4HC1L 1JGLL 4EIGB 3VGAB 4GXUM 3HZVA 2DQHL 1FVCA 1OARH 5GXBB 5GHWL 4H5SA 4S1DC 2VH5L 1EXUA 1G7IB 1QQDA 1KYOJ 3I9GH 1GSMA 4BFIB 3N50A 5F7FA 4CNIB 1VFOA 2HWZL 1EERB 1LO3H 4LLQA 4JFFE 2WM0A 4M62H 4D0DB 2GAZA 4K8RL 3SKNB 1JP5A 3G6AA 5I1CH 2EDTA 3RVVC 3MCLL 2OL3L 3VWKA 3IXTA 4NN6C 5DHXB 1GRWA 4XI5D 3QEQE 5CFHA 4RWYL 1MEXH 5B8CB 1SJEA 4QF1B 3VXTB 3ZDXF 3V52L 4JJHA 1K8IA 3X14A 1KB5A 3Q0HA 2UZXB 3MV7D 4S1SH 1UWXK 1KPRA 4O9HL 3BW9B 4FNLH 1IGIL 1FH5L 1U8QB 4CKVX 5FUCC 3U7WL 1XGPB 2VAAA 1G7IA 2YA2A 4U0RB 1J5OH 1JMZA 3KHOA 3WSQH 3QHFH 3QXAA 1T1XA 1JZ2A 3CDGB 3RUGB 5I15L 2LTQB 1K85A 2MPAL 3QUZB 1DBKH 4P57A 1AR1C 1RZJC 2GJ6E 5IEHB 1P84K 2Y7QA 3EYQC 1U3YA 4N1CA 4L8DB 1U3HD 5FYKU 1N8ZA 2H1PH 3HI1B 3P0YL 4HX1B 5B8CA 4ZUUB 1LDSA 4PJXA 3V7AG 2A0LC 5HGHB 1MI5E 2YRZA 1MCNA 4V1DE 4W6XB 5E56A 2LAGB 3HG1E 5JUEL 3HFMH 4UINH 5KVFL 3FZUC 4I0CC 5FM4A 3ULUF 3BW9A 3JWOH 1HKLH 3GSWB 1XGPA 4Y1AE 1RZKL 3DXAE 2O61A 5L2KD 3F58H 4PV8B 4KTDH 4U1HA 3CDGA 4U6HA 3PGDB 2ADGA 4HPYL 3WEXB 3T4AA 5D2NA 3KPQB 3GM0A 5GQBA 3QUZA 4NO2B 3ZTJH 4OGXH 4FQLH 3EYVA 4X7EC 5MEND 1VFBB 3W11C 4U7MA 2ZNWA 3B9KA 2R1WA 4XC1L 2G5BB 4HX1A 1AI1H 1QFHA 4ELME 4ZUUA 3IDIB 3EDEA 3VG0L 3P9WB 3IVKB 2DJSA 3OJ2C 4RGMB 1O0VA 2FB4L 4U05A 5CGYD 3E6FB 2YKLL 1UJ3B 2MMXA 2QHLA 1W0WA 1CDUA 2FIKA 1XR9A 2Z31C 3FONA 2Q7YB 3RVUC 2XT1B 4JFYB 1WTGT 2W91A 3VFMB 1X4YA 1J1PH 2D4DA 1UYWL 1WQVT 3HI5H 2Z35B 4PV8A 4QRPE 3FB8B 4CN1A 4HJJL 2JE8A 1ZT1B 1H3XA 4NGHH 5DURB 1AIFB 4RMUA 3KPQA 5GS1B 1FORL 4NO2A 3T1FB 1N7MH 4S2SB 5I0ZA 4KAQL 2GITB 4I8DA 4YAQB 1G0DA 5F3HB 5C71A 3GB7A 1H9VA 4AM0A 1ULVA 3MJ9L 5IBUG 4MJIA 4M7LL 1CTOA 3X3FH 4E41E 1VA9A 4K3HA 1A5FH 4P59L 4YUEH 5T1KA 3QEUA 3STZA 2VL5A 3MJGX 5FO9B 1RJCA 4OCYL 5FOJA 4PBXA 3VXUD 2PW2B 1FVDB 2VDMH 3RY6C 1P2CB 4Z8FH 3E6FA 1UJ3A 3UC0H 1EAJA 2VXTH 1RUQH 3NPSB 1G1YA 3PJSB 3NAAL 1JHLL 4JFYA 3NIGE 32C2B 4DKAA 2ADFL 4PB9L 3T4YA 3WFCH 2Z35A 3U48A 3F62A 1NBVL 2W9LA 1NBYB 1ZA6A 5DT1H 1BFVL 4P3WA 1ZT1A 3KPRD 1OB1A 3WFDL 5EORL 4WI8A 4EVNA 5GS1A 3T1FA 5IROC 3V6OA 4S2SA 5BZDB 1OTSD 3HI6L 4ODXB 1QHPA 3W81A 1BAFH 2GEEA 3MYJA 1AXTL 5K9JL 2NYYC 1P9MC 3I6KA 2Q76B 4N1HB 1YEFH 1P5VA 1MCFA 3FQRA 2BXYA 1CGUA 1I75A 3O2DL 1NC4D 4ORGB 3FFCB 4ZAKA 3GBML 4N8VA 2PXYD 5HXMA 4GRWF 4DAGL 2PW2A 2YD2A 2FIRT 4KKNA 1R3JA 1IZKA 3ULUD 2UUDH 1HSBA 4NO5B 1AO7D 2FLRT 4JZOB 1OAXH 4WWKD 1Q1JL 3TH4T 2PYED 1RUKL 4PLOB 3RKDC 1N64L 5HYJB 5D93B 3CVIL 3V4VL 1QFOA 4GW4B 5DSCB 3BYTA 3RTQB 2BJMH 3ABZA 2QR0B 4FQXD 2QSTA 3ZLQC 1P1ZA 2VISB 1AKJB 4KZDL 5BZDA 4MJ6A 4FQ2H 3CLEL 5ACMA 3LH2L 4ODXA 3RP1A 3TESA 5IVXA 3KPSD 2Z4QB 3IU4L 5CCKH 1BQLL 3W9DB 3TVMC 3ARDB 3UTOA 1CFVL 1GC1H 1MAKA 2Q76A 3MGTB 1KJMA 2XNAB 1F5WA 1WZKA 4WW2C 4PY7B 4HJGB 4JGUA 4PJXE 1J05B 1SVCP 2CIKB 4NQCB 3QPQD 4HUMB 5HTSA 1J86A 1A02N 5JNYA 4DUXA 3WMSA 2EC9T 3B2UC 4NZUH 3T2PA 2V9TA 5B3NA 3L7FA 2ATPB 3HLAB 4NO5A 3WDJA 4DZBA 3IAGC 4NC0B 1ZSDB 2FJFB 4JY6B 4DCQB 5HYJA 4KI5F 2J12B 3FJTA 5F7EH 3OXSA 4GW4A 2FLBT 5DD3L 1DEEB 3FQUB 5C0DA 3MREA 1EFXA 5D2NE 2EYTB 2VISA 1JZ4A 3E3QC 4G80B 3LOWA 4JFOA 3KLAA 1UC6A 5K59F 2Z4QA 1ZS8B 1DDHB 4NUGL 3P9LB 4K2UL 3T0AA 5FUOL 3ARDA 3WFHB 1OPGH 1ZT7B 2IPUK 4K7FB 5IFAH 4PY7A 2BY2A 1WLHA 2E7CA 3MLTB 4HJGA 4NZRL 1IAII 2FD6L 5ADOL 1IGMH 4WUUD 4FABL 1A4KB 2CIKA 2DLTA 1H15B 3FQNB 4XWOD 2C3HA 1H8OA 3W5MA 4BUGA 3L5IA 4KY1H 4YBLC 2ATPA 4C4KT 3VFTB 1U6AL 4TSCH 3VD3A 1ZSDA 5JDSB 4OF3A 5D1QC 4JY6A 5DMGD 4DCQA 4Y8AA 1L7IH 3QPXL 4XB7A 3C6LC 3THML 3C6SB 1SJHA 1DEEA 4TOYL 4F15B 4JPKH 4GH7B 1KJ3H 3NABL 2EYTA 5DD5L 1JNHB 4YEFA 1TETL 4N0YH 1D5MB 1H8NA 3NCEB 4P2OD 1DDHA 5TQ0H 2P24A 4EDWL 2ZWLT 1MREH 1II4E 4K3DL 4XP6H 1ZT7A 4HIEB 4MJIE 4FQPA 5E2WL 3PHOA 1BECA 4U6YB 3LN9A 3MLTA 1XF4B 4MNGB 2ZUUA 1KCUL 3MUZ1 1MCSA 4ZODA 3M17B 3OR6B 1A14H 1A1MB 1CG9B 2I27N 4Y5XC 1N59B 3OZ9L 3IB4A 3ARGC 4UNUA 3VFTA 4DGYH 3AXLB 2C4FU 3ES6A 4M1CD 4K94L 4M1GH 4FZ8L 3BP5B 1YNKH 4AIOA 3EDFA 4OB5L 2IPTH 1A1NB 3EFDH 3DRQB 4F9PA 4DFIA 2V5RA 2BFVL 4Q7DA 1CGSL 3V6OE 3BKYL 2XN9B 4D94A 2F53B 5J4MA 3VFWB 4CU6A 1RK0A 3GIVB 2DQDH 4QTHB 1T3FB 3N85H 4PJ7F 4HIEA 4LSTL 1P4LB 3HPLA 4U6YA 1DBJL 1XF4A 4X83A 4MNGA 3AMKA 5AZ2L 5HDBF 4XCCH 5BS0B 2X4RA 4I18A 4K3JH 2WK2A 3D0LB 3RAJL 4H26A 1A1MA 1CG9A 3OKDB 2AJ3B 4W70A 5KJRL 4NKOB 3QXUA 1ZHNA 1KELH 2APTA 1WWAX 4LGSB 4XP4L 5ILTL 1IE5A 2R4RL 3RDTC 3PP3H 1BQHA 3CAFA 3AXLA 1I1AA 5ISZA 1MCJA 3NBNA 1ZTXL 1HZHL 3SDDC 5HSFA 1RVFL 1VEMA 1XIWB 4ODWA 3MA7B 1A1NA 5DGQA 4D9RD 3WJJC 1OSPL 1MRFL 2DJ4A 1QR1B 2OS7A 4IOFD 1LO5A 3LS4L 5DD6A 3HNVL 5IVXE 2YPVL 3O6FB 2JK5B 1DBBH 4PJDF 4Z18A 3S9DB 1UG9A 4QTHA 4UDTB 4YZFF 1KV3A 2IEPA 1E6OH 3VXRB 1E6JH 5JHLL 2IALB 4KRPB 2H26B 1RUPL 1XCTA 4MWFA 5F1SA 3P4LA 5KSUA 4DKEL 3NCBB 3EO0B 4JM2A 5KSAC 2I60L 3HMXA 3OKDA 2AJ3A 3DMMD 4HXBH 5CLWA 1UZ8B 3O6LH 2NY1C 4MQTB 5BZWB 3RBGA 4PYGA 3T0ED 1ZHKB 4ODHL 1EHLL 3T08A 3WNLA 2HKFH 2PN5A 4PLJD 3TBVA 4JDTL 2X9XA 4MAUL 3H6JA 2X4QA 4X99B 3MA7A 4JFQB 5EN2A 3O0RH 3WIFB 1AQDB 1AR2A 1BZ7A 5J13C 3IF1B 1HH6B 4HCRA 1JUFB 4U1KB 1JV5A 2HTKD 3PV6A 3MRQA 4LCCC 3ZT5A 5KANI 3Q5YA 4QRTB 1FYTB 2JK5A 5BRZD 4KMTL 4OD1H 2ZUTA 1TTUA 4UDTA 5EBGA 2AK4B 2B1AH 3VXRA 5JXED 4Y2DB 3HCVA 4FMKA 1KCSH 1N6UA 3QNYB 4HIXL 3O3BB 3IDUA 4LLDB 4XXCA 4LNRB 5CP7B 1CN4A 2NY0C 4GMTL 1W72B 1FN4B 4IIQB 4UQ2A 3FN0H 1BOGB 1A6VH 1DN0B 1ACYH 1H5BC 5CJBA 5AYQA 4CMMA 1F6LL 4JN1H 4LHJB 4UBDD 3OB8A 4YFDB 5HHOD 3CSYA 3AROA 1H3PH 1JHTA 4NRYB 1PX3A 2MWCA 4X99A 1IQWL 1UB5A 2B1HL 2C1PB 1QFUH 3W0WB 3RL2A 3D87B 1OLZA 3ARFB 4QKXB 1F90H 1LDPH 3IXAB 4LAQH 1JUFA 4R2GB 3BKML 4U1KA 3EAKA 2XV6B 1FYTA 4X6FA 4HCRH 3QCUH 1RMFH 1INEL 3O3UN 3PDOA 3OGCB 3MCKB 3IGAA 2EKJA 4PJ8B 2BVYA 1NUNB 4BJLA 3QNYA 4KKBC 5DQDH 5C8JA 2JJSA 2XA3A 4LLDA 1I3UA 2CQVA 4Z7QE 4LNRA 4PTUA 1MFAL 2QSVA 1MJUL 1YDPB 1BJMA 1HINH 2CJUH 4OLZL 3CFBB 1DN0A 4BFBD 3QDHA 2JB6A 1Z2KA 1UM6H 1MCIA 2F5AL 1C7SA 2G75A 4G5ZH 2A9NH 4RMWA 2GSIB 1YEJH 4NRYA 5H37G 1OGAB 1N2RB 1KCVH 4EDXB 3H7BB 3ZT6A 5IIEB 2VXUL 1S9VB 2C1PA 3NZ8B 4LSVL 1G9MC 4Z5RB 2ZCHL 1YJDC 4O58L 3ARFA 3HMWH 1T0MA 4HXAL 4HBCH 4KU1A 1FZOA 4HFWB 4KMQA 3PIQB 2DQTH 1FV1B 4PP2B 4JEGB 3DJ9A 2R0WL 1PG7H 2JTDA 1AD9A 5IWLA 2IPKB 3ESUF 4ENED 3MCKA 2P5WD 3GNML 4HJ0C 4XP1L 4DN4L 5FOBA 5EC1A 4DTGH 3RI5K 2YR3A 4TSBL 1OAZL 4G8IB 4HLZH 4OD3L 5DZNA 4YGVB 3RA7H 4EI5B 3EOTL 1JZ6A 2NY3C 3QUKA 1NCCL 3QHTC 2I9LA 2XRAL 3JUYA 1FLRH 3TN0C 4I5BA 4JFXA 2CKNA 3K3QA 1HHKA 3BPCB 2GTWB 2QKIA 5ISZE 1BMGA 3NH7L 3OTTA 1K4CB 4EDXA 5IIEA 3H7BA 1S9VA 1R5WB 3NZ8A 3INUH 4WU7B 1NCDH 1S7TB 3G5YB 3H42L 1KC5L 2GUOA 4MLSA 4YPJA 4PREB 5I66A 5F9WC 2COQA 3JWDL 4TVPH 1LE9B 4HFWA 2HLFD 1FV1A 4M00A 3MODL 4ZFOL 4RWHA 4L4TA 3S3JA 4MQXD 3DIFB 5L9DL 5K9OB 4N0FB 3HE6B 4O4YL 5IT2H 1J10A 3VG9B 3B6SB 4YGVA 5FGSA 2EDJA 2VIRA 5CSBA 2G2RB 2XIDA 2FBOJ 3LKNB 4JR9L 3MJ8B 4LVNB 1WJ3A 4ERSH 3BPCA 1VFUA 5MERB 2DWEA 3HZKB 4FQQB 2BDNH 5KSBF 4IRZL 1K4CA 1X4XA 2GHWB 2NR6D 4HHAA 1KLUA 3ZHKA 4KTEL 5GS0C 1MCPL 3NZHH 2IMMA 2Y5TB 1FDLL 1LEIB 4WU7A 4NQDD 4OLWH 2DLGA 3G5YA 5E4EC 4PREA 1YQVH 4JKWA 1RIHH 4JANB 2EE9A 4GKOA 5FYLH 4LU5L 1JNNH 4UTAL 1ADQH 3BH9A 2Y25A 4OKVB 1J8HA 5KW9H 1AH1A 1L0XA 3PGCB 5K9OA 4N0FA 2F54A 1B0RB 3VXRE 1KPUA 3V0VB 4YPGB 3MUGA 3DETD 2IMNA 4XP5H 2R39A 1CL7H 4N90D 1QACA 3GSVB 5J6GB 2X44D 1I3RA 4XWGL 2AEIT 4GRMB 3UTPE 3L3KB 4Y5VC 1DUZA 1PKOA 2AP2A 2NY6D 2V7HB 3CFCH 4XI5C 5E2JA 1HEZB 5D70L 5MERA 3HZKA 3PGFH 4RZCB 3ARWA 4UV7L 5DRWB 5CEXA 5LQBL 3OKMA 1XZ0A 2VMFA 1WICA 2UY7A 4P0DA 3ULVL 4H1LA 1N26A 3BZEA 3MRRA 3GSQA 4NKMA 4XPFL 5EA0L 3Q6GL 3WN5B 2CMRH 2VDKH 3SE4C 1AC0A 3P40A 1NCNA 3BEVB 2OR8A 3JTTB 4MQ7A 3T2OA 5C0IA 3PGCA 1A9EA 1A7BA 1B0RA 2Z31B 4MYWB 1A6TA 2MCG1 5DZOA 1FPTL 5F1OB 4KJQD 3X11B 4F3FA 2J7LA 3FCTA 4XRCA 3DX9A 1LK3H 4LLMA 1U42A 3MXVH 4KZEH 4GG8A 4GRMA 4I0PD 5FYKD 3L3KA 1GGBL 1U3HC 4GAGL 1M7DA 4A2LA 4PJIF 2JJVA 3I6LD 1IKFH 2Z93B 1HSAB 1G7JA 4RNRA 4L3CB 3BZ4B 2OR9H 4RZCA 3BO8B 1MVUB 3HAEB 4JFPB 4OCNC 1X7QA 1ZT4A 5C0RL 1QBLL 1CVRA 2F58L 5TQ2L 1RZJH 3C5ZB 4TNWF 3CFEB 4O2EB 3MBEB 4TVPE 3UJIL 2EKSB 4JREB 3CC5B 4L5FH 1MCBA 4WFGE 4KVNH 2P46B 1RU9L 1RUML 3JVGC 2VDOL 3W39A 5I1KH 3MRPA 3GMLA 5C3LD 4PJEB 1C1EH 4KROC 4K9EH 3K2UH 2J3SA 2Z31A 4GMSL 2QSQA 3ZDZE 2GY7B 4RIRA 4NHCL 1QNZH 1HHHB 4WCYH 4R90H 3O9WD 4A6YL 2DQCL 2NX5B 4GUPB 4WI9A 2VB5A 1Z3GL 1JZ7A 1A6AB 5JXAH 5C2UB 2OZ4A 3EFFB 2JIXD 1M7IB 4GQPH 3ROOB 2EXYD 5SWQB 5DUML 1CWVA 3LQZB 3TT1L 1R6VA 2J8UB 1G0XA 4L3CA 1ACZA 3BO8A 1PZ5B 4ZOCA 2VJXA 2Q7NA 3EYOA 4JPVH 43C9B 5JHDD 1WC7B 5CGYC 3C5ZA 3CFEA 1VDGA 1ZA3B 2EKSA 4ETQA 2UWEA 5HPOA 15C8L 5FYLE 3KYNA 4XX1E 4WNQB 2AS5M 3D3VD 3U0TB 5DD0H 1FL5A 3HZYB 2CRMA 2YD7A 2J5LC 3DECA 4HBQA 5E2TH 4PJEA 3RY6A 2HT4D 4L4TE 5ICZA 4J8RA 4JO1L 3EYSH 1ZGLB 1KSRA 3ELAT 1X5HA 4P5KB 1HHHA 1ERNA 5D7IB 2Q8BL 4NHUB 3Q5TA 1A6AA 1P84J 4QXGH 3QEHA 1LEKB 3EFFA 1GOGA 1ROWA 5A2IH 1I3GL 3L9RB 4TUKH 5SWQA 1ZHBB 3IFPB 2OZ4H 5IROA 2XY1A 3OAZH 2QTEA 3IT8D 4PJ9D 1I4FA 4S11A 4O2CB 1MF2L 1PZ5A 1NJ9B 1IC7L 5LXGL 1D6VL 3VXSA 1PY4A 4GQ9H 2E8ZA 4WV1C 5EFIA 3JV6A 5CIPB 4LPCA 2HRPH 3EDKA 1P9MA 2DYPB 2VXQL 4JZNB 2VABB 1AFVL 5EZIH 3VRLE 3FRPG 4WNQA 1NBZB 1YMMB 2Q1EA 3U0TA 2IBZX 5L8LB 4XCEA 2Y6SC 2ZUXA 4KHXL 2O93L 5IK3B 1BBJA 1J8HE 1CD1A 2BSRB 3QI9D 3WHXA 2KZ1B 4GKSB 2F54E 1ZGLA 1NAMA 2A77H 2I26N 3VMNA 5FUCE 5D7IA 4XCNB 3SCMB 1NMAH 1OTSC 3DSFH 1MCCA 1Q38A 2HH0H 5FF6B 4KI1A 3MLVH 3T3ME 2BRRL 1LEKA 1PSKL 2HKHL 4HDIB 3L9RA 4QRUA 3L3IA 4RRPA 2DLIA 3MOAH 1FGNL 2EDHA 2R0LH 2PXYC 1CF8L 1T66D 4M5ZH 4F58L 3TVMA 5CIPA 3O2VL 4G9FB 3MRFA 5C0FA 4QXWA 1YMHA 3ULUC 5I6XC 4JZNA 5HYSB 1MRCH 3GJFB 4WWKC 4WW2A 1YMMA 3B9EA 3FL7A 4DQOH 3NTCH 5C09A 3S4SG 3GRWL 3QUMA 5JORB 2A1WH 4QHNB 1A3QA 2VLJB 2OSLB 3LRSA 3VGDA 3MOBL 4NOFA 1ZV5A 3C60B 4R8WL 3T77B 4X0KB 3IDJB 1J7VR 4WFED 3D0VB 3UBXI 3KVQA 1NAMH 1RZ7L 2CIIB 5FF6A 3C6LB 1MELA 4HK3J 3NVQA 1G9NC 1C12B 2XTLA 4N0CD 1UKSA 1SEQL 2BVPA 4K7PX 4P5TB 4AMKH 1A0QL 3KS0J 5C0JB 4AL8L 3MLXL 3QPQC 1KLGA 1XR8B 4I3SH 1M7XA 1A1OB 5I0DA 1D5IL 2QQLH 1WISA 5HYSA 3O11A 5CIPH 3UTTB 1G6VK 1S5HB 3AS3A 4P2YA 1FG9C 4JDZB 3PQYE 3H3PH 4WUKH 2X4PA 4XVUD 5IW1A 4O2FB 1G9EA 1Q9LA 3QXDA 4QHNA 4A6YA 1I7ZA 2VLJA 1HK6A 5LBSH 1K4DA 5TE7L 4M43H 1HI6B 1KJ2B 3BIAX 5D1QA 3IDJA 5EWIH 2W65B 1T89C 1KG0B 2CIIA 3C6LA 1TCRB 3O2WH 4FFZL 1XMWA 3D85B 5L88H 3E2HC 2VZSA 5L0QB 1A64A 1QKZL 4GS7C 4LRIC 4NIKB 4NRZA 1RZFL 3L3OA 5D71L 5DK0A 4P5TA 5C0JA 2VDQL 4NM8L 1JZ3A 1N4XL 2VQ1A 3U79A 1X3DA 3UMTA 2R56L 3TP4A 4M6MH 3CX5K 1X5FA 4Q6YA 1A1OA 4KKCD 2V2TB 1KTDA 2UWEE 5B38G 2ICEA 3RNKA 1B0WA 1WBYB 2IH3A 5HGDB 4O2FA 2Y36L 5T1LD 3GJFH 4OZGA 3FT4B 4JN2A 4U33A 3KXFA 3B4NA 4HWBL 2FH6A 4LCWA 4Y5XA 1QUNA 4YK4B 1BREA 3TCLA 1PG7X 4YHLH 3ARGA 3O4LB 1HI6A 1E27B 1F8TH 1KJ2A 1Y18B 5C0GB 4F7CB 1CFSA 4YHOH 1QFWI 2W65A 1IARB 1FFRA 1KG0A 3L3HB 3CFJB 1JWSA 1N6QH 1TCRA 1LQSR 4M7JH 2FATL 4NYLB 2LAAA 4R97C 3G6DL 3SDXA 3D85A 3QO1A 5DUPL 3BZFA 2CLZB 5ANMA 4LP5A 3LAFA 5IMKB 3K8LA 1KJVB 5ADPL 1M05B 1V7NH 5TGBB 5JW3L 1IGJB 2FRGP 5EU6D 3VXSE 5CEZL 1G9ML 2VNCA 4Y4KD 3T0VA 1YJDL 5GJSL 3VA6A 2V2TA 2GK0B 1SBSH 3E6HB 3P0GB 5DRZB 4YFLF 5DA0B 4Y5YB 1UQSB 4AG4H 3D39B 4R0LC 1VENA 1K2DB 1QSVA 4M1CC 3S36L 3WHE1 4G8GB 5JW5B 1QFWL 3FT4A 3V4PH 1EEUA 2D0FA 4W6WB 5IFHH 2JCCA 1IKNC 4E0RB 2NY1B 1E27A 5EO0B 5C0GA 5JQ6L 4F7CA 1QRNA 2OJEB 4S1QL 1K6QL 5D7IE 1GPOH 3L3HA 1KJ2H 1U8LA 4JRYD 2PR4L 4Y0GA 1J12A 1DFBL 3SDDA 1NCWH 3WJJA 4AEHH 2ITCA 4P2RA 2JELH 1QBBA 2ZCLH 3ET9F 1DANU 3W9EB 5J13B 5IMKA 1KJVA 4C56D 4TULL 1M05A 3B43A 4PV9B 1IGJA 3CK0H 4MHHI 1SMAA 4JB9L 4U2ZA 4AIXA 5LJYH 4PRPD 2VN4A 2OM5A 4ZOAA 3QEGH 3TJEL 4CJ1A 5GZND 3U46B 3N1PC 3SGDI 3E6HA 5DRZA 4ZD3H 4ZFZB 4LEXH 3D39A 4R4FH 4DK6A 2YWYA 4IBLT 4M48H 1YMME 4QRRB 4KI5C 1DQMH 5C09E 5KSAA 1H3WM 3EYUL 2NNAB 5E8NA 2NY0B 3MRKB 4KVCL 4E0RA 1CGWA 1WAAA 5T1MB 5C0ND 3WNKA 1HCVA 3QO0B 5DC0A 4KRLB 1NFKA 1BFTA 2OJEA 2ZUSA 1NUFA 4MD5B 4GG6B 3ME0A 4BSVB 3IFNL 1EJOH 1T22B 4EBQH 2YXFA 2D2OA 1MFEL 4K71B 3LMJL 3Q5OA 5LGJB 1T80A 3P4NB 3MV9A 2VDLH 3HAEG 5GRUH 4J7RA 4ZDHA 1NANI 1SY6A 2X1WL 5D7KE 3E3QE 3NCFB 4X8JA 2H41A 4PV9A 4LCCA 1N6VA 1G7LA 1FCCA 4P4KD 4PUBH 4POZD 1DEDA 3UTSB 3UX9B 3IDMB 4HWZA 3DMMC 4QXUL 3U46A 3CIQA 2ITDB 5I1JH 4QT5B 4RAUB 4Z7VB 3T0EC 3RUGF 4D2NA 4NWUH 4PLJC 1KIRB 4QRRA 4X6DB 2YSSB 1F97A 2P8LB 4PG2C 3MRKA 1JPST 3QA3B 2VLJE 1EMTL 5ABDE 2DQUL 2L7UA 4UB0L 4JKMA 4PTTB 2CDGA 1H5BA 5C07B 4ETYA 4EKXA 3T8XB 4GG6A 4BSVA 2FZ3B 3VFUB 5EU4A 1CFQB 2AXHA 4X6BB 5IB1B 5DJ6B 1WZLA 1JWMB 3WNPA 4O02H 1L6ZA 5LGJA 2A6JA 1YEKH 2NW2B 2CO7B 5JXEC 4MJ4A 4Q0XH 2FX7H 2VE6A 4JHBA 4F8TA 3DV4A 3WV0A 2YD6A 1DBMH 1CZ8H 3QHZH 1Q8MA 1RJLB 1ZEAL 4PJFB 3IDMA 4HKBB 2O5XL 3EO9L 4OLYH 1KEGH 3VXQB 3U1SL 1YPZB 4QT5A 4RAUA 4Z7VA 3K46A 3OX8A 3VXMD 5SV3A 2O5ZL 3VH8B 1KIRA 2X4OB 4X6DA 4UBDC 1MVFA 3ARPA 3C8KB 4ZUWA 4OI8A 4OZGE 2A6KA 3K4ZA 3QA3A 3KXFE 1Z9OA 1JI2A 4LCWE 3WFBL 1NMCB 4MA7H 1PD6A 4Z6AT 4MNQD 1NLDL 3QDJB 2CDEB 5F7DB 1SYVA 3ARQA 3NGBB 3BSZL 1CFQA 4X6BA 5DJ6A 1JWMA 1NBQA 2VH5H 1UCTA 3SDXE 4FHBD 3QQ4A 1IFHL 2BK8A 5J3HD 6FABH 3NFPB 5ANME 4PJHA 4AT6A 3BD5A 5IVZA 4JFED 4QNPF 5GSVB 2BNQE 1NC2B 2OP4L 3P11L 4PJFA 3SOBH 1LILA 5C08E 3RVWD 5GSRB 3QULA 2GT9B 2ICES 2IQ9H 2VLME 3VXQA 1WK0A 3I02B 3MCLH 1CICD 5HHQA 3OHXB 3U0PA 5HDOA 4S0SD 3GO1H 3C8KA 4RWYH 2P45B 5AD0B 3CZJA 2JCCE 5DEZA 3X12B 3TN0A 2C1OA 5GRJH 3QDJA 1QLRA 1QRNE 2EE2A 3U7WH 3R1GH 5DTFB 4CU7A 3VFGL 4MAYB 2H9GB 1MPAH 2FR4B 1UM5H 1CFTB 1R3HA 2F9BT 4ENEC 5KS9B 1UWGH 4P2RE 1T2XA 3BWAB 1OTUD 3OG6B 4U1GB 3BD3A 3M8OL 5JMOC 5I15H 1G6RA 5GSVA 4OLVH 4B7LA 4G8EA 4OCXH 4POUB 3VFPA 4AEIL 1KULA 1V3LA 2XPGA 2UUDK 3P77B 5H2BB 4LMQI 3I02A 3Q6FB 3VXPB 1OOAA 1BVKB 4LLUB 2WNGA 5EBWB 1NGZA 3WKMH 2L7JA 5J57B 4GJTB 1A6WL 3RWJB 5MHSE 1KLFA 5EULV 5FV2A 5AD0A 3T2NH 3V95A 5SWZD 3FHAA 3FFDB 4LFHG 4YR6A 3OGOE 3QDMD 4KHTL 3HRPA 3X12A 1WAAE 4Y5VB 1EH9A 1H0DA 4FFYL 5HBBA 3LN4B 4JY4B 1NGPL 5CJQH 3GI9L 1GGCH 4CRPA 1FBIH 5DMKB 1OAKH 2HLFC 5ESAB 3K81A 3DHJA 4NNYB 1W2KT 3DBXB 4M9PA 3PWPD 3QWRA 2P5EB 1CFTA 3MV7B 4MQXC 1UWEL 1FQ9C 2FH8A 3MV9E 3NIFF 1OAYL 1L4IA 1J0YA 3C09B 4U6VH 3LRGA 4Z9KB 5TDOA 4C83B 2YHGA 1MJ7L 3ECBB 2D3VA 1JRHI 3X17A 3RU8L 1WZ1L 4ZO6A 3P77A 5T3XL 1BVKA 2GK2A 5E2UL 4EQ2A 3BP6B 4LLUA 4XMPH 3A0OA 2F8OA 1IL1A 1JF6A 5DI8A 5JA8B 4P48A 4KK9D 5EUKB 4ACPA 1FG2B 2ZUWA 2NR6C 3FFDA 3QFDB 1U3HB 4Y5VA 3TBWB 5BV7L 2YKLH 4U1NB 3IFLL 2FX9L 4JY4A 3S5LG 5HYQA 3UXFA 4CDHA 1QVOA 1UYWH 5I8EB 1JRHL 2D31B 2R0KL 1QLFA 4LCYA 5E5MA 3MV7A 3P4OA 2YZ1A 4BQ8A 5GS0H 1HIMH 1QLEL 3N1GC 3DETC 4KQ3L 5IW6B 2ZZUT 2XG5A 3SE4A 1DLHB 1IEBB 3N0PB 3MGOA 1I8MA 1FYHB 5DURD 5FKPB 4I1NB 3B3IB 1OD7A 4Z7VE 3KPMA 5TPWH 4X7FC 2NY6C 1YNLH 3T0XA 4NT6A 2WQRA 4X6DE 3DYMA 3VRJA 4KWUA 2NY5C 4W4OC 3QNZB 4LASH 2X7LB 1DP0A 2YA0A 4NQSA 1NMBL 3TYFB 1FGVL 3ZKXB 5KVEL 5J12B 3R4DA 1U3HA 5MENB 4XC3L 3LQAL 1AD0B 3GMNB 3PNWB 3QISA 4UMGA 4XZUA 5I8EA 4UOW1 5KSVA 4HGWA 5DEFA 5DJDA 4M7LT 2HLAA 4KMLB 1GXEA 1HXMB 1FNFA 5EU5B 5ELIA 2R15A 3S88L 5EORH 1A3LH 4PJHE 5L2KA 4KJQC 5HI5D 5ICYA 5CWSB 1U91B 3JVGA 5DFTA 5ID0A 1R24B 2A74B 1GJIA 1I7RB 3HI6H 2AJXL 2J5LB 4PJFE 2W38A 4PJGB 4I0PC 5FKPA 3CDFA 1CLCA 5GRXG 4F9LC 5F93C 4BH8A 4OLUL 2DIBA 1KIPB 3EOAA 2Q8AH 2AV1B 3GBMH 3QNZA 3TYFA 2X7LA 4FQ1H 2H2PD 4H20L 4WW1B 4KGJA 4JRXA 2D7TL 5BJTB 4W6YB 2QQQA 1FP5A 4ZFFB 3PNWA 3FFCD 2EZ0D 1RUKH 1S7VB 2VTFA 4WFFE 3V4VH 4IDJL 1GCFA 3WD5H 4UT7L 1CXKA 1EEYB 5EU5A 1BVLB 4IOIA 2X89D 1BM3L 3O9WC 1U91A 2CKBL 2ZSWB 3WXVH 4HG4K 1UEYA 2A74A 3A6OA 3F6LA 1IAIM 3IU4H 4ODBD 3RTQD 1P4BH 4Z0BL 2IANB 5F1KC 2EXYC 5I1IH 4MDJA 4X5LA 1YEHH 1AKJD 1OD9A 2A83A 2QL1A 4CJ0A 4KQ4L 4DVRL 2VWEC 4LSQL 4S1RH 4F7TB 3WDIA 5MP6L 1CLZL 4FG6D 4R6UA 2DBLL 4P9HL 1NC4B 1AGFA 4NQCD 3VXUA 1M71B 4WV1A 4QRSB 5D7SL 2HT4C 3U82B 3U36B 1MCEA 4TTDD 3KPPB 5I6XB 1KENH 3J8F7 1PFCA 1PX4A 2PYEB 5I73C 2ZSWA 1R0AL 4QYOA 1KN4H 2X1XR 1TJHL 4P5MA 3MRJB 1VADA 2PTVA 2RJMA 1A2YB 1GHFL 1T83C 3KPRA 3QIWD 3VI4E 5DD1L 3B8YA 4FQXB 2MHAB 4FTVE 1MSPA 4PJ9C 4NZTH 5D5MF 5JLZB 2FD6H 4MB4A 3KPSB 3U7YL 3FT2B 5HY9A 3DVNB 4Z0XB 4F7TA 4CADA 2VXVL 2Y07L 3BE1L 1KBGH 2XQYK 1CLYL 3LS5L 1GGIH 4ODTH 1YEEL 3V9FA 4LARH 4ZFGH 4P9MH 1AE6L 2RBLA 5EC2B 4Q9RL 2PXYA 3UTQB 4KKAD 1HNFA 4OGYH 3WUZA 2ENSA 35C8L 3H9SB 3THMH 3MV7E 1NLBL 2F5BH 4NPYB 3I6GA 2DAVA 3KPPA 2F74A 1AO7A 3TFKD 4JZJB 4WWKA 4DJMA 2G60H 4LBEB 4NQTA 1BWWA 4UILL 3VXOB 1F4XL 3ARZA 2PYEA 4XHJC 4LDLB 4I48B 4E9LA 1TETH 3MRJA 2VDNL 5DJ0B 3V5KA 4EDWH 1DR9A 3MV11 3QWQB 3R0NA 4H25B 4YJZL 5DJAA 3CU1A 4FQXA 1TZIB 3IJYA 3QCTL 3BPOC 5JLZA 3KPSA 3FT2A 4L9LC 2X9WA 3DVNA 4Z0XA 1T66C 5DDHA 1U8KA 5CBEA 3HNTL 1ORSB 4UUJA 1C08A 5J89A 1FE8H 3E2HB 1F4WH 1TPXB 3F5WA 4EI6B 3WIHA 1HQ4B 1UFUA 1N5YL 2AXGA 1TZGH 4WUUB 5EC2A 5E94B 5IG7A 2ESVB 3DURA 1BLNB 1RULL 1XGRA 2W9DL 4HEME 1DL7H 3BQUB 4NUJB 4PLNC 4R7DB 3CNKA 4LVHC 5FO7B 4M6NH 4WDIB 4QRQA 2IH1A 5E8OA 2DKSA 5FDWB 3GKZA 5BW7C 5FGBC 3ZDYE 5L2KE 4I48A 1FZMB 2EYRA 3SQOL 3ZL4L 4M03A 5DJ0A 1S7UB 4ONFH 4N0CC 1HN1A 4HUXB 4H25A 3OPZH 3EW3B 3FAXA 1Q0XL 1FNSH 2MCPH 1T89A 5L7XL 2XN9D 4P2OB 2F53D 4ESKA 2DMKA 3RAJH 2YBRB 1MQKL 1OAQL 4JFZH 3BKJL 1RURL 4JRXE 4DVBB 1T6WA 4KXZH 4HKZA 4LRIA 4MDIB 1HQ4A 3KGRA 4WUUA 4FZEH 4QGTA 2YUWA 5BS0D 2EDFA 1J0HA 3WIHH 5C7XH 4E5XB 1BLNA 4Q58C 3DO3A 5E5UB 1P7KB 1JTOA 1RVFH 4R7DA 3W5NA 3B2VL 5FO7A 3IETB 3BESR 4YDLB 4OI9A 1WFNA 5FYJD 3CXDH 1I7TA 3RQ3A 3X13B 1CE6A 5SX4I 1A22B 1FZMA 3G6JF 1XGTB 3KNBA 2V17L 3LS4H 4ZUVB 1N5AB 2HN7A 1QSED 2GJZA 4M6OL 4CMHB 1S7UA 1XIWD 2HFGH 3MR9A 4HUXA 2F19L 2D9CA 5GISH 4K55A 4JLRB 3GMPA 5E1AB 1SM3H 3T09A 4BKLB 3G5XA 4DKEH 5T33L 3QXTA 3O6FD 1LP9B 2FO1A 4IJ3C 3BEWA 2KH2B 2CRIA 3BUTA 2YBRA 4HLJA 5CJ8A 4G6ML 4KKCC 1LNUB 2WINB 4KRPD 4FQCH 5IESH 5I8CB 4WTZG 1PKQB 3ZDXE 3SKUD 1ZHLB 4OSUL 3VXUE 4QHLA 5IB3B 4DZ8B 3BMVA 4NC1C 3QZWA 5DJXB 4R0LA 3MRIB 3RVXC 4ZUVA 1XGTA 2VR5A 4RA0C 4Y89A 1NDMB 4RSVA 1IKNA 4AK1A 1L9MA 3KPRE 4PB0L 1JPGA 5D96C 4JY5H 2R0ZH 2CGRL 4JLRA 5E1AA 4OT1L 4BKLA 3TZVC 2DWDB 3S34L 1WEJL 4HIHB 4Y4KC 4NFCA 2W0PA 4IRJD 1JF1B 2AK4D 1YC7A 2WINA 4Y2DD