2P5EE

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eE02
2FL5A 3VWKB 3GI8H 2P45B 4Z5RA 3VXUD 4JVWA 5DZLA 4U7SA 2R2HA 4LVOB 1FORH 1N3NB 2OL3A 1ADQH 1WBYB 2A73A 2PTUA 3S36H 3U7YL 2XZCL 4WV1A 1MPAL 3GMMA 3KPNB 4R0LB 4YNYA 1BD2A 2FH8A 2ZUSA 3GMQB 2ITCB 2X4PA 3H8NA 1SY6L 5FHAH 5INDB 1BIIA 1IZJA 1YEKH 4S1QL 2JIXD 3TBYA 4ZFZA 3ES6B 2A38A 4PJFF 4GSDL 3E0GA 4LF3A 4IBLT 1Y0LA 3CSBA 3MNZB 5HY9A 2NY6D 4WW2B 5D96B 1N4XH 4Y19D 2NY6C 2FLBT 2Z35A 1I8IB 1LO4L 5JLZA 4X6EA 2Q3AA 1U41A 2YMXL 5ESVA 4GAJL 4D9LH 2R4SH 4V2BA 1CF8H 4U05A 3UJTH 4OLWH 1D9KA 1FVCB 5EU6E 4R9HA 2AV1A 3WDJA 2IF7A 3WIHL 3LKSB 3WIIH 4MJIB 4EUPA 3OX8A 5CJBA 5F3BA 2IAND 1EERB 4JFED 1GJIA 1MHCA 1TTGA 2F58H 5FYLD 5FF6B 3JV6A 5IKCB 1ZKAA 5BS0A 1EGJL 4GLRH 4Z8FL 2Y7QA 3BRFA 2BOCA 3DWTA 3M07A 1MIEH 4XI5C 4KI5D 1R5IB 1AP2B 2D7TL 3CCHA 4KI5C 2BVTA 1FBIL 1KNOB 3MCLL 2FHFA 1F3DJ 3WCYA 4M43L 1WJ3A 1D6VH 1P6FA 5DRXB 3U4EA 5HYSB 1FNGA 4KVNH 5JZ7D 3GMNB 5JZ7C 1NAKL 3NH7H 4MVBD 5SWSB 4MJ6B 1J11A 1NCTA 2EC9U 5EZIH 4OCWL 1CFVH 2XQBL 4YIQB 3ULUE 3QEHB 3U0PA 1KPUA 5E6ID 3CK0L 4GBXD 4G7VH 3UZQA 4R8WH 3MOAL 3VGBA 4CRPA 2UVEA 5E6IC 4GBXC 2WQ8A 3BW9B 5A2KH 3BSZH 3QIBD 3VD5A 4YZFF 2DYPA 4L1DA 4ZOAA 4WHTB 4MCYA 5HHOB 4N8VA 3O9WA 2DB8A 1XIWB 1X5IA 5D7IB 1U92B 4XMPH 3R1GH 3UJJL 4MS8D 3DSFL 3LKQB 5HTSA 3PHOB 3VW3L 4V1DB 4LCCC 5D8JL 4OZIF 1OW0C 1KIRB 2ZCKL 3PQYE 4QRRE 4QRPD 3GUTB 1JZ4A 3P3YA 3C8KA 3MJ8B 1JK8B 5C7XL 3WS3B 1Y6KR 3GSUB 5HYFA 1D7FA 4YDJB 1IAKB 4MA8L 1QYGL 4E42A 1G84A 1T0MA 1OLZA 2ZPKL 3GSNL 5EU5A 4XRCA 1T83C 3QHFL 2HVKA 1H3WM 2ZSWB 1KYOJ 3SHSA 4G8GE 1KB5B 4NO0B 2EDYA 3QFJB 4AK1A 1G7MB 3CFJB 4H88H 3FO0H 4HK3J 2R1YB 4LQFL 4N1CA 1DQDH 5T1KA 1N64H 3KXFB 2XXMB 1FGNH 3F12A 1YMMB 3SE3A 3KLAB 1K8DA 1TJGL 3VI4F 1JP5A 1ZHNB 4UTAL 4NDMB 2VKXA 1OTSC 2OZ4H 4LCIH 4Z7VF 1JYNA 1JTOA 5FEBA 3P9LA 2BDNL 1ZTXH 3L7EB 1CFNA 3QIUA 4HMEA 3MJ7A 5JIHA 5HGDA 3FFCB 5TF1H 4NWUH 4BKLA 3BKML 3TGXA 3HPLB 4NO3B 1O5DT 4U1HA 3VDAA 2APWA 3WNOA 3BKJL 4YHLH 4QTHA 4KZEH 2DQDH 1T4KA 1N59A 1C08A 4Z95L 1DBKL 1M7IB 3MA9L 5CWSA 4MDIA 3IXTB 4UTBL 4OCXH 3DYMA 3GIVA 1XGYH 1N6VA 2B4CC 2N1KA 5JW5A 1KFAH 1A3LL 3VFNB 5F1OB 4XPGL 1TVDA 4AQ1B 5ACMA 4TPRL 2OR9L 4XCNA 4HIEB 2F53B 2WBJA 4NT6A 5IB1B 4IHOB 1R24A 2QADD 4L4TD 3RAJL 1XCQB 5HHME 4RMVA 1JFQL 2B2XH 5IK3B 1RVFH 2RB8A 2JCCE 2YXFA 3MBEB 4MJ5B 1BQUA 2D7NA 3HCVA 1CBVL 3KHQA 3D2UD 4HHAB 3UTSD 4PP2A 3VFMB 4P46D 4PJEA 3HKFA 1S9WA 4P46C 4G9DA 1MLCA 5DJDB 5FHBH 5A43C 2JKXA 1BBDL 1V3MA 5I1JL 3QDMB 3QRGH 3OJVC 1DCLA 4JB9H 1XGTA 5FYLL 3WDIA 4X7FC 3DHMA 3WLBB 4F58L 2XWBB 5E95B 5F89A 1XR9B 5BO1H 4O9HL 3SOBH 5I9QC 4YH6A 2O5XH 1ORQB 4LSDA 2VR9A 1JZ5A 2B5IC 1QLRA 3HZYB 4O2FB 3Q6FB 4G9FB 1BWMA 1YY9C 2FX8L 3LS4L 4LPVA 1QFPA 3U4BH 1TZIB 1FO0A 1INQB 2VQTA 3MLYL 4N5EC 3QUYB 4PJGB 4BQBA 5DFVC 5D72L 3OGCA 4ZSOE 1T03H 2ITDA 3QHZL 1NGZA 2NY0D 3RU8H 5C08D 4OD2B 1DR9A 4IRJA 1T5WA 2NY0C 3LB6D 4Y4FB 4PFEA 3I02A 1FJ1A 1LILA 2D3VA 1OB1B 5FOJA 3F58H 3VXRD 3X3GH 5MEQA 3SCMA 2QQKH 2C3XA 1O7VA 2DD8H 4R0LA 3MROB 3IXAA 5DGRA 3Q5TA 4U3XA 4HJ0D 3RZCD 3P9MA 1NC2A 2D31B 5IFJA 4IRSD 3RZCC 5A40E 1S9VA 4HK3N 1TVBB 2Y6SD 2VLRA 4LPCA 1JGDA 5DRZB 1DQMH 3KPMB 2Y6SC 4HX1B 4X0KB 3KJ6H 3CSPA 3QPXH 5I73B 4WW2A 1LMKA 5EO1A 2R69L 5GGTA 5E94A 2FGWH 3U7AA 3MBXH 3TC9A 2F8VA 4G8FB 1H9VA 5KVEL 1KGCE 5TGBB 1JMZA 3U30C 3UTTE 5L7XL 1RIUH 4ONOA 2NR6D 1FC1A 1MEXH 1QOKA 5BZWB 4S11A 5DRWB 4PJIE 2EH7L 4OF6A 4X7CC 3SKUD 5MENB 5CSBA 1VA9A 2GSGB 2Z93B 3T09A 3IKCA 1NMCB 3RUGF 1JPFA 2J88H 4I0PB 3UYRL 3H42L 3BZEB 2JB5H 3WL9A 4I4WB 3LV3B 1N7MH 1NFDE 5GRYA 1IKFL 2X9YA 1S9XA 5FF6A 5IKCA 2MMXA 3LQAH 1PLGL 1T7ZA 3MA7A 5IHZB 4NQED 5GS0H 1CLYH 3DGGB 5DEFB 3SO3C 2C3HA 5M94B 1MRCH 3KYAA 3IAQA 4BYHA 4U0RC 1R5IA 1U8MA 2YN5A 1RULH 3K1KC 5IT2L 4TSAL 1FVDA 1AIFA 3H9ZA 5DYOB 4GS7B 5IVXA 3TIEB 4QGTA 3VGFA 1CGTA 1Q9OB 2BSRB 4ELKB 4O02H 3SJVD 2W0KA 1KELH 1BM3H 2A9NL 4OM0H 2B4CL 4HUMB 5DMGC 2OYPA 4GKNA 3WIFB 5BVJA 3P11L 4WWKD 3U6RA 2FJHB 4JFOB 3TH4T 3HNSH 4Z0XA 3TZVA 4YIQA 4F37F 1LE5B 2KQNA 4WWKC 4QHKI 3WKML 1KTLB 5HI5C 2ZCLL 4BELD 2JJSC 1ERNA 1V7NL 2ZOKB 3QDJB 3S88H 4RBPK 4OZFA 3S97C 1IEAA 4G8EA 1S7QA 5HHOA 5I8KL 2W9DH 3V0WH 5D7IA 5EC2B 1QFWM 3HFMH 1A7QL 2VC2L 2R56H 4DW2H 3T8XA 1IKNA 4LSTL 1AGCB 3AREC 5ACZB 3ARVA 3ZYIA 5D1ZA 3KAAA 2I60L 2GK0B 3GUTA 3RVWC 2Z8SA 4X7EC 3WS3A 4NQCD 3U9PL 2VXVH 3KPSD 3PV6A 2X5PA 2DLFH 5IESL 1U6AL 3GO1H 4P48A 3VFWA 1QTYT 2DQHL 4QEGA 4L5FH 1ZEAL 4DGIL 3TNNB 5DD0L 2PYFB 1Q0YH 2VIRB 1YEJH 4NO0A 4ALAH 3ULUH 4WO4A 1G7MA 3CFJA 1A5FL 4ELME 1HHJB 3C2AH 1RUML 3EKCA 3T0AA 1KXTB 2YD9A 3ZKSD 3QWOB 1FNHA 5E9DD 5DD3L 3MR9B 1CE6B 1T7WA 3RIAK 2IQ9H 3KXFA 4M5ZH 1TXKA 3VRJA 1NBVL 3NCMA 2X42A 4WW2F 3MODH 4J2XA 3SDXB 1CL7I 2X4NB 4OLVH 4WJ5B 5D9SA 4CVWA 1WFOA 2EEDA 1U9KA 3WNPA 5CCKL 3W39A 3L7EA 4JFDB 4YGVB 1AKJD 4RGMB 4WUUD 5DXWA 3BAEH 4M7JH 1NCDH 1KLGB 4NO3A 2EEBA 4KDTA 4Q97A 3EO1A 4J7RA 3VG0L 1NBYB 1NFIB 2MPAH 2PXYB 5EZOH 3C8HA 4S0TD 5CEYB 1QFOA 1BFVL 4W68A 5DSCA 2EXYD 2AXJA 4TRPH 3RI5K 3W9DA 2NY3D 2Q76A 3ALPA 4E41E 2O26U 1UYWH 3H2WA 4GKOA 3T0EA 1P9MC 2DLGA 5ICXB 4PRNB 4MDJB 4ZPTB 2GFBB 3CFCL 4CMMA 3MO1B 4R7DB 4Z7UB 5E2UL 2Q8AH 2APFA 3G6DL 3HG1D 1J1XL 3QQNA 4KPHL 3I50L 5IJVB 5CJXA 4HIEA 4OCRH 2R2CA 2OBGA 2PW2A 2ADJA 2VZUA 4K07A 4BSVB 3QRFM 1DBAL 3SN6N 1G7PB 2YPVL 4AH2A 1QFWL 3D39E 2JIXB 1JZ3A 2MQ3A 2VKWA 3ZHDA 4NQXB 5JPNA 4ZUSB 4NJ9L 2NY6B 4MJ5A 4NUJB 1LDPH 3T2OA 4FQIL 4Y19B 3I3EA 2BNQD 5D7KD 1VENA 1U8NB 3TN0A 1ZHKB 4CN1A 1SYVB 2F54E 3O41A 4PY7A 1WSST 1IC7H 3NA9H 1FG2B 4OFPA 3OKMB 2XZZA 4N8CL 3L9RB 3LHPL 4I77H 4WCYL 1JCKA 4PRPE 3H9SA 4JG1H 2Q7NA 2FBJH 2UZIL 3AS0A 4JE4B 5D7IF 1L9NA 3GIZL 4P2QD 1F90H 2BVQA 3MOQA 2IANB 1Q9KA 3I6GB 1QVOB 2QL1A 4JFEB 4OQ1A 3RHWK 4HUVB 1UACH 3O81A 2DI9A 4P9ML 2K1MA 1ORQA 1F6LL 3N85H 1OAZH 1AGEB 3MV8A 4GH7B 4JHAL 3RWHB 1A7PL 1HHIB 1UWEH 4JZOB 4O2FA 1A1NB 5JHDE 3HC4L 4P3WA 4XNXH 1VEMA 4PJGA 1PG7X 4I18B 4K3GA 2D03H 1QQDB 3OQ3B 1L4IA 1NQBA 2IALB 1MJJB 3QEQA 4RGNC 3WNKA 4Y4FA 2P5WE 4HDIB 2FX7L 3LSOA 3WS6C 3O2VL 3PE9A 2R9HC 3ZDZF 4ZXBD 5C8JB 3KGRA 1D5ZA 4ZXBC 3U48A 2EZ0C 4B41A 5E6IB 3FO2B 4GBXB 5C2BH 3MROA 2JK5A 1MHHB 4K3HA 4O2CB 4MD5B 4LSUH 3H7LA 2D31A 1OAQH 2FNBA 5GJSL 3BZ4A 1JWUA 4FQJH 4QXUH 1E27A 4UILL 3O8XC 5T5FH 4XB8A 3VXTB 3A0OA 4OD3L 3DO3A 3LIZL 4R7NB 3DURB 1MUJA 4OB5H 5C0CA 4QRPB 1HQ4B 1KENH 1TZHA 5TGBA 3MRMB 3SE9H 3UC0H 1HXMA 5J8OA 5FO7A 3D3VD 2DKSA 1TTFA 1V7MH 1RIVH 2HH0H 2PTTB 5BZWA 5DRWA 1OD7A 3DIFB 3NTCH 4IDJL 5MENA 2MSPA 3NACL 4LBEB 2Z93A 3G6AA 2R1WB 2BVOB 5DUBA 1E4WL 4XMLL 3TCXA 2DQGH 4GG6B 1A4KA 1DSFL 1FIEA 3WIHA 1ACZA 2HFEA 4XP6H 1UXWB 2VXUL 4CU7A 4GMTH 5EFIB 1Q72L 4UV7H 4MHHG 2HRLA 5J11C 1KEMH 2MOVA 4I2XE 1ETZB 1IGYA 3DGGA 5DEFA 4HS8H 1KG0B 1KCUH 1YEFL 2V9QA 5F88A 1IT9H 4X4ME 3MLWL 4H26B 4H1LH 5KOMC 3LZFL 4JFFD 1IM9D 3V0AC 1QRNE 4E0RB 4TUKH 4NPYB 5IMKA 2IEPA 2XG5A 1A7OL 2NY1D 4I5BA 4PRAB 1S3KH 5T3XD 3VGHA 4HWBH 4PRDB 2MCG1 2NY1C 5CGYC 5CJOH 3EO9L 5D71L 5DHVH 4YBQC 3Q48A 1J0IA 3MRFB 5HGBA 5L2KB 3OAZK 1LE5A 1I9RL 1FNLA 4KMTH 5FA3A 5IFHH 2GCYB 1FPTH 3GI8L 4KHTH 3DMMD 1KIUA 4KMLB 4NBYB 2IAMD 1NL0H 1ADQL 3OWEA 5DVKA 4NKIH 3IJYA 3S36L 4NO5B 4AZ8A 4FZEL 4NZDA 4A6YH 4GRWB 5EULV 4QNPE 3VD4A 4L4TB 4TSCL 3QIWC 5T1MA 3NFPB 4N90D 3L3KA 1O0VA 5ACZA 5FHAL 3TYGL 3ARFD 2VABA 3U82B 4YGAB 6FABH 4R96A 4LLUA 3D2UB 3UTSB 2DWDB 3OKNB 5BRZD 4OKDA 3KLSA 3GGWB 4P46B 1A3RH 3A6OA 5DJCA 4UU9A 3QDAA 1TZGH 3OKKA 1I3RA 3EYOB 4KRLB 1NAMH 2R4SL 4Q0XH 1PSKH 3EYVB 1CF8L 3MRKA 4MMZC 3UJTL 1TLKA 1S9YB 4ZQKB 2CRIA 5MERA 2H1PL 3DX8A 4M6NH 2LU4A 3WIIL 4NRZB 3IDYC 1ZVHA 5IVZB 1KSRA 1BZQK 1S7VB 3BO8B 4WJ5A 2F58L 2HFTA 4XP1H 2X9XA 1JL8A 1OCWL 1UB5B 2EDNA 3T3PF 5EDXA 4LKXA 2A1WH 4KVCH 5IBUB 1KLGA 2J3SA 5CP7B 3ZMRA 3CGTA 5J57B 1NBYA 1NFIA 2PXYA 3KLHC 2IADA 3IT8D 2EXWD 5DVNA 2NY0B 4R26H 2Q87A 1CD0A 4JFQA 5C08B 5B22A 3V7AG 2EXWC 1D6VL 4KJQC 4UNUA 1ZT4A 2ICEA 3JBG7 4XXDA 5E2VH 2VZ3A 1OTTC 3L3GB 3ROLB 3F62A 1M6OB 4PRNA 3NH7L 2GFBA 1S7SA 2DI8A 3D48R 4Z7UA 4NN7B 3IVKA 2DQJL 2BP3A 1MFNA 1CFVL 4XGZB 4OLEA 3ZKND 4N9OB 4JJ5A 4UOW0 5I66A 1CXHA 4WDIA 1CDUA 1MCFA 3RZCB 4G7VL 4R8WL 4IRSB 5AEAA 2X4OA 3BSZL 4HBCH 2EE2A 4WFED 5KSVA 1MI5D 5J0BA 4NQXA 4HULB 2CK2A 4ZUSA 5I2IA 4XMPL 3R1GL 4EDXB 1DJSA 1U8IB 4EI5C 2EYRB 2W0PA 5CSZB 1LEKA 1DBBH 1U8NA 1UB6B 1ZHKA 2CIIB 3FTGB 1SYVA 4J23A 1WV7T 2EDBA 1FG2A 1DTUA 4U1SA 5JXED 3OKMA 4XC1H 4PJBB 5JXEC 4PGDB 1M71B 3LAFA 3T2NL 4L3ED 4XVSH 4JRXD 3OAYK 3WHXB 5FUCC 5I8OH 1T0NA 1IAIM 3CX2A 1YNLH 3ALWA 4FQPA 4JQVC 1H0DB 1UG9A 4EOWH 1QVOA 1D5IH 3UTPE 5H2BB 5IBUG 1PDKA 4H88L 3RWHA 3SO3B 1WGOA 3FO0L 3VXPB 1UKTA 4U0RB 4JQXC 4P3DB 1RMFH 3AB0C 1FGNL 3DLQR 4FXGA 2E7LA 2W0LA 2IQAB 1P4BH 1JN6B 2XY1A 2YBRB 1OQXA 4LCIL 3LQAC 1QHPA 4B50A 5GS0D 4Y5VC 5HDQH 5GS0C 3BPCB 1ZTXL 2NZ9D 1UZ6F 3OG6B 2PYED 5TF1L 1LHZA 4ZNEE 4Y4HD 4U1IA 3ZSTA 2GJJA 2WIMA 1KIQB 4NOBA 5ESQA 4WWKB 4HGWB 1FYHB 1NBQA 4YHLL 2H6PA 4G6FD 4KZEL 5D70L 3V6ZB 2DQDL 5T3ZE 3CU7A 2ORBL 1EFXD 1H8SA 3FO2A 4MQ7B 5C6TH 4OCXL 4DKAA 1I7UB 4DUVA 3SDXF 1FC2D 1XGYL 4MD5A 5JW3H 2JB6B 5EU6D 1KFAL 1LE9A 4PJDE 4EQ2A 4XCEA 5DZOA 1HSBB 2F15A 1UM6L 4DN3H 3VXTA 2AK1H 1HEZA 5HHQA 3FAWA 4LCCA 3ZDXE 2AJYH 3MLUH 2DM2A 4RAVA 4CVXB 3G5YB 2KL6A 4C56E 5ISZE 1EXUB 3MRMA 4DWHA 3NPSC 4NQCB 3FT2B 3KPSB 2P47B 4Z7UF 3E6HA 2PTTA 2OM5A 1T83A 2VXTL 3F7VB 4WU7B 3WNNA 1W0WA 2FD6H 2VQUA 2V2WB 3ARBC 1MJUH 3HAEH 4M5YH 4ODWA 5FHBL 2JF1A 4K8RH 2ZSVA 4PJCA 4LNRB 4XPHH 5E9DB 1KJ3H 1EZVY 4OKVA 3F65A 3LQZB 4JB9L 3SY0A 1CE1H 3ULUD 1G9MH 2Z0BA 2UUDK 2K3TA 4YR6B 4DVBA 5BO1L 3SOBL 5HYJE 2O5XL 5D6CB 4QTIH 3QQ9D 1XF3B 5EUOB 1ZA3A 3AS2A 1Y18A 3MRRB 4LHJB 5I75B 5EIIB 2OJZH 4ZO9A 5HVWA 1JHTA 5GGRB 4LVHC 2WQRA 5IR1B 3WBDA 4RAUA 1B0WA 2YRLA 1CGXA 3PWUA 4ODHH 5L2KA 1T03L 5F6IC 3JV0A 2BERA 2XPGB 3PQYD 1LO3H 3ALXA 2GCYA 4QRRD 4TOYH 1ZVSB 4ZAKA 4KI5F 3F58L 3X3GL 1U2CA 2QQKL 3V5HB 3ESVF 5GS1C 5L9DH 1KPVB 2DD8L 1JUFA 1TJHH 4KGJA 4YWGH 4U1MB 4D0BB 4G8GD 2D0FA 3S4SA 5FM5O 5DJ0A 1OGAA 3QUKA 1LD9B 2OLDA 4D2NA 1I1FB 2BSTB 2DM7A 1IAII 5DTFB 4DAGH 4PGJA 1CLCA 1DQML 4PG2C 2BNQB 4Z0BH 3WO3B 3KJ6L 4JDVB 4NKQB 1YPZA 5I1KH 1UEMA 3GGWA 3REWA 3QPXL 4LLQB 5H37H 4AIZA 2FGWL 3MBXL 3GKZA 3V0VB 3BWAA 4LLDB 4RMWA 5EBGA 1M4KA 5EZLB 3VD9A 4LLYA 3FONA 1MEXL 1YYMH 5JXAH 4ZQKA 3ZL4H 3OKDB 4P2QB 2J8UF 3OGOE 1U3HD 3DNKA 4P3CH 4M1DH 1U3HC 2BJMH 2J88L 1L6ZA 1P84J 1FL5A 4JPWH 1N7ML 4WFGE 1T6VN 5EOQH 3DVIA 3OB0H 4GKZB 3O2WH 1TETH 3TO4D 1AD9B 5GS0L 1CLYL 3W9EA 1EBPA 3TO4C 1MRCL 1MQKH 4YXHH 8FABB 3QULA 1EDQA 1VKXA 1QSFA 3LEYH 1RULL 3CLFH 3O3AB 4EI6B 1MCEA 1XF1A 4PJHA 3S36X 5HHMD 4GG6F 3N06B 4NQDA 1M7XA 3KYOA 5JIKA 2ZG1A 1RIHH 5CHNB 5DUML 3RWFB 4O02L 3ZT5A 4F9PC 4ZXBB 1BM3L 4M7LH 1C5BH 4OM0L 3QQ4B 3ROLA 3PHQB 1X5AA 2EIEA 1NCCH 4P4KC 5K9OA 3HNSL 4U2ZA 4H5SA 4NGHH 3DO7B 1G7LB 3P2TA 1EJOL 3LH2L 3S88L 4DOHE 5ENWA 1BD2E 4X9BA 1VDGA 3O8XB 2Q20A 1OP3H 2W9DL 1OP5K 1G6RL 3V0WL 3PDOA 4TVPE 2O61A 3DI2B 4EDXA 1X9QA 1U8IA 3SDAA 2R56L 4DW2L 5AG8A 5L8LB 3FO1A 1CK0L 3B9KC 4OBSA 1FCGA 3D3VB 2EC9T 3BWUC 4HWZA 4PJBA 1I85C 1BGXH 1LO2H 1U8PB 4PGDA 1M71A 1JYWA 1RU9H 3D0VB 2VXVL 4QXTB 1TCRB 2DLFL 4ODSH 3GO1L 1AE6H 4WU5A 5MP6H 4YK4C 1ES0A 4GRWF 2QR0B 4OFYD 1QSEA 2F74B 1Q0YL 1U8KB 2AQ1A 5CJQH 3AM8C 4P57A 4ALAL 3MRGA 4U6XB 3ULUL 5J11B 4XNUL 1I1RA 2LVEA 3C2AL 4HQQH 2IPTH 3SDYH 3VXPA 5IP4A 2AI0H 4BZYA 4EKXA 4CNIB 1MWAH 1IC4L 1NGPH 4KI1A 1U8LB 4AEHH 1JWSB 2IQ9L 4M5ZL 1K9TA 5B8CC 4FFZL 2YPLA 4IIQC 3V7MA 3UPRB 4F7TA 1R3KA 4BZ2H 4O58H 5I16B 3M17A 3MODL 4JFFB 1IM9B 1MCBA 4OLVL 4G43B 2FGZA 3U36A 2C7UB 4Y2DD 2ICCA 2NY1B 4OI8A 4KKCD 3BAEL 4M7JL 1IE5A 4Y16D 2X4RB 5D2LA 1KIQA 4C57C 4KKCC 4Y16C 2MPAL 5EZOL 3OKYA 3MNWA 1IGIH 4JKPH 1KGCD 1MVFA 3DMMB 4TRPL 1DUYA 4JZNB 4XC3H 2IAMB 1UYWL 5CJ5A 2JB6A 3TO2B 4P23C 4BM7A 5KBNC 2W07A 2F8XC 1GAFH 1UZ8B 1P4LA 2E7BA 2Q8AL 3HMWL 5DWUH 5BXFA 3T2QA 3QIWB 3AREA 1A21A 3QNXA 3RVVD 4U1JB 4XX1G 3RVVC 2AJVH 1MFDH 3REVA 3G5YA 4U2YA 2DF3A 5FGCB 4PRHE 1EXUA 1Z9OA 3BYYA 2H3NA 5BRZB 5I8CB 1LDPL 1YJDH 3L3OB 3LS5H 5LWYH 2UZYB 2MTPA 2HP4A 1QBAA 2V2WA 4QLRA 3DV6B 1IC7L 3NA9L 5DGQA 5T3ZH 4JVUA 1FL6A 3OHXB 1A6ZA 1A7RH 3VFSB 2A6DA 2FBJL 2Z31D 5DK2A 3JUYA 2DMBA 4PLJC 3IDYB 4LVEA 1A9EA 3ARDD 5DK0B 1ZLVH 3UPCA 4PLKC 3ARDC 3ETBF 1UACL 5ESAA 1RJLA 1OAZL 3N85L 4LCUB 1MJ7H 1UWEL 3RVUC 4U6TA 1FLTX 4FOMA 1M05B 4JFXB 2Y25A 3V6FB 4XNXL 4JZJC 3QI9C 4NQVB 5DLMH 5BW7C 3HRZB 4G5ZH 2D03L 1J7VR 1L7IH 3DECA 5IF0A 4Q9CA 5L88H 3QXDA 5EG6C 4K55A 1P9MA 3VFUB 5I1CH 2EDFA 2CH8A 1MOEA 4GAGH 2NY2C 4M9PA 3P4NA 5C0GA 1EVUA 4KK5C 5HHVH 3B9AA 3QXUA 3N9GH 4TSBH 1Y6MR 4OTXH 1KT2B 2PCPB 2W60B 4N9GB 2BHUA 1ADQA 5IB2B 2C3VA 3ARGD 5C2BL 3NPZB 4D0BA 1NGXB 3RBGA 4D9QE 3ARGC 5DQ9B 1GOGA 4LSUL 5IMMB 5CINH 1CXIA 4M62L 3I75B 1FNAA 1MI5B 5T1DH 5GSVB 5HJ3B 3V4UH 1LO0H 1ACYH 2XG4A 4EI5B 4PJXA 4UMGA 4L3AA 2ZJSH 2YWZA 3PGCB 5T5FL 4JGMA 5C0IB 4NQTA 4OGYL 3O6LH 1QBLH 4GG8B 1UJ3C 2CDEB 4OB5L 1F6AB 3IYLW 5HBBA 4JRYA 1HI6B 3KPRA 1KENL 4PJEE 3SE9L 3UC0L 4L3EB 1FN4A 4JRXB 1RIVL 2GTZB 2AP2A 2N4IA 3NTCL 3LEXB 1YEEH 3G5XA 2ZZUT 3NIFE 3AY4C 4B7IA 4JKLA 1BVLB 4ZD3H 4GXUM 2E9IA 3ISWA 4ZUVB 4XP6L 1HK6A 2XN9A 3AB0B 3BH9B 1V3LA 2HFGH 4GKZA 4JR9H 3EZ8A 3QISA 5GRJH 4UV7L 1NGWA 1KEML 2XA3A 3TP4A 2NW2A 4W70A 4HS8L 4RWHA 3I3DA 1KCUL 1UVQB 1BJ1H 4Y5VB 5CIPA 1IT9L 3NA4A 2DIBA 3TNMA 4PGBB 4G6AD 1NCWH 1C5CH 3D39D 2J12B 4FZ8H 3G9AB 4G6AC 4J6RH 3WS6A 1T1ZB 2B1HH 4OUUA 4Y4HB 1SQ2N 2MFNA 2Z4QA 3MRJB 3RWFA 5E8NB 3JWDL 4UQ3B 1GH7A 4MAYA 1S3KL 1CGYA 3HC0A 3PHQA 4HWBL 1F4AA 3MGTB 1VFOA 5CJOL 1EFXB 2F54D 1R5VB 4YHNA 4KMTL 3ROOA 2JJTC 2NXZD 5IFHL 5IIEA 5EU6B 1FPTL 3HZMB 1ITCA 1GIGH 2I5YH 3GDBA 3MFFB 3B83A 4PRPD 5EUOF 4LCYB 1RUQL 1EH9A 3O8XA 4NKIL 1I4FB 5KSAD 4GQPH 5KSAC 2M1KA 2AEQH 3EHBC 4A6YL 2VLRE 5HD8C 5IFAH 1G6RB 3H0TA 4EDWH 4ZTOH 1FFPA 1JPGA 4M6MH 5JHDD 1DLFH 3BH8A 2X4QB 4Q2ZA 1S9KC 3EGSA 1P4IH 1QPPA 6FABL 1U8PA 4JLRB 3L95A 4AL8H 2VLJA 3HI6H 4QXTA 5BJTB 1WFTA 2P5EE 3DTXB 4GAYB 3IFPB 4KKAD 4JFPB 5D1XC 1IL1B 4KFZC 1D5MB 1FE8L 2QR0A 1TZGL 1L7TH 2ZUXA 3CH8A 4X7TB 2OL3H 4LDOB 1U8KA 4F2MB 1PSKL 3GB7B 5E8PA 1UCTA 1EEYB 4K7FB 5FV1L 3PWNA 1EHLH 1ZVYA 4Z6AT 3MRLB 4K8RD 2CUHA 5FGBA 1JWSA 4M6NL 3IU3B 3H7BA 4L4VD 4K8RC 3VFTB 3TF7C 1YN6B 3UPRA 3IS0X 1SYSA 4TVPH 4HS6B 4JG0H 3S35H 3WEXB 3T4AB 3CZFB 1E4XI 3G04A 4G43A 5AYUH 4LVHB 4D3CH 3BOVA 3GMOB 2OZ4A 4PJAA 2A1WL 1ND0B 4KVCL 5IVXE 5C71A 4QF1B 5F6IB 3I6KA 3F7YB 4MQXD 2B0SH 3KS0J 4WNQB 4R26L 1EA9C 4MQXC 3PQYB 1F8TL 3IETB 1XH3B 4QRRB 25C8L 3BEWA 1FZJA 3GSWB 1HDMB 4POYA 1FZKB 1X44A 1IVLA 1T04A 4RNRB 5C09D 3TO2A 5GS1B 1CICD 1UXSB 4DUXA 3TV3H 1A6PA 1TQBC 3O3EA 1DZBA 3SGEH 1QSVA 4NRXB 5FB8A 1Q38A 4G8GB 4EUPH 3QIWA 2FB4H 1IFHH 4KV5E 1CD1B 1WLHA 2VDQL 3P4MA 3SGDI 1JGVH 3H3PH 4RA0C 3R8BB 4BH7B 4HBCL 1VSCA 4MCZA 3T2PA 4QHUA 4HMCA 4ZMAT 5C92A 3W5NA 1MCPH 5BQ7A 3L3IB 4JFZH 4LHUD 3GSOA 3IF1B 3IJSA 3RA7H 2HLAB 3L3OA 4H25B 3O3DB 5EU4B 3T3ME 1DBBL 2OXHA 4Q9RH 4W4NA 4NUGH 5F1NA 3VMOA 2HJLB 1CGVA 3RWJB 1QRND 2FWOA 4XC1L 4RISH 4XVSL 1U3HB 2W0FA 4JPVH 5I8OL 5BCAA 2LU3A 3QG7H 5FV2A 1YNLL 1NLBH 4IMLB 4PJ5D 2YRPA 5DK0A 4HC1H 4TUJB 4EOWL 4HKJB 1DBMH 3TO4B 2VDRH 3RJDA 2V2TA 2EDHA 1J8KA 1DE4B 3MOBH 4NKOB 2NMSA 4PUBH 1RMFL 4JFXA 3V6FA 2XWJA 4NO2A 4NQVA 4RX4D 5L2JB 1XEDA 3L3JA 1P4BL 5HHMB 3DOSA 3UX9B 3GMLB 4DKEL 2YPKA 2JCCB 4LASH 4KDWA 5HDQL 5EIQA 5LGJA 1LEIA 2HT3C 1N0XH 1HOCA 4P4KB 2ICES 2BXYA 3LN5B 4HIHB 1U58B 2C4XA 2WWKT 1QLEH 1IZKA 1YNTA 2H8PB 3NCCB 3T0EE 3LRSA 4LOUC 2OJEB 3C9NB 5C6TL 1RD6A 5GQBA 1XR8B 4QWWC 3O2DA 1OM3H 4QRSB 1HWGB 5JW3L 4YPJA 1W0YT 1GVIA 3GZKA 2X1OA 4RMUA 3NIGE 4EI5A 2EO1A 1G7QA 3AMKA 3FT4B 4DN3L 2AK1L 3B9KB 3GSRA 1PJ9A 1HE7A 1WBZB 2AJYL 1RSFA 3MLUL 4GG8A 1GGYA 4XTRD 2NYYD 4FQXA 4QYOB 4XTRC 2NYYC 4BQ8A 3AMLA 2CLRB 1HH6A 4YK4B 4ZSOB 3UP1A 3Q6GH 4OGZA 5JNYA 4YO0A 4LGPB 3U7WH 1MH5A 4JQVA 3QO0B 5CMAB 2FD6L 1R5WA 2HKFH 1U95B 5DD6B 1MJUL 1I7RA 4M5YL 4QRUB 4LNVA 1KJMB 4K8RL 4PRIE 1SEQH 1DQLH 1S7WA 3CC5B 4NM4H 1KJ3L 3BH9A 2AK4A 4HUUB 5B8CB 1JGLH 4IIQB 3WV0A 8CGTA 3MV8E 4K94H 1CE1L 5E8EB 1G9ML 5DEGB 1XGRA 3TA3D 3QUXC 1UVQA 3JTTA 4OCSH 2NNAA 2CIKA 4Y5VA 1A1MB 3FHQA 3CUPB 1UM4H 4PGBA 3FOMB 4Y2DB 5ID1B 4HWEH 3CX5K 4KK6C 3MNVB 5AZEL 4NFDA 4H1LB 4Y16B 2OJZL 4ZO7A 2V9RA 3QEQE 3DUUB 3OKEA 2Z91B 3V6BR 5E56A 3A67H 1YZZA 1D3CA 2C1OB 2FIKB 5C0NC 3GM8A 4ODHL 3TYFB 1IM3B 2VJXA 3I6LE 1F5WA 3SKNB 1A6TB 4PJIB 3MFFA 4NM8H 3HE6C 2FEEL 4KKNA 2Y5TA 5ETUB 3VRLE 5J1AB 5L9DL 2ICWB 1DL7L 1NFDB 4G42B 2PTVA 1TJHL 2YD5A 4YWGL 5IMLB 3UTPD 3KPOA 4X7DC 5IM7B 4MD4B 3AUVA 3WD5H 4ZOBA 4A6YB 1E4JA 1CI5A 2X4QA 3DRQB 1R3LB 1RZIA 4FTVA 5DMIH 1Z9LA 3RKDC 4FP8L 1F58H 3JV4B 5C0CE 4CDHA 4Z0BL 3ARBA 1AQDA 5I1KL 3WE6B 3BRGC 5E1AB 4UIKH 4KRMB 3IFPA 1FL3A 4NBZB 1D5MA 2GJZA 4XNQB 5F6HJ 2EE3A 1YJDC 4C59B 3RFZC 3RX7A 3EYUL 1YYML 5T1LA 5JXAL 1NAMB 4K7FA 5C0RL 4F7PB 2Y4SA 4K23H 1GGBH 4OZGA 3ZL4L 5T3ZD 3MRLA 2V2XA 3ARDB 3KNBB 1VCAA 4M1DL 4P3CL 4R4ND 2BJML 4R4NC 2AAVA 4F7EB 5FYKE 4H1LG 2AS5M 4JPWL 3ESUF 3ZE0F 1M7DB 1JWMB 3ELAT 4KGLA 3UO1L 4RFEB 5EOQL 3IJHB 3ARRA 5HVHC 3QUZD 1BX2A 4JZJB 3O2WL 3QI9B 4PBWD 5GGSB 1TETL 4RMRA 1S7XB 3TIDA 3NFNA 2X2YA 3MRBA 5ID0A 1ND0A 1B9ZA 5FECA 1MQKL 4YXHL 3LEYL 5M7QA 4WNQA 1JNHA 2GJ6E 5J13B 3IETA 2VMFA 4XBGB 5ISZD 3UTZB 3VJ6B 1RIHL 1Q94B 3TVMC 1H3XA 2UV3A 5GS1A 4M7LL 1C5BL 3HE7A 2ILLA 2A0LD 4JM4H 1NCCL 5C0DA 3VFVB 1Z5LB 2X4SB 2A0LC 3ARGB 3ARUA 2VITB 4NZRH 2R23A 1A6UH 2CDFB 3JTSB 1S5HA 3X11A 2XTLA 3OKLA 1RZJH 3OJDA 4Q74A 1NH6A 2RFXB 4PG2A 4BH7A 1EK3A 2WUBH 2BNUB 4MSWB 3MC0A 4R2GC 5DC4B 5INCB 1W8NA 1XF2A 1FIGL 2YA2A 3PHSA 1IMHC 1RZ7H 4U49A 4ZODA 4IDLA 1AO7E 4LCWA 5IBLC 3LN4B 3GMRA 2HJLA 4AIOA 3DV4B 4MD0A 4RIRA 1T1XA 2EDDA 5GGVH 3BIKB 3HS0B 1WVZA 5IW1B 3E3QE 4X83A 1P5UA 1LO2L 3C6LC 5D7JD 1RU9L 1G0DA 1XZ0A 5F1KC 4ODSL 2DQFB 4MNHB 3MUZ1 1CQYA 1AE6L 4GRLD 3QB7C 5MP6L 4JDZA 4J3XA 1L0XA 4E41B 4GRLC 4IMLA 5K9KB 5B38B 4HLJA 4TUJA 4OZFH 3HC3H 5H8DA 1RJYB 3VXOB 1EAPB 2P4AB 1A6WH 1HHKB 3S37H 5EPMA 4HQQL 3SDYL 4L8SC 4NKOA 1MWAL 2K7PA 3LQMA 1NGPL 2HN7A 3RGVD 4GXUN 3O6FA 1OTUD 4O58L 1FH5H 3D39B 4DKDC 2FX9H 5CZXC 2XYCA 3MV01 1OTUC 3GMLA 5DJZB 4Z78A 4PJ8C 3BD5A 3LN9A 5IB5B 4P4KA 1P53A 3LN5A 4HIHA 3ULUF 1OT1A 3OXSB 3GMPA 2F54B 5EBWA 4F8TA 4WY7L 1KJVA 1CDIA 3U0TA 4EVNA 3KPLA 4JKPL 1JHKH 2D7MA 3L5XL 4PRPB 4KXZH 3JXAA 4XC3L 5TE4H 5KVFH 2Q1EA 5KSAB 2RBLA 4PGCA 1GAFL 4OI9A 3IFLH 2J8HA 3GBNH 3GSVA 5I1AB 4G8IA 5EO9B 3B9KA 1MAKA 3DBXA 1NGYA 1WBZA 4OAWA 3W0WA 1U8OB 1U0QA 2AJVL 5JHDB 1LK3H 4S1DD 4U7MA 4S1DC 2MJWA 3TFKD 1WC7B 1CG9B 3WFEH 1KN4H 5DFTA 5A2IH 5D1XB 2JELH 5B38G 3QFDB 3SE4C 4M61A 3LS5L 3RIFK 3V6OA 5IW6B 5LWYL 3EFFB 4J8RB 3QO0A 3QWRD 5AD0B 4JO2H 2A83A 1HXYB 4AT6B 5T3ZL 1BVZA 5TDPB 3STLA 1KJMA 3S5LA 3HAEB 1A7RL 1C5DA 1GGTA 4W6YB 5SX5K 4PTUA 2GI7A 3KYNB 3FFDB 4IIQA 2WW8A 3SE8H 5DA4A 1GSMA 4NP4H 1CFTB 3IFOB 2G75A 2O93L 5JQ6H 4D9RE 5HI3C 4GJTB 2OK0H 1BD2D 1FCCA 3BDBA 5EWIL 5GRVL 1MJ7L 2DMCA 4X6DE 3OPZH 3MNVA 3CLEH 3T4YB 5BV7H 1DQJB 4TVPD 1CGSH 1V05A 3DUUA 1C16A 2Z91A 5KZCD 5EN2B 2WSKA 2GITB 3I2CH 2I24N 5CEZE 4G5ZL 5IB4B 1L7IL 4UB0L 3UTTA 3TYFA 5L88L 3FO9B 4KQ3L 4P23A 3PWVA 3SKNA 5DHVA 35C8H 1KCKA 4Y1AE 4L3CB 1CICB 1TQBB 3W5MA 3BDXA 3MRCA 5HHVL 3BJLA 5EBMB 3N9GL 2RHEA 4OTXL 4G6MH 1D9KD 2AJ3B 5J1AA 1FAIH 5FUZH 1QBMH 3RJQB 3M8OH 4MD4A 2JCCF 2V5TA 3UTOA 5CINL 3ARQA 4JO1H 2MKWA 3PXHA 4JAMB 5E4EC 4I2XB 5T1DL 4CN6A 3V4UL 1R3LA 1LO0L 1ACYL 4LHUB 2KKQA 2ZJSL 4KJPC 1FV1B 4ESKA 5C07A 3OZ9H 5BS0D 4LEOB 2AJZA 4L9LC 4CDGC 4W6WB 3O6LL 2RIKA 1WFUA 2ATPB 1MFCH 3HAEG 1I3GH 1QRNB 4ZS7H 4N0CD 2C3GA 4WFHE 1KB9J 1EO7A 4N0CC 4XNQA 4KKLD 3WFDH 4LMQE 4YPGA 1JF1B 3K8LA 1NAMA 4MLIA 4XHQA 1MCWW 4AMKH 2PO6C 1C12B 1WIUA 3MV7A 4PJCE 4L8BB 4OGXH 1RZ8A 4ZD3L 3AU1B 2R2EB 3OL2A 4OD1H 4WHYH 2MHAB 3BPNC 1M7DA 1AFVH 2EYTA 2A6IA 1YEDB 1NUNB 2XT1B 3IJHA 3UPAA 2HFGL 5IG7A 3QI9A 4JR9L 4MAUH 1A0QL 5GGSA 5GRJL 3C5ZA 5BW7A 2DYPD 4ZO6A 1BHGA 3GSXA 3IAPA 4JKKA 3O9WD 4MA7H 2V7HA 1OARL 2P8PB 3OF6A 4XBGA 3UTZA 2B1HL 4CVUA 2OTUA 1IGMH 1AQKH 1IEHA 1Q94A 3D9AL 2HTLD 3GBLA 3PP4H 2IG2L 5IVOA 2HTLC 3RX5A 2ZNWA 4JO4H 3PUCA 3VFVA 3V7AE 5ACLA 3X12B 1EJ6A 5HGHB 3QR2A 4ELMA 3RPIA 1MCQA 2CDFA 3HUJE 3JTSA 3SDCA 4FHBD 1GIGL 1MCWM 1CDHA 3CDGB 3QH3B 1RK0B 2RFXA 4TUOA 3SKOA 4LLAA 5J1SC 4OT1H 2EDWA 7FABH 3PGDB 1OGAE 4NKDB 4HJGA 5AAMA 1ZHLA 2AEQL 1UJ3A 2IJ0C 3Q1SH 1U36A 5H37G 5KN5A 5T1KD 4YEEA 2OMNA 3UROR 5IFAL 3FN3A 3RWGB 4EDWL 4ZTOL 1YPZE 2EDEA 3LN4A 2BC4B 4BFEA 4M6ML 1DLFL 4PJIF 4Z7NE 2UWEA 2OX5A 5GRZA 3AY4A 3QIUD 2CDGB 4Y2OA 2DLEA 1CVSC 4AL8L 5F7MC 3HI6L 1T3FB 1JF5A 5A2LH 2CQVA 5CKAA 2DQFA 4MNHA 3RTQC 2VZTA 3BJ91 1NFDF 2BRRH 4E41A 3VXNB 1L0YA 3MRIB 3MREA 4GQ9H 5HHPB 1L7TL 2P8LB 4XB7A 2QKIB 2OI9C 5B38A 5TE7H 2OL3L 4FFVC 3MZGB 5DT1H 4HZLB 3VXOA 1TVHB 1RJZB 4V2CB 1ZHBB 4PGZA 4Z76A 4OFKA 2P46B 2V7NA 1MWAB 5GS2H 1ZSDA 2KPNA 3ZDYE 4TVPL 2JJWA 5A3ID 3QNYA 2WBJD 5DJZA 3S35L 5ICYA 2I07B 3T77B 1QSFE 5A3IC 4LSPH 2WBJC 4K94C 4D3CL 3B8SA 5AYUL 2EKSA 3D18B 2V9TA 2YUWA 2J2ZA 4PJHE 4NQDE 3SDDC 3QYCA 3NAAH 3BPLC 2B0SL 2JJTA 2MKLC 4LLWB 4CW1B 4F7CA 4YAQA 3O3BB 1KTKE 3CPLB 3F7PC 4HKXA 1NLDH 1QR1B 2B8OT 3RY5A 5HXMA 1WWAX 2DKUA 1RUPH 1MRFH 2Z92A 5E4IA 2BRQA 2EECA 3EOBB 5TE6H 3TV3L 1CIDA 1YN7B 5DO2C 4N0UA 4G3YH 1E4KA 2PUQT 1E0OB 3QJHB 5EO9A 1IFHL 1WF5A 2P1YA 3ME0A 1U8OA 1X7QB 3H3PL 3L5WB 3OB8A 4HPYH 3QXTA 2EEAA 1P7QA 1NDGB 1P2CB 1ZT7A 1KIPA 3DXAE 3M1BB 4BZ1L 1MCPL 4PJ7A 5D1XA 3VFOA 3QFDA 3T1FB 1I3UA 2P7TB 3RA7L 1I7ZB 5IW6A 2EIBA 3NIDE 3DVNB 4Q9RL 1J05B 4NUGL 1R3IH 2P5WA 1CYGA 2R8SH 1HXYA 1VFUA 3KDMB 3NN8B 4I9WD 4NC1E 4HKBA 1F3RB 2B20A 4LSQH 4IRJD 4NKMB 3HAEA 1QSEE 1XMWA 3ARYA 5J1TC 5FYJU 4DUWA 3QG7L 5FOBB 1KLFA 4Q7DA 1NLBL 3SCMD 5F9WC 4XNMA 4XMKH 5GIRA 4PJDB 5HVHB 3CSYA 3V2AR 4PBXA 1D5BB 2YPLE 2BNRA 1DBML 4MLSA 2VDRL 3WUWB 1FGVH 1HQRA 3DETC 1NC2D 4N0FB 4PUBL 2CUIA 2CLVB 2VLRD 4IS6B 4NWTH 4XP5L 3IDJA 5EN2A 1BQHB 2E9WA 2GITA 1RUKL 4C56B 5ISZB 5D2LE 1C7SA 3BHBA 5H94B 3TVMB 3OKOB 2PNDA 1N0XL 2OQJB 4GO6B 3WO4C 5FYJD 1QLEL 1UCBH 1VERA 1C8PA 4NHCH 5CZVH 4KTYA 4Q58C 2AJ3A 4JM2C 2BCKB 5E99H 3BZFB 4PTTB 1OM3L 2XY2A 5DQDH 1NCUA 2YD3A 1YMHA 3PG2A 3PL6A 3D1MC 4X8JA 1OPGH 3PWLA 4X4MA 5HYJB 5F93C 1RZJC 2IFFH 3RNQA 1BJ1J 3VGEA 2E9BA 2ZUYA 1FZMA 3BRDA 5KSBA 2CRMA 1RK1B 1E28B 3PWPA 5GS3A 2X6MA 5LBSL 5CEZH 5KAQG 3X17A 2I25N 1KTDA 1P1ZA 2GSIA 1Q0XH 3GI9H 3Q6GL 3PNWA 4GRLB 3L5IA 5I1GL 3K0WA 1K3ZA 2XNAA 3WLWD 3EOAA 2FEDD 1YDPA 2HKFL 3C2SA 1JZ6A 3X13B 4OFDA 4ERSH 3WUWG 4AENB 2KZWA 3TZVD 3DRTA 3AXLA 1KC5H 4L8SB 4JFYA 3CXDH 1SEQL 4RMSA 1DQLL 5LVEA 1YEDA 4NM4L 1BQHG 1JGLL 3RGVB 4U6YB 5C9JB 1VESA 4K94L 5HHOD 1A2YA 1REIA 2VDPH 2IH1A 5F7EH 1Z0NA 4ZUUB 4M03A 3BGMB 4OCLC 1UM4L 4FNLL 5LGHH 5SWZE 4ONGH 1RHFA 4HWEL 6CGTA 5LG1A 4BFIB 3BP6B 4U6HB 4Z77A 1IKNC 3FQNB 4Z7WA 1MFAH 3CXHJ 2P8MB 5D1ZD 4QOKA 1N5YH 4QRQB 3A67L 1DDHA 2H32B 1BREA 3VCLA 3DVGA 2BHYA 3FQUB 3NCJH 3RUGE 3IDXH 5ERWA 2VE6B 3D69A 3QDGE 2FR4A 4Y8DC 2E8YA 1RK0A 4NO0D 4WO4D 4NKDA 1F11A 4M8QA 4FQ1H 3OV6A 1AGDA 2VISA 1X4XA 1JZ8A 3D25B 4PJXE 3KXFD 3UTQA 1JPTL 2BSSB 2XZAL 1G0YR 3WXWH 2EO9A 1KV3A 3ZE2E 5I0ZA 3LPWA 4NNYA 5KW9L 1OAUL 5FO9B 3O45A 3T04D 5DMIL 1F58L 4JRYE 5ICZB 3GJFK 2CDGA 2DDQH 1SBSH 1XGQB 3KPRE 4AYFA 5C0JA 5FUOL 1T3FA 4KU1A 3PIQA 2L7JA 5TPWH 4JJHA 1PX3A 5I8EA 1CL7H 1WIOA 2YD2A 3D85A 3OR7A 1JHLH 4Z5RB 3HNTH 2R0WH 4ETQA 2R2HB 3QP3A 4CL7A 4ONFH 2OL3B 5I6XC 3QUXA 4I0KA 4K23L 3T0ED 4WV1B 1N5AA 2J5LC 2XN9E 3RVXD 3GMMB 4HK0A 4DOHB 3FB5B 4YNYB 1BD2B 2BFVH 1MNUL 1BZ7A 1OD9A 4EN3C 5EH1A 3PDGA 2X4PB 4L8DB 3T77A 1KCRL 1HWHB 5CJXC 1BIIB 1RZKH 2GUOA 4RGNE 3WFZA 3D18A 1OSPH 5KZCB 5JHLL 3TBYB 3IKKA 2ESVE 4LF3B 1JPSL 1A4JA 1X5YA 2ZUVA 1Y0LB 5HY9B 2FRGP 5CD5D 1NBZA 4LEXH 5CD5C 2Z35B 4TQEH 1LEGA 5ECJE 5FYJL 3HE6A 5BV7C 5JLZB 3TN0D 4PP1D 3EOBA 2WV3A 3V4PH 4FXLA 1ZT1A 4JM4L 4QNPF 3H9SD 4PREB 2AV1B 3QPQD 1HILA 1SVCP 3BVNA 1UKSA 4OGAD 3QJHA 3QPQC 4NZRL 2HJKB 3KPPA 4OGAC 4IEFB 1E6JH 1U8QA 2VXSH 4EUPB 3LVEA 4RZCB 5F3BB 1RZJL 1MHCB 3IDMA 3JV6B 2AV7B 2WUBL 4L9LB 3MV8D 5BS0B 1P2CA 4XAWL 2Y7QB 2FJFB 3M1BA 1NCAH 3BD4A 4WVRA 5CGMA 1RZ7L 4ZS6D 2D0HA 2J6EA 2ADGA 4RQQA 2HJFA 2XXCB 4ZS6C 3RX8A 2RCSL 2VLJE 3MV9A 4ZNEA 3D0LB 3A6CH 1OVZA 2C1PB 3QEQD 1QHOA 3U4EB 4JANA 1FNGB 2CR3A 4Y4FD 4ZFFA 3P4OA 4M6OH 1T1YA 3BPNB 1ZLWK 1A8JH 3RDTC 4X7SH 3U0PB 1KPUB 4FABH 3HC3L 4MQTB 5J3HD 32C2B 2WANA 1LO5A 1A6WL 5J3HC 2L0DA 3S37L 2A6JA 2ICWI 3FN0H 2DYPB 4K71C 5FM5M 3WUWA 5DDHA 4MCYB 2ZOLA 3O9WB 2CLVA 5IBTH 4OJFL 4PJAE 3CDYA 2G9HA 1CT8A 1FH5L 4PPTA 5FYKU 2FX9L 2SEBA 4C56A 4MXWL 2HLFD 3TVMA 3ZHLA 1BOYA 5LXGH 1RPQA 2EYSA 5CBEA 1ZV5A 1EEZB 2AXFB 2ZCHH 4D0DA 3F8UB 5C0CD 5D1QA 3C8KB 4P5KA 2DLHA 3L5HA 3UAJC 4M7LT 1S7UA 2CXGA 4E42B 1HKLL 3ARPA 1MCIA 1T0MB 4XAKE 5EU5B 1WICA 4XRCB 5MEND 1JHKL 3OG4B 1PEWA 4J1UA 2HVKB 4P2YA 4YHYC 2CLZA 1F00I 4PTTA 4JGJA 5JW4N 1OLLA 4Y4KC 3KYKH 3UZEA 1MRDH 3IFLL 2YD8A 3GBNL 2ENSA 1B4JH 5T1KB 4XPTH 4YC2C 5HYJA 3F12B 5FYKD 3KYMB 3G08A 2O5ZH 3FT3A 1E28A 4GW1A 1LK3L 4HJJH 3ILQC 4DFHA 4HLZH 2A9ML 3C6LA 4L4JA 1C7TA 3QIUB 1CFNB 3FN9A 1F42A 2J4WH 3RTQB 1KN4L 5SV3A 2AJXL 3ULSA 3OXRB 4HWUA 4U1HB 2OI9B 1B0GA 2X7LA 2YUZA 4QTHB 5HVFB 1IQDA 1T4KB 3O0RH 1N59B 1C08B 3AAZB 3M45A 4MDIB 4KDVA 5TDNB 1KEGH 2VH5L 4L8SA 1U3JA 5CP3A 5JW5B 2GAZA 4HIIA 1RZGA 4UT9L 2Q6WA 1U8JA 4U6YA 3SE8L 4R97C 1WZMA 1DQTA 5DHYB 4XCNB 5JQ6L 3BD3A 4ZUUA 4NT6B 2WBJB 4FA8A 5C70A 4PJ8A 1NCBH 3ORJA 1R24B 4L1HA 3U4AA 5LJYH 5J12B 1MREH 3OPZL 1FDLL 5F9OH 1UH3A 5GS2D 3CLEL 4U6HA 1T1WA 5BV7L 3BPLB 2GW5A 1TPXC 4DKFL 2VZVA 4MA3A 1CGSL 3EDEA 4J3TA 4OCMC 5KAQF 4MGXA 1QBBA 3MQIA 4ONHB 3RWIA 5C2UB 1U3ZA 3IDNB 4PJEB 4PJDF 3EJZD 1S9WB 5A2FA 4G9DB 4WI4A 5DJYA 2Y23A 4WTZG 1ZXQA 4HSQA 2E7MA 4RDQG 3G5ZB 3BPOB 3E3QC 2YD4A 4ZPVA 3ZDXF 3R06A 2YD6A 3WFBH 2I27N 4KQ4H 4PV8A 2HFFA 5F72S 3ZKQD 1FAIL 1KJ2A 1QBML 1XGTB 2VO5A 3D25A 4E5XB 4XH2A 5F1SA 5F89B 5B4MD 2BSSA 4EBQH 1F6FB 2KUTA 3CJJA 3FKUS 5B4MC 1HYSD 2F5AH 1QLRB 4BQ9A 3SE4A 2YD1A 4M1GL 5FO9A 4WTWA 3HR5A 3HMXH 5HDLA 3OZ9L 4HBQA 4DVRL 5F8RC 3GHBH 4TTGA 1MFCL 1I3GL 1PQZA 3WHE1 2PXYD 2ITDB 1NGZB 4IRJB 1T5WB 3JWOH 5C0EA 3I02B 3BUYB 4PB0H 1FJ1B 5T5NG 4AMKL 5F9WB 3ZKXC 5MEQB 3SCMB 1EAJA 2BY3A 2AK4E 4OGXL 4ENED 2AABH 3FB5A 1NC4A 4PRBA 3IXAB 4OD1L 4ENEC 1UM5H 7CGTA 5FO8A 2FH6A 3NCYS 4LLVB 4L8DA 1AFVL 3P9MB 1NC2B 5IFJB 1FQ9C 4MAUL 1S9VB 1QA9B 1A9BA 2WBWB 1MFEL 2VLRB 5F3HB 1PGRB 2V5YA 3C60A 1JGDB 4U4BA 3ARZA 5CUSL 2X1XR 1FNSH 2H2PC 1RAMA 5I18L 3H9YA 5EO1B 5E94B 5AWNH 3WO4B 3DGCR 2PN5A 1S78D 4JY4A 4LSVH 1AQKL 1S78C 1QO3A 2CKBH 3PP4L 3F6LA 4LAQH 1IAOB 2A74B 4JO4L 2KBGA 3ZHKA 3BN3B 1P7HL 1IARB 4PREA 4OV6F 3B9DA 2HA1A 3IKCB 1JPFB 2YEZB 2HJKA 3NBNA 4POUB 3WL9B 3CFEA 5F7NC 1KTRL 4RZCA 1Z9SA 5E5MA 1HNGA 1S9XB 4GKSA 5FYKL 5KVMC 2AV7A 1NSNH 3TPKA 4C83B 7FABL 4L9LA 4HIJA 3VFGH 5A16A 1RQ5A 3MA7B 4XI5D 2FJFA 3QO1A 5CIPH 4J4PC 3O11B 1JYVA 3Q1SL 4D9RD 1I1AC 2DBLH 4FTVE 4G7YH 4UOJA 1U8MB 5T33H 3UBXB 4LSRH 1FVDB 1LWRA 2VUOA 3B5TA 1AIFB 2E7LC 1EVTC 4P2CG 1QFUL 2CJUH 5IVXB 3WSQH 3D0LA 1A22B 4K7PX 2PO6A 3QA3A 2C1PA 3B2UC 4OCYL 3L1OH 1I9JH 1EO8H 3MUHL 4R4FH 3RBSA 5IQ7H 4GKNB 5BVJB 3U6RB 3TZVB 5JW4Q 4Z0XB 4GQ9L 4OZGE 4FFWD 1J87A 5TE7L 4FFWC 1N8ZA 4PD4K 4EIZC 2R1XA 3U83A 32C2A 2F19H 2AJUH 4HC1A 2FEEI 4OZFB 3V95A 1LP9A 1IEAB 1TQCC 4G8EB 1S7QB 1WWWX 4LLMA 1G9EA 2M8XA 4RGOH 1K85A 1KCLA 2K7QA 3ZE1E 3BIBX 4K3JH 3MACL 1BJ8A 5E24E 5HI4C 3LOWA 4HW6A 4PRHA 5FA4A 3T8XB 5DC0A 4YHKH 4Y89A 4LSPL 4OF3A 3P77A 1AR1C 1EEZA 2AXFA 5D1ZB 2CGRH 5LCVH 3NAAL 2VUYA 3PV6B 4XP9H 2X70B 3VFWB 4RBPH 2UYLB 4WFHD 3EYQD 3MUY1 1NLDL 4KMQA 3EYQC 2EDTA 5C3TA 4HGMA 1BEYH 2AGJH 4WO4B 1RUPL 1MRFL 5C0FB 1ZLSH 4ZTPH 2DIAA 1Z0MA 3UBXG 1T6WA 3IS1X 3NCYP 4G3YL 4WTZA 4CAGA 1PVHA 1UA6H 2XQYG 3VRJB 4BA8A 5JO5A 4AIXA 4Y7MA 3KYMA 1OTSD 5DS8A 1Q9LA 2R39A 4B53A 2P44B 3TLRA 5E8DL 2Z9TA 1YECH 4OZHA 4MJ2A 4KRPC 3RL1B 5D9SB 4HPYL 1FVEA 3GBMH 2BZDA 4JREC 3W39B 1R0AL 4LCWE 1L9MA 5F9JB 3RTQA 4P9HH 4GFTB 3OXRA 3EO1B 1YNKH 2HT4D 2V5SA 2HT4C 1IGFH 4CVZA 4OZFG 3AAZA 4QKXB 4UINH 5DSCB 2R8SL 5L2KD 5I15L 2LVCA 3W9DB 5TDNA 2Q76B 4H0GA 1JBJA 2EE9A 4ODTH 4LSQL 3DX7B 3T0EB 4U1NA 2NCMA 1PBYA 4CMMB 4ZAKD 5DUPH 5EIVA 1RURH 1BWWA 4ZAKC 3W11D 1AXTH 5DHYA 4XMKL 4HG4J 1G6VK 1K4DA 2Z8WC 4GW4A 3W11C 3VD7A 3BKYH 1YQVH 5FM8A 2PW2B 2ADJB 3VXUE 4AH2B 5E2WL 3SDDA 2HYMA 1FGVL 5IOPA 2WWKO 1OGAD 4HWNA 5JPNB 2LTQC 1KB5H 4NWTL 5BV7B 4CBPA 1CIUA 4P2OA 3RNKB 4ONHA 3MRDB 3TN0B 1RZKC 3EYFA 3IDNA 1CFQA 4PY7B 3O41B 5I1IH 4MXVE 3G5ZA 1IAIH 3IDIA 1YEHH 3H9SB 4L29A 1UCBL 3DX6A 3GKWH 5CZVL 4NC0B 4Q9QL 2WM0A 1INDH 5E99L 4JRWA 2BVQB 5ALCL 4PRIB 4E5XA 1Q9KB 1RUAH 1TIUA 4OIBA 3MV8B 1WITA 3WJLC 3W0WE 5K9QG 1YY9D 1CXFA 1OPGL 1R3HB 4N5ED 4BH8A 2K9UA 5DFVD 1O7SA 2IFFL 2RJMA 1EBAA 1UWGH 1VFAB 1QSFD 3V6OE 2UVFA 2EDJA 4JFEE 5CEZL 2NTSP 3QEQB 4X4XB 4QT5A 1UC6A 5AYQA 1KCSL 2B7DT 2EH8H 4IRZH 4NQDD 1Q0XL 3GHEH 5MHSE 3BUYA 3LSOB 4JFHE 4NYLA 4MMXC 1J0ZA 4RDQF 1H3PL 1ZE3C 1D5ZB 4F37K 3ZSSA 3VFPB 1IEBA 4ERSL 3O2DH 3VG9C 3U46A 4XBEH 4CMHB 2JK5B 4JHBA 5EBLB 2P43B 3GSQA 3CXDL 3WN5C 2FATH 1S7RA 4LLVA 3PJSB 5J6GA 1XFPA 5DVLA 4LHQB 4FRWA 1QA9A 3BZ4B 5F3HA 1JWUB 1E27B 2HT2C 1J8HA 3O6MH 2VDPL 5F7EL 1AC6A 2NTFA 2Y5EA 1VPOL 5LGHL 2ZUWA 1MUJB 4ONGL 5B39B 3SDAD 4DGYH 1F2QA 5C0CB 4APQA 3SDAC 3VXSA 1TZHB 3T1WA 4MNQA 1HXMB 3FJTA 2WWMD 3B9VA 3MRPA 4YDIH 5FO7B 5HYQA 2P5EA 1N5YL 3LRGA 1IAOA 2WWMC 4JM2A 2A74A 2NY7H 2ERJB 5CKGA 4UDUA 1JMXA 2J8UE 3LPFA 4YHYB 5T5NF 1X5KA 1J10A 3G6AB 3IDXL 2P24A 3S8WA 5DUBB 2YEZA 4Y4KB 5CFHA 4NC1C 4QHLA 1QSED 1A4KB 5DJAB 1X4YA 2HFEB 5IEKA 4ZFOA 43C9A 2CMRH 3E2HC 5D2NE 4C83A 5FKPB 3RL2A 4FQ1L 1IGYB 3O11A 2YA0A 4HXAH 1V3KA 3KR3H 5F88B 1XGPA 4PJEF 5C07E 4JKMA 4P2RA 3UBXA 2Y06L 2YPLD 1RFDH 2UZXB 4XVUD 4F7MA 4GG6E 4XVUC 3TPUB 2XWTB 5MEPA 4B0MM 4OLXH 5IMKB 1RY7B 2DDQL 2GJ6B 4I5BB 5DMGD 4KJWC 2E3VA 5HGBB 3BQUA 5TPWL 4WHYG 3UDWC 5HI5D 1CL7L 2FYYA 3MV7E 2GTWB 5FA3B 1EFQA 1JGUH 5L0QC 2FHCA 5MI0C 1JHLL 3HNTL 4NFCA 3BE1H 4R97B 4ONFL 3VE0B 4JHWL 5JPMA 3IJYB 4YHML 3CFDB 5JDSA 2X05A 5B39G 3UMTA 3CAFA 3PP3H 3LKRA 1ZGLM 2BFVL 2E9JA 2VAAB 5GGVY 4GAJH 3ARED 3B6SB 5T1MB 4XP4H 1TPXB 3EJYD 3L3KB 3Q3GB 2IPUG 1RZKL 3EJYC 2VABB 3RVWD 1OSPL 4HFUL 3OAZH 5F7WC 4P5TC 4R96B 1AO7B 1J9CT 4LLUB 4TYUA 1IGJB 2DQIH 2DRUA 2X70A 4LEXL 5I1HH 1I7TA 5DJCB 4MQSB 4UU9B 2UYLA 3DUSB 3OKKB 1I3RB 3MGOA 4XCFH 3VA6A 3MRKB 2HVJA 5C0FA 1I1YB 1SM3H 4ZUWB 5HGAA 3QAZC 1VEOA 5MERB 3MCLH 3UTSE 3DX8B 2F9BT 1E6JL 2VXSL 3MCKA 4WW1A 4OF8A 3RL1A 4UAOC 2NZIA 5F9JA 4PIRF 2VDOH 1MLBA 3RP1A 1GGCH 4LKXB 2UWEE 3TJEH 3OJ2C 2IADB 1WWBX 1U93B 4JFQB 4OIIH 1I1CA 3TBVA 3LKNA 4PV9B 3A6CL 3ZKXB 1ZT4B 5BZDA 2ICEB 3DX7A 4GMSH 4XXDB 1ZOXA 1KBGH 4YHZL 5C1MB 1S7SB 5IGXH 1ZMYA 2BY1A 4RWYH 3IVKB 1OY3B 2QSCH 4M6OL 4RFNC 2E27H 4EN3A 3QXWA 3JWOC 4JJ5B 3R4DA 5I66B 4FABL 5HSFA 3H6JA 2DMKA 5IVXF 2X4OB 4X6BB 3P73A 2JTDA 3FN0L 2MWCA 4I3SH 3B3IA 5KSVB 3VWJA 3VXRE 1QYGH 2ZPKH 3GSNH 5C0AA 5I2IB 5CBAA 5IBTL 2MNUA 3SQOH 2G5BA 4X9IA 3KS0H 1GPOH 1BAFH 1F02I 2HRPH 1LEKB 2ADIB 3RNKA 1JPST 3V52H 4AJ0A 3MRDA 4FN0A 4JO3H 5LXGL 5FKAA 3G5VA 2XRAL 1BZ9A 4U1SB 3ZYZA 1D6EA 4JRYD 5I1LA 3KPRD 1FLRL 4KV5F 1T0NB 1JRHL 3EDFA 2WINB 1QNZH 4M8VA 1EEQA 1DBJH 5IV2A 4PRIA 3SEPA 5DI8A 4N0UE 4X6CA 1KULA 1FYTA 1ZANH 3MTRA 3OR6A 3KYKL 3BKJH 2XN9D 4JCMA 3T3MF 1GXEA 4NHUB 1B4JL 1R3HA 1H5BC 4XPTL 1DBKH 4ODBD 2YN3A 4FXGB 1X5XA 2D7PA 4X99B 4PJ7E 4X6DB 2O5ZL 1PG7H 1VFAA 4HJJL 1CFSA 3BUTA 4RGND 3OAYH 3VWKC 5JOEA 4X4XA 5ITBH 2J4WL 2ED7A 3MPCA 1OAKH 1ONQB 4U1IB 2OR9H 2R9HD 4NQEE 5ESQB 2DTMH 3RDTA 1BVKA 4MAYD 2EZ0D 2H6PB 3VFPA 4Y1AB 1B3JA 4MAYC 3RAJH 2VN4A 1TQCB 5EBLA 2DQCH 3HLAA 1F4HA 5AUMB 4U31A 5ADPH 1I9EA 2BOBB 3PJSA 1LE9B 3SJVE 43CAA 3MJ9A 1T20A 1KXVC 4HGKC 3SGEI 4XCEB 4DQOH 3O8XD 2BNRE 2VRAA 4ODXA 2IBGA 4PYGA 2VLKA 1HEZB 2D2OA 4WEBH 4LCCB 5HHQB 3CMOH 4LAJH 1NCBL 4KUCD 4RAVB 1IGTA 5B39A 4ZUTB 1N2RA 3SQBA 2LABA 4HV8A 5F9OL 1NEZG 3DUHA 3J7HA 5CGTA 3E6HB 2ADFH 2VLJD 4JDTH 1L6XA 1W0WB 1N0LA 5IWLC 4KH2A 4FQCH 5B3JE 3PGFL 4ODWB 4Y4KA 3NIGF 1MAMH 1QD0A 4P5MA 5DJAA 2ZSVB 3LS4H 4PJCB 4XCYA 5SX4I 1ZLUK 4NQCE 4KY1H 4YHPB 4OKVB 5FKPA 1OOAA 3WFBL 4KQ4L 5DRNA 2X4UA 3SY0B 1P7KB 5DJ2A 3QHZH 1L0QA 3ARXA 1H15A 4DVBB 1W0VA 4O5LL 5FGBC 4JREB 5MEOA 4EBQL 5I1DA 5DEZA 4H8WH 1GZPA 1ZA3B 5KSBE 1Y18B 3TPUA 2QJDA 4IOIB 3PWPE 2XWTA 3HMXL 2DM4A 1JHTB 2GJ6A 5CGYD 3WFCL 3MRQB 4RAUB 2VLMD 4YBQD 3GHBL 3PWUB 1SEBA 1N26A 4P9HC 5D6DA 2GTWA 1E4XH 5GHWH 1BMGA 4PB0L 2QSQA 4WUUE 1FORL 3VE0A 2V5RA 4ZAKB 2UUDH 4XAKD 2H26A 1XIWC 3CFDA 4KK9D 3SPVB 4PJGF 3HUJB 2VAJA 4KK9C 4U3CA 3CH1A 2AABL 3Q5YA 1JUFB 1SBBA 5FK9B 1UM5L 2VAAA 3QIWD 3VGGA 3S4SB 3NCEB 3MRNA 5L7XH 2G2RB 3B6SA 5DJ0B 1OGAB 2LTQB 4GW5A 3Q3GA 5JDJA 3QUKB 5FXCH 5J6HA 5C0BA 4KC3B 1YEKL 3GJFA 4UT7H 5EORH 1AO7A 1T2QH 3G6JE 3HG1E 4Z7WE 1YPZB 1FNSL 4AQOA 4HT1H 1IGJA 3REWB 3UYRH 4QOKE 1GL4B 3F7RA 1N4XL 4AIZB 1M1SA 5FGSA 4NJAH 5CLTA 3QZWA 3DUSA 2YS4A 4O2EA 4XHJC 3BWAB 1ZS8B 2GT9A 5TQ0H 3T65A 1GZQA 4LSVL 4QHMA 1RJCA 4D9LL 1FFQA 1JGEA 2PR4H 4LLYB 3VRLF 4LAQL 3FONB 4OLWL 1I1YA 4ZUWA 2H41A 4LSSH 3EDJA 2BNQE 4M48H 3QJFB 1G7HA 5I9QB 3B9EA 2B5IB 1FL5B 3FQTA 1DLHB 1JV5B 3NZ8B 1NSNL 3VFGL 4PJ9A 3IB4A 3W9EB 1MIEL 2CD0A 4NFBA 4BUGA 3KLHD 3QULB 4QHNA 2DBLL 2YZ8A 4YDLC 1VKXB 1QSFB 1INEH 3BP5A 1U93A 4LSRL 2YSSB 4WIQA 2P49B 4PBVC 4PJHB 4KJQD 4CN4A 4AM0A 2CJUL 3WSQL 4NQDB 2W65A 4PV9A 3ABZA 3KYOB 3WJJC 1JVKA 1OTTD 4F3FA 1T89A 4KVNL 4NRYA 3L1OL 3VA2C 3P0VH 1EO8L 4KWUA 4R4FL 2F8OA 3VG9B 1MCDA 3S4SG 1CDJA 5K9OB 5EZIL 1UKQA 4TTDC 3WN5B 1A6AA 4H5SB 3BXNA 2VZSA 3LEVH 3ZKMC 5ENWB 2F19L 5I1EH 2AJUL 4X6BA 4QY8A 1PX4A 5IESH 4RGOL 3HRPA 3MBEC 3UZVB 3TBSB 3PDOB 2O61B 1PW3A 5DQJB 4EI5D 3GRWA 9CGTA 3FCTA 2ADIA 5GPRA 3SDAB 4WI2A 1CXLA 3U30B 3FO1B 4YHKL 3DXAB 4PLOB 3MV11 2HWZH 1HH9A 1BF2A 3K8KA 5DD3H 4FQXD 4HWZB 5LCVL 3QXAB 3AFLA 4FQXC 1QG3A 5EO0B 2VSDA 3LMJH 4M02A 5LAXA 2VOTA 3CFBB 2WINA 4WU5B 1MCJA 1AJ7H 1ES0B 1EPFA 1NEZA 1F4YH 1NUGA 2VDMH 1QSEB 2H45A 5CCKH 3OSKA 3H9HB 1BEYL 1I3VA 2AGJL 3MRGB 4P57B 1OP5H 1X5FA 4J4PA 1CLZH 4ZTPL 1DFBH 1DANU 1ROWA 5DMJB 5DR5H 1I1AA 3IRPX 2AK4D 3P4LA 4N0YH 1DQDL 4NHUA 1N64L 1CDGA 2APTA 2YPLB 4F7TB 4X99A 1R3KB 5D7LA 2X1QA 4X6DA 3M17B 1YECL 1KPRA 2OZ4L 2MCPH 5JR1H 4NNPH 1AXSB 3GBML 3CFCH 3K2MC 3V4VH 4Z18A 3U36B 3MV9E 4NWUL 1ONQA 3V5DA 4P9HL 5DJ6A 3ILPA 5D2LB 3S3JA 4X5XB 1YNKL 3I50H 3VI3E 3K7UA 1CWVA 1S8DA 4JY5H 1AGFB 1PYWA 1IGFL 4Y1AA 5MI0B 3MNWB 5FGRA 4UINL 4NCC2 1DUYB 3OAUH 5AUMA 4ODTL 3TH3T 5GISH 2BOBA 4NJ9H 2JE8A 2X4TB 5T3XE 4FQIH 1BOGA 4QXWA 1P4LB 4CADB 5BXFB 1S7TA 2OTWA 1J1OH 5I73C 3AREB 3QNXB 1J5OH 3N0PB 1GRWA 3BKYL 1KACB 1YQVL 3WNLA 2OS7A 3EOYG 1IC1A 3BESR 1A47A 3QEUA 4D0CA 4WCYH 5HPOA 2Y1VA 15C8H 3REVB 2UZIH 4P5TB 4ZUTA 2X89A 4A2MA 3KWWB 2A2QT 1A02N 2B2XL 1RVFL 3DROB 3GIZH 3N1FC 2H3NB 4IOFD 2LU7A 4M9OA 4FTVD 1HHHA 2E8ZA 4MJ4A 4YX2H 4IOFC 4YQXH 3L3DB 3ARBD 1NMCC 5EOTA 4JN2A 3E6FB 3AS1A 3QAZB 5I1IL 1FL6B 1IAIL 4DK6A 5FGCE 1A6ZB 1YEHL 2A6DB 5JQHC 5B21A 2NY5H 3GKWL 1MCOH 1PFCA 2D0GA 4YHPA 5DK2B 3FB6A 5T1LD 3QRGL 2ZUQC 1INDL 4JY6A 1P7KA 1Z6JT 3S3PA 4CJ1A 1A9EB 5EUKA 4UAOB 1GGIH 1RUAL 4HLZG 5ESAB 3TBTA 2Y72A 1RJLB 1R3JA 1A14H 4GS7C 5JIPA 2QHLA 4EZMA 3O2VH 4X6FA 4P4RB 4IOIA 1QPXA 3WHE0 5DMKA 2IBZX 3U4BL 3UYOD 3MRQA 5SWZB 3VMNA 4KZDH 4U1KA 2DM3A 5IF0B 3QXDB 4FS0A 3RU8L 5I17A 1CXEA 4XBPA 5GZOC 4TNVF 2EH8L 4IRZL 3P4NB 1YQ2A 3GHEL 5C0GB 1JF6A 4RFNB 2BVPA 2VQ1A 2MQCA 1CGWA 4Y5XC 3RUGB 2I9TA 4OD3H 3HE7D 5KTEH 3SPVA 4YE4H 3HUJA 5GRXG 3HE7C 4HFWA 1DEDA 3O2DL 1PEZA 2C3VB 4X6DF 4XBEL 4FFYH 5FK9A 1G7IA 3BEVA 2RGSA 2EE6A 2FATL 3CVHH 5C9KA 2G2RA 2XKNB 2W92A 4MWFA 3FQRA 2HTKD 5L6YH 3MUGA 4PJXB 1WAAE 2HTKC 5FDWB 3ZT7A 3O6ML 4XMLH 5GGQH 1AR2A 1DSFH 1T22A 4DZ8B 4IMKA 4M1CD 2VXUH 3QHTC 5J9PB 4DGYL 4JRYB 4LCWD 1XF4B 1Q72H 1ZS8A 4M1CC 3KPRB 1JI2A 2IH3A 4NZTH 4YDIL 1RIUL 1FN4B 5EU3A 1YEFH 5CILH 4XZUA 3WFHA 3G5XB 5I74C 3MYJA 5D5ME 3QJFA 1B90A 1DVFA 3WJLA 4XT1C 2GEEA 2JB5L 5F7DB 3HZVA 1DLHA 2XN9B 1JV5A 3NZ8A 1XCTA 2CMRL 4EJ1C 3LQAL 1NGWB 4D8PB 3RWEA 1B2WH 2NW2B 1ZK9A 4KHXH 2IBBA 3KR3L 4JPKH 5CIPB 5ITFB 3HI1A 4OZIA 3O6FD 3TNMB 1SJEB 4RGNB 2YSSA 1FHGA 1JI1A 1RFDL 3O6FC 1UQSA 2FO1A 4OUUB 3IFNH 2ESVB 4PJCF 2Z4QB 2DJUA 3FRPG 3HHRB 4X98A 4Z7OF 4OLXL 4FZEH 1KELL 4MAYB 4P4KD 3HC0B 3VXQA 3NABH 1QLFA 5EU7C 5DVOA 4TSCH 3WN5A 2PW1B 4HUKB 4YHNB 5CEXA 1UENA 3ROOB 3TWCH 3TYGH 3VXMA 1DUZB 5IIEB 1JGUL 1S5IH 2QQLH 3W82A 2PYEE 3BE1L 2YOCA 5J89A 2WMPA 1ORSA 3R0MA 1QZ1A 1F3JA 3TBSA 1ZGLA 1UWXK 3MRHB 5DQJA 2GQHA 3HFML 2BMKB 1PG7W 3L7FB 4Z7VA 3H0TB 4F33A 4YXLH 3B9KD 1BFTA 2VLLA 2VXQH 1FFPB 1JPGB 3QUMH 4XP4L 3DXAA 3W0WD 3BH8B 3KG5A 4Q2ZB 2WIIA 5LQBH 3EGSB 2IC2A 3QXAA 1AD0A 2H1PH 5EO0A 2ZWLT 3L95B 2VLJB 1YYLH 5DJ8A 2A77H 2DQIL 3HUJF 2XACC 3CFBA 5E8OB 5I1HL 2Q86B 3LKPA 2RR3A 4L5FL 4NSKA 3V6OC 1EX0A 1WQVT 3V5KB 1OCWH 4XCFL 3O4LA 3HA0A 3C08H 3H9HA 5MHSD 1YEJL 4JFHD 5E8PB 1SM3L 3STZA 3PWNB 3CZJA 2ARJB 4TULH 1YPZF 1G9NH 1J12A 1CU4H 3H7BB 4PG9A 4Z7NF 4I18C 3C5SB 4IOSD 1SYSB 2FDBP 3MXVH 5TH2A 1AXSA 3G04B 3VH8B 4PJAB 2DQJH 2VDOL 4MVBC 1GGCL 1HYRC 1AGBA 4H0IA 4KJYA 1NCDL 3UDWA 4K9EH 5TFSH 4X5XA 3I6KB 3TJEL 4H8WC 4QO1A 5KSUA 5A1AA 1AGFA 4C4KO 4OIIL 3BEWB 1FZJB 3HZKB 3UTTD 2NX5A 3QIBC 3K8MA 1QP1A 4P23D 1T04B 5E0QA 4GMSL 2FO4A 2X4TA 1KBGL 4G80A 3VRIA 1PY9A 4UQ2B 1HHGB 4MS8C 3ZDYF 5IGXL 3O3EB 4RWYL 2PKDA 2QSCL 4CADA 2E27L 1LP9E 1A64A 1QR4A 4HUXB 5FB8B 3QBTB 1DN0A 3IDGA 4MNGA 4OCRL 1AC0A 4PJHF 1T7YA 3P4MB 2OTPA 3T2NH 4P5TA 2VR5A 3KWWA 4I3SL 5D2NC 1VGKA 3DROA 4MCZB 4WGWB 3BP4B 4QHUB 2Q7YA 2J6EH 3BGFC 3JWNC 4P49A 5EOCH 1MY5A 5DA0B 3SQOL 1J1PH 5BQ7B 3WKNA 1G7JA 3GSOB 3IJSB 5C07D 1GPOL 1IQWH 4I1NB 1BAFL 3LRHA 2HRPL 3K81A 3L3DA 3V52L 5E5RB 4JO3L 5F1NB 1P69B 3E6FA 4I48A 2FWOB 4J3WA 4X9HA 4I77L 5K93A 4OZ4A 1NUFA 4JG1L 1YEGH 1T7XA 2W0FB 4PLJD 1QNZL 3B43A 5HYSG 1U2HA 5T3XH 3AGVA 3MV7D 1DBJL 1F90L 3C6SA 4PLKD 1MCLA 3VH8G 3HB3D 4NN5C 1XF5B 1ZANL 3HB3C 2ZUUA 4NIKB 5CS7A 3RVUD 2V2TB 4PJBF 4P4RA 3NIDF 2B39A 4OZHE 4YDLB 1MSPA 5D70H 4WENB 4NBXB 1JJUA 4L8CA 3QI9D 4CU8A 2XWJB 3MYZA 3C5ZD 4NO2B 2EICA 2ORBH 5JA8B 3L6FA 3DX9A 3C5ZC 5SWZA 1VACB 3L3JB 3HMXA 4S1SH 1PG7L 2YPKB 2NY2D 4TN9A 5LGJB 3UJIH 1LEIB 4U1GC 1GHFH 3OF6D 1HOCB 4LDLB 2NLJA 3GJEA 4KK5D 1OAKL 2N7AA 3LY6A 5ITBL 1UM6H 2KH2B 5GSRA 1ED3A 2DTML 3ULVE 2ED9A 4LQ1A 3RUGA 1YNTB 3FRPA 3LRSB 4I0CC 2LQRA 3QDGA 4XWGH 1AY1H 4MA1C 2QADC 2DQCL 4I3RH 5ADPL 2XKNA 3SDCD 4QXGH 2L4OA 1OAQL 2VXTH 3SDCC 4DQOL 5D2LF 3JSSA 5ALBH 4FQJL 5L8KB 4QXUL 1MCNA 1UH4A 5FDWA 3CDFA 1G7QB 4WEBL 2EIDA 3A6BH 3CMOL 3GSRB 5CSGA 3U9UA 4JHZA 4DN4H 4DZ8A 2E6PA 5J9PA 4FQXB 5DMYA 1XF4A 3NGBC 5IB3B 2XOTA 3QXVA 2DTSA 1A1OA 1KXQE 1KLUB 1HH6B 4W4OA 1V7ML 3ZLQC 2HH0L 3K80A 4DZBA 4LPYA 4ZYKA 2ADFL 5JNYB 1PKQE 4YO0B 1MH5B 2CKBA 1X5HA 2I9LA 1JYXA 1ITBB 1FNEA 3BI9X 3CIQA 4JDTL 3DYOA 3KPQA 1R5WB 3JUZA 4FQCL 4ORGB 4XPBH 2YZ1A 4DFIA 5CP3H 4E41D 1I7RB 4K3DH 3K3QA 3BYTA 4R4BA 2DQGL 3LKOB 1MAML 5F7DA 1S7WB 1H5BA 3RWCB 4M93C 2AK4B 4GMTL 2GYSA 2DJSA 4KY1L 1C1EH 2ZG3A 2VERN 4D8PA 4F80A 3MLTB 5FCUH 3BFOA 1XGRB 3JTTB 2YHGA 2NNAB 2CIKB 5TJWK 3VWKA 5ITFA 4UIMB 1SJEA 3LB6C 4H8WL 2EDLA 1N3NA 3C87A 1WBYA 3EFDH 2ESVA 1GOHA 4TUKL 3KPNA 5I0DA 3OKEB 2FZ3B 1GYAA 4NN7C 3GMQA 2ITCA 2PW1A 2D9CA 4HJ0C 5INDA 1DUZA 1E4XL 4IRSC 5GHWL 4KHTL 3ES6A 1NL0L 3EBAA 1KJ2H 3MNZA 4UV4H 2Y5TB 3BKCH 3EHBD 4NOFA 1I8IA 3MRHA 5HD8D 2BMKA 3L7FA 1E4KC 3KPOB 4YFLF 1J8HE 1E6OH 3TCLB 2BVYA 3NPSB 5DK3A 1FVCA 2NR6C 2NY4D 4K7PY 4UT7L 2NY4C 1I8LC 3ZYJA 1RZIB 2NXYD 3DYPA 4FTVB 5EORL 1P7QD 3T0VA 4MHHI 2NXYC 5IWLA 1T2QL 2LAAA 3ARBB 3LKSA 3VXSE 1AQDB 2PF6A 4MNQE 4HT1L 5D1XD 4UNVA 1A3RL 4MJIA 5E8OA 5HYEA 2Q86A 1FL3B 1P84K 4NJAL 3V5KA 5TQ0L 3THMH 2GJZB 1FAKT 1NAML 2P5WD 4Q0XL 2PR4L 3FRUB 2ZUQB 5F8QC 5T1LB 4PJXF 1AP2A 4LSSL 4OZGB 3BIAX 4M48L 2ARJA 1KNOA 2V2XB 3ZE2F 1Q9WB 3C5SA 3FMGH 3SKJH 1CTOA 3KPTA 5DUMH 1HCFX 2NY5C 1MFBH 4XNZC 5DRXA 5HDBE 5HYSA 4HS3B 3GMNA 4XP1L 4P2RE 1BX2B 2YR3A 3I85A 5SWSA 2BNRD 3BDYH 2DIJA 4MJ6A 3VH8A 3TIDB 5ID0B 3NFNB 3MRBB 3HR6A 5FECB 5KS9E 3JV5A 3QEHA 4WEUD 5K59E 1EJOH 1KF9B 1INEL 1OT2A 1JNHB 3LH2H 4JCLA 4JVPA 3BW9A 3OBAA 1CLOH 3HZKA 4OM1H 4WHTA 4EIGB 4Y5XB 2X1WL 1XIWA 1G6RH 1K2DB 1U92A 5E2VL 3HE7B 3P0VL 3LKQA 4LMQI 1FRGH 4UQ2A 1HHGA 3PHOA 4WFFE 5C0DB 2IMMA 3ZTNH 1HKFA 4V1DA 1CK0H 4HUXA 1OQOA 4AEFA 1KIRA 2R23B 2ARJQ 2R29H 2XZQH 1S5HB 3LEVL 3X11B 1MY7A 5I1EL