4ZNCD

Fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 35
structure length 207
sequence length 207
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zncD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zncD01
1DDHB 3LPFA 3WJJC 1BM3H 4UAOB 2YC1B 5TDPA 4TSAH 4HWEH 1AQKL 3QXAB 1NMCB 4NO0D 1OVZA 1NKOA 5A16B 4BA8A 2Y25A 3K8LA 2HG5A 5IR1B 3ILPB 1CXKA 3MV11 3ARVA 2XA8H 1G84A 4HWNA 3MGTA 5IG7B 3O0RL 4N8VB 1LE5A 3QUXB 4IS6B 4ZUVA 3KLDA 2FGWL 1NCWL 1VCAA 1K8DB 2BVEA 3OJMB 1QLFA 3VXOB 3K80A 5ID0A 1T0NA 1W8OA 2BK8A 1INDL 1N6QH 1KYOK 3AY4A 4NCC1 5IWLA 5CILH 5DT1H 2GTWA 3F5WA 4LPXA 2RCSL 4L5FH 4F3FB 1KPRB 4WTZA 1I9IH 4K7FB 1IGYB 1FE8H 2Q3ZA 1HN1A 1KJVA 1X5XA 2AJVL 2CLZB 4XBPA 1MHEB 4HD9A 3MV7A 2HG5B 5A2FA 5J1AA 2VMFA 3GHEH 1TFHA 4P4KC 4V1DE 4JDTL 1A1MB 1UM4L 5EIIA 2AXFB 1LNUB 3CSBA 5ID0B 4M5YH 3O3EB 4U3HA 3RBSA 4NQDB 3WL9B 1QFPA 1BEYL 4P4RB 1S9XB 1IGML 3ARDD 4ZUVB 5E2JA 2FB4L 4N1CA 5HXMA 3L7FA 2AI0L 4XWOD 5D1ZB 1SM3H 3BPCA 1CGXA 1VEPA 3RHWK 2C7UA 1QVOA 4JPIB 3QEUB 1FVEB 1DTUA 1R3KA 2F8OA 3QFJE 5EZOL 3ULUH 4Y4FB 1U8LA 1DBJH 3DARA 1UM6L 1HH9A 2VERN 2XICA 3D3VE 3OBAA 5FAAA 2VIRA 4QRTB 4GRMA 3FO9B 4MAYD 4UU9A 4LP4A 3LQAL 1DANT 3CVHL 4GKNB 3QISA 3LRSB 1CDIA 4KZEH 4KI5D 3BJ91 3OKKA 1XF3A 4U6HB 1KIPB 3BD3A 3QDHA 3QCTL 4PJIF 1PKQB 4JDVA 3CZFB 5DVKA 5FM5O 2P8LA 3SEPA 3RIFK 4XC3H 5E6IC 3NFPB 1ZT1B 1SYSA 3KLAA 2EO1A 5GGSB 1LP9E 4FTVE 3ULUL 3RUGF 1MCWW 4MSWB 5IV2B 5HYJA 2FD6H 2BY1A 3VFSA 3TIEA 2G9HA 2X42A 4GRWH 5DR5H 1CIUA 2ESVB 2P8PB 2PTUA 1U8IA 4Y5YC 4PJCB 1YA5A 1IGMH 1TZHA 2FJHA 1JHTA 1BIIA 4P3CH 3C08H 1FFNB 4YDJA 2XWTA 3MRKA 2Z8WC 4F58H 5ILTH 3EOTL 4ETQA 3U4BL 2YPKB 1G6VK 3BIAX 1Q94A 2B0SL 1IM9A 3KPOA 1AO7A 3IKKA 5GS2H 2GTZB 4YHNA 3QA3B 4WO4B 1HNFA 2F74A 4MJID 1FAIH 3RWHA 3RL1A 4X7SL 3SQBA 4G8IB 2NY2B 4LSTH 4Y5VB 1EO7A 3O9WB 5D6CA 4WIQA 5INDA 4Y5YB 1TETH 5EU3B 3DROA 4FQQB 4OIIH 3BE1L 4GMTL 1K8IB 2EDHA 4HKXB 1MY7A 1CD8A 5SWSD 3QUYB 3MXVL 5IQ9B 2GQHA 3IS0X 3IXTA 4FZEL 1S7UB 1EEUA 4PJGA 2WIMA 5BRZE 3V5HB 4PY7A 1JN6B 4ZXBD 2VDNH 5C2BH 4JFZL 5DSCB 1Z9SA 3MA7B 3F7YA 5B38A 2HTLC 3UC0H 1IGCH 3RHWF 4U1GC 5LJYH 1G7HA 2R15A 2A83A 4G80B 1YNLH 1KJMA 1KTRL 3CK0H 4I18B 5TJWK 3NCEB 3GSNH 2DKUA 5I16B 4PB0H 2DKMA 4M43H 5IFAL 5T3ZD 1X5FA 5FM5M 3W0WA 4ZXBB 3PWPE 4WW2F 2UWEA 3SKUD 3P0VL 1EGJA 3D5OF 4Q7DA 5DHVA 1S7QB 4I48B 2DQUH 4JG0H 3I2CH 5DRXB 2BMKB 3DXAD 1BWWA 1N6UA 1AP2A 4R7NB 1VPOH 7FABL 3VFWB 2OTWB 2PTTB 2OJEB 4UV7L 5IIEA 1WTGT 3JWDH 5FHAL 5F7EL 3H9HB 1NLDH 1CK0H 5CGYC 2YOCA 3TYFA 4AT6B 1BZ9B 4GBXB 4GMSH 4R4NC 5IB1B 1RVFH 1LK2A 5F70A 3V52L 4QRQB 3KG5A 1HCVA 3D85D 3ZYOA 2LFGA 5IMLB 5I8EB 1B0GA 5I74C 5K9QI 3L3IA 5HI4C 3VWJC 3FB8B 4IRZL 4HS8L 3MR9B 1OHQA 3I75A 4HKZB 1FPTL 1OP3H 2DJUA 2NY6D 2GHWB 4K8RL 2ADFH 2FIRT 5DRZA 5D70H 3QDME 2V9RA 4O58H 2HTKD 5EUKB 1BQUA 2JK5B 1FCGA 4I0PD 5I8CA 4Z7VB 2X4TA 4OSUH 3DMMA 4WFGD 5L6YH 4DCQA 3MLTB 3PQYD 4YHZH 1KEGL 4AQ1B 1PX3A 3O6MH 2VQUA 2B8OT 1J1PH 1VGKA 1ZVYA 4LEOB 1MRCH 5CJOL 1K3ZA 1RJCA 3FFCA 4WVRA 4X99A 5DJAA 5F7MC 3R06B 4YHOH 4LSSL 4LCYA 1GZPA 1OTTC 1ADQH 4WW2C 4R0LA 2IAMD 1AO7D 5IF0B 4TNWF 3JV4A 1U92B 1XH3B 4JHAL 1TJIL 4M8QA 3LDBC 4JO2L 4X5XB 4Z7NE 5CKAA 5DHXB 5D7IF 5D2LA 2D7OA 4JZOB 4OCXH 5ADPH 2VH5L 2D03L 2IG2H 2QADD 1BFVL 1J1XL 1MVFA 3QIBC 2ERJC 4QCIB 4EBQL 4GLRI 4U3XA 3QCVL 1BVKA 1JVKA 3B2VL 4K71C 5D9SA 2C3GA 1U3YA 2AK1H 3C6LD 4QRPA 5C86A 3MRRA 4GQ9H 4EZMA 4LCWD 3BX7C 2GAZB 4NZTH 5TQ0H 4WEMB 3ZTJG 1J10A 5JR1L 1ZANH 3T1FA 4YE4L 2JJUA 3V7MA 2W59A 5FCSH 3MRDB 4PJEB 1IC4L 4XBEH 3TH4T 3UROR 4XMKH 4LCUA 3SDXA 2JIXD 3N85H 3ZT5A 1JF5A 1PSKH 3CVIH 3U9PH 4PS4L 1DJSA 4PGJA 2DB8A 3PWUB 2QQKH 1NGZA 5F1IA 2HAZA 2CH8A 1A1OB 1RZKC 2HFGL 5DEGA 5EOCJ 4QTIH 3TO4B 1J8HE 4YFLI 3UJTL 3PDOA 2GAZA 5CZVL 2Q86B 3NFSL 5DRNB 3O6LL 4OV6F 5J0BA 4TUKL 1C16A 2GJ6A 2W07A 4G7VL 1JMXA 4NKOB 3GBLA 3V4PL 2K3TA 1R6VA 2X4QA 3QDJD 2HVJA 4PRHD 4GOSA 3HNTH 1OOAA 1IBGL 1O0VA 3U36A 4DEPC 4JGUA 1MHHA 1CD0A 5DLMH 2NY6C 2PYEA 5C08E 3KYMB 4FQJH 1DFBL 2F5BH 2VTFA 5IF0A 1YN6B 3BJLA 3QEQD 2H9GA 2F58H 4NRXA 3DGCR 4PJ5B 2DQGH 1R0AL 3PDGA 2E3VA 1A7NH 1LO3H 1E27B 2R69H 1NGYB 4JN1L 4PBWD 4X6DB 4F37K 5KJRL 4QCIA 4E41D 2ESVD 3VFUB 2OYPA 43C9A 1SJHA 3GI8H 3PGCB 5I1JH 4D8PA 4UBDC 3WIIH 1EX0A 4YHYB 3LS5H 2HWZL 1FZMB 5GS2D 1V3KA 3BDYH 3PQYA 4XP4H 2CRIA 4QNPE 5CJBA 2P5WD 2DLIA 3TEUA 3HNSL 4PUBL 4X99B 5IMMA 1JBJA 4V1DD 4N1EA 1HI6A 1RZIB 2BOCB 2D7QA 2HKFH 1CWVA 3FRPG 4LRNH 2IH1A 1GSMA 5IMLA 3RA7H 4ONHA 2FZ3A 5F97E 3R1GH 3MFFB 2AABH 3F62A 3K4AA 1BZ9A 2QQNH 4U05A 3DMMB 4PGCB 4FXGB 3TBVB 2HT3D 4IRSA 4WDIA 3F7VA 1RIVH 1F3RB 4Z0XA 1PZUB 5DUML 4JQVC 3ULVL 1C5CL 3JV6B 4Z76A 2IH3A 3Q2CA 1GGIL 1QBLL 1SJEA 3W39B 3AREB 1ZSDA 4KH2A 1GOFA 3TGXA 2V9QA 1NAKH 4UT7H 1R5VA 1QSEE 1VFMA 3SDAB 1XF4B 1ZGLB 1RUMH 2YD1A 4OZHE 1F8TL 1KYOJ 2HN7A 3LRSA 1DVFA 2WNGA 4WI4A 3D0LB 4G9FB 2XXMB 2RFXA 5I75C 2H32A 4UU9B 1RK1B 3IDJA 4Q58C 5ESQA 5F96H 3G04A 3T04D 4CDHA 1KTLB 1JJUA 1I1AC 3MOAH 4YXLL 3CDGA 1CGUA 3RI5K 1N0LA 2BMKA 2VABA 3REWA 1FSKC 4PJGB 3NCMA 5E2UH 2DIJA 3PHOA 3IXTB 4PTTA 4OZIA 1SVCP 5I6XC 1F4AA 3WNMA 3RBGA 4Z95L 3WNPA 5DK0A 1AXSA 1IAOA 5ERWB 4HFWA 4RFOL 3B8SA 5GRWA 3SBWC 4KK8D 3AGVA 3VMNA 1UVQA 4F80A 1LDSA 1P5VA 1XCTB 1JNNH 1YUHA 4HKJB 2VQ1B 5IMOA 3I3BA 5DC9B 4JY6A 3CDCA 3HFMH 4K8RC 3QXVA 4MA1C 2G5RA 3GSRB 2ZSVA 1G9ML 4Y16D 1YY8B 3O2DL 4CUCA 3OG6B 2P5WE 5D1XA 4BUGA 4ZFGH 3SE8H 1JWUA 3BDXA 1OM3L 1KNOB 1K8DA 4UV4H 1KIRA 3STLA 4GS7C 1MLCB 1FNHA 1G7JA 2C3VB 4YK4B 5FUOL 2LABA 2P43B 3WXWL 5F7NC 3DGGB 2K9UA 4M7JL 1EVUA 1MCQA 4EDWL 1TVHB 2F54A 3TZVB 4DZ8A 5ICYB 4QY8B 1ES0B 4CVZB 3IAQA 3BKCL 5K9KA 4FXLA 3FQXA 1FCCA 1R3HB 4UB0L 5E99H 3O9WC 1OCWL 3IDMA 2C1PA 1GAFL 4ZO9A 2D31B 1F4XL 1J87A 1I8MB 1NBVL 2YA2A 2R8SH 2J2ZA 1AFVH 4NC2B 1QRKA 4LF3B 1W0VB 1FG2B 1QTYT 5HHMB 2GYSA 3EYFA 1AGFA 1JWSB 3EO9L 5D2NA 1MREL 3TNMA 1DSFH 2GUOB 3MLYL 1KPVB 3RIAF 3MGOB 2RHEA 3MLVL 5GZNC 2CLVB 4XPAH 4ONGL 5IFHL 1P5UA 5AD0B 2DM7A 5CIPA 4LIQH 4NZRL 2XACC 1A6AA 5SX5K 1OP5K 4QRUB 3RIFF 5KVDH 3UTQA 1T5WA 4PJ7F 5JDJA 1CLOL 4YUEH 3HI1B 4LQ1A 2HH0L 5IESH 3OR6B 1K6QH 2J8UA 3P77A 1VA9A 4Y8AA 3H9ZA 3TZVD 3VMOA 2GUOA 4XAKE 2RJMA 1LO5A 5FA4A 3HE6D 3VXME 1NUGA 4NO5B 5KOVC 4GO6B 1WFUA 1C1EL 3DOSA 3LKOB 5ESVB 1CLOH 1ZHKA 5E2VH 3T4YB 3D85B 5K9QG 1FVCA 5EBWB 5C09E 4PFEA 4JLRA 2IPTH 3M1BA 3MLUH 4D9RD 5D7LE 2XI9A 5ESAB 4GBXD 4ONGH 5E1HB 1YDPA 4WY7L 1IILE 4BZ1H 1N6VA 3QEUA 2CJUL 2R2HA 4WUUB 5DEGB 4JEGB 4ZPVA 1C12B 2OZ4L 3NCJH 1JF6A 4QHKJ 5AYQA 3JZ7A 5C07D 3B9KB 5DFVC 4P0DA 4Z5RA 3Q6GL 2VXTH 3HE7C 4AM0B 3K4DA 1J0HA 5CP3H 1CU4H 1KN4L 3LIZL 3O4OB 2H8PA 3UYPA 2Z4QA 4N8VG 1OCWH 4F33A 5GGVY 2CUIA 1NC4D 3QIWC 5I15L 5J1AB 4E5XB 1PY4A 1X6NA 3HRZA 3QG6A 3VD3A 5HHOB 5IHLB 1KJVB 1BVKB 5AEAA 2VN7A 1IGYA 1U3JA 4LLWA 3IDUA 4M7JH 4LNVA 3T77A 3ZHLA 4GG6B 2OR9L 3AS0A 5DJCA 5FO7A 3HHRB 4Y7MA 4BSVA 3BISA 4L4VD 2I5YL 3QFDB 1CVRA 2DQHH 5DA0B 4XNZB 3RWGA 5CSBA 3RNKB 5DC0A 2CO7B 5EPMA 3VXRE 4XX1E 2QJDA 1UA6L 4KI1A 5C70A 1SYVA 4LASL 5IM7B 3CDGB 4TULH 3LMJL 5I19L 1UADC 4Z7UF 1NFDB 3OKNA 2QADB 1CQYA 4PV9B 2VZOA 5ETUA 3VJ6B 4H0HB 1HK6A 1KPUB 4PJFF 1H3PH 1BIHA 3OXRA 3TVMB 3LOWA 4NPYA 5HD8C 4LQFH 4TVSa 3CUPB 2J7LA 4I18C 5E7FA 5F88A 5C0AE 4JFED 4BQ9A 4RDQG 2QV2A 3ZT6A 1CXHA 3MR9A 3STZA 3V95A 5KANG 1ZSDB 4B0MM 2BDNH 3TBYB 2VL4A 2HKHL 3MLSH 4YXLH 4V1DB 1FO0B 3OKDA 4QLRA 1K85A 5CJXC 3MV8B 2E7MA 4Z7QE 5LKNA 5AUMB 4P4KA 1HYSD 1OP9A 2DWEA 5E2TL 5I17A 3H9HA 1RZFH 3QHFL 1H3XA 2YKLL 4JVWA 4LRIA 15C8L 1RUML 5DVMA 5IKCA 4M1DL 3JUZA 2XG4A 3AROA 1IEAA 2EDTA 3MJGX 4PJAF 4S2SA 2XPGB 4L9LB 3AM8A 5C09A 1U2HA 3O81A 1T1ZB 4MVBD 3MUGA 1IQWH 2WINB 3ZE0E 3S37H 1IEHA 1AGDA 1KBGL 3MRBA 2EXYD 2I9LA 3C5ZA 3E6FB 3AMLA 4YK4C 3OXRB 3HE7B 4HWBA 1QFWM 4AL8L 1I9RL 3ULVF 1GGBH 3Q3GB 3QPXL 1BOYA 1TVDA 4LIQE 1R3JA 5SV3A 5CMAB 1Q38A 4V2BA 4OCYL 5E6ID 4PJ9C 3HLAB 3IDGA 4S0TD 4YX2H 2NY5H 1B0WA 1R24B 1S9VB 2A73A 2VZ1A 5INCA 5CEXA 1CICD 3T0EE 3F7RA 3K46A 1Z3GH 3VRJB 2L7UA 5HHOA 5CP7A 3I6LE 3NIFE 1NC4A 1N2RB 4KXZH 1MVUB 1IFHL 3V0VA 5EFIA 5ISZD 2DQIL 3IFOA 5D7LD 1JRHI 1IC1A 5C0GA 1L0XA 1WEJH 3DURA 5ITBL 4WWID 5FYJE 2V5SA 3IF1B 4XXDB 4LVOC 3GKWH 3UJIL 3WHXA 5FDWA 2HT3C 5F6IB 1KTDA 3HR5B 2OL3L 5DMGC 4DUWA 2X05A 3IT8D 4IRJC 5E9DE 2LTQB 1INEH 1XR9B 4U3CA 2I9LB 4MXWH 3HB3C 5I1KL 3HTLX 4RX4A 5FHBL 4FQJL 4WWKC 2Y7QB 2EYSA 2X10A 5HHXL 3QUYD 1FVCB 2DQFB 3RTQD 4BQBA 3VFVB 4Z7WA 1CXIA 5EU6D 3MA9H 4GKOA 2W0FA 3PL6A 3LB6D 5TE7L 3V4PH 1U8OB 2ICWI 3T3ME 4M1GH 2APTA 2P47B 1YMMB 3LKRB 3BN3B 4Z78A 1T5WB 1YDPB 1SYSB 2HP4A 2VDLL 2XQYG 3KLAB 2ITDB 4HDIA 5CZVH 4EIGB 2GY5A 3BD4A 2EDJA 3MV01 5D9SB 5FHBH 5I1KH 3AU1A 3OKDB 4D94A 4G8GA 5KSVA 1OTUC 3BT2H 3K2UH 1NGWB 1AKJD 3NOIA 1PKQA 4G43A 4NO5A 3QPQD 2JJSC 3NABL 1UH3A 1ZV5A 4UQ2B 5GZOD 4XBEL 4OZIE 1D9KA 3TA3A 4WFFD 3X3GH 4IOIA 2UVFA 1MEXH 5DMGD 4XPTL 2VRAA 2X89A 1SY6A 3QG7H 1MUJB 5T5FH 1GZPB 1GIGL 1MFNA 5D2LF 5F8RC 2JTDA 3B2VH 3G6JF 1I8KA 1UWGH 4ZYKA 2QKIA 4YR6A 2EDYA 1CLCA 3RUGB 3ALWA 4RAHA 5BV7H 1QVOB 5FO8A 1B2WL 1QRNB 5ALBL 1B9ZA 3NN8A 3DI3B 2X4UA 3DGGA 4FN0A 4OIBA 4YX2L 3ZE0F 4H5SA 4JFXA 3KPRE 2XWBB 5CP3A 4ZG1A 1N5AA 4R9HA 4YXHH 1NGPL 3QPXH 2E6PA 1CICC 1GGBL 4S0SD 3QFDA 1IC5H 3T1WA 3ZKMD 1A6TB 3PXHA 3S88L 1KBGH 1BQLH 4HXBH 4I3RH 1N0XH 3SE4C 2ID5A 4QGYA 1ZT7A 5DJDB 3FB7A 4JFOB 4OKVA 4R4ND 2GCYA 1CTOA 5F9OH 4PD4K 3OGCB 4JM2A 1C5DA 3BAEH 4K3EH 2ZCLH 3BEWA 3EDFA 5ISZA 5AZ2L 4F9PC 1KXTB 4MCYA 15C8H 4CBPA 1YEFH 4YPGA 3QZWA 1RZFL 3CCHA 5F9WC 1QR1A 4YEFA 1GGCL 2KZWA 4TQEL 2I07A 1FPTH 3OV6A 2CDEA 3V2AR 1PJ9A 3PWJA 2R1WB 3RJQB 1WGOA 3V6FA 1PZ5B 3KXFA 3D9AH 4P23D 1MWAL 4BJLA 5FEBA 1NC2B 2IPUK 1GC1C 4R3SB 4YDLC 4RX4D 2UWEB 2X4RB 4RBPH 1ETZB 2DL9A 4GRWE 1RZ8B 1YC7A 2RGSA 1A6VL 4X7CC 2AQ2A 3NIFF 4I18A 1EBAA 5CEZL 3WFDH 1RHHA 3C6LC 4HJJL 2OCFD 4NHCH 3U79A 3OXSA 5B38B 3X14A 2FL5A 1VPOL 3MRFB 1T4KB 4XAWL 1WZ1H 4ORGB 4NM8L 3X11A 1FL5B 1HHKA 1MCKA 2DQUL 4Q2ZB 3QIUB 2CD0A 1JN6A 4J1UB 3AREA 2X1PA 1ZHLA 1JGEB 5C08A 1KOAA 3QULB 4YXKL 5D8JL 4QRRA 2PXYA 5CKGA 2EH7H 4UIMA 3QJFB 3PWLB 4GBXC 1FLTX 2G75B 4HBQA 4B5EA 1I4FB 2X6MA 1I1FB 1HOCB 5C0JA 1K4CB 4JFZH 3KVQA 4N9OB 43CAA 1L7IL 2G60L 4DKAA 4YDIH 2BOCA 2A6DA 3RVVD 2Y36L 3BH9A 3O3AB 3DV6A 3QAZB 4PRPA 5EC1A 1MSPA 5BZWA 3LV3B 2NTSP 4DZBB 3QUZD 1OSZB 3C8KA 3C5SA 4RRPA 4ZXBC 5SWZB 2NR6C 3VI4F 4ZOEA 3L6FA 2G9HB 1F4YL 5D5ME 2VXTL 1F2XK 1MCEA 3ZHDA 4X98B 1FV1B 1HQRB 4X7SH 3CSYB 5FO8B 1V7NL 2YEZB 3QP3A 2IJ0C 1FAIL 4PRBA 1MWAA 4OZGB 3VH8B 4AH2B 4QRPE 2B0SH 5F7UA 3LV3A 2AJSL 4GG8B 4UIMB 5ILTL 3T0EA 3GHBL 5KSAB 2J8OA 1I75A 1QKZH 5HGBB 5F1SA 4BSWB 5E5MA 5EU5A 4W4OC 1A6WL 1FYHB 4Y16C 3C08L 1XF5B 3LAFA 3KYMA 1HIMH 2BVTA 1CGSL 2XZAH 3CNKA 3U7YL 3C8DA 5CSZA 1TQBC 1BJ8A 3VU2A 5D2LE 3OGOE 2H6PA 3HPLB 4ZO7A 5IB4A 2FL5B 3NVQA 4M6MH 2R4RH 1A8JH 5DYOA 5DUPH 4MD4B 2H2SC 4QWWD 4X7FC 1T83C 2ZCKL 3FN0L 4K3JH 4DOHB 4RA3A 3ZKQD 1K6QL 3ME0A 4L4VB 5IESL 3DJ9A 3AU1B 3WFBL 1KCRL 1ETZA 3CXHJ 5AZEH 3KYAA 4XC3L 1D5BA 4OCWH 3PHOB 3JVGC 2ITDA 4OD1L 1C5BH 1HHHB 4LIQL 4NZRH 3G08A 3MROB 1OAYL 2VE6A 3HAEB 5CFHA 2VABB 2ZUSA 3D39B 4HZLB 5B22A 2OMBA 2FGZA 1HZHH 3WS3A 5I1AB 3WFCL 4O2EA 4PG9B 1KTLA 4LFHD 3HAEG 3V6BR 1S9XA 1TJHH 3IU4H 4G9FA 4H88L 2DM3A 5E70A 4F7TB 2EKSA 1A1MA 4XCCH 2OTUA 1NBVH 2I24N 5FKPB 2Y72A 3OF6D 4P57B 5F7HA 2V5MA 3DECA 1T0PB 3ORJA 1QSEB 3WV0A 3AUVA 4WUUD 1IGIL 4Z7VF 3K0WA 1NGZB 1KPRA 1QFWL 4XZUB 1S7XB 4WO4D 1T03H 5DMIL 1HSAB 4U1IA 4OF3A 4H8WL 5D7JA 3JV6A 3ARBD 4Z76B 1BQSA 3SDXB 5DVOA 3GFUA 3RVVC 5IB3A 2NY2C 3DURB 4NQSA 4W68A 2HVKB 2H26B 2NW2B 3T1FB 1UM4H 1RZGA 1MJUL 3O2VL 1OM3H 4MD5A 3VFTB 3SE8L 1P1ZB 1U8HB 2CMRL 2G5BA 4YC2B 4WHYG 5D71H 3I6KB 4KDTA 5IROA 1G7LA 3TN0A 4GKZA 5HYSB 1G9MH 5FGCE 4NNPH 4OKVB 4I3SL 2HJLA 3E3QC 4UILL 3T2OA 2ITCB 4KPHL 2DAVA 5DEZA 3JTTA 1OQXA 3O3BB 1GYAA 5D93C 2FHBA 2IBGA 1A6TA 1U8MB 4FFYH 5KSAD 5KVGH 2DL2A 3G6AA 5J89A 1R3IL 3JV0A 2A6JB 3ARYA 3QUZA 3Q3GA 4Z95H 4XWOC 1I8LC 2X4TB 3RWDA 5KTEH 2FGWH 1H5BC 2HFEB 4OQTA 1B90A 3QEQA 3IJHB 4JM4H 2AEPH 3U0TA 3TLRA 5HHQA 43C9B 2WV3A 4L9LA 5DTFA 2Z8SA 1L9MA 4AY0A 1OB1B 1VACB 4M1CD 1CDCA 4HJ0D 4JFFD 2DLFH 1LWRA 2OM5A 1RI8A 3W11C 4UMGA 2BSSA 4L8BA 1EEYB 3MOQA 1H3GA 1MAMH 1VGEH 4JN2A 5JOPD 5KS9E 4HH9B 5EOCL 2AVGA 4NGHL 1QFOA 5D1ZD 1U8OA 1RUQH 3NCYP 4GW4B 4KMTH 4A6YB 4OF0A 4Q9BA 1EFXD 1A7OL 1PAMA 1FNLA 5EO9B 2X1OA 5ACZA 4JFDA 3VXUD 3ETBF 4JHBA 3HE6C 1BAFL 5E56A 1ZWIB 2VL5B 4MA8H 5I18H 3RVTD 5C0BD 3QIUD 2PW2A 1T1XB 1SJVA 2IFGA 4YNYA 1FL3B 4U1KB 1MQ8A 2W9DH 1MFCH 3LD8B 3OKLB 1VFOA 1NFDA 3OKNB 2YD2A 3P73A 5H37H 4L29A 5B3NA 4L3AA 1T7YA 1BWMA 4JB9L 4OZFH 4LRNL 2NY7L 3I9GL 3LKNB 3ZDXF 3IETA 5D72H 1CLZL 5EPMB 3C5JA 3GBMH 1X5YA 4P23B 2BNRA 4G9DB 1ERNA 4PG2A 5IQ9A 3OJDB 1T7XA 1KIUA 4LK4A 4X4ZA 1NBZB 1BD2E 4FG6D 3NMEA 3MGAA 4OGAC 1EXUA 3G5XA 5GSVA 3LS5L 2JIXB 2GKIA 1MCPH 3B9KC 4X6BB 5DSCA 3GRWA 3D18A 3S7GA 3GI8L 5KVEL 2IWGA 3PIQA 4A2LA 3VXPB 4JRYA 1MHPL 4XP6L 1CXLA 5HGAA 3EGSA 1WITA 1ZE3C 1GL4B 1LO3L 1Y6KR 1A7NL 2NY0D 1XGTB 2B1AH 1NGQH 2F54E 3GNML 2AJUH 1B3JA 2F58L 3FFCB 3DETC 5T1LA 2XPGA 1JHTB 1GVIA 1OGTA 1QEWA 3NIDE 1PG7L 2V5RA 2IALB 4F2MB 3QQ9C 5EO1B 3TIEB 3QDGD 2ZNWA 4ZPVB 3ARSA 4EXPX 3VD4A 2V2TA 1WWBX 3MV7E 1RFDL 5E8OB 5F44A 5EC2B 4ZNCD 5H35A 1DQLL 3QBTB 3T4YA 3TH3T 2ADJA 1YMHA 5EO0B 4OB5L 4XVUC 1NBQA 1FP5A 1FFOA 4NQVB 4PGZA 2OSLB 2DQJH 3TJHD 1QSFD 3VFSB 3O8XA 4OB5H 4OZGF 4QEGA 3VXRB 5AUMA 3ET9F 2XY1A 1T2XA 1J8HD 1DQLH 1QSFB 3K81A 1M05A 3DVNB 4NFBA 2NY6B 4PV9A 2QSCH 1CQKA 4B41A 2VIRB 3VA2C 2OJEA 1JHLL 5DS8B 2FBJL 4L9DA 1Y18B 2OTWA 1RFDH 5L2KE 1JTPA 5DI8A 1AKJB 4RWYH 1WCQA 5TE6L 3RWEB 1SEQH 3MGOA 5C3LD 2R2CA 3QCVH 3QO1A 1X4XA 5ID1A 4GAJH 3MX0A 1EZVY 3OTTA 1KJ2B 1T0MA 4Q0XL 3MRCB 2W91A 1QBML 2BNQE 3BFOA 4OLZH 1L7TH 4OZHA 1HWHB 4MJ5B 2DWDA 5I16A 3U82B 1O7SA 5FOBA 1TJIH 3UDWC 3FZUC 4P46B 1MI5B 3P2TA 2FIKB 1DQTA 4PJHB 3QRFM 5IGXL 1BF8A 4MNQB 4P23C 5FV1L 1MFBH 1PKOA 1F97A 2KZ1B 3GSOB 4G42A 3QIWB 4LSDA 4NFCA 3UBXA 1WFNA 3U46A 2DICA 5E08H 4FFZH 3O6ML 4WI2A 5E7BA 1X9QA 2AK4A 2FJGA 4C83A 3WYRA 3LN9A 2EIDA 5IB2B 2VLRE 3BWAA 3EAKA 3PGFH 3DMMC 3RPIA 5D72L 5CBEA 4LLVB 1HXYA 5D70L 1E0OB 3SGDH 2DTMH 3LKSB 1DP0A 3SO3C 2R0ZL 4JB9H 1I7ZB 1J8KA 5CS7A 4M02A 1Q9WA 5C07A 5JOPE 1GGYA 2CUMA 3L5JA 1T1WA 4FQXB 3V52H 1RVFL 3VG0H 3U0PA 1J0KA 1AHWC 4GMSL 4MDIB 3P9WB 4LDEB 2VYRE 3QEGL 3H0TB 2YA0A 1UKQA 3HG1E 4PJCA 1RV6X 5IJKA 2EXWD 3QUXD 5HJ3B 3CIQA 3TH2T 5IB5B 4RNRB 3VWKA 2IAMC 4GAYB 1PG7W 5ENWA 1AGEA 1IKNC 1ZVSB 2P45B 3OHXA 1HDMA 3HI1A 1KJ2H 1S7VA 1G0DA 5J6HA 1ZT1A 3SJVE 5AWNL 4KMTL 1DCLA 1MRDL 5ACMA 1NCAL 3E6HB 5JORA 1OWRM 5IHUL 5EOCH 3P4NA 4CN6A 1U8NA 1OAKH 3ZKXC 2AV7A 4PJGF 4Y1AA 5DFVD 3ZDYE 3MRCA 3GSNL 3QXWA 5AG8A 1QPXA 1WBXA 1JNLL 4R26L 5FA4B 1YNLL 1BVZA 4PRAB 5D2NB 1J5OH 3FAXA 1R5VB 4MNHB 5MENB 2Q87A 3UC0L 4AEFA 5HYSG 1UXSA 3GMNB 2WIIA 4S1DC 5IVZB 5I18L 4MA8L 1J8HA 2GW5A 1R3HA 3O3DB 1TITA 4P5TB 4OBSA 1MELA 1A3LL 1A7OH 4MXQC 4JREC 4LCCA 4X98A 5IVXB 3BRFA 2GITA 2C1OB 3BE1H 1QA9A 3CFIC 4KHTH 5FYJL 1MCDA 1UKTA 1ZEAH 5HBBA 1MAML 3W39A 4KJYB 4OIAA 4GW1B 4OZFG 5GRZA 2EDQA 3BESR 2F53D 4GW5A 3WN5C 3GMPA 2NW3A 4KDWA 4PP1D 5MEPB 2UZXB 3LS4H 3VXUE 3JWNC 1JFQL 5I73C 3AXLB 3DRQB 1XIWA 3BO8A 4PP2A 2CLRB 1T03L 1DVFD 2CIKA 1YN7B 1FJ1B 4CU7A 3FT3B 2A9MH 1YY8A 4IRJA 1HILA 3QWOA 4S1RH 4OFVA 2C9AA 4JKPH 3MJ7B 2ENYA 4FFVD 4RMQA 5FA3B 1Z9LA 1JGLL 3BHBA 3MLXH 3SGJA 1MQKH 2DRUA 2BVYA 3T2NL 3VXPA 4X6DF 3PNWB 3C5ZC 4RMSA 1Z0MA 4YIQA 1FRGL 1EO5A 3KPRB 2P8MB 1S5IH 3D2UA 3QCTH 1U3HD 1MJUH 3WFCH 5ESQB 1BP3B 2O5YH 3K1KC 4WHTB 4EN3D 4LFHG 5EIQA 4Y19E 1NBZA 3A6CH 4POZC 5TF0A 3UCRA 3HCVB 3GJEA 4OD2A 4RFNC 1BZQK 3C5JB 1TNMA 1P2CB 3PP4H 3LEVH 3EOBB 3LEYH 3L3GB 5DD5L 3D39D 1IGIH 3H9SE 1ZT4A 4ZFFB 4J23A 1YEKH 1ZXQA 2AXGA 2EDXA 3OX8B 3O11B 4O2FB 4BKLB 5T1KA 1MJ8L 1BGXH 3G04B 4NZUH 2H32B 3GRWH 4ZAKC 1Z6JT 1P7HL 1TJHL 3REVB 1FIGH 1CGSH 2D0GA 1BEYH 3FMGL 4IOFD 1HHJB 1EERB 4QRSA 3PJSB 2ESVE 4YDVA 1HYSC 1RJYA 2Q1EA 3ULUF 2Z0BA 1DZBA 3HE6B 1XF4A 4JDTH 4OV5B 4UT9L 1HZHL 3WKNA 1KG0B 4FQ1L 5EO9A 3MJ9H 4WUKL 4PRNA 4RDQF 1T04A 4QGTA 4QHUA 1VFBB 1G6RA 1C5BL 2UWEE 1D6EA 3IXAA 4PGEA 3W0WE 5E8PA 1V8HA 4IIQA 3ULUD 1CI5A 4NT6B 3J7HA 1LEGB 5J57B 1KCRH 1R5IA 1DN2A 3ZYJA 2R1YB 1F2QA 2YZ8A 1UH4A 4QOKA 1BBDL 4DGVL 3WDJA 1BJ1H 2EDDA 4GRLC 1SJHB 4ONHB 5IQ7H 5BRZA 1PX4A 3KPLA 4UZGA 1MCIA 1U8PB 4FP8L 4K94H 3P9LA 4I77L 3I3EA 5F7LB 5I1CH 2DDQL 2F53A 1EH9A 2HTKC 4NKQB 4RISH 4G6FB 4N0CD 5D4QA 1F4YH 3MREB 3TIDB 1RD6A 1BM3L 4P5MB 4U33A 1JNHA 5DQ9B 1XGYH 5DJXA 4H0GA 2E7LA 3VD5A 4KY1H 1NCUA 2ARJA 4P2RA 2EEAA 3OZ9L 2UUDH 4LKCB 4NM8H 4WI7A 2X4PB 4IRJD 1RZ7L 1W72B 2QHLA 5ADOH 4NYLB 4GBXA 3O4LA 1JPTH 2P24A 3RFZC 3I84A 4ELME 2XN9E 4WU5B 5D5MB 1WFOA 2VLJB 5JMRA 3GJFH 2UZIH 3FT2A 1RJZB 5FGBC 2IGFH 3ARQA 3CFDA 1MWAH 1TQCC 5DD6A 2RIKA 4EN3A 3GMQB 3KJ6L 5DRXA 5GS0C 1ORSB 1RUAL 5T1MA 4JFQA 4TTGA 3EOBA 3WSQL 1UZ6E 5MEOB 3UPRA 1XR9A 3V0WL 5BO1L 1GGCH 3HMWH 2OXGA 3X3FL 3WIHL 4PGBA 2XY2A 1WZ1L 5AZ2H 1GJIA 4NHCL 2GSIB 5JHLL 2P5EA 3KJ4C 1T22A 3EYVA 5CEZH 1IKFL 1WBYB 4ZNEE 2KQMA 2JB5L 1FZOA 2VITA 5IW6A 4RZCA 5GGQH 4X6FA 1NCDL 4ODXB 1BQLL 4WO4C 2FJFA 1N5YL 4NYLA 1S7UA 1LO4H 5HI3C 4ZQKB 2QQLL 4WHDA 3PGDB 2V2WB 4OLXH 3FB6B 3MBXL 4FQQA 4KROB 1CN4A 2X09A 5DD0H 1MH5A 5C0EB 4ZUSB 1YEFL 1X5GA 5HYEA 3DSFH 4D9QD 1NEUA 5CSGA 5DD3L 5HYQB 1NAMA 1XH3A 1YPZB 4K3EL 1UWGL 4Y2OA 1AGCB 4D2NA 4NOFA 1GIGH 4MXVE 1XGPB 1WZLA 3LHPH 5GGVH 3T0EC 2APWA 1N0XL 3FB8A 3BIKB 4KJYA 2CLRA 2W65A 5F9WB 1JPST 1TIUA 3G6JE 2P5WB 4BH7A 5EULV 1CE6B 4UTAL 2E9IA 1MCJA 2XZQH 4KKAD 2H2PC 4KRPD 4MLSA 1FL6A 2Z92A 4OQ1A 5EU7C 3HUJE 4UDTB 1B6UA 4NN5C 4R8WH 4HS3B 3D1MC 1VADA 5JXEA 2VLKB 4K3GA 4P3DB 4KKCD 1JL8A 1B2WH 1S78D 5BV7L 2FX8L 2VDLH 4NKDB 1A14L 1EHAA 5FXCH 2EIBA 3L3IB 3DX8A 4PJIA 3VGAB 4QHLB 3EJYC 4ODVH 3UTSE 3U2SB 2V7HA 2VWEE 1IMHC 3MRMB 2GITB 5IB1A 4JPKH 3DHJA 5H2BB 3BI9X 4TPRL 4XB7A 5B8CC 4N8CL 4LCWE 3X3GL 4KKAC 3C60A 1IGTA 2WUBH 3PV7A 4AIOA 1L6XA 2OS7A 3E6HA 2BSRB 4G80A 3NABH 2XN9A 4X7EC 4GQPH 1KT2B 1KELL 5JQ6L 1WIPA 3HB3D 2VSCA 3IKCB 2NXYC 3AB0B 3O11A 1S7VB 5J6HB 1U36A 3K2UL 1I7RB 3BT2L 1KCUH 5JQ6H 4HV8A 1XCQA 4PRAA 4PY7B 1WIOA 4QHNB 5D96C 1WBXB 2ZKHL 1U8KA 2V7NA 4P2RE 5IHZA 3MRQA 1CIDA 5C0FA 4CAGA 5A2JH 3V8OA 2VZUA 2R56L 4N8CH 1OARL 3TJHC 1TZIA 3DUUA 4HWZB 2AV1B 4BFGA 3RTQB 2HFFB 3OKMB 4M1GL 4K9EL 4NNXA 1Q9LA 5E8NB 1G7HB 4MMXC 2FO4A 1EJOH 2K1MA 3QH3A 1UENA 4CU8A 1UEMA 3MA9L 3RVTC 2ED8A 4M4PA 2EICA 1A9EA 4GRLB 3ULVD 1AQDA 5HHXH 3V5HA 1G6RH 1G7PA 3FJTA 4HBCL 2I9TB 1T21B 1N7MH 2VDKL 5DMKB 4J3XA 3VWJD 4F33B 4M48H 3FT3A 5BMFH 2HLAA 3B2UD 4QOKE 4NO3A 3HPJA 5DEFB 3GSQB 3U6RA 3BO8B 5ELIA 4H26A 4ACPA 3S37L 4N9GA 5ICXA 4I0PC 3ES6B 3FONB 3JWOC 5D6CB 2XNAA 5GRYA 5JHDD 4ODHL 1J7VR 4N90D 2NTFB 4AJ0A 3LHPL 3VFNB 1FQ9C 3SKNB 1CZ8H 5J7CC 1IFHH 4BK4A 1T20A 4P2QB 2APFA 1IGFL 3NIDF 2JCCB 4P46A 1FN4A 3BQUD 3VD7A 3DSNA 1Z3GL 2DQTH 1CLYH 3QHFH 2VXSL 3QXAA 5A1AA 1RZJL 3W9DB 4ENED 1BIIB 2AEIT 3LN5A 1DDHA 1NANH 4OCYH 3UZQA 2HT4C 4OLXL 4WV1C 1QRNA 3BSZL 3P4MB 3P77B 2QQLH 5DJ6A 5DZNA 5B39G 4XNYL 4B7IA 3M45A 4FOMA 4HLJA 2ZOKB 2PO6B 4KKNA 4P5TA 3IAPA 3T0WA 1N5YH 4ZDHB 4LBEB 3DPBA 3FO9A 1Y0LA 5CEZD 4EI6B 1X4ZA 5GGQL 3MV9B 4Q97A 5FUZL 3TNNA 2FX9H 2O61B 3ARFD 4H20H 1ZA6B 1AI1L 1KPVA 3WLWC 3M07A 2M1KA 3BPCB 4NQVA 2DTSA 1JYWA 4UNVA 3C60C 1FG2A 2D4DA 2Y07L 1I3RB 1N4XH 4TULL 3HMWL 3ZL4L 2IQAB 3CMGA 5JPMB 4KVNH 3V0WH 1F5WA 3IDMB 3RVXD 5A3IC 5SWSE 5DF0A 3U9UA 1CDUA 1RUAH 3ARRA 5T1DH 4AIZB 2V2TB 2HFTA 3X12A 3NAAL 1QNZH 3MRNB 5ICYA 3RU8H 5FO9B 1CVSC 1X7QB 1IT9L 4AEEA 2I25N 4OTXL 1U0QA 2OR9H 3D48R 3DO7A 1DLHA 1MLCA 4LQFL 2DQDH 3C2SA 4NO3B 4OT1L 3AMKA 2XG5A 2HRPL 4OCRH 5I1LB 5JOFA 3IJYA 5IBUB 2Y23A 1GC1L 1ND0A 3GKZA 3VXUA 3BGFB 2JCCA 3F6IA 1J05B 2CKNA 2X7LB 3GSRA 4GSDL 5I15H 2NY0B 3GUTA 2UYLB 4X8XA 2YRZA 3GO1L 4LASH 4MHHG 5GPRA 3SE4A 3MFGB 1I7ZA 1S7WA 2D2OA 4NRZA 4XAKD 2ZZUT 5C0EA 4HAFA 1UA6H 4J4PA 4X6BA 3GMLA 3BN9D 4Z7VE 2DI8A 5I76A 3RPIB 5ERWA 4XNUH 2I60H 5A16A 4G5ZH 4HJ0C 4ONOA 5IJVB 3NCJL 4HIEB 4NQCB 4CADA 2HFFA 3N1PC 4NNXB 5T1LB 2WWKO 4WFHE 1CCZA 3QUMB 1UH2A 2BCKA 3KYOA 5I1CL 5KN5B 4RGNC 3ILQC 5FDYA 4ODWA 1UXWB 4TOYH 5HPMB 1MVUA 3JSSA 1RULH 1N2RA 1NC4B 2FH6A 3LKNA 5GGSY 3PF2A 4KK5D 1ORQA 4RZCB 4S1SH 1FHGA 4CMHC 3PV6A 1I7RA 3ELAT 1C1EH 1UWXH 2JIXA 2FIKA 4N8PA 2KKQA 2W0LA 1CL7I 1KB9K 4WU7B 3MNWA 4KRLB 1SVZA 1Q9LB 3OKLA 5E8NA 2OL3B 2VLJD 5KVMC 1D9KC 1TZIB 2HH0H 4J2XA 4YHIA 4LLMA 4J3TA 1UT9A 1F58L 1MNUL 2QHRH 5CBAA 5CZXC 3V4VH 4QYOA 5TGBB 4MQ7B 2OZ4H 5I71C 2B5IB 4CMHB 1A3RH 1ORSA 2CJUH 4QHLA 4XPAL 4EUPA 4KUZL 4KUZH 4J3VA 5HI4D 3HI6L 5FV2A 4ERSL 1ZS8A 1NBYB 3IDYC 2MTPA 2RB8A 4CW1B 4PLNC 3MLUL 3VA6A 3O6FC 1V3JA 5J13C 2WUCL 1F58H 1MNUH 3GB7A 4QT5A 2EE6A 1R3LB 3L3OA 1H8NA 1R5WB 5MI0B 4KRPB 1YNTA 3RGVD 4EI5A 2FECL 3KR3H 4WFHD 1YMME 4UB0H 3KPPA 4BH7B 4LVNB 2VDPL 1HSBA 1QLEH 2YSSA 3LEVL 2GFBB 3PP4L 3I6LD 4HJGA 4S1SL 1LE9B 4CDGC 3EJJX 1XGPA 4MQ7A 3T0ED 4EDWH 4LSQH 2DMBA 4OKDA 3WXWH 1RULL 4JM2C 3FCTA 4CMMB 1QQDA 3MLVH 4GG6E 1WT5A 1FYTE 3BXNA 3ECBA 4F8QA 4PJDB 1V7MH 2EC9T 5HYJD 3UTTA 1T6VN 3T0VA 3QI9B 3VFUA 2I60L 1JK8A 4LAJH 3MLXL 3FB6A 1HXMA 3MJ8A 5DTFB 1F4XH 2B4CC 4JKPL 1JNNL 1T89A 2UVEA 2FEEL 3WLWD 1RJLB 4X7TA 3WUZA 5H37G 4BFEA 4RAVA 4RFOH 2BX5A 3Q6FA 5M94B 2ZOLA 1MCNA 1OPGL 3WHE0 4MJIA 5E00B 4YHKH 3HZYA 1FFQA 4OT1H 1H15B 1T22B 1JFQH 3G5XB 3T65B 1A4JA 4DUXA 1OD9A 3PWPB 1WBZA 1EEZA 4YAQA 1IT9H 3OKEB 2GJ6B 2J6EL 1NL0L 2Q76B 2VISA 4WI8A 3MOAL 4IEFB 5FYLD 5SWZE 3TZVC 2OTUB 2R2BB 1WZMA 2A6IA 3JWDC 3EUUA 5IMKA 2J12B 3L3JB 5IB3B 2CKBL 3BH8A 3ZL4H 2BSED 2DN7A 1XEDA 2D9CA 4S1QL 1CDGA 4O2FA 3ARBA 3HUJA 3OKOB 4PR5A 1U41A 3EW3B 4HGWA 1EMTL 1A3LH 1X7QA 4LSVH 1ADQA 2PR4L 4LPUA 3FO0L 3GMMB 5KZCB 3W0WD 2VE6B 4X8JB 6CGTA 4EXKA 4ZO6A 5FUZH 5DZOA 3ROOA 5E2UL 3IFPB 3ZDYF 3ULVH 3PE9A 1X5AA 2YPLB 2R4SH 2VISB 1LD9B 4TVPH 5C0AD 1J5OL 2Z35B 5KSUA 1UC6A 4A6YA 3MLRH 5CEYB 1NLBH 2P8MA 3BEVB 2AABL 1T83A 4NKMB 1ONQA 4LPVA 4L4VE 4M5ZL 4URTB 1ITCA 1OD7A 3RA7L 4NBYB 4NDMB 5IHUH 3OR6A 3CX5K 3C6SA 5BS0E 4YHYC 1MRDH 3H3PL 3JBG7 3RZWA 3Q6FB 5DURD 2DQTL 4UINL 4LVEA 1QLRA 1CBVH 3BD5A 1IGJB 1MF2H 1MIEH 3R06A 4M3JA 3BDBA 1JPGB 4LL9A 3P11H 3RI5F 4Y1AD 1PYWA 2ZJSH 1GGIH 1QBLH 2HWZH 2RR3A 1ZMYA 1P4IL 4MMZC 4XCYB 2PW1B 3RL2A 2H1PL 1ACZA 2AS5M 5EORL 4PGDB 1W0VA 4DCQB 2ADIA 2P5EE 1H5BA 5EUKA 2QQNL 3QUZB 5F21B 2ICWA 3RVUC 3R1GL 3OAZK 4NQTA 3BP6B 3MRLA 4GG8A 2D9QB 4LLUB 5F7DA 3O3BA 3FQTA 1ES0A 1EFXA 2F15A 3VH8A 4AH2A 4CVZA 1B6DA 3P3YA 1AD9A 1AGBB 1JZ7A 4AYFA 1A1NA 2M8XA 1ZLWK 4ZAKA 3PHQA 5IP4A 1U8HA 2G2RA 4XP4L 5HPOA 1UACL 3MNZB 5IBLD 5FFLA 3QO0A 2WWKT 3VE0A 4G7VH 2EEBA 3VG9B 4MCZA 1R5IB 4TUKH 3ZE2E 1OARH 3FT4A 3OAYK 5I1JL 3FQUA 3O6KH 4ELMA 5BZDA 2FH8A 4U1SB 4Y5XB 4HIHA 5KJRH 4PJBF 3F8UB 12E8H 2HFGH 2IFFH 3DLQR 3O6FA 1FL5A 4YGAB 1R0AH 2DQGL 2DMKA 4Y2DC 1T4KA 3BYYA 3HE6A 1XIWD 4PS4H 1AXSB 1IAOB 1KELH 1PSKL 3CH1B 3QDJB 4HF5L 5D7JC 3PJSA 1Q0YL 2A1WH 3EO1A 1DFBH 5L2KD 5CUSH 3BKJL 4OLZL 2FWOB 3N1MC 3P4NB 4Q0XH 4NQCD 5FF6A 5JR1H 1JUFB 4GAJL 4X4XB 4Z77B 2WWMC 2VZ3A 5FGBA 1SEQL 2AXGB 3OX8A 1XCQB 3WS3B 3FAWA 3OHXB 1NGXA 2BXZA 3HAEA 4ODVL 3L3GA 2QSCL 4OCNC 4ORGA 2BY3A 1I1YB 4E41E 1A14H 1FNFA 2FX8H 4HIHB 3WUWG 3NFSH 1J1XH 2D7TH 3LQAC 2JE8A 3HC0A 3KLHD 2D03H 1P7QD 1U3HA 1YQ2A 5KS9B 3FN9A 2YWZA 4MCZB 3QUZC 2DQJL 4XHJD 3QEQE 3BEWB 3RWJA 4PRHA 3L9RA 3MRPA 2GCYB 4XMKL 1OTTD 1NDGB 2W0PA 4IMKC 1ZLSL 5J12C 3D3VD 1AO7B 1KENL 4NZTL 4OF8A 4YC2C 1NCBL 5EU5B 5TQ0L 4C54A 5LAXA 5EOTB 4LHUB 3MNVA 3DI2B 4YHZL 2IBBA 2EYTB 5BW7C 5JOFB 1FFNA 4C56A 1OW0A 5I66B 1W72L 4I4WA 2ESVA 2P8PA 2R9HD 4O58L 3DO7B 4B7LA 1PG7H 4WHYH 3SOBL 3CFKA 4ZUWB 2Z9TA 3CGTA 4PJEE 3W2DL 4OCXL 2VZVA 1A1NB 5E4IA 3S98A 4QXUL 2C3HA 2BVPB 4JO2H 4TUJA 1IEBB 4C56B 1NGQL 2QKIB 4YR6B 5F9AC 5DQDH 3UO1L 4RGMB 4Q74A 3H9SA 1D3CA 1VENA 2PF6A 3M17A 4XP6H 4PLOB 4ALAH 1F6FB 3SDCD 4KGJA 5EB9A 1U95A 3UP1A 2FBOJ 1KJ3L 1FGNH 1WK0A 1E28A 2APXA 3MRJB 3MRPB 4UV7H 4G9FE 5DZLA 1Q1JH 5DO2C 1BQHA 4Y1AB 4WGVB 4LHUG 2V2WA 2ATKB 2P49B 3MV9A 1I1AA 3QIBD 4MJ6B 2ZNXA 2Z93B 5F7KC 2ADFL 4NZJA 3OPZH 5JW4R 1WISA 1IAMA 3CU7A 2VUOA 4HS8H 5C08B 3MCKA 4IRZH 2AP2A 4JRXA 4P4KD 3G6JB 5BJTA 3P30H 5IFAH 2OI9B 4HWUA 1FH5L 1MFCL 2Z8VC 3PXJA 4W6XB 3OXSB 2HVJB 2J1KA 5CEYA 1OQOA 3LRHA 2DLTA 4Z6AT 1NEZA 3IRPX 2UY7A 2UZIL 3N9GL 1WV7T 1U8NB 1NLDL 2CXGA 5F1KC 1C16B 3VGDA 1FGVL 2E7LC 3MACH 5JO5B 3VWJB 3S34H 1SBSL 4W70A 4FZEH 5E8OA 1E6OL 5EWIH 5GRUH 4KMLB 5J13B 4N0RA 1KV3A 2PYFB 3LKRA 4GRLD 3O6FB 4DJMA 3I2CL 3GMMA 2MKLC 1I8LA 3CXDL 5ENWB 1T1YB 4KY1L 4GMTH 2I27N 3CFDB 4N0UA 1V3LA 2ZCHH 4RMTA 3P0VH 4FQCL 1TETL 2DYPA 4KTDH 3H0TA 4X6CE 1DE4A 2EDEA 3MRHA 1QSFE 4IOSD 3VFVA 3LN4B 4F7CA 4PB0L 1YJDL 3CH8A 3VE0B 2IBZY 2EECA 2P24B 2NCMA 1UB6B 3MNZA 4E0RA 4IS6A 2VXQL 1IGCL 4MZ3A 4HC1L 3U46B 1U3ZA 1ZT7B 5DJDA 4ZUUB 1M7XA 2LTQC 3GMRA 4FP8H 5CEXB 3QEHA 5GSVB 3T65A 4M1CC 1SEBB 3HNVL 3ARZA 3HLAA 4DN4L 2EIZB 1XF1A 1OL0A 3S4SA 3SCMA 4K3HA 5HHME 2FD6L 2NY2D 3ECBB 2NYYC 1RK0A 4U6VH 3HR6A 4PJHE 3RZCC 4ODUA 4WTXA 4KPHH 4X4YB 2J5LC 4Y88A 1G7MB 5M95B 3D69B 1YQVH 4FQXC 1YEGL 5KSBA 1T2QH 1HINL 3PABB 1U8PA 3IDIA 1HHIA 1S9VA 2VXUH 1JK8B 1KT2A 1OGAA 3IYLW 3U4BH 2J4WH 4QXTA 4FQLL 5IKCB 3ZTNH 1YECL 1H0DB 2PO6D 2EE3A 2YXMA 5CHNB 2QSQA 4BQ6A 1NJ9A 3HG1A 2AQ1A 3LQAH 5DMIH 5I1IL 4BZ2L 3DUSA 3MUHL 4NT6A 1BGXL 1XZ0B 4WV1A 1UM6H 5CJ5A 5K59F 5LQBH 2Z35A 1AKJA 4Q9RL 2CXKA 4NKDA 1BREA 5E1AA 5DD5H 5F88B 2AI0H 1KCLA 3MMEA 4HH9A 3CD4A 2DMCA 2PKDA 4I9WE 4DVRL 4LPWA 3TVMA 3MO1A 3HMXH 3A6CL 3GB7B 5TPWL 2Y4SA 3EZ8A 1T7ZA 4H0IA 3MV8A 3AS1A 4FQLH 4UDUA 4F2MA 3FRPA 4GS7B 5E24E 3ZLQC 2VXUL 2X4SB 1OAYH 5HVGB 1JNJA 1N3NA 1HINH 3CVHH 2A2QT 3VFPA 4EVNA 1KFAH 1YQVL 3ARGA 3BPNB 3O2DA 5C6WH 1EK3A 5CBAB 1CDJA 3IJHA 5K9OA 5C71A 1WVZA 3RWCB 3ARDB 1DBJL 4DVBA 2FATH 5F7YC 2FHCA 3BPLC 4HMCA 3QUKB 1IZJA 1ZOXA 4M93C 1DEEB 2FB4H 1QFHA 1S7RB 4PJHF 4ZS6C 2AEQH 1O5DT 2EDBA 3UBXG 3CX5J 4R97B 3D87B 1RIHL 1DANU 4M5YL 4NWUL 3T0AA 2WM0A 3BHBB 4G9DA 2AJSH 1VSCA 5B4MC 3GHEL 3C2AH 3KHOA 4G6JL 4N0YL 3LRGA 5E94B 1A2YB 1XGRB 4P46C 4WFED 2BVOB 5C0CD 3ARGB 3IJYB 3VG9C 3CFEA 4HWEL 2AAVA 2RCSH 4L5FL 4PJAE 1ZEAL 4YBQC 4WFGE 1BECA 4KTDL 4FQCH 3WD5H 3PG2A 4PGBB 3B83A 1LO0L 1G1CA 3KXFD 4HH8A 4U1LA 4YFLF 1PKQE 2P44B 4XB8A 2ZWLT 1CF8L 3P0YL 2WLZA 1AC0A 2VDOL 4JDZA 3S34L 5CLTA 3VWJA 1ND0B 3RVWD 4XHQA 4YDIL 2PO6C 3KYNA 5I1LA 4Y2DD 5BQ7B 5LGJA 4AG4H 3Q5OA 4Y4KC 2WANA 1HWGB 1K2DA 5EBMB 1JNLH 4HZLA 3HG1B 3MRNA 3DTXA 3W5MA 4UBDD 3P30L 4TSAL 1S7SA 3UZVB 4QT5B 2HT2C 4YXKH 1G7QB 4HWBL 4JHWH 4KK8C 1NCAH 5C0IB 2CKBA 1F4HA 3BQUA 5ABDE 5E1AB 4XCNB 3RKPA 4XAWH 3DBXA 1T66D 1KJ2L 1CS6A 1L0QA 3L3KA 3T2PA 4P5MA 1KLFA 5E9DA 4HJJH 4JRYE 1ZVHA 5GZOC 2O5XH 5HHMD 3TBSB 5JIIA 2E27H 3RVUD 1RK0B 4EEEA 4P5TD 4ALAL 5MENE 4RMUA 3L5HA 1S7TA 1BD2A 3FQXB 1TPXC 4P2QA 4XWGH 1IM9D 2BNRE 5DQDL 3UO1H 2VSDA 1OSPL 1B4JL 1PLGH 5MERB 5DJ6B 5BRZB 2R2EB 2C4FT 1G7MA 1EHLH 5L0QB 4GG6F 2YPLD 4KHXH 4GKZB 3GSWB 3P9MA 4R2GB 5IBLC 3RDTA 1GZQA 3O4LD 4E0RB 1KIRB 2HFEA 1MHCA 3RWDB 4M7ZC 1I8MA 3N06B 4MAUL 4J6RL 3VRIA 2JJWA 5F9OL 5GS1A 1OY3B 3ZKMC 1SEBA 4FFZL 2I9TA 1CFVH 1KENH 3GBNH 4QY8A 5JXAH 2JLLA 4XZUA 1U58A 3OKYA 1KUMA 1SY6L 1B0RB 1DUYB 2Q7YA 4MWFA 3ALPA 3S88H 5C0CB 4Q6YA 3VDCA 1OW0C 4XNQA 3B3IB 5IGXH 3I6KA 3TN0B 3IFLH 2GTWB 1I1FA 4NN7B 1NGPH 3QZWG 4YXHL 2APBA 5I1EL 2NW2A 2MOVA 2NZ9D 1T0NB 1VFAB 3MSPA 4XXCA 3RY6C 3ARTA 3C9NA 3BZEB 1U3HB 3LCYA 2FSEB 5KS9A 2FLRT 3GJFK 2D7TL 4OZGE 3MRQB 4EIZC 3DV4A 1G9NC 1C12A 5C92A 2VDML 1BZ7B 1UVQB 4AIZA 5L7XH 4HGKC 3QG7L 4ORZC 3IKCA 3VW3H 4R4FH 2EC9U 2MFNA 1YYLL 3LZFL 4NNYB 2ARJQ 4XCFL 6FABH 4WWKB 5IFJB 1Q9KA 1GRWA 1DVFB 5KG9A 3WIFB 2A1WL 3K1DA 1QP1A 2WP3O 1JZ3A 3QI9D 3UAJD 3GJFB 4UT6H 4OM1H 3V6FB 2QEJA 2J8UF 3RWEA 5JW4Q 1H3VA 1T3FB 4HPOH 4HX1B 5HHVL 3SKOA 3P4LA 1RUKH 3FQUB 4PJ8C 3T0EB 3KPQB 5KSBE 1RK1A 4HIIB 3IDJB 3UYRL 5CIPB 5GS0D 4U1HB 2X4NA 5F3BB 3QO0B 4M03A 3VXRA 2HN7B 4O2CB 2XZCL 1UACH 5C0BB 2FYYB 2AJYL 1OF2B 4PJXE 1P4LB 2NXYD 2X1XR 3KPSA 4L8SC 3RY6A 4P2CG 1A7RL 4OCSL 5FUCC 2AJUL 2H32H 4X6EB 4LSUH 3RNQB 2B1AL 5K9KB 1JPFA 2AXJA 4PJCF 3FTGA 2YD3A 4FXGA 5CD3A 1MHPH 1I7UB 1NH6A 1KC5H 1U8JB 3WE6B 3VDAA 4DN3L 3PWVA 4JCLA 2PNDA 4M6AA 4O9HL 3TV3L 2ZJSL 4L4TD 1OGTB 1NGYA 1E27A 1P84K 1G9NH 1SMAA 4ZFZA 1FNAA 1LEIB 1DQQA 4FNLL 3WFHA 1VEMA 5FUCE 1CFQB 4UINH 4X4MA 3GBML 2Q8AL 4XMLL 3H3PH 2B2XL 5EOQH 1JGUL 2EKJA 3TA3B 1NGXB 4ZUSA 4HG4K 1A0QL 3DVGB 4X83A 5TH2B 1U9KA 3X14B 4EDXA 2P5EB 4N0FA 1YPZE 4Q6IB 1K9TA 2NY1B 3ZDXE 5DK2B 2DM2A 4X6DA 2EZ0D 1LK3L 3CSPA 1DL7H 4PYHA 2R4SL 4P59H 2CUHA 1UYWL 2PXYB 2W1NA 4HDIB 2A9NL 1BAFH 1KGCE 2FJFB 3DYMA 3NCCB 4QHNA 4G7YH 3TO4D 3U83A 4X4ME 3FO0H 4ZODA 1HEZA 4R96B 3GMQA 4M1DH 2VDRL 1EMTH 4LSVL 4L8CB 4HUKB 4ODTH 1AR2A 5HHPB 4XC1L 5HJ3A 2CPCA 3VWKB 4S1QH 4P3WA 2XN9B 2I07B 1CXEA 3C9NB 5IBTL 2W9EL 4NSKB 1UM5H 1C7TA 4L9LC 3WUWB 4NN7C 1VGEL 2IQ9L 3R4DA 1T1WB 4I5BB 4M6OL 4ZAKB 3OGCA 1GGTA 2VWEC 3GIVB 2A77L 4LKCA 1RZKH 5HVFB 2J6EH 3I3DA 4PRPE 5C08D 5DJXB 2AJ3A 4P46D 4LCUB 1H3PL 3NPZB 3B6SA 3BUTA 4OCMC 4JRYD 4UDTA 4YHKL 4MCYB 4R2GC 3HE7D 5KTEL 1NCCH 1FL6B 1U92A 2Z92B 2OI9C 3LMJH 5I19H 3PHQB 4PY8J 3GSWA 3P9MB 4JKKA 4PYGA 1R3IH 1KB5L 2P5WA 1QRND 1MCLA 3KPSD 1AHWB 4LEOA 5B4MD 1VGKB 1S9KC 2N7BA 4PB9L 1R24A 2OTPA 5IMMB 5HDQH 4I3SH 5EA0L 4X9IA 5HHQB 1J11A 4Q9CA 2KBGA 1V7ML 5I9QC 2CMRH 2I5YH 3RZCB 1YPZA 3O2VH 5GS1C 3FN3A 2VR5A 2X40A 4IOIB 4M8QB 4IRSD 3E6FA 4LNRA 2XKUA 3QHZL 3HZMB 3AAZB 3LDBB 5DRZB 2X4UB 1FYTD 3G6AB 4Z0BL 3GK8L 1DBKH 4Y4KD 4K7PH 2E8YA 4NP4L 2OXHA 5LWYL 1JZ4A 1A5FH 1QFWH 2B7DT 4E41A 4HXAL 5DS8A 2VDPH 4QRQA 4HIXH 3BQUB 1QYGL 1M05B 3IU3A 1EZVX 4NCDA 1CU4L 1RZGB 1JGDB 3UTPD 2EEDA 3Q6GH 1JRHH 3TFKC 3QQ3A 1WBYA 4OFKA 4NWTL 1GPOL 1AIFB 2MJWA 3CC5A 1LDPL 1D5XB 4HUNB 3HI6H 4ERSH 3AREC 5C0NC 2K7QA 1JZ8A 4WY7H 4BZ1L 5D7IB 3V7AE 1YZZA 4KV5F 4Z7WF 4IJ3C 3ARUA 3LKPA 1LK2B 4LLAA 3GZKA 5DWUH 2V5YA 4H1LB 3OWEA 2Q86A 5E2VL 3VMPA 4X80H 4LLMB 4DTGL 5AZEL 4D0DA 3QIUC 2C4XA 3W0WB 3TO4A 1OTSD 1J0YA 4PJXA 1N59B 3QHTC 3TJEH 4DEPB 2E7HA 2OL3A 2ZCKH 3FN0H 1EIBA 3NPSC 1XMWA 1F11A 3TFKD 3S36H 3B5TA 4M6ML 4P9ML 4PG9A 1G9MC 3VXTB 1VERA 3MROA 3IFOB 2XQBL 3G08B 1W0WA 1Z5LA 1XGRA 2VB5A 1A6WH 1AXTL 4D3CL 3SKJL 3U4EB 4DFHA 2YUVA 4YDLB 1QKZL 3TYGL 4TOYL 5CP7B 4ZXBA 3H3KA 3OJVC 4AEHH 5T3XH 4CNIA 1CICB 3MLYH 2A83B 1Z9MA 1V7NH 3B9EA 1JMZA 3IF1A 3BRDA 5D2LB 4OM0L 3BGMA 3NGBB 4RMRA 3DX6A 2ED7A 4YHNB 1ZTXL 4JAMA 4OQTH 3MJ7A 2EDKA 3FB5B 3BKCH 4GSDH 4U31A 3MZGB 4ZS7H 5E6YA 4NM4H 4CRPA 4OZGA 1TMCB 2A73B 1MWAB 2ICEB 4Z5RB 1L7IH 2G60H 4OZFB 5E0QA 5FUOH 1S9WB 5LBSL 2XFXA 1HYRC 4ZFGL 4YNYB 1QNZL 3PDDA 4PJBB 3NAAH 5TF1H 5FYLE 3RWHB 3FTGB 4KI5C 3FOLB 5TQ2L 5ESAA 2FNBA 3RGVA 4EI5D 3CPLB 3U9UB 1LEGA 4PJDF 5C2UB 2EH7L 5D1QC 1CFNB 4TVPD 1NBYA 3P4OA 2GJZB 4AENA 4M00A 5A2IH 3CFJA 4JY4A 1C8PA 1FIEA 4QHUB 3V6OA 3IDNB 3LKQB 2Y07H 1UZ6F 2MNUA 3HRPA 5CD5D 2QR0B 3BMVA 1YNTB 1AI1H 4LCCB 3BP5B 1ZA6A 2D7PA 4QRSB 1I9JL 1I3VA 4PRIB 2G75A 1A6VH 4YBLC 1PY9A 1P6FA 4M62L 4LBEA 4O4YH 3UMTA 2A74A 1X4YA 4ELMF 3VFWA 3JVGA 2LQRA 3EZJB 1T3FA 2R29H 3FFCD 2YD6A 1IRAY 1TLKA 3KLHC 4MNHA 5MENA 2H45A 4OZHF 4TTDD 3X11B 5JW3H 2JF1A 4X4YA 4UI2A 3LH2H 4YHMH 4RNRA 2IAMA 3QJHB 4LF3A 1JF1A 3TBWA 2ZUVA 4NQDA 1J18A 3QUMA 3TPUB 3B8YA 3SDDC 4LRIC 5LCVH 1FNEA 5GISH 2CGRH 1IGFH 4FQXA 1EBPA 1NC2A 5EZLB 1CZ8L 1U8LB 3T09A 1CDYA 3GMRB 3KXFB 4BQ8A 5DHYB 1S7WB 1ORQB 2F54B 3TZVA 4ODHH 3PWJB 3HRZB 1TTFA 5FA3A 5CBEB 1MCFA 5HPMA 3STLB 1FBIL 4L3EE 1S8DA 5EU6B 3T3PF 1JWUB 3IFNH 3INUH 3SE3A 2ZSVB 2ZG3A 2DLHA 4JO3H 3HAEH 4JCMA 1BPVA 5JW5B 4JFPA 1YPZF 2E9BA 3WFEH 4F7MA 1U58B 2PYFA 4JJHA 2QLVB 3F5WB 1J0IA 5FECB 5FKPA 2B1HH 2OR8A 3FKUS 3BZ4A 2XWJA 5FYKH 1M6OB 4LOUC 2AXHA 4C83B 5FM4A 1MEXL 1VEOA 2ZP0T 3QI9C 4XNZC 2XWBA 1LP9F 3LKOA 4L4JA 5ESVA 4F15C 4PJAA 4GXVL 3TO4C 4NQCE 2X1WL 3T0XA 4K7PY 4LCWB 2LAAA 3MGTB 4JN1H 5HYIA 4EJ1C 5HYJB 2Z91B 4KRMB 4TYUA 8CGTA 2R0KH 4MNQD 3UTQB 3G5ZA 1JGVH 1YYML 1A6AB 1P53A 1PGRB 4OF7A 3SCMD 2XV6B 3D0VA 3O3UN 1QD0A 3EO0A 3EYUL 3KJ4B 2VDQL 5E95B 1IBGH 1PD6A 2IAMB 1M4KA 3V5KB 4NCC2 1LO5B 5TE7H 2YRPA 3R8QA 5I6XB 3KLSA 4W81A 3BZFA 3DBXB 5J9PB 1ZA3A 3EO0B 2X70B 3LD8C 3MQIA 4BSWA 2XXCB 4O02H 3U0WL 2CKBB 5FYKU 2MPAL 3FL7A 5B39B 3DO3A 3DVFA 1INEL 3N50A 2R0KL 1FVEA 1R3KB 2CRYA 3CSYA 4XMPH 5MEND 2XFXB 5MI0C 4NBZB 5J6GB 2OL3H 3TNMB 2UV3A 4Y5VC 4JFEA 4UTAH 3H2WA 4U49A 2DJSA 2Y5EA 3DIFB 1UJ3C 2W0FB 2WZPD 2VLRB 4FZ8H 2AEWA 5JXEC 1WEJL 5ITBH 5EZIH 5HD8D 2NY3D 4I2XA 4MGXA 2ATPB 1LEKA 5FYKL 2XWJB 5JUEL 2DQIH 2QADC 2B1HL 4NQEB 3VCLA 1T20B 3BH9B 1AY1L 1NAMB 3TVMD 2VLLA 1N8ZA 4RQQA 4JRYB 5J8OA 1BFVH 3EDDA 4K23H 2VH5H 3MOBH 1Z2KA 2FO4B 2CRZA 4P99A 3MBXH 3IFNL 3INUL 4C57C 4XVSH 5J11B 4KJQC 4CNIB 4P2RD 1QLFB 4S11A 3VXOA 4JZJA 1OGAE 1RQ5A 4MS8C 4HK3J 4X6CF 4LSSH 1LO4L 2ERJB 3ZHKA 4C4KO 3ARGC 3VXQB 1JGEA 4WHCA 4JRXE 3SY0B 4NIKB 4HIJA 4ODXA 1J1PL 3REWB 4TSBL 1A7PL 1FC1A 5CWSB 4NC1C 2E8ZA 4U1MB 1IKFH 3MV9E 4LAQL 5E6IA 3QH3B 3EKCA 5MP6L 4PJ7B 5JDSB 1P7QA 3FQWA 5L6YL 3BKML 1FNEB 4P2OB 3JXAA 1R3JB 1N59A 2AV1A 1DLFH 1IGTB 3FOMB 5E2TH 4A2MA 4U6TA 4OZIB 3S96A 1JF1B 1RHFA 1S3KH 4N68A 5DA4A 5CCKH 4OUOA 4YHML 4LLDA 4RCAA 5F6HI 5C0CE 3MBEC 5JW3L 4JFQB 5SWSB 1V3MA 4NN5B 5F1IB 3KJ6H 4GRWF 2HKHH 3MLSL 3D3VA 5LXGH 1MI5D 3THML 1DR9A 4O4YL 3FT2B 4D9LL 3FT4B 1IM3A 3FZUD 1NMCC 1QRNE 2RFXB 2EE2A 3JWDL 1OTUD 3MRDA 4PJEA 4X6CA 5FHAH 1KLUB 4HT1L 3MLWL 5IJKC 4P4KB 3EOAA 1U93A 4PREA 1JPTL 4BUHA 5DDHA 1AD0B 5BVJB 3A6BH 5CLWA 3RGVC 3MFFA 4KZDL 1W72A 5SV4A 4JG0L 1OB1A 4O5LL 4GAGH 1W0YT 4B53A 4Y2DA 3WO4C 1EFXB 3SE9L 4L4TB 4U6XB 1YNKH 4BQCA 2VLKD 2RAMA 1I1CA 2OBGA 4RISL 2BOBA 3EDEA 4IRSB 3FOLA 3TWCH 3VXNB 2WQ8A 3VRLE 1JZ5A 3GSVB 3O41A 1QFWI 1LILA 3VJ6A 4I77H 4D8PB 4MAYC 5C2BL 4E41B 5EBLA 3EDJA 2W65B 4JY5H 2VDNL 5IM7A 1RU9L 1TNNA 2YUXA 1DUZA 5I8KL 2HJLB 2A38A 5IQ7L 2OX5A 4LHUD 3HZVA 1KB9J 3VXSD 1EO8H 4JM2D 1JZ2A 1P1ZA 2EDOA 2G5BB 4LVOB 5K9JH 4LNRB 4OQTL 1ZTXH 4XVJL 4J4PC 5KSAC 5JIKA 3DX6B 2R1YA 4OIIL 2VITB 5JQHC 4QXGL 4NQSB 5GGRB 3B6SB 1ACYL 1KN4H 3LIZH 4P49A 3VH8G 5I73B 1ONQB 3U36B 2EIZA 3I75B 4U1IB 1NQBA 3S36X 2OQJB 1B0GB 5T3XL 3OJDA 1TQCB 4UT9H 3EOTH 4F58L 1QUNA 4WW1B 4OZIF 3KPSE 1U93B 4PREB 4HPYH 1NCTA 3C60D 3Q5TA 1EJ6A 5DR5L 3IB4A 3GRWL 1IM3B 4AIXA 2XN9D 4RGOL 5TDNB 2AJ3B 1RJZA 4C56E 1RPQA 5T3ZH 5GJTL 1N64H 1ZKAA 2EXWC 4JG1H 2BY2A 2XTJC 5I8OH 1I9EA 4DTGH 4J8RA 5DQJA 3HMXA 4MA3A 5IVNA 5DWUL 3SDDD 3HCVA 5I1HL 2ARWA 2GSGA 4YBQD 4NUJA 4HCRL 4DUVA 3PWUA 1U42A 3CFCL 3FQWB 4LVHC 3CVHA 3S9DB 4MD4A 2KUTA 4HS6A 3V8CA 1DSFL 2XTJB 4XPFH 3EO9H 2LV4A 2DI7A 4TN9A 3S3JA 2NXZD 4FQ2L 1AFVL 3G6JA 4LGSB 1EEYA 2ZSWB 2GK2A 2MSPA 1BLNA 2YBRB 4QRPB 1QYGH 3VGAC 4NO2A 5E99L 3V4UH 3ZE2F 2A9ML 5T33L 1S5HB 2AW2A 5CJQL 1A5FL 2CIKB 5CD5C 3BVNB 2YEZA 4NP4H 3LQZB 1B4RA 3PWVB 3GK8H 3QI9A 4POZD 5I0DA 4LMQE 4LARL 4KU1A 3D25B 3E8UL 3LS4L 2OK0H 4NJAH 5GGRA 3QHZH 3O41B 3B5HA 2CQVA 5E2WL 4UV4L 2NW3B 3A0OA 1U95B 4DZBA 4Y4HA 1MJJB 4DOHE 2GJ6E 4NHUB 3JUYA 4LGPB 5HDQL 4RAUA 1FE8L 4LCIH 2GFBA 3JTSA 3E3QE 2FEDC 5E5UB 1IEAB 4FQHA 4KHTL 5FYJH 1H3UA 3KPPB 1CYGA 5HYSA 3UTOA 4IMLB 4ZUWA 4QOKB 5IV2A 4LPTA 2HJFA 1AD0A 3BN9C 4KKBC 1KNOA 3QXUA 4BM7A 3QJFA 3GSNB 1CR9H 1IC7H 2DOCA 2JJTA 2YPVL 4KC3B 1WLHA 3VGEA 4P2QE 5CAYB 1ZA3B 4EUPB 5IMOB 1I7TA 4JDVB 3DYOA 3L7EA 4HQQH 1HHKB 5D1QB 1S7QA 3V5KA 3GIVA 1RSFA 1AR1D 1XF3B 2PTVA 2W38A 4U6HA 3C5ZD 1KEMH 5F96L 3X13B 1WC7B 4F7EB 4MYWB 3V6OC 4QNPF 4JFFE 3CFBB 5HHNA 5T5NF 5IBTH 4P2OD 5IHBA 1KJMB 3JWOL 5AWNH 4MQXC 5T1KB 3ISWA 5BS0B 3H42L 4OJFL 1ED3A 3UAJC 2JJVA 1NSNH 2BERA 3VD9A 1EGJL 1PZ5A 5ANME 1A9BB 4Q2ZA 1SYVB 1OAZL 4NOBA 1S9YB 4YLQT 4XI5C 5F7WC 3PWNB 35C8L 5FF6B 1A64A 3AS3A 3CFBA 4JZJB 5HHNB 1LK3H 1MCBA 1FJ1A 3VG0L 5IJVA 4PJ7A 5JDSA 4GG6A 4MHHI 3DX9B 5TH2A 5C07B 3MA7A 2QSVA 3DUHA 3O9WA 5ICZB 3QDMA 1DVFC 3FB7B 4JFOA 1B0RA 2HKFL 4K7FA 2F74B 5JIHA 1INQB 2O5ZL 3LKSA 1E6JH 1XF5A 2CDFA 2DTML 5ACLA 5MHSD 3VXQA 1JPSH 2Q8AH 5T3ZE 3PGFL 4QF1B 2FHFA 1CFQA 1CD9B 2NLJB 4FNLH 3GSNA 4I2XB 3CCHB 3NH7L 3ARWA 1A21A 1G9NL 4RMVA 2DQCH 4WDIB 5T3XE 3BDYL 2NQCA 4HKXA 4XCEB 4RWHA 3F65A 4YO0B 2HJFB 3NFNA 2NZIA 5EU4A 3WIIL 4OFDA 4ZTPL 5KW9H 3S6CA 1FG9C 4FQHB 4WUUA 5SWZA 3QA3A 4WO4A 4ODSH 5GGSA 3AY4C 4NQEA 2R0WH 3UTSB 4LSUL 3HZKB 1PBYA 1DN0B 4OFYD 3BYTA 1UKSA 2F19L 4Y8DC 1ZLVH 3F7PC 3SDCC 3SDXF 3UTZA 1A7RH 5DJ2B 1H5BB 5I75B 2ADIB 3DMMD 4NFDA 1QA9B 1QSVA 2NX5D 4AQOA 2W60B 1KIPA 4MJIE 2YD5A 2WBJC 2Q8BL 2IANB 3BUYA 3U7WL 1IQDB 2MQCA 4RWYL 4OAWA 5KSVB 2FBJH 4GRMB 3TM6A 1RUKL 5AD0A 4KKLC 5AAMA 2AJXH 2WMPA 2ZSWA 3UJTH 4M93B 5DRWB 4D0BB 3VXSA 3BUYB 2PYEB 2FCBA 5E4EC 4QTIL 3DTXB 4JR9H 3WJJA 2W60A 4K9EC 2HT4D 5JA8B 4PJBE 1AGFB 1JWSA 3U9PL 2P1YA 3N85L 1JV5B 4KUCD 4P4RA 4UAOC 4OGZA 1IC4H 1D6VH 4U7SA 4WWKA 4YE4H 5EC2A 4IHOA 1DN0A 1T7WA 4APQB 1X5ZA 2YMXH 3ZT7A 3DYPA 5F1OB 4RGMC 4U4BA 3EYSL 1CGTA 4K7PX 1AO7E 4XVTL 1MHEA 2AK1L 4W6YB 2NXZB 4P5KB 1YMMA 2VDMH 4HUVB 3EJZD 2R39A 3UTTD 4F3FA 3DV4B 4HC1A 3MV7D 5EO1A 4GKSB 4HUUA 4PR5B 5EU4B 5ICXB 1IL1B 5FDWB 3RVWC 1DQDL 5LGKA 3WL9A 5ADPL 1HKLH 3L3JA 2EDLA 3QB7C 4MDIA 4BH8B 3CLFL 2F19H 2EDRA 4KMQA 1QOKA 1FORL 1LP9A 4FTVA 4XNMA 4ODSL 3MV7B 3B3IA 2IEPA 1AQDB 1D5MB 2X1QA 4YHOL 5EUOB 2CIIB 5AYUL 3T3PE 1MRCL 3ILPA 3ARXA 5CJOH 5T1LD 3TC9A 5KW9L 1MCPL 3DX9A 5JXAL 1GXEA 3W11D 3WHXB 3EJZC 2WBJB 1DEEA 2LVEA 4F37F 5KBNC 3QUYC 5FGSA 4MAYA 1KEGH 3HZYB 3CFEB 1OAXL 4YWGL 5SWQB 5C0GB 4IDLA 2E9WA 4OSUL 1N5AB 4X5XA 2BNRB 1MRFH 3QJHA 3SQOH 1JPSL 3MRBB 5IVXF 1HQ4B 1UQSA 4KJWD 4O00A 4WCYL 1S9YA 3E2HB 4G42B 3MRGA 3L95B 3QO1B 2WQRA 1PLGL 1B4JH 3ARED 4J3UA 3RUGA 2EO9A 3I85A 1LO2H 1TCRB 3H7BA 1MIMH 2Y9RT 2BSRA 3QQ4A 1F3JA 3VFOA 3QUKA 1QSFA 2IPUG 2FO1A 3BKYH 3PP3H 3FO1B 4XTRD 3ARBC 5IK3B 2GY7B 3L1OH 4FRWA 4NJ9L 4A6YL 1DQJA 4PRID 4Z7VA 1ZGLP 4MD0A 5F7EH 2BOBB 2ZG2A 3VXSB 2NX5B 3WXVH 4JFDB 1CFSA 1EGJH 4V1DA 3QCUL 2VR4A 5DJ0A 1TZGH 4FA8A 3S8WA 4Y5XC 1Y18A 4ETYA 4PRPD 2IC2A 1RUQL 3EHBC 4XP9H 1NKRA 3CDYA 4HWBH 4JHWL 3CPLA 5J4MA 1UWEL 4Y0GA 2DIBA 5DDHB 4MD0B 3TYFB 1U3HC 3BP5A 1KPUA 4BFBD 1KLUA 3S35L 2KQNA 1RZJC 3WHE1 1YEIH 3CK0L 3VFOB 3FRUB 2DLFL 3WDIA 5E6ZA 3WKMH 4OZFA 2H3NA 2X2YA 5EO0A 1DBML 5DJ0B 1ZLWH 3D69A 3IS1X 2YPVH 3U0TB 4JM4L 3P0YH 3CUPA 1D7FA 4ODUB 4NPYB 5DD1L 4U1LB 2XT1B 4KVCH 1LO0H 5FB8B 4PJBA 1YMMD 2NNAA 3FOMA 2ICES 4XTRC 1MFDL 5FYLL 1H0DA 4MAYB 1Q72H 3HI5L 4FFYL 4G6AC 1DQML 3F7YB 2MQ0A 3PGDA 4LCIL 3DXAB 3V9FA 5F9JA 3ULUE 4U0RC 3NBNA 4NNPL 1TXKA 1BQHG 4NO2B 1G7LB 1UEYA 3KHQA 5D71L 1J12A 4LDOB 2AGJL 4N0YH 1JTOA 1OTSC 4KI5F 1YN6A 2R0LL 4FTVD 4WFFE 2C26A 3GIZH 2O93L 3ULUC 2FEDD 3VRJA 5I0ZA 1G7IB 4NWUH 1FO0H 3DXAA 4JHZA 1K8IA 4XNXH 3I50H 4H8WH 4ISVB 5HDLA 1S7XA 4Y5VA 1W8NA 1NCNA 2WLYA 4NQEE 2FATL 5C9JB 3WLBA 3K8MA 4PJIE 1MFAL 3HC4L 3PDOB 5ALCH 5L2KA 1AC6A 5D1QD 2EKSB 1ZHBB 1LEKB 1PDKA 4KQ4L 4LCCC 1D5ZB 1KFAL 4RGNE 2H8PB 4PRHE 5BVPL 4S2SB 4LMQI 4NQXA 2J88L 4LSPH 1TZHB 3P73B 3EFDL 3NCFB 1IL1A 1NMAH 4PJ9D 4F57H 2VLJA 5FYKD 3IJSA 2F54D 1FL3A 4U1KA 4YBHA 4FABH 5AAWA 2R2HB 3HMXL 1AJ7H 4KZEL 1TVBA 5BXFA 1U2CA 4KGLA 5BVPH 1HHHA 4DVRH 4LDLB 1BOGA 1ZWIA 2VL5A 4P5TC 3MMEB 1W2KT 4IHOB 1N26A 5ALCL 5F1NB 3DRTB 4HCRA 3WFBH 3R0MA 3K74B 4DKEH 4JG1L 4K3JL 1F02I 4OZ4B 4DQOH 4Q9RH 3GDBA 3FQNA 1WUNT 2IQAA 1SQ2N 3CZFA 4PJ7E 1JV5A 5DK2A 1KCSL 3BRGC 5DUPL 5J3HC 2NYYD 1TJGH 3L3DA 3S5LA 4RGND 4R2GD 1FYTB 3E1F1 5D2NC 1SM3L 3DVGA 3EYFB 4JPWH 3TESA 3I50L 2DI9A 4XNXL 4LVHB 5DJ2A 5D7SH 4ZD3L 2GK0A 3S4SG 3UTZB 3RZCA 4JQIH 3BOVA 3T4AA 4XRCB 4OF6A 3GHBH 1NAML 5ANMA 3GIZL 2R0LH 1XGQB 4L1HA 3WN5A 1HHIB 1IQDA 2AJVH 2IANA 3NACL 1QHPA 1BFSA 2Z91A 3TO2A 1I9IL 4JFFA 1VESA 2NPLX 1F6AB 3KNBB 4TNVK 4LCWA 4QXGH 1QFUH 3MLTA 3QEQB 4K3DL 5C0BE 3C5SB 3HI5H 3SPVA 1YEHH 2D31A 1MFDH 3QDGB 4PJFB 5FYLH 2XTJD 3S4SB 4KVCL 1NCWH 5EIIB 3HZKA 3SCMB 1FN4B 1CXFA 4DN4H 3HNVH 3JTTB 5J06A 3PHSA 3PUCA 1G6RB 3OB0K 2A6DB 1INQA 3NCYS 5C6PB 3OR7A 4JY5L 4XI5D 3VFNA 1NDGA 3HA0A 3QG6B 3NFNB 1JWMA 1XGUA 4P57A 3L9RB 2YUZA 4I5BA 2C3VA 2BXYA 4O2CA 5C0BA 2A6KA 2AQ3A 4HK0A 4IIQC 1DBBL 2ZUYA 4P9HL 1YJDH 4WW2B 1AQKH 5D1XB 1I1AD 4R7DA 4BELD 4H25B 3MRHB 3KDMB 3PWNA 4QHKI 2LU4A 5D8JH 3NCBB 1EUUA 1G7PB 3O4LE 3V6ZB 1IE5A 1MAKA 4GAGL 4O5LH 4HUVA 3D39A 5DHYA 2YPLE 4GFTB 1TZGL 2JJTC 3QCUH 5A3ID 3U48A 3MRFA 4LLDB 5IR1A 3J8F7 3AVEA 1BHGA 4TRPH 1OP3K 5DK0B 5LGHL 4PBVC 1ZLVK 3M1BB 4Z7NF 3WFDL 4HT1H 4ZOBA 3V0AC 1FGVH 2PN5A 4NSKA 3D0LA 3TPUA 4LHQB 1JE6A 1UFUA 4KKBD 5JLZA 4NNYA 2MQ3A 4A6YH 3NA9H 5DYOB 5LXGL 5JW4N 1DBAL 5E6IB 3GMOB 3MPCA 5B8CA 4PJDE 2F53E 3MBEA 4R96A 1MIML 3NIGF 4OF5A 4HEME 4LGRB 3ULVE 2WK2A 1S3KL 1HHGB