4ZNCD

Fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 207
sequence length 207
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zncD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zncD01
4HKXB 1A47A 4OZGB 3IDYB 4LNRB 2AK4E 2IFFH 2X1XR 3U0TB 5LVEA 3WFHA 4NQUA 3LCYA 1VEPA 2NXYD 1A6ZA 3WD5H 4JGUA 4CVZA 4ENED 1BJ8A 1CE1H 2XXMB 1DVFC 4G8GA 3LEVL 1AH1A 1QLRA 2XG4A 4G7VL 1FV1A 1NKRA 4P59L 3Q3GA 4U31A 1P53A 1Q9WA 3CFKA 4K07A 4NPYA 2AK4B 4JFQB 8CGTA 1TCMA 2X10A 4MX7A 2Y5TB 2GFBB 1SYSA 5DT1L 5KS9F 1M4KA 5KSUA 1E6JL 3MLRL 4C55A 1KELL 2VR4A 4H88H 5DVMA 4K9EC 4MA3B 2ZOLA 4PRAB 1F11B 1L0YA 2Y07H 2FX9L 5EB9A 5FGBA 3X12B 3T3PE 1F4YH 3MLYL 2XTJB 4ZFGL 1SBSL 3UTTA 4PGEA 1MQKL 5GRWA 3QR2A 3KG5A 4MVBC 3SDAC 3BP4A 4OCWH 5HHQA 2FWOA 3UO1H 2IADA 2DQDL 1MEXL 3RNQA 2JKXA 4L4VE 2XKNA 4KJQC 3MJ6A 1YC8A 3MBEA 2IPTH 1NLDH 4F37K 1VHPA 3FT2A 3LV3B 4FQ1L 2FEEL 4O00A 2D2OA 4OLVL 2X9XA 4OZ4A 2AEIT 4ZFZB 8FABA 1ZHNA 2FNBA 5KVEH 5H37H 1KT2B 3U7AA 4AJ0A 2EXYC 2IG2H 5E24E 4OLWH 1HQ4B 2CO7B 4PRPA 1BWWA 1Y6NR 1FIGL 5C0BA 2B20A 1SMOA 5TE6H 5FCSH 4I8DA 1I7UA 2ZG3A 4HEPG 3QIUC 3MRHA 4PJXF 4XB7A 3V52H 1R3JB 3TBSB 4YHNA 1KCSH 4ZO9A 3GHEL 2N7BA 4FRWA 2E6PA 3IU3B 3PNWA 4JM4L 2PXYD 1NGXB 3WIHH 1BFOA 2I60H 4JJ5B 5DEGA 2QHRH 3WS6A 1Y18A 4EXKA 1A9EB 3VI4F 1BD2A 1DBKL 4LSQL 4OZIF 4J3VA 1QR4A 3EYVA 5KSBA 3CD4A 5DFVD 4YWGL 3PV6A 2HA1A 2VZVA 4JVUA 3V4VL 1HKLL 1OAKL 5FAAA 1RU9H 2FR4B 4XPFL 2E9IA 3WFEH 4LQFL 4HZAA 2XYCA 3VXOB 2FH8A 3RUGB 1F6LL 3MJ8A 5EDXA 1GPOL 4S1SH 1JF5A 3NACH 2XWTA 5F9WB 3SO3C 4MXWH 1MWAA 3T65A 3CXHJ 1JPSL 5A16A 2CO6B 1RVFH 2H26A 1XGPB 2CD0A 4UOW1 5F8QC 3MUGA 1N5YH 5GS1C 5IEHB 3DI2B 1UEMA 5GS2D 3C60A 4YC2B 2BNUA 1RK0A 1OSPH 4QRRD 3SCMA 3T2NL 4JHWH 3MRFB 3RA7H 5ALBH 2HWZL 2Z93A 1MI5E 2VDPL 4PJDA 4Y4FA 5DRNB 2EDLA 1MLBA 1NGPL 1DSFL 3QQNA 1C08B 3O2WL 4P49A 4NQTA 1I7RB 3VA6A 3GIZL 2EH7L 4IOSD 3RTQC 1E4XI 3MJ9A 1E4KC 5IGXL 4IRJB 5F7UA 1IC5H 3C9NB 3PWVA 5C0CA 5I8OH 4Q9QL 3MYZA 5ACZB 5I1EH 1J05A 4WCYL 3HMWH 1KTKE 4HWBA 3QNYB 2H2SD 2OP4H 4HCRL 4JREB 4L8BB 3WHXA 3N1PC 4M7JL 1L7IL 1HINL 2B5IB 5JPMB 2FIRT 4QHLA 4WTZG 3GRWL 1I7TB 3LEXA 4QXWA 1JF6A 4CN6A 1I4FA 5I30H 1AFVL 4TSCL 3V95A 3S36L 4Q9CA 3VH8B 4DUVA 5EOQH 4HD9A 1H3UA 5CJ5A 2FX7H 5GRUH 4PJFA 3LS4L 2CXGA 4YDJA 3DX7A 3FB7B 3PWPA 4MMZC 5DRXB 3ARGA 5I1CL 1QQDB 1P4BH 3FO9A 4N9GB 3DO3A 4L1DA 1K85A 2P8MB 4BSVA 1HH6B 5E6ZA 4YNYA 4BZ1H 1CIDA 4D0CA 3O2DL 4PJGA 2FL5A 3HZYA 3B2UC 4NNYA 2DLHA 1F4XL 3K80A 5CD3B 4I4WB 3UYRH 1DQJB 2YD6A 2QV2A 5JDSB 3B9KA 3O3EA 1PG7H 1HHIB 2M8XA 3KLDA 3MACH 5GSRA 2AEPL 5FHBH 1B0RB 5F6IB 5CEYA 1TLKA 2EDQA 2R9HD 1F4WH 1CICC 3N85L 3GHBH 4XMKL 4URTB 1P9MA 1WBZB 2A9NL 4JKPL 4JFPB 2UZYB 4MJ6A 1HIML 4LDLB 2EDKA 4PRID 1G7HB 4MD4A 3CCHB 2DTML 4PV9A 5J11C 4J8RB 5HYEA 4YE4L 3VFPA 1A7OH 2Q6WB 1DLFL 3HG1E 2UWEA 1GIGL 3ZE0F 2VIRA 5LWYL 3LQAC 1IAIM 3MLSL 5EZOL 1ZHKB 3VXSE 3QJHA 4ZPTB 1FE8L 3ZMRA 1JNNL 1XMWA 2B39A 3VFTA 3VE0B 5C3TA 2BXYA 2H6PB 2D7NA 1XT5A 2O5YL 4GMSH 4KGLA 2GTWA 4M61A 4PJXE 5JNYB 1IBGH 4DKEL 4DN3H 4JN2B 1FVDB 4ZS6C 2D4DA 1VADB 1DQDH 4ONFH 5C09B 1NL0L 3ULUL 2J5LB 1FO0H 3WDIA 3RIAK 2Q3ZA 3IDXL 4U1NA 3VI4E 1RUAH 3SKUD 4OZIE 3G6DL 1ND0A 1QFUL 1JI2A 3OMZA 1A6WH 4HGWA 4ZUVB 3C5ZB 3TBTB 4LCCB 1MF2L 2EYRB 2HN7A 3L95B 1EXUA 4HFWA 2DAVA 4QOKB 1UVQA 1FZOA 1AC0A 2G75A 4MQ7B 1XF2A 2QJDA 3RZWA 5F7EL 1MFCH 2UUDH 3LQMA 1IVLA 3RPIA 1SM3H 4FQ2H 4IMLA 1JZ4A 5TDPA 5T5FH 4MAYD 4Y16A 2R0WH 1FP5A 1PSKL 1N2RA 2XN9D 5DR5H 5EOCJ 5I1HH 2J8UF 3ZZ1A 3HE7B 1U8PA 1NBZA 4L9LA 4WI2A 2ZSWA 2W0PA 1GL4B 2A6KA 4P9MH 1KCVH 4MJ4A 2VLKE 2CLRB 4P4KD 4JY6B 1OARH 4HH9A 2OK0H 4U1GC 2A0LD 2C3XA 5J1AA 4PJ8A 3EJYD 4HJGB 4WUKL 1I1CA 4WTXA 4WNQB 1V7NH 2A0LC 5I75C 2RFXA 1T80A 3DMMC 4AENB 5CFHA 4IRSD 4LMQE 3C8HA 2AI0L 1QSFA 4PRNA 2GKIA 4Y2DA 2RGSA 5I16B 4NDMA 4JG1L 3HRZB 1PG7X 1KV3A 3NCYP 1KCRL 4MLIA 1D5XA 1U8JB 5FM8A 5F7LB 4RGNE 3UX9B 3X14B 2ZNWA 4F8TA 4N1CA 4IOIA 1AGCB 3UTSA 3DX9A 3BP6A 2MCG1 3RWIA 5JQ6H 1OPGH 3BPLC 2YK1H 5DURB 1WEJH 5GRVL 3PIQB 4HV8A 2CGRL 3RHWF 2HJLB 2QQNL 3P77B 3IFOA 3NABL 1A1OA 1RJLA 2BNQD 1KIRA 4FQLH 3KPSE 1YJDL 1ZLSH 5C0DA 2CLZB 4MJ5B 1KULA 4G9FA 3X3GL 4QHUA 3AY4C 2XFXB 5H8DA 1JWUA 4UDTB 5MENA 3WIIL 3MLVL 3GK8H 3KYOB 1OTUC 1U2HA 1KB9K 2V9RA 3DROB 1QA9B 4JPVH 5I1IL 2R4RH 3SE8H 2BVQA 1MCLA 5I15L 2ESVD 4MNQD 5H37G 1FPTL 5F3BA 3C5JA 2W65A 1MWAL 4UDUA 1P84J 2FIKB 3CNKA 3BQUA 5F7KC 3RDTD 4X80H 1XIWA 1WZKA 4M62H 4LSTH 1ZK9A 3SE9L 4FG6C 1HHHA 2VDQH 4JRXE 3RDTC 5JXEC 4X4XA 4I18A 1KTDB 4RX4D 2NY3D 4UQ3B 2VXTH 3FMGL 5FGCE 1H3PH 2NQCA 4G8EA 5I6XB 4ZAKC 5ESAB 4XCEB 2BSTB 3QO1B 3RZCB 1D9KD 5D5MF 4H5SB 4RCAA 5FCUL 1U3ZA 3O3DA 3MA7A 2VLJE 1D9KC 3TBYB 2HAZA 2N1KA 1C5DB 4RBPK 5B4MC 4O2EB 3GDBA 4JRXB 4G3YL 3P4OA 2P5WA 1X7QA 4FXGA 3VFWB 2CDGB 4R4BA 3QUKB 4HK0A 4KUCD 1JTPA 5HPMB 4LLMB 1H3WM 2ERJB 5D2LA 1ZWIB 3VRLF 4X4YB 3S5LB 4G9DB 2AJYH 4NC0B 4Y8DC 3RL2B 3BPOB 4XVJL 3MLUL 2AQ1A 3GSOA 2P42B 3MRJB 3QISA 4GT7A 4PS4H 2ZOKA 1EAPB 3PGFH 2HJFA 1VFBA 3ZDXE 1OF2B 1P69B 4Y5XC 1FQ9C 4PJCB 3ROLB 1RI8A 1AI1H 1Q0YH 2WINA 2FJHA 3EFDH 3S88L 3TJHD 4GRLA 5E08L 4YX2H 4M8QB 4GAJH 4DOHB 1IC4L 5KVFH 3O0RL 1ZV5A 1QFWL 4NZTH 2G60H 2KH2B 1PLGH 1HSAB 2W38A 4HUUA 4NWTL 4Y4KA 2YD1A 4N0FB 3EO1A 1K4CB 1EK3A 5ESQB 4OT1L 4EJ1C 3QUXA 3L7FB 5KSAD 4A6YH 4CVXA 1NCCH 1I1FA 3A6BL 2PO6B 4G5ZH 5KSAC 1M1SA 1NEZG 1NMBH 2NY7H 3CDGB 4Y7MA 3PQYB 2DQGH 2HFGL 2F53D 1RZ7H 3B3IA 1CL7H 4ELMF 4PBXA 2Q7YB 5ENWA 4TRPH 4KK9D 2E7LA 1NMCC 2CDFA 2EEBA 4JKMA 4P3CH 5JW4N 2J4WL 1CBVL 1UH3A 3U79A 4M5YL 4OJFL 2RR3A 2HFFA 5LKNA 1EEQA 3SPVA 4K3EL 3V9FA 4MCZA 4CMHB 2OQJA 5KTEH 3THML 1PZUB 4AK1A 2AJ3B 3LH2H 2ARJB 4I3SL 3GB7A 5IFJB 1F3JB 5AYUL 4M4PA 3MV7A 3M07A 3QHFH 3FQXA 1AGBB 3U0WL 1FRGL 4Y1AE 4LHQB 5LJYH 1G7QA 4MWFA 1DVFB 4ZUUB 4KQ4L 4JDVB 3GSVA 1TQBB 4NP4H 4HK3J 2IBBA 4HW6A 3FAXA 1TJHH 1V8HA 3NOIA 3UP1A 2BOBB 3MV01 3ZTNH 1NBYA 3AU1A 2VUYA 3M8OL 1J1XH 5IUSA 3REWB 2DQJH 3AXLB 2NW2A 5CMAA 4Y1AB 4IJ3B 2HLFC 3EGSB 5F7DA 1C12B 2DL9A 3OKKA 1T0MA 3K4ZA 3U6RA 5L9DL 2EXWC 5B38A 4FFZH 4GW1B 5D93C 3TVMB 3D39D 4LIQE 3RY5A 2IFGA 4BFIA 3ARXA 3RVVC 3DIFB 3SDAB 1YJDC 1J18A 3BEVA 3TFKD 4PYHA 3T0WA 1MH5B 3VFOA 2VWEE 4X8JB 2GCYB 5C0EA 1X3DA 3TFKC 3VWJD 4LAJH 3BUYA 3G5XA 3MA9H 1HHKB 4UV7H 2EYTA 2XOTA 4XBGA 4Z77A 4XC3L 3KWWA 2BY2A 4OIBA 1KBGL 1V7MH 1X5FA 2A83B 1D6VL 4JDZA 43C9B 3O6LL 1LO0H 4UT6H 4W6XB 5L8KB 2OM5A 4Z7WA 3JWOL 5D7JD 3MXWL 1YEEH 1K5NA 4OSUH 3RY6C 3ZKMD 3V6FA 2WZPD 2AXFA 1IILE 2B1HL 3FOMB 5D7JC 1Q1JH 1KSRA 3ARBD 4EN3D 3R8QA 2ZUVA 1SY6L 2CR3A 1YN7B 3DX6A 5DQJA 4ZS7L 3QIUB 1JNLL 1VACA 5CLTA 3DUHA 2QQLL 1INQA 1RZFH 5D5ME 1OL0A 1Z3GH 3SDYH 4ERSL 4PJ5D 5SWSB 2JCCB 5EPMA 2AJSL 1CE6A 3BDYH 3MRDA 4YQXL 1F2XK 5K9QI 1U3HD 1MCDA 4OLUH 1K4DB 5E6IB 1OP3H 3O11A 1U3HC 3IDUA 4G43B 4H8WH 1B6DA 1CT8A 1G9ML 1K3IA 3UYOD 1YNLH 4LLDA 4M7KL 3WFCL 4ZOAA 3OG4B 3MNZB 2PXYA 5C0RH 5C08E 1KIQB 3G5YB 3B9DA 4NQED 1UWXH 1CU4H 3UAJD 1NFKA 3H9ZA 1GZPB 2MQCA 3UAJC 3GSWB 2IGFH 4OI7A 1A0QH 1XCQA 5GS1B 4NGHL 4OZFB 4NQDB 1UEYA 3GBNH 1MCCA 5J56B 4NRYB 4QGYA 4G6JH 1FFPA 2FJFB 3BGMA 5HVHC 1U91B 3D2UD 5HHXH 3MRLA 5L2JA 1BZ7A 2H3NB 4CBPA 4HKBA 1QBLL 4JFFD 3FZUD 2DB8A 2IPUK 1DL7H 1A6UL 1RAMA 3GMOA 4KKLD 5J8OA 5CHNA 4B41A 2EDWA 2YA1A 3U1SH 3HC0B 3QEQD 2YPVH 4YIQA 3G6JA 5E95B 3RTQB 3RWCB 5FYKL 1DEEA 3X13A 2XQYG 4ZYKA 4RA0C 2QSCH 3S96B 4QRRA 3LRSB 4U05A 2AVGA 3SDCD 3NH7L 4F15C 5DVOA 2R69H 4FOMA 3HMXH 5T1MA 3H3PH 3H7BB 5FYLD 1S7SB 3JSSA 5TGBA 1LE5A 4UINL 1QEWB 5GRJL 3T8XA 5IBLC 5EC1B 1AP2B 2GAZA 3GM8A 4JPKL 3NZ8B 2NYYD 2J6EL 5C7XH 1FNSH 3F5WB 3CVHB 2FYYA 5EUKB 1IC7H 1FG2A 2NY5H 1TVDA 4LCWD 3CGTA 1HYRC 5CWSA 1MLCB 4XWGL 3C6LD 4LLAA 4EDXA 2YWYA 4DGYL 1NCDL 5JW5A 5L88H 5SWQA 2NY2D 3T0VA 2E8ZA 2F54D 3WFBH 3TT3H 4RQQB 1I3VA 1KTRL 4EI6A 1DUZB 2A1WH 2KBGA 3AFLA 5C0JA 3NGBC 4Y4HD 3NA9L 3K2MC 4JE4B 1RZIB 3V7AE 3FHAA 2BRRL 4XC1L 1H3GA 2EE2A 1YA5A 2GSGB 4KI5E 3BIKA 4IDJH 4PTUB 4S0SD 5GGRY 4ODXB 4I0PD 1QBMH 1TQCC 4NN5C 1F97A 3CSPA 2GSIB 3FN0H 1WUNT 4HIEB 4XTRC 3UEZA 5IHZB 4XCFH 5DQ9A 1CICB 3IS0X 1FVCA 1HWGB 2XPGA 3HNVL 2R1WB 1KXTB 1RJYB 4HS3A 1EJ6A 4MCYA 4RNRB 2WUCH 3RVTC 3HHRB 1KEGL 2P4AB 4XNQA 1XGQB 3VXUD 1OAYH 2DQTH 3ROOA 4NO3B 5J11B 1NC2B 1U0QA 1UM6L 3TA3C 3MRIA 1BGXL 2HJKA 2MFNA 2IQ9H 5ADPL 3FJTA 1EFXB 3PG2A 4HXBH 1F3DH 3SN6N 2ZUYA 5IM7B 4LVNC 1J8HE 3HA0A 3JWOC 3DXAD 1R24A 3CXDL 4PRIA 3ES6B 2XZQL 5JR1L 4U6XB 3QQ3B 3ARWA 1F58H 2GT9A 2CMRL 4YFLF 3I50H 5IHUL 4H0HB 5EU6D 3DV4B 5MEPB 1NDMA 5BZDA 4QXTB 1XH3B 3OG6B 4UBDD 2FGWL 3DGGB 4NBXB 1JNJA 4KDTC 2W9LA 5I74C 4QXUL 3BP7B 4PRHB 3MLTA 4TSBL 4MZ2A 1VFAB 4K3JL 5DDHB 3QG7L 4MNHA 1DBAH 3CDYA 5C0AE 4ZPVA 1J12A 1VA9A 5C6PB 2R29H 3T2PA 1IEBA 5HDQH 1LO5A 2X4UA 1TVBB 1G9MC 4A2LA 1GOFA 2P8LA 2E7CA 1CI5A 4NFBA 5F9OH 1A1MA 5GJTL 1QFHA 3RWDB 1TTGA 2FBJH 4QEGA 4X6CB 2YD4A 4NRZA 1NGWB 3DVGA 1NC4B 2IF7A 1CTNA 1CK0L 1HHJA 3MYJB 2Z35B 1IAKB 3U7YH 3OKLB 3S34L 3DO7B 1KPVA 1RUPH 4U1GB 4U6HB 3KYMB 3VFVB 4BKLB 1Z9OA 4Q6YA 4G7YH 2R0KH 4HT1H 1GGCH 4FFYH 2GITB 2IAND 1I3GL 4WO4C 4MAYA 3EYFB 1Q72L 5I75B 2XN9A 3DMMB 1WBYA 4YHZH 3H42L 4KMLB 2BY1A 4JRYB 4PUBH 4S2SA 1ZA3B 3TO2A 4OKDA 4TULL 2P46B 5J6GB 5GSVB 3V4PL 1DN0B 3AAZA 3L5JA 1QYGL 4P4KA 5FOJA 3QQ9C 1IGCL 5BRZB 1AR2A 3DETD 5I1LB 1J88A 1FCCA 4FXLA 4WWKC 4XX1G 2R1YA 3DETC 1E27B 5FO9B 3OJMB 1DQTA 3BPLB 3K2UL 1CGSH 1P2CB 5HDBF 4GG6A 2NW3A 4I2XB 5DS8A 5CIPA 4IRSA 4LRNL 3VFRB 3UJIL 1CLYL 4O51B 3FQRB 1GGTA 2HFTA 5DVLA 3FOLB 1V5JA 3EKCA 5BW7C 4K7FA 4BQ9A 3R0MA 2DWEA 5C07D 15C8L 1VFOA 5D71H 1TMCB 3RUGF 1ORSB 4P2QB 1U92B 5BS0B 1EMTH 2K9UA 2NTFA 3OKDA 2EYSA 5C0FA 4XP4H 2FEDD 2ICWJ 1TZHA 1BQHG 1NMAH 2B2XL 2MHAA 2BNQA 4JFDB 4Q9BA 4X6DE 2FEDC 4PJDF 3NPSC 1UXWB 4TPRH 1PBYA 4WY7L 5C70A 3DV6B 4HS6A 4FQJH 5HI5C 1YEDA 3S4SA 3BKYL 4DK3A 2ICWI 2DQIH 4X99B 5TH2A 1RHHA 3JTTA 2V2XA 3ECBB 1UENA 4ZAKB 4MQTB 2ESVA 4N5EC 1M7IA 4JQXC 5EO0A 4X6DB 1PKQA 1CYGA 2VAAA 3WUWA 4YDVB 3RIFK 2OMBA 4J2XA 3D6GA 3RDTA 4RFNC 2BOCA 3MODH 5JXAH 3VGAC 2C1PB 1HH9A 4R4NC 5ANMA 4UUJB 2D9CA 2FD6H 4RX4A 5FXCH 5DYOA 4D8PA 3NBNA 4JO4L 3D85B 5FGSA 4PP2B 4NJ9L 4QRTB 4NKIH 3IDNA 4U1KB 5I2IA 1S9VB 5DWUL 5FYJH 1D9KA 2C3GA 1MHHB 1DQQB 1ZVSB 3T4AA 4KQ3L 1GH7A 5DSCB 5DUBA 1JHKL 4NN7B 5GGQL 2B4CL 2C3VB 3HR5A 4PJFF 4ZXBC 1FLRL 1MFEH 5HGAB 1S7WB 2FZ3A 3ULUE 2Z9TA 4G8GE 3CFBB 2DKUA 4PTTB 4ZNEA 4KKAD 5CCKH 1CL7I 4TVSa 1W0VB 4RMSA 2W9DL 4LKXB 3CMOH 4HEME 4NJAL 5D7KE 1AKJD 1C5CL 3QRGH 4JDTL 1T2XA 4ODVL 3S37X 5K9KB 5MP6L 4PJGF 5IQ7H 2ADJB 4QYOB 3BVNA 1NUNB 2CSPA 1ORQA 3O4LD 4DQOL 4Y5XA 1M7XA 1D5ZB 1SJEB 4F8QA 5D6DA 4OTXH 3I6KA 5DMYA 1S8DA 2PCPB 5JW4Q 3QNXB 1H3TA 3TN0D 2OR9H 3UCRA 1MSPA 4XXDB 1HEZA 4HS8H 4O02L 2MJWA 2ZPKH 1TZGL 5DFWH 2B8OT 2G9HA 1Q94B 4P0DA 1ACYH 3EOBA 2W9EH 3C8KA 5I71C 3FCTA 5E8EB 5HHME 4O58L 1JPFA 1I9RH 1X6LA 4EDWH 2WBWB 1NMCB 2UWEF 3PDOB 4NHCL 2DWDA 3WXVH 2WBKA 5KSAA 3I6LD 4NO0D 5D8JH 5I1JH 3EUUA 2NNAA 3GMNB 5KG9A 1NJ9A 5E99H 4HG4J 4I3GA 4KK8D 2VITB 1INEL 2L0DA 5HGBB 2QKIA 3EO9L 4PRDA 4PRPE 4CDGC 2F53A 1Q9KA 3L7EA 4KK8C 5C0BE 4PGDB 1MY7A 1G7IA 2EICA 4WFED 3UTPE 1OY3B 2JJVA 5A40E 3M17B 1S9KC 3WSQH 1IQDA 5TQ2H 1P5VA 5LXGH 4I5BB 2X89D 3MV9B 1UZ6E 1XCTA 5HYJB 1PZ5B 3PHSA 2VXQL 1F00I 4QO1A 4WI6A 3VGEA 2YMXH 2YHGA 1YN6A 4P2YA 1BZQK 5KSBE 4ZQKA 4GW4A 1DFBH 1CFNB 5F44A 1T83A 3FB8B 3IJHB 1JWMB 4PR5A 3DVNB 1RZGB 2QADB 5FF6A 3L9RB 3BIBX 1IGJB 1W0YT 2MPAH 5CSZB 1VEMA 5MHSE 3PJSA 4PP1C 2QBWA 4GW5A 4FMKA 3KYNA 5DJDB 4XRCA 3WKNA 2ZZUT 5TF1L 4E42A 4ZG1A 1Q38A 4ODUB 2AXJA 2R23A 2E7HA 2IJ0C 5BQ7B 3L1OL 2X4QB 2F5AL 4PG2C 1HI6B 3WFDL 1I8KB 2DIJA 2C4XA 1CFQB 1QUNA 4LLQB 5HXMA 1A3RL 1QZ1A 1IAIH 1XGRA 4PJDE 2CRYA 3VDCA 1QKZH 4U6TA 3D39A 5CSGA 3MJGX 5T3XH 4OFPA 4ZUWA 3CXHK 1TJIH 1LEIA 3IB4A 4KRLB 3T0ED 1PEWA 3VWJA 4XMLL 3SDDD 2R0ZH 5GISL 2P8PB 1CDBA 4N90D 3U7WH 3ARFB 5D1ZD 3T0EC 4LVHC 1QLFB 5C0CE 5IG7A 4GBXC 5EZJA 1QRND 2C9AA 3RY6A 1VGEH 3QI9D 4HMCA 3S9DB 5D7JA 2CDEB 3OKEB 4FP8L 3NIFF 4UIKL 3IGAA 4NUGH 5TFSL 2DQFB 1A14H 4Z7QE 3O6KL 2Z31C 5I8KL 3R06B 4L8DA 1WIUA 3ARBA 4EN3A 5J06A 3MROB 3UDWA 4BQCA 1WJ3A 3S6CA 1A7QH 1JPGA 2V17L 5D72H 2W07A 4K3GA 5IB2A 4FZ8H 5LG1A 4JZNA 3DUUA 3DPBA 4XNZC 4OV5B 4YXLL 1I9IL 4PJ5A 4DAGH 4X7EC 4P23C 1U3HA 3PHQB 1JRHL 4JY4B 2X7LA 5FHAL 4QTIL 3PWPE 1Q0XH 2DICA 2VDNL 4KXZI 2AEWA 2XWBB 2EECA 3ZHLA 4R96A 3GJFA 3MGAA 2EKSB 3STZB 2DMCA 2E27H 4PJGE 5HI3C 2B0SH 3HC3H 1NBQA 4WW2C 1X5KA 1VKXA 4NQEA 4OF7A 2Q86B 4Y5VB 1K8DB 2HH0H 4GQPH 3ULVF 4U1LA 3TYGL 5LQBL 3WBDA 4HC1A 5HD8D 1S3KL 4F37F 1CWVA 3HI6H 3CDCA 2BDNL 2IAMB 1O7SA 2AABH 2JIXD 4YR6A 3IXAB 3ZO0A 4EI5C 5IWLA 3V7MA 4MZ3A 1UZ8B 3BZ4B 1H0DB 1XF3B 5FK9A 1A7RH 3QZWB 5E8DH 3D2UA 2Y72A 1AXTH 2F74A 2GUOA 3M1BA 3MMEB 3OPZH 5JUEH 5JO5B 5BV7C 4I48B 1I9JL 3OAYK 4JFFA 4B5EA 3BZEA 1AO7D 4R97C 4TVPE 3WKMH 2ADFH 3ARTA 3P9WB 2ZJSH 4NM8H 1PQZB 3W11C 3QEQA 1JYXA 4FQIL 4NKDB 3MGTB 4ZOEA 4CDHA 5I73C 1VERA 4XNMB 4Q6IA 3N1GC 1MHCB 3MR9B 5IKCA 1TETH 4HUNB 4NKOA 3VFUB 1FL3A 1U8HB 3SDCA 4HUKB 4PB0L 1EBPA 1OP5K 3NPZB 3B5GA 1MCWM 4G6AC 1JV5B 5EU5A 2Y23A 4L8CA 2MWCA 4GJTB 2BC4B 3L3OA 1T7WA 5DJ6B 4CJ0A 2IALA 3I9GL 1JFQL 3MBXL 3NGBB 1SYVA 3QFJD 1CGTA 3LAFA 3FB6A 3SKJL 3UZEA 5FFLA 3OHXB 32C2B 5DJYB 2VH5H 1YYLH 4LCWA 4QHNB 4KDVA 1WWBX 3MV8D 5DHVA 1JHLH 3C6LA 4S1DC 5SV4A 1TQCB 4G80A 4NN5B 2VLMD 4OM0H 3RI5F 5C2BH 3RWHB 1MREL 2F54A 4ZDHA 1F8TH 1LO3L 1T2QH 4MSWA 5F1SA 2DQUL 4KHTH 3G08B 3WE6B 2XRAH 4Y4HA 5CBEA 1NLBL 4MA1B 5HYSA 2X70A 2GHWB 5I0DA 1T03H 1TITA 3VH8G 1H3VA 3MZGB 4U6VL 1HCVA 4NYLB 2VZ1A 2D4FA 4ETQB 2HVJB 4I0PA 4LEXL 3BUTA 5AAMA 1YDPA 1LD9B 4EBQH 3TA3B 4N8CL 4NQSB 3TZVD 1EERB 4RWYL 5CZKA 1KJMB 5L0QC 4KRPD 3VFMB 4B50A 1XGTA 4WI9A 4Y19A 1HQRB 2HT4C 3P30H 4RGMC 3D3VD 5HGGS 4LVNB 5INDB 2E5EA 5GJSH 4L29B 5L2KD 1IKFL 3TBVA 1U95A 5E5MA 3VXUA 1QSFE 3NTCH 3K4AA 4K9EH 5F21B 1UB5B 5F9AC 1J0ZA 2HTKD 2KUTA 5FA3A 4RZCA 3SY0A 3Q1SL 4GSDL 4NSKA 1U8LA 3QFDB 3U9PL 4MJIB 3VXTA 5EA0H 2YUWA 1RZ8A 3KAAA 1U8QB 1FZMB 4U1IB 1BF2A 4HAFA 4FXKA 1EO7A 4G6FB 3P4MB 5I74B 3NIFE 3VRJA 5DJXB 3WXWL 3DXAA 2P5EB 3ORJA 5DC0A 5DTFA 4FTVB 5GGTH 2A9ML 3HNTH 1OGAB 1B2WL 3MRCA 1FYTD 3QUZD 1S7TB 4PV8B 1I7ZA 1I8IB 4OCRL 3SQOH 3VGBA 1J0KA 4IIQC 2CJUH 5KVDL 5EU6A 3HUJE 4WI7A 3SBWC 5D1QB 3ZHDA 4APQD 5L7XL 1IZKA 4J4PD 3VWKC 1QNZH 3EYQD 4APQC 5MERA 5JHDD 5AZEH 4RMUA 1WC7A 3UJJL 5IP4A 2ATKA 1AGEB 1U8KB 4TOYH 2QQQA 3IJSA 4NN6C 4R4FH 4Z7UA 4OFIA 3IFNL 4MA7L 5F7NC 3NCCB 2NX5B 1FH5L 1RIHL 3HUJB 2PW2B 3FT3B 2VLRD 4Z7VE 3PGDB 3MFFA 2BSRB 5MEQA 3HR6A 3EIFA 3ULVE 4WO4B 4C4KT 2R2HB 3OGOE 1I1YB 4J3WA 1EX0A 1W8NA 1TVHB 5FA4B 1KGCE 1QSEB 4BSJA 2QR0A 4H26B 4AIZB 1KNOB 1DLHA 1ZT1B 3QEHA 1JL8A 4XCYA 1QVOA 3DECA 3O4OC 4Z7VB 2IBZX 4JVPA 4D0BA 4NKMB 4WWKB 4D94A 4YHML 1FFQA 3BP5A 2A6DB 4U1MB 1ZS8B 2IANA 2QSVA 3S3JA 5EORL 4I3RL 3DSNA 3OR6B 4HZLA 5D2LE 5I8EB 1JNHB 5GGSA 1AHWC 1T1XA 2ILLA 3G6AA 4I1NB 4NM4L 1ONQB 1XZ0B 4P46C 1LP9E 4XPBH 4DFIA 1CIUA 4XPHL 3MLWL 3MLXL 4UTBH 1R3HB 1MCWW 4UT7L 2WIMA 1CXEA 3RIAF 2AXGB 3R1GH 5A43C 2IH1A 3TF7C 1KIUA 5BOZG 5IIEA 4N0CC 4XPTH 4XGZB 3IJYB 4EUPA 3O6FD 3S35L 1LP9B 3O8XC 4GKOA 4FQXC 3E3QC 5IMOB 3O6FC 3IKCA 3KYAA 5GIRA 5E5RB 2X4NB 1H15B 3G5VA 3BJLA 2IH3A 3VW3H 5ETUA 2A77L 5C07A 4FQQA 3ZYIA 2ZCHL 3G6JF 2VXVH 3H6JA 2HRPH 3L5WB 2EIBA 3D0VB 4LAQH 1S7UA 1N5AB 4KJPC 4NNPH 1A6AA 1BIIB 3D25A 4OV6F 2R2BA 1I8MB 1EAJA 4JFZL 1Z9MA 1OTTD 4GAYA 3F7VB 2Q8AH 1MRDL 4RFNB 2EDBA 4TUJB 3CLFH 3CVHH 4OUUB 1OW0C 2DQEH 3VGAB 1B4RA 3T2OA 2OXGA 4AMKH 4MD5B 1DUYA 3UJTL 1VFUA 2BSSA 2X4RB 3NIGF 2HRLA 4XT1C 1K8IA 1DBJH 1X5ZA 4ZFFB 1NAKL 3OX8A 4PG9A 3L3DB 4X9FA 5T1KD 3MV7E 5AG8A 1ADQL 5TDOA 3LEVH 4IS6A 3MCKA 3O45A 4G42A 4G7VH 4UU9B 4ZXBB 2AV1B 5FKAB 5CJXA 5DRWA 1XF4A 4FQCL 4DUXA 4YAQB 1WAAA 3FONA 2Z91A 1OWWA 3UPRA 1KB5A 3L5XL 1FFNB 5CD5D 3LKSB 5DGRA 5DT1H 4CNIB 1FAIL 4QRPB 2OI9B 1E6JH 4PJHA 5FO8B 3MLRH 3Q5TA 3QIBD 5FDWA 4HDIA 5FYLL 1M05A 3WNNA 5T1LA 1ZT7A 1AD0B 1S9WA 4B0MM 4D0DA 4GH7B 1W72A 4ZFGH 1A1NA 1SBSH 4UIMB 1L0QA 1MQKH 3CFDB 3Q6FB 5IVZA 1S7XA 3WJLA 5E8PA 2ADGA 1AD9A 4Z5RA 4N0UB 2DQDH 1NBVL 3S5LG 4P2OC 1CLZL 4RBPH 3VD7A 3ILPB 3KLHC 1JUFB 1AKJA 1YEKH 1CTOA 3MOQA 1GGIL 2I07B 4JM2B 4XP1L 4OLVH 2X1QA 3LQAH 3VXMB 3O4LA 4LPTA 3U30C 2BK8A 3OGCA 1ZHBA 3WIFA 3D0LB 1E4WL 3IDGB 1H5BA 3GIVB 3H9HB 1R3IL 1NCWH 1N59A 1U2CA 4ZFOL 1OD7A 1MRCL 3QA3B 3JWDL 4AH2B 4WW1B 5CZXC 2Z8RA 1BFSA 4Z7WE 1J7VR 4YBLB 3BOVA 3VRIA 2PETA 1UGNA 3M45A 5K9OB 1FIGH 4MA8L 5DFTA 5F70A 1W8OA 2OYPA 3BKML 2VYRE 3V4UL 5B3NA 3GHEH 3I3EA 4JM4H 5FUCE 6FABH 5CGYC 1J87A 2EH8L 3RWEB 4HUXA 4LCYB 1DBKH 4LSQH 3J8F7 4GRMB 4ELKB 1L9MA 3DBXA 1EIBA 5BXFB 4NO0A 5TDNB 5AUMB 1S78C 5J6HA 4YWGH 1U8OA 1EJOL 5A2FA 3UC0H 4UILL 4OLEA 3QDJB 4EVNB 1OAKH 3LKQB 4M1GH 5CP3H 1LEGB 4LQFH 5EU4B 3VFGL 3W0WD 5I19H 4FNLL 5D4QA 3MGOB 4ZTOH 2XNAA 1GPOH 1T1WB 5D1XD 1LNUB 1JPSH 1SJXA 2R0LL 2X89A 5F89B 3LN5B 4FS0A 4LRIA 4M7ZC 4XBEL 4LMQI 3WJJC 2OL3A 4Q0XL 5CGTA 4NRXA 5JOPD 3GSNL 5DUMH 5E2UH 3FB5A 4LGRB 1P6FA 2Q8BL 5DUPH 5A3IC 1IM3A 4LPVA 4XCCL 5D7IA 1ED3A 2NXZC 5TPWH 2VDPH 3K8KA 3QWRD 5F9DC 4LCIL 4QWWC 1WGOA 1NGPH 4UB0L 12E8L 3HZMB 5EUOB 1FZKB 5CP7A 4V1DB 1FNGB 1Q9LB 4MS8D 3W2DH 3VD4A 3GIZH 2EH7H 5EC2A 5IGXH 5I66A 1G7LA 2Z4QB 4PJIA 5JIKA 3EYOB 4NC1E 4Q9QH 3G6JE 5FUOH 2FRGP 1OAZH 2CIKA 4WCYH 4LVHB 4BH8A 1IL1A 3NZHL 4PB9L 4QRRE 4PY7B 1BREA 4GBXB 1G1CA 4HCRH 3VXRD 2H32B 4NQXA 3TIDB 3CFEB 4JKLA 5HHOD 3KHQA 1OAUL 5LAXB 4UI2A 4GG6F 3QHTC 1A6TA 5JIPA 1R5VB 2Z31B 3T0EA 1AFVH 3T3MF 4TSCH 3SDDA 3S36H 3UTZB 2IEPA 5FOBA 5D1ZA 5DJ2A 3SGKC 5FM4A 4WTZA 1EHAA 2DJUA 4GXVL 1EPFA 1CD8A 2BRQA 3BKCH 4PJBB 4EEEA 1QRNA 4XNZB 5IOPB 5DRZB 5GGRA 1X5AA 5HHNB 1MRFL 1U8MA 1F3RB 4AZ8A 3BE1H 5DJCA 2Q76A 4PGBA 4P23B 1EHLL 5BZWA 5IF0B 1KPUA 1MCOL 1N6QL 2J88H 3V0WL 3O2DH 4GS7C 4OZHA 4NZJA 3WLWC 3MPCA 3BPNC 1AR1D 1YEJH 1F6AA 5KSVB 4XMPH 7CGTA 2AEPH 4ZSOA 2H8PA 3QDAA 3BZFA 3MJ7A 3GMMA 3VFSB 2VISB 3FO0L 3N85H 2O5ZH 3FO2B 1VPOL 1NAMA 2RIKA 2V5RA 4XMKH 3JTSA 4JKPH 5EBLA 2RJMA 2X9WA 4EI5B 4PD4J 1HIMH 3ZT6A 3ZKNC 4GUPA 1RURH 2P44B 4WW2A 3W9DB 4M1DH 1UH4A 1BLNB 4YE4H 2ZG2A 1DLFH 5BV7B 2IPKA 4P2RD 4L3ED 5F96H 4R97B 4FA8A 5LWYH 4GFTB 5E70A 3UPAA 2I9TA 5EZOH 4W4OC 1E6OL 2XACC 2NY4D 5D7LD 4FFWC 4ODWB 4OZFG 4G8IA 4OQTA 3TO4C 4G6KL 5I73B 4ZO6A 3QPQC 5HGDB 2AKRA 1XGUA 2V7NA 5ACLA 5JORA 4UAOC 5C3LD 4YO0B 1T20B 1UM4L 4HJJH 5IR1A 1AO7A 4KZDL 4DCQB 1A7BA 3BN9C 4AM0A 3SJVB 3D1MC 1X5XA 4ETYA 3OAZK 3OR7A 2LAGB 3IDXH 3JV4A 1EUTA 3RAJL 4OD2A 3ULSB 3FQNB 5EIIB 1MF2H 3PL6C 4JZOA 4GQ9L 5HJ3A 4YGAB 1WBXA 1KEML 4BH7B 2BVTA 4UV4L 3N0PB 1ZVHA 5C0GB 3CU7A 3LKRA 1MNUL 4DWHA 4RIRB 4QT5A 1BBJA 4OI8A 4XCNA 1I1AD 2IMNA 3QFJA 2PYEB 1LEKA 3QXDA 5EOTB 5B3JE 4RA3A 2P7TB 2DLFH 2FDBP 1XGYL 3MV8A 4F33A 1QSZA 2ICEB 3U48A 3EYUL 5KS9A 3EOTL 3MO1A 4WUKH 5J9PB 3I02B 4HF5L 1FCGA 3DUSA 4LP5A 4O5LL 4F7TB 5F1NB 3EDKA 5TQ0L 1MHPH 5D9SB 3VCLA 1OAXL 3L3HA 4PLKD 1AQDB 1P7QD 2A74B 4R7NA 4OGZA 2EDDA 1WZMA 2BNRB 3OTTA 4JG1H 3DTXA 1KCRH 5KVGL 4JR9L 1AXIB 3QXUA 3MRKA 3HS0A 2LVCA 4UMGA 1T04A 4OQ1A 1FSKC 3TZVA 4ODSL 3OKMA 2HG5A 1U8NB 1TPXC 4KK5D 3V5DB 2CGRH 2YBRA 3NABH 3QH3A 1CF8L 1NH6A 3D3VA 3KXFB 1BBDH 4GG6E 1YJDH 4M1CD 3ARED 5L2KA 3T1FB 4Z76A 4R7DB 3WLBB 4EOWL 3X3GH 1FNLA 1KCKA 3ZT5A 3CFCH 5H2BB 5FYJU 4E41D 1FFOB 2N4IA 1EHNA 1T5XA 1FGNL 4C56D 5I15H 5DHYB 3KPLA 5D70L 3UBXI 3VFNA 1FPTH 2XQBL 1CD0A 1R5IA 2VQTA 3QIWB 3VWKB 1NGYB 3SGJA 4LGPB 2UYLB 5I17B 3O41A 4KFZC 1YC7A 1ZGLP 1KJ3L 1U6AL 2ITCB 2XKUA 1RMFL 1NUGA 5BVPL 4HSQA 5E8NB 2BNQE 4IIQA 4KV5F 5DO2D 1FYTA 3QUZA 2VMFA 3QCUH 3SBWA 4I77L 5IHLB 4LHUD 4M6OL 4U0RB 5I0ZA 1A4KA 5E94A 3MNWB 3RNKB 4C58B 4APQA 3VA2C 1T22B 1YECL 4J4PA 4NBZB 1UADC 5AZ2H 5FCUH 5ALCL 1IJ9A 5JHDA 3CH8A 5DJ0A 5F6HJ 2ESVE 1T6VN 3PWNA 4MNQE 2VDKH 4OF0A 1EFQA 3GNML 3MCLL 3JVGC 4P9HL 3WIHA 2J12B 2VLRA 1EH9A 5F6HI 3EFFB 5ANME 1JGVH 1MJ8L 3IXTA 1T1ZB 5IV2A 2F58L 4XVJH 2WWMC 2W0FB 1D6EA 3MLUH 1S5HA 4MNQB 4X6FB 1AHWB 3V6BR 3QUYD 3UPCA 4KRNA 4QCIB 4P46B 4MB5A 1T5WA 5SX4I 3T77B 4PJ9C 3MUY1 4XVTL 5IQ9B 4DW2H 1X6NA 3NFNB 3FRUB 4L3CB 1T0NB 2O61A 2X4OA 4ZNEE 5IB3A 4X9BA 2V7HA 5E08H 2VQ1B 1T21B 3CFJB 1IC4H 3GJEA 1XR9A 1HOCA 1FJ1A 1U9KA 3OKOA 4TNWF 2DLGA 5ICXB 3GI8L 1KJ2L 3HLAB 4LSRL 4DKFL 4F9LC 4ISVA 3V2AR 3O8XB 4NWTH 4KVCL 3QDHA 5J3HC 4FQXB 3MRQA 3FO1B 4OT1H 3TIEB 5HHPB 4M7LL 1RZJL 3CX2A 3A6CL 1PVHA 2DF3A 1MJJA 1RD6A 5EH1A 1FL6B 4X5XB 1AC6A 2HFGH 1IAOA 4KTDL 1FFRA 5GRYA 3O6FA 4JZJA 1NEZA 1NAML 2J4WH 1CBVH 5KN5B 3U4BL 2W60B 4OJFH 2YPLD 3CH1A 1HZHL 3KPPB 3MREB 4UNUA 4BELD 4FQHA 3V6OA 3THMH 4F7CB 2MCPL 4I3SH 3F7PC 1P4LA 3HPJA 2R39A 3BXNB 1RUQL 5JW4M 1HDMB 1MFDL 1YEGL 3BPCB 4YBQD 3TBWB 3B5TA 43CAA 1N3NB 1CG9A 5IJVB 3I75A 1OW0A 4OCXL 3KPOA 3VI3E 3E1F1 2F53E 3U36B 5I1KL 1QP1A 2VE6A 2FEEI 2VJXA 4EZMA 4OQTL 4Z9KB 4LF3B 4LSVH 3FFCD 1HXYB 3X11A 3DRQA 2NR6D 2DBLL 2ENSA 3IKKA 3M8OH 3O3BA 3EJJX 4HIIB 4KKBD 4GKNB 3U2SB 1N0XL 1WSST 4R3SB 5D2NC 4JFXA 5T1KA 3ZDYF 1QR1B 1FBIL 3F6IA 4OM1L 2Z8WC 1A9BB 1CD1A 2IBGA 4OBSA 1C7TA 5E00A 4HPOH 5FKPB 3PXJA 3L3JB 3BEWB 1KCUL 5JLZB 1SJHB 4QY8A 5J12C 5CILH 2X9YA 3L3IA 4X7TA 4PBWD 4P2OB 1SVZA 4O2CB 3FT4B 3QIBA 1NFDA 1I3RB 2E6JA 3P4NA 5GQBA 3UTTD 3U30B 1KBGH 3O2VL 1Z9LA 2VABB 1PY4A 1YQVH 5CJQL 4Q2ZB 3O6LH 3F65A 3MBED 3JWOH 3K0WA 3X3FH 1A4JB 3BYYA 3KPNA 4GRWB 4M6NH 5F88A 2I9LA 2B1HH 3GSRB 5ILTH 2XTJD 1CR9L 2ICES 3GSXA 3D39E 1MHEA 2P24B 1SY6H 3RIFF 2G2RB 1B88A 1G6RL 1A3LH 1IFHL 3QXVA 3LPWA 2XWJB 3SGEI 5AWNH 2HTLC 1U93B 4LEOA 4R2GC 4OGYH 5GGUA 4K7PX 5DK3A 2CIIB 3CPLB 3OZ9H 4KJWD 4E0RB 2AJSH 3W9EB 5H35B 1S7QB 3CSYB 1XR8A 5E7BA 4YQXH 3WD5L 4ZUTA 5F1IB 2DS4A 2IPUG 5FO7B 1CE1L 1FO0A 1F02I 4N1EA 5GPRA 2J8UA 4KGJA 1G9MH 1A5FH 4RAUA 5ITBH 3LKNA 5DMJB 4P5MA 2D0GA 5IK3A 5SWZB 2CXKA 1NCAL 2Y07L 3JV5A 4MGXA 2VDLL 4PJ5E 1M7DB 2OTUB 3CC5B 3JV0A 4M7ZB 4YHOL 1NGQH 3DX8B 1HILB 1BOGA 4OCWL 3W0WA 2V5YA 2WP3T 4Z7UF 2Z92B 3LKOB 1T4KB 2NXZB 1RY7B 1QBLH 1NLDL 5ID0B 1S7RA 4RMWA 4DZ8A 2IBZY 4HULB 3MXVL 5D1XA 1A6UH 3LEYH 4NQEE 1QPXA 5JHLL 1EEYA 4NO2B 5IFAH 4PJEA 5HHVL 3EZ8A 5KVEL 4U6YA 5FYKH 1RZKC 4Y5YA 2EC9T 3STLA 4OLWL 3NH7H 3V0VB 1G7PB 4XPGH 5D96C 4U1SA 3QWRA 4U2YA 5C9JB 1T7XA 4K3HA 3NFPA 4JFFE 5GRJH 3V52L 3EJZC 3X17A 1IGML 2CRIA 3BO8B 4GO6B 1R0AL 2J6EH 1WWWX 2QHRL 3QEQE 4IM8A 4S10A 2ZNXA 4MQXD 4IRJD 1S9YB 2BERA 1G9NL 2IQAB 1CGXA 5ESVB 1MFBH 4JFOB 4ORGB 3VXRA 5ITFB 4DGYH 3KLAA 4I0KA 3MNVB 1RU9L 3MOBL 3BH8A 3WFEL 5FYLE 5HHOA 5FEBA 4AT6B 2D9QB 2A6IA 2OTWB 3NA9H 5T5NF 4S1SL 1RULH 5EWIL 1M6OA 2VLLA 1U58A 4Y8AA 1T1YA 1MPAL 3V8OA 1CDYA 4GS7B 1N7ML 1FAKT 1HSBB 1RVFL 2C7UA 3BPNB 5I8CB 2XZCL 2QTEA 1N5YL 1RUML 4LKCB 1PGRB 2BHUA 4LCWE 3WEXB 1JN6B 4FFVC 2WSKA 3S97C 4CW1B 1Z6JT 4LLYB 4FQPA 1ES0B 2HVKA 3NCJL 1H9VA 3RA7L 1X5IA 3DRTB 4NNXB 4WHCA 2F54E 5FYJD 2HFEB 2SEBB 1IEAA 5I76B 3F7YB 4W6WB 1KLUB 3BSZL 3UZQA 1KEGH 4OLZL 1IQWL 1G1YA 3EDEA 2C4FU 1ITCA 2P48B 4P57B 4RAVB 1O7VA 4HHAB 1T3FA 1UM6H 5DK2A 2FO4B 1IC5L 1FVEB 3QNZB 3NIDF 1BGXH 2ADIB 1YPZA 5ADPH 3MZTA 3FQUB 3CUPB 4LFHG 5I1EL 3FN9A 4M4RA 3RVUC 3HMWL 2EO1A 5FUZH 3RWFA 3B6SA 3VJ6A 2Y6SD 1JI1A 2GY5A 3LQZB 1RIUH 2ITDB 3TO4B 3GEWB 4R0LA 4ZFOB 2ICWA 3QPXH 3CXDH 4LQ1A 1OM3H 5INCA 2XZQH 3HI1A 4PJ7B 2WAHA 1ZA6A 5E2VH 3SDXA 5IHUH 2QL1A 3T4YB 4UAOB 5I30L 2HLAA 3VXUE 4W4OA 4KKCD 4L3EA 4P2RA 3G9AB 3FTGB 3TNMA 4PJHF 4E5XB 2Y5EA 3I2CH 3WDHA 5EOQL 1J1PL 5D7LA 4QXUH 3C8DA 3F12A 5GRUL 3ARRA 3VXQA 3AC0A 2COQA 5FGRA 4ELMA 3GM0A 1Z0NA 2GJ6B 4KJYB 1M71B 1G7JA 1KYOJ 3T0XA 3QZWG 3QG7H 1P4BL 4OF8A 4LOUC 1TZIB 3DXAE 1J1OH 3PL6B 3GGWB 1UCBH 4LSUL 3BX7C 3C6SA 4MD0A 4KK6C 1Z5LA 3P4LA 5IW1B 4A6YA 2PTVA 2D31A 5ADOL 1JK8B 4OD3H 5EU6E 2FH6A 3UYRL 4G8FB 1PG7L 4M02A 4IOFD 5E8OB 4S0TD 3OAYH 4UT9H 4OGXL 4BFEA 4LK4A 2LU3A 5C09D 1GC1C 2JELH 1F4WL 3U9UA 1IE5A 3AS1A 1CK0H 1DQLH 1JF1A 2ATPB 3GSNB 2R2EA 2F8VA 2AJZA 3C5ZD 3HCVB 3S98A 3INUH 2BVPB 1G7MB 3B5HA 3D9AH 4M03A 1V3LA 4X6BA 4D9LH 4QOKD 3C5ZC 1I3GH 5CEXA 1SVCP 1OP5H 2I26N 1A7OL 2A6JA 4Z0XA 1I1AA 5HYQB 4FZEH 2AK1H 4GKSA 3V4PH 4C57C 4LSPL 2E9JA 3LB6C 3PWLA 3LHPL 1IGCH 2CRZA 3HE7D 3RX5A 4P4RA 4NO5B 3E8UH 2DD8L 5F7MC 4F2MB 2FJGB 2HKHH 3HAEB 1FSKB 1OCWH 4N9OB 2H9GB 1ZGLM 1P7QA 1WITA 4HJ0D 4LRNH 2IANE 4DN3L 3SE4A 1R5WA 1CLYH 4X7FC 3GKWL 5C0IB 4ONFL 4WU5A 1FO0L 1IGTB 4LLVA 4X7SL 1RUAL 4RRPG 4J1UB 1LK2A 1CQKA 1MCHA 3W39B 3CVIL 5EN2A 3P9MB 4U3CA 5T3XD 2X44D 3MX0A 2GJZB 3HZKB 1WICA 5IMKA 5D7IF 2NLJA 5H94B 1KJVA 2JLLA 1AGFB 4Q7DA 1V3KA 3VGGA 3W81A 3AREA 2IWGA 4F7MB 5IB5A 5DURD 3UTQA 4FQ2L 5EZIL 1HXMB 1ETZB 5T5FL 3FQWA 3BKYH 1BQHA 2R0WL 4MNGE 1W0WA 3ILQD 4E41A 1RJZA 1QHOA 4EKXA 2H32H 3BQUD 3QCTL 5EOCH 3D69A 4C56A 5C07E 1KCVL 4L5FL 2ZUWA 5K59F 1BX2B 4RGNC 3WNKA 4M93C 3KGRA 3KDMA 2DM7A 4K8RL 1NGZA 3RGVC 2DJ4A 4WENB 4MNGB 5C0ND 1QFWI 3GMLA 4Y89A 5I1AA 1NUDA 1IGYB 4PJAA 5C0NC 4RWHA 1C16B 5ICZA 2CKBL 5CBAA 1JZ7A 3MRGB 4U1JA 1C1EH 2DBJA 4K55A 4Y2OA 3WHE0 5E1HB 4P3WA 1JYVA 4JFEB 4XH2B 3RZCD 5JQ6L 1OPGL 3HI5H 1FLRH 1ZGLB 2YK1L 2AS5M 3RVWD 3GFUA 1MJ7H 1U8IA 1UWGL 3RZCC 4PJ9B 1DE4B 3G04B 1UXSB 4H1LB 4JRXD 4FQLL 1ZLSL 1EGJL 3WN5C 1WAAE 1S7VA 4JDTH 5MP6H 4ODVH 2RBLA 3PWJB 4XNUL 5DMIL 4PJHE 2HT2D 2ZWLT 3GK8L 3QUYA 4HIJA 3HPLB 3V5HB 1VEOA 3IDMA 4V2BA 3BDXA 3SE8L 1Z0MA 4GRLD 3CLEL 4IHOB 4TUOA 4F7EA 4TTDD 2ZG1A 5CUSL 1FNEB 2VAJA 5GRZA 2AJUL 5LGJB 2E9WA 4M62L 5GS0L 1TZGH 4LSTL 5BV7H 2VDQL 5HGHA 2Y7QB 3MRNB 3E6HA 1N4XH 1R3KA 2JB6A 4UQ2A 5GRXG 4WW2F 4EIGB 1Q9OA 2K1MA 1YY8A 1Y0LA 4F80A 2OTPA 3GMQB 4O58H 3O4LE 5IB1B 1INDL 4NHUB 2XTLA 3HMXA 5HSFA 3F58L 4PREA 4JPIA 1N8ZB 4D9RD 1GAFL 1PDKA 5IVXA 5KANI 1BEYH 3EO9H 1UB6B 4F3FB 1MCRA 2D7TL 1J86A 1YUHA 5E9DB 4NWUH 3TYFA 1SJVA 2PO6C 3PQYD 5HYIA 5DLMH 3EO0B 3QG6A 2YPLA 3GUTA 2HMID 1FZJB 4XP5L 1QFPA 4MXQC 4PS4L 3TN0B 2BHZA 3PGFL 4HUWA 2VXQH 4PGCB 3I6LE 4AEIL 3RWGB 3MRMB 5IT2H 4HUVA 2G5BA 1Q0YL 2L7UA 3TH4T 5FDYA 5D2NB 1A21A 2UV3A 1UQSA 4M48H 3EFDL 4QHMB 4WDIA 4YX2L 4WFEE 4HWZB 3H0TA 4CVUA 3VXNB 4NZTL 3FFCA 1EV2E 1DVFD 2BFVL 3OXSA 5J12B 4JHAH 4HKXA 4OZGA 4LNRA 1TTFA 3IDIB 3QDMB 1TQBC 3C08L 3U0TA 4XNXL 2APWA 3JUZA 2J1KA 3QT2A 1UKSA 3IAPA 3IDJB 2FSEB 3ARYA 3O3AB 4G5ZL 2H41A 1H8SA 1FLTX 2NY7L 4JQVC 1A3RH 4JY5H 4C4KO 4P5TB 1IGFH 1T7YA 1V05A 2BP3A 3HNSH 2R8SH 4IJ3C 5KBNC 4P3CL 1A8JH 2AK4A 3N50A 4XMLH 5GISH 4MVBD 1WIOA 3KJ4C 4JFQA 3W5NA 3SDAD 2NY1C 4PJIE 2Y5TA 1MVUB 2GFBA 3D18B 5KTEL 3TVMC 1FG9C 1TCRB 4KJQD 4POZD 3LH2L 4R2GB 5K59E 4MA3A 4L8SB 1MCFA 1F11A 4PRAA 3ZTJH 2D7OA 4POZC 4R6UA 3L3KB 3QHFL 4KROC 4FP8H 4UIKH 5JOFB 3SKOB 3X12A 1A22B 3O6KH 5I8KH 4K8RC 5C8JB 2EDNA 2DOCA 2EXYD 4M3KB 3BRGC 3WL9B 2CK0H 1TJHL 3CZFB 4RFOL 1EEUA 1QLEL 4QRUB 3LV3A 1ZEAH 3OKNB 2VWEC 4JANB 3BKJL 4L4VB 1MJUH 3JUYA 3SKMB 4X9IA 1J1XL 5AD0B 3QIUD 1NCBL 2WWKT 3AS3A 4ZFZA 1PJ9A 1QRNE 4DTGH 3U82B 1TTUA 1KT2A 1EO8H 5FHAH 4QTIH 5KAQG 5SWSD 3MLZH 3MUHL 1LO2H 4KWUA 5E6ID 4X98B 1OGTB 1HQ4A 3CU1A 2OCFD 2W0LA 3KJ6H 1F90H 5E6IC 4OZHE 3NCBB 2VSDA 4AEHL 2VKXA 5IJKC 4HMEA 4WFFD 1ZLWK 3TYGH 4MQSB 1R3JA 3TBSA 4YHLL 5LQBH 3QI9B 2V5SA 3IU3A 3BJ91 3IFPB 4ZSOE 1NGXA 2CUHA 2BDNH 4JJ5A 1KJ2B 3BISA 3NAAL 1HHGB 1NSNH 2BY3A 1A9EA 4CU6A 4OIIL 1LO0L 2BVYA 4OKVB 3WUZA 3EOAB 1JIBA 1YEEL 3DHJA 5TJWK 4OSUL 4L4TE 5CEZL 4F9PC 3EOYG 4YHIB 1A6VL 4KTEH 4ZO8A 5GS0C 4NQDD 3U46B 5C6TL 1PAMA 5D96B 1FC1A 1I9JH 3QDGE 1B9ZA 3ZYZA 2FR4A 2JJWA 1SHMA 3VXOA 3RUGA 2FATH 3IU4H 3HB3C 1RZFL 4JO1L 3QJFB 3P11H 1Z3GL 2GYSA 3BWUC 4L4TB 1XGPA 4PD4K 1ZSDB 3RTQD 5IEHA 1NKOA 2BVUA 1VESA 4Z8FL 3QDGB 1XEDA 4MJ2A 4H8WL 5BVJB 5C6WH 4M43L 4FHBD 3MRFA 1YNLL 4KAQL 3LZFH 4H20H 5DRNA 3HE6C 3I9GH 1JFQH 3B2VH 1MI5B 4P3DB 1C08A 2JIXB 4K71C 3SKJH 3FQTB 1I7RA 3ZLQC 2YEZB 5E4EC 4IRJA 2A73B 3C9NA 4ORZC 4HFUL 3ISWA 2CKNA 2DMBA 5ACZA 1WISA 1MREH 5IEKB 5ERWB 2R1XB 4G6JL 4U2ZA 5SX5K 3QNYA 1MIML 3KPMB 1WZLA 1WVZA 4L8BA 1UJTA 3IF1B 1NLBH 4QTHB 3BHBB 2OZ4A 3B9EA 5JPMA 2LQRA 1I7TA 3P0GB 4U6VH 3QFJE 1P1ZB 1WT5C 4U0QB 3U1SL 2YPVL 1GGBH 2WIIB 4RMRA 4N8CH 3B2UD 2QSCL 3VH8A 1HK6A 1GSMA 4RWYH 3GI9H 2BCKB 5KS9E 4K3DH 4JGJA 3TJEH 3HMXL 3FB7A 5DRXA 1QQDA 2K7PA 3CK0L 5EZLB 4N9GA 3AUVA 2FHFA 4ODTL 2F5BH 2I5YL 3MRPB 2P8MA 1CICD 1HH6A 3ZDZF 4KMQA 5BOPA 2QHLA 4XZUB 1LGVA 2J8HA 1O5DT 5IW6B 1NCTA 5JW4R 1FNSL 3Q1SH 4GSDH 5CD3A 4I4WA 1G6RB 5CJ8A 1DQJA 1IC7L 5JDSA 5IFHH 4ZD3L 2NY5L 5MI0B 1NEUA 1HHIA 1NC2D 4KI5C 4X6EB 2VDRL 5F9JB 1B0RA 4N0YL 2WQRA 1EFXD 3O9WC 1D5MB 4QXGL 2A9MH 3T09A 3WFBL 3TT3L 3D3VE 3MLPA 1WBZA 1B2WH 4JFPA 5L2KE 3S7GA 1D5BB 2J8OA 5GXBB 4OCRH 5KVDH 3MRRB 1G7HA 3CCHA 4J8RA 2FX8L 1JGEB 2EKJA 1MCEA 5L7XH 3P73B 2Q6WA 4MLSA 4DKDC 1NFDF 4IDJL 4BM7A 5JW3H 1BVKB 4OAWB 4QNPF 4GRWH 2OR7A 1C7SA 2XIDA 4ZS6D 3FN0L 2AJVL 4LBEB 3HG1B 1ZHKA 1UT9A 3AVEA 4K7PY 1FORL 3RKDC 4ZPTA 4XCFL 4PRHD 2OJEB 2WANA 3VE0A 3IFNH 3QEGH 3QO0B 3VXSB 4MA7H 1RIHH 1LDPL 2YC1B 2WUCL 4OD1H 2H6PA 3TPUB 2PW1B 1CFSB 5JNYA 1ZKAA 3PABB 2WBJC 4HIHB 4JN2A 1CFVL 1FVDA 1QD0A 4PRBB 1VADA 4NCC1 4NQCE 4HKJB 4PJXB 2R4SH 2AQ3A 5C09A 1WCBB 2IQ9L 1OB1B 3C5SB 4WV1C 1LK3H 3LKPB 3OAZH 1IRAY 2Y25A 5CZVL 1QBAA 3BT2H 1UACH 1YNTB 3GSQB 4OZIB 1DANT 4ZUVA 3C5ZA 3TBTA 1NC4D 3ARDB 4LCCA 2EYRA 4YHMH 1X5HA 5I1DB 3L95A 2VLRE 4QOKA 2AGJH 5EORH 3F7RA 4MQ7A 5B21A 3I50L 4NQCB 1CXHA 3P0VH 1JHTB 2KQNA 2XZAL 4NUJB 1KPRB 2VZOA 4XPHH 3MLXH 5IMMB 4YPJA 1MAJA 3DMMD 3HE7A 4UT7H 4JRYD 4Z0BH 3FFDB 4CJ1A 5B22A 3OAUL 2ZSVB 1DBAL 2CLRA 2VZUA 4JY6A 5BRZD 2XI9A 3P9LB 3DNKA 3TWCL 5HDQL 4L9DA 3BYTA 1SEBB 2VLKB 3Q48A 4HJGA 4AEEA 3QWOB 5DJAB 4NOBA 3S35H 4WNQA 3SE3C 4YLQT 4X0KB 3HZVB 5HPOA 4YEFA 5F9OL 4AENA 5ICYB 3SO5A 1T7ZA 1IKNA 4OLXH 1GZQB 4PJEF 2A77H 5I16A 5DMKB 2ZCHH 1RIVH 3HRZA 1U8JA 4ONHB 1JWSB 2HT3C 4Z7OF 3X14A 3U7YL 1Q8MA 2LU4A 3H9SE 3ZTJG 5ABDE 1AGCA 1OTUD 4RGNB 4JFZH 4P2QD 5BS0D 2BVEA 5E6YA 3ARPA 3PIQA 4HT1L 4LPUA 1GGCL 1CCZA 2HJLA 4M93B 1I85C 3P77A 3S37L 3RGVB 4JFDD 4F57L 5IMLB 3I6GB 4O2FB 2HKFL 2CLZA 2YD9A 4MJ5A 3JBG7 1FL5B 4M7LT 3UJTH 4YHZL 4PUBL 3KPSB 2YN5A 4FG6D 2GK2A 3V6OE 2XFXA 5JXED 3H9SB 1NAKH 4UDTA 1TFHA 1AJ7H 3KYOA 4O4YH 1LE9B 3DROA 1IAMA 1QA9A 1ADQH 2IC2A 4ZAKD 2OSLB 4HWUA 4KI1A 1UJ3B 1R6VA 5A2IH 9CGTA 2MOVA 4QRSB 2FIKA 4FQCH 2A38A 5B4MD 3L5XH 5A2JH 5DD5L 1FAIH 1U41A 2ARWA 5DJ8B 3WN5B 4TN9A 1KTDA 1RUKH 4UQ3A 2NY6B 3MJ9L 3D85D 5CINL 2Y1VA 1QO3B 4RFEB 5GGVY 5ESAA 3CAFA 2ZUUA 5FGCB 4XCEA 2VXSL 2BSTA 3QO1A 3RZCA 1N6UA 1JTTA 4H5SA 2H2PC 2ARJQ 1EMTL 1JJUA 3DURB 4HIXH 3TBYA 4HWBL 5DD1L 1NMAL 3NN8B 1C5DA 3ZE0E 4O2EA 1CGYA 3V5KB 5C2UB 4JRXA 5JMOC 1NBVH 2VLJB 3MSPA 1EA9C 2UY6A 4NN7C 3VFWA 2CDGA 5DD6B 5DD3H 5DMGD 1CFTB 3QUKA 2X1WL 4FQJL 1GGIH 5HPMA 3ZL4H 5DMGC 4LLMA 1ZWIA 4X4YA 3S5LA 4G9DA 1JGDB 1FNAA 3RL2A 4JAMB 1BWMA 1FN4B 1JMXA 4YDIL 5F3HB 4YGVB 3JV6B 1YPZF 3MRJA 5K9QG 3GSUB 1EAPA 5GGSY 1OF2A 4HXAL 3BMVA 3ROLA 4PJCA 1ZT4B 3KPQB 3MODL 5FB8B 3ULUC 3WO4C 2BVOB 2PR4H 1PYWB 3PF2A 2FD6L 5JA9A 3SDXF 4M8QA 3REVB 3OXRB 3E6FB 2EH8H 2FB4H 5FYKU 1R3LB 5MEOB 3OJDB 1HSAA 3DSFH 1A7NL 1YZZA 4UTAL 1EJOH 4N0FA 4OI9A 1K4CA 5ESQA 2DM3A 1KN4L 4PJ7F 4UILH 1MFEL 3L7FA 2F15A 3AROA 5FGBC 4YHPB 2PO6A 1OSZB 2J8UE 3VFGH 4DN4H 3QXAB 3CDGA 1ROWA 3IETB 3PQYA 1OLLA 3QRGL 5E4IA 2WMPA 5IQ7L 4TVPL 5ISZE 2R0LH 1ZVYA 3MQIA 3GMPB 7FABH 2Q7YA 3JZ7A 2APFA 3QUMB 4XBEH 4Q0XH 2FECL 3GSNH 3LMJL 3G9VA 3MV9D 4DKAA 4XCCH 1X5LA 3BWAB 5HYJD 2AJ3A 2OR9L 2ARJA 1UM5L 5IFJA 1F3JA 4LLUB 2KKQA 4LCIH 2C1OB 4HKZB 4JQIH 5GS3A 5T33H 1AGBA 5ISZB 1ACYL 2NY0C 3TNNB 2E3VA 2W9EL 5CJOH 2QADD 2HLFD 5DI8B 1DVFA 3QCVL 5D6CB 4ZUUA 3G5ZB 2CK2A 4JDVA 2MQ3A 2QADC 2EXWD 4EDWL 3PP3K 4XPAL 1J11A 2JJTC 5JOPE 1AGDB 4XHJC 1JRHI 2BOBA 4KVNH 3HAEH 3RVVD 3KJ4B 3LD8C 2NY1B 5I1JL 4YXHL 4GMTH 1PG7W 3P2TA 4JHBA 1TJGL 4PB9H 3REWA 4WI4A 5E2WL 2EIDA 2AEQL 4KZEH 1MCBA 3AXLA 4P5KB 4Y1AA 1KIPB 1MIEL 2GW5A 3EGSA 1C12A 4QRQB 4CMMB 4KROB 1OAUH 4S1QL 4GW1A 3TVMA 2XZZA 2D3VA 2AJXH 5TQ2L 3DIFA 3SDAA 5LXGL 3R4DA 4BZ2H 5DEFB 1MH5A 5ELIA 5GGTA 4X8JA 5DK0B 2O5XL 2GCYA 2PYFB 5T3ZL 4NZDA 2YMXL 5ECJE 2CKBB 3K81A 1HHKA 3QEUB 1OT2A 3FN3A 4HX1B 2A83A 4WUUE 25C8L 3C60C 3ARFC 5ID1B 3C2SA 5IB4B 1EHLH 43C9A 2GJJA 2I24N 2MPAL 5HHOE 1MCOH 1N6QH 4Y4FC 3FOMA 2X2YA 4Q9RH 1P7KB 5HY9B 1YMME 2VL5B 2RB8A 1YN7A 3N1MC 1UA6L 3QIUA 3L3GB 2X4PB 3EZJB 4WUUB 1BVLB 3RX7A 3VRLE 4DZBB 4U3XA 1VPOH 3UBXB 4AIOA 5SWSA 2JCCA 5D5MB 1CVRA 4QF1B 2QSTA 5E6IA 1K4DA 3ZE1F 1YMMB 4LFHD 3T2QA 4DVBB 5T3XL 4G43A 4BJLA 2DYPB 4XXCC 1S5IH 1OOAA 5GHWH 1JZ8A 4PJAF 3BGFC 4N8PA 2YSSB 3U7WL 3MNZA 1KIQA 1IM9B 3G5YA 1YPZE 3A0OA 4H1LH 3BAEL 5C08B 4CL7A 4X5WB 4Y5VC 3FKUS 1GZPA 3QQ4B 4WEBH 2IAMD 3GSWA 2Q87A 5GS1A 5LGHL 3ARGC 4OZFA 4NQDA 2IAMC 5EO9B 3OSKA 4NRYA 3OQ3B 1BZ9B 4NCDA 2X5PA 2FJFA 1U91A 4LNVA 4GG8B 4WU7B 2H3NA 4L3EE 4ZNCD 1A7QL 4N5UA 3ULVL 2EE9A 4LARH 4ONGL 3HE6B 1KLGB 3BN3B 4DAGL 3FRPG 2DQCH 4D3CH 3B9KC 1SEQL 4K71B 4Z7NF 5IBLD 4KXZH 3PWUB 3HC0A 4ELME 5E4EB 1J8KA 3RTQA 3RWCA 3HRPA 1E4KA 2Q7NA 1KEMH 3S96A 1FDLL 2V2TB 3LRSA 4GKZB 1DTUA 4TSAL 1AE6L 1P9MC 2WQ8A 4LASH 4UV4H 4MDJB 5B39B 1VFMA 4QHKJ 4YDLC 2E27L 3U4EB 3RL1B 1KG0B 3H7BA 5F8RC 1S7SA 1E28B 3LSOB 5E2JA 1QEWA 3ETBF 5E1AB 2HH0L 5EBWB 4LP4A 5EC1A 1AP2A 1EZVX 3DJ9A 1F42A 4QHKI 3NZ8A 1BQUA 3O6ML 1KYOK 3Q6GH 4OGAC 3RJDA 3F5WA 1MY5A 3CVHA 5EUKA 4N8VB 4G6ML 3QSKB 1CZ8H 2X4SB 2EZ0C 5IVXF 4U33A 4NKQB 5FM5M 4H25B 1MLCA 1P4IL 4O5LH 4TUKL 1WTLA 1ZTXL 1K6QL 1A7RL 5TQ0H 4CN4A 4BSWB 5EFIB 3OPZL 5GRVK 4J3XA 5IBTL 1PEZA 1MCPL 4RQQA 4FABL 1XF5B 4XTRD 1HN1A 1DUZA 2EEAA 1NQBA 1ZHLB 2ZJSL 4NM8L 2HYMA 3L6FB 2YPKB 2V2WB 5KVGH 1JVKA 3BMWA 1RZIA 3RVTD 4MA1C 4Y19D 2GSGA 3QRFM 1TETL 4J3UA 1RK1B 4PTUA 4ODSH 4BZYA 4ODXA 2YD7A 5E5UB 2VZ3A 2GSIA 3TA3D 4HIEA 5IHZA 1NFIB 4MAUH 3IVKB 1DDHB 4PY8J 3O9WB 1CICA 4WJ5B 2GTZB 2R1WA 1RJYA 4RNRA 2BMKB 2UVFA 5DJZB 1JPTL 4Y16C 3T0AA 2WP3O 1XGQA 4PY8I 5D7SL 4NO3A 1NC2A 2VH5L 1YYLL 3BW9B 4OZGF 1S9XB 5D70H 2ORBL 4L9LC 2XQBH 4AG4H 4MJID 1WCQA 3LN4B 3I3BA 3SKNB 4OM0L 1NANI 1EFXA 4K94L 1F8TL 1B4JH 4Z78B 4LLWB 3U0PB 3WNLA 4KPHL 1T2QL 4G6FD 5IM7A 4PJ8C 4KHTL 3ARSA 2P5ED 4FTVD 1MCKA 3TCLB 3ES6A 1OGAD 1J8HB 5FIEA 1MUJB 4U6XA 3QQ3A 1MFAL 4E41E 4WHTB 3Q5YA 3RBGA 4JLRB 5HVGB 5B8CB 4Y2DC 5CEZE 3WS3B 1NDGB 2WBJB 3F7QA 4X7CC 2JE8A 3DV4A 4L1HA 5MEPA 4QXTA 4C56E 1WFOA 1XH3A 5D1QD 3DGGA 4C54A 4U7KA 3GNMH 2VTFA 4WV1B 5F7FA 4P9HH 5D1QC 3BP7A 4PRHA 5EO1B 3ZE1E 4TQEH 1VFAA 2OLDA 4W81A 3P30L 5DDHA 3PE9A 2XT1B 5L6YL 4YPGB 1MJ8H 4XBPB 2C5DC 4M6ML 2NX5D 2MKWA 1TVBA 5C0AB 1B90A 2GK0B 5CP3A 1K2DB 4NQVB 2CLVB 1T66C 4Z6AT 2AV7B 4WO4D 3RWDA 4X6CA 3PP4L 2JK5B 1AY1L 1NGWA 2MSPA 3KPRE 1AIFB 3VDAA 3T3PF 4F7PB 1LWRA 3EYSL 1QSED 1AQKH 5F7WC 2EDOA 1NC4A 4LHUB 5GGTL 3MYJA 2Z35A 1IAKA 3OKLA 3BH9B 3DO7A 1LILA 3QQ9D 5FYKD 4R26H 4RISL 1RQ5A 3T04D 4U6HA 4WWKD 3KYMA 3VFVA 1J10A 4BKLA 5IESH 2XA8L 5I18L 3GI8H 1KJ2H 4DKFH 4I18C 2GITA 3MRBB 4HLJA 3I84A 5TE7H 2PTTB 4KVCH 3EYFA 3ULVC 3KPRB 1RZKH 4CADB 3GKZA 4KTYA 3DMMA 1QNZL 2JB5H 4M7LH 4JRYA 4S1RL 5KOMC 1VGKB 1ZA3A 5AZEL 4LDEB 5J6GA 5GSVA 4ZUSB 3A6CH 3HAEG 3AS0A 3GMRB 4YXKH 1DN0A 5HDLA 1ITBB 5BRZA 4X8XA 5I1LA 5FECB 4NZUH 1EEZB 2BJMH 5CS7A 3UTOA 2RQ8A 4U1HB 3RWJB 4LCUB 1E27A 3BD4A 5FO9A 4YHKL 2PNDA 2NZ9C 1P2CA 3ESUF 5KZCB 1YMHB 4I2XA 4X7DC 2R15A 3U4BH 4WVRA 3FHQA 3VGFA 3VXPB 4HCRA 3VFRA 4IMKC 4XAWL 3EHBC 4O51A 3FQRA 3PHOB 5T1DH 3FOLA 5BJTB 4NT6B 1CGVA 5HI5D 2VXUL 3KNBB 4UOW0 3AY4A 1MQ8A 1MFDH 2W0KA 1YEGH 4OFKA 4OCYH 1B0GB 1GHFL 2VKWA 5HVFB 1ORSA 4P2QA 3QULB 1U92A 5BS0A 5EBMB 5I1KH 4K23L 4N5ED 4JFDA 2UZXB 1UXWA 4KY1L 2YPLE 2OZ4H 1QTYT 3DV6A 4XPBL 4X4ZA 4C83B 4JO3H 2DBLH 3ALXA 2CQVA 1KTLB 4X99A 4R4ND 5JXEA 4UTBL 5J7CC 3CDFA 2I27N 1MCIA 1YY9C 4Y4KC 3O2DA 1FBIH 3ECBA 4OM1H 4JG0L 4ZAKA 3QUXC 5JPNB 4JFYB 3RGHA 5HI4C 5IVOA 4X6DA 4YDVA 3LDBC 1BFVH 2X4TB 1KCUH 2VB5A 3V6ZB 2EIZB 4J23A 2Z8VC 2MQ0A 4ZXBD 5T1LD 1AXSB 4LSSL 4MDIB 5EU3B 2C1PA 4UUJA 3FFCE 1A2YB 5F97E 2D03L 3D85A 2E7LC 4PP2A 4QRTA 3VW3L 3PGCB 4OZGE 4QRPD 4U1KA 1ZLUK 3IAGC 1S9VA 4LPCA 1MHHA 5CJQH 1DQQA 1ZVSA 4YDKH 2OI9C 4R90H 5DSCA 4LAQL 1BF8A 4H1LG 2WNGA 3WFHB 2C3VA 5DZOA 4K94C 5HGAA 2ED8A 1S7WA 4KU1A 2Q8AL 1A6ZB 3IRZA 3CFBA 4CVZB 4PTTA 1QOKA 1IFHH 1W0VA 4JVWA 3WO4B 4G8GB 4LKXA 1QLRB 1FV1B 3Q3GB 1WQVT 5K9KA 5M7QA 3H2WA 3UTTE 1Q9WB 3CFKB 2ADJA 4NPYB 4QYOA 4JM2D 1DBJL 3VXMD 3WO3B 3OB0K 1G0DA 4MX7B 4BUGA 1D5ZA 1SJEA 1SYSB 2LTQC 4JM2C 5KSUB 5BMFL 2NXYC 1IMHC 2PCPA 4RDQG 2ZOLB 4LPXA 4ENEC 3QNXA 5E0QA 2XTJE 4XXDA 2AP2A 3AMLA 4QGTA 5J4MA 3UTTB 4BYHA 4PGEB 4YBLC 1UC6A 1Q94A 1YEIH 5HHQB 3BP4B 2FWOB 2IADB 3RNQB 4X9HA 1NCAH 5E8EA 2XKNB 2VDLH 3MBEB 1GC1H 4M5ZL 3FT2B 4XNYL 4JFHD 4ZOCA 5HHMB 4YHOH 4XVUD 3PDOA 1WF5A 5ACMA 3UXFA 4OZ4B 4LSDA 8FABB 1ZHNB 4XVUC 3GMNA 1WZ1L 1UKQA 3VD5A 2VITA 5JOEA 3QDJD 1JGUH 3ZE2F 5HGBA 4PIRF 1YEKL 2AQ2A 1BD2E 3MXVH 5EULV 4PGDA 4PRPB 2NY0B 5JHLH 3KS0J 3LQAL 3HN3A 5HHVH 5C0BB 1EUUA 1JMZA 4WFHD 3M17A 1TENA 1MVFA 1I7UB 1MAML 5FUCC 3MRHB 1IZJA 4LU5L 1NCWL 4PP1D 5HDBE 4I5BA 4YHNB 3MV9A 2KL6A 5HYJA 3PNWB 1ZXQA 1PZ5A 1BFOB 3LD8B 5JZ7D 1YEHH 5DEGB 1Y18B 1BD2B 1CFNA 2MKLC 5JZ7C 3EYVB 3FB8A 5KSBB 1GGUA 3IJHA 1JWMA 3PV6B 3DVNA 1RZGA 3MOAH 3L9RA 1IGMH 1IGJA 2JJTA 5CSZA 3RUGE 6FABL 1R0AH 5DJDA 4V1DD 3K7UA 1QFWM 2PXYC 5JMRA 3MJ8B 2VN4A 4ODUA 1G9NH 2XWTB 1MWAB 3T65B 3UC0L 5BQ7A 5DFVC 5A16B 1G84A 2X4QA 4M1GL 2H26B 1HI6A 3MCG1 4LVOC 4OB5H 1I8KA 3MOBH 3MUGB 4XVSH 4GBXD 5I19L 1CFQA 4HPYH 3C60B 4LLQA 2BNUB 4ZTOL 1RK0B 3SCMB 5EWIH 4HBCH 5K9JL 5JTWA 3BDBA 2F19L 2Z93B 1MPAH 4R8WH 4PJDB 4Y4FB 1N7MH 1LO4L 3A6OA 2Z31D 1MLBB 3RI5K 2XZCH 3LS5H 1RUMH 5DUML 5E2UL 5A1AA 2P8PA 1BJ1J 1F6FB 3LIZH 4ZTPL 5DUPL 3ARFA 4NC1C 3KR3H 1QLFA 1WWCA 3NCJH 2AXHA 4M3JA 1CFBA 4I0CC 5F72S 5TPWL 2YUVA 3PWVB 4Y0GA 5C0CB 2CDEA 2K3TA 3OKEA 4JJHA 1J05B 4P23D 2YR3A 3BSZH 1N0LA 2DQFA 4OLZH 1IQWH 4LVEA 3R06A 1KUMA 3PUCA 4KC3B 3W2DL 1A3QA 3CSGA 2OJZL 3MROA 4PJFE 4J3OC 3WHXB 4KUZL 2B4CC 4QHLB 4JKWA 4M9OA 3LEXB 5FUOL 3BGFB 4D9QD 1I4FB 1OAZL 5HI3D 4OV5A 2B1AL 4X4MA 3PHQA 4JY4A 5FYJE 2H2SC 4XXCA 4PJFB 2DIBA 4EI5D 2XWBA 4YDJB 4HQQH 3DX7B 3PWPB 1WK0A 3ARGB 2FCBA 3NCYS 3FO9B 2EKSA 1CS6A 2C3HA 3STZA 3WNMA 2ZKHL 4BSVB 1DQMH 4YNYB 3T0BA 4D0CB 4PLNC 2Q86A 2Z0BA 4Y5VA 1K8DA 1J1PH 4PJGB 2FL5B 3CMGA 3HZYB 3BKCL 4NNYB 3ZYOA 1ZLWH 1GVIA 3B9KB 3O3EB 2IAMA 3BE1L 3IXAA 3W11D 5GSRB 4LSUH 1UZ8A 2UWEE 5CEYB 5L8LB 1CD9B 3BZ4A 1H0DA 2EDYA 1UG9A 1XF3A 2J88L 2KDGA 3L5IA 3QZWA 5BO1L 5ADOH 1JGLL 3LPGA 3MMEA 1DR9A 4MJ6B 5JO5A 4I48A 3VG0H 4YDLB 4G6AD 1YEJL 3LRHA 1IEHA 4O9HH 4XMPL 3SJVD 4MD4B 4OGXH 4PV9B 2DL2A 1PQZA 2E9BA 3VFPB 4NKDA 1J5OL 1U42A 2O5ZL 3MGTA 2UWEB 4XNMA 2R9HC 2VIRB 1MHCA 3MR9A 3VFUA 2PKDA 4PJCF 1U8HA 1FNHA 1RURL 3QJHB 3ZE2E 1GYAA 1UFUA 2YRZA 1UYWH 2EIEA 1JV5A 4M1DL 4X9GA 3TGXA 3VFTB 4BK4A 4S1DD 3MC0A 2EDFA 2M26A 2BC4A 2GTWB 4M61B 5F96L 4KHXL 5DJ6A 3SEPA 5C09E 5KOVC 4LSPH 2LVEA 4ALAL 4DEPC 4P99A 3LHPH 3ZDXF 2PYED 3OHXA 32C2A 1IGIL 5DJYA 2DD8H 4QHNA 4U1NB 4XAKD 4ZODA 1ND0B 4HJJL 4HGWB 4YUEH 4QOKE 2WWKO 3QUMH 3RWHA 3TH3T 5T3ZE 5HYFA 3GKWH 2HN7B 2F8XC 1V3JA 4HFWB 1EXUB 4B53A 3HFMH 3G08A 3HC4H 3WE6A 4YJZL 1UVQB 1FZOB 4MHHG 2G75B 5SX5H 1XF2B 3R8BB 4X7SH 3EBAA 3N9GH 2ENYA 2HT4D 4AL8H 4HK3N 3HTLX 1C5BL 4HAGA 3RPIB 3ZKSD 4IMLB 1P7HL 2BNRD 4NYLA 5TDPB 3HKFA 3CVIH 2ZCLH 4WFGD 4ETQA 4Y16B 2HVJA 1N2RB 2JF1A 2YKLL 3L5HA 4RRPA 1LD9A 5E2TL 3TA3A 4NQSA 1U8PB 1NBZB 4L9LB 2M2DA 3VD3A 2VC2H 2ZSWB 1REIA 4LGSB 1KJMA 2A6KB 5F71A 3DVFA 3T08A 3VFMA 4CUCA 5EZIH 4WGVB 3QB7C 4HH9B 1HQRA 4BFGA 5EU7E 5I1GL 5J1AB 3KXFD 4PJ8B 5INDA 4L29A 3QHZH 3UTSE 1BP3B 3H7LA 2VR9A 4MAYC 2RFXB 2DLFL 2KPNA 3QCTH 1CDJA 1UB5A 5M95B 4ODHL 4L5FH 1QSFB 1SY6A 4PRNB 5T3XE 4Y2DB 3QFDA 2JJSC 4MJIA 4NDMB 1BJMA 1U8QA 4P4KC 4G9FE 1FZMA 4U1IA 1D5XB 5DC9B 4K8RH 1NCNA 4KDTA 5DD0L 1CQYA 2NCMA 3P4MA 1MHPL 3EJYC 2BX5A 3QIWD 5DJXA 3VWKD 5MENE 3DWTA 4IOIB 3TV3L 3T1WA 3UTSB 2P5EA 3DX9B 4XP9H 3BP6B 4FTVA 4LIQH 3RWIB 3QIWC 5AYQA 5FV1L 1OGAA 1S7TA 1TXKA 4HV8B 4IRSC 2CKBH 4PV8A 1I8IA 3IFOB 1A1OB 1RJLB 1KIRB 3ZSSA 5C0DB 1DP0A 3O3UN 5D1QA 4G9FB 1T2JA 2MNUA 4U0RC 4QHUB 1JWUB 4RGOH 5MENB 1UWGH 3RU8H 1PD6A 3IRPX 1AGEA 1BBDL 1U8KA 2BVQB 3F62A 1EGJH 3A67H 5F3BB 3C5JB 5C9KA 2W65B 2NX5A 1J0IA 4UDUB 2D0FA 3HUJA 2PW2A 3FT3A 4XNUH 3BQUB 5IBUB 4IRZL 5DMIH 2XG5A 1XIWB 2DDQL 3CFCL 2VDOL 3PGDA 3WV0A 2BSRA 3SGDI 1HHHB 1N64L 1HNGA 4JCMA 2P5WE 4X4XB 4I18B 4WO4A 2R2HA 4GAGL 3CLEH 1I1YA 5LCVH 4DGIH 4G8EB 1TVHA 5CUSH 5FA4A 1QSEA 4OCSL 4P46D 2AJUH 4H26A 4AIZA 2JCCF 3Q0HA 1KNOA 5GS0H 1ZT1A 3O3DB 2XY2A 3MA7B 4JO2L 4Z7VA 3QCUL 1PFCA 4NKMA 4OZFH 2YRPA 4WWKA 3P4OB 2P5WB 2A6DA 1X7QB 2DMKA 1ZS8A 4U1MA 4FXGB 2NY3C 3OR6A 4R4BB 4HK0B 5I8EA 1JNHA 2YA0A 4N0CD 1INDH 4WI5A 5AZ2L 3F58H 2VO5A 5D2LB 1ONQA 1XZ0A 3VMPA 3WMSA 3O8XD 1GAFH 2VDKL 4FQXD