4M7ZB

Unliganded 1 crystal structure of s25-26 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
LKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB01
4P2QB 5B38G 3KYMA 4MA8H 3GHBL 3W81A 3WN5B 1D5BB 3L5JA 3EOTH 5TQ0L 4U1NB 4H88H 5BOZG 1L7TL 4AIZA 1T5XA 1Q72H 4PJXF 5SWSA 4XCCL 2NQCA 4WVRA 3B9EA 2LU4A 4YXKH 1AXIB 3KPRB 3TN0A 1WF5A 1MFEH 4CU8A 4N8PA 1UJ3C 1RU9L 4H1LH 5FO8B 4OKVA 3QZWG 4HS8H 5C0FB 5HGHB 1BQLH 3UC0L 4PRPA 2B20A 3ROLA 5JA8B 1H3GA 4QTHB 3RU8L 2W92A 4TTDD 4KUZL 4GO6B 4PJEA 1MHHA 5AYQA 4Z77B 3GMQB 1VEPA 3MNZA 1P6FA 4MJIB 1LE5B 4LPYA 3ZE1E 5I15H 1CXEA 1PQZA 5AZEL 1WIUA 3D18A 2NPLX 1GGUA 4PG2C 4B5EA 2BNRB 3GSVA 4MMXC 1MLCA 3JBG7 1JRHH 4HIIA 2XRAL 3TJEH 3EO9H 4EJ1C 2WAHA 4PB0L 1MF2H 3QPQC 3T8XA 1N59B 4GW1A 5DK2B 1OTTD 1Z5LA 3IU4H 1CIDA 2CLVA 2DQGL 3L7EA 5FGCE 4L8CB 4F15B 3GI9H 5I0ZA 4HGWB 3Q48A 4PRAA 3O8XD 2IGFH 5C0ND 3GBMH 1J0ZA 3GSOB 4NRYA 1J1XH 4NQXB 3FO9B 3O11B 5I2IB 3MGTB 5FGBC 2G5BB 4C4KT 1BZ7A 3EOBA 3RKDC 4ZFOA 3C6SA 2X4UB 3SDXA 3P2TA 1R24B 3M17A 4I3RH 1AGFB 5IBTL 1ACZA 3GK8L 4WHYG 1WFNA 3I6LD 4WENB 2V7HA 2ZUWA 3K4AA 3BGAA 3TFKC 4OF3A 5C0GB 5E8OB 2KZWA 4P49A 3PDDA 5MENA 3QPXL 3OKMA 4JDTL 4OLUL 1VSCA 1FZMA 1KNOA 2GTZB 1EEYB 1YEEL 4YH6A 3LKNB 4GBXB 3VGGA 5HDBE 4LGRB 5GS0L 3GIVA 1FFNA 4Y4FD 3RIFF 2P44B 3PJSA 4EN3D 5J7CC 2ARWA 1Q9WB 4KQ4H 4OIBA 5C07B 4J3XA 1U3JA 4NQCB 3T0VA 4KJWC 1I1AB 4ONGL 1G9MH 4CVZA 5GRXG 1MI5B 4I5BB 1ZHNA 1ETZB 3WNKA 1T89A 5IG7A 2DB8A 2YA1A 4ONHA 1DQLH 2ARJQ 2R2CA 3L5XH 1U8NB 1N5AB 4I9WD 3SEPA 4U6HB 4HS3A 5J1SC 5GJTH 3VFMA 3DETC 1EFQA 1GOFA 2VOTA 4FABH 5HYFA 2H8PB 5C6PB 4P9HL 5F8RC 4XHJD 2H2PD 2NY3B 4IOIB 4KZEL 1BIHA 3WBDA 3VFPA 1JCKA 3GBNH 4UAOC 5IW6B 3UCRA 4Q58C 4R90H 4KKLC 5MERA 1KXQE 2JK5A 2DICA 3RWDB 1VACA 4E9LA 1YUHA 1I1YA 2H3NB 4P99A 2J6EH 1FAIL 1HXYA 1MCPH 4NUGH 3BKML 2BERA 1S7TA 3IAQA 3R1GH 3VRLF 3SE4A 4LLMB 5KSAC 2XQYK 3MJ6A 1DJSA 5FV1L 2DQHH 3RPIB 3P40A 3RWCB 4KK8C 4XPTH 1XGUB 2YXFA 2PR4H 1QLFA 4P5KA 3BT2H 4XCEA 1JF6A 4JFYB 4ZMAT 1HHGB 1H5BB 2O26U 2IANE 4U1JB 1TXKA 3BSZH 4UUJA 3E6FA 1A3RH 1N7ML 1A7PH 3FQXA 1T2QL 1TZIB 1WCBB 4Y5XA 5BZWB 5JQ6L 5D7JA 5FDYA 1G9NC 2ZCLH 1AI1H 5E5RB 3VGFA 4WV1A 1U3HA 1PG7X 4I3SH 4PJ9C 1E28B 4PJGE 3O4LD 3RWJB 4UTAH 5IB5A 1T21A 1OP3H 1P7QD 1TJGL 5E1HB 2GSGA 5JW3H 1RUQL 3FT4A 5CKGA 5FDWB 5F7DB 4JFFA 2R8SH 3SKOB 2R0WH 3LEYH 1I1CA 2E9BA 3WIIL 2HFTA 4GRWB 4DW2H 1JPSL 3GB7B 4QHKI 1FVCA 2VXTL 4P2QD 5JOEA 4XNUL 4YFEA 4HLJA 3PDOA 4U33A 1NFDF 4H25A 5HHVH 5F1OB 3VE0B 1XGTB 2HKHH 2X4PB 3CC5A 3OPZH 4OF7A 1S7RA 3K8MA 4Z18A 4S1RL 3KPRD 2HFEA 1JPST 4L8SB 2DI8A 2PCPB 3U2SA 3MV9E 1FL3A 4YDJA 4WUUA 2A83A 5CEZD 5D93B 1IZKA 1RZFH 4KUCF 2DMKA 2XA8L 4H0GA 1L6ZA 3CDGB 4MMZC 4O58L 4BA8A 3VXME 5E08H 4QXTA 4Y7MA 2CRZA 5EIVA 4ODTH 1AO7D 5EBGA 4NM4L 4X6EA 2EH8H 5IGXH 4MJID 4ZD3H 1IT9L 1KOAA 3QWRA 4MXWH 5DF0A 4ZTPL 5FUOL 2ZCKL 3ZT7A 2BDNL 3EDKA 4Y4HC 2BNRD 1WZMA 1I9RL 2VLMD 4MB5A 3HR5B 4AT6A 3VXRE 1I7UB 2FJHB 4QHMB 3RWEA 5SWZB 1UEMA 4N5UA 3CX5J 2A9NH 1XMWA 4RFEA 5IMLA 2XWBA 3EFDL 5IHZB 4H26B 3QDGE 5F9DC 3C8KA 3LS4L 3GSQA 3JWOC 2AGJL 3HPJA 1A3QA 3IJHA 4JM2A 4M4RA 5KAQF 4XT1C 2WINA 2X10A 4XNXL 5GRZA 3AROA 4XVSH 3VXSB 2EDRA 4JFPA 1NMCB 2UVEA 5IVXE 3BEWA 1JK8A 1WISA 1NUGA 4UV7L 1RFDH 4ODHH 4D9RE 2WBKA 4AY0A 2VLKE 1KYOK 2XQBH 3CFJB 3UJTH 1QBBA 3G5YA 3I3BA 1J11A 3EO1A 3WXVH 2X05A 1HDMB 3LS5H 1NAMB 3QQ9D 1Z9LA 4A2LA 1YNLL 1I8KA 2VR5A 5JHLL 1IAIH 3BYYA 1NGXA 1NCWL 1C12A 1AFVH 4CJ0A 1H8OA 3IRZA 4KAQH 4HZLB 2HFFA 5H2BA 1CXHA 2C3VB 1FNSL 4OCYH 5I1HL 4JJ5A 4X6DF 1X4ZA 3L3IA 3K1DA 1VFUA 2CIIA 4F80A 1LEIA 4GBXD 5IESL 4LVOC 1YMME 3OJMB 1J0HA 4QLRA 2H32B 1KULA 3N1MC 1IGML 1PLGL 3RNQA 5DJZB 5C0NC 1A1MB 1T80A 4P5MB 4KY1L 2BOCA 5CEZH 2FZ3B 4NQCD 1I8IB 4KPHL 1I1AD 4R8WH 1MI5D 3AM8C 4JZOB 4AEIH 1Q1JL 1AD9A 1RZ7L 4GKSA 5D6DC 3VWKB 2ZWLT 4YHKH 4X7FC 3I6GA 3K2UH 4GW5A 4TULH 1IGIL 3K8KA 3OKLA 4ENED 1TETL 1HIML 5F88A 4QNPF 3DYPA 1IARB 4OCXL 3VFVA 3MR9B 4OZGF 2ZOKB 2F74A 5E2TL 4FQPA 3HMXH 5HDOA 3B8SA 1IMHC 4JO3L 3VXOB 1R5WA 2NY3D 5E99L 1KG0A 5D70L 3N1PC 3TZVA 3SO5A 2OP4L 3RIFK 1JZ7A 4OI8A 1G6RB 4U1MA 4MDIA 3MLTB 4X7SL 5C0CE 4BQ8A 4LCIL 4JDZA 3DTXA 4WFFE 3CVHL 3GO1L 3DBXA 3IDYC 5FUZL 4RDQF 3SE9L 2YSSA 3V4UL 1SMOA 1UB5B 3OX8B 2R4SL 1E6JL 4UMGA 3X11B 2DQUH 4HK3N 4EN3C 4OQ1A 1X5FA 1YQVL 1F90L 2BVOA 1NQBA 4WU5B 1MIEH 5HHNB 3U4AA 4PGBA 1C08B 2GSIB 5DI8B 3ZSTA 3UZEA 5JUEH 4PGDA 5F7FA 1PEZA 3MRMB 2DLFH 4EI6A 1JNHB 5D7IB 1OW0A 2W0PA 4ELKB 1U6AH 3STBA 1IBGH 3RGVB 4FN0A 1IEAA 1U8QA 1UCBH 4YQXL 4PJ7F 1QQDB 4DQOH 4YHZL 2OMNA 4PJ5E 3H42L 2ORBH 2UUDH 5IHBA 2CKBL 3WFEL 2X44D 3QDAA 5F89A 5EZJB 3NFPA 1HQ4B 4OD1H 4Y88A 2XQYG 4Q6IB 1UH3A 4HULB 3IXAA 2IALB 5JIPA 3DGGB 1U8OB 2YN5A 2OTUB 5A2LH 1BQHA 5BZDA 1VDGA 2VXQH 3NIFF 1R3HA 5KSBE 3JWNC 5E95B 5E8PA 1KCLA 1JGVH 5DJAA 3MOAL 1FGNL 1WZ1L 4IJ3C 3EFFB 1NCBH 1UZ6F 1B0WA 4NJAH 3LKSA 3MO1B 1BVLB 4HSQA 1K3IA 1YN6B 1Q0YL 4ZFFB 1T0NA 3Q6GL 2VYRE 3B9KC 3FO1A 3T0AA 2HN7A 2BSTB 4JKPH 3SKJH 3O3BA 4GMSL 2WBJA 3NFNB 3PWVB 2QL1A 2R1YB 3C6LB 43CAB 3GSXB 2VMFA 3DURB 2F8OA 5JZ7C 4G8GB 4MX7A 1MRDL 2B1AL 2XWTA 3R0MA 5DK0A 1JYXA 4XNMB 4PJCB 1Y18B 4OCRH 4ZOAA 3QDJE 1F4AA 3KXFB 3KR3L 3GKZA 3FO0L 4PLKC 4OJFL 5CEXB 4KROB 4UILH 2PXYA 4WWKB 3UZVB 3MCLH 3QEHA 5EBWA 5GISH 1X44A 3A0OA 3Q2CA 5SWZD 1NGYA 3UROR 1CFVH 4P4KA 5BVPH 2JJTC 5I1AA 5C1MB 1I3GH 5TE7L 1D9KB 5DFWH 2CDGB 3FHQA 2G75B 4U2ZA 4PGEB 1NGQH 1X5GA 3QULB 3BKJL 4XC3H 2AV7B 4RX4D 3VH8A 5EU6E 3CFCL 4M9PA 1ZS8B 2CK2A 3SGJC 3UDWA 3RX5A 3WFBH 3AB0B 3ILPB 5ANME 1JUFB 3VXSD 4UT6H 5IVOA 1F8TL 2MMXA 1LP9A 2EDFA 3D87B 1YECH 4QWWD 5JOFB 1YEKL 12E8L 1KLUA 4HEPG 2BVQB 1NBYB 2Y6SD 3SKUD 2BHUA 4MLIA 5HDQL 3GGWB 1HHIB 2R2HA 4CBPA 4Y5YB 1MJJA 4JZJB 4PRBB 5FK9A 1F4YL 4CU7A 4L9LA 5KS9F 1S7SB 3GMLA 3KPQB 5J89A 5L2JA 3VI4F 4NCC1 2VERN 3VXUE 1NEZG 4R7DB 3X14A 2UWEE 3MBEB 4FQXA 4O2CA 3VCLB 5E6IA 5T1KA 3GJFA 5IB3B 3B5HA 3P4OB 3ARPA 3CJJA 2QKIA 1KIPB 4F15C 2Y06H 5FGRA 5IFJA 5GS2D 4AH2A 5E2VL 3IDMB 1W8NA 2DQEH 1MCKA 1DSFL 2NCMA 1F4XL 2ESVE 4OGXH 3SQOH 5AWNH 5EBMA 1KCSH 1FL6B 4N0YH 5T3ZD 2BZDA 3VWKD 1NBVL 2XNAB 4MA7H 4HAFA 3RY4A 5BXFB 3U7YL 4XCYA 4YDLB 1FFPA 3HCVB 5IHUH 5CD3A 6CGTA 1ITBB 2FJGB 2WK2A 4H5SB 5I17B 4FQ2L 4JB9L 4K71B 4MHHG 4OLYL 3DRQA 5JNYB 2PYFA 5GGTH 4JRYB 3FB6B 3V4VL 5C6TL 3BRGC 4WUKH 5J12B 2ICEA 4WHDA 5IW3A 3BZEB 4J3TA 4K7FB 4NO3A 3WIHH 1JRHI 2EC8A 1TTFA 2MPAL 2HVKB 3WNLA 1BF2A 5SX4H 2GFBB 3QH3A 4NKQB 2VQ1B 3VD5A 3R8BB 4OGYH 1JGUH 2BSED 1G0YR 1J88A 2X89D 1S7WA 4XPBH 1PY4A 1GAFL 3MA7A 4Y2DC 2AXFB 1F3DJ 1CQKA 1ONQA 2MHAA 4LSTL 3QRGH 3B6SA 1MQ8A 2EYRB 1HQRB 1T3FB 3RVTC 4UNUA 4Y2OA 3V6ZB 2HJLB 4CNIA 5DUPL 4NPYA 1A7NH 4ZO9A 1FVDB 1N6VA 1OSZB 5B8CA 4R7NA 1FZJA 3W11C 3D39B 3L3DA 1Z2KA 3DLQR 1P9MA 3GSWB 2RHEA 3GDBA 4N68A 3RBGA 3PWPA 1M6OB 4UDTA 4GG6F 2YPLB 3HC4L 1R5IA 2HA1A 4ENEC 5GIRB 3OKNB 1FRGH 1NAMH 4XAWL 4JFOB 4ODXB 3AS0A 4LLVB 3RL1A 1XGRA 4ZO8A 1NLBL 3ISWA 3RGVD 1T7ZA 4H0IA 1U93A 2NY3C 1DBBL 2EH7L 3F62A 2PKDA 1GYAA 3CFEB 4OM1L 3RIAF 5KJRL 5ID1A 4ZSOE 1Z0NA 4NQTA 2JCCE 4Z7OF 1LNUA 4OD3L 2A74A 1MAMH 3MV8B 1IKFH 1FE8L 2QQLH 4XAKD 3ULVE 3QR2A 4LSPL 4C56A 3HZYB 3B9DA 5ENWA 2DQFB 2H32H 4Y19B 1RZJL 3HNVH 2IJ0C 3AAZA 5KSUA 5GSRA 3D0VA 2YD4A 4DEPB 1BFVH 5HD8C 3GI8H 4U2YA 3ILQC 1HHJA 4HIEA 1CCZA 5T3ZH 2IQAA 3LRHA 3QHZH 5M7QA 3MLXH 3AS1A 5IKCB 4Y2DA 5I71B 4E41A 1AR1D 3UTSA 2W9DL 1S5HA 2EDKA 4NKMB 3D9AH 4YHIB 2JB6B 3C6LD 5C0DB 5FUCC 1EMTL 1X5ZA 4M7JL 1AIFA 4G8GD 3WKML 3MRPA 4C83B 1QEWA 1G6RH 1F13A 3EYQD 3H2WA 3I6LE 5TDPB 3T0EA 2C1PA 2Y36L 2QV2A 3DARA 3N85H 3QB7C 4B41A 4AL8H 4NQVA 5DUBA 4IRZH 4G6MH 3KXFD 2CSPA 3P4NA 4GKZA 3ZDYF 3TT3L 4KROD 3OR7B 2V5TA 4WWKD 4EBQH 1IAOB 5KG9B 4U1GC 3ULSB 2XYCA 5GS3A 4RMTA 2AXHA 3NACH 3KGRA 4HS6B 1CE1H 4HJ0D 4NKIH 3DIFA 5I8OL 2VXSL 1D9KD 1JHLH 4BFEA 2I9LB 4KI5D 4M1GL 4RMWA 2QHRL 3UAJC 1FNFA 5TGBB 3PNWB 1J0IA 1S8DB 2A77L 3CFDA 5EC2A 3FQRA 1S7QB 3WFZA 5A40E 4EDXA 1HILA 3BGFB 4CDHA 4M1CD 2WV3A 2NTFB 3S88L 4GFTB 1JWUA 2CXGA 5DMKA 3WO3B 3FRPA 4P5TA 4KI1A 2X4RB 3R0NA 4M6NH 1RY7B 2ADFH 4MS8D 1ORSB 2CUHA 2CR6A 2W9LA 3IDNB 3FB7A 1A14H 4KTYA 5I19H 3KNBB 1VPOH 5KVMC 3JTSA 1D5ZA 2F15A 1IC5H 2J1KA 5GGRA 1R3LA 3P73B 2ATPB 4D8PA 3CVHA 2ARJB 2R2EA 4X8JA 5J11C 4U1KA 3WNNA 2AXGA 1ED3B 4E42B 2V5MA 2I60H 3CVIL 3MBED 1VFAA 5HHQB 3V6OE 1GC1H 2FYYA 1KJ3L 2R2BA 2E7LA 1JP5A 2ITDA 4M7ZC 1QFUH 5DFVC 1FNGB 1XF4B 3TNNA 2H6PB 3PWJB 4OCNC 1IAIM 5T5NG 3MODH 3PWNA 4F3FA 1F11A 1IQWL 1H3PL 3WLWD 4OI9A 3PGCA 3MJ7A 1UXWB 1FZKA 2FB4H 3VMPA 2CLZA 5GQBA 1SBSH 4NZTL 1INEH 2VE6B 3PWLB 2AJ3B 1JWSB 3QUYB 3S6CA 4WW2B 2LV4A 2WUCH 4IIQA 4Z7VF 5ICYB 4WO4C 3DRTB 2NLJB 4WJ5A 3TPKA 4M6OH 4MAYC 5IM7A 2VDLL 2NZ9C 5HGBA 4ZDHA 3TBWA 4LOUD 2VZUA 2JLLA 4XWGL 1V3KA 3JV6A 2BVYA 4JRYD 2MFNA 3KDMB 2ATKB 2CKBA 5F7HA 5HHOB 5EUOB 4P9MH 2GYSA 5GGQH 4KTDH 4YNYA 3WCYA 4GQPH 3G6JF 1CK0H 3IS0X 3ROOA 1RMFL 4XBEH 3ULUH 3P0VL 3NN8A 3CH1B 1OSPH 3P30H 1HI6A 2GTWB 4AENB 3KS0H 3S3SA 5M94B 1RUKH 3HC3H 1UXSA 3NIDF 5IWLA 4P2QE 4C4KO 2BRQA 2NW3B 5L88H 3MUJA 5DQ9A 3ZTNL 5EO0A 1UH4A 3CLFH 1OAZL 5DA0B 4MA8L 2GIYA 3VG0H 1F2QA 3EOTL 2Q87A 4H88L 1OB1B 5DO2D 1Q72L 2ITCA 3UTTB 5F21B 4NHUA 1ZE3C 2NY5C 5DD3H 4YXKL 1MFEL 5CEZE 4ZPVA 4Q74A 3D39D 3VD9A 4PBXA 2YPLD 3U0TA 2X1PA 4HS8L 3SY0B 5KBNC 1FFQA 3QIWC 3SPVA 3WNOA 4OGAC 1BQLL 5DEZA 2W1NA 3CGTA 4QOKA 4EI5A 2VIRA 2VLLB 4KHXH 2FL5A 4XI5C 5GRWA 5IW1A 1QRNB 3K74B 5TF1H 3B5GA 4MJIE 1IAII 4LASH 3U36A 3JTTB 3LKPB 1RZIA 4PJHB 5I1DB 3BWAB 1G84A 1S7XB 4RBPK 1MHCB 1QR1A 3T4YB 2VNCA 4WO4A 5I15L 5K93A 4MB4A 2DKMA 4WTXA 3T3PE 1LP9F 2VLME 1YMHB 4FQCH 1I1FB 1JRHL 3MV8D 4HPYH 1KT2A 3TJEL 5BQ7B 3EO9L 1QBML 4Y19D 3S36H 2R1WB 4J6RH 1MF2L 4W4OA 3IU4L 4NP4H 1WV7T 2IANA 3HG1B 5D7KE 1HSAB 2IGFL 5JW4R 5FYLH 5HBBA 1IKNA 1F58H 2XA3A 4JZNA 3WJJA 3P4MA 3RIAK 3GBML 5I1KH 4ZS7H 5CILH 1MQKL 1J1XL 3Q5OA 1CGUA 2YC1B 4MJ4A 2JIXA 3HZMA 1JPFA 3I3DA 2A6JB 3AXLB 4I2XA 1MSPA 4Y4KC 3D85A 2ADGA 3NCJH 4PJGA 4QHKJ 2HT4C 3RGVC 1ZVSA 1NJ9B 2X9YA 5EN2B 3GNMH 4I3RL 3F12A 3ZKNC 4HHAA 3QO1B 3IT8D 4LNRA 5C8JB 1CS6A 3QIWA 4UQ2B 1T04B 3P77B 2V2XA 1ODAA 2C3XA 3U4EA 5CP3H 4BSWB 1MJUH 3VWJC 2FD6H 2VDMH 3IJSA 4BK4A 3TF7C 1P7KB 3OJDB 2UYLB 2P8LA 4Z6AT 5C09E 2N4IA 5D1QB 5C07E 3RVVD 3QG7H 3MV9A 4NQCE 3C5JA 2Z35A 4KQ4L 4OZIE 2DLHA 5DRXB 4Z7WB 3HUJF 3PV6B 1G9ML 4D0BB 1MREH 3VXMA 1A7QH 4JPIA 3CU1A 4MD0B 1R5VB 4PTTB 3AC0A 1CVRA 4G8FA 2XG4A 3QP3A 5IVNA 1DQLL 5T3XD 1U8LA 3L5XL 5E00A 3MUGA 2FHCA 8CGTA 1D6VH 5GJTL 4ELMA 5IBUB 4FABL 5TH2B 3VGAB 5ITBL 1MVFA 1A1OB 2RJMA 5T1LB 3X3FH 1PD6A 1NFIB 3GBNL 1UKQA 3VXRA 1HSBB 4R90L 5I30H 3ULVL 3JZ7A 3OHXA 1RK1A 5I74B 5TE6H 3C9NA 4GXVH 4GAYB 4CKVX 1XR8B 2J6EL 2OLDA 3FL7A 1MCPL 4NUGL 3QDGA 1J8HB 3BZFA 5GRUH 2CDFA 4LARH 1QA9B 3R1GL 4YDVA 1X5IA 4HAGA 3QUXC 3MUZ1 3T2NH 2EDLA 4NWTH 1CFSA 2DQHL 4YFLF 4XPTL 4RGNE 4IS6B 5IVXA 3W5NA 4M1CC 3O6FB 2QSQA 1IEHA 5TDOB 1AGCA 3ZDZE 4WGWB 5CSZA 1EZVY 2VLKA 1AC6A 1A3RL 3QUYD 4PRDA 1J9CT 2P8MA 2EZ0C 1A7PL 3UYRL 4IDJH 1HKLH 3RWIB 4YHLH 4AQ1B 4JG0H 1GCFA 1TVHB 2ZCLL 1AI1L 1M7IA 1IAKB 4I3SL 3H7BA 5HHOD 2VAAA 4LHUB 1B0RB 3HN3A 2AK4A 4UTAL 1DBAH 2FX9H 3QHTC 5KANI 5J6HA 4O2EA 3MRRB 2FLRT 3HI5H 2AJUH 3WS6C 5GS1B 1S9XB 5JW3L 4ZPTA 3MPCA 3MJ8A 5D2NC 3L3OB 1CTOA 2Z92A 1YMMA 4N1CA 2JF1A 3QDMA 2R8SL 3C5SA 2R0WL 2WIIB 3O2DH 4PTUA 3LEYL 4FQQA 2IAMA 4JAMA 4PV8A 4YGVA 1GHFH 2PO6B 4JY5H 4DW2L 3F6IA 4QRQA 5C0AB 1K2DA 3OAYK 4P3CH 3S36X 4LCYB 2XFXB 1N2RA 5HHVL 4K3EH 2HKHL 2R69H 1BFOB 3OPZL 5LBSH 4TSAH 4J8RB 3UTTD 4XPFH 2Z93A 3ZHLA 1EVUA 4JANB 4XX1E 1T1XB 4UBDD 3S98A 1DDHB 5IB4A 4O2FB 3W0WB 3THMH 5GZNC 5F7NC 3ZMRA 3WO4C 4LMQE 2X4NA 1DQMH 2J12B 1RZFL 4O51B 4RAVB 3HS0B 4PRHE 3HLAB 3TA3D 1NDGB 2EYSB 4LOUC 1C16B 4JFQA 5EZIH 2YRZA 4LBEA 3B2UD 2ERJC 5E08L 1QRND 1ZA3B 4CGTA 1A9BA 4ODTL 5C0CA 1N8ZB 1OTSD 3RWFB 2EH8L 2EXWD 3DI3B 4ZD3L 5IGXL 4YZFE 5IEHA 1BIIA 4MXWL 1MUJA 1MH5A 4HKZB 5DJYB 1QHOA 1TPXC 4XBPA 5F9AC 1ZT1A 5ALBH 3S7GA 4F7MB 3QNXB 3HNSH 4G9FB 5E2UH 5SWZE 4DZBB 2WUBH 4HX1B 3RUGB 3TH3T 3S5LA 4RFNB 2A9NL 4O4YH 5LVEA 3WYRA 4W6XB 4KWUA 4OAWA 1BREA 3MJ9H 1WQVT 3HG1D 2F5AH 4MJ2A 3IF1A 1MELA 3TCXA 2C1OB 2C3GA 4LMQI 4EKXA 4X0KB 4E5XA 3A67L 3TIDB 4X4YB 4XVSL 3MRCA 4Z9KB 6FABH 4Z95H 1EJ6A 1XR9B 1I9IH 1FORH 1UA6H 3QUMB 3D2UA 2VKWA 3GMRB 4K7PY 5JW5A 4XGZA 4ODHL 1HHHA 4G80A 5HPMB 3SDCA 2XQBL 4P2OB 3UJTL 4PJ5A 1MY7A 3G6DH 3AREB 5F3BB 4R4FH 3ZLQC 5CEYB 4LCUB 4N8VB 4GRWF 1RHFA 3WXVL 3LS5L 3BP6B 3OKEB 4PJAE 2XKNA 4Y16C 1AFVL 5JXED 5SX4I 2HT2C 4KAQL 3EYFA 4OZHB 5HXMA 4R4ND 3CSYB 5KSBA 4OCYL 1MHEB 3PL6A 4NN6B 4ODSH 2N7AA 3GJFK 1AD0A 3UP1A 2B0SL 1HINH 3L1OH 1AH1A 2Z91B 5FF6B 4NFBA 5A16B 5D1QD 1K4CB 3ARBA 5C2BH 2AXJA 5CLTA 5E4EC 5DYOA 4WNQB 4CW1A 3AU1B 5CEZL 3SDAA 5HDBF 1YEIH 2W07A 3BD4A 4AIOA 4R8WL 4NT6B 4RQQA 2D7QA 4AEIL 5FB8B 2AJXH 2VITB 4YHKL 3K2UL 4TULL 5E5MA 4N0CC 3SGDH 3WXWH 1LWRA 5E7FA 3LN5A 2FO4B 3QDJA 3DROA 2IH3B 1NC2B 1VKXB 4NM8H 3RI5F 3HMXL 5E9DB 1PY9A 4YHYB 2J2ZA 3SDDA 1OAKH 2PW1A 3O3AA 4MWFA 4U7SA 2W65A 5T1LD 4GMTH 5HI4D 2K1MA 1ZV5A 4M3KB 2VISA 1XGQB 1BM3L 4I77H 3FCTB 4K9EH 3VFRA 3MNVA 4Y5VC 1CZ8H 4HCRH 3X12A 1L9MA 1J8HD 4QCIA 4MQ7A 4ISVB 5BRZB 4MXQC 1QVOB 1FC1A 4Y16A 3P3YA 5HGGS 1CFTA 1GZPA 3W5MA 3MROA 2DQUL 1JHTB 1S5IH 5EU6A 1AHWB 5FO7B 5ANMA 1MIEL 1T5WA 1G7MA 4PIRF 4JHZA 2XZAH 1BOGB 5DZLA 4H1LA 4BH8B 3O6FD 3GM0A 2NY0B 1YYLH 3G04A 5JUEL 4F7TA 3VFUA 3REVA 5D7IE 1FP5A 3MQIA 2DLFL 4HIHA 1J05B 4YUEH 4M6AA 1ZLWK 1AGDA 1U6AL 3W39A 1EPFA 3N0PB 4L4TB 1IBGL 4JPKH 3DO7B 1O0VA 5B4MD 4P23C 1UCBL 3WE6A 1F3RB 4JN2A 4LHUD 1AE6H 3VXUA 3OR6A 2Q3ZA 5D2LB 3HA0A 2UWEA 4LPCA 3B2VH 1D6EA 4LF3A 3TH2T 2HLAB 4OD1L 4HWBL 2V9RA 3DMMC 2IPTH 3X13A 4NO5B 4PJGF 5EPMA 2QSCH 1H3XA 2YD6A 5DSCA 4JKLA 2JELH 3V95A 3T77A 2VXQL 2PO6D 3SOBH 4LSSH 5C0AD 1JWMA 4X6CA 5HYSG 3NZHH 5HI3C 2HTLD 4UQ3B 4GAGH 4F7EB 3GKWH 1JGVL 2NW2A 1KJVB 3BD5A 5IB1B 2MKWA 4HJJH 1NCBL 4NJAL 2A6KB 1CGWA 4YIQB 1X3DA 2XTJC 2A6DB 4V1DB 1BEYH 2SEBA 5B39B 5JMRA 1ZHBA 4FZ8H 5HY9A 1A6VH 1T7VA 4JKPL 3SKJL 5ACZB 3I2CH 5LGKA 4POZD 1EEZB 4JPWH 1SJHA 1IGYB 5ESQB 4U1LA 5T1MB 4R2GB 4HH9A 2OXHA 4HFUL 4LCWB 5DHYA 1Z3GL 2ED8A 3NA4A 3ULVC 4G8GE 2QJDA 1BBDH 2J8UF 3F7YA 4KV5F 4ZUUB 5DQJB 5EU5A 2DQIH 4JKMA 2D3VA 3KYOB 5K9OB 3LV3B 4HT1H 1G7HA 5JPNA 1BQHG 3I02A 1IGJA 3QEUA 1ZWIA 3KXFE 4OCRL 2V2TA 4NRXB 2ADJB 4GG8A 1S7UB 4NN5C 4MD4A 4LPUA 1I9EA 3OMZA 5C0IB 5D5ME 4DCQA 1JE6A 4UILL 3MLPA 3ULUE 2DS4A 4MCYB 2V9QA 4RRPA 5GISL 4G9FD 5FV2A 3GMNA 3TBTB 3BH9B 1P2CA 1T1WB 4Z7UA 3KPMB 5IMOB 4JFDE 4OB5H 1CFVL 2NNAA 1G7LA 4GXUN 5BVPL 5HYSB 3VFNA 1I3GL 5I1LB 2P47B 5A1AA 1NGQL 1DTUA 1K5NA 3DUSA 3VXQB 3GSRB 4XC3L 1CGTA 3DVIA 1WAAE 2XN9D 1CFQB 1RUMH 2XG5A 3WFBL 2AP2A 3MRDB 4S1SH 4UT6L 4X98A 4TNVK 4LKCA 3MMEB 4HG4J 1UZ8A 4F37K 3VFGL 1WWCA 5DWUH 4DUVA 3TA3C 4RNRA 1KJ2H 4KJQD 5JORB 2OR8A 5IEKB 4P2OD 3ARED 4K3HA 3U6RA 4ZSOA 3LEXB 2MKLC 4L1HA 4NQEB 1EAPA 1U8JB 1JGDA 3KG5A 2YRPA 2P48B 1PDKA 3GRWH 1UYWH 1Q9KA 1LK3H 5JDJA 3H0TB 5K9JL 2P5WE 1ZOXA 2J6EA 3KPOB 3BPOB 3JV4A 2ZSWB 3UBXB 1GJIA 1CLOH 1J8KA 1FN4B 3MLSH 5MEQA 4YC2C 3PQYB 4D0CA 3VH8G 1OP5H 1J5OH 2ZG3A 3MRLA 1NMAH 5DT1H 3CXHJ 3BGMA 2Q7NA 3U4BH 4LCCB 4RCAA 3LCYA 2YPKB 5IROA 3RVWC 4W70A 4PP1D 2X2YA 1LDPH 2DQEL 3HHRB 3FQNB 4PP2A 4OGXL 4HKBA 3SQOL 2NY6D 2M8XA 1CLZH 5AWNL 3TBSA 1JPGA 1KCSL 4PJCF 2EDQA 2XT1B 3LH2H 5FYLE 3T65A 4OV5A 5E5UB 4PY8J 4X4ZA 3TM6A 1HH6B 4NSKB 4MA7L 3L7FA 5DTFB 3V5HA 2E9IA 1I3RA 3OXRA 5IHUL 3FOMB 1A5FH 1JZ3A 1DUZA 4QYOA 5GGTL 2H41A 1NC2D 5E9DD 4TUJA 1RIUH 1TJIL 2FGWH 3TIEB 4LRIC 5LQBH 1QSFE 3QXVA 2GJ6E 3WIHL 3KLDA 5EOCH 3HRZB 2FR4A 2KZ1B 4L1DA 4Z76B 3UYOD 4Y4FA 4OGYL 3O3EB 1JGUL 5CAYB 4XPBL 1T66D 1I3UA 4TPRH 3H9ZA 5BRZD 4PJFF 3QRGL 1JPTH 5ILTH 5D1QC 1IGCH 2BMKB 2I25N 1FYTB 5JW4M 4K8RD 5I76A 3LZFH 3L95A 1EH9A 2YZ1A 5EBLB 1NLDH 3LIZH 4R0LB 5C0BB 3RNKB 4G42B 1PKOA 4KJPD 4L29B 4EUPB 5MHSD 1F00I 4D3CH 2NY0D 5BOPA 1IGTB 1X4XA 4QRPE 2YPLE 4PR5B 5J3HC 1OHQA 3MRBA 1W0VB 1FG2A 3MRJA 3HAEB 4M1DH 1NAML 5L8KB 1RAMA 2B8OT 2QSTA 2R0KH 4ZFZA 4L4TD 1DQJA 2O5YH 4OV6F 8FABA 2PTVA 3V79C 3R8QA 1QO3B 1FVEA 3IDGA 4WCYH 1MJ8H 2IBGA 3V6OA 3GMOB 4XZUB 3EDDA 5JPMB 1A9EA 3I85A 5LWYH 3TYFB 3MV8E 4KRMB 3GMMA 4Y89A 5IVZB 2A6IB 5HYJB 3T4AB 5EU7C 1IKFL 2QQLL 3VGDA 4P3DA 4Y19E 4B0MM 1S9VB 2JJWA 4PJBA 5D6CB 4HUXA 3BP7B 5I73C 3HNVL 3VGEA 2A73A 4LFHG 5K59E 1BFVL 3GI8L 1N0LA 1DL7H 3NABH 3T08A 5T3ZL 3QHZL 5KSBF 4V1DD 4YO0B 3MLXL 4LLAA 5IHLB 4PV9A 3LB6D 3T0XA 3MLRH 4X9BA 2VN7A 4WTWA 4R2GD 3D9AL 4LCWD 4HUMB 3O4LA 4YR6A 3TO2B 4R3SA 5IR1B 4ZUSB 2XV6B 4W68A 4M61A 4K7PH 1FNEB 2Z0BA 3NCCB 3G5VB 1G6RL 2CH8A 5DS8B 3AMKA 2Q86A 4IRJC 3N85L 3GSUA 1FJ1B 4AL8L 1DLHA 3DVGA 4IRZL 4G6ML 5L2KE 2R1XB 3OKDA 1A6TB 4P2QA 1I4FB 5GPRA 4EBQL 3EGSB 3WN5A 1D5BA 4U1NA 2DL2A 3BJ91 3BP4B 4CN4A 3EDEA 1AGEA 3T09A 3NACL 4K8RH 3DX7B 3RTQC 3KPRA 3MV7E 4J4PA 4NKIL 4N0FB 4PJXB 1TMCB 3ABZA 3HE6B 1JHLL 1G7JB 3C60B 3BEVB 5C0FA 1LO2H 3IGAB 2DM3A 2V17H 5HGHA 5DJ6B 4K94C 1ND0B 2X41A 7CGTA 4POZC 4X80H 1H3WM 2F19H 3QXDB 4QTHA 4NNXB 2CJUH 2WMPA 1CG9B 5TPWH 4Z77A 3GMQA 3KPSB 4MJIA 1LE5A 3Q5TA 3O9WB 4F2MB 4M6NL 3HMXA 1J7VR 2ADFL 2IFGA 4GOSA 3V4PH 1FBIH 4NUJB 1ZLUH 2YS4A 2VDNH 1A14L 4MNQE 4NQED 4WI5A 2P42B 5I19L 1VPOL 2FHBA 2ZSVB 1IC5L 3JUYA 3KLAB 5F9JB 3IS1X 4N0UB 5DMYA 4CJ1A 1RJCA 1N59A 5DK2A 1UT9A 3N1GC 5B38A 2I60L 4L8CA 1GGBH 5KVEH 1GC1L 3EJZD 4HGWA 2NYYC 3PQYD 4RFNC 1QFUL 2R29H 5A2JH 1KPVA 3MODL 4YAQB 3FRPG 3FO9A 5BW7A 3O11A 4IBLT 5I2IA 3MGTA 2G5BA 4ZXBB 4BZ1H 5CJ8A 5MI0C 4J3OC 5C9KA 4XP4L 2X4UA 4YXHH 4N8CH 4DKEL 1SBSL 4HKJB 1TDQA 1R24A 4HMEA 1AGFA 3G9AB 2NY2D 2ZUQB 1FAKT 3P9LB 2WUCL 4M6OL 4QGTA 2DN7A 5E1AB 1AC0A 5C0GA 5EUOE 1VCAA 3M07A 5BO1H 1MCHA 3U0PB 1A6AB 4P9ML 2XACC 1SEBB 5GGQL 4KTDL 2GTZA 2V5SA 3QXTA 4RGNC 3N9GL 1CK0L 1EEYA 3LKNA 2G2RB 4NZJA 3ULUL 3BQUB 5LAXB 3RHWF 1OSPL 3NMEA 3P30L 4AG4H 4DZ8B 4PREB 1DQQB 3N1FC 3NGBB 3RAJH 5D1ZC 4HFWB 1RUKL 3HC3L 4M9OA 1R3JB 1RJLB 1FYHB 5C09A 5C07A 3DJ9A 4PGCB 5L88L 4NQCA 2QADC 5F72S 3TJHC 4LDLB 3CLFL 4QHUB 5CGYC 3ELAT 1MI5A 4I5BA 1FYTD 3VG0L 1ETZA 4WU7B 5I18H 2CIKB 5IJKA 2NY6C 5C0BD 5DD3L 4LLYB 1U8NA 1N5AA 2KDGA 4JGMA 4TOYH 1U8PB 5KOVC 1HYRC 2C5DC 2H8PA 4RMQA 2P5EB 4JFZH 2AQ1A 4WY7H 2HLFC 3TYGH 5CIPB 1O7VA 4IOIA 4FMKA 2YD9A 2FEDC 1QRNE 4QRTB 5HGAB 1F02I 4KHXL 5IW6A 4YHYC 1XAUA 4HUUB 4K7PX 3DX9B 3RWDA 4LASL 5I8KH 1UACH 3W2DH 2EKSB 2H3NA 3LSOB 1QFWH 3PGDB 5ID0B 5EO1B 1H15A 5ESAB 4FQCL 3ZL4H 5HYJD 1UWXK 4LLMA 1UB6B 1A1NB 3HNTH 4HPYL 3STZB 2AJZB 3VXTB 3LQAL 3CLEH 4BZ2H 2XI9A 1XGUA 5F9WC 3S36L 4JREC 4DGVH 4I0PB 5D71L 5FA4B 2JCCF 4MGXA 1NCNA 1HHGA 1H5BA 4U1JA 3HG1E 4NP4L 4M4PA 3ULVF 2I07B 5DUMH 1FV1A 2J88H 4KJPC 5FYLL 1KB9J 2ZUSA 1GVIA 1KUMA 1F58L 1TZIA 3O2VH 1MFCH 1WCBA 2WP3T 5AD0B 5BZWA 2A0LD 5I1KL 4ZS7L 5I9QC 5CILL 5HI5D 4F9PC 4JRXE 3O2WH 1MCRA 5CJXA 1E28A 2Q76B 3SGDI 2HMID 3RWJA 5C2UB 3NCJL 1RVFH 1B0GB 3IXTB 2AJVH 2OL3H 3BDXA 3W9DB 2OI9C 4HF5H 3GNML 3L3GB 2Y9RT 5FDWA 1QSEE 5F7DA 1LK2A 5FKAA 2EDTA 2HT3C 3SKOA 3OGOE 4FTVB 3B83A 2WLYA 3FKUS 5J0BA 1KTLB 3GB7A 3TO4C 4P46B 5F7EH 4JLRB 2D2OA 4WHTB 3VE0A 2X4PA 1GSMA 2EE6A 4D9QE 3LHPH 4PJDE 4X7TB 1MJUL 4PS4L 2HTKD 1RK0B 1NFDB 2FD6L 2VDML 3FT2B 3OBAA 3EYUH 3AY4C 4L8SA 1EV2E 3IDXH 4ZS6D 2PCPA 3HE6D 5KAQG 3V0WH 4EUPH 3P9MB 1WTGT 2VSCA 3QG7L 4P2CG 4Z7WE 1DVFB 3C60D 4U1SA 4PRPE 2QEJA 3F7PC 4N9GB 3UTPD 5BS0E 3ESUF 3CDGA 3NFSH 1TQBC 4PJHF 4RMRA 3PHSA 3HAEH 1MREL 4HMDA 4YEEA 1A7QL 4FXKB 3ARDC 3S3PA 3FB8B 4NWUH 3T3ME 4YHOH 4OF8A 3KPSD 3O9WD 3IVKB 1T7XA 1JGLH 5GGTA 3RVUD 1D6VL 3VXNB 2P8PB 3QIBB 4FHBD 1JGEB 3WEXB 3C5ZC 1LO4H 3HR5A 3WIHA 3X3FL 3BHBB 4M93C 2J5LC 1I7UA 1KIRB 2FJHA 4QHMA 2ZOLB 5SWZA 5I30L 5TE6L 3I6KA 4GXVL 3QQNA 4H26A 5INCB 5IHZA 1J8HE 2O5XH 2PTTB 4HD9A 3T0BA 5GRUL 4LARL 1Q8MA 1YDPB 2EEAA 4RX4A 1TCRB 5CUSH 3WHXB 2P46B 1YYML 1M4KA 3VXSA 4DVRH 1U3ZA 3T2NL 4NWTL 1IM3B 4JVPA 5ICZB 1EGJH 1QSVA 4ZXBD 5ICXA 4HXBH 3CFJA 3BAEH 2YD8A 4KRNA 3QI9B 4OUUB 4OFYD 3TNMB 5E6ZA 1WUNT 4TYUA 1HDMA 1ZGLA 1NAMA 4IDJL 1HKLL 3WIFA 4YHLL 2IPUG 1OTUD 5DLML 1JHKL 1EBPA 4PJAA 4HZLA 4FXGB 3TWCH 3V7MA 2BY2A 1A7RL 2C3VA 3MSPA 3SBWC 2GCYA 4KKBD 1GGYA 2XXMB 3STLB 3PGFH 1DBAL 2FX9L 3PHOB 2Z31B 1U8MB 1OF2B 3HI5L 2AJUL 4RSVA 4FNLL 3BPOC 4X6DB 3BQUD 2MJWA 3VFTB 1X9QA 2H32A 5I75C 3PV7A 3O2DL 5CSBA 4AJ0A 4Y0GA 5DJZA 1WZLA 1GHFL 1A1MA 2HP4A 4P5MA 4JY5L 4APQB 1UQSB 2FZ3A 1I8IA 4LSDA 4YPGB 2M2DA 4X6BB 1LEGB 3N50A 4Z5RA 4K3EL 5F1NB 1V8HA 3VWKA 2R69L 5LBSL 5JDSB 4XPFL 3W0WE 1IEBB 2NY2C 5LGHL 3THML 2LTQB 2EIZB 3MR9A 4OLVH 4CVWA 2ZOKA 3DO3A 4JHAH 2P5ED 1EX0A 1IC1A 3FQUA 1DQML 2KPNA 3RA7L 5AAMA 1BZ9B 3VXOA 1YJDH 4OZGB 3QQ3B 1XF2A 5EZIL 4LSRH 1G6RA 1UH2A 2RGSA 3MLTA 1AQKH 4PJ8B 1GGCH 3BN9D 1T7YA 2LVEA 1RUAH 5D1XC 4OKVB 1Z6JT 1ZSDB 3OX8A 4JY6B 4X7EC 3X11A 1MVUB 1M1SA 5ACMA 3BPNB 3HNSL 1G7IB 1MHHB 4WU5A 5E2UL 3TPUB 3NIGE 4YK4B 1I75A 3RUGE 5HHNA 2WUBL 1C08A 4I0PD 4O4YL 2GSIA 5DI8A 4XCFH 3GSVB 5K9QI 1MLCB 3MJ9L 3IDIA 5J9PA 3MRMA 5EIQA 1JNHA 1MCSA 3FFCB 3MRNB 1RJYB 5D7IA 4ELKA 4NJ9H 5CD5C 4XMLH 1NFKA 3WV0A 4Z95L 1I9IL 2CLVB 1FORL 1UA6L 2GHWB 4WI3A 3MRIB 1QQDA 5DK3A 3SE8L 3ULUC 1A6WH 4PRAB 3R06B 4PJ7B 3G6DL 4JFFE 4R4FL 5EZJA 3I75A 1HQ4A 4NRYB 1MCIA 5I1IH 2IALA 3C08L 1T0MA 3DGGA 1U8OA 2Z9TA 2OTUA 5TJWK 1UENA 4FTVD 4WEBH 1BZ7B 2X1QA 4ZFOB 1MCNA 2ICCA 4P46D 2VDOH 3M17B 4LK4A 1QACA 2KQMA 4GSDL 1D5XB 4ODSL 4UU9B 4Z0XB 3O6MH 4KVNL 1HINL 3MO1A 1BVLA 3K4ZA 1YN6A 1HH9B 4HW6A 2O61A 2X42A 2BSTA 5FAAA 2CR3A 4CVXB 2WNGA 5MENB 4Q0XH 4NQDB 1DVFD 5C2BL 3OKMB 3CAFA 3PWVA 2R1YA 3C6LA 2F8XC 43CAA 2A0LC 4HKXB 3DURA 1YEIL 4J1UB 4G8GA 2UVFA 4KK5D 4KUCD 4RMVA 5FCUL 2AJXL 1FFNB 4OZIF 3EJYD 1Y18A 2FCBA 3VFWB 2AS5M 4M02A 3VXPB 3KXFA 5E9DE 3MCKB 3SKMB 3LQAC 2W38A 1PBYA 1UM5H 5CZVH 4NM8L 5E94B 3QIBD 4WWKA 1P4LB 1OAKL 5D5MA 2BNQB 4NC1C 1QFOA 5D8JL 4N9OB 4QRSB 3OGCB 4GMTL 3ZHKA 4DN4H 1AKJB 4U6TA 2GKIA 2YWZA 2DJUA 4I77L 3VFMB 1YY8A 1D9KA 5J1AB 2CDGA 4K9EL 2JJUA 4MVBD 4Q9CA 3CCHB 5BRZE 1CZ8L 4HCRL 5DJCB 1O7SA 3QULA 4YBHA 3VFPB 3R4DA 4F7PB 2AV7A 4YBQC 4KZDH 1ZS8A 3QJHB 3ILPA 4K3JL 1S5IL 3C60C 2V7NB 2JK5B 1WAAA 5GSVA 1ZTXH 5MHSE 1I1YB 4MCZA 2XZAL 5JOFA 3HRPA 2BVQA 1NBYA 3PABB 1YYLL 3QI9D 1A21A 2NXZC 4H8WH 4KKAD 3GGWA 1HHIA 4XMKL 4OBSA 2BXYA 5E8DH 2ZKHH 4LIQH 4Y5YA 3EYVB 4JZJA 4PRBA 4BZYA 1JZ6A 3RVUC 4YUEL 1YZZA 3ZKMD 3U79A 4HDIB 1AY1H 3BIAX 3KPQA 4JPKL 5EB9A 3MNWA 3SQBA 5KS9B 4ZOBA 1NGZB 3E6FB 2P5WA 3MBEA 5F6IB 2HWZH 3BKCL 5JIIA 1UKSA 1AE6L 2ZJSH 5ELIA 2Z31D 4PGJA 3FQXB 5IB3A 3B2VL 4X4ME 4IMKC 5F97E 5D7JB 1CT8B 1INQB 4CAGA 3GJEB 5DVKA 4U0QB 1KIPA 2IPTL 3UX9B 1L0YA 3MJGX 2QSCL 3RZCC 1BJ1J 2OJZH 4H1LG 2JELL 2AI0H 3IDMA 4C55A 2AEPH 4GQ9H 3SOBL 4LSSL 1T21B 4APQD 2PW2A 1WCQA 3NZHL 4GAGL 3GKWL 4R97C 2VLJB 1FL6A 1OT2A 1V3JA 1NGPH 4HJJL 4V1DE 2XNAA 2XZZA 4ZXBC 1TFHA 5BXFA 1JN6B 4WFGD 1BEYL 3RBSA 3LKRA 3HCVA 2R0ZH 1FVCB 4FZ8L 3TV3H 2FJGA 4H5SA 3QO0A 4UAOB 4LCWE 2ZUQC 4WW1B 5JNYA 4JPWL 5JQHC 4K07A 4H25B 3FB6A 5HHXH 4PJIF 1W0YT 1RZGB 2J4WH 3JUZA 4JDVA 3DPBA 1BBDL 2FLBT 4K7FA 3OJVC 2DQIL 3ARQA 3ARTA 2DQDH 2GJ6A 4PJ8D 5FECB 1IQDB 2GFBA 3HE7C 2QQNH 2VQ1A 5KSAB 5EWIH 3WHE0 4DK3A 4I18C 5H8DA 4X7DC 5I0DA 4IOFD 2AXFA 2EYRA 4WFHD 3TLRA 1HQRA 5CP3A 2GUOA 4PLJD 1T3FA 3V6ZA 2HJLA 4YZFF 3RVXC 4IHOB 1QBAA 2Y72A 3NCYP 1FVDA 1OSZA 1SM3H 1CGVA 3DSFH 1QFWM 2A9ML 4QRPA 4R96B 2YPLA 4JJHA 4PJ9B 4X9HA 3ME0A 1P5VA 2VDQH 3FFCD 2NMSA 5EU4B 4JFOA 3O0RH 4GG6B 4ODXA 1RUML 4LLVA 4S1SL 4OBRA 3VMOA 4N5ED 1UWGH 3F65A 1GIGH 2XWBB 5F96H 4TNWF 5DWUL 1B90A 3C8KB 3CFEA 1NCAH 1KJ2L 1OLLA 3HPJB 3IJHB 3NA9H 2DQJH 1LEKB 3V52L 3BN9C 4NQEE 2VH5H 1KIQB 3MV8A 1EXUB 4ZG1A 3BEWB 1DN2A 4L5FH 3HZYA 4ZUVA 3GRWL 1UYWL 4Y19A 2IADA 1LK3L 4LP5A 1J87A 4ETQB 4GKNB 3K0WA 4I3GA 2MTPA 1BWMA 1CLOL 4PJAF 3MLSL 1RZKC 5K9KB 4ESKA 4X6FB 3FZUC 1J5OL 1NMAL 3MLWH 3NCEB 4M43H 5DT1L 2X1XR 3BVNB 4U6YB 3U4BL 4XRCB 2HFFB 2B2XH 5MEND 5ADOH 5AEAA 4NQDD 4NKMA 2JB6A 4JJ5B 4K23L 1LDPL 2XIDA 5C0DA 3TP4A 5C9JB 3ARFC 3N1QC 2WWMD 1JI1A 1LEIB 3RL2B 1CLZL 1PJ9A 3BMVA 3LQZB 3LH2L 4UV4H 4C83A 2WW8A 4Y4HB 1D5IH 2VRAA 3RNQB 1S9WA 5IQ7H 1MCWM 5ISZB 3V6FB 2ED7A 2BOCB 5KVGH 1A5FL 5DJ2A 1MPAH 4XNZC 3JWDC 1XCQA 3S34H 3QPQD 5L2KA 1T83C 3OR7A 1RIUL 1IAOA 1QFWI 2BNQD 2FGWL 5LCVL 5KG9A 1TITA 3I6GB 5EC1B 1UVQB 3IFNH 5LQBL 4MA1C 5IMMB 2WQRA 1AKJD 4HS6A 5EOCL 4HGKC 3CMGA 3MXVH 3EYOB 3O2DA 3SDYH 1KEMH 1F4WH 3QA3B 3VDCA 5TGBA 3PNWA 1S8DA 3GSNH 4TPRL 1IL1B 1JPTL 1FYTE 1S7QA 5ILTL 2EE9A 2C7UB 1MOEA 2ICWI 1IGCL 2NTFA 3D69B 3W9EA 4JDZB 5DD6B 3LZFL 2N56A 5AUMB 3M1BB 2YSSB 1NLDL 2B4CH 4U0RC 4D3CL 1ORSA 3TFKD 4EIGB 4YFDB 3EJYC 3IDNA 2PYEB 3VJ6A 1IC7H 4KQ3H 1C1EH 3KNBA 4M1DL 4U7KA 3HC0B 5FA3A 2R0KL 3P73A 4OFVA 2ATPA 2UZIL 2ARJA 4LVOB 1WBXB 5A2IH 1ED3A 1CVSC 4XVTH 4E42A 4UINH 4KRPC 1EEQA 2EXYC 3MFFA 2H9GA 5HHQA 3JV0A 4WCYL 1KB9K 1E4JA 1MJ8L 5HYJE 5MP6H 5LWYL 5D7JD 2EDEA 3ZHDA 1XF4A 3ARWA 1M7XA 3PWJA 5GRJL 3LMJH 4KJWD 4OFDA 1GGTA 2D7NA 4WFEE 5ACLA 2YRLA 5BV7C 1UXWA 2YN3A 5EA0H 4X4XB 1ORQB 1OOAA 3MJ9A 1U8HB 4UNVA 2DDQL 2VE6A 2VLJD 3PWLA 2AJ3A 1JWSA 2K9UA 1MCLA 3QUYA 3VMNA 1RSFA 5FOBB 1DL7L 4WW2A 1LDSA 3D0LB 3NABL 5ICYA 3IFOB 1FL5A 3DRTA 2XY1A 1R3HB 3ZYJA 4MDJB 3E8UH 3MLRL 3VFOA 4M48H 3ZDXE 2C3HA 1RQ5A 2C4FU 4KKLD 2ATKA 1LMKA 5HHOA 5EUOA 1E4KA 3IDYB 4XBGB 3IETB 5F7WC 3CFKB 1ZANH 5FM5M 4K9EC 4K7PL 3MBXH 1K85A 1ZXQA 5CGTA 1NBZB 2NX5B 2HN7B 5IFAH 5C7XH 3O3BB 5J6GB 5DHVB 3G6JB 2GTWA 4AENA 2WBJB 5KSAD 2VZVA 3TH4T 3VD3A 1P4IH 4KK8D 4MNGB 4K2UH 1CICA 3SE3C 2W0KA 3CFBB 3KLHC 1OB1A 4FS0A 1BD2E 3UTTA 2L7UA 4K8RL 2F54B 4PJXE 3RZWA 3QWRD 4HC1H 2I27N 1UJTA 3ULUF 4GRLA 3UTPE 2ENYA 2CQVA 5DA4A 3B4NA 5C08E 1LO2L 4PJ9D 2V17L 3MV01 2VLLA 4LPXA 3SGEH 1ERNA 1QRNA 2F19L 4P4KB 4K3DH 4OFIA 2CJUL 4I0CC 1QSZA 3GM8A 3KPSE 2OS7A 3LD8C 5TPWL 4OM0H 4NCC2 3LKPA 5I1DA 3BWAA 1S7XA 2DLTA 2R9HD 2Q8AH 4DKFH 5DD1H 3TN0C 3MREB 4BSVA 1IC4H 2L4OA 3V4PL 1FBIL 4NQSB 1I1FA 3S35H 3B9AA 4TUKH 2VDNL 2R15A 5BQ7A 1X7QB 1LP9B 4Q9RH 4IJ3B 5GRVL 4S0TD 2VLRB 4JRWA 4ZTOH 2G60H 2DLIA 4HCRA 3B9KB 5KVEL 4YK4C 1VA9A 3HG1A 3O6KH 5CMAA 3WSQH 3BH8B 5FK9B 4E41E 3WLBB 1HSAA 1OAUL 2D7TH 2LFGA 1OQOA 1P6AB 2R29L 5CINH 3I9GH 4L8BB 3NAAH 2Y07H 3X14B 1NC4B 4FQXB 3UEZA 5E6IB 2A6JA 3AXLA 3SJVE 2G9HA 4BZ1L 1P7QB 4FFZH 4YXHL 4M8VA 4N8CL 3M45A 1NJ9A 3QEQB 5EN2A 4RISL 2CMRH 2FIRT 5JIHA 4GAFB 1JJUA 4Y4HD 4RMUA 3QO1A 5T1DH 5GHWH 2R39A 4ONOA 5C8JA 5ISZD 4UQ2A 3RJDA 5JXEA 1HYSD 1T04A 3P77A 5BO1L 2BOBB 3DHJA 4J12A 2C9AA 3C8DA 1PAMA 3MA9H 3BDYH 3NPSC 2CDEA 1MCBA 4N90E 3GUTB 4RWYH 4OFPA 4L4VE 1FFPB 2WP3O 5IMKA 4PJDA 1I85A 3OJDA 3DYOA 4AG4L 4OZFG 1T1ZA 2LE9A 3SGKA 3RAJL 1TQCC 1G9NH 3OAZK 4Z7WA 4X5XA 1XGPA 5DRXA 1C5DB 1DBMH 3PV6A 3QQ4A 5BS0A 4D0BA 3BIBX 1PG7H 2D0HA 4MD0A 1R5VA 3HUJB 3PWUB 1AO7B 3ZE0F 2WWMC 5I18L 4P2RE 1ZVHA 3BYTA 1CD1A 3CZFA 5SV4A 4TOYL 3MLVH 2X9WA 5TH2A 4JFZL 2PYED 5J06A 2XKUA 2D7OA 1KCVH 3QCVH 4WY7L 3TYGL 2YD3A 4CNIB 1WLHA 1A1OA 1K6QH 2GJJA 4EXPX 1U8IA 1Z0MA 3LKOB 3LQMA 5B8CB 1HSBA 2VUOA 3G6AB 1T89C 2BNUB 4UDTB 5I8KL 1UACL 3F58H 3V0VB 3W2DL 4GAYA 1XR8A 1QFWL 1J8HA 3BPLB 4I48B 4FP8L 1QA9A 5TDNB 3ZL4L 3HNTL 4YHNB 4OZFB 1YC8A 3CLEL 3T0WA 4BZ2L 4FG6C 4IS6A 5J8OA 1PZUB 4DGVL 3QUZA 3O6FA 3M8OH 5TDOA 1J86A 9CGTA 3E6HA 1LNUB 2A74B 5DHXB 5E8EB 5DUML 2J88L 2IWGA 1TENA 3RWIA 3O2VL 1MFCL 1TVHA 3SE4C 3MRGA 5KSUB 3U9UB 5AYUH 1KJ2A 2DYPA 3BP5B 1NPUA 1IAKA 3BE1H 5KANG 1A7OH 1HHJB 1B0RA 4LHUA 2JJSA 4IEFB 1RVFL 4BUGA 4LIQE 2OL3L 4CMMB 3MRRA 2R0LL 4Y2DB 4HF5L 1G6VK 5LXGH 2NX5D 3CDYA 3JWOH 3L3OA 5F6IC 2FWOB 5FEBA 3ARYA 2FGZA 4FTVE 3GRWA 3QJFB 3S35X 2WBJD 1JNNH 3UPRB 4Y5XC 3MYJB 5D7JC 3KPLA 2PO6A 43C9B 2F58H 3EOAB 4MXVF 4LCYA 5HHMB 2XFXA 1V7NL 4WV1C 5F7EL 1U3HC 3MRPB 1QEWB 4DGYH 1RUPH 1MJ7H 3ZKSD 1BFOA 1NFDE 3BXNB 3LHPL 4J8RA 2VR4A 2F54D 1TZHB 4JANA 3EYUL 1S78C 1DDHA 3IDXL 5SWQB 3RY6A 2P43B 4O2FA 3V0WL 3W0WA 5HGDB 4NZDA 2BXZA 3C2AH 4QOKE 4AEHH 5TQ0H 4RAVA 3WFDH 1EK3A 2GY5A 3HLAA 1FLTX 4YXLH 3NFSL 2EYSA 5GS0D 1C16A 3U0WH 3SO3C 1FZOB 1TJHH 4P4KD 4BKLA 5DJ0A 1ZA3A 1UM4H 2VDRH 2FBJH 4OI7A 4UIMB 4KDWA 4NWUL 4YHOL 3RWFA 5DVOA 1QTYT 3RRQA 1JGLL 3L5WB 2DQCH 4U1HA 4JQVA 2Y5TB 4HKZA 5DJYA 3O45B 4F7MA 1JWUB 3QNXA 1KTDB 1LO4L 5DMKB 5J13C 4DZBA 5F1IB 4MJ5B 2AJSH 2VLRD 4HX1A 3RUGA 4XX1G 3F5WB 2DRUA 1SYVB 5AZEH 2H26B 2E7BA 2IQ9H 1VGKA 3B9KD 2AV1B 3FB7B 1YPZF 1KCUH 2O5XL 2JKXA 1RJZB 1X5HA 3BZ4B 1D5ZB 5F1SA 2C1OA 4HWNA 2RQ8A 3P0YH 4HK0B 1JFQL 5CUSL 4X0KA 4X4YA 3TIDA 4QXUH 5JZ7D 4DVRL 1YY9C 4I2XE 1XR9A 2UZXB 1NC4D 1LQSR 3ALXA 4FQXD 3GMRA 1YEDB 5E6ID 4OCMC 1EGJL 4WDIB 1F3JB 5FGCB 5HPMA 3GIZH 3ETBF 4HXBL 4JFHD 4P2OA 3BAEL 1K8DB 5F3BA 3AREA 3TNNB 5I8CB 3QEQD 4FFVC 1WBZB 4J7RA 4LCUA 4PLKD 4N8VA 5F6HI 2GW5A 4XH2B 3L6FB 3PWNB 2R9HC 4F3FB 3BP6A 1F11B 5I16A 3PGCB 3OKEA 4JM2C 4JVWA 4U1GB 3MJ7B 5DHVH 3QXAB 2Y25A 5DD5H 1D7FA 3A6CH 4OZHA 3MC0A 3TWCL 4XC1H 1MHEA 32C2B 5CSGA 4OLZL 4S1QH 2X4TA 4DVBB 3OZ9H 5L0QC 4KXZH 2IEPA 4X6DE 1P84K 3OSKA 4JO4H 2Z91A 4U3HA 5A16A 4O02H 1K4CA 3D3VE 3HB3C 4JDTH 4WNQA 3AU1A 4YNYB 1QLEH 1I8LA 1WT5A 4NT6A 5EORH 1ZT4B 5I1EH 1PSKH 4WFGE 1HI6B 2VITA 3G5XA 4FMFA 4ELME 1I7ZB 4X83A 5IB2A 4F9LA 2IH1B 3S97C 1K4DB 4OGZA 2I9TB 1CTNA 2FO4A 5EO0B 4OLVL 2IH3A 1NC2A 1VKXA 5J11B 4JHAL 5E9DA 1CLYH 4I4WB 4UOW0 1YJDL 1EHNA 4LSRL 1HYSC 1AQKL 4M7ZB 1XGQA 2E6PA 1GGCL 3FCTA 1RUAL 3RDTA 1NL0H 25C8H 4KZEH 1VENA 2ZP0T 5BRZA 4ISVA 1CU4H 1QVOA 2RAMA 2IF7A 2VQTA 3UTOA 1FNHA 3KWWB 1AHWA 5FO7A 3TZVC 1FC2D 1BOGA 1QR1B 1QBLH 4BH8A 4WO4B 4MAYB 1KLFA 4XCFL 5F3HA 3IKKA 5T5FH 3B3IA 1U3YA 4U6VH 5A2KH 1KT2B 3BPCA 2VTFA 4NZRH 1J05A 4NGHH 4NJ9L 1R3IH 2VO5A 4JHWH 4L4TA 3DO7A 2AK4E 2KKQA 3UJIH 5ESVB 5DFTA 1MAJA 3PUCA 5ITFA 1A6WL 1N7MH 4PJ7E 5D2LA 5HVHC 1T2QH 4U49A 4CU6A 2OQJA 4PPTA 4Y2DD 5ADPH 2HLAA 3QDME 4BH7B 2DJSA 4X4MA 1F3DH 5J56B 5I1IL 1CD8A 4HXAH 4KK9C 2ED9A 3RVTD 1OW0C 4WEBL 1SHMA 2ADGB 1ITCA 3CPLB 4MQXC 4PJGB 5HHMD 5ECJE 5IT2H 3NIFE 4UQ3A 3IDJA 5GGSY 3ZZ1A 5HDLA 3P11H 4HHAB 3W11D 1KJVA 5IB1A 3FAXA 4UDUB 5FYJD 4G7VH 3FHAA 2A6KA 4YIQA 3O6ML 3V8OA 3QIWB 2OX5A 2A6DA 4V1DA 1UZ6E 3GZKA 5B39A 4OF0A 5ACZA 4NQDE 1Z9SA 1EEZA 1IGYA 5T1MA 2E27H 4Q0XL 3VRIA 5D7LB 5C0RH 2WIMA 4LCWA 4PJDF 4JFEE 2GI7A 4XPAH 2EICA 1UKTA 3U4EB 4EQ3A 4GUPA 2Z4QB 4ZYKB 4S1RH 4ZUUA 3IJSB 5DQJA 5I1GH 1HCFX 2FJFB 3LV3A 5TFSH 2P8LB 3RKPA 4Z78B 2J8UB 3CUPB 4R9HA 3VW3H 5AAWA 4ODWB 4NRXA 2H2SC 2ADJA 1CDJA 4PG9B 1S7UA 4PJEF 3TVMA 3L3KB 1KCKA 4O58H 4HWEH 1UM5L 5C6WH 5CZVL 4OKDA 1MCOL 2WBJC 4JPIB 4NYLA 1X5YA 1HXMB 1AGBB 5HD8D 2NXYC 3ILQD 5F1KC 3TBTA 4OZFH 3L3JA 4DN4L 2EC9U 3EYSL 5HYSA 2HH0H 3Q0HA 5I1LA 1ES0B 3BIKB 1SJEB 2P24A 4WEMB 4IMLA 1HCVA 4BUHA 3VXQA 1YNTB 4Y4KB 3KLSA 4X7CC 4BFGA 1S9KC 1GH7A 3VXRB 4KZDL 1OARH 1CFQA 2PXYC 1BHGA 5GGSB 3EHBC 3OHXB 1WZKA 1T7WA 1RK1B 3MMEA 4NBYB 4NRZB 1YNKH 1UC6A 5GS0C 2VN4A 1EHLH 5JORA 2AGJH 1NCTA 3IDUA 5IEKA 5IV2B 2CDFB 4P4KC 4XNXH 3GHEH 2B1HH 3QRFM 4OCLC 4H8WL 3LEXA 3FN3A 5E8DL 3SDXF 2ZKHL 4DTGH 4NQEA 4LIQL 1CFSB 3V5KB 3E3QC 1R6VA 2XWJA 5CJQH 1BF8A 5IVXB 3EAKA 3UDWC 1AY1L 4AIXA 3H0TA 3VWJB 2DKSA 5CSZB 4ZODA 3KPOA 4XTRC 5DC4B 2ZSWA 2VZSA 2HWZL 3DX8B 3VI4E 2ZJSL 1FN4A 4EQ2A 1BQUA 1YNLH 3PQYA 3UAJD 3DGCR 5FYJH 3U9PH 4P9HC 4PYHA 1C7TA 4LCCA 5HPOA 2YPKA 2OJZL 1FNSH 2X1WL 4L9LC 3FQTA 3WUWB 2AI0L 2AEPL 4GQ9L 4Z7QF 3FQNA 2VLJE 5J6HB 2ICWA 3LN4B 1YN7A 4MLSA 4QT5A 5KVFH 1KPUB 4FQXC 1NGPL 3G9VA 5E6IC 5EZLB 4NSKA 2ILLA 3RQ3A 5DTFA 3SGEI 3OTTA 4PV8B 5CKAA 4QRQB 2R0ZL 3FOMA 1NBQA 3CXDH 4OLEA 4GT7A 4LLDB 1OWWA 2WSKA 3OG6B 2OL3A 4PRIB 3HI6H 2J4WL 4DK6A 1J10A 5A3IC 3TIEA 2V2WB 1B6UA 1ZLSH 1TETH 4F58H 2W0LA 2YR3A 4HIJB 5L9DL 2ICWJ 2DQDL 3BRDA 5DFVD 4P0DA 3ORJA 4Z76A 2APVA 3IU3B 2QQNL 2X4NB 3QUXB 3O3EA 5EWIL 1JIBA 4NKOB 3ARGC 1MCEA 1UG9A 3QBTB 4X9FA 1MRFH 3KHOA 4X7SH 2BMKA 1FYTA 3K46A 1SVZA 1N5YH 4PJFB 5F7MC 2RIKA 2EDNA 2E5EA 4TUOA 2X70B 4LVHC 3NCMA 4R0LA 4Z7NF 1JNJA 4G42A 5E24E 5IEHB 1RZ8B 2UY6A 4WO4D 2WM0A 3O6LL 4L29A 4EUPA 4MAYD 1IGTA 3MACH 2NZ9D 3DSFL 4O9HH 4PR5A 2N1KA 3NIGF 5HJ3B 4Y1AB 1W0VA 2OSLB 4GG6E 4FQLH 3VRJB 3HAEA 2VDQL 3O0RL 2OBGA 1UWGL 4GRWH 1GIGL 3BKYH 3K2MC 1QO3A 5D2NB 3LRSA 4MJ6A 5F96L 2BC4B 1NCAL 2VABB 3NA9L 2ZNWA 5B8CC 2DQJL 4XZUA 4LP4A 1FH5H 5JPMA 4IRSA 3TYFA 3BWUC 1P9MC 5IVZA 2A6IA 5HYJA 3T4AA 4Z7OE 4XXCA 3D2UB 5JOPE 4L5FL 4XGZB 1I7RB 2ZG2A 3BPLC 4X6CE 4YHZH 3T1FB 4G80B 1JZ2A 2AEWA 5D6CA 5E6YA 3BP7A 3BO8B 3WFEH 2VQUA 4HPOH 1VFBB 4ZAKA 3WO4B 5D7SH 1B4JH 3QIWD 3MLWL 4M43L 4YO0A 3FQWB 3ARGA 5T33H 1FFOA 4OGAD 1EHAA 2XZQH 4XI5D 2ERJB 2B2XL 1EGJA 5KSBB 3V7AG 5ADOL 1PYWB 5D7LD 1NCDH 1RHHB 1A8JH 5IOPA 3QCTH 2IBBA 3BJLA 4ZUSA 1UGNA 2BP3A 3Q3GA 1WVZA 1FNEA 4UV4L 3G5VA 5CLWA 5ISZE 1QP1A 3FT3B 1TPXB 2Z8VC 5IQ7L 3ARBB 5GZOD 5I6XC 4FQ1L 2DWDB 1GGIH 2HVJB 1X5AA 2D0GA 2PN5A 5KVGL 4PY7B 2DI7A 2R1XA 1A6TA 3O3DB 4RQQB 1TTGA 5DVMA 3S34L 2B1AH 3U1SH 3VXMD 3U48A 3EGSA 3ZDYE 1J1PH 1BBJA 4Z7UE 1AJ7H 3BP4A 1KF9B 4F33B 3IFNL 4EZMA 3DX7A 1BD2A 4BYHA 1A0QH 3MXVL 4GAJH 3SDYL 4PJXA 1KEML 3DROB 3HE6A 1F4WL 5DQDL 3T0EC 1S7VB 5DD0H 3O4OC 3BEVA 1N6QH 1DQDL 3IGAA 4NKDB 2LVCA 3GSNL 5DJ6A 1J0JA 5C08A 3FB5B 4Y4KD 4KDTA 1KLGA 5DRNB 3VXRD 2VWEE 1OAXH 2VISB 5FIEA 1UCTA 2HT4D 1AXSB 3T2PA 4AM0B 4NNXA 4JM2F 4FZEH 1QZ1A 4EDWH 3ZKND 1CG9A 1KB5B 2OXGA 2GJZB 3KPSA 2X7LB 3O9WA 4QCIB 3B9VA 4F2MA 4NN7C 4Y16B 2PYEE 4XB8A 4NUJA 1XF1A 1IC7L 4G8EB 5ANMB 1JTOA 2JJVA 1C1EL 4KQ3L 1S9YA 4NDMB 2ZSVA 4QY8B 3KLAA 5F9JA 5GS2H 2YPVH 12E8H 4I0KA 3VWJD 4D9RD 2IPKB 4XVTL 2Q6WB 4UINL 1G7QB 2NY5H 3OXSA 3REVB 4P5TC 3QAZB 2VDPL 2FIKA 1R0AH 3CMOH 4HIHB 5E4EB 4S2SB 3MZGB 5MP6L 3TEUA 1AGDB 5C0JB 1K3ZA 1Q94B 3LMJL 3U30C 1T4KA 1U58B 3EIFA 1WIPA 4UTBH 4YAQA 4G8IB 4BFBD 1RIHH 4W6WB 3VXUB 2KUTA 5GGUB 5EA0L 1D6EB 2OTWB 3SJVA 2HJKB 4OFYA 1N26A 4QXGH 3ZT5A 3ALPA 4JO1H 4MD5A 3PF2A 1EO8H 2E7LC 1H0DB 3BMWA 3NOIA 3TESA 4Z7VE 3E8UL 5DMGC 5E1AA 4M48L 2AJYH 1BZQK 2EE3A 4LSVH 3BW9B 2ESVB 2PUQT 3SN6N 3U0PA 1A6AA 2ADIB 4PRID 1F97A 3I50H 4U31A 4G6FB 4PUBH 4Y5VB 5DVLA 4LLQA 2NX5E 3AFLA 3H9HB 1NGWB 4G9DB 4YHML 3MBXL 2GK2A 2HFGH 3G6JE 3BQUA 1H3VA 5LAXA 5IFAL 5C7XL 4L4VA 4OLYH 4DZ8A 4PREA 1J1OH 4IIQC 1DQQA 3QUXD 4MNGE 3HI1A 4HFWA 2EDWA 3MRFB 5C6TH 1R3JA 1RJLA 4MAUH 3H3KA 4PGCA 3HZKB 4K2UL 5IK3B 4DUXA 1SYSB 2H1PH 1CXIA 3F7YB 3NIDE 4ZQKB 5EDXA 5GXBB 1G1CA 3L9RB 1MLBA 4KMLB 2HRPH 4QHUA 4U6XB 3MLYH 3ZTJH 2VSDA 1DLFH 1T2XA 4ERSH 4G6KH 1I7TB 2F54E 3D25B 4WU7A 4I9WE 2M26A 4NNYB 1FIGH 3TC9A 2EZ0D 1U95A 4WFFD 3K4DA 4LLYA 4HC1L 1U8PA 4P2RA 1P69B 2VXVH 3EJJX 2GT9B 5FHBL 2P5EA 4P23B 4Z8FH 4Y1AD 5JR1H 5IWLC 3H3PH 4OCWH 4QRTA 5HGAA 4JY4B 4HUUA 1MY5A 4K3DL 5D9SB 3UZQA 4DOHB 3VFNB 3DX9A 2X9XA 3DMMB 4OM0L 3OQ3B 4Q2ZB 4X9IA 2EKSA 2Q8AL 3PP4H 4TSBH 4OQTH 3LSOA 4MA3B 2YK1L 1K8IB 1OGAB 5ID0A 1IC4L 1YEHH 2OK0L 4F8TA 5INDB 5CZXC 2UY7A 2AEQH 4K3GA 3S35L 4LKXB 1UB6A 4PJBE 1A1NA 5MEOB 4KXZI 4KRLB 1Y6NR 3D2UD 3VXTA 2VLRE 4EI5C 3DV4B 3MRQB 4RNRB 5L8JB 4L8DB 4I0PA 4KK6C 2XTJB 4PJ5D 5FA4A 4ZTOL 2G60L 5C3LD 3U6RB 1REIA 3VFSB 3K80A 2EO1A 4OD3H 2I07A 5GZND 3O6KL 3WSQL 2JCCB 2J8HA 2MQ0A 5DMJB 2D7TL 1Q9OB 5AD0A 4ODBD 5CINL 3I9GL 3NAAL 3O4LE 2Y07L 2X4SB 2LABA 5C0EA 2Q76A 5LGJB 3E2HC 1G9EA 2ZUUA 5CFHA 1AQDB 1B0GA 1EJOL 1K9TA 1T1YB 3BUTA 4W4OC 4ORZC 5A2FA 2MSPA 1YEFH 3W9DA 4NN5B 4D9LH 3L3GA 2CMRL 3FO2A 1UFUA 4OF6A 2APXA 2W9DH 1NSNL 1RURH 5T1DL 5GHWL 2J3SA 3ARBD 2GY7B 3QIUA 1IKNC 4FTVA 1N3NA 3WJJC 1B6DA 7FABH 4NBXB 4PP2B 1KTLA 4HKBB 5IUSA 5DDHA 1JPGB 2R56H 4P46A 1ZT7B 4JLRA 2CO7B 4WHTA 2BSRA 3T2QA 4MZ2A 1KPRB 3KPRE 4XMPH 3MA9L 3BDYL 4X7TA 3OXRB 4R6UA 5DJ8A 4RWYL 5BJTB 2J8OA 1RK0A 1NFDA 1CGYA 1BVZA 3BISA 3FT2A 4GRMB 4HBCH 4NHCH 2DIAA 3P9MA 1CE6A 4G6AC 1CQYA 1G9NL 4OLXH 3Q6FA 4N9GA 3JSSA 3TA3B 4TRPH 3BD3A 4JM4H 1DBML 3HUJE 1AO7E 1PG7L 1TTUA 3O41B 4FXKA 4EEEA 3WJLA 1JYNA 3FB8A 1KV3A 1SY6H 5DJXB 2CKNA 2FX7H 2XPGA 2LU3A 2BNRE 1LVEA 1L6XA 3MLVL 3RWHB 3SCMA 2GAZA 4X5WB 4Y16D 4C57C 3A6BH 3VXNA 1XF5B 2HT2D 3S4SB 2P8PA 3QIBA 4DFIA 5GZOC 5HVFB 1JGEA 3QCVL 4R4BA 3WEXA 3OB0H 1HN1A 4CVUA 3V5DA 1K6QL 3NBNA 3BHBA 4YE4H 3JV5A 4XVUC 4YC2B 1KIRA 2ZOLA 1BVKB 4YHPB 1X4YA 1T6VN 3F7RA 3UTQB 3FRUB 3GI9L 5I8EA 5INCA 4GJTB 3U7AA 4B50A 4ZUTB 1FG2B 2PTTA 4P59H 1LGVA 5EOTB 2VL4A 1PGRB 1FIEA 2EDXA 4ZFZB 5F6HJ 1DQJB 2XZCH 5A43C 3RWGB 1LD9B 1IM3A 1FVEB 5ICZA 2ZZUT 1JF1B 3VXUD 4M6MH 3QFDA 3M8OL 5DJDA 4N0CD 5IBUG 3QI9A 3FTGB 3OJ2C 3TNMA 2B7DT 2KQNA 2NY4C 1DN0B 1AXTH 1RI8A 4GS7B 2DOCA 4POUB 5AYUL 2ESVD 3BE1L 1A7OL 4BSJA 5HYQB 1EBAA 3PHOA 4G6FD 1KCRH 2Z31A 4PYGA 1U8MA 2VC2H 1ZLUK 3ZKXB 3ZDXF 1Q9LB 1BX2B 1LO0H 5LXGL 1FPTH 4MXQD 5CWSA 4X6DA 5B3JF 3JWOL 3VFTA 5GRVK 3OAUH 1XCTB 1JNNL 1FFRA 4APQA 1UQSA 1MI5E 2AAVA 2F58L 1CIUA 3D3VA 4M61B 5ETUB 4YPGA 4X6BA 1LEGA 4YFLI 1VFMA 1SJXA 4G43A 4DGYL 1RUPL 1MJ7L 3RX8A 1PZ5B 3WD5H 1MCWW 2BY0A 3H9SB 3E0GA 1MHPH 3AMLA 3GSUB 3LKQB 5JDSA 1KB5H 5FYJU 1EO7A 1OPGH 2DJ4A 2EIZA 1OAZH 1WC7B 3OF6A 4LHUG 1RZJC 3C2AL 3ECBB 4AEHL 2IAMC 4P23D 3KPNB 3DUHA 3WFDL 1BZ9A 2D7PA 1AGEB 1CDUA 3KAAA 4OZGA 4YXLL 3QQ3A 3U0WL 1TJHL 2Y7QB 3AVEA 4OCSH 4HWZB 1A02N 5DRWB 1QYGH 1UM4L 2Q20A 2FBJL 2VDRL 4PJ8A 3TBYB 3DMMD 5CP7B 2VL5B 4L9DA 1ZSDA 2DQCL 3QUKB 3MFGB 1OGAD 3DV6B 4JY6A 5JW4Q 5I73B 5HI3D 3GFUA 1U2HA 1MVUA 1BLNA 1G7IA 3TPUA 1LE9B 2PR4L 4BK5A 1XIWC 2AJSL 3BT2L 4KGJA 2BSSA 4XP9H 2XTJD 5K9QG 4FQHA 1JNLH 2DMCA 2IQ9L 3BSZL 2DLGA 1CLCA 3GSNA 1KCUL 3TCLB 2D31A 4I1NB 5FM5O 3I84A 1J18A 5FUCE 1QBMH 5F44A 3MRNA 3FFCA 1RJYA 3P0YL 4JQXA 3ULVD 4ZUWB 3ES6B 4D0DB 4QXUL 4YDIH 5B38B 1ZLVK 3BFOA 3MRIA 5KTEH 4IRJB 1XZ0B 3GIZL 3R06A 4PJ7A 3QNYB 4LDEB 1KPVB 1MQKH 3MGAA 5E0QA 1RULH 4GRWE 4E0RB 2EIEA 5J57B 4I13B 1SMAA 3QZWB 5MEPA 5DD5L 4CL7A 3A6CL 3RTQB 4XC1L 1UJ3A 1D5XA 1MWAB 4S1QL 4UU9A 3SDCC 3OZ9L 4Z0XA 3S96A 2Y5EA 3CD4A 1HH9A 5CBAB 5T3XH 1MRCH 4JO4L 3OKKB 4YWGH 4CVXA 4Q7DA 4O02L 5EO9B 4NQDA 4WEUD 3SKNB 1QLEL 4HKXA 1XIWA 4JFEA 4J1UA 4N8VG 5EORL 2J7LA 5D72H 5I1EL 1PSKL 4PG2A 2VXUH 3PL6C 1YEGH 1IGFH 4TVSa 5C09B 4WIQA 4JVUA 3VFWA 3P4LA 4TNVF 3QFJB 1B4RA 2Q8BH 3VXPA 3VG9C 3SKMA 3MCKA 3MCG1 4PD4K 4F37F 4OZIB 3RJQB 5E94A 1W2KT 3DX6B 2OZ4H 4FFYH 1P4LA 3ARBC 4OD2B 1CLYL 3CZJA 2BNQA 3SDAC 3ZE1F 4QRSA 3OGCA 5FKPB 1INDH 1AKJA 2JB5H 2P45B 3WFHB 1MNUH 5J1AA 4Q97A 1KSRA 1NL0L 25C8L 3CCHA 2QSVA 4M5ZH 4IDLA 5ITBH 5DJCA 3RVWD 2XICA 5FGBA 3VXSE 1CU4L 2RFXB 4F7PA 2BJMH 4LAQH 2XN9B 1RIVH 5MI0B 3QJHA 3F7VB 3SDDC 3ULVH 2V7NA 1RFDL 4JQIH 4HC1A 2V6HA 5TF0A 3QYCA 1E4WH 1QBLL 4QRUA 4G7YH 4JCLA 1URLA 5FGSA 5IF0B 3KJ6H 1JV5B 2YEZA 2E9WA 3O81A 4JCMA 3PABA 1H15B 1C7SA 3MTRA 5T5FL 1G0DA 4U6VL 3ARZA 1YEJH 3EYVA 4LL9A 4NZRL 1IAIL 1U2CA 4S0SD 4NGHL 1R3IL 4HDIA 5BCAA 4JHWL 4RGNB 4GW4B 5DEGA 5KS9A 1NGZA 3UJIL 3EO0B 1NCUA 1FV1B 2MCPH 3UYRH 5D1ZB 4O5LH 4C58B 4LSUH 1OVZA 3QSKB 4A2MA 1DUYB 1GZQA 4FFWC 4U1IB 1INQA 1CT8A 5ADPL 3GJEA 2QADB 3QAZC 4HXAL 3UTZB 1T22B 1PVHA 3REWB 1A6ZA 1N64H 1EA9C 2NY6B 5CGMA 5T3ZE 5IT2L 3WL9B 3KPPB 3TBVB 2VLJA 2E7CA 3P11L 3IFPA 1LK2B 5FKAB 1R3KB 4G7VL 4WHCA 3H9SD 1CDCA 1JN6A 5J3HD 1A3LH 1T20B 2P7TB 1VADB 4YGAB 2W0FB 3GMPB 4L4JA 5D7LE 4NCDA 4WW1A 1KGCD 1WBYB 2E27L 5C0RL 4QRRB 5BVJA 4PRNB 4XPAL 3CDFA 1RZGA 5IQ9B 1CFNB 5KSVB 1X6NA 5I1GL 3WFCH 2J8UE 4J4PD 4MSWB 4PJIB 4KV5E 5TFSL 1UM6H 5FECA 1IQDA 5F9OH 3VW3L 5KSAA 4U1SB 4AYFA 3MLZH 3ET9F 4HWEL 5F9WB 4JREB 4PRHB 3W82A 2YA0A 4IHOA 3ZE2E 1FO0B 1SBBA 3QWOA 4M8QB 5B39G 4PFEA 1TNNA 2ZUVA 5HVGB 1WSST 2HH0L 4UB0H 5I9QB 2QR0B 1ULVA 4R96A 5HYEA 1ZHLB 1YC7A 4PJ9A 4LEOA 4CMHC 1NDMA 4P4RA 5EU4A 1CYGA 1FLRH 2FATH 4GG6A 1OARL 2GK0B 2OI9B 3BESR 1E4XH 1M05B 3I6KB 4DQOL 2F5BH 1YNKL 1IM9B 3FONB 2ORBL 4IRJD 4WGVB 1EHLL 3T0DA 1IRAY 5D7KD 3L5HA 4WI9A 4I8DA 1LEKA 3GHEL 2B1HL 3DXAB 4XAKE 3A67H 4XPHH 3TO4B 5DEFB 1MEXH 1KIQA 3HMWH 4DTGL 2X4OA 4LVNC 4RGMC 1EXUA 1G9MC 2UZYB 5CJQL 5FXCH 1ADQH 5ICXB 3RTQD 4ETQA 1TZGH 4TTDC 4GKNA 2VWEC 3QEGH 4A6YB 1FSKC 1ZGLB 2DM2A 5K9KA 4B53A 4X6FA 3WIFB 2VDKH 4OLWH 5FYJL 3U9PL 2OYPA 3BVNA 4PJAB 4U6YA 5EFIB 3IJYB 4JO2H 3OG4B 1TQBB 5F7LB 4XRCA 4BFIB 4HJGB 2GCYB 2WBWB 3ARDB 4LGSB 1KN4H 1FGVH 5C9JA 1CWVA 2B0SH 3RL2A 1ZHKB 2YD7A 3MRHB 1MFBH 2W60A 1OTTC 3LQZA 5KVFL 4XB7A 3CH8A 3IKCA 4PJCE 5AZ2H 3VD7A 4ORGB 4Y4HA 2YA2A 3O8XC 5D96C 3C5ZB 1FHGA 3LDBB 5ISZA 5C09D 5C07D 3V6FA 3QFJD 4M93B 2J5LB 3CXDL 3UBXG 4PRIE 4Z5RB 3MCLL 4HK3J 5IROC 1B9ZA 3HI6L 2ENSA 4GKOA 4G3YH 4ELMF 5EC1A 1UVQA 2EE2A 1ZLSL 2NYYD 4F58L 5IMMA 4ODVH 3QXWA 4PLOB 1HK6A 2X4QB 2P49B 4KI5E 3EYOA 3NZ8B 4NO2B 3FQUB 3QA3A 1DFBH 2RR3A 2BK8A 1XF2B 1IL1A 1CXLA 2C7UA 2PTUA 4PJFE 1MRFL 4ONFH 3D69A 1BM3H 1N5YL 5DD6A 3HPLB 2ZCHH 5AUMA 3M1BA 2LQRA