4M7ZB

Unliganded 1 crystal structure of s25-26 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
LKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB01
1JWUB 2ZCKL 3HFMH 2MSPA 5JIHA 1CG9B 5D7SH 2R1XB 5FOBB 1KPVA 5EUKB 2AJVH 3N0PB 1KJMA 3F7VA 1MJJB 5MENB 4AENB 2UWEF 3MRLA 5FXCH 3E2HC 5TE7H 5F3BA 2ICES 3O2DH 4XH2B 4FQQA 5I15H 3D85A 3W0WE 5HHVH 2YR3A 1NBZA 1F97A 3BESR 4JVUA 5TE4L 4RZCA 3OJMB 1NUGA 3STBA 1RVFH 3TA3D 5DDHA 3TFKC 5DS8A 2QR0A 5CINL 1F58H 1SJVA 5CSZB 1ADQA 1WZKA 3WEXB 4YDKH 1L6XA 1K8IA 3IT8D 5FM5M 4ODVH 2AJYL 3B9DA 4K94C 4CVXA 5JIPA 4RWYL 2D7OA 1MH5B 3D85D 2DB8A 3RVUC 1AO7B 1WAAA 4PY7A 5IT2H 3ILPB 3S3PA 1JWSB 4H8WL 3VGDA 2A1WH 3K4DA 2Y4SA 5HHQB 1I1YA 4LNRA 1FL6B 1T2QL 4NQTA 5EO0B 4HBCL 4QXGH 1TTGA 3FB7B 5JZ7D 4XVSH 2FO4A 5KVDL 1I9JH 3MODL 3NA4A 3QUKB 4WCYH 5A16A 4FG6C 1IFHH 2XQBL 5IB4A 2WWMC 2OP4H 3SKMA 5IV2B 4TNWK 1C1EH 3QEGH 1LP9B 3RAJH 3WFHB 1UEMA 2R0LH 1F90H 1BX2A 1F11A 3A0OA 3UAJD 3VE0A 1I8LC 4HWZB 4CVUA 3DARA 1ULVA 4OFYD 3GGWA 4LSTH 5CKAA 4J3TA 1MSPA 3DXAA 4PY8I 5EU7C 3EUUA 2XKNA 4YFDB 2GK0B 4PGZA 4G6AC 1XF2B 1MJUL 4MMZC 3TO4C 4GAGL 2F74B 1MF2H 2GKIA 3U30B 1NFIA 4WV1B 1J05A 1JWMA 4CVZA 3TIDA 3KPMB 1IC4L 3FT3A 3UC0L 3X11B 4G42A 4WI5A 1EXUA 1AE6H 4Q2ZA 1WIUA 4QEGA 4LFHG 1FFNB 1A1OA 2LFGA 3LPWA 4LPUA 3DXAD 3HS0B 3NIGF 4JHAH 5EULV 3TV3L 2MMXA 5L7XH 3OXRB 4NWTL 5E94A 3SKOB 1KJVB 5IW3A 2XY2A 3P11L 2OI9B 5LWYH 4XCCH 1U8IB 3K8KA 1JNLL 4P4KC 4OLXL 3P0VH 4TVPL 3H7BB 5ABDE 3FFDA 5D2NC 3DIFA 5DURB 1G7IB 3BW9A 3BZ4A 3MYZA 4D9QD 3WN5A 1FH5L 3OKOA 1OPGH 1A3RH 3CSPA 4BYHA 4ELKA 3QXDB 4ETQB 3WDIA 3MGAA 2W9EH 4GBXC 3D0LA 5ERWB 1ONQA 3BKML 1ORQA 2DD8H 4WU5A 1HSBA 4AL8L 2E3VA 2BNUB 3EO0A 3IFPA 4I2XA 4PGBB 4QTHB 1QD0A 4KKCC 4WTZA 2VSCA 1VGKB 3L5HA 1YNKH 5CJBA 2R2EA 4KROB 4KI5C 4HIHA 2Z31A 4XCYA 5KW9L 3L7EA 1UWXH 2NZIA 3AB0C 3QFJE 2OL3H 3IXTA 1CL7L 1A22B 4RA0C 3NPSB 3DOSA 1EAPB 2P24B 4FMKA 5HVFB 2I9LA 5C0IA 1FN4B 2Y7QA 2BERA 4U6VH 1JNNH 1ZHLB 2CKBB 2FBJL 4P9HC 5FYLL 4KRNA 1LO2H 5E5RB 4P59L 1DFBH 3W9EB 2Z31D 1LEIB 2CK0L 3C5ZC 5F44A 1YEEL 5IP4A 3KYMB 1S7VA 5DD3H 2FZ3A 2XICA 5DRZA 4M43L 1UQSA 4M6AA 4RISL 3HZMA 4OLYH 4ZQKB 4X6CA 4PJBA 2GJ6B 3VRJA 4RGMB 5FUCC 4K7PL 3WD5H 4QHLA 3NPZB 3E6HA 4CJ0A 2W60B 1T22B 1U3HC 5DFVC 3LEXA 5F7NC 5H94B 2H2PC 1IGJA 2MWCA 2WM0A 5I1EH 5AYUL 2HLFD 2OM5A 1XCQA 2E7HA 4C83B 3RFZC 4K3JH 2B0SL 3TN0A 4IOIA 1D6EB 4JCLA 1OSZA 4WJ5A 3T4YA 3NIGE 4WDIB 3TBTB 2PXYA 4PGEA 1CU4L 4WUKL 2DBLH 1BFSA 2X4OA 4OLVL 4I18C 1CFSA 5SX4H 5D6DA 4ZUTB 5CZVL 1FZKB 1DE4B 3MRBB 3RX5A 3AFLA 1H8NA 1G1YA 1CF8H 1LE5A 3TN0D 1JZ8A 4PJCA 1ZAGA 4KPHL 4PJIB 4LCCC 3S98A 1L0XA 1NCBH 4C4KO 5CLWA 5EU7E 1KCSH 4GKNA 4GRMA 2PXYD 1A47A 1ITCA 2GT9B 2HJLA 3GJFA 1HYSD 3V95A 3SCMA 3DBXA 3SE8L 1IL1A 1PQZB 3NZ8B 4RGND 1NGYA 3G5ZA 2PCPB 1PYWA 3EFFB 5K33A 5DEFB 5IBTL 4EDXB 2NW2B 1A7PH 4XP1H 2FJFA 5D6CB 4RFEB 1LQSR 3QUYB 3SY0A 2KQNA 1I8KA 4YHZL 2CLRA 3QHZH 2ZG1A 1YMMA 3SCMD 4JPIA 4OM0H 2Y06H 2A83A 1K4CA 4YXHH 4M48H 4D0BA 2Y25A 2L7UA 1MCJA 5D2NE 2NTSP 2DMBA 1D6VH 1SJEA 2WWKT 3BYYA 4ZDHA 5JXEC 4WEBL 4NZTH 4PYHA 3OAYK 4WI3A 4MSWB 1CGSH 3BIKB 1YMMD 2G9HB 3QISA 3D3VE 4W4NA 2R69H 4PRBB 2FEDD 1G9EA 4MQ7A 5ANMA 3VWKC 3LD8C 4IM8A 3VFSA 1M71B 2OZ4L 3GSVA 5EBMA 2BJML 3VG9C 5FB8B 3TJHD 4MXQC 3CVHL 5M94B 1MJ8L 1QO3B 1YNLH 4P2RA 1KJ2L 4RIRB 4N68A 1Y18B 1BZ7B 2Q6WA 4PJDF 4IDLA 3K8MA 5EU5B 2XWJA 2IMNA 5H2BA 5EC1A 1CDCA 3FB6B 5I1JH 5HHNA 3NOIA 2QQQA 1J1PH 1AJ7L 4X6DA 4UT6H 2YSSB 3ZE0E 2SEBB 1CT8B 1JFQL 2V7HB 2I5YH 1Z9MA 1S78D 4KAQL 2ADJA 3ULVC 2X9YA 2JIXB 4P2RD 4YHIB 1EBAA 5F70A 3S97C 3C6LC 3CCHA 2EH8L 4IIQB 2F9BT 5T3ZL 1CIUA 1UXWB 1G0YR 1A4JA 1FVEA 2IQ9L 1NSNH 1BQHB 4IMLB 4WHCA 3ZYIA 2GJZA 4NKDB 1V3MA 3VXTB 3DETC 4NBXB 5CILH 3QQ4A 4GAYA 4WNQA 3WS6A 3T3ME 2O5YL 4ZFOL 5C6TL 2C3GA 5JHDA 1HQ4B 1I8MA 4HF5H 4ELMA 3G6DL 4M1CC 1T0NB 3NIDF 5D8JL 1CE6A 4NSKA 3GBNL 4YIQA 4HS6A 3MCLH 1CXFA 2WBJA 2I60L 3PWNA 3EOTH 4M7KH 5IKCA 3BGFB 4J1UA 4E41B 3U0WH 3NN8A 3K0WA 4KHTH 4BZ2H 1GZPB 4OCWH 3HE7C 3V52H 5TQ2H 3W11C 2GAZB 1BIIB 1AHWC 5JHDD 1J87A 4YWGH 1FFRA 3MV7B 1UWEL 1B6DA 1B0GA 2EDJA 1ZGLA 5F7YC 3L3OA 3SDDB 1DBJL 5EZIL 2EIDA 2NZ9C 3S37X 1MEXH 3IAPA 2XWBB 4L29A 5KG9A 2A9NL 1IAIH 4L8DA 2WBJD 1J5OL 4TTDD 3X13B 1MLCB 1UVQA 1R5VB 3N1MC 3NFNB 1OAXL 1GOGA 1D9KC 3C8KA 3HAEG 1RIHL 4TULL 4JG1L 3K81A 1JE6A 4PBWD 1FCGA 4GQ9L 4HH9A 4ZSOA 5KOVC 1D5ZA 3WFDL 4R4BB 3GI9L 4DN3H 3ULUD 3T04D 4D9RD 5BVJA 2EDDA 3TBSA 1H5BA 2ICCA 1IAOA 3UBXA 1BEYH 3RUGB 3FCTA 1GRWA 2ICWJ 3SDAC 3H0TA 2EEBA 4N0YH 1ACYH 3FN0L 1GJIA 1OAYH 4G5ZL 2V17H 1X7QA 2V5MA 3LS5H 3QHFH 3MA7B 4XP5L 4PRPA 2H9GB 1BM3H 3S7GA 1A1NB 3CZFB 5K59F 4XMLH 5E0QA 5DD0L 3B3IB 4NKOA 2D03L 4LPVA 3CLFL 2XA8H 4JO3H 2BVOB 5J9PA 3EO1A 2FB4L 2Q8BH 2VDPL 2X05A 5C71A 5JXAH 3TA3C 1GL4B 4EQ2A 4PJFF 3KYOB 4HLZH 5C0BA 2XY1A 1U92B 5ACMA 1KB5B 4K7PY 5CUSH 2QHRH 4HXBH 1CFQA 2Y36H 3QEQB 4PRPD 5DJYA 3P4OA 1WWCA 3QUXB 2RAMA 4XVJL 2OR9L 3BH9A 1CL7I 1LEKB 5F9OH 4KTDL 4NN6C 1C5BH 1IAKA 1MCOL 1OT2A 5E9DA 3MFFB 4BFIA 4Q0XH 5C0BD 5KN5A 2IPKB 3MPCA 4FXGB 5JOPE 1DUZB 2MOVA 1D5XB 3UDWA 3WXWH 4HIIA 2CXGA 3QDJA 3PWJB 5F9WB 1U95A 4O2EB 2ZCKH 1FNLA 3KS0J 4NJ9H 1JNHA 4I5BB 3QIUA 2GI7A 1DN2A 3L3IA 4N0UB 1PDKA 5DQJA 3OAYH 5GISH 4B7IA 1FL5A 4U6YA 5E9DD 3VXQA 5EU3A 2A6JB 3ULVE 4TTGA 1U8HA 3I9GH 4KMTL 4U1HB 3MRCB 5TE4H 4NM8L 3JWDC 1TZIA 3QDJD 4X8XA 3CPLA 5C09A 3HZKB 5INDB 3RWIA 2ARJB 4YDIL 3C5SA 2APVA 2B1AH 2BNRE 1ES0A 5DHVB 1T7ZA 3T3PF 2YPLB 2GSIA 2Y23A 1VA9A 1UJ3B 2FRGP 3MV01 1GAFH 1OB1A 2AJYH 4X4ZA 2DQHL 5EBLA 3C09C 2CDGA 3QCUL 5L6YH 3QULA 4RWYH 1YDPB 3CFKA 1AXSB 4JRXA 5J3HC 3CUPA 2J4WL 1GC1L 4U1JB 3S37L 1JYWA 1U8PA 3RPIB 1A7QL 1QBLH 4QCIB 4DVBB 5I6XB 5C09D 1TVHB 5HGAB 1HI6A 3QCVL 4JFXA 2IF7A 4FQIL 5IG7A 4JPVH 2JE8A 4DFHA 2FSEB 2FX7H 1ZANH 4J3SA 1FZJB 1T1ZB 5KVDH 5I1AB 3MREA 3DRTA 5FHBL 4JRXD 5K59E 1MRDL 1SM3H 3PWPA 4ORGA 2XQBH 3VG0H 4JN1L 1WCBA 1QQDA 1RZIB 2GTZA 4CNIA 1BFTA 3IJSB 1WISA 2GCYB 4PJ8A 5HXMA 4GAJH 3O2DA 4F7EB 3RY6A 4HKJB 2CKNA 4L3AA 1XR8B 3NABL 5BS0B 3IJHA 3CFEA 1G0DA 4L9LB 3BN9C 3CH1B 4YPGB 1BQSA 1XFPA 3CH8A 3NA9L 2YD6A 5SV4A 4J3UA 2K3TA 4C56B 4QRPE 3PWPD 1UZ8B 2X42A 1SBSH 3LKOB 3QJFB 3B2UC 1MCFA 4WTZG 4GAGH 3KG5A 1K3ZA 1OW0A 4PJ8D 5F89B 5HGBB 3L1OL 1YEFL 1TCRB 3QQ3A 2QQLL 1IC4H 3UC0H 1A5FL 4QRQB 3D0VA 2V2TA 2OJEB 3F12B 3T09A 1EERB 1N6UA 4LLQB 3VGAB 2VXQL 2VDMH 2PR4L 3TV3H 1U36A 4P23B 4HJJH 4NWTH 3LKQB 1IQWL 2NNAA 1J10A 4ODXB 1ZT7A 2N56A 1JNLH 3BDXA 3OKYA 3RWEA 3VRLE 1XGTB 4HD9A 1X5JA 4FZEH 2NY6D 5D5MF 5I30H 4QHNA 5KVMC 4HUMB 2XFXB 3EOYG 2MKLC 5I73C 2CD0A 1BFVL 1FH5H 3HRZA 1U9KA 1XIWC 4PYGA 1NL0L 5DWUH 5B39B 2EXWD 3JWNC 4J4PA 4OZIA 3BKMH 2EIZA 3KLDA 4ZPVA 1S7WB 1YYMH 2DRUA 4LIQL 3RZCC 1TJIL 1X6NA 4JKPL 4AL8H 1NUFA 1A3QA 3CFBA 4JRYD 4EKXA 4P99A 3KAAA 3FOLA 2VERN 4EDWL 5F93C 3VFRA 1CTNA 1DBBH 1NLDH 2EYTA 5KW9H 1PLGL 4J4PD 2W65B 3AMKA 3MC0A 2VQUA 5FM8A 1WAAE 4PR5B 4ZYKA 4OV5B 4EXPX 2VQTA 1S5IL 1X5KA 2DLTA 1OHQA 2AGJL 5GGQL 1N2RB 5FOJA 3CC5A 3FQRA 3IDNA 2FBJH 4P3WA 1KIRB 3O9WA 2LU4A 4JO2L 4NC1E 4NRZA 1OY3B 3P9LA 4P59H 4UTBL 5SWQB 3L9RA 1CZ8L 3TN0C 4GRWB 3OGCA 4S1QL 1LP9F 2YC1A 5CJOL 5DHYB 3ARDA 1YEEH 3LKNB 4OZHF 1JUFA 4RISH 4TNVF 5LBSL 2CGRL 4LSVL 4POUB 1BWWA 3KPOB 1BD2A 4K7PH 4OZGA 5BQ7A 1YMHA 2WNGA 4YZFF 1JL8A 2BSRA 2YPVL 1KLUA 3RGVC 3O9WD 3HI6L 1GPOL 4XX1E 2HKHL 1MQKL 1FVCA 4WI8A 3ARDD 3O6FA 1L7IH 2PYEB 3DXAE 1KG0B 4ACPA 1BD2D 4HMDA 3TNNA 4OFKA 5FV1L 2ILLA 2B0SH 3HA0A 1R3JA 2YUVA 4HQQH 3SE3C 3FN3A 4NQDA 4OUUA 3HPLA 5FM4A 1CU4H 2OL3A 4HK3J 1FIGL 2XKSA 4QNPE 1PKOA 5DUBB 3D69A 5FA3B 4KKAD 5CZVH 4PJ7A 2Q87A 3O6FD 4Z0BL 5BZDB 4XXCA 3O0RL 5ALCL 2ITCA 4D9QE 4KDTA 3MRKA 1BOYA 3KJ4C 1EMTH 1OL0A 1DBKL 5IBLC 5FGCB 5FO7B 1TZGH 3S96A 4KPHH 4M6OH 4NQDD 4BJLA 1P6AB 3U0TA 2J88L 3O2WH 3VFMB 5DJ6A 4S1DD 3GMMB 5FO9A 5LGKA 1OTUC 4F8QA 1H15B 5D72L 1AKJA 5GGTL 3L3DA 3H9YA 3U6RA 2JB5L 1NDMB 2X70A 3C5JB 3A6BH 1MAJA 1CGYA 4P5KA 4Y19B 1RK1B 3H6JA 3M17B 3QPQC 5IBTH 2R23A 4XCNB 3IDYC 5D7KD 4W70A 3S36X 4I2XE 2WUCH 3P40A 4Z77A 2IBZY 4UILL 5TH2B 4YHZH 1AR1D 1PY4A 3QZWB 2IBBA 1AKJD 4Z7OF 1RK0A 4MAYA 2IAMC 3MBEB 1U8JA 2KQMA 4X6BA 2BC4A 3UROR 5DJDA 4OZ4B 1X5ZA 3GO1L 1VERA 4LAJH 5IFJA 1QPPA 5J12C 1XH3A 5B38A 4PGCB 2NY5C 5JMOC 3I50L 3LRGA 3VFVB 2DL2A 1JPFB 4WEBH 3LRHA 3PWLB 4FXKB 3KPSA 4JAMB 1TJHL 3QFDA 3VMOA 4F33B 3PDDA 4S0TD 4MAYD 1RZ7L 5I1GL 4MCZB 3FAWA 1NCAH 5AUMB 2K7PA 1S8DB 1OWWA 4LSSL 3C87A 2OZ4H 3RVXC 2BJMH 3BMVA 1KTDA 4YUEL 3CVHH 4LCUA 3TT1L 4EUPG 1ZGLP 4PJBE 2D0FA 3ZZ1A 1J8HB 4XTRD 3LEVL 2E7MA 3DV6A 1J12A 5IMOA 3KPSD 1EVUA 3ZDYE 5I1KH 4ONGL 2R15A 2NXYB 4LCWA 5C0JB 1RUML 5DA0B 3SPVA 3ZTJH 3LPFA 5AWNL 1AGCB 2HJKA 2BSSB 4CADB 5I2IA 4KAQH 3OTTA 4Q9BA 4QHMB 3T0DA 2V2WA 2VXTL 4TTDC 3GMLB 2EDRA 3PGDA 4JZJA 5T3ZH 1T5XB 2Q7NA 1EEYB 2IQ9H 2R1WB 4LCWD 1BQLH 1ACZA 2DIAA 5DLML 2X4RA 4D8PA 3O45A 4D0DB 4FQHA 2CUMA 1PG7X 4G9FB 2YS4A 3AS2A 1KACB 1F8TL 3LKRB 4R0LA 4H1LH 1PSKL 4GG6B 4RGNE 2O5YH 4M7LL 1FZMA 1RZJC 3AREB 5EUOA 5L8LB 3DTXB 5T33L 5DSCB 2C4FT 1J0JA 3G6DH 1N5AA 5D8JH 4GJTB 5HPOA 2CDFB 4FQLL 1BOGB 3NCMA 1JZ4A 3TESA 2NPLX 3FQNB 2XRAL 3KGRA 4LVHB 3MLWH 2VLMD 2Z93B 4W6YB 5FM5O 1AI1L 2FATH 1H5BC 2F19L 4AEEA 5AEAA 5DQ9A 4LKCA 2NY1D 4RQQB 1A9EB 5K93A 1UWEH 4LAQL 1UM6L 4TUJA 4G43B 3E6FB 2W0PA 1KPUA 4FTVB 3Q2CA 3MV9B 4LSPL 1HNFA 3F7YB 1NC4B 3WIHL 2ZG3A 4PJ9B 2A9NH 1J5OH 4I3GA 5J7CC 4AK1A 1PX3A 3EHBD 1YMME 1FDLL 3UTTA 5IOPA 2GITA 5ICXB 3ALPA 1IC7H 1OAXH 3SDYL 4TULH 4HUVA 4JFEB 2GK2A 4JG1H 4P2OA 4UMGA 4QXUL 3ZYOA 1SVCP 1I1AA 1Q0YL 4GQ9H 3WFDH 2HFFB 3GI9H 4OT1L 3TZVB 2E27L 4XZUB 1ZE3C 2DLIA 4LEOB 3U36B 2P42B 5FECB 4MD5B 4LPYA 2VAJA 2FGWL 3UTTD 1H9VA 4E5XB 2D0GA 3EZ8A 4G5ZH 5DJXB 3BKJL 1CGUA 4I0PA 5ANME 1TITA 3RHWF 1I1AD 4NUJB 4EI5A 4PV8A 3DURA 4X4YA 1PZ5B 1SJHA 5DD0H 2D03H 2F54B 5IJVB 4P2RE 3ZSTA 1U8QA 3CLFH 1X4XA 4HUXA 3RI5K 1MCBA 3U1SH 1N3NA 4PJXB 4G6ML 2X44D 5KVFL 1XZ0A 2RGSA 3QIUC 3V79C 2V9QA 3K46A 3C8DA 1MCDA 1R3LA 4JY5H 4X6DE 4KI1A 3STLA 1BHGA 4EI5D 1WC7B 3BT2L 3BE1H 1RV6X 1AIFA 1I9IL 3C08L 4XVJH 3KR3H 1TZHB 5JA9A 1FG2B 1A1MB 1XR9B 5A1AA 2JK5B 3HCVA 3GEWB 1H3GA 2K9UA 1HOCB 4O4YL 3SGDI 1MCOH 3PWVB 2DQTL 1XF5B 2VZOA 3UPRB 3ZKMC 1ZSDA 3ARBA 1OAQL 5F1OB 1MI5A 2AXFB 4BSWA 1TTUA 3SGKC 2ED9A 5CCKH 1DR9A 3D9AH 1INQB 1PG7L 4O02L 5JHDE 2NY4D 5F6IC 3TCLB 1HXYA 1XGQA 3MCKA 4ELME 3VXMA 4PJAF 3OKKA 4HXAL 3MLUL 4I9WD 3NCYP 3QNZA 4NBZB 4AY0A 4NDMB 3ARBD 2HTKD 4BH7A 4KKLC 4DCQA 5E2VL 5E8EA 1MI5D 2BVPB 3WL9A 2XWTB 4KMTH 3REVA 4MB4A 3AY4A 5MEPA 4NM8H 4K8RL 1GGIL 3S88L 4EXKA 3ZSSA 2YA0A 4YDIH 3QDGD 3ARGB 3WBDA 3ULUE 4D9RE 2M1KA 3VXMD 1B0RA 3QCUH 1A2YA 4Z5RA 4HWUA 4XNYH 1UM4L 1QSEB 2J4WH 3RY6C 5ISZB 3MZGB 3S37H 4OF7A 3TBVA 1S7XA 2VAAA 1OGAB 1A7QH 3ARSA 1HN1A 3JTSB 2W1NA 3WXVL 2Z9TA 3RUGF 3QCVH 1H0DB 4TUKL 2IG2L 4FQIH 4L5FL 4ZSOE 2VLKB 2WP3T 4MJ2A 5FGRA 5HHOB 4ZTOH 4K94L 3QJHB 5M95B 5E24E 4BKLA 3BEWA 4GKOA 1G7LA 1GGYA 4JN1H 2O61B 1E27A 1NMAL 4TSBL 2PW2B 3MJ8B 3LS4L 3VFUA 1AC6A 1N59B 1DZBA 4PRPE 4WWKA 3VXOB 1Q9LA 3FOMA 2EXWC 5D70L 1QHOA 1CD9B 5J0BA 3JV6A 2VXSL 4LSDA 4WHTB 3NA9H 2BCKB 3GMNA 3RNQA 4NFDA 2DICA 1BAFH 4H5SB 3KPRB 4YGVB 1A3LH 5IW1B 1KB9K 4H88H 4JFOA 5C0BE 2X7LA 5DFTA 3D39B 3F7RA 4UAOC 1VSCA 4XNQB 4JM4L 3RL1B 1R3KA 2OXHA 4WWKD 4GRLB 4X7CC 3DROA 4LASL 2RBLA 1YEFH 2NX5B 1OLLA 2OSLA 3PDGA 4XPTL 1JGUH 4ZXBC 1HKFA 3GBML 1GVIA 2IPTL 2DDQL 1A7NL 3AM8C 3VXSA 3MRFB 4MD0B 4U31A 2HFEB 2E9BA 2J5LB 2V5RA 4XCFL 1TPXC 4NQSB 4XNMB 2PR4H 5E9DE 4OGYL 4R7DB 3T2OA 2KUTA 1IQWH 4YBLB 3SJVB 3MACH 3BI9X 2UYLB 2NLJB 3WNMA 4LCIL 5C07B 3QDJE 5GGRA 1RJZB 3LV3B 4Y4HA 4LL9A 1G7HB 1I3RA 2ICWI 2VIRB 3MOAL 4WUUB 2CR6A 3VXSD 5EZLA 1BFVH 5HI4C 1NL0H 3G04B 3HNVL 1NCCL 2HT2C 2WW8A 4N8CL 1VEPA 3IDUA 1AQKL 4YR6A 1AD9B 4LIQH 3NFPA 5EOTA 4GXUM 5CJQL 3SDXB 1AO7A 4JDTL 5C09E 1MCKA 4GKZA 5I0ZA 4U6HB 5HGGS 3VW3L 3B9KB 3CAFA 4P3CH 2MPAL 1W0WA 4Y4HD 4EDWH 4FXLA 2ESVB 1B90A 5D1ZC 5AAWA 3DRQB 3VGFA 1SY6L 4XBPB 5BMFH 1ZLWK 1PLGH 5DMIL 3LMJH 4JRXE 2ADFL 5HY9B 5AD0B 5J89A 2X40A 3SGDH 1AO7D 1ERNA 3CDCA 2AGJH 5GGQH 1D5MA 5IV2A 4UT9H 3MBXL 2DQCH 3V9FA 5D96C 4CRPA 1HEZA 4UTBH 5C6WH 1CZ8H 4HGMA 3GI8L 4M1DL 3VCLB 5B39G 4Y2DC 4JGMA 3RPKA 1IM9B 5CWSB 2D2OA 3OXSB 3PWPE 2R56L 3D25B 5LGJB 2R1YB 2DQGL 4S1DC 2AS5M 1BF8A 1YN7B 4P5MA 3WHXA 1D5BB 4MDJA 4JFZL 4NQEB 4WO4C 2YPVH 1TQBB 2PN5A 4KDTC 4NP4H 4MX7B 3VFWA 3EYQD 3HI6H 2H3NB 2F74A 3ET9F 4P9HL 4PD4K 4Z7UB 1MQKH 4Q9RH 1WV7T 2AK4A 4L9DA 4JY6B 4ONFL 1S7RB 2NY2C 2PUQT 4LSUL 5F8QC 2F5AL 2X4TA 3JVGA 1JGLH 2H1PL 2VLRB 3PHQB 3BO8A 3ROOB 1EK3A 2DKUA 3SKOA 4TSCH 2OK0L 1U8IA 2AK4D 5LXGL 5D9SB 4Z0BH 4ZS6D 3O0RH 1WSST 4PJHA 5DXWA 4L4VB 1EHNA 5BVPL 4HIJA 1QFOA 4V2CB 2R8SH 3BWAB 3KXFA 2IADB 1DBKH 5B38G 4X6FA 3ARQA 3PIQA 2X1PA 3FHQA 4ETQA 3WV0A 2CLZA 4RRPG 2ZCHL 2VDKL 2KZWA 2J88H 4GKSB 1R3IH 4JRYE 4OCYL 4PIRF 4EJ1C 3FMGL 4Y5YC 5D71L 5C3TA 1RFDL 3UTSB 5JA8B 1FLTX 5FUZL 3QIWB 5JQHC 2JB5H 1ZHBB 5I66B 5GGVL 5CGYD 3KXFD 3DWTA 3LN4B 4OZIE 3HUJB 2NR6D 4MXVE 3RZWA 2DKMA 2EO9A 4FQ2H 3IS0X 4QYOB 3O81A 1T7YA 2C4FU 4NN5C 4KRMB 3GHBH 2APXA 1UB5A 1ZHLA 1FJ1B 1O7VA 2R9HC 4JFPB 1UH3A 1KJ2B 2BZDA 1OLZA 4YFEA 4L8BB 1GGCL 2FL5A 4PJ5A 3W9EA 1XMWA 1LEIA 2BY3A 5D93C 3ARFA 3MRIA 4NM4L 2DQJL 3FONB 4LLMB 4JZOB 5EO9B 4YHNA 4GRWF 1H8OA 3I50H 4NZDA 5FYKU 3MXVL 1TJHH 4H25B 4FFWC 3ZT6A 1RZ7H 5I1GH 4RCAA 4PG2A 1RZKL 2A9MH 5L0QC 1NEUA 4NNXA 4PJ5D 4LSSH 4XNUL 4M7ZC 3ARFD 2X4SA 4YDLB 4QXTB 1IGTA 3MLYH 4RSVA 1BD2E 3T0VA 3GSQB 4KKBD 1M05A 2QV2A 3U7AA 1KC5L 5HDBE 4OZGE 3QZWG 2XG4A 1D6EA 1EZVY 1OTTC 4ONGH 1NKOA 4IJ3B 2NY1C 1R5IA 1RUMH 2NTFA 5D7LB 4F9PC 1MRCH 3RA7L 4M61B 4K71C 1U41A 2IH1B 4LSQL 2FR4B 3EJZC 2W9LA 5JW4M 2V6HA 5FGBC 2A0LC 2B39A 2VXTH 1ZWIB 5E00B 4M1GL 4TNWF 4GAFB 3BXNB 2EIEA 5I71B 3RWCA 4NQDE 4L3CA 4PJIA 3O4LB 4NGHL 1UKQA 4M7LT 3AGVA 5E95B 1J0IA 1ZLWH 5HYQB 4PJ7E 1UKTA 4JKWA 1ZVYA 1J8KA 3MUHL 3IDIA 1F8TH 1JYVA 3U2SA 1PSKH 4H26B 1XF3B 1PQZA 1HH6A 3G6JB 4X8JA 5F8RC 4QT5A 3ULVL 3JV5A 3PGFH 2QQKL 5E2WL 1D3CA 4FQLH 4P2OC 5DEFA 5D7KE 3GMQB 1UH2A 1MHCA 5D7IA 3UJTL 1I1AC 2XRAH 3CVHA 5D6CA 4ALAL 5IB1B 1Q9WA 3KHOA 1AI1H 1OARL 2WK2A 1HQRB 5J57B 5GS2H 1IBGH 2G2RB 1DTUA 1FZOB 1URLA 5CD3A 4JY4B 4NN7B 2X4NB 2CIIA 1UM6H 4LAQH 3JUYA 3ROLA 1Q9KA 2HH0L 4L8CA 5HI5D 3J7HA 4I0PC 4P5TC 3WIHH 5IFHH 1P84J 4QRSB 1EHLH 1WICA 4JKMA 3QRGL 2W38A 3C60B 1FDLH 3S36H 2BVQB 2D7PA 3SDYH 2F8OA 4WY7H 2ERJC 1JRHL 3FO2A 1K6QL 4QXUH 3WNKA 5HD8C 4BH8B 1Q0YH 4Z7QE 3Q6GH 1NFDB 4XHQA 5B8CA 4OT1H 3X12B 3VXRB 2APFA 3T0EC 3GSRA 3MRPB 2Y6SD 1OQOA 1Y18A 3NFSL 3KPSE 4D3CH 1QRNB 3QA3B 2FGWH 1RZGB 4LU5H 1OT1A 4I77L 1T1WA 3BMWA 4X9IA 4KK6C 3BKJH 5KTEL 4LHUA 1CE1H 3FO9A 5BJTA 3RKPA 3RWGA 1VPOL 4AYFA 4BZ1L 1CT8A 1PFCA 5EIQA 3RTQB 5T1LA 4HFWB 2LAGB 3SDCD 5JO5B 5DK3A 5DO2C 2NQCA 3GSXA 7CGTA 1KUMA 5DI8B 1UXWA 4LCWE 1P7KA 2VL4A 5DHXB 3ZDZE 3HR5A 1HHJB 4KHXL 4Y5XA 4IMLA 4LHUD 3T77B 5CBAB 4KXZI 4HWBH 4HLZG 1EIBA 1RUQH 3B5GA 5HHPB 3G6AB 5T1LD 2Q3ZA 4TN9A 1YEHH 5HHMB 2B4CH 5DZOA 3DPBA 5J1AB 4WU7A 4ZUSB 4GG6F 2VQ1B 1MHHA 2ATKB 3QIBA 2GFBA 4Y4FA 2VLME 3AXLB 3OQ3B 4UNVA 1PG7H 4EN3A 5BW7C 2EYSB 2AV7B 5ESQB 5EUOE 4AIOA 1IILE 4QRTB 4ZFZA 1BIIA 3ARVA 2YOCA 3MV7A 4HK0A 2AKRA 3LSOB 4NHCH 5ESVB 3MLUH 3SDDA 4LGPB 1GGBL 3QIBD 4LLAA 5E2VH 2WIIB 1ADQL 4Y4FD 5GGSY 3X13A 3HKFA 5ACZA 1GGIH 1MLCA 5DD6A 3S88H 3NFNA 3TO2B 5IEHB 1MRFL 2IPUG 4EN3D 5HPMA 5TGBB 1AY1L 1FGVL 1S9WB 4MJ5A 3MV7D 5DMGC 3ZDXF 2DQIL 3PJSB 5EC2A 2AEPH 4PLJD 1N0XL 5GGVY 2ZSVB 3SDDD 4WTWA 2LQRA 1UM4H 4PJGB 1UENA 1KCKA 3UTTE 1E4WL 3TYFB 1U58B 3MRQB 3UO1L 2DLGA 3WFEL 1Y0LA 4YDVB 3WXVH 3JWDL 4X83A 2IG2H 1EV2E 1J11A 4FQCL 3CZFA 5KS9A 1QR1B 3KPQB 4S2SA 3WUWB 4L8SC 5F7FA 4K94H 2GTWB 1LDPH 1BBDH 2W9DL 2FNBA 2P8LB 3M07A 1DP0A 3NMEA 4KK5D 1NMAH 1CDGA 3KYOA 1T66D 1JGEA 3OG4B 4X4MA 2NCMA 4F15B 2MHAB 4JLRB 1KB5A 4GMTL 3LQAC 3KNBB 4GG8A 1F6AA 2FX8L 4CBPA 4P46B 4PP1D 4PJXF 3VD9A 1B2WL 4OF3A 4DKEH 3CD4A 4PV9B 3JV4B 2VXSH 1P5VA 2YXMA 2EXYD 4RNRB 3S34L 4X99B 3OR7B 4X98A 1JHLL 5MHSD 4KKNA 3O3BA 3R8QA 2VITA 2YD5A 3VXPB 2IPKA 4JM4H 3OAZH 3U7YL 1DUZA 3DX7A 4HPYL 4IOSD 2VNCA 4XPTH 2HVKA 1SJXA 2IPTH 5F9JB 3SGJC 1A7NH 3HG1A 3FRUA 1R5WB 3CFCL 1NLBL 4XCFH 4XPAL 1HIML 2ZOKB 4I9WE 2VMFA 5FF6A 4OGYH 6CGTA 3VI4F 4OLWL 1MI5E 3MNWB 1MVUB 5D1QB 3VXNB 4I48B 1AGFB 3QDGE 2X4PA 3HZKA 4HIEB 5INDA 1TVDA 1N8ZA 3HG1D 4RBPK 1CIDA 2YPLA 2JELH 4P3DB 1IKNC 3VXME 5JHLL 1UJ3A 2LV4A 3HNVH 1NCCH 4OZFB 4PTUB 2FX9L 2UZYB 5KOMC 3HPJB 3LIZL 5L8JB 3TWCL 1AQKH 2Y5TA 1YDPA 4EZMA 1TIUA 4S1RL 2ICEB 3GSUA 1CCZA 3VW3H 1I1FA 1PW3A 2P48B 2HP4A 2P5WA 1A7BA 3EYFB 1XGRB 5GZND 2YPLD 1HHGB 1SY6H 3O6LL 2HTLD 2R2HA 1JP5A 3ES6B 2Y07L 4LHJB 3ZE1E 4JFQA 4UNTA 2ADFH 4WV1C 5F6HI 3U30C 2FH8A 1BF2A 3P0YL 2P5ED 3I3EA 2Z4QB 1Y6MR 3VFPB 2AV1A 3BPCA 4FQJL 2WZPD 1ZVSA 4OQTA 1TTFA 2ID5A 1A0QL 2P5WD 4E42A 4KJWC 2X41A 2P44B 4F7EA 2DAVA 1FIEA 4U1MB 2G5BA 3BP6B 1XR8A 1BP3B 3LN9A 2MKWA 4XHJC 1VACB 4L9LA 3CH1A 5SWZB 2R29H 2CRIA 2OI9C 2XPGA 2R56H 4JQIL 1K9TA 3L5WB 1RI8A 5EA0L 2X1WL 3D2UB 5IMKA 5CBEB 5GIRB 2R4SL 3QJFA 4NRXB 1NGXA 3DVFA 4U0QB 4MJ4A 5F89A 4ENED 4P9HH 1TCRA 5C0EA 1WWAX 1NBYA 4ONFH 3VGHA 2A2QT 3O3DA 2J6EA 1HKLL 3F12A 3ZTNH 2F5AH 4Z7NF 3QXAB 3BHBA 2X9XA 4NQXA 4BA8A 4L1DA 1DEEB 5DD1H 1BFOA 3RVVD 5DRXB 2B2XL 3RIAK 4KROC 1QLRA 1JRHI 1AGBB 2EE6A 2LVCA 4YHPA 5TPWL 1G84A 5A2LH 2C26A 5E1HB 3VI4E 5E2TL 2OK0H 5LXGH 5CJXC 3QEUB 3VXSE 3NPSC 1C5DA 4OFIA 5DEGB 3RY4A 5BVPH 4ODBD 2XFXA 1S7QB 4MXWL 4PREA 3TBWB 1MPAH 1B88A 4P48A 3ZO0A 2H8PB 2ZCHH 3WDJA 2W59A 3FMGH 5D71H 3WKNA 1TCMA 3CNKA 3SDXF 3BOVA 1DLHB 5FUOH 5DJCB 5MERB 5E6ID 4RGMC 1YY9D 5GGVH 4LOUD 3I02B 2E6PA 1FFPA 1QEWB 1DQLL 4JFYB 4NHUB 1GSMA 1AO7E 3SKNB 1FPTL 4HKZA 5FDWA 4JO4H 3MV8A 2ICWB 4FS0A 4WHDA 1G7MB 4X4XA 2BXYA 4PG9A 5GSRA 4B5EA 1KIRA 3HI5H 5FO8A 3UCRA 5EU6B 5SWQA 4XB8A 2WWKO 2D9QB 3KWWB 5DHYA 4NM4H 4RMRA 3ULSB 3GSWA 4O51B 4X9GA 4NNYB 5IVNA 1H3WM 3CFJA 2EE3A 3CU1A 3MR9A 4PRAB 3ECBB 2C1OB 3MXVH 4YAQB 1HNGA 4OD3L 3MV8D 3VDAA 5C0FB 1CN4A 1JHTB 1O0VA 4YBHA 1QSVA 3V6OA 3GUTB 1MIEL 4ZUVB 3FT2B 1R3HA 3UJJL 5DQDH 3H7LA 3IS1X 1MAMH 3GB7B 2H6PB 4MNQB 4P2QB 3MRGA 4ISVA 1RIUH 2GSGA 4XNUH 3SE4C 2IANA 5IWLC 5GSVB 1AGEA 1GZQB 4MJIA 2YRZA 1SBBA 2NY5L 2C1PB 1UCBL 2XXMB 1FFOA 1T7XA 1S7SB 4RBPH 3RA7H 3AC0A 3EYVB 3PNWA 1PEZA 2AK4E 1ZLUK 3HC4H 1KIPA 4LSQH 5BZWA 1FAKT 5FA3A 3SO3C 1XCTB 2IAND 5I1CL 5ENWB 4CDGC 3CFDA 3PE9A 1HH9B 4G9DB 5C0GA 3QUYC 3HE6B 4M1GH 4MJID 4J6RL 1QSFA 3W9DB 5CGTA 5FO7A 1HWGB 1IC5L 1R0AH 1RULL 2RFXB 4QRRD 4NGHH 4PB0L 1ORSA 3BP4A 5HYEA 5DJ0A 4N5ED 1YECH 1H15A 1YZZA 2ZUVA 4M00A 2YKLL 4PJHE 4BQ9A 4JHZA 4OSUL 3KXFE 4Y19A 1BZ9B 5I1DA 3ULVH 1M7IA 1QSFD 2QQKH 5E2WH 3M17A 1JNJA 1FQ9C 4H1LG 4M3KB 3VWJC 4XBGA 2D31A 3ZKXB 3QUZC 4U1LB 1OARH 1KCLA 1JPTL 4HC1L 5ITFB 4I0KA 3LEYL 4YO0A 5JOFB 3AU1A 5KSAB 4OZ4A 4Y19D 2ZUYA 1DVFA 1P4IH 1RZJL 1NANH 1QYGH 1U6AL 3DMMA 1CFNB 3BVNA 4UDTB 4KGLA 4N0FB 4KJYA 4OV6F 4W81A 4DGYH 1UXSA 4P57B 3QRGH 5F97E 3VFTB 3PWLA 4JAMA 3O3AB 4YX2L 5IQ7L 3HRPA 1JRHH 3P4MB 4IOFC 3NCFB 1K6QH 4MCZA 4PJ5E 2KZ1B 4IIQC 3FT4B 1QP1A 1LHZA 4ZO7A 5I8KL 1DVFD 3K80A 4Q6IB 1HCVA 4TQEL 1HXMA 3DMMD 1C08B 2D4FA 4HV8B 1J8HA 4HH8A 3NFSH 2XN9B 5IVXA 2C3HA 1MWAB 4KV5E 3BEVB 1TLKA 1JTPA 1X6LA 4I77H 2CR3A 1BVZA 4UQ2A 3VFOA 4PY8J 4LSRL 1VPOH 4BZ1H 1AGCA 4RAVA 4CADA 4KVCL 4JG0L 4QHMA 5IB5A 3WHE0 2DI7A 1J8HD 3BGFC 5A2KH 1T5XA 1FNFA 4KHXH 3OPZL 1IGYA 1DQTA 1QFWL 1H3XA 1F4YL 3HMWL 1OSPL 1A14L 1P5UA 3WIHA 5DMKA 3BGMB 1S9VB 3RIFK 4MS8C 3T4AB 3ETBF 5C2BL 4G6JH 3ZLQC 4MLSA 4YHLL 3DTXA 4OD2B 5GS2D 1OM3H 1LD9B 1WBXA 4Z7VA 3GSNH 2YMXL 4PJIE 1DSFL 5I76A 5IMMA 2PTVA 3GSOA 3QFJB 2JF1A 3FQNA 2HLAB 4Y4KA 3OB0K 2HRPL 4LVEA 3HLAB 5ICZA 3V7AE 1XGPA 4ZUWB 3LZFH 3P30L 2C7UB 3SQBA 4WI6A 1QA9A 3ZHDA 4IRSA 3O41B 4Z78A 2IC2A 4KY1L 1Z0MA 1OAZL 4G6FB 5JDJA 4G43A 3E6FA 1HE7A 5D7IE 3N9GL 3WS3A 1FO0L 4G7YL 5JDSB 4PGDB 1DN0A 1GGBH 4PP1C 3F7YA 5CS7A 5CMAA 4F7MA 4Y4KD 4V1DB 4WW2B 1ADQH 3CVIL 4JR9L 5EIIB 1U91B 1MAKA 2FBOJ 4UBDD 4LCYA 2PO6A 2CDEB 1MRFH 43C9A 5GZOD 1HSAB 4U1KA 1NGPH 4IRSD 4PP2A 4GXUN 5C8JB 4KRPD 1G9MC 1N0XH 4HWBA 1RAMA 3ILQC 1ZVHA 4JVPA 4HUNB 1NFDF 2F5BL 1E4WH 3UO1H 4UINL 3WFEH 4HPOL 3QUXC 1MLBB 4LDOB 3JWDH 2O5ZH 2PO6D 1W72B 3D18A 2A74B 4G80B 1KENL 3G5VB 1CXIA 4HWEL 4HKBB 3MXWL 5C0DB 4FQCH 2L7JA 4FMFA 1ZHNA 4X7SL 1G7PA 1KLGA 5D1XB 2DJUA 5J6GB 5E08L 4Z76B 5EPMB 1TFHA 2W9DH 5F9WC 1L4IA 3O2DL 5AG8A 1YN6A 2FYYB 3FQTA 4NJAL 4HUWA 3QG6B 3FO0L 2VDQH 2NY0B 5HHVL 4GMTH 4Q9QH 3OWEA 2FX8H 3IVKB 5F21B 1X5YA 4X6EA 4FQXB 1RPQA 4HS8H 1HCFX 1P69B 3DVGB 1KIQB 4MB3A 3VH8A 4YDKL 1I8IB 1IEAB 4ODVL 3BDYL 1JHLH 1VGEH 1UH4A 1O7SA 4G6KL 3UPRA 2HVJA 4APQB 3LN5A 2EECA 4DAGL 3MGTA 1OTSC 5IT2L 1UJ3C 4HPYH 3WUWG 2A1WL 4L3ED 5IF0B 4G8FB 1NLBH 1T2XA 1HIMH 5I6XC 2V7NB 3FFCA 3I75A 2MJWA 1J1XL 4L4JA 1FNEA 4OLWH 1YQVH 4PTTA 1LE9B 1IFHL 3KYNB 2F53A 2VJXA 1C1EL 3QEGL 3RAJL 3TH3T 2QTEA 3ARGA 5I75B 2R0LL 5JHLH 1GGTA 3MV7E 2OMBA 3D3VB 2FX9H 1R24A 3FFCD 3LIZH 5IVZB 5JIIA 1T7WA 3X17A 3TWCH 3TFKD 2EC8A 3HI1A 4UDUA 4DZ8B 4S1RH 3WO4B 5JW5A 2F53D 4XPGL 5T1DL 4J12A 4L9LC 2MQCA 4Y1AA 4XCEA 4NPYB 4PJGF 4ZS7H 4Z0XB 1M7DB 3ARGD 3RVUD 1MIMH 1JPGB 4XT1C 1B0WA 3IGAA 5I8OH 2Y07H 1EX0A 4U7MA 3MLPA 3C8HA 3CX5K 4LLUB 1CS6A 3AAZA 4QF1B 4XC1L 3KLAB 3P0YH 4MD4B 4KFZC 5L7XL 1I8LA 3PDOB 3LH2L 4ODWB 3WNNA 3MJ8A 1G7QA 5DMJB 3T1WA 4Y1AD 5LWYL 3VGAC 4G8EB 2BMKB 2PTTB 4FG6D 2A6IB 4JJ5B 2WINB 5KS9E 2WWMD 4YH6A 4OZFG 4NZRL 1VFAB 4P23C 1NC2A 3PWUB 4DN4L 3QXUA 1A9BB 3AS1A 5GS3A 5J13B 4JQIH 1OD7A 5MHSE 3RRQA 3OB0H 1A3RL 3F5WB 1HILA 2W9EL 5BXFA 1CBVH 2R4SH 2DD8L 3TBYB 4XC3L 1I7RB 1W2KT 3ARTA 4X7EC 3RQ3A 4GRLA 2GIYA 8FABB 3NIFE 3BN3B 2V5TA 1ZHKB 1YNKL 3O2VH 1NC2D 5I8CB 4G6AD 4G8GA 3OJDA 1LDSA 5GGSB 3OKLA 5IBUG 3MRFA 4FNLL 4XRCA 5DUMH 4O2CB 3QG7H 4P4KA 5C0RH 3DUUB 2OL3L 3TC9A 4Y16B 5EU4B 3G08A 1SY6A 2B2XH 3X14A 5ID1A 3IB4A 4U6XB 4U33A 2Z92B 5HYFA 5E7FA 4GRLD 5E2TH 3UBXI 1JNNL 3VFNA 2R2BA 3HG1E 4GBXA 3U0PB 1LO2L 4ZAKB 4IRJB 4G8GD 4WUUA 1I7ZB 3ZMRA 2WQRA 3OKMA 1UG9A 4RMUA 4B50A 4MXWH 1DEDA 3DECA 4XAKD 3WLWC 4IRZL 3ZHLA 3ZE2F 1A6TB 4P4KD 4UT7H 4FA8A 4E0RA 5I1IL 2L0DA 5K9KB 4PJEA 3OR6A 4GLRI 1KPRB 4AIXA 5B3JE 2RIKA 2I07B 2VN4A 4X5WB 5DK2B 5FKPA 1HHIB 1ZA6B 4XVTL 2NXZB 1RJYB 5IHLB 2KPNA 5CLTA 4GBXD 3GJEA 2YPLE 4WUUD 2ADIB 5CHNB 3DRQA 4S11A 2PKDA 1UM5L 1UC6A 3C9NB 4XBPA 1KGCD 4LLDA 1Q94A 1KTLB 4KKCD 4PPTA 3H3PL 1HZHH 2P5EE 3FB5A 15C8L 4NC2B 4Y5VB 4JREB 1FPTH 3V6FB 4KI5D 5F7LB 1QFWI 3V0VA 5GS0D 3C5ZA 4EEEA 4MA3B 5JNYB 5K9JL 4N9GB 3A6CL 2P5WE 3BPOB 3KPNA 5FK9A 1NDGA 3C6SB 1IT9L 3ORJA 5EOCH 2IH3A 1RU9L 4MNGA 1QLEL 5F3HB 5CWSA 1CQYA 1U3HA 1QRKA 1CF8L 3D25A 2R1YA 2DYPB 3C5ZD 4OD3H 4YXKL 1NCBL 4NQEA 3PGCB 3MRNB 5TDNA 4N0CC 1NCUA 1MIEH 1Z9OA 3UJJH 3IDMB 4I0CC 4IHOB 4Z7UA 3BP7A 3O8XB 4TOYL 3QXTA 2DL9A 4UUJB 1KCVL 4R2GB 3L3HB 3U79A 3HZYA 1TXKA 1U3HD 5DFVD 3MNVB 5EN2B 5DD5L 4J3OC 4I18A 2H2PD 3S35X 4KU1A 5K9OA 3PP3K 2NY5H 2A6DA 4F2MA 1UCBH 1IGIL 1VFBB 4NQED 4EI6B 4JN2B 5T1MB 5HGHB 4LIQE 1S9YB 2VH5L 4HAGA 3N50A 2J8OA 5DTFB 2Q7YB 2H32B 1CICB 1BVLB 2Y06L 3TIEB 6FABL 4LCCA 2VZUA 5GJSL 5I1CH 4ONHA 12E8H 4M48L 4M5YH 2DMCA 2IADA 1Z0NA 2BNRB 2DQDH 4DZBA 3DI3B 1IC5H 1ZOXA 1BJMA 1WBZB 3MBEC 1D6VL 4FFZH 5EIVA 1RULH 1MHPL 1NMCB 2IQAB 4PB0H 5GRXG 5A3IC 2DLFL 4I13B 4FZ8L 1CGSL 5ID0A 1I7TA 3PV7A 2A73B 2YKLH 1KCUL 3BRGC 3UTSA 1YNTA 1S9KC 1AP2B 1F2XK 5EBGA 3HNTH 3QIWA 4JM2B 3ALXA 4NO2A 4CDHA 2HJFA 5D7JB 1E4KC 2DWEA 1QFUH 5E8NB 4QYOA 1XF4A 2PNDA 3DV4A 4JKLA 4H20H 4G8IA 3FQUB 1TJGH 2FIKB 1VKXB 3KS0H 3QXWA 1JPTH 2AJZB 4ZUUA 1S3KH 3UTSD 4JFPA 4HC1H 1PVHA 3B8YA 4L8BA 3FQWB 3QIWD 5JXEA 3FO1B 2B7DT 5T1KB 4FFVC 2I5YL 1RZJH 1U6AH 2FD6H 2NXYC 1JTOA 2ZKHH 3VGGA 1CTOA 2Z35B 3BQUC 1KV3A 4Z7WA 4YBQC 5IK3B 3VWKA 4P2CG 2IMMA 3MV8E 3Q3GA 4QRPB 1WFUA 4HMEA 4YX2H 4KQ3L 5IB3A 5EFIB 3DX8B 4H25A 3SEPA 3VI3F 3WLBA 3GIZL 4GUPB 5JXED 4XP6L 5TDPA 3HAEB 4NQVB 1JN6B 3L95B 3PABB 5KSVA 2DTMH 3GSQA 5CIPB 5JIKA 3VWKD 3EOAA 3UTZB 1BGXH 4XPBL 1FAIH 1IM3A 4MXQD 3V6OE 1SEQL 2AJUH 5D7LA 2PYFB 3DX9B 3O3EB 3AREC 4HDIB 2AEQH 1F4AA 4U1SB 4NO3B 4LSRH 2IANE 4M5ZL 2VLJB 2HKFH 5JORB 4JG0H 3EGSA 2DM3A 4HUUA 4LVHC 4MJIE 1FE8L 4OIBA 4YWGL 4DTGH 1KPVB 1KJMB 3JUZA 1T89C 4H0HB 1YY8A 3MRLB 5F3BB 1MEXL 3IFNL 5GZOC 4H0GA 3O4LA 1UGNA 4FQQB 3QDHA 1F4YH 3HMWH 4A6YL 1OSPH 3C6LD 2Q1EA 4JZNB 3TNMB 1T20B 1NBZB 3BH8B 1W0VA 4RZCB 3OKNA 5DDHB 4PJ9C 5DS8B 5C2BH 4KZEL 1XF3A 2QR0B 3D5OF 4CAGA 3G6JA 1QSFE 4YHLH 5E8OB 2V5YA 2DF3A 5KZCB 2YMXH 5IVOA 1DSFH 4CVXB 2VDOL 3PQYB 3BIAX 3DETD 1HHHA 3DYMA 4BFEA 1PBYA 1AHWA 2HRPH 4PY7B 1OAYL 4M1CD 4QTIH 2V17L 5E70A 3TZVC 3ARZA 3LS5L 3P30H 3QHFL 3V4VH 4Z7VF 1BM3L 1DBML 1HDMA 4Y19E 3R8BB 1T21A 3P0GB 4MCYA 1C16B 1JZ6A 4B53A 3IF1A 5IW6A 1ITBB 2FJHA 4KY1H 1OAZH 1AFVH 4PB9L 1D9KA 1FO0H 4G7YH 4HFUL 4JO3L 2Q8BL 3W11D 3ARRA 3CVIH 2QKIB 3UTPD 1KF9B 2E8YA 2NW3A 3G5YB 5HSFA 5IB4B 3SKMB 1WZ1L 2NZ9D 5CP7A 2QHRL 2W92A 2Y36L 1RUPL 1F3JA 3T2PA 4MJ6A 3BKYL 3SDAA 3PP3H 4XXDB 4DKAA 1BX2B 1F11B 3EJJX 3QO1A 1D9KD 5EORL 1LO5B 3VXRA 3B5HA 3W5MA 3QYCA 3PP4L 3GGWB 2F5BH 3DXAB 1I85C 3EOBA 2XKNB 4UINH 3HNSL 2WP3O 1JF1A 1SYSA 3GSNA 1JK8A 4R96A 5CGMA 4JDVB 4HWEH 1NFIB 1J05B 1JWMB 3SDAD 5F7UA 3TIDB 4X7SH 4NJ9L 5E08H 3FT3B 2BNQA 1T3FA 3X3FL 4TPRL 2BFVH 1J8HE 4Q2ZB 1A1OB 5GISL 1P9MA 5IVXE 1AD0B 4AJ0A 4M4PA 2UY7A 5KANI 4MZ3A 5F7EL 5IESL 4NJAH 1WLHA 3Q6FB 3FO0H 1MHEA 5D5MB 3I9GL 4MQXC 3MRDA 1KELL 4R4ND 3T2NL 4R7NA 4H8WC 3WJJC 3T8XA 2B1AL 2BNQD 4DGVL 3G6AA 1CXHA 3MROA 1QPXA 3FFDB 3DIFB 2OMNA 1GAFL 2UVFA 2Y72A 3BDYH 3BW9B 3BZ4B 4KUCF 5L6YL 3WN5B 4G6KH 5J1AA 2P43B 1ED3B 1S5HA 3ARGC 5J6HA 4ELKB 5BV7B 3D0LB 1ONQB 4DAGH 1ORQB 4AQ1B 1QBLL 1HSBB 5SX4I 1SQ2N 2GW5A 3AXLA 3EO0B 4I2XB 1I9RL 2V9TA 1I3VA 2IALA 4RGOH 4JPVL 5C2UB 2EYSA 3CMOL 3U9UB 2R2EB 5FIEA 2FX7L 1ZANL 4Z7VE 2FHCA 4HIHB 2Z31B 1NCWL 4XCYB 3LSOA 5FCSH 1J1XH 5ESVA 3L7EB 1B3JA 1SM3L 5BO1L 3H2WA 5C08A 3K4ZA 3VG0L 5D4QA 3IXTB 3Q5OA 4ZPTA 4ZOBA 4JQVC 1YEDA 4D9LL 1GIGL 2I9LB 5C0IB 2Z91A 4OZHB 2VZ1A 2Y7QB 2VLLA 2VZSA 4GAJL 3TO2A 5IEHA 1I1RA 3QQ9C 4WW2F 1ZT1A 2FJGA 2DWDA 1ZS8A 1DQMH 3MX0A 1S9WA 2BSTA 3FZUD 4M9OA 4J3VA 4P4RA 1NEZA 5JLZB 4O58H 1TVBA 1F42A 1S7VB 2F8VA 1UQSB 5C08D 4NNPH 1B4RA 2O5XL 3HZMB 4XPGH 1SBSL 4PJBB 5ETUA 1TMCB 25C8H 5T1DH 3TYFA 4IDJL 1RMFH 32C2A 4YDVA 5J3HD 3E6HB 4WI9A 4WHYG 2E7BA 2DQFB 4P49A 2BVYA 1IGJB 3KPQA 1QR1A 5KSBA 3MRMA 4XC1H 4GRLC 2VDML 4HJJL 3LH2H 3JBG7 5I8EA 4UNUA 3MJ9L 2DLHA 1Q1JL 3WSQH 2EDXA 4IOIB 2X1QA 3IDXL 4BFBD 2MHAA 4M93B 5IMLA 3K8LA 4WJ5B 4LLVA 3MLRL 3T4YB 2J5LC 3KNBA 2OTPA 5CSGA 2PXYB 4Y8DC 4NZRH 2D7QA 4WENB 2X4OB 3JZ7A 4FZEL 4DN4H 4YBLC 5I30L 2VWEE 4RNRA 4CW1A 1F13A 4XPHL 5DWUL 3S5LA 4OB5L 4EQ3A 4RGNB 2OXGA 3BN9D 1YYML 1LE5B 1ZA3A 4XC3H 3VXPA 1KTRL 2J8UA 1KLFA 4GW5A 4GKNB 4GRMB 4JANB 1QUNA 3LQMA 4L3EE 2HJLB 4C57C 3GJFB 5JUEH 3B2UD 3SCMB 1DBBL 2Q76A 1R5WA 2FDBP 1UACL 1NLDL 4FNLH 5GS0C 1EJOL 5INCA 2HYMA 1KIUA 2C3VA 1G6RH 3B9KC 4POZC 1FV1A 1NGYB 3G5ZB 5E03A 1PYWB 4XMKL 1JVKA 3SBWC 2E6JA 3MNWA 4M9PA 1XIWA 4R97B 2FJFB 1QZ1A 4HCRL 1WTGT 3SY0B 4HIEA 5IQ9A 4MA1C 4JKKA 2CLRB 3RZCA 2QADB 1YMMB 4HT1H 4JPIB 4OKVA 4PRIA 3EO9H 2A83B 3UTOA 3EYOA 4P3DA 2P7TA 1K4CB 4IRZH 3FFCE 4OAWA 3V0AC 4KZDL 4PTUA 4HS3B 5I1IH 4D0BB 1EFQA 2Q86A 4IS6B 2PF6A 2EEAA 3DUSA 4R3SB 5JMRA 2F53E 2AW2A 2YZ1A 3LB6C 3EZJB 3HB3C 1SJEB 1XIWD 3FB8B 4CMMB 4XVTH 2A6KA 3RZCD 4KC3B 4MHHI 1I4FA 4PRID 1WWBX 1XGRA 4KUZL 3TCXA 3NBNA 1H3PH 2JKXA 1UM5H 2UVEA 2JCCA 3SQOH 1L7IL 3MJGX 1IZKA 4MQ7B 4XVUC 5ANMB 3ES6A 3H3PH 1F6FB 2YD9A 1K2DA 3VFSB 1TQBC 3GSVB 5EBMB 3WFCH 5AG9A 1KN4H 5F1IA 1KXQE 15C8H 2RR3A 3CSGA 1CDHA 1L9MA 4NO5B 1IAII 3NCEB 2PETA 4OFDA 1FORH 4P2RB 3OJVC 2Z4QA 4ZG1A 1FBIH 1NAMH 2L4OA 4HQQL 4Y1AE 1F4XL 5K9JH 3ZE0F 3A6CH 1U8LA 3BJ91 3OX8B 2XWJB 1Q9OA 3KYAA 5H2BB 4YHKL 1T0MA 1IT9H 5DRNA 2ARWA 2W0LA 5HHNB 5C0AB 1RU9H 1FGNL 1U8MA 1Z5LA 3B9VA 1NBVL 3BP6A 1T83C 1QLEH 4FHBD 3RGVA 3VFGH 1EMTL 1MFCH 2ADJB 4KK9C 1TZGL 4M6OL 4YXKH 1YPZA 1YYLL 3O2WL 1A4JB 3K74B 1FVEB 3V5DA 2VL5A 1T7VA 3T3MF 4TOYH 5L2KA 4N90D 4CJ1A 3SE3A 3CXHK 3SE9L 1KCVH 3RGVD 2GJZB 4HG4K 2HN7A 2OX5A 3A6BL 1EFXB 3GK8H 3QQ4B 3ARYA 5DD5H 4GAYB 4WNQB 4CU6A 4JDZA 3SO3B 1IGIH 4EUPB 1I8MB 4ELMB 5C0NC 1T5WA 3FTGA 3QIWC 5B21A 4NSKB 3MO1B 2OYPA 2WUCL 3QPXL 4YIQB 4HS6B 3KLSA 2VH5H 1T0PB 5L2KD 2WBJB 4FRWA 4NC0B 4G8GE 5IKCB 6FABH 3P4LA 3QDMA 5GJSH 2AVGA 3MUGA 3NN8B 4X7DC 4XAKE 1MFBL 4DKFL 1P4BL 2AXHA 4K9EC 4M02A 1SYVA 3MRJA 1ZGLB 1MHPH 3L3OB 2AJ3B 2DLFH 4L4TA 4FZ8H 4L29B 5IBLD 5EZJB 4L8DB 4WUUE 1KCUH 1NCAL 1ZV5A 3QDMD 1FYTA 5DJCA 2YD8A 3C8KB 3VWJB 5MERA 1KGCE 3T65A 5CD5C 4HKXA 4GOSA 1OTUD 3QUZB 3J8F7 1QEWA 4PJEE 4ZSOB 3IKCA 4HH9B 4JFYA 2IAMA 4NHUA 1D5ZB 4U3CA 5BVJB 4KI5E 3P77B 4Z95H 1IRAY 1S9XB 5GGRY 3TBSB 1ZT4A 3NCJL 1IAOB 3UBXB 4L4TD 5I1KL 3FCTB 4OLZL 4YDLC 4RAUB 3QPQD 3H0TB 1CLCA 2HMIC 4N8VA 5JPMA 1FYTD 1CD1B 3LHPL 5C86A 2OLDA 1X7QB 4H0IA 1X5LA 1WIOA 3KWWA 4PRPB 1WEJL 1JZ2A 3P4NA 3S4SG 4IJ3C 4NKMA 5AAMA 2IAMD 4I3SL 5K9QI 3HZVA 3DYOA 1YJDC 5F1KC 4NKOB 2GYSA 1V05A 5HYSA 4NNYA 1E28A 4JVWA 1A7OL 2FLRT 3ECBA 4P9MH 5J9PB 3DO7B 5MEOA 4KQ3H 1BQLL 1QLFA 4LP4A 3GIZH 3GUTA 4ZUVA 2VUOA 3FT2A 5FUCE 4MNGE 4XP6H 1CFQB 5I71C 2X6MA 1J0HA 5DJYB 1WBYA 1NCDL 4PRDA 2VR9A 5J4MA 4MA7H 2DS4A 1GZQA 3PXJA 4XB7A 3RVXD 2C3XA 4NQEE 1EUTA 4XPBH 3TT3L 2C1PA 4K7FB 1IAKB 1SEQH 5E9DB 2EEDA 3MLWL 5KN5B 3EYVA 4OIIL 3JWOC 2B8OT 2FATL 4RMVA 4HIIB 4M5ZH 3QDJB 4PJAB 1U95B 4GXVL 3UYRL 1FSKB 2JB6A 3M8OH 1HH9A 1JNHB 1FE8H 3ULVF 4YGAB 4HC1A 3U4EA 5EO1A 3W9DA 3IFNH 1FL5B 5J56B 4U6YB 4ODUA 1KB9J 5EU3B 3TP4A 3T08A 1IMHC 4NN7C 5DJ8B 4A6YH 1U8HB 1IC7L 4TNVK 2MFNA 1DJSA 5C09B 1FVDB 5TE6L 3RWIB 2RCSH 3L6FA 3C5SB 2E7LC 4N1EA 4YNYA 4KZEH 3UTQA 2ZWLT 1ES0B 3C60C 5F7MC 3MZTA 5LGHL 2GSIB 2EE9A 1OB1B 2VDOH 5EBLB 4HX1B 1RUAL 3QCTH 2CDGB 4JM2F 3QULB 3CFKB 1BJ8A 3QNYA 4JRXB 3CUPB 4JFDB 5ALBL 5E8PA 4GH7B 1U3YA 1U8PB 3UTSE 3DSFL 3QUMB 2XNAB 1U93B 2QSTA 5HJ3A 3B2VL 1DBMH 2NY3B 4UIKL 5ITFA 4NOFA 4JFXB 5KSAA 1EPFA 5D2LA 5IG7B 2FHBA 2CRYA 3QWOA 2J1KA 4PB9H 3RIAF 1F3RB 5DT1H 4HFUH 1ZLSH 4QHUA 3FAXA 4R4NC 3UXFA 2VABA 4MVBC 3U1SL 3LVEA 3MREB 3DRTB 4P57A 4ORGB 3L3GA 3O3AA 3RTQC 1WCBB 4CMHB 2OS7A 1QQDB 1WZ1H 2EKJA 4JY5L 3W39A 3P4MA 4CNIB 1RUPH 1P9MC 2HA1A 4DQOL 3V5HA 1UKSA 2YUZA 5I1LA 3BKYH 4PJ8B 1MFDL 3BE1L 5KSAD 2RB8A 4NO0A 3KR3L 3BYTA 4Q6IA 5IHBA 3IJHB 5EORH 3CFEB 1CFTB 5EWIL 4K07A 3SO5A 3PP4H 4DVRH 4Z7WE 1M6OB 4BZYA 2BX5A 1S7UA 5J06A 5JW3H 1NGZB 2XN9A 3O6KL 5T5NG 3BEVA 3HNSH 1JBJA 1AXIB 3QHTC 4MDIA 1F4HA 5CCKL 5E56A 2UWEA 4KDVA 3D9AL 4NRYA 4YEFA 3QQ3B 4NO0D 1D5IH 3AS3A 3X3FH 4TPRH 3D0VB 3MMEB 3U9PH 4MQSB 1X4ZA 4C58B 4NYLB 5JOEA 2NY6B 1KB5L 4YDJA 4RMQA 1JHKH 4FQ1L 2XN9D 1FG9C 3KDMB 4UV4H 5F7EH 5IESH 5D7LE 3VRLF 1CGTA 1GC1C 35C8H 2EDKA 1KELH 3MYJA 1CLOH 3QH3A 2NNAB 2ITDA 2VISA 3FZUC 3T2NH 1FO0A 1ZT7B 2ZCLL 4XX1G 5JPNB 3BGMA 4MYWB 3GMPB 4JRYB 3QIUD 4PD4J 3TPUA 4F7PB 1JYNA 4DGVH 3N85L 1YEIL 5FA4A 1QFWM 3GDBA 1KFAL 4QHNB 3SGKA 4F7TB 2YWZA 3HRZB 1LD9A 1BPVA 4XNYL 4OZIB 1KXVC 1JGDA 2EIZB 3P3YA 3EKCA 4WEUD 3F58H 3LQAH 5MEQA 3NGBB 3GM0A 1I9RH 3CFBB 3OKEA 3ZKMD 2OTWA 3VXUA 1GHFH 3FOLB 3U4AA 3CMOH 3G6JE 2HT4D 1WAAF 3VFRB 2BHYA 3O41A 4ZTOL 3B5TA 1UZ6F 1NCWH 2BK8A 2EYTB 5ICYB 4HK3N 5JDSA 5BO1H 3UTPE 5DJ2B 4QXWA 4LVOB 1DCLA 4V1DA 3JXAA 4ZYKB 5IHZB 5DR5L 4D9LH 1GIGH 3QNXA 3KPLA 1T04B 4JCMA 3CC5B 1M7XA 3FQRB 4KKLD 3VXUD 4XAWL 1BBJB 4M7JL 3O9WB 4NRZB 2O93L 3P9LB 3L9RB 3STZA 4F15C 2YC1B 4BELD 3IFOB 3S5LG 1FL3A 3ARDB 4LGRB 3ZYJA 1BAFL 2BOBA 4P46C 1JUFB 4EVNA 1A3LL 2O5XH 3WCYA 3V8CA 4H88L 4Q9CA 4OJFL 1BD2B 4V1DD 3BDBA 4MNHA 5E5MA 4IDJH 4OCRH 3DGGA 1MLBA 4OZGB 4RMTA 5BQ7B 1YMHB 3PHOA 4G80A 5B4MD 3DUHA 2BSRB 1KLUB 3ZKNC 1JGUL 1QOKA 4U3HA 5C0DA 3GMOA 5E8DH 3D6GA 5J6GA 3VXRE 5HVHB 5DC4B 4OQTL 3O6FB 1LGVA 1ZTXL 2I9TA 1QVOB 3THMH 3MJ9H 5ADOL 3MACL 4QNPF 1Q1JH 1OAUL 3IDXH 3QG6A 3MLRH 4NQDB 4DUWA 4OUUB 3HPLB 3BZFA 2BNQE 3DVNA 5HYJA 4YXLL 5C9JA 1CYGA 4XPHH 5D1QC 3VD3A 2ITCB 2EICA 3MRKB 3LKSA 1I7UA 4OB5H 3ZL4L 4ZXBA 1T1YB 1RHHA 1UT9A 3AM8A 4OQ1A 3RWDA 2F58H 2J6EL 4P3CL 3U0TB 3BD5A 5ILTH 1FLRH 1U8NA 5DJ6B 1U42A 5FO9B 2CLVB 5HYJD 2FECL 4JFFA 1AKJB 1UACH 1EEZB 5BMFL 5HYIA 4JRWA 4O5LH 1EJOH 3C2AH 2QSCH 3L3DB 3U6RB 1HK6A 2EDHA 2V7NA 2X70B 3LMJL 4ZXBD 2G75A 4XWOC 1KNOA 4XMKH 1J0ZA 3WIFA 4DW2H 5DVNA 2X9WA 1KCRH 1UZ6E 3BP5A 4UT9L 2DQCL 3CK0L 3ZKQD 5HDQL 1FNSL 4HCRH 2CPCA 2R0ZL 4JFFD 2VR5A 3JTTB 4XNZB 4MAYB 3QAZB 3MA9L 5F7DA 4X6BB 2AABL 4ZOAA 5DJDB 4KZDH 1PD6A 1DUYA 1KYOK 3L5IA 4LFHD 5C08E 1BWMA 5IFJB 4Y2OA 5D1ZA 3ZT5A 3GMRB 1XH3B 5B38B 5HI4D 2HT2D 1MCSA 5BRZA 4NP4L 3KPSB 3QFDB 4QWWC 1M7DA 4Q9RL 4X6CF 1KT2A 4KUZH 4PJBF 5HVGB 3TLRA 4UU9A 1IEBB 5L8KB 3I6LD 3I6GA 3ABZA 7FABL 3ZDYF 3MTRA 1JGLL 1CDYA 5D1ZD 2CKBH 1V3LA 4MD4A 3LQZA 1DQJB 4Y2DA 4LQ1A 4ODWA 1A6ZA 1QR4A 1F4XH 3DV6B 4TSCL 3RX8A 5IMOB 5BRZD 4RFOH 1G6RA 1OQXA 1SEBA 4YHKH 5EB9A 4F9LC 3BRDA 4ZD3L 4JHBA 4JJ5A 2WINA 3BUYA 1FGNH 3SPVB 4ZO9A 1NBVH 5E1AA 4WO4A 1U8KA 5KSBE 4AIZA 3PWUA 4P0DA 1KOAA 1MUJA 2R8SL 4N5UA 1P7QB 2HJKB 3KYKH 5I2IB 3L3KA 2V2WB 4PRHA 1AXTH 4Y2DD 3PGDB 2CMRL 4JZJB 2HAZA 1DQQA 3TBYA 2CXKA 4ZFFB 1YYLH 1KN2H 2N1KA 1R3IL 4NIKB 3V6ZA 5GJTH 4MA8H 2X4RB 4D8PB 3O45B 4IMKC 1LMKA 1ZHKA 4FQHB 3SE9H 4WO4D 5I8CA 1U2CA 4PJCF 5IR1A 5TF0A 3AMLA 3MLTA 4R0LB 3BISA 3GHEL 3LRSA 1T03H 1N0LA 4W6WB 1CVRA 4PRHD 1NCTA 4X0KA 1FZMB 3DUUA 5EUOB 5HHXL 5CZKA 1E4XL 2NY2D 2QBWA 2QJDA 4FQ2L 4Y16A 1P53A 1UB6A 1PKQA 2J8UE 4LARL 3TPKA 3QPXH 2Z92A 3GHBL 4N8VG 3EFDL 3A6OA 3G5XA 2QSVA 1VESA 5IGXL 2HG5B 5F1NA 3HC0B 3SKUD 2VDLL 5IM7B 1NAMA 4LVNB 4BUHA 4KTEL 2XV6B 4DKFH 1MFBH 4AM0A 5DQ9B 1P4BH 5EDXA 4Y5YA 4LKCB 2M8XA 5T5FH 3BPNB 1WF5A 4WFGD 1RQ5A 4Y16D 2X4UA 4TUJB 1KSRA 4ETYA 1Z9SA 1KPRA 4LEXH 1DDHA 2I07A 4X5WA 5DUPL 2OQJA 4GW1A 1ZA6A 5IEKA 5GPRA 5SWSA 3UTTB 4PRIE 2A9ML 1YEGL 2GITB 3T1FA 4HUVB 5CHNA 4XNXL 4LRNL 3C9NA 4PJDA 3I6KA 4X6CE 3MLYL 3PG2A 5DRWA 1GXEA 1MFNA 3IDJA 4ZMAT 3NCJH 1V3JA 5F96L 4OLZH 2NXZD 3S9DB 1MRCL 4N9GA 5SWSD 4TRPL 1CDJA 3BQUB 4HEME 3LHPH 2JCCE 4J8RA 3LKPA 4YHYB 1WEJH 3N1QC 4EI5B 4PV8B 4I3SH 3DURB 4X4YB 2JJTC 5F3HA 2R9HD 1SJHB 2CK2A 3VMPA 5DYOA 3TM6A 5B3NA 4X6DF 4HUXB 3U46A 2DYPA 3V5KA 1A7OH 1EGJH 4U0RB 1NJ9A 2FWOA 5C0CA 1N3NB 5IB2B 3K1KC 5IFAH 1XZ0B 3HE6C 1LEGB 2WAHA 2P8PA 3SKJH 1R3LB 2YZ8A 2VKWA 4N90E 3VU2A 5GRUL 5E2UL 4BSVA 3BPLB 1NCDH 5E4EB 3MFGB 4FFWD 2EE2A 2DQEH 4F9PA 3VJ6A 1PY9A 1AIFB 2Z8SA 3UBXG 3PGFL 4PJCE 5AZEL 2NY4B 5CEZD 2KKQA 1UEYA 3HCVB 2DYPD 1YPZE 3WKML 1UCTA 4UQ3A 2ARJQ 3TT3H 5C0CD 4YJZL 5FGBA 1ZSDB 3ARBB 2DTSA 4I1NB 5T1MA 3RL2A 5L2KE 4OLEA 4OIIH 4BSWB 4ELMF 5CSBA 1OTTD 2YPKA 1IBGL 4GXVH 3TIEA 3UYRH 3OJ2C 3Q5TA 1EJ6A 2IGFL 3QDGB 2ZUQB 3MJ7B 2DN7A 4M3JA 3GZKA 3ZKXC 3EJZD 1HXYB 3MCKB 3VXMB 1WBZA 5IFHL 1EHLL 2VB5A 4NWUL 2A0LD 4BH7B 5KSAC 4DCQB 5E8EB 1X5IA 3S36L 3WL9B 3ULUF 1RJLA 4WY7L 3WE6A 5MEPB 4C55A 3QDME 3V0WH 4AMKH 1PX4A 4HLJA 5TE6H 5H35B 1AP2A 5I16B 4HZAA 5GQBA 4UTAL 3Q6GL 5DJAB 3QRFM 1PEWA 1G0XA 5LGHH 1U3JA 4M6ML 5KVEH 4O9HH 2DQUH 3IXAA 1RUAH 4NZJA 1B0RB 4YEEA 4D0CB 2X4QB 1A2YB 4D3CL 4Z5RB 4L4TE 5E5UB 4CN6A 4D94A 5ALBH 5DA4A 4LU5L 4Q6IC 3TBVB 1S7XB 2VAAB 2FIKA 4F3FA 4MAUL 1FYTE 3DSFH 4P2OD 3EDKA 4KK8D 4P5TA 2AJZA 2IFFL 5E4IA 1CE1L 3B2VH 4UIKH 43CAB 3NTCH 3FQWA 4O2FB 1LK2A 2HT3C 4PJFA 2EDTA 3P73B 3RWHA 4TVSa 1WWWX 1KEML 5T3XL 5TJWK 4WW1A 4BKLB 3BEWB 1G7LB 1RZ8A 2LTQB 2BXZA 2E9WA 1SMOA 1U8OA 1E27B 3NZHL 5CEYA 5EFIA 3T0EA 2FECI 4I0PD 4P5TD 1YUHA 3VFUB 2ZUTA 2CSPA 4DQOH 1K5NB 4HWBL 4WWKB 1MFDH 5F6HJ 1Q9LB 3ELAT 1RUQL 3FOMB 1BMGA 4NQVA 4A6YA 4TUOA 3JV6B 5EWIH 1YEHL 3PABA 2B4CL 2VE6A 5CIPA 3T0BA 5HD8D 3DGCR 1N5YH 3CDGB 1AQDA 3UTZA 3O6KH 1BVKA 4JFOB 4F57H 3T0ED 2DMKA 2HT4C 2X7LB 2PYFA 3O3EA 5I17B 4I4WA 4K8RC 1R3KB 3DROB 3RVTD 1F45A 2VLJA 5JORA 5F7WC 4KK6D 3P9MB 1G9MH 3DX6A 1KB5H 2B1HH 1OWRM 3VXSB 4FQ1H 4NHCL 4LLYA 2LVEA 4ONOA 2C9AA 4HJ0C 1K4DA 5DO2D 3OF6A 5C1MB 2W0FA 2PW1A 4N9OB 1Z3GL 2ZOLA 2ZCLH 4UOW0 4JZNA 3TNMA 1T20A 5GGRB 3BH8A 3OV6A 3IU3B 2VLJD 4Y4HB 1I3RB 3N85H 1EO8H 1YEIH 1IAIM 4RMSA 4WW2C 4XWGL 1KFAH 2OTUA 2P8MA 5EZLB 2AEPL 1IQDA 4GS7C 5E8OA 2ORBH 5A2JH 5I9QB 3PQYA 5B22A 5B4MC 5BW7A 1TETL 4YR6B 3NFPB 5EOTB 1F5WA 3OF6D 2JLLA 5SX5K 4GKZB 3PHSA 2CIKA 1W0WB 2RQ8A 4FP8L 1C16A 1J1OH 2AERT 2P47B 5KZCD 1JV5A 4RMWA 3PQYD 1LDPL 1BBDL 4KJPD 5F72S 2ATPB 4OFYA 1VADB 1Z9LA 2QKIA 3GNML 5DHVH 3DI2B 2V2XA 4K7PX 3OKDB 5DR5H 1ND0A 4R90H 5D1XC 3G5YA 3MNZA 5E2JA 1D5MB 2YD4A 4XAWH 4DKEL 4M7JH 5D2LE 1HEZB 4YC2B 2EDEA 1F3DH 4XXDA 3HMXH 2AEWA 2NY0C 1SVZA 1E4XI 1LO5A 2EDQA 3CZJA 5SV3A 3JSSA 4FQXC 4OJFH 4PRNA 4QOKA 4P5MB 4L8SA 5DMGD 3WHXB 4MDJB 3TF7C 5DVMA 1OAKL 3RU8L 4UV7H 3VFWB 4JDVA 4LLWA 3HC3H 4QRUA 1JWUA 3RWFB 1CG9A 2AK4B 2BHZA 2R1XA 4APQC 5FOBA 5EUKA 4OQTH 1MJJA 1ZTXH 5MENA 4URTB 4AENA 2XN9E 2EYRB 1AD0A 2X4TB 1ZXQA 4XH2A 5F9AC 3F62A 5ADOH 4QOKD 5DVKA 5IHUL 3BO8B 1OAUH 3Q6FA 5D5MA 3CX2A 2D7NA 4B7LA 2UWEE 4O00A 3VGBA 1INEL 5CSZA 4YXLH 3RY5A 1FNAA 3WEXA 2JELL 5MEND 4PJHB 1A6AB 4HIJB 1A64A 3ZL4H 3KXFB 5IROA 1MH5A 3SGJA 1ED3A 4AT6B 4M8QB 5DZLA 4X6FB 4PGJA 3PIQB 5I75C 4PUBL 1NAKH 2CLZB 2WV3A 2XZAL 2J6EH 2BOCB 4WIQA 3ILPA 1MNUH 1JWSA 2GY7B 3IKKA 4OZIF 1E6OL 4MXVF 3QEHB 5HHQA 4QKXB 4AH2B 2VXVH 1FL6A 3WO4C 1NMBL 5EO0A 1B9ZA 2YD1A 3U9UA 4NCDA 3EDFA 3FB7A 1A02N 4MA1B 3TVMB 3RKDC 2AXJA 3QUKA 4K3HA 1IKNA 3DHMA 3OMZA 3RVWC 1LP9A 3CK0H 5HDQH 1FNSH 3WFHA 2GHWB 2W91A 3OSKA 3VXUE 2R0ZH 4G7VL 3AVEA 4OZHA 4W68A 5GRJH 1I3UA 1UB5B 3MJ9A 3MA9H 4HWZA 2AABH 2FL5B 2R29L 4PJ5B 5GS0L 4JJHA 2GUOB 5JLZA 3ARXA 3ARFB 4JHWL 3MRIB 1CR9H 2WANA 4R9HA 5J11B 4V1DE 2GK0A 4YHNB 4NCC1 5GRVL 4PLKC 2YA2A 5FYJD 3VRIB 1XF2A 5FV2A 5J13C 1QBMH 4WV1A 5EOQH 1KXTB 3KPMA 3X11A 5KANG 5HDBF 3TJEL 2DQFA 4NNXB 4OZGF 4JB9L 1FFNA 2AI0L 4KJQC 4C54A 3ZTNL 7FABH 2X4SB 3HS0A 3SOBH 1IGTB 5DD1L 1M05B 1XGYH 3OXRA 1RURH 3ME0A 1KJVA 2P1YA 4GRWH 4N8PA 5EBWB 3FKUS 1PZUB 2VDNH 1R5IB 2NTFB 5TF1L 2W07A 4ZD3H 2XZCL 5EG6C 3V7MA 2JJSC 3HN3A 4Y16C 3H7BA 3HR6A 3PF2A 3HHRB 1G7IA 3PUCA 3EAKA 4HCRA 4KJWD 4CU7A 1KULA 1WTLA 4ZOEA 3K3QA 1MPAL 3IAQA 3QXDA 2CMRH 5SX5H 4XHJD 5ERWA 1AC0A 4IRJC 4PJ7F 4ZAKC 1X5FA 3RWCB 4L3CB 2BNUA 1BLNB 4PGBA 4QTHA 4OCMC 4JANA 4DOHE 5HYJE 1VGKA 3S6CA 4QY8B 5FUOL 4HGKC 5IJKC 1CXKA 5DURD 1MCRA 1IVLA 1BJ1H 3IDIB 4DGIL 3U2SB 3GHEH 4HULB 1HH6B 2NXZC 5CJXA 3RBSA 4X8JB 4QT5B 5HHXH 1E4XH 1VFUA 1INDL 4LARH 2BVEA 2DLEA 1EAPA 2P24A 5D7IB 1MHCB 4JO4L 1FN4A 1FRGH 2IJ0C 4FFYH 4LRIC 3EFDH 4DUXA 3CVHB 2CKBA 4JFFE 1QG3A 1Q9WB 5IGXH 3HI5L 2VDLH 2X1OA 2ZNWA 4KROD 4Y5VC 5LAXB 3UZVB 1RZKC 2JTDA 4JREC 4AG4L 4KTEH 1RY7B 1G9NC 5I18H 5C6PB 2Z8WC 3KYMA 5CD3B 3GIVB 4HS3A 3BPOC 4KQ4L 4IS6A 2CIIB 4ZQKA 4R3SA 4WGWB 1Q9KB 2GJ6A 3ROLB 4L8CB 3CFIC 2BY1A 5DUPH 4OF5A 4HWNA 3FB8A 3X3GL 4Z7QF 4CMMA 2W60A 1T22A 5LQBL 5DQDL 1YEGH 4LQFL 1MAML 4NT6B 1LO4L 5GGUB 3WFZA 2QADD 4FABH 1GOHA 5H94A 4XNXH 1MFEH 3I6LE 1RIUL 3FO2B 4LRNH 2IPUK 1VB9A 1REIA 3CDYA 3PXHA 4K9EL 1TNNA 4XI5C 2R4RL 5B8CB 2GQHA 4C83A 2DI8A 2GJ6D 4NO5A 3SDCB 3GSRB 2N4IA 1GCFA 1WT5C 3O8XC 5MP6H 1EVTC 5BRZE 5F96H 1JI1A 2BVTA 4R2GC 4WDIA 4F80A 4H1LB 3TBTA 1G6VK 3OX8A 4TRPH 2VN7A 4ZFOB 1T1WB 3HC4L 2CJUL 4U2YA 2DIBA 4LHUB 5C0AA 4ZUTA 1FZKA 3BX7C 3FO9B 4DEPC 1DE4A 3MRBA 5HI3C 5BJTB 4M62L 3RWGB 3ZDZF 5T1LB 4B41A 3IAGC 1R0AL 3H9HB 3K2UH 2A77L 1CICC 3SE4A 3F6LA 3GSXB 3UZQA 5IWLA 5GS1B 2EO1A 1P7KB 2GT9A 3HR5B 5IUSA 1YECL 4Y5XB 4ZFGL 5GRUH 5E2UH 5C0AD 1JI2A 4LDLB 4CL7A 2BHUA 1JZ5A 1NMCC 4M6NH 1GYAA 3NZ8A 1C5CH 1EFXA 4PRHE 2PCPA 5AZEH 1YJDL 3EFFA 2WQ8A 3WKMH 4KK8C 4EDXA 2NW2A 4EUPA 4PFEA 2IBZX 4RFEA 4WU7B 3BSZL 3QUYA 3MO1A 4JM2C 1X3DA 1MHHB 3H42L 3QIBB 5EUOF 2XTJB 2GFBB 4ERSH 4Y4FB 4B0MM 5D7JC 3FN9A 3OAZK 1NCNA 2IGFH 5H37H 1T4KB 4EN3B 2D7TL 1EFXD 1P4IL 4WFGE 4ZFZB 1QYGL 2H26B 2QQNH 3NCYS 1PKQE 4MHHG 4HK0B 5EOCJ 2AKRB 3WFBH 4DGYL 4NWUH 1HYRC 1H8SA 3EDEA 1O5DT 2AJ3A 3QUYD 3QR2A 1YC7A 2H2SC 3RGHA 1P7HL 4MSWA 3BIKA 5EZJA 4UZGA 4YHOL 2G9HA 5ACZB 5JQ6L 5DD6B 3W2DL 3JWOL 3S3SA 4PRBA 5FYKL 1EGJA 3VWJA 4UTAH 2DM4A 1ETZB 1M71A 5HPMB 5FB8A 4LK4A 3QUZA 4M6MH 1QO3A 4MJ5B 4RIRA 1WITA 5L2JB 3UPCA 5EC2B 1BZ7A 3P77A 1S9XA 2WBKA 4JE4B 3RVTC 5IIEB 2BY2A 5EU5A 2FGZA 2YHGA 5SWSE 4RAUA 4MAUH 3O6ML 3FB6A 2IFFH 1Y0LB 3RDTB 5ESAB 1YC8A 1CD1A 2YSSA 3VWJD 2BSED 5DJZB 4PJDE 4OCSH 2SEBA 2V7HA 3QUZD 3GRWH 3E3QC 3OAUL 4OF8A 5KS9B 1DLFH 3QI9B 3FRPA 1YA5A 2JIXA 4S2SB 4YHIA 1KEMH 5EZOL 1V3KA 5T3XH 4KDWA 4IIQA 4WEMB 3BWUC 5DK0B 2H41A 3DO7A 2IEPA 3NZHH 1BQHA