4M7ZB

Unliganded 1 crystal structure of s25-26 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
LKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-26 Fab (Igg1k) Heavy Chain
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7zB01
3CFKB 4LSQL 5LGJA 1M6OB 4XNQB 1JL8A 2HH0H 2DQFA 2VE6A 4UV4L 1IGTB 3QHFH 2BNQD 4Q97A 1QHPA 3DLQR 4QHUA 2FHCA 7FABH 2CUMA 3EJYD 5EN2A 4UQ3B 3NH7L 5I19L 2EICA 2VWEE 2AXJA 3WUZA 5JIKA 4MD4A 1DSFL 5KG9B 2MKWA 1U95B 1U8NA 1U8HB 4NJAH 4JRXD 4NOFA 3LS5H 4EUPA 2PO6B 3U9PH 4PGCB 5CD5C 3MRGA 5E9DA 1ZMYA 4HF5H 4K55A 3ARDB 1BM3H 1FAIH 4YHKH 3U48A 4JM4H 2K3TA 2QJDA 5D4QA 1JHLH 3RZWA 4NQXB 1IT9H 1GGCL 2IBBA 3DWTA 3F7QA 1BBDH 3VW3H 1VEPA 5ALBL 4N8VA 5D7LA 2Q20A 4POUB 2CXKA 3CFEA 5GS2H 4Y1AD 5H94A 3CFDA 2EDLA 4PJDB 4F7PB 1NFIB 1YYML 4HZLB 5LGHH 4PRIB 2JB5L 3WO3B 1A3LH 4R3SB 4P3DB 2V6HA 3F5WA 5GZOC 1I7UB 1NCCH 4Y2DA 3GB7A 1NGXB 5KSAB 3TBYA 3STLA 1K5NB 2X2YA 3TNNA 5SWZA 3IRPX 1CGVA 4OLYH 3SKJL 5T3XD 3CDYA 4EI6B 2GTZB 3RFZC 3Q2CA 1RIHL 4TVPE 3RKPA 3Q48A 1FE8L 3T0WA 1J10A 3N85L 1X5FA 3RY5A 1Z0NA 5ABDE 4H1LG 3SDAD 2D03H 1KEMH 3MA7B 4G9FA 3PP4L 4KUZH 4KVNH 4RGMC 1TXKA 4U1SA 2Q7YA 2MQ3A 1JWMA 1BD2D 4BH7A 5I1JL 3FAXA 1W8OA 2QADB 3EDEA 5DJCB 2FSEA 1B88A 1F4HA 3KNBB 4N1CA 4DVBB 1U3JA 4S10A 1VKXB 3PL6C 1KC5H 4JFQA 4JM2B 1IGML 3MRPA 4GLRH 5TDPB 1NKRA 3BPLC 5B3NA 4LLMB 1FL6A 5EU5A 4OD1L 4WW2C 3KHOA 1H8OA 4U2ZA 5CS7A 4PD4J 4YX2H 4M9OA 2YPLE 5E8OA 5DQJB 4F33B 4XVSH 1JP5A 1WZ1L 2VISA 1K4DA 2AJZA 4Y2OA 4PJFB 5TFSL 1A6AB 1RZJL 2Q8BL 2F5AH 2BC4A 1FRGH 1LEKB 2PO6C 3PXJA 1X44A 3JTTB 3VE0B 4FQIH 4PPTA 4ZFFA 5EBLB 3JUYA 2VZ1A 4H1LA 3ARDC 1XGPB 3D48R 2X4PA 1OP3K 1JRHL 2EC9T 1OB1B 5F3HB 3TIDB 1E4WL 3BRGC 4P9HL 3TNNB 3GHBH 4RFOL 3MXWL 1N3NA 1Z5LA 4PP2A 4X9GA 4KQ3L 1FO0A 5GGQL 2GTZA 4X6BA 2JCCE 1MAMH 2P5EB 4QRSB 3OKOA 3U9UB 1VHPA 3S5LA 4YNYA 4M5YL 4QRQA 3VXQA 5F88A 3MZGB 4WV1C 2PNDA 4DVRH 1LO4L 4EDXA 4KROD 3GEWB 3AREC 5HHVH 1EHNA 3KS0H 2AJUL 2BY2A 1KG0A 1NUGA 4BH7B 1KCVH 1RUAL 3ARUA 5DYOB 1Q38A 3NAAL 2HRPL 1B90A 4NRXA 1SVCP 1YDPB 4G6AC 2O5YL 4G8GE 1S9WB 3HRPA 2CUIA 5JTWA 3TA3C 1F3JB 1MFCL 1FFRA 1HCVA 4FP8L 3WIHL 1OAXH 1R24A 4ZS6D 4KY1H 2C3HA 5C0DA 3TIEA 3QDHA 1MHCB 1DBKL 1ZLSL 3WNOA 4P46A 1PZ5A 2EIZB 4FQXA 3FZUC 5FYKH 4PJFA 1KCUL 2PUQT 5EIIA 1MCDA 5DD1L 2F53E 3CDGA 4NFDA 4MAYD 4LIQE 2EDWA 5GRWA 3VFVB 3DMMA 4WHDA 3PNWB 4PG9A 3FB8A 4HAGA 4R97C 1QFWI 3PWVB 4D0DA 2AXGA 2W9DH 3WHXB 1RMFL 1FLRL 4MX7A 5CZKA 1MQKH 4ODWB 1XGQA 4TQEH 3ECBA 1UB5A 3CSBA 3ULVL 4TVPH 1ODAA 3CFCL 1KJ3H 4BFIB 4DFHA 3HAEG 2VDPL 4BUHA 3GBMH 2R8SL 5KVFL 4YHIB 3G9AB 3RJDA 4K3EH 3RPIB 3GBNL 1OTUC 3S5LB 2WQ8A 5ILTL 4U3HA 3CLFH 1OW0C 5DUPH 3VGDA 1NEZB 1EHXA 2VQ1B 2H26A 2Q6WA 9CGTA 4JKKA 2HG5A 4KKCC 4PRAA 5AYUL 2CH8A 3D0LB 3IFLL 5IBLD 5L7XL 1CD1B 3F7VA 3OB0H 3HE6B 2AXHA 5GISL 3GGWB 4NJ9H 3BGAA 3BPCA 4L8CB 5EO9B 1R3JA 3GSRA 1ZS8A 1GGBH 1PX3A 3GSQB 3X12B 4HPYL 3SGEH 5FCUL 3WSQL 4MXVF 4FTVB 1PG7H 4OT1L 3GMRA 3BKCL 1RSFA 3CVHL 5AZ2L 5J11C 2E7CA 5J4MA 1QA9A 2R0WH 43C9A 4FQ2L 2EEDA 5CD3A 3MA9L 4JFPA 2OI9C 4Z7VF 4U7SA 1KT2B 4LSUH 1JZ6A 2HLAB 4R7NB 3BGFC 5IF0A 5INDB 2EE2A 3HE7B 4LK4A 5HYSB 3AS2A 2GITA 4JZNA 5I1KH 1KTKE 4ONFH 3V7MA 5IGXL 2ZSWA 5EIIB 2EDJA 3N06B 4MAYA 4WWKA 3RVWD 1IJ9A 4U0QB 5T5FL 3W82A 1LO2L 1AXTH 1WCBB 4PBWD 1B4JL 3BAEH 1ZANH 4JKLA 2P48B 4UT9H 1IARB 2EDBA 3OG4B 1NC4B 5DD0H 2VLRA 4I48B 2CQVA 2H32H 1TZHB 2X70A 3DX9B 4JY5L 4CVWA 1GPOL 3S4SB 2FECI 1Z3GL 4X9IA 1D9KA 3QJFA 2XTJB 2B1HH 4CVXA 3MBXL 4Z7NF 3M8OH 4FABH 5IESL 4IIQC 4JRXA 3TC9A 3HE7D 1GGUA 4LU5L 1BPVA 2HTKD 1PKQE 3B9EA 3HZKA 4MGXA 3MUY1 5IMMA 3EHBC 3O3EA 4ZDHA 4YXHL 1KB5L 1V3LA 4OZ4A 1IGJA 1I3GL 3MJ7A 2C1OA 3BHBB 1FLTX 3RBSA 2VMFA 1HIMH 1D6VL 1DUZB 1SJHB 5TQ2L 3TBWB 4FZEH 2CLRB 5BOPA 3DSFH 4FQCH 1H5BA 3AAZA 1F4YH 2DQGH 4ZSOA 3T77B 1C1EH 1OF2B 1CFTB 2W65A 5ISZD 3AY4C 1QVOB 3H7BA 4QRTB 1N5AB 5T1KB 3TBTA 4AJ0A 4OM0L 1UZ6E 4OZFH 4NO3B 4LSQH 5F89A 1WVZA 2YUXA 4HGWB 4Q9BA 4O58H 3LKSA 43C9B 4BQ6A 4W6WB 3TA3A 3MOAL 4JFPB 1U8QB 4Y5YA 4YAQA 3T3PE 1PAMA 2IPTH 2XZAH 4NBYB 1K85A 2VQUA 3OL2A 5HGDB 3UAJC 5FYJD 1OW0A 5T1LB 4YHYB 2ZSWB 1DJSA 3TJEH 4PJAE 3MBEC 5DGQA 2LE9A 4RGND 5C92A 3BE1L 1NAML 2BHUA 3EYQD 3ZYIA 2CKBB 2FB4L 5GGTH 4LRIA 1MCRA 1CICC 1MLBA 5LG1A 5KVGH 5HHOE 4OZGA 4LVNB 3NA4A 4HC1A 1IT9L 4HS3A 4FZ8H 2BP3A 1KIQB 1BLNB 5DJ0A 1U0QA 1EO7A 1QLFA 1Q9LA 1YN6A 2HJLB 1MRCH 2VKXA 4UTBL 3RL2A 1SM3L 3HS0B 3JZ7A 3PDDA 4RFNB 3QUYB 2PW1B 4QRUB 2JB5H 2VAJA 3P0YH 3RGHA 5FYJE 2FH6A 4MD0B 4DKFH 3U46A 4GKZB 3MJ7B 5KAQG 3T09A 4LKXA 5H35B 1QSED 4IIQB 3X11A 1MJ8L 2H9GA 3QIUB 3LN5A 3QI9A 1ORSB 1CT8B 1L7TH 4P5TC 1IMHC 3FO0L 3BXNA 1CFTA 4HMEA 2HT2D 1UADC 5HHPB 2X40A 1HNGA 4NN7C 3LCYA 4KI5F 4TRPL 5C6WH 3MV9D 5KSBF 1GGTA 4KROB 1MI5E 5J6HA 2P8MB 5I15H 5F96H 1AC6A 4F58L 1N5YH 1MWAA 3MLZH 4NNPH 4PP1D 4L8BA 2NW3B 5HI4C 4DKEL 5DUML 3TFKD 4Z76B 3OWEA 1CD8A 3T2PA 1DVFA 1HHHA 3JVGC 4OSUL 5K9QG 1FG9C 5CBEB 3C8DA 3PGDA 3OXRA 4HXAH 3LQAH 2R1WB 2VOTA 1IGMH 4K3GA 3TZVA 4B41A 1JGLH 1CD9B 3ARBD 1MRFH 2P1YA 4NBXB 4UQ2A 5D8JH 4RGNC 3W5NA 2YXMA 3RI5K 5HYJD 3EO9H 1QSEE 4YK4B 3VA2C 3AM8A 4J23A 1S7QB 1XGTA 1YZZA 1TTGA 3SCMA 1WZ1H 1B0RB 1U58A 4LSRL 2GTWA 4XWOC 5DEFA 4Z95L 4PRHB 5DJ6B 3KPSE 4WFED 5IM7A 5BQ7B 4CL7A 1MCEA 2VABA 1CLCA 1J8HD 2PTUA 3MV8A 4HCRH 2AEPH 5DMKB 4OQTL 1ONQB 3W0WE 2HVKB 1INEL 4P57A 3JWDH 5DJXA 3GSNB 3TBVB 4M7KH 3UBXA 1B2WH 1KJVA 1FZJA 3P40A 2FZ3A 4JFZL 5ADOH 2FHFA 5I1HH 4PJDF 3O9WC 4XNUL 1JTOA 4LCYA 4R0LA 1UZ6F 1IVLA 1H15A 2WBWB 2QADD 5FM5O 2QHLA 5F7NC 4FFYH 1J0ZA 1A64A 2DAVA 2XZCL 5D1XC 1BVLA 4H26A 4UT7L 3HMXL 3QISA 1INDL 4JFOB 4Y16D 5JOEA 1IGTA 2OJEA 2HKHH 2D7PA 3F12B 3V79C 3RA7H 5ACZA 2GSIA 3E2HB 1EHLH 4AEEA 1LILA 5DGRA 3GSOB 1ZV5A 4HLZH 1NMCC 3DX8B 5J89A 1FVCB 5CWSA 1FL5B 3D69A 2ZCHL 2R1WA 5KS9F 1EVTC 4R6UA 4PRPE 1M7XA 1L9NA 3IDIB 3KPQA 4JGMA 3KYKH 4KZEL 3FRPG 5JXEA 5D2LE 3REVB 1YNLL 4ZXBC 4ETQB 5BZDA 3SKMA 5JLZA 5L2JB 1XGTB 4LKCA 2OR8A 5DEFB 1ND0B 5GGUA 1BHGA 4M00A 4C58B 3O3BB 3PWLA 4RGNB 4M1CC 5FA4A 5ICXA 2ITDB 2FIKA 4G5ZL 1AKJB 5LCVH 1DQLH 2HVKA 4JPIB 4P57B 4AY0A 2XI9A 3GRWL 1KCSL 1CK0H 1RZKL 2VR5A 1QEWA 5FO8A 2CLVA 5EBMB 1UZ8A 1I7TA 5DI8B 3MJ9A 2I9TB 1XIWB 1C5CH 2ADFH 4JJ5B 2MPAL 5BJTA 3QNXB 4N5EC 1T6WA 4CVUA 1L6ZA 5IMOB 3VGEA 4Z7WB 2VL5B 1XZ0A 3Q1SH 1T7ZA 5EU4A 4WIQA 3L5WB 5JPNB 1LO0H 1NCAH 2QSCH 1F4AA 3ZT7A 1G9ML 4QKXB 4PG2C 4JQIL 1IGIH 5E2WH 4LLWA 2HWZH 4BZ2L 5I1EL 3HZVA 2O93L 2X4UB 3BKJH 1SEQL 1TCMA 3ZDYF 4I0PA 5D1ZD 2ZWLT 1MHPL 4LPYA 4JPWH 1JVKA 4TUJB 4K3DL 5HPOA 1UEMA 2AJVH 1DBBL 5DJ2B 3VFSA 5F7FA 3KPQB 4X6EA 1RK0A 3I6LE 2XY2A 3P3YA 1N0LA 4IRZL 2VL4A 4XXCC 1CXLA 4G7VH 4HKBB 5JLZB 5JW3L 2BCKB 4MNQA 4LSVH 5TDNB 4F33A 2ZUWA 3DUUA 4PJHA 1G7JA 2OI9B 4TOYL 5DQ9A 4FRWA 4PV9A 1CDBA 4HMDA 2JJSA 2DQHL 3JTTA 4U1JB 5GS1B 1JWUA 5D93C 1CDGA 2AJYH 3IFPA 1FCGA 1B4JH 3VDCA 5T3ZL 3BP7A 3CGTA 1S78D 4WU7B 3MV7D 2QADC 1HHJB 5FYKU 4HGMA 4XBPA 4JPIA 4JPKL 4IBLT 1Z9SA 1UXWA 4J3OC 2Y72A 5I16A 2DMKA 3T65B 5LBSH 1G9NH 4ZPTA 2FJFB 4TNVK 1EO5A 5IOPB 1P4IL 5IFAL 4TULH 2OR9H 1U8NB 4ZUVB 4PJBF 4U1GC 4HUWB 3EBAA 3VXUE 2VXSH 1SEBB 4KFZC 3BZEB 1YQVH 3BZFB 3U4EA 4PGCA 4ZTOH 1FSKB 4Z7WA 3VFMB 2HKFL 1D5IH 3F7YA 1OAUL 5F88B 1OL0A 2MOVA 5DC0A 4GRMB 1KCLA 4GXVL 4P2OA 4WU5B 1YEGH 1KN2H 1DVFC 5CUSH 1E4KC 4FFZH 4POZD 4FZEL 1TCRB 4JCMA 5MERB 2QHRH 4GAJH 2ESVD 4PV8B 3V6OC 1BOGA 5IVNA 2UZYB 3RZCA 5GS0H 1AD9B 5I1LB 1P4BL 3RNKA 2YRZA 4EDWH 4DUWA 4TUJA 1JF1A 1QFWM 4PRBA 4HWBL 3ALWA 3WJLA 5A3ID 2DD8H 4HS8L 3EYUL 1WICA 5IK3A 1BMGA 3DBXA 4RNRB 4ZQKB 3WL9B 1H0DB 3ULSA 1ZAGA 2F9BT 4TSCL 5BVPH 1V7MH 4Y5VA 2FBJL 5DQ9B 4OGAD 5IHZA 5DHYA 2BRRL 3DMMB 2NW2A 1S5HA 4P5TA 3QDMB 5I9QC 1CU4L 1CTOA 2FB4H 4PJIE 1Z0MA 4H20L 4XWGH 1RHHA 1JWMB 5BV7H 4JDTL 1BJ1H 1AE6L 3TA3D 4HD9A 4KK6C 4Z7UE 4HFWA 5T3ZE 4PRHE 5HGHA 3QXTA 3FT4A 4FMFA 3BRDA 4N90D 3MRLA 5EIVA 4OUUB 2GK0A 5TDPA 3BGMA 1UT9A 1G9MC 4KK5C 4P2QA 3TN0A 4OIIL 3FOMA 4JZJC 3R8BB 3QG7H 3G04A 4KQ4H 3LEVH 1OQXA 3T08A 4JDVB 4NPYA 4QHKI 3P4LA 5I8KL 1NLDH 1U8KA 2HT3C 3NZHL 4X98A 3RHWK 5ISZE 1QOKA 2X6MA 3AMLA 3GGWA 1ZA3B 3C87A 5DWUH 3BH8A 4P2RD 1TQCC 3E6FB 1BOGB 5CSZB 5F9OL 4OFKA 5D71H 3L1OL 2PW2B 2YD9A 1DN2A 1JI2A 3GUTA 1X5IA 3U0WH 1XH3B 2DF3A 2R4SH 3T0EA 3RJQB 3OKYA 4U6YA 4U3CA 5KSUB 1OP5H 3MTRA 3ULVE 1HH6B 4MJIB 2XWBA 4P9ML 4CBPA 4PP2B 3O6LH 1S5IH 3DBXB 3O45A 1VADB 1TVBA 1H0DA 1GGIL 3DROB 5HYSA 4Z18A 4TUKL 1J0HA 5BRZE 1HQ4A 4Y5VB 1NFDB 2X4NA 1JZ3A 4LF3A 3IDXL 4JN1H 1TJIL 1BM3L 3TVMC 3Q6GL 5JNYB 3SDXB 4PJEF 3HRZA 4JHAH 4XCFL 1KG0B 2NX5D 3IJSB 4S1SH 3CMGA 4JRYB 2A6JB 1S9WA 4N0CC 1WT5C 4M6AA 4E0RA 2GK0B 2AK4D 3DVGA 2FWOB 1JGVH 3VFRB 5JOFB 4O00A 2X1QA 1O5DT 4HC1L 1OAQL 2AEPL 3FO1A 1RIHH 3S37L 1WWCA 1CE1L 5HHOB 2P24A 2RB8A 4YR6B 3T2NL 4X5LA 4M6ML 3DV6B 1NH6A 4MMZC 5EULV 3AAZB 1EZVY 4KVNL 4KUZL 4L3CB 2P8PA 1VEOA 5DVKA 2MHAB 1N5AA 3MOQA 3OXSA 4MX7B 4XMLL 1GC1H 1XH3A 3RKDD 2G5BB 4HGWA 1YMMB 5F7YC 1KC5L 3QDJD 4L4TA 4WCYH 1DLFL 4EIGB 2NNAB 4JFEE 1UVQB 1HQ4B 3QWOB 1NFDA 2ZCHH 4ODVH 4YX2L 4G42A 1UJ3A 3SGJA 4OFYA 3OAZK 1AGBA 1KTLA 4ODHL 5DVOA 5IMKA 2NLJB 5ANMB 1PJ9A 2OL3B 1NL0H 5EU3B 3D0LA 2CDFA 3VGAB 4ZFOB 3HAEH 1U41A 3O4LB 4QTHB 2IADB 1DQDL 1NCNA 1F11B 4JRYA 3WFBH 1CI5A 4W81A 1WAAE 1A02N 1MI5D 1QLFB 2V5YA 3EJYC 3CH8A 1VFMA 3EYVA 5IJVB 2Y6SD 4O5LL 4ZOAA 1N64L 1A1OA 1I1FA 2ZG1A 3JXAA 4MJ4A 4QRUA 3QBTB 2DICA 5C86A 3SKOA 5HHME 4NQDB 4OLUL 1HQRB 4GAYB 5C9JB 5F6IC 1DBJL 5B38G 3QPQD 4WDIA 1RZKH 5F93C 2WP3T 3PGFL 4NQSB 3ZE1F 4XXDA 2DBLH 5BVJB 1IAOA 3AREB 1ES0A 3B9VA 2BNRE 5D7LD 3P9LA 3LQAC 2XZZA 5CMAB 5ERWB 5C0AB 1G6RL 1MCIA 3UPCA 5HHVL 3Q1SL 5CHNB 3U30B 3BDYL 2A6IB 3A6CL 4AZ8A 3HZMA 4H0GA 4NKMB 4OZHF 2J6EA 2YBRB 3VXRD 1CF8H 2O5YH 3M1BA 4H1LH 3C2AL 3BIBX 3DO7A 3GBLA 2NW3A 2NX5A 1P9MC 1E6JH 1IGIL 2PYED 3U7WL 1P84J 4IMLA 3QIWB 2XQYK 3QEQD 1T1XB 4ZO9A 4ZD3H 5CBEA 4K9EL 1MCWM 4KY1L 1X6NA 1RUML 5ESVA 4EN3C 3HZKB 2W38A 2X09A 4PJEE 3QCTL 4HG4J 1V3JA 3ZTNL 2AJVL 1DBBH 2W07A 4X6FA 2C1OB 1S7RA 2ADJB 2XXCB 4YDIH 2YK1H 4X4XB 1DUZA 1SJHA 5EU3A 2CLRA 4S1QL 4G7VL 2MSPA 4ZFOA 1AR1C 2NY0C 4HT1H 4NKQB 3TP4A 1F00I 3MBEA 3SCMC 2WWMC 4ONOA 2Z31D 4NWTH 4WUUB 1CLOL 2LAAA 5FYLL 1MQKL 1VFBA 2MTPA 1KIPA 4J7RA 2AJYL 4Q2ZB 1C08A 2EXWC 2BRQA 3OJVC 4UNVA 1WT5A 5DJYB 1FPTL 2EE9A 3TA3B 4P23A 3MGAA 5F71A 2FR4A 2P5WE 4S0SD 5JOPD 3MUGA 1YMHB 3C08L 3PDGA 3TCLA 2VLJA 3OAZH 1QSFD 1YEDB 2R23B 3MLTA 3NCYS 1MREL 3HPLB 4QHMB 7FABL 1IAOB 3A67H 5LQBL 3OAUL 5I19H 3ILPA 1A7BA 4R0LB 4Z7QF 1TETH 3BX7C 4LCWD 1UA6L 3RIFF 4IOSD 2HKFH 3QUKB 1OM3L 3U4BL 5HPMB 4PJXB 5FIEA 4PJGF 3LS5L 4JG0H 3RHWF 2OJEB 2DL9A 4MZ2A 1AXSA 2M26A 3CLEL 3L7EA 5CUSL 2W91A 1H3WM 1HDMA 3E6HB 3LKRB 1JE6A 3RL2B 3HS0A 4NM4L 4X0KB 5EB9A 1T2JA 5EUOF 2CRMA 2NY2D 3EO0B 1TTUA 1D9KC 1OGTB 3C8KB 4JAMB 5EZOL 3BMVA 2WIIA 1DDHB 4WI3A 3IDIA 4YHZL 4HWBH 3FB6B 2XA8H 1YYMH 5EC2B 4S2SB 3UZEA 1AHWC 5CSBA 3REVA 1GL4B 3RWFA 2MFNA 5I18H 2ENSA 4UBDC 3UJJH 3QI9B 4EN3B 3RY6A 4P4KD 5IR1A 3PGCA 3F6LA 5C08D 4XAWL 3ARFA 3C5ZD 5BVPL 1M4KA 1XEDA 5HHPA 5K9KA 2WLYA 4OLYL 5D1XB 2CKNA 4UUJA 1I7RA 2ITCA 1VFBB 1EHAA 1XF4A 4LHUG 4RQQA 1DN0A 5E6YA 5HGBA 3SDXE 5EZJA 2DQTL 4OB5H 2X42A 3ZTJG 1N4XL 1MWAB 4AG4H 3O6FC 3TNMB 2X05A 3MBXH 5SWZE 2G75B 4A6YL 3BZDA 1G7MB 1SBSL 1OARL 5E4EB 5EU7C 1F6AB 1AQDA 1DQTA 2DLFL 4QHMA 2E3VA 5KVDH 3O9WD 3BIKA 3MLYH 3QNXA 1ZLWH 1HHKA 1TZGH 3S97C 1HYRC 4Y5VC 4O2FB 3W39A 5ICYB 3BEVB 4CVZB 5B8CB 4Z6AT 3EGSA 4LCWA 4NN6B 3L5WA 5JPNA 1MCJA 5GGVL 3IDNB 5DJ6A 3DNKA 3S7GA 1AJ7H 3JWOH 4W6XB 5D96B 4AK1A 3CUPA 4DGVL 3CFDB 5KSBA 5D1QD 4MXWL 2CIKA 4IRSA 2GCYB 1F42A 4PRIA 3SQOH 3VG9B 3X14B 5IEKA 5C0GA 5BW7A 3C8KA 1HI6B 2Z8WC 1J1OH 4ZUUA 4V1DE 4Y2DB 5MENB 5F9JB 1F6FB 4CMHB 2A6DB 2AW2A 3QQ4B 5CGYC 3G6AA 4BZYA 2NY4D 3GMNB 5DF0A 5E8PB 1B9ZA 1ZHBB 2FEDD 5I71C 3QAZC 4KMLB 3TJEL 2ZUVA 2BDNH 2EE6A 4PRDA 3ZE0F 3O6LL 1OT2A 1VFOA 2DWEB 4ISVB 5TDNA 3LY6A 3FO9B 5I6XC 2C4FT 4KAQH 3JV4B 5IROC 4NNYB 1A6TA 3K1DA 3RUGB 3KLAA 1HHIA 3BP7B 2Q7YB 3UYPA 3RNQB 4Y4KD 3UYOD 3MRQB 3MLXH 5B22A 4L9LC 4MJID 3HHRB 2DJUA 4O51B 1MRCL 5C09B 2X89A 5E2TL 1T22A 5D7IB 3V5DB 2QV2A 3J7HA 4UDTB 5IOPA 4JDZA 4Z7QE 2X9YA 4JM2A 4Q9RL 3D69B 3VWJD 3N1MC 5I8OL 5I1DA 4LLMA 3NIFF 5EU5B 1C7TA 1ZA6B 3O6FD 3R06B 4L4TD 1NC2A 4PJGE 4K2UL 3H9ZA 1CFQA 4LQ1A 5GGVY 4OLWH 5IVZA 2FL5A 1KENL 4HEPG 4KI5E 3ZHDA 4ETQA 1FNSH 1IEAA 4F37K 1BEYH 1W0WA 3WKMH 5SV4A 3TGXA 3QUZB 3A6BH 1ZOXA 5CINH 1A6WL 4FQLL 4YXLL 2QLVB 4I3RH 2EKSA 5MERA 3FOLA 2X4SA 5HDQL 4ALAL 3ZE1E 2R4RL 3I75A 2Y5TB 3GMOA 5F1OB 3CDCA 4TUOB 5ESAB 1LP9F 1F90L 4LIQH 4NNPL 2APTA 1LQSR 3JWDC 4EOWH 3TPKA 4KKBC 3GSNH 1LO3L 3RWJB 2F54B 2ZOLA 3MLWL 3OPZL 3KPPA 5DD3L 4P49A 4I9WE 4DWHA 3LAFA 3PXHA 1MLCB 3UTSA 4N8CH 3ULSB 3OKOB 5DEZA 25C8L 4KK8D 3CFCH 3BQUD 3FONB 4U6XA 2HMID 2VL5A 3O9WA 3O3UN 2QBWA 1J1XL 3F65A 2HTLC 3WEXB 5FDWA 4HWUA 4QOKA 1KPUB 2CGRH 3O3AA 1EEYA 1I9EA 3BPOB 4K3EL 1JHKL 3T1FB 4E42B 2ICWB 3WE6B 2KZWA 5IB5B 5GHWL 1PYWA 2DM7A 3BW9A 2AJ3B 4ODXA 3NCEB 4K71C 1FYTE 3PWPB 2X4UA 1HNFA 1DQDH 3WFBL 5ECJE 4M93C 3DV4A 2XWTA 3IFLH 3UEZA 5FECA 5L7XH 3S5LG 6CGTA 3EKCA 4OCXL 4KZDH 1CR9L 4XPHL 1A6ZA 1RIVL 3HUJE 5LAXB 1MH5B 4WY7L 2ESVB 1YECL 3EO1B 1JZ5A 3SDAC 3FCTA 3WD5H 2H45A 4FQXB 4WW2A 4H8WH 1GC1C 4JE4B 1NGQL 3PGFH 1T21A 3TO2B 4F80A 3QG6A 5F6IB 4XNXL 2FX9H 4O2CA 4G6FB 3D1MC 1S7TB 2NY0B 3VXMA 1INDH 3CDFA 3GMOB 1YNKH 2PW2A 3CSYB 4HULB 3VXSB 2AXGB 1H8NA 3VH8G 4XCNA 5H8DA 2ZPKL 4HS6B 1HXMA 3QFJA 3QRFM 1RURH 3T0EB 3WS3B 5MENE 2JJVA 1AXTL 3GNML 4ZNEE 1BZ7A 4C57C 4KKBD 1MY5A 2P8LB 4XI5C 5E7BA 4MJIA 4K3JL 1XGYL 3NMEA 1MLCA 4HUUB 4K7PY 1EFXD 1P7KA 3MV8D 4K7PH 3THMH 2AXFA 3O81A 1J8HA 1NGPH 4NQEB 4K9EC 4U6XB 1U93A 4C4KT 3SGKC 2E7LA 4HEME 3F7RA 3B5HA 4P2OB 4WU5A 1AFVH 3KYMB 4OD3H 1H3GA 2Y06L 5KZCB 4YHOH 2ATKB 2ICWA 4GRWB 1DZBA 3WE6A 1PYWB 3O3DA 2B1AH 1CDCA 5SWQB 5HD8D 3BPCB 4HT1L 3P4OA 5E99L 5IHBA 4JRXE 1X5YA 3HR6A 4AMKL 1NDMA 2RIKA 3PHQB 5KSVB 3GI9H 2AK4B 3MSPA 3GI8H 3DSFL 1DBKH 1ZLSH 3O2DA 3GRWH 3VXSE 3QO1A 4YDVA 3UTTB 4LDOB 3VD4A 5LAXA 3OGCA 3EO1A 3T2QA 2GKIA 2PYFB 4M48H 4MQXD 4ZFGH 2NXYC 2KBGA 1I1CA 3HTLX 5E6IC 1IQWH 2HT4C 4F37F 3VFTB 2FO1A 3IS0X 3QG6B 3MOAH 4OZGF 2Z8SA 1SBBA 2MQ0A 4NHCL 3VXMD 5IVXA 3QDMA 3VFOB 4TVPL 2R2BB 5FCSH 2QSCL 4RZCB 5DRZB 2F74B 1QQDB 4WNQA 1PEWA 1G0XA 3GBML 4KDVA 2G5BA 4FHBD 3S3JA 3DX9A 5KVFH 1A9BB 1H3XA 4DGYH 4K23L 4WV1B 2DS4A 3OG6B 3MUJA 1LK2B 4HUUA 4X4MA 3WN5A 1CFVL 2OQJB 5FV2A 2XRAL 4RAHA 5AYUH 4MDJA 5MI0C 2DJ4A 4OZ4B 5LXGH 3W81A 2XA8L 4LSDA 1G84A 5D93B 2BSTA 3B3IB 3ZYZA 3EOBA 2ATKA 1E28B 2YD8A 4PJ7B 4UOW1 3KPSB 4OZHB 2IADA 2C3XA 5K33A 2HFEB 4XAWH 3GSWB 4G8GB 3B6SB 4YDLB 4JCLA 1E4KA 1CICA 2AJXH 3GUTB 2IPUG 4RMQA 2VDMH 1A6PA 1EXUB 1IBGH 3T3ME 4IOIB 1GAFH 3LD8C 2FGWH 1OCWH 5F1KC 3ME0A 3MC0A 3V9FA 2O26U 3BN9D 5JXAH 2WP3O 2YA1A 3C5SB 4Z8FL 4LFHD 4M7LH 2X4NB 4HFUL 5DD0L 4OF8A 1URLA 5DUMH 3ZLQC 4DKEH 3QCUL 3CX5K 1JYXA 2GT9B 5I74B 4G6ML 3K74B 4QCIB 1TZGL 1TPXC 5L2KD 1KEGH 3PIQB 1CFNA 3MJ9L 5EO1A 2I27N 2AJSL 3FB7A 1S3KH 4CRPA 4NZUH 2ORBL 3KYOB 2YBRA 4CJ0A 1A9BA 3ARGC 3MRKB 4R90L 2A6JA 5DC4B 4PY8J 3ZHLA 5IHUH 1AJ7L 2EZ0D 3JWOL 3EJJX 2Q86A 3O6FA 4FQJH 1WZLA 4XMPL 1Q0XL 3EDJA 3WN5B 3W2DL 4EI5B 3NPSC 4IDLA 5C0BE 5C0CA 1Z9LA 5DTFA 4JFEB 1UACH 3ARSA 4JB9H 1U6AH 1T3FB 1J1OL 4OCWH 3BIAX 5HXMA 4LCUA 3HLAA 4HUXB 3V4UL 3IETA 3EW3B 3VRJA 3AB0B 4HCRL 2CRZA 4JFYB 4TTDC 1I8KB 3D25B 2OP4L 2ADJA 3QJHA 1QYGL 4IIQA 4G9FD 4XBGA 5ADPH 4PJIF 1OTSC 4I4WA 2CJUH 3KPSA 1FFPB 3U6RA 1SYVB 4QTIH 4RSVA 2JB6B 1BAFL 2CDEB 2KH2B 3B6SA 4C55A 4H20H 4XWGL 3WKNA 2XTJE 1WLHA 5I17A 1QSVA 1T89A 1WZKA 1H9VA 3RY4A 1EXUA 2EDTA 3QDJE 1FV1B 5FUCE 2JJWA 3SE8H 2C3WA 2N4IA 3KPOA 3WJJC 2B8OT 1MF2L 1YEDA 2R23A 2UVEA 3N1GC 4M5ZL 4KK9D 4RAUB 1UVQA 5HVWA 3RA7L 2NY3D 3BP5B 3OKDB 5DT1H 5BXFA 1OTTC 4WHCA 3V6ZA 1EO8H 1DQML 1MNUH 1ORQB 35C8L 1I8LA 3LD8B 5T1DL 4F7TA 5I8CB 1KCRH 5F9WB 3QUKA 3SOBL 3HUJF 1G7LB 3MR9A 2LFGA 1LD9A 2YXFA 4JREB 3SCMB 3A6BL 1QFPA 5FGSA 5MP6H 5IM7B 4OM1L 3GM0A 4F3FB 4IDJH 3QUZC 5IJVA 2PETA 4QYOB 5FHAH 3RWDB 5CAYB 5CILH 1A5FH 4OZIF 4WI9A 3E3QC 3NFSL 5DMYA 2XZQH 32C2B 2ZG2A 4I0PD 2CRYA 4GRWH 5CEZL 1JHTB 5DJXB 3GSNL 1L7TL 1KB5B 3O6KL 4OZFB 1I1AD 2LU4A 3AGVA 1KJ2L 1I8KA 2FZ3B 1CXFA 4TUKH 3ARBC 5DLML 2Y23A 1S9YB 2NXZC 1ES0B 5GRJL 4OLXL 1KCSH 4N8CL 4LSTL 4U2YA 5JHDB 5EU6B 4AENB 5EUOB 1ED3B 3UYRL 4UDUB 3G08B 1QFWH 5IW1B 3IYLW 3Q5YA 5DSCB 1KELL 3H3PL 2GJZA 5EZJB 3GJFB 2IGFL 1ZT1A 3LRSA 3C9NA 4X6CF 5HYFA 4D9RD 3INUH 2G75A 4M43L 3HB3C 3L3OB 5K9OB 3P30H 5DUBB 1UC6A 3OAYH 4PJHF 5ESVB 1S7VB 2Y7QB 2O61B 1U8PB 4FN0A 1HHKB 7CGTA 4P2RB 2BZDA 2L7JA 3SO5A 4F7EA 8FABA 1NJ9A 1NKOA 3WYRA 1NCWH 1JNJA 4DZBA 2FIRT 4JPWL 1JWSB 4PJXE 4LSSH 4G6KL 5C7XH 4NO2A 1BF8A 1BF2A 3D18B 1B6DA 4ODTH 3SO3C 2E27H 5GRUL 2WBJD 1X5GA 3CUPB 5HVFB 3JWDL 4BSVA 1BQHG 4IOFD 1H3UA 4M7KL 1FBIH 3GMLB 3FMGH 3QEQE 4UB0L 3EOTH 5DMGC 3X14A 5IEKB 3I3EA 5C0GB 4XPTH 5DJYA 3LRGA 4WTZG 2Z9TA 3CX5J 3O2WL 2FR4B 3GMMA 4NFBA 1U3HC 5F9JA 3PV7A 2IANE 5FM5M 3ARPA 4OZFA 3MRDB 3KPRB 5D72L 4Y8DC 4HV8B 3G6AB 3P4MA 2OMBA 3H9HA 4UU9B 2O5XH 3NFPB 3M07A 5D7KD 5CJOH 2VDQL 4P48A 2DWEA 4ISVA 3SBWA 5E6IB 1LEIA 3QDMD 5LBSL 4ODHH 5FUZH 3U2SB 4OLZH 1DP0A 5F72S 5FGCE 1AR2A 5HPMA 4RWHA 1CCZA 1K8IB 5EORL 1HINL 4S1RL 5LVEA 3QIBC 3L5XL 2K9UA 2Y06H 4LPVA 4PJ8D 4PUBL 1U91B 3RNQA 3RWHB 5GJSH 1ZT1B 2UWEF 4WEUD 4O51A 3NACL 2R56L 4NQCA 3VMOA 4HUMB 4PREA 4ZUTA 2CSPA 1TJGL 2V7HB 4XHQA 1EFXA 1NGWA 2EIDA 4I0PB 1MCNA 4W4OC 5KW9L 4JAMA 4FFZL 3DECA 1GH7A 3H42L 1VFUA 3QQ9C 2GEEA 2BNRB 1DBJH 4ESKA 2QSQA 3SGDI 2ADGA 3NABH 4ZAKB 1H5BC 2F5BH 5EC2A 5A43C 1P4BH 4FG6D 4CN1A 1A3RL 3LZFL 1UXSA 4MD5B 5J1TC 1QNZL 1QRKA 1ZHLB 3T3MF 1XF5B 4YHPB 5I6XB 1ZHKB 2EYRB 4ODSL 2PO6D 4ZPVB 1V05A 4RFNC 2DD8L 1I75A 5K9KB 1KTDA 4PGDA 4BFEA 4PB9H 5GS1A 1XF4B 3QIBA 1CK0L 4L4JA 1D5XB 4L5FH 2XQYG 1AHWA 1UM6L 4D0CB 3WDJA 2VZVA 5IW3A 3PDOA 4QRPA 5BS0A 1KJMB 5HY9A 5DRXA 2GJ6E 4HV8A 4ZPTB 4NNXB 1A1MB 4P5KA 2NQCA 1FZOB 5HTSA 1PQZB 3NFPA 4YIQB 1X4YA 4HUWA 1IZKA 1CFVH 4KTEH 3FQWB 4XCCL 3U2SA 4JFXA 5GGSY 1U3HB 5FF6B 5DHVA 4GMSL 3I02B 3BN9C 1YEJH 5DDHB 3OKMB 3VRLF 4QOKD 2CUHA 3T1FA 4PG2A 4NWTL 2XNAA 3QXUA 3QXVA 2IQAA 3JV0A 4ELMB 2AJ3A 1SY6H 2VDNH 1FFQA 5DA4A 4HKJA 3U82B 3CXHJ 1RZKC 3ARYA 3RZCB 1MHHB 1AD9A 4P2QE 1E6OL 2YUVA 3QXAA 1CTNA 5CZXD 2KPNA 1OT1A 3C08H 1JFQH 4D94A 4GG6F 5GRVK 4ZAKA 5D71L 2VDML 1KJ2B 4JFFD 4GFTB 3AMKA 1R5WA 4X6DA 5TE6H 4RMRA 5AWNH 2HLFC 1YJDH 2HVJB 2D2OA 4QXWA 5FOBA 1IQDA 1RK1A 3IRZA 4WW2B 2HT4D 3MRRA 5E5UB 4OGAC 2H2PD 3JV4A 1GCFA 4P9MH 3TYGH 2PTVA 4JPKH 3WHE1 5FK9B 3QDGB 1S9VB 4F9PA 3X3FH 2VLLB 2QSTA 3T0EE 3D3VA 1PKOA 4QWWD 3BWAB 1KEGL 2XG4A 5T1MB 1BZ7B 3LB6C 5HY9B 4Y16A 1EVUA 4N8PA 5DD6B 4WUUE 1T5XA 3N1FC 4DN3L 5IHUL 1S7UB 2D7QA 4S1SL 3QH3A 2V5SA 1MCOL 2SEBB 4GBXD 1YEGL 2KQMA 2YPKA 4FFWD 3LHPL 2EO1A 3O2VL 2VAAB 1KPVB 4JB9L 3RU8H 4MXQC 4WUUD 4UTAL 5D70H 3OHXB 1RU9L 1HKLH 5KSAD 4G9DB 4G8IB 4I9WD 5J06A 3DXAB 4LFHG 4ZS6C 4AT6A 2A9MH 1B3JA 2HT2C 4PRPD 5FKPB 1ADQL 1QSFA 2B39A 3SDCD 2R2EB 4WJ5A 3VFGH 4JO3H 3P4OB 1CE1H 4JN2A 3DX7B 4LEOA 4YGVB 3DURB 4OB5L 4PGEA 5CZVH 4HS8H 1GHFL 4N90E 2Q76A 2X4OA 3RKDC 3PQYE 2H2SD 4U6VH 2P46B 3NTCL 4HUNB 1VCAA 2DTML 4PJBE 4XPFL 3UTTA 4HK3J 1Q1JH 4P3WA 4UAOB 1V7ML 3HI1B 1K2DA 3ARZA 5EDXA 1X5LA 2BMKB 3ZKXC 3MLYL 1AY1L 4LCCA 4OAWB 4OFIA 1WTGT 4G80B 4OJFH 2AI0L 3EFDL 4W70A 1W0VB 1HXYB 3VD7A 4NN6C 1BZQK 2XQBH 5H37H 3S88H 2WQRA 1GZPA 4WCYL 1Y0LA 1R6VA 2AS5M 4JDTH 4Y4HC 5CJXC 4ACPA 4DGIH 2UZIL 1FORH 3DTXA 1CD0A 4N0CD 2HN7A 4QRRB 1ZXQA 1OSZB 1IEHA 3BKYL 1IKFL 4YXKH 4X6DF 3MNWB 1EBPA 4NCDA 4JO4H 4Y2DD 2YSSA 3D85B 4WEMB 4E0RB 4OM1H 2XWTB 5FECB 3ZE2F 4PLJD 4BJLA 4YBQD 4PRID 3FN0L 4UINL 1JNLH 5K93A 3L3JB 1JIBA 3I84A 1AD0A 2M1KA 1YPZB 4YDJA 1KFAH 1KUMA 4Y1AA 2VAAA 1UM5L 3P0VL 2N7AA 5JA8B 1MFEH 3QPXL 1RULH 1N64H 5LGJB 3D87B 1M6OA 2I9LB 2BNUA 2P7TB 2P24B 5IMLA 1CFSA 1KULA 5JO5B 4XP5L 3P9MB 3KJ6H 3RWEA 5B8CC 2JIXA 5FKPA 3CFBA 4OZHA 5FYJH 3VXNB 1SJEA 5FV1L 4AEHL 3ZDXF 1A4KB 4HQQL 4Z7UF 5IFJA 1YEEL 4P46C 1T0NA 1IRAY 4NQED 3WNPA 3HG1E 1VENA 1HXMB 5DFTA 3FFCA 4I5BA 3B2VH 1WSST 3RTQA 1YMMA 5A2LH 4Q9CA 1BFVL 1U8IA 5DK2B 3SKNA 4P23D 3IFNH 4Z0BL 4LLUB 4ZYKA 3VG0H 2WW8A 4GKNA 4CMHC 3ET9F 2CO6B 3MV7E 2NNAA 4CUCA 4I77L 5E08H 3C60B 4HLZG 1RJCA 1BWWA 1VGEH 4KJQC 4XCFH 3U7WH 3K8KA 5CJ5A 4NC1C 1CGYA 3GKWH 1ULVA 3B9AA 4PJDA 1HZHH 4F7PA 3DTXB 4WHTA 3LOWA 2MWCA 3O11A 5F7DA 3ZKXB 3LKQA 4K9EH 1JPFA 4LLDB 3RWIB 4I3RL 5I76A 2VUYA 4ZFOL 5DRWA 4WFHD 1Q94A 1JGVL 1FN4B 1JGEB 4N8VG 5TQ0L 3TBYB 4N9GA 3JBG7 4Z7UB 2XA3A 2XYCA 1RJYA 3D9AH 2CDGB 5GRUH 1J1PL 1T1WA 4LAQL 2ARJB 5JHLH 1A1OB 5IIEA 1ZLWK 4PJIB 3GJEA 4GRWF 1TTFA 3EOTL 5HSFA 2BSSB 4WHYH 5JDJA 3FQTB 1P7QD 1QD0A 2NY3B 4GAYA 5FYLH 3IDYB 2YPLA 3EZ8A 3QUXB 3W11D 4DTGH 4RMSA 5D7IE 5HDOA 4B7IA 1VACA 2DDQH 1DTUA 1P5UA 3WFHA 1AGEA 4YFLF 1YY8B 5JO5A 3LEXB 3U4AA 4ORZC 4Y5XB 1UM4H 1YEFH 2YZ8A 3UBXG 1FFPA 4HK0A 3U6RB 4OGXH 1M05A 3SGEI 1A7OH 5TE4L 1UH2A 3GSUB 3T8XA 3BUYB 1R5VB 2A6IA 2XT1B 1QQDA 4WNQB 5M7QA 5BV7B 4LASH 4OCSL 4R26H 1FL3B 4DUVA 2Z31A 5I1IL 3R0NA 2P5WA 3MLVH 5FOJA 1UWXH 4F2MB 4NBZB 4QXUH 4ZYKB 1I9IL 1WFOA 3LDBB 1V3MA 2BHYA 2VSCA 3CIQA 5CKGA 3S34L 1A6AA 1NL0L 2X1OA 3KWWA 3R8QA 3TH3T 2VO5A 1I8MA 1CXHA 1JGUL 4ZFFB 1AGCA 4JPVL 5EBLA 5J3HC 1IC1A 4H1LB 2BSTB 3B3IA 5E2VH 1FQ9C 3RWIA 4K07A 2FX9L 4G8FB 2E7LC 4GG6E 1E28A 4PJ7A 1P7QB 1UYWL 1LD9B 5DO2C 3DUSB 3GSWA 4G8GA 3L3DB 3S37X 2W9LA 2XKNB 1JV5B 4WO4C 4OLUH 5EZLB 1I7ZB 4HPOL 3ZKSD 2V2TB 3D2UD 1MPAL 1BIIA 5GZNC 2IH3B 2PR4H 3MRIB 4MHHG 4Y5YC 4UT6H 3OX8A 4L5FL 4IOIA 3QNYB 3HCVB 4X8JA 3FN9A 3WBDA 1KB5A 1QR1A 5E1AA 1VACB 3SPVA 5E03A 3SDAB 3KLHD 1WZMA 2BFVH 3LEXA 2OSLA 3VI3F 4JFFA 4A6YH 4NWUL 3H2WA 3DVNB 3WNNA 1QSZA 5JHDA 4JM2F 4NRXB 2F8VA 1YDPA 4UILH 3TCXA 2K7PA 4YHOL 1JGDB 4NDMA 4XB7A 4UDUA 5HYEA 4PB0L 4APQD 5GPRA 2V2XA 4N68A 1W72L 2GJZB 2LAGB 4IMKA 5SWSE 4AMKH 4MS8D 5FYLD 4LRNH 5CCKL 5D5MF 4OKVA 5DZNA 5KN5A 1FC2D 2W9EL 4S0TD 3LKRA 1CXIA 1RZFL 2EDYA 2HFFA 4HIEA 5ID1A 2IANB 1FO0L 5E0QA 4CNIA 3DXAD 2EIZA 4S11A 4PJ9A 3QSKB 3EO0A 4YDIL 4M48L 1RHFA 1MI5B 4YE4L 4XGZA 5J56B 1D5MA 1U8PA 4N1HB 3FB6A 4MCYA 4ZTPL 3KR3L 3L3KB 5CP3A 1ZLVH 2IPKB 4LCIH 3RWFB 3TWCH 4Z5RA 2EE3A 1CLOH 3UPRB 1F3RB 4QLRA 4ODWA 4NO2B 2FJHB 5A16B 5IR1B 4CDHA 3C5JB 3DUSA 1ACYL 5GSRA 2CDEA 1DLHB 4BFIA 3SEPA 2HJFB 1A4JB 2CIIB 3HC4H 3VFPA 1BZ9A 2O5ZL 5I17B 1I7ZA 1KPRB 1U2CA 3LIZH 1TQBB 4E5XB 3GMLA 5CJQL 5JDSB 4BELD 3UZQA 3OX8B 1MREH 1FV1A 1GXEA 1LO5B 5DMJB 1HILB 4P3CL 1U92A 1NEZA 2BJML 3D39E 3PWJA 5FKAA 2H26B 2Q6WB 2E9JA 3C6LA 2B0SL 4HXBL 2DL2A 1AQDB 4C56B 4RAUA 2IH1B 2APWA 1KV3A 3QO0B 2WSKA 2YZ1A 4O9HH 4RIRA 2F53D 1HCFX 5E6IA 1MCOH 1LEIB 3MV9E 1JYNA 4S1DC 4GAGH 3OZ9H 1NUFA 1Q9WB 1G6RB 1ZS8B 3Q0HA 5TF0A 4LCCC 2X7LA 3W39B 5ICYA 3MLPA 4NQVB 4XNMB 4UTAH 3QUMB 2OYPA 4NC0B 4X83A 1HKLL 2B2XL 1GRWA 1LEGB 4PBXA 2J8UB 4I18C 4X6CB 4KKLC 4X7FC 3MRFB 3IDJA 5JPMA 2BOBA 5KSBB 3LSOA 4XH2A 4PREB 1KT2A 1BEYL 1CLYL 3TO4A 3MRMA 4QHKJ 2NYYC 1A7RL 5D1ZB 2R0LL 4JO1H 3S96B 5FM8A 2GW5A 4TSBH 5E2UL 5D2NA 1AO7D 4PJGA 4Y4FB 3PWUA 1OCWL 2JCCB 4OCRH 3W9EA 2Q1EA 3WLBA 1T7WA 3HA0A 2MCG1 1PSKL 4U49A 5DJAA 2OXHA 4Z8FH 4RMWA 4EOWL 5I1JH 5J9PA 3NBNA 1B6UA 1AY1H 3QCUH 1XF5A 4YHPA 4U1HA 4XC3L 4OJFL 5K9QI 1I8IA 4MJ6B 4N0FB 3P11H 5DD3H 5EUOA 5SX5H 4X9BA 3MJ9H 2AK4E 3RUGA 4WFGE 1Y18B 4KPHL 5IV2A 2VLRD 4KJPC 1PFCA 1YPZE 1U8MA 3VCLB 3SDDD 4X4YB 5IMMB 5JW4R 5BO1L 2Q7NA 3VGFA 3H8NA 2X1PA 4JY4A 4JG1H 3MXVH 5GS2D 5GRZA 1TIUA 1PVHA 4E41E 2ARWA 5B39B 2F5AL 3TBWA 5CEXB 2VLKE 4L3EA 4U3XA 5DVMA 1NFKA 1KLUB 2FO4A 4O02H 2FEDC 4A6YB 4M7JH 3AFLA 4F7EB 3BYYA 2AQ1A 2OP4H 1QFOA 4NRYB 1NCBH 1J18A 4M62H 1X5JA 3V0VA 4DKAA 4N0UA 4GRWE 4KJWC 4YWGL 3UO1L 4NT6B 4OCXH 4RX4D 2HH0L 3IVKB 5HYJA 2NY5C 4P9HH 3QQ3B 3EUUA 3BRFA 5I66B 2EKSB 2CLZA 4F57H 4KRLB 3NH7H 3Q5OA 4ONGH 5HGDA 4G3YL 4PLKD 4GKOA 1BBJA 5IT2H 4BM7A 4YPJA 1RI8A 3AVEA 2BDNL 2EYTB 4PJGB 3TH4T 2EDDA 3B2VL 2YKLL 3GMQA 4KGLA 2V5RA 3KPRA 3E2HC 2Z93A 4X7DC 4M5ZH 3JV6B 4LGRB 3NCJL 1TVDA 4KK9C 3VG0L 1VA9A 4JVUA 1MFBL 1DCLA 4D8PA 5GGRA 1JHLL 3B83A 3IAGC 1GGCH 2F53B 4K3JH 4D9QE 3ZHKA 5EBWA 2Q8AL 4P2RE 4C56D 3D2UB 3GJFH 5LGHL 1UGNA 4XCEA 4QF1B 4NYLB 3K1KC 4ODXB 2I07B 3BZ4A 5GS3A 2P49B 5FYKL 2XZQL 1KXQE 1L0QA 1DBMH 2CK0H 2R2HA 3D9AL 3MGTA 3X13A 3DV4B 2NCMA 3DARA 2B1AL 5CEXA 4G6AD 4UV7L 1KLUA 2FO4B 3O6KH 3WJJA 1DL7L 2XN9D 3OKEA 1FIEA 1GOFA 3LDBC 5F21B 2IPUK 4OUOA 3HFML 4PRHD 5EC1A 5L88L 3GI8L 3N0PB 4N0UB 1QBBA 1WF5A 4GUPA 2D03L 4DTGL 4YQXL 5J6HB 1AXIB 2R4RH 3ZKMC 4LSTH 1EJ6A 1MRDH 3D5OF 3LMJL 4ZPVA 3IDYC 5I66A 4UQ3A 1MCPH 4XP1H 4Y4KB 5AAWA 4GO6B 1K8DA 1DVFB 1HHHB 4GS7C 4XZUB 3VXRA 5C0EA 3MLWH 3OPZH 3CSYA 3VXSA 1JPST 2FCBA 3QHFL 4MD4B 4HIIA 4AIZB 2QEJA 3NIGF 5HDLA 1AHWB 1MWAH 3VDBA 4WO4B 5ILTH 5FA3B 1LK3H 3WS3A 4CAGA 4NHCH 3HC3L 2ADIB 4FNLH 5CIPA 1K2DB 1D5BB 1DSFH 3STZA 2FEEI 4APQB 3MRBB 4WEBL 2YA2A 1YYLL 4FQ1L 4IRSD 5D5ME 3AM8C 1VGKB 2RQ8A 4K23H 4P59H 2GTWB 4EXPX 2A73A 5GHWH 5LWYH 3CFEB 1YY9D 2ESVE 1A9EB 4LMQE 1S7WA 2E7HA 4LRIC 4LDEB 3I9GL 4R3SA 5CP3H 3MA9H 2WWMD 5C0IA 2IQAB 1XR8A 2DMCA 5IWLC 5GRXG 5JXEC 4O4YH 1V5JA 4U31A 2OZ4A 5JW4Q 3SQBA 4X4ME 1F13A 4LHUB 1E0OB 1E4WH 1NDMB 1F3DJ 3PHQA 5I1KL 1NCDH 4M8VA 4MNGA 2DM2A 1C5BH 1JF6A 3CMOL 3WD5L 4XP6H 3QO1B 4YDVB 3RBGA 2I5YH 1MPAH 2RFXB 2W60B 4POYA 3KDMA 1ZANL 4TTDD 1X7QA 2HTLD 4BFBD 3C60D 1Q9KB 3WXWL 4M6NH 1BVLB 5GS0D 3GDBA 1IQDB 4N0YL 2GY7B 2BNUB 3SJVD 4LNRA 4NUJB 1CFSB 1PY9A 3BUTA 1Z3GH 4OTXH 1G7HA 1SJXA 1P4LB 4KU1A 1IAMA 1UWXK 3A0OA 4MLIA 1ZVYA 3IAPA 5DRZA 2F74A 1H3TA 4P2CG 5E5MB 4WO4A 1MFCH 2H3NA 5I71B 4JHWL 1KB5H 3FFCB 3MRJA 5F9DC 3MCLH 2FLRT 1NGPL 4WV1A 2A6KA 2ZKHL 3GSXA 2OJZL 1W8NA 1S7UA 4U6HA 3CSGA 1ZTXH 3QH3B 4D2NA 2DQGL 1KCKA 3LV3B 2NY7L 5DVLA 4PJAB 3LZFH 4OM0H 1MCSA 3ROLB 3CFKA 2ITDA 1F4XH 1OAZL 1XGPA 3CSPA 3OJDA 3GI9L 1PKQB 3VDAA 3VWJC 3ULUC 1RMFH 1XR8B 5JORB 3ZZ1A 1JK8A 2DMBA 5TH2A 3TIDA 1YEHH 3TJHC 2ZOKA 2XKSA 3OF6D 1ACYH 5HVGB 5FO8B 4U1KA 1U42A 3QCVL 5C09E 4C56E 3SDCC 4ZFGL 1Z5LB 4JJ5A 4D9QD 1XT5A 3GJEB 2A74B 3N1PC 5DC9B 3HI1A 1AI1H 1T0PB 5C07E 4D9RE 4F7MB 3PWPE 1FYTB 2YPLB 4KDWA 3RVXD 3DHMA 4PBVC 4EDXB 4AH2B 3WO4C 5E7FA 4NKIL 4AIOA 1FFNA 4HK0B 2QQLH 3NCYP 2A83A 3UTZA 1M05B 5L9DL 3TESA 4OFYD 3EOAA 4HIHB 1LO4H 3B43A 3S98A 1NFIA 3BH9A 4HZLA 3U9PL 2W0PA 4FXLA 5FCUH 1CFNB 5EO1B 1X5AA 3F5WB 3KXFD 1PG7L 4OT1H 1JNNL 2H3NB 3BKCH 5F7WC 2Z31B 1A14H 1OTTD 4QEGA 2Z8RA 1N8ZA 4U1NA 2HRLA 4QGYA 35C8H 2F8XC 1K5NA 1E6OH 3RDTB 1UKQA 3ETBF 4XBEL 2Z92B 3SDDC 4MDIB 2UY6A 4EI5A 4IMKC 1ZE3C 1DVFD 1OAXL 5DTFB 4Y1AB 3BDXA 2HLFD 4HUXA 4MSWB 3VJ6B 1XF3B 4PJ5A 3ALXA 3MA7A 1JCKA 4G9FB 5CILL 4OKDA 4ZXBA 1K9TA 2AJXL 3FN3A 3P9MA 3RWEB 4DOHB 5JORA 4R7DA 4X99B 2R39A 3O4LE 4XC3H 2FSEB 4OSUH 5I16B 3TVMB 1EV2E 2NXYB 4DVBA 1A4KA 4NM8H 3VGAC 3MV01 2AQ2A 1GAFL 2BOCB 1Q72H 4OF6A 4Z77A 4WW1B 1KEML 2V2TA 3UTPE 3KPNA 4HG4K 1MRFL 3OKKB 2I24N 5D8JL 4I3SL 4HX1B 2OK0L 1QFWL 3QNYA 4JHBA 1OAKH 5AZEH 1R0AL 5AG8A 4QRRD 4XPGH 5J1AB 2EZ0C 4BSJA 2AEWA 2JJTC 2HG5B 4YDKL 1JZ4A 4XTRD 2EDKA 3C60A 4DQOH 3WV0A 4BKLA 1BVKB 3HE6A 4JFFB 2C9AA 12E8L 1Y6KR 3GKZA 3V6ZB 1R3JB 5I1CL 5IEHA 5J6GA 2A9ML 5FO9A 4JHZA 1R3IL 1R5IA 4GH7B 4YWGH 2QQNL 3RRQA 3W2DH 4XVSL 1FYTD 4NZRH 1NCWL 3BSZH 4Z7UA 1UACL 1C16B 1GHFH 2LQRA 1FRGL 4C4KO 4KKAD 5C7XL 4XHJC 1IM9B 4ONGL 4X6BB 4I8DA 4MDIA 1Q1JL 4Y16C 3OMZA 32C2A 3U9UA 2Z31C 4ODBD 5HYQB 3FQNB 4TVSa 4WWKB 2XZCH 3GO1H 4NP4L 4U0RB 4QY8A 3HMXH 4G8EB 2VH5L 4UT7H 1NAMH 1QP1A 4HBCH 3TF7C 2ZCKL 4MB5A 1BD2A 3HI6H 4RFOH 3N50A 3RGVD 1QBLH 3H9SE 4Y5XA 5ISZA 3KPMA 3MLRL 1TZHA 2X70B 2FJHA 3EYFB 3L7FB 3TVMA 1NUDA 3GSUA 2VDOL 4WFGD 5FHBL 1A4JA 3VGGA 1RUQL 2J4WL 5B3JE 4E41D 4OUUA 2IMNA 4KKNA 1JMZA 3BKYH 1EGJA 3DYMA 4PJ8C 2VLKD 4MA7H 1PG7X 2L7UA 3FOMB 4ENED 1RAMA 4HX1A 3P0GB 5C0DB 3L5JA 4GG8B 1I85A 4K7FA 4NQDE 2B1HL 1RUAH 2ZUQC 5E00B 5EORH 3FN0H 1PZ5B 3W5MA 2VLRE 3NAAH 5SX4I 3V4VH 5J1AA 4HMCA 3CVHA 5HHOD 3BHBA 4HIXL 1DBML 2CK0L 3QDGD 5BRZA 5A3IC 5IBTH 5DS8B 1U8KB 4X98B 3ARGB 2R56H 2WINB 43CAB 1AO7E 1GYAA 1AGCB 3L5IA 5CSZA 5J6GB 4GOSA 4NO5B 5LCVL 2YOCA 3H7BB 4QRTA 5DJZA 5T1KA 3QDGE 4XB8A 5FHAL 1LEGA 2FHBA 2GJ6D 4NQCE 3NFSH 5D1QC 4R2GC 4F58H 2BX5A 2IBZX 1C5CL 2ADFL 4QNPF 5HI4D 3PWNB 1NBZB 1IAIH 4XH2B 3ILQD 5EU6E 3O45B 3C8HA 1GVIA 1VFAB 3MRMB 1A2YB 4MS8C 5HYQA 1MWAL 4XPAH 1FLRH 3UMTA 4JFDD 3VRIA 4PB9L 3Q3GA 1ZGLA 5EOCJ 2CKBA 3G5XA 3NFNA 3AU1A 3T4AB 3LKNB 3UYRH 3BISA 4JQIH 4YDLC 2OSLB 1SMOA 3RIAF 3V7AG 4N0FA 4B0MM 2V2WB 2NY1D 1T0MA 4LSRH 4P59L 3GSQA 4Z95H 1BLNA 5DJ0B 3WS6C 1E4XH 1IGCH 2J88H 1P6FA 4QXGL 2V2XB 4QHNB 5IV2B 2DYPD 2PW1A 4PGBA 4QRPE 5BS0E 1UWGL 1W2KT 2DWDA 2P42B 2WBJB 5GISH 1IAKB 1SM3H 3E3QE 5E00A 5JHLL 2HLAA 5JW3H 4CNIB 1IC5L 5L2KE 1B2WL 1EERB 3MRHA 3QUXC 5HHOA 5IF0B 4JFZH 3BKML 3X11B 3F62A 5BRZB 2BERA 1SY6L 3I2CH 4DKFL 1MY7A 2YD7A 3CVHH 5AZ2H 4RGMB 5T3ZH 3ARQA 4PLOB 1BP3B 5KVEL 5E9DE 4QRRE 1WITA 5HHNB 4NC2B 2XWJA 1MEXH 2EYRA 1XCTB 1EK3A 3FMGL 3IKCA 5HYJB 1A7OL 5TE4H 4EI5C 2H2PC 1F3DH 5FFLA 1OPGL 3U0PA 1DLHA 2AERT 3PL6B 4OI8A 2JKXA 4OTXL 4FS0A 1CDHA 1NC4D 4IRJA 3FQXA 3ARBB 3QZWB 3UTPD 4JRXB 5E8EA 3EIFA 3S36X 5D7JA 2YWYA 3MLZL 3CJJA 4K8RL 2ID5A 4NO0A 4KV5F 1S8DB 1UENA 3U0TA 3FKUS 5IB1B 4R2GB 3PDOB 4QRPB 5BS0B 3VG9C 1NAMA 5FUZL 3GIVB 4Q58C 4Z0XA 4XT1C 3AS3A 2IH1A 5EO0B 4YHNA 1QFUH 1G6RA 4J6RL 1MCCA 1IFHH 3QAZB 5EBWB 4LSPH 2VABB 3EHBD 3HAEA 5C0AE 3T0XA 4BK5A 2HTKC 1XF2A 3QEUA 4EBQL 3H9SD 2YPLD 5F7HA 3RU8L 1ZVHA 1MSPA 2UUDK 3MRCB 2DWDB 2WBJA 4OZFG 3SKOB 4QF1A 2Z4QB 3RWGB 3BZ4B 3TBVA 3OJMB 1JJUA 1A7QL 1N59B 1C1EL 1KBGL 2K1MA 1MHHA 4TSCH 1MJ7H 1F2XK 4J12A 3DETD 1INEH 5BVJA 3U1SL 3PWUB 4HWBA 5JQHC 1J0IA 2ICWI 1ZLUK 1EGJH 1NGZA 4Y19D 2Q87A 5JQ6L 3AUVA 2D0FA 4GQ9L 3LN4B 3SDCB 5IHLB 4KHTH 2COQA 2DI9A 5HHQA 4XNUH 5CGMA 1JPTL 2MMXA 4NKMA 4QNPE 1QSFE 4JFOA 1QBMH 3FTGB 1FZMA 3M1BB 4J4PD 4YHML 2VIRA 1YEKH 5GS1C 5TE7H 5ACZB 1N7ML 2GSIB 4TTGA 5E2WL 1OOAA 3KXFB 2QL1A 4KJYA 4L29B 3KLSA 3ARBA 3LKOA 3MCG1 1FVCA 5CWSB 4X4YA 1MHPH 1EMTH 1TITA 5I75C 2RJMA 3C5ZB 1NANI 1NMAL 2VLJE 4KTEL 1AH1A 4UMGA 2FECL 1D5BA 4HLJA 1FG2A 4YE4H 5AD0B 5EO0A 3KPTA 3NZHH 4YHNB 4L3EB 4Q6IA 2SEBA 1IKFH 4YXKL 4LSVL 2YPKB 4X80H 2W59A 5GRYA 5J13B 4OFPA 4RDQF 4JO2H 4TOYH 2QKIB 3SDYH 1XMWA 1MVUA 5EOCH 2OS7A 2IEPA 2H8PB 1QPXA 4GRLA 1SJVA 5EOQL 4RMTA 3V95A 1EPFA 3BGFB 1N2RB 4DCQA 4XWOD 4Y4HA 3MRCA 1MJ8H 1ZT4A 4X5WA 2CPCA 4BQCA 1QLRA 3MPCA 5FUOL 3FL7A 3D39B 5GGRY 4YGVA 3FT3A 4HWZB 1SQ2N 1T1YA 3BD3A 2J2ZA 3PQYD 4ERSH 1CN4A 3OXRB 4XP5H 3HPLA 5L0QC 2BSRB 4XMKH 3RZCD 2DQUH 4EUPB 2C3GA 5F96L 4Y7MA 4I3SH 4ZTOL 1XZ0B 1CFBA 1P1ZB 5E95B 1D5IL 4Y8AA 4MAYC 4D3CL 1Q9KA 3TYGL 3MJ8B 3B5TA 4CMMB 1DFBH 2AV1B 1PZUB 1UH4A 1W0VA 1HXYA 4PP1C 3V6BR 5K59E 3SE9H 2F53A 4A2LA 3L7EB 3BJLA 1GZPB 4ELME 1G7HB 3IFNL 1YNTA 4LLWB 3FQRB 1F8TL 2YD5A 3MV8B 1CXEA 2LVEA 3D2UA 3FFCE 4K94C 4EUPH 2NTFA 3NN8A 5DD5H 2OXGA 2HN7B 1ONQA 1WIOA 2DIJA 3MRJB 2XFXB 1WK0A 4IHOB 3VFSB 4RGOL 1HZHL 1KJVB 1FZJB 2A6KB 1A7RH 1S7SA 3RAJL 3MV7A 4HJ0D 5AD0A 3SE4A 3L3JA 3VD9A 3NIDE 5EWIH 3RY6C 4P4RA 2QKIA 4OQTH 3ROLA 1REIA 3PJSA 2VC2L 4MQXC 2ITCB 4H26B 1EJOH 1R3KA 3WIHA 5IMLB 2OL3L 4U7MA 4DCQB 5AUMB 1XR9A 1CDIA 4L8SC 1JK8B 5C70A 2BVOB 3GSOA 4WTZA 1EAPB 3VXRB 4PY8I 2FJFA 4KMTH 2YUZA 2NY4C 3SGDH 2GSGB 1L0XA 3BPOC 4L4VB 2BSRA 4P5MB 3RWCA 2V9RA 1C8PA 3ARED 4OZIA 3VXTB 1EHLL 2V7NA 3MJ8A 2OR9L 4O02L 4PJ8B 3UAJD 4BZ1H 5BZDB 5L2KB 4CMMA 3EGSB 4LCWB 4M7JL 2VXSL 1FNGB 5E2JA 1BFTA 4HHAB 2GUOA 5I8KH 4YFEA 2A73B 1BQUA 1NLDL 3KVQA 2NZ9D 1FFNB 1MJJB 5C08E 1FGVL 3S9DB 4X7CC 4ZODA 3VI4E 4Z78A 2DIBA 3QWRA 3ULVF 4PIRF 1G7QA 4Z7WE 3T3PF 3U0WL 4PRBB 1JGUH 1Q94B 1KXVC 4UINH 4LOUC 2A6DA 1LP9A 1QEWB 5GQBA 1FNFA 1EX0A 3P73A 4YHYC 4Z7OE 3DGGB 4LDLB 4JZOA 1X4ZA 3EZJB 4JFHD 1Z9MA 4KROC 2BSSA 3JSSA 4P4RB 2VXQL 2AV7A 2EXYD 4J4PC 4OIAA 2PXYD 1JYWA 3VXQB 3A6CH 1CL7H 2NW2B 4BQBA 3Q6GH 2FJGA 3IAQA 4XHJD 4HPOH 2R9HC 3AROA 5CIPH 4KKLD 1FGNH 4XCYA 3V7AE 2PR4L 4HQQH 2J8UE 3VGBA 4X7TA 1YEEH 1KN4H 1U8JB 5AUMA 1XR9B 3HZYA 3V6FA 4R7DB 4TNWK 2H32B 3HZVB 1T22B 1EAPA 2EH8L 4LOUD 2Y07H 3T0ED 4P2OC 1HOCA 3FT4B 1R5VA 3B9DA 5BV7L 1QO3B 3QCTH 4M1DL 5E5MA 4L4VA 3VXUD 2E9BA 1IL1B 3LS4H 5C9KA 1ZEAL 4P2QB 3TN0B 1ZA6A 4GKSA 5LJYH 4UIKH 1RK0B 1UWGH 1NC2B 1GOHA 5E08L 2VTFA 3WNKA 5E9DB 4UV7H 2V7NB 4PJ8A 4HKBA 1WIPA 2VDRL 4IOFC 4ELMF 5FEBA 3X17A 5L6YH 1WGOA 4G43A 4JFFE 3U7YL 4CN4A 1SEQH 4HHAA 3V5HB 2GUOB 4C83A 3T2NH 1RUPL 4PJAA 1QZ1A 5D7LB 4PJBB 1PX4A 3MYJA 4YQXH 2A2QT 3I75B 4WHYG 5TQ0H 2ATPA 1OY3B 3LMJH 4JKPL 3IDMB 3ZDXE 5KVEH 4QHLB 1G7QB 5F8RC 4YH6A 1HHJA 2UUDH 3SJVB 3UJTL 1J1PH 5I74C 5DHXB 4KI5D 1K6QL 4OZGE 5F9OH 2V9QA 5E70A 3T0VA 1BQHB 2Q3AA 3L3DA 3CVIH 1VESA 3BWUC 2VLME 3F58H 2KZ1B 3WNMA 3V5KB 2HT3D 1I1YA 4ZUVA 4NQTA 4X7SH 4YHIA 5JW5B 3DROA 3VA6A 3U7AA 4L8DA 3MROA 3U4EB 5EUKB 2PYEE 3FONA 1OM3H 4MA8L 5JNYA 4J4PA 2CRIA 2WIMA 5EU7E 2YC1B 2EXYC 5T1LD 3LIZL 4WGWB 1XF1A 4QOKB 1KPUA 5DURB 4O2EA 1BD2B 5EIQA 3R4DA 2BNQE 1U8JA 1UJ3C 1RZIB 5IB5A 1P4IH 4OGZA 5E9DD 5IFAH 3F7VB 4CGTA 3QEHA 4RDQG 3L3IB 1T89C 3EYFA 4PV8A 4AL8H 4LLAA 4OV6F 4GAFB 4OCMC 4MB3A 2XOTA 4PS4H 2VXVL 4FTVA 4JFQB 5HGAA 1J05B 3QFJE 1LGVA 4R4BA 5DEGA 4GXVH 2R0ZL 4XAKE 5FGRA 1ZSDB 1QA9B 2D7MA 5DJ8A 1MH5A 1WC7A 2GAZB 4K7FB 3PP3H 1JN6B 3RVTC 2QHRL 4GAJL 1C5BL 3CMOH 3WDIA 4FQQA 4GMTL 3OR7A 3QUZD 2I5YL 1F2QA 4C54A 2IAMC 4WO4D 1QKZL 5IVOA 3TO2A 3V5HA 4U0RC 1CGTA 1F58L 4FQHB 3HMWH 4U1LA 4MHHI 3WXWH 1UYWH 1IKNA 4MCYB 1S5HB 5D7JD 1CYGA 1CGUA 4LARH 1IM9D 4KHTL 4LPTA 2Y1VA 4AG4L 3ES6B 2VN7A 3QFJB 5HHMB 3SJVA 2UZXB 5IUSA 4Z7OF 1J5OL 5A16A 1J11A 1OB1A 2VDLL 5F3HA 3KJ4C 4PY7A 2NY3C 4M8QB 2CR3A 3LB6D 2JELL 4HFWB 5J3HD 5HGHB 1WISA 3PV6B 1D9KB 4V1DD 2A1WH 5TE7L 1E6JL 3UTQA 2RAMA 3HKFA 4PGJA 3CC5B 3MCLL 1VFAA 4L8DB 4I2XA 5DJDA 4NQEA 3E8UH 1A1NA 2HJKB 2OJZH 1HILA 2VXUL 3OB8A 3Q3GB 1ZGLB 1I3RA 4F9LA 5JW4M 1U3ZA 3KYMA 3DOSA 4UILL 5BV7C 5IMKB 1WBZB 2NY7H 4F15C 5I2IB 1DANT 1RZIA 5CZXC 3O3DB 5GSVB 1K4CA 4KHXH 3EJZC 3BH8B 5IVXE 4JG1L 1F4XL 1OAZH 4G6JL 2ED7A 4J3SA 2YD1A 3CXHK 4TN9A 5KTEH 4M4RA 4OQ1A 3LEVL 2JF1A 3N9GH 4QHNA 4Q0XH 3CXDH 3TVMD 3VWKD 4PGBB 4X6CA 1R24B 4DK3A 3ULUF 5F97E 2DQIL 4H0IA 1NCBL 1ADQA 4FXKB 1MFNA 3C60C 1J88A 4HWEH 1VADA 2VLKA 1TVBB 4H88L 4L3EE 5DR5L 5DWUL 5I8EA 3PUCA 1OWRM 4UZGA 4H25A 3LRHA 4LPWA 4OD2B 4ENEC 3FQNA 2AQ3A 4ZXBD 1EIBA 3IDGA 5ERWA 1B0GA 4N0UE 5INCA 5H2BA 3L3GA 5B21A 1TETL 3VFOA 1RVFH 4D0DB 3WHXA 1UA6H 5HYJE 5F7MC 3K4DA 2IAMB 4M9PA 4K94H 2QQLL 2E5EA 5E2TH 5L9DH 1UB5B 1I8IB 4MJ6A 3KPLA 3IKCB 5CKAA 4PY7B 3UJIH 2VDKH 4KRMB 4KI1A 3ZDYE 4RFEA 1KIQA 1F97A 1OQOA 3DO7B 3NCJH 1Q9LB 5E5RB 3O6MH 4KJQD 1DQQB 4BSWB 2J8HA 4LLYB 1T4KB 1CF8L 3QUYA 5EBGA 5DD5L 1CDJA 1OGAD 1U8MB 3RPIA 3VCLA 5BMFH 3RVUD 3KPRE 2NY6B 4ODUA 4GXUN 5D1XD 3MACH 3ZT6A 4OLWL 4D0BB 2Q8AH 1WEJL 1KGCE 5IB1A 3K2UL 1I3RB 3EDKA 4G9FE 4GAGL 4PJ9D 4Z7WF 1A6WH 4FQLH 4GW4B 3D0VB 4Z0XB 5H35A 3J8F7 1OGAE 5J12C 4URTB 3UJJL 3TV3H 6FABL 1GIGH 5ESQA 4DEPB 4XVTH 4L8CA 1T7XA 5C0AD 5J1SC 2ZP0T 1T2QH 4XTRC 2P8PB 4HC1H 1F90H 4LIQL 4XVUD 5D7IF 1XFPA 3OXSB 2NY2B 4YHLH 2MCPL 1I1AB 1W72B 3IVKA 4QO1A 4IM8A 3P77A 2HMIC 3F6IA 4OCRL 5CFHA 1BOYA 5F7EH 2DYPA 2GJ6B 3IXAA 1NLBL 5I8EB 4MAUH 2HFGH 3MLTB 3O4OB 2GITB 4JZNB 5D2NC 1LDPL 5CP7B 2OK0H 3ARXA 1JPGB 4OD2A 1BQLH 4TPRH 3QDAA 4XMLH 2UYLB 3VRIB 5IB3A 1PLGL 3B5GA 5IBUB 1B0GB 5INCB 1NAKH 3E0GA 2IFFH 1JHKH 1F02I 1CGSL 4U1MB 3KYOA 1OVZA 5I1CH 5GGRB 4PJHE 4KVCL 4KPHH 5M94B 3VXRE 1OTUD 4GQPH 4OCLC 4RFEB 3QRGL 1HDMB 1UWEL 3TT3L 4CVXB 3BPNC 3MLSH 4JG0L 1RIVH 3NA9H 1ETZA 3VXUB 3SQOL 2LABA 4NZJA 1AIFA 5C07B 5LWYL 4ZDHB 1CDUA 3C5ZA 5K9JL 3ZE0E 3VWKA 4NM4H 4M4PA 3MGTB 2P44B 2ZUYA 1FG2B 4XNXH 4XXDB 3QR2A 3WCYA 4I18B 1L7IL 4EN3A 4O4YL 3OKEB 2VITA 2ZCKH 4G6FD 4WI6A 1I7RB 1HH9B 5CBAB 4F57L 3ULUE 3TBTB 2BVUA 5HHNA 1RURL 2X4QA 3HZMB 1A8JH 4FQXD 4H8WC 2V9TA 2R69H 5I30L 2BHZA 3TH2T 5IT2L 5JR1H 2VDOH 1YPZF 3U0PB 5JOPE 3PL6A 3MMEA 4M93B 3BO8A 4PYGA 3TNMA 1PY4A 4IMLB 4MCZA 3QIWA 2EH7L 1G6RH 1T1XA 3D3VD 4EI5D 1F6AA 3O0RL 1T1YB 3MO1B 4DJMA 5T1LA 1J8KA 1E27A 4HJJL 4PJFE 1JPGA 4M1DH 5D1QA 1INQA 1KXTB 4HIJA 3V4VL 1S7RB 1EAJA 3VMPA 3IS1X 1JI1A 4ZUSA 1AQKL 2CMRL 1BJ8A 4KMQA 5KVDL 3TN0C 1FIGH 4PJ7F 4LKCB 1A22B 1VGKA 3NGBC 2BY1A 2JTDA 4JEGB 3S6CA 3MBEB 2LU7A 3U7YH 4KDTA 1HKFA 1RUMH 4YXLH 1N26A 1YNTB 3K8LA 3O3BA 3MNZA 2NR6D 3CK0H 3NCBB 4R9HA 1ZTXL 4Z7VB 4QYOA 3RWDA 5E6ID 3FQUB 3ZT5A 1C08B 1S7WB 4KJPD 4NZTH 2A9NL 3T0BA 4OI9A 1MUJB 4B5EA 5B38B 2B20A 3VH8B 5DMIL 1C12B 3KYNB 3O4LD 4L9DA 3X3GH 1N59A 3GMNA 2PCPA 1S7SB 1MIML 5DI8A 2I9TA 3ARDD 1OAYH 2RFXA 5T33L 3S3PA 4AENA 5EPMB 1JZ2A 1QFHA 1I9JH 1A6TB 4NJAL 4PJXA 4EVNB 2GQHA 1D5ZB 4DOHE 1WQVT 2C7UB 5B39G 2KQNA 4LNRB 4NUJA 1TENA 3DVFA 4L1HA 1JYVA 1FZMB 4HGKC 4WFHE 3BO8B 1E4XL 1IGCL 2J88L 3BT2L 5C09A 4OGYH 3OAUH 2JJUA 1XGRB 1KYOK 3KJ4B 4S1DD 2IQ9H 4E9LA 3QIWD 3BD4A 4MA3B 3VW3L 1CICD 5GIRA 1DBAH 3QA3B 1U8HA 3I50L 5DJ2A 4P5MA 3G6DL 4WFFD 1GZQB 2XIDA 5L8KB 4WY7H 3CH1B 1A3LL 4CADA 2VB5A 3QIUD 3IDUA 3VXTA 1BGXH 1BJ1J 1JNNH 3I6KA 5I8OH 5F70A 4KTDL 3HPJA 4W6YB 3V8CA 4NN5B 1ZHNB 2C1PB 2GFBA 3G6JA 1JWUB 4XP4H 1KIRA 2WWKO 4LLQB 4RQQB 3V4PH 5CINL 4LARL 2R29L 1PKQA 1MUJA 4P3DA 3UXFA 2ZPKH 4Y4HB 3WFCH 5B38A 3NGBB 2XPGA 1UXWB 4OIBA 4XP6L 2IG2L 1HEZA 3V8OA 3QQNA 3STLB 1PGRB 3FT2A 4U1KB 1S7XB 3P73B 3DGGA 2VR4A 4Z7VE 3GJFK 4NUGH 1SEBA 3BZEA 4ZSOE 1NBVL 2LTQB 3HNVH 3F7YB 4ZMAT 3EDDA 3S35H 5C0RH 2ORBH 4RAVB 2C4FU 1T83C 1D5ZA 4XCYB 2L0DA 4AH2A 5IG7B 5HI5D 3W9DB 1P5VA 4K8RC 3IU3B 1J1XH 5C0JB 1T6VN 2BY3A 3UTZB 2H32A 1RFDL 4JY6A 1XGRA 2CGRL 4P2QD 3TN0D 3UTSE 2GCYA 3DX8A 4JQVC 4J3WA 2DLHA 1HOCB 4M1GL 3WIIH 1AR1D 1HI6A 5GZOD 4OCWL 2AKRA 1FNAA 2VXTH 12E8H 4Q0XL 3ESUF 3ZKQD 1GZQA 2OM5A 1WV7T 2J12B 1T20B 1UG9A 5IK3B 1I85C 1UXSB 1NCTA 2CJUL 3I6KB 5E8OB 3HPJB 4MXWH 1IGFL 4QTIL 2IAMD 1GJIA 2I60H 3FO9A 2J8OA 1ZHNA 1L0YA 4EUPG 3MYJB 8CGTA 1HHIB 4ZXBB 3VWKC 3PP3K 1UH3A 2WM0A 3QCVH 1YUHA 4QHLA 5SX4H 3IJYB 5IJKA 1IM3A 1J0JA 1X5XA 3IU4L 4U6TA 4D0CA 2ZUTA 5EN2B 2YEZB 3VFWB 1QRND 3BEWB 4IEFB 4RISH 4MMXC 3UJIL 4DGYL 1WAAA 4M03A 2YD3A 1I7TB 4DUXA 2BOCA 5KG9A 3TBSB 4J3TA 2GSGA 1FAIL 4HUVB 2DQCL 4YHKL 5I1DB 5M95B 3GNMH 5JW5A 4KRPB 2AXFB 5E56A 4JRYD 3WLWC 5E24E 3VXME 3DMMD 3FQWA 5JUEH 4XP9L 1BD2E 5I73B 1FYHB 1S78C 4X6DE 4RAVA 3OKMA 1J0KA 1ITCA 4MA7L 4O2EB 3KS0J 3SDYL 3T4YA 5MP6L 4QGTA 3ZDZF 4Q9RH 4EJ1C 3W9DA 1UKTA 5SWQA 3LPGA 3BQUB 6FABH 2APVA 5DFVC 3B4NA 5F1IA 4HKJB 4R4ND 4LVNC 4HIXH 4KI5C 1JTPA 1X3DA 3GIZH 4FTVD 5CEZH 5CGYD 1F3JA 2ENYA 1KENH 3ZMRA 1CL7I 4YHLL 2E6QA 4U6YB 4GJTB 4Q6IC 2HFTA 1JF5A 1LP9B 3KPPB 4RRPG 5SWZB 2AABH 2XWBB 1JN6A 1OGAB 5IKCB 2YRPA 3NPSB 4P46B 3UTSB 5HDQH 4R0LC 4ALAH 2BCKA 1RIUH 4MNQB 4BH8B 4MAUL 5JXAL 2WBKA 4GSDL 5D6CB 1MQ8A 5GS0C 1CIDA 3CDGB 4LF3B 2FYYA 4U1JA 1RZJC 3QDGA 5FDWB 3WEXA 2VLLA 2DI7A 4G6MH 3MV8E 3O3AB 3PWVA 3GBNH 2D9CA 2NY5H 4WU7A 1LE9B 1MCLA 1CBVH 4LHQB 4XPAL 2AJSH 1Q72L 3B9KD 1SYSB 3KPMB 5IJKC 2P45B 1RQ5A 4M43H 4EQ2A 5I1AB 2J3SA 5DJCA 1UKSA 25C8H 4R90H 2VJXA 4M6OH 4AYFA 5EA0L 5CJXA 3QRGH 1VERA 1QO3A 1FZKA 2NPLX 3PQYA 1EUUA 4WFEE 4L3AA 4RGOH 2OQJA 3UTTE 3NA9L 3NIDF 4YO0A 4I13B 1G9NC 4J3UA 4LGSB 4MDJB 5T3XH 2KL6A 3FO1B 5L0QB 4N0RA 4RCAA 3V4UH 2BVPA 2F19H 3QUYC 4QXGH 3H3BC 3O8XA 3LEYL 3CVHB 2XRAH 2DRUA 3OKNB 3PE9A 4XVJL 1K4DB 2AJZB 1BBDL 3MCKA 2E27L 3T4YB 5EZIH 2WUBH 1H8SA 5GSVA 5LGKA 1FSKC 2NZIA 2J6EH 1S7TA 3DVIA 3GSRB 1IC5H 3VXMB 5DQDH 2ATPB 3EYSH 5C0ND 4N5ED 5I1LA 5DJZB 2Z35B 1N6QL 2X4PB 3N1QC 4HS6A 1PBYA 2NY4B 5JMRA 2P8LA 4LP5A 3WS6A 1Q0YH 1I3VA 2D7NA 4FQPA 4Y19E 4H5SB 1M7DA 4R7NA 4D9LL 5KANI 3V6OE 1MF2H 1A6VL 3HI6L 1X5HA 1J8HB 1GPOH 3MROB 1OPGH 1TNNA 2ARJQ 5EUKA 4FXGA 4BQ9A 2AJUH 1JPSL 1U93B 2FGWL 4L9LB 5A40E 2DKUA 5SWSB 3PP4H 5MEOB 1FC1A 4PUBH 3VI4F 5ANMA 1KCRL 1AQKH 2W0FA 3L6FB 3MQIA 4HFUH 2J4WH 1SYSA 2R2CA 4FP8H 3UTOA 3QNZB 4P2OD 3KPLB 4K7PL 1TJGH 3THML 5CEYA 3NOIA 4XNZC 1FH5H 1HIML 2BSED 4YK4C 5HGAB 5EG6C 3MOBL 3QWRD 1YN7B 5C0CB 4NZTL 5EU6D 1IFHL 1KCUH 5JMOC 3TIEB 1T5WB 5KS9E 3IETB 2F54E 1MHCA 1ROWA 1Q0XH 4WI4A 5J57B 4FOMA 3D0VA 4GW4A 4NQSA 2DLIA 3VFTA 2VXQH 4U05A 1RZJH 3MCKB 4XRCA 4FQHA 3WFDH 2JIXB 5I1GL 1Z2KA 2NY1B 3VFVA 2ZNWA 3W0WD 5C0AA 1A7QH 1OF2A 2R2BA 3BYTA 1DQJB 3IKKA 3QP3A 1MHEB 5HHXH 3C6SA 2NMSA 3B9KC 3ECBB 2VLJD 5T5NF 2WNGA 1U8IB 2Y07L 4HKXB 5DK2A 1HH6A 1UCBH 4IRJB 3BT2H 3UTQB 1LK2A 4YZFF 2PTTA 5KVGL 3DIFB 5KSAC 2EDHA 3CC5A 2W0KA 4HWNA 1GGYA 2BXYA 1QR4A 4I2XB 4FZ8L 1YEKL 4FXGB 5L8JB 2JIXD 1YC7A 3PABA 2YA0A 4MXQD 2OLDA 4U1IA 1GGBL 2YD2A 4WHTB 1JZ7A 5I8CA 4X4X<