3UIZA

Crystal structure of sefd_dsca in d2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
133
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIVGNKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
molecule keywords Chimera protein of SefD and SefA
total genus 20
structure length 133
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uizA00
4PHXA 3UIZA 2CO2A 4OR1A 2CO4A 2CO1A 2CNZA 2CNYA 5D55A 2CO7A 3UIYA 2AXWA 2CO3A 2IXQA 2FVNA 2CO6A
chains in the Genus database with same CATH superfamily
1TEYA 1NAKH 3T4AB 3UJJL 5IROA 4X6EA 2FLRT 4Q56A 1BFSA 1DL7H 3BMWA 1G9ML 4LSPL 2VSDA 1BF2A 5I18L 1LMIA 3PJNA 1OAKL 2X2IA 4M61B 4N6RA 1HZHL 4XPTH 4ZFZB 2IVFC 2L4OA 3FN0H 2HRLA 5A7EA 3JV6B 1K5WA 3MKKA 1M6UA 4NRZB 2JJSA 1PSKL 4ELMF 1KCBA 4PMEA 5BMFL 1GS6X 4LCCC 2VABB 2R15A 4OF8A 3V0WL 2D7MA 3TYGH 5JHDB 1E9OB 4R2GB 4WWKD 4B6ZA 2OCCB 1J5CA 4FG4A 5I73C 5AYTA 1T5XA 4ODUB 5KSUA 4ODWA 3QHTC 4Y4KD 3TBVB 5ELIA 4B5ZA 1NBZA 5CBEB 1WTLA 2VXTL 2DS4A 1QSEB 2YPKA 2ZUSA 3IDIA 3P54A 3TM6A 1T21B 2WXPA 3K4ZA 2JKLA 3F04A 1T89C 2NXYC 4HJJH 2E74C 4OCNC 1JGDA 1O9WA 4FFVD 5I9QB 4B0MB 2V2WB 3EBAA 1NPUA 2DBLL 4LNRA 2CNZA 2VISB 4NO3A 5KBPA 2OFQA 2Q86B 4Y19E 1EEUA 1MCSA 5D6CA 1F2XK 2IOOA 1KFAH 3RDTB 4KMLB 3NIFE 5KJRL 3QDGB 2YPVL 4WI7A 1A1MA 4FFTA 4BZ1L 4HSCX 3MV9E 2Q6WA 3HG1B 3WTYA 4IGBB 1BQLL 1M7IA 3UEQA 1AHWA 1RZKL 5HJGA 1A3ZA 4G6KH 2ITEA 4ODXB 1V7MH 3ZTJH 1C16A 4LLMA 1CLYL 4P5KA 2VL5A 2BINA 1F11A 3KGSA 4H20L 1Z3GH 1M9SA 3OF6A 2JJUA 5LQBH 3OHXC 4IRZH 2AKRB 4B9KC 2JJTC 1DJGA 1S3RA 1X9UA 3OX8B 1EO8H 2DMHA 4OD3H 1LK2B 1FVCB 5DJDA 4Z5RB 1CLOL 5FK9A 3OB8A 1EEQA 1AS6A 4OQTA 3ZSSA 3LKQB 5HY9B 5CJ5A 4PJHF 4QKTA 1X9RA 3G5XA 3HS0B 3UFIA 4ZFGH 5AUMB 4MCZA 5D96C 3D0LA 1G7JA 1J87A 3F7QA 3CHXA 3KGUA 3S37L 1LEKA 3CFUA 3QJTB 4GMSH 1AY1L 4OJFL 3WEBA 1J8KA 3AWGA 4TVPE 3L9YA 4BH8B 1GGYA 3MV8E 3GI9L 1IGYA 2GTZA 4KY1L 2QVIA 3H6JA 4G71B 5D7JD 3KXFA 1EGJA 1JPFB 2BHYA 5FOBA 4AW4A 1H3VA 5ANME 3UTQB 2WUBL 4LAQL 2IIJA 3V0JA 2A77H 2P42B 4GW1A 5JXED 4LP8A 2WXHA 2G3MA 1FWXA 2X4OA 1QSFE 3P30L 2XTJD 4XMTA 2A6JA 1ZHKA 1A9EA 3DX8A 5C0FA 3N9GL 3DK2A 2D9QB 2QVTA 1CXLA 1LEGA 3IDXH 2YBRA 4JQVC 1WFOA 3OB0K 2X6UA 1T1XB 3IFNH 3GO1H 4E9XA 3TBCA 1I8MB 4LLYB 1FNSH 1NFAA 3V4PL 1CE1L 4PJCE 3DX4A 1XD1A 3W9EA 3GIVB 3OMNB 4OGAD 3SY0B 1W72B 4A7VA 2I69A 3CVBA 2IWFA 3SSGA 4JN1L 1IFHH 2HXAA 4DIXA 5IK3B 3KE0A 5H37G 5IT2L 1QFWH 5CS7A 2P52A 1DBAL 1MAJA 1A4JA 1MHEA 3AS1A 2C9PA 3EBIA 4JY4A 3Q05A 1ADWA 2AZUA 3HBPA 4H25A 3WUZA 2IG2H 2NY3D 5AD0A 3MNWB 3FFOA 4UAOB 4TUUA 1VERA 3GZKA 3TA3A 3TZVA 2H3XC 5E8DH 4FKEA 4ZX4A 1KWGA 3J2PA 2W94A 3GMRB 1M6OB 3LYRA 1OZTG 2A9BA 1FC1A 1MFBH 3IJYA 5T1LB 2Z7YA 2NR6C 5CJQH 4BUQA 1J1OH 4P5TC 2VN4A 3VQLA 5C70A 4G6FB 2P9RA 5IWLA 4O02B 3MCYA 2C7UA 4WI3A 4TUJB 1DBKL 4Y16C 4XODA 1U8LA 1U95A 1W15A 3NK3A 5DVKA 1A2YB 1NMBL 3OKLB 5DWUL 5DR5L 2IBZY 3H9SB 4QYOA 4OF7A 5ACZA 3CN4A 2HTLD 2NQCA 3L1GA 3U48A 2G30A 3VXMD 3WHE0 1UACH 1KY7A 4YSSA 5AKRA 3ZX1A 2E0PA 1HH9A 1LWHA 4ZFOL 4G80A 5CXPA 1MRCH 4OI9A 3NYKA 2WNXA 1OAUL 3QRLA 4XP9L 3IXAB 2IDSA 2K9UA 1GR7A 1DQLL 5DRXA 3PWJA 4GT0A 5T1KA 4FQHB 5BRQA 1BWMA 1H3WM 3NCYP 4RMRA 5IUCA 3Q5YA 4FS0A 4JPIA 4ZO9A 4J8RA 3C5ZB 5AKTA 2P24B 1KJ2A 5HVWA 3MLYH 3PUCA 5D2NE 4PEEA 3S8FB 2OJEB 4XBPB 3TT3H 4YSQA 2DYSB 4WO0A 1U8OA 2HA1A 2D03L 3BPCA 4Q9RH 1G9NH 3N1QC 4GRMA 1FGNL 1G5GA 2X2YA 3ME0A 4UINL 3HB3D 1NFDE 4FXKB 3MRHA 3UAJD 1DBJH 2V5YA 4PJ9A 5L6YL 4MD4A 4WHYG 4OCWH 5AW8B 5HI4D 3MBWA 3KH4A 1VCBC 4NYLB 1ZANH 3DI3B 2C34A 3S35H 3S8WA 1ZS8A 3K5SA 4NO0D 2WHVA 3IPEA 2P5EB 2HFEA 2RCSH 3F5WB 2QR0B 5FFOA 5ICUA 4JBSA 2APSA 1BAWA 2V3EA 1V3LA 4DN4L 5TQ2H 1V05A 4F37K 3KPTA 5IMLB 1GGBL 4HAKA 4HXAL 4KAQL 4NDMA 5TFSH 1SVZA 2VN3A 1CFNA 4CU8A 5ACMA 3ZE2B 5FGBC 2C7FA 4HK0A 4YUEL 4BELD 5JW4R 1VGEL 5C6TL 4RBPH 3W3BA 5F0JB 1G7PB 1JD9A 4QRBA 3RTLA 4O02H 2W07A 4FG6D 1I4FB 2ZPKL 3HI6H 2WQWA 3PNWA 5LB1A 3RYMA 5IFAH 5KSBA 3PL6A 3A4FA 4YHZH 3NTCL 2XA8L 4K9EC 1LGVA 5D2LA 3UTTB 5C7XH 1LWRA 1MWOA 5E1GA 3UAAA 4WTXA 1Q90A 2IEPA 1A6UH 4HGWB 5T1DL 4JFPB 2YGNA 4F7TA 5L6YH 1E6JH 4GI9A 4DVBB 4DO6A 3SKNA 1V27A 3TJHD 4KUZL 5DHDA 2DD8L 4L8CB 1U8KB 2A1WH 1DVTA 2FO4A 4OZ4A 4GQ9L 4E68A 3H2PA 2PTTA 2JKNA 1M1XA 1QSED 2CUIA 3TL5A 5DHVB 3HJEA 2OI9C 3US1A 3HI1A 3JT2A 4MBRA 4GSRA 3VRJB 3RWFA 3I9GL 3R19A 3A5VA 3E3QC 1NGQH 1JYNA 4I18A 3RI5K 5GGTL 3K6SB 1FE8L 3KVDD 5J6SA 2G3ZA 1R3JA 3DIDA 1MIEL 5IMOA 3EDJA 1M1SA 1XGTB 1BQKA 1IAOA 3IDJB 3ZHKA 5IFAL 2PWEA 1ZV2A 3WS3B 4APQD 4BSJA 4BKLA 2WMPB 5C7ZA 2BC4B 1P5VA 2BSRB 3HIZA 5EEZA 1FLRL 3AY4A 1CC3A 4XCFH 5BXFA 2HRHA 4XOEA 3ARFC 1UH2A 4BJLA 1A7RL 1KOAA 1N26A 1HFUA 3EJSA 4B9GA 5C9JA 3BPLB 2DWXA 3PQYB 3L4CA 4J3UA 3RPIA 4QEGA 1QNZH 3O2WL 4ZNCD 3ZE1B 4AI7A 3DYPA 1VFUA 4F3FB 4Y4KC 4AJYV 3SGEI 3GBML 2QQKL 2YD1A 4YLBA 5C08B 1OE1A 3BUYB 3HG3A 4WI0A 4P4KC 4LL9A 4ALAH 4FTVD 4YFDB 2V0AA 4XMLH 1OHQA 4L4TD 1LP9F 2Y36L 3LKOB 4HETA 2X5PA 3QDHA 4JL1A 1P4LA 3HAEG 1XIWC 5GGRB 3H6AA 1GJUA 2X4TA 4UTBA 1V3KA 3R06B 1OT4A 3PWPD 3ZMRA 1QTPA 2NCEA 2YUVA 4CSTA 1BFOA 2ZWZA 3K91A 1HX0A 4KROD 2Z31A 3UTSA 1AOHA 4H8VA 3C8DA 1OTUD 3HR5A 1BXAA 4YDVB 2ESVD 1F5WA 2IPTH 4Z7QF 3ZE0F 2VR6A 3PFUA 5I23A 4E41D 2XWXA 5CEZE 2G0KA 1VACB 3KVPA 2HFTA 5GZOC 4G9FB 3QVAA 5CHNA 3T4AA 4N2FA 3S96B 4IBUA 4YIQB 5K5YA 4RBPK 2EXSA 3O3DB 4E9LA 1U58A 1AHMA 5SWSB 2DQJL 4EI6A 4DTGH 1WBXB 2ZWNA 1HK6A 3HVDA 1MY5A 3U1SH 4MJIA 1PJWA 2IG2L 1D5BB 1HXYA 1GZPA 1MHPH 1RHHA 5HDBB 3LPOA 1N6QH 1MCJA 2R2CA 1VPOL 3SKJL 4NNYB 4KZCA 5KOMC 3G3LA 4F9LA 4CN4A 2CHXA 4QTHA 2X4RA 2KLRA 5L7XL 5ALBL 3DO4A 2B08A 1Q94A 3Q06A 1AD0A 2QPDB 3D06A 3WFCL 3FC8A 5ITBH 4HEPA 2DQTL 4AENB 1UJ3B 5ETUA 5TGBB 4BSVB 2GJPA 3GXFA 1RERA 1HSAB 2IOIA 3L3IB 4U1LB 4WU7B 1TTRA 3O6KH 1GC1H 3D3VB 2P7TA 3IAPA 1R3KA 2PO6B 5HYSG 3O9WA 1A47A 1KGCD 3MLTB 4QXUL 1FGVH 2GBVA 4K3JH 5I30L 4QHNB 2D7TL 3LEVL 1CGVA 1IJNA 2HB0A 2PW1A 2AXJA 5FKPB 1N0LB 2V2XB 1WBYB 5E2UH 1IGJB 3BZ4A 4X50A 4S11A 2ZTBA 5C86A 3HTLX 1EDYA 4FYQA 3G08B 2FSEB 4LCCB 5C1MB 3CSGA 4OLYL 4QXVA 3KHOA 2YS4A 3ZXAC 1TVHA 3RWIA 5CSGA 5SWQA 3TYFA 2OA9A 3TH3T 3UIYA 5FB8A 5E24E 2VDMH 1X5MA 1KEMH 2JH2A 3OR7A 2HRPH 3ARGA 1R17A 43CAB 4YHOH 3RGVC 2VDRH 4AM0Q 1MWAA 1I8AA 1MHCB 3FK3A 4WNQB 2ZKXA 3VE0A 2ATPA 5JHMA 3WEXA 2VL5B 5LVEA 3BISA 4DK3A 2H6UA 3MNDA 3EGSA 2JE8A 5C6TH 1A4CA 5DUPL 1DJIA 1YEKH 2ED8A 1O9VA 3B34A 5ISZA 1ET7A 3BPOB 3EYUL 4ZPVA 2NYZA 3NJVA 4GXVH 3VA6A 2ICEB 4OGXH 1LK2A 2NY1C 4G6MH 4GKSA 4N6QA 4ZAKB 3VFMA 5CD5D 5CAYB 1NLDL 1JHTB 1QFPA 5INDB 4QOKB 5IROD 1T3FB 3IJEA 1Y18B 3N5AA 2IBGA 2R23B 3IAGC 5AUMA 2DWDA 3FCTB 4M1CD 4LDCA 3C9NA 1KBGL 5BZZA 5CD3B 4L37B 1CYGA 4ZO7A 4XX1G 2XQBH 4YPGA 1T1YB 2JCCA 1DCLA 4OZIE 3TVMC 4FGMA 2OL3H 3QRFM 1SQ2N 5TDOB 5IB3B 2Y4SA 4QRRD 4MRBA 3PABA 4JY5H 4AIZA 1NINA 4G8IB 3IDMA 4HC1H 4OJYA 3IVKB 1Y6KR 2X4OB 4YQXL 3V4PB 5CILL 2OXHA 2R4SL 5FYKU 3ROOB 3DX8B 4U3HA 1P6WA 5C0FB 2BFVH 3O3AA 3ORJA 3D0AA 1HHJB 1OCOB 3DYMA 1EZVX 5LHDA 4RGNC 4AXWB 3RL2B 1VZGA 1G6RL 1A7PL 2XKUA 2AEWA 4AVHA 1BSIA 2OMYB 3KM1A 3FOMA 4MDJA 1DBML 3TWCH 1J8HA 2NZ9D 3A22A 4PS3A 2YPVA 5C09D 2NZ9C 5B7MA 4FNLH 3KPLB 4M5TA 2WZ6A 1NAMA 3EJRA 1JK9A 2X88A 2X3AA 3RURA 1T2JA 4G1EB 1WJ3A 3JYCA 3SCMC 4BFFA 4J2XA 3GSWB 1N64L 4PSRA 2X6CA 4MQ7A 4EIZC 3LRLA 3C09B 3DO7B 3CAFA 5H35B 3ULUH 4XN4A 1DBBL 4V1DD 1V3MA 4PJXF 3WO3B 1AXIB 5MHSE 3MNWA 3SEPA 2BFVL 1X6NA 2D3LA 2ZYSA 3A3YB 3U0TB 1NIDA 2V9RA 4LSRL 1CPUA 1GZHA 1YG9A 5F6IB 5D2NA 3TS8A 1KGXA 4JO2H 1RZKC 5E5RB 5I1LA 2GHWB 3DTUB 2VDNB 3MRIB 4YLQT 5KSBE 4PJDF 1OTSC 2BERA 5B1JA 1ZT4B 2SEBB 4LSSH 5FYJE 5I73B 2EKSB 1F58H 3EYQC 4LCUA 4NUPA 5IB1A 3FH8A 3QCUH 1G0YR 1JI2A 1JPST 4AVIA 2VC2L 3JTSB 4PJDA 5TJWK 3F7KA 3FSAA 2R2HB 1C7SA 3BWSA 4AEHL 2NZIA 4CDGC 1T7ZA 1YN6B 4FFYA 5F70A 3PGCA 4G8AC 4IHOA 1QPPA 4O2CA 3KPMB 1QATA 3QXWA 1EK3A 5TH2A 1KB5L 1CQYA 2JCCF 2P3YA 3EO9H 4J3VA 4YXLL 1G5AA 2DI9A 4PV1C 2YWYA 4NERA 1MFMA 3WIIL 2AXFB 5EIIB 3NBNA 4R90L 2I60L 3HBZA 2X28A 5CZRA 3T4YA 1J1XL 1EJOL 1FC2D 1NCWL 1QHQA 2ITCB 4M1DH 4XPHH 1ECZA 4W9IC 3OBAA 1CICC 2MCG1 5B1KA 2YO3A 2EC8A 3D7PA 3FONB 3CFJA 4PTUA 3QDMD 4X0KA 3IETB 4RDQG 1HAUA 4LGRB 1U6AL 2TSBA 1KCVH 4PVLA 3OMZA 3ALPA 5ERWB 3BN9D 2PWHA 2Y72A 4Y19B 3FZUC 1FBIH 1P84J 4EDXA 4KK5C 3W56A 2EUXA 5HDWA 3OD3A 1N8ZB 4F93B 3ECWA 2GB2A 4B0MM 2BWIA 4NPJA 4KJPC 5IZ7A 2IDCA 3VFGH 4AQAB 4PAZA 4NJAH 4OM0L 4YS4A 1UFGA 3NPZB 1DUYB 1CD1B 3FRUB 3KPOA 2XWCA 4O2EA 5FAAA 4LLQB 5T3XD 1UM4L 4HYTB 5ILTH 4YDZA 3NEOA 2Q3ZA 1IC0A 2EYRA 4B9JA 2HFEB 1N4XL 1RK0B 2EDFA 4O58H 4GSXA 2PCFB 3OHXB 1CICA 1Q0EA 3QYMA 5I1AA 2DQTH 1N0XH 2P8LA 2L7EA 3SPIA 2ZSWB 4JHZA 5HPOA 1VA9A 1WE5A 2BY2A 4H5SA 3VX1A 2E6QA 2JLLA 4M4RB 4PH8A 5IJVA 5CGYC 3QAZC 1KGIA 5AKSA 1T89A 3C12A 3VYPA 1WTGT 2CBTA 3VI4F 3LSOA 3QEUA 1BVZA 2IH3B 4Y4HB 1BXVA 3GRWL 2YPKB 3QHZL 4K8RD 4DVBA 1QI3A 1HHHB 3BO8B 1IZJA 5T3ZH 4L8CA 4L3EA 3TBWA 4I77H 4L5FL 3FU6A 3TTYA 4KKZA 1KY6A 1CFQA 1TR7A 3GIZL 3MZGB 1R3LB 5D7SL 4NUGH 1XBDA 1PLAA 3OPZL 3VXPB 5HHPA 1IEHA 4KRNA 5DHVA 1GKOA 3QWQB 3LIZA 2J8HA 4ZS7H 3GSUB 4R4NC 3HI1B 3F6LA 2CGRL 2OW7A 4OZGE 4L8BA 4EKJA 1DQMH 3GXDA 1KCWA 4IJTA 5ID0B 4M6NH 4MRCA 1X7SA 3DMMD 5IJCC 4GFTB 1OPOA 1UXWA 5F7EH 2MCPL 1TQBC 3O2DL 1HNGA 5AOKA 4XMKH 3O6FC 4NQEB 1IC5H 4Q6KA 1GOFA 4FXGB 5MEPB 4LVHC 3SE9H 1CF8L 3TV3L 5HGGS 2BXZA 5CKGA 4WWOA 2CO4A 4K7PY 3ZQXA 5JPNC 4FULA 1ES0B 2FCBA 4WJKB 3QXVA 1X5KA 4MDIA 5D7JB 2Z6FA 3VDAA 5BVJA 3VXSB 5LGHH 1U8MB 5CJQL 4PJFE 3H3BC 4EI0A 3H7LA 5DMGD 1AGCA 5DSCB 1B2YA 1WFIA 4NIKB 4OIIH 3Q8BA 4PJBE 1CYXA 4G11A 4NZTH 3D51A 5JIMA 3QC5X 1LO5B 3RILA 1DJWA 4WTWA 3EFOA 2VXQH 4MA1B 1E67A 2J8UF 1ANUA 5IHZB 2G0LA 2VSMB 4U6VL 2DM4A 2R51A 1J0ZA 3LQAL 2ZUQC 4HCRH 4PJ9D 4FL4B 2BMKB 4FQ1H 1D7DA 3LNDA 1NWPA 3BQUD 2OR9L 1QKZL 4N2CA 4ZXBB 4MZIA 4QRFA 2VC2B 2YRPA 3G6JB 1E9OA 1E5YA 2YGPA 3AREB 1JK8A 4TKWA 5F7DA 3QPQC 2Q2EB 4PREB 4XO5A 2K8QA 5AW2B 4JANA 3WNMA 4KMQA 3NN8A 1GCYA 1ZTMA 5CGBA 2C4XA 1T21A 1M7DB 5F0LB 5FOBB 1N8OE 2W5PA 3P0VL 1FZKA 3GSRA 4FKHA 3NDYE 1C08A 1DJXA 3F8UB 1D2OA 1T0MB 3JV4B 1PY0A 4K9EL 3WI9A 4A2MA 4WI5A 1R4XA 4H1LB 3VVWA 4J4PD 1EJ6A 3P40A 4IMKA 4L1SA 3S96A 5FLUA 4HIQA 4Q2ZA 6CGTA 2EJ1A 3ARDB 3D25B 2O6DA 3FQ4A 1AS7A 2B4CC 5FM4A 4QDGA 1OD7A 1R0AL 4TNWK 5KYUB 4ODTH 4KGJA 5C6PB 1XCQB 4IS6A 4FABL 2GIMA 4D7PA 3M45A 3WCYA 2BHFA 2FJFA 2YWZA 4MQSB 2A9NH 3WE6B 3D8MA 1D6VL 5E9NA 4AGMA 5FPIA 3LXCA 5KG9B 2ICES 4R7LA 3RBGA 2H1LM 5FW7A 1HH6B 4EMZA 1UA6H 3Q2VA 2GAZB 2EH7H 1KXHA 4MMXA 4ABUA 4AEIL 1OV8A 2NQDA 1QMUA 3MBEC 4DPCX 5F89A 3F58H 3AUWB 1MCOH 3HCVA 2Z3FA 3QW9A 1RVFH 5SX5H 1C7TA 1ED3A 5JUEL 3WY2A 2OYLA 2JTDA 3QEQD 4JY4B 3FO1A 3NJMA 2H6PA 5GS3A 5JPMC 5DVPA 1XF4B 4TOYL 3M7OA 5LDSA 1ASQA 4WV1B 5HHOE 1LO0H 2DTSA 2AEPL 1E6OL 2DZEA 2BHZA 1JHLL 5GGSB 3EOBA 1I1CA 3JBG7 4MXVE 5BV7B 2HFGL 3ECBB 3QR1A 1GZQA 4MZRA 5HHNB 3AQXA 4AMWA 5B39B 2CHZA 3PDOA 2HLAB 2ZXGA 3G5XB 2G5BB 2K6WA 3I85A 4OCXL 4N2MA 2A9MH 1RV6X 3RL1A 4Y2DC 3BAXA 3AXHA 1E30A 1GVIA 1XDTT 4IRSD 3VX0A 1XTMA 5A40E 3MGOA 2VYRE 3HHRB 2HKFH 2V17H 3O3EA 4RSYA 3S34H 4CC1A 2BP0B 2VUKA 4ONHB 3CCHB 3MRJB 3SKUD 1UXSB 4D9RD 4FTVA 4HKJB 1I9RL 3RVXC 5C9KA 4B9ZA 2B1AL 3CU7A 1XGUA 3V5KA 5ACZB 2ZNXA 4N8VA 3WY4A 1MCKA 1Z9OA 2PR4L 3P3TA 4UCFA 1PKOA 1KXVA 4N5UA 5TE4H 2J55A 4JM2C 1YEFL 3ZU8A 4Y19D 2ORBH 4ETYA 3C6LA 2FK9A 2R0LL 1HU8A 3ABGA 4YK4C 3AQYA 4XHJD 1E2WA 1CGWA 1QLFA 3PXLA 2PCXA 3PHOB 4P2RB 3M46A 5AAWC 5ISZB 2ZUWA 3QDJE 2VOTA 1OQXA 3SQOL 1XAUA 3RWCB 1SMDA 1GGUA 4JPIB 4UQIM 4KTGA 3V6OE 2P24A 1YCSA 2HJFB 3IBOA 5A2CA 4KTYA 5KVFL 4NUQA 3CBKB 3PV6B 4P3DA 3IBEA 4EEEA 3P9LA 1JWSA 5D4IA 1HOEA 2WYHA 1MLCA 3SBPA 1JXDA 1F42A 1I1AA 4X7CC 4ZSOA 3RFZA 4ALAL 2FYYA 4KFZC 3FU0A 4FP8L 3T77B 4X4ZA 3VMNA 4BK4A 4JAMB 4JO4H 2LW3A 2JB5L 4QRSB 2OJ1A 1CR9L 3IKCA 2VZSA 3HE7D 4I4WA 2LU7A 3EHBD 2AC0A 4KQ0A 4MA7L 4YDNA 1M6OA 2F7QA 1TZ8A 1EDQA 3RGBA 3F5WA 3GJEB 4UQEA 2QR0A 1J0KA 1YMHB 2F15A 3APMA 5J9PB 4OKVA 1RULH 5GRWA 3WXWH 3WSQH 3TA3C 3WNKA 1KB9K 2XG4A 4NCDA 3FO9B 4Q4EA 4ZW6A 1G4MA 1WO2A 4K73A 5M7QA 1GTNA 3B2MA 3OAYH 4UQDA 5AW7B 3VGAC 2ZUUA 2COQA 3RGVA 5FO2A 3K4AA 4ZW8A 3WUWA 5IREA 4RGOL 3CLFH 1XGQA 2I07B 4ES9A 3T0EA 2IDTA 2OULB 2B1OA 4W4NA 4Z7UF 4OIBA 3MLSL 4CADB 1NAMB 4GO9A 1UT2A 2GEQA 2JQMA 4AG4L 1J9QA 3UC2A 2W0FB 5F9DC 3TFKD 2OSLB 5I16B 4MQ7B 3NCXA 4MNGE 2R9HC 5GISH 4OLWL 4OCYH 4GP4B 3WLBA 1J1PH 5IKCA 1A9BA 4FMFA 3AMLA 2XTJE 3ESVF 5IW3A 3MRDB 4JO3H 1D5IH 3B2VH 3BSHA 3LCYA 5HVHB 5I0DA 5E6IC 5IVZA 3L4UA 3ES6A 5IM7A 4XVSL 5JXAL 4WWID 4DOHB 1PZBA 1YEEL 2WWNA 3OXRA 4YUEH 1NCOA 1U33A 2UXFA 5E8PA 3GPEA 4DO5A 3QZWA 4MZ3A 3MV8D 2DYRB 3MRQB 4QNPE 4JZJB 2XWEA 4Z7OB 3RIFF 1K6QH 2BSRA 4LPUA 4IRJC 1FGVL 1QYGH 3QA3A 4O51B 5I30H 1OE2A 4DGVL 3ILEA 3RX9A 4J3SA 3STBA 3ULUF 3GXIA 4TLTA 4F5CE 1Q9WB 2VLRB 3HNVL 3T0EE 4NYLA 1I8IB 5J6HA 5CCHE 2Q9OA 4YDKL 1OP4A 3FO2A 2IOMA 4PRHB 3C75A 1W0VA 5D72L 2VDNH 3CH1A 4I2XA 4PJFF 3B2VL 5IMLA 1BAFL 1ASPA 2Q7AA 4GIPD 1S5IH 3BH9A 4N2BA 2VIRB 2CLVA 2QPSA 1EEYB 4K8RL 1A66A 4XMXA 1O75A 1I9JH 3QC6X 4WU5A 4YZWA 3EOAA 4HPHA 1H6UA 1G7PA 1GMEA 1LP9A 1SRDA 2XKNB 3O4OB 3MXVL 5KBDA 1T1ZB 2FHBA 2W59A 2I9LA 4M8QA 3HBGA 3UROR 3VMOA 4PTUB 3CVDA 3QYCA 4U6YB 4YHNB 1J9RA 1JGIA 2FX8L 3MJ8B 4HJ0D 4Z77B 3OAZK 3ISWA 1M53A 4Z3FA 1BXXA 4D0CA 4I7ZC 4WWKA 3QR2A 1RZ8B 5B1JC 4X4KA 4YXLH 4MHHG 2NUPB 5KVEL 4HJ0C 2FO4B 3K6IA 4OZ4B 1XSKA 5F9WB 2LLNA 4QF1A 2ZCHH 2PTTB 5EDXA 5C09A 1KTCA 4FNSA 4G9FA 3HC3L 4FJZA 3KLHD 3AWEA 4GG8B 1TZIB 2VGLM 1VRSA 3ESMA 1ETZB 5JLZB 1CL7I 2JCWA 1KJ2H 3DOHA 5C0AE 1AR1B 3I2CH 3LS4H 4QJ3B 4ODVH 5KYXB 1A22B 4PJGA 3GSXB 4WDIB 4D9RE 2H0JA 2RFXA 1GHFL 2YKLH 3GPSA 3LJ3A 5CGTA 1GZPB 1RHHB 3WNNA 4K8RC 4JS7A 3VXNB 5BS0E 4BSWA 1RJLB 2VDPB 1MUJB 3QUGA 4F8QA 2YA1A 5JR1L 2F53E 5F7MC 4DK6A 5A6MA 4NQVA 4YL9A 4QXWA 3BT0A 2GJJA 5BV7C 2GC7C 5DZOA 2UX6A 4B9IA 4DWHA 1LM8V 5DJAA 3GGWA 1N7ML 4MD5B 4AENA 4XCYB 5EUOB 1Z9SA 4XZUA 5ETUB 5CZXD 5TGBA 4EBQH 4ENED 1ASOA 4AC4A 3D39B 1KJ3L 3A6CL 2D4FA 3FSOA 5C0IB 4PPTA 1R3LA 2BPBA 4KJQC 4QPEA 1AC6A 4K7PH 4OLZH 5BOPA 5LNDA 4L1TA 1H15B 1FYTE 4FZEH 2W80C 2I25N 1MCCA 2G5UA 4XMWA 3FUEA 2ZCLL 2QHLA 3C60B 2QV2A 4AZ8B 2XWJB 3ETBJ 1T66C 4M02A 4JRXD 3EGDA 1QEWA 4B9PA 2R8SH 4DGUA 2GTWB 1Q8MA 1B4TA 2NY4B 1YEIH 2CKBH 3STZB 1F4YH 4ZZKA 1QX1A 2O5ZH 1MG2C 4N2NA 1L6PA 2NPLX 1QSZA 3D30A 3RWIB 3RRQA 4PJBB 4IRJA 4HIJB 3B9KD 3IGKA 4J3TA 3QWOA 5EN2A 3OR7B 4GP5B 4PRPE 4JN2A 4ADIA 5TPWH 5D7JA 4PJ8C 3PL6C 2WGXA 2WN2A 4FFZH 1BAFH 1MWAB 5EU6E 2F1BA 1C8QA 5FDWB 3W0WD 3G7TA 2ATPB 5BUAA 4NN7C 3K6OA 5LO7A 3WEXB 4PJEE 4PRPA 5I1IH 1FF5A 3O3DA 2HYMA 1QLRB 5EZIH 4CVZB 1U92A 1XD0A 5A16A 5EBMA 3WOVA 1EFXD 4S0HA 1VJSA 1GGIL 3RUGA 2WPGA 4NQED 4F80A 5C0RL 1P5UA 3HE7C 4KXCA 4JQVA 4YDIL 5IQ9B 4O02L 2L8AA 4OZGB 5J7CC 2ADIB 5E0FA 1DYZA 3CZNA 3EBHA 3I50H 2I60H 4WHTA 2J7LA 1XH2A 5KSBF 1YEEH 3RA7H 1EDHA 1AACA 1H3PL 1Y0LA 2WVSA 1IGMH 3IKKA 1WLHA 4WEBL 5TPWL 3FUJA 1CICD 4YPGB 5DRWB 2JCCB 4P99A 3D39E 3KCWA 1M7DA 4W9LC 3KAAA 4PJ5E 2CO6A 4U49A 5EHFA 3QNYA 1H8OA 2ZXDA 5BZXA 1GW0A 1HZKA 1N5YL 3AROA 3S48A 3PABB 3E8VA 3ZL4H 3WYRA 4HMDA 4JK0D 3PIQB 2CK2A 3BUTA 3HC0B 1ZIAA 4MAYA 1S9YA 3N1PC 1S5HA 1DJZA 3PE9A 5DO2D 2ZPKH 1KCKA 1GIGH 5IB2A 2UZPA 1IILE 4FD0A 1OGAE 3HRZB 3VNZA 1R33A 4G43A 8FABA 3UBFA 2JQAA 2VUOA 4ZX3A 2NY7H 2CALA 4JM2D 1IAIL 3TJEL 1URZA 2XX1A 2F08A 2N3JA 1WGVA 2ZCKH 3TYGL 1TKWB 1KTBA 4OV5A 2VR9A 3KPSB 3CVHL 1J8HB 4MBOA 1RURH 3RVXD 3TYFB 1BBJB 2AMUA 5LBGA 4XMPL 5D72H 3CNKA 1L9OA 1OIOA 4P5TD 4Y16A 4K71B 5EULV 1RUML 2WB1A 3L9EA 3GSWA 3QXDB 4Q0XH 3VE0B 3HCVB 5IWLC 1CGTA 1MJ8L 3GXPA 5DS1A 5BVPL 4FZEL 5EUKA 1F3DH 3VH8A 4NO5B 1K6QL 2NDFA 3K6DA 4AGQA 1OLZA 4P2YA 3ZR6A 2VXQL 1D6EB 2X4SB 1LDPH 3D6GA 5E2TH 3IMSA 3K2IA 2HG5B 3VFTB 3SKMA 4MTMA 2I24N 4LSVL 4LRIA 1DR9A 1QSFD 1T3FA 2NDGA 4PGBA 5GS0L 1UM5H 2DQHL 2R69L 5AB1A 4XNAA 3NJFA 3CVHB 3P1VA 2VAAB 1OK8A 2WLJA 3GTVA 4J6IA 4RSVA 4BRJA 1TQVA 1YEWA 2L7JA 4A39A 1EHNA 3PGCB 4M7JH 4BUHA 5E51A 2VN6A 4PI2A 2E7BA 2DWYA 4QR7A 5DDHB 2JI2A 3NFPA 1FVEB 2GJRA 4XWGH 4UIKH 4IRSB 4M43H 4MNHB 3WIHA 1O7SA 3D50A 5TD4A 2CLRB 2GFBB 3O4OC 4ODHH 1E8YA 4L4VE 4DPRA 2FX8H 1PLGH 4P46D 1KLGB 2QTEA 3GKZA 3K46A 4WIQA 3WBDA 1IMHC 3HAEA 3KPNA 1AZRA 2J8UA 3HNSL 4HWEL 4LIQH 5LAXA 2Y2TA 3D2UD 5EU7C 4AK1A 1EERB 2FYVA 3VXTA 1MRFH 3CZLA 2MEJB 2PPAA 3V6FA 2H26B 1JNNL 2Z91A 3GMPA 3MRRB 4F58L 1NCAH 4U6XB 1K8DA 3LPWA 5IQ7H 3EG9B 4NC2B 4PRBB 4R7DB 2O5NA 2CJUL 1D9KC 3CX2A 4HGKC 3Q8FA 4IBTA 3PDDA 4YGVA 4O9HH 2CSPA 1PDKB 3REWA 4D8OA 5E6SB 1LO4L 3FO0H 4J4PA 1AO7B 3T3PB 3GI8L 1I7RA 1UT1A 3L5XL 4G1EA 3PL6D 1X5FA 5F7AA 2XQBL 1PZAA 3RTQB 1FG2A 3G5VB 3VFOB 2Z64C 1QA9A 2HPOA 5BRZA 1QRND 1T1WA 4UV4L 2XQ0A 3ULVH 1ZSDA 4ANUA 1EO5A 5CLTA 3TLRA 3GSNH 4CBZA 2XDHA 5KBNC 2UVFA 2NX5D 2O72A 3L1OH 4RMUA 4YSCA 5JR1H 1BX2B 2DV6A 4CC4A 2DIAA 3Q6FB 3B2DC 2BM3A 2ZXWB 3IRZA 3RVWD 5KVFH 2GJ6A 3OV6A 4FLQA 2LLGA 4P2QB 2XZAL 5EOTA 2ARJA 2EQDA 2PCFA 43C9A 5DMKA 3PWVB 1H3UA 3HS8A 3L6FA 2XZCH 3RZCA 1L3WA 1NL0L 4R0LA 1XGRA 3FO9A 3O8XC 3DVFA 3N06B 4PJDB 2QPFA 4W9JC 3FT3B 2UY7A 4CNIB 3I6KB 2VT0A 1JPTL 3BPNB 3DDFA 1MF2L 1L0YA 2DQEH 4NBYB 3WFDH 3LXAA 3RGVB 3O6LH 4P5RA 3WUWB 2UUDK 4APQA 4IBWA 1XGQB 1CDGA 4Y0GA 5EU6B 3V0FA 1KEML 3K2UL 4KTDL 4OD1L 1R0AH 2YXVA 4KK6C 1AMXA 3N42F 3CVIH 5K39A 1T4KA 2IH3A 2XJKA 2ZXBA 5AENA 4I0PC 1MVUB 1G7LB 4PCYA 3C60C 1TZGL 2AXFA 1A6UL 1O6SB 3D9AL 4TV3A 3WTSA 4EAEA 4KKCC 2AGJL 1HEZB 2VR7A 4G7YL 4XC1L 4R4ND 3SODB 5IKCB 5DFVC 1E9QA 2DL9A 2W38A 3EFDH 3NACL 4PP1D 2GITB 4GG6A 1USZA 1PGRB 5BQ7B 2ZP9A 3MGTB 5HPMA 2X2JA 2E9JA 4L8BB 1HJBC 2LTQB 5ERWA 4B9FA 4XP6H 1TVBA 2E46A 4Y19A 1JCKA 3CSTA 1UXWB 3M88A 4IBLT 4XNZB 3TBSB 4YHMH 5AL8A 3T2QA 1TQCC 2CNYA 1HCFX 3MRQA 3PHAA 4JZJA 4KVPA 2JB6B 5DK2A 4XRCA 2EEFA 4WFHE 4AW7A 5E23A 5PCYA 4PJ7A 1KCLA 1QQDB 1ZANL 3Q2NA 3SQBA 4OBRA 4KXBA 1RURL 5BVJB 1KSRA 1GAFH 5HGDB 1FYTD 3T8VA 5I6XC 4U7KA 2ESVA 3H85A 5TE7L 3ZUCA 1INQB 1KLUB 4F2MB 4F2FA 3PG2A 5HDBE 4HG4J 1KXTA 3LKPB 2ZP8A 4QT5B 2BY0A 2DDQH 4GP8B 5ESVA 3DMMC 1ZT1A 1CTMA 1TTAA 5FO7B 2OM5A 3CFIC 1HXKA 3DV6A 3L3OB 5D6DC 1A25A 2EH8H 5J5EA 2WXRA 4M9PA 4UNVA 1AKJA 5AOJA 5BS0A 1GKEA 2YN3A 3MOBH 3WIAA 4WU5B 4BH7B 3V5HA 2RD0A 5D93C 4F7MA 2XKNA 1LP9B 1SXZA 2XFGB 2J56A 3HE7A 3UZEC 1WZ1H 2X7LA 5IJVB 4I0PA 4UUJA 2CRMA 2ZAHA 3QUKB 2A73B 2MCPH 5F7EL 3ARFD 3FOLB 4JFYB 4KKCD 3MV7A 4WFGD 2UYLB 2MCMA 4XXWC 1D5RA 1UB5A 3ECQA 4GINA 1TETL 3HRZC 3LAFA 4N9GB 4PS8A 2DY2A 5CGYD 4LASH 5J3HD 5F6IC 2B3RA 5L8LB 5IGXH 2Y06L 2ZYIA 1HIMH 2E7MA 4X4MA 3BP7B 4MMXC 3RWGB 3CZGA 3KYNB 4NSKA 3V4VA 1TF4A 5L2KB 1QNIA 1RZ7H 5FFLA 4PUBH 2YKKA 1EHKB 3O3UN 4JO1L 3FQXB 2W9LA 4HPOL 3RBSA 3BAWA 1DVFC 2JK5A 2NYKA 4OLUL 3KPRD 3SKOA 2WW8A 3OSVA 1D5MB 5H94B 3NOIA 1XCQA 1PNCA 4IS6B 1RP9A 2CU9A 1UD8A 1HZHH 4XPTL 4TRPL 2DOCA 3QDAA 4NUJA 4L8SB 3MUUA 3NAAL 2XA8H 2B7DT 2CHNA 4FXGA 3A6OA 3K72A 1OTTD 4PLOB 5AW4B 2EDTA 2J6EA 2B5IC 4OUUB 1IBGH 1RJLA 2VDOL 5CO1A 2ED9A 1AE6H 4X98B 1NCIA 2G75A 1HJCA 1HOCA 5K59E 3VU2A 2WAQA 3CFKA 1ED3B 3LMJH 5EU5B 1IARB 1ZE3H 1W0WA 3NSFA 3NK4A 1XMEB 3KLQA 3SOTA 3VI3E 4OCLC 4OGQC 4FZ8L 5JZ7D 5EB9A 1TQCB 1CE6A 1J1XH 2JIXB 4HUCA 4I0KA 2JXMB 4YSDA 1BZ7A 1WCBB 1DVFA 3RVWC 2BOLA 5HHNA 3DTXA 4POZC 4NLHA 2ZIDA 2EYSB 1HEHC 4YXKH 1U3HA 2A74C 4MAUL 3B6SB 3FU5A 3ILQC 4TUKH 2QGCA 1GGCH 1KB5H 3EF7A 2PPEA 3SDDB 3RB5A 4JANB 3BX7C 2BWDA 3U4BL 1MCNA 1FL5A 2BFGA 5DS8B 1MNNA 3F64A 1H8NA 5DK0B 2XPZA 1VHPA 1N67A 3IU4H 4QLWA 5B22A 3IGLA 1JGLL 3LNGA 3CIQA 1UD3A 4NZFA 2Q1EA 3V7MA 5B38G 4N3UA 3KLLA 4PJIA 5GGTA 4TNVK 4GBXD 3BQUB 4Q4IA 4PJFA 4BFRA 1B0GB 1ZHLB 5JIDA 4JFXB 3ZW3A 4ONOA 4ZDHA 1T20A 1MFEL 1CS6A 1IC1A 2X89A 5D7LE 2N59A 4FXTA 4G7QB 1OTSD 2D3JA 2P8PA 5HGBA 1MW2A 5MP6L 4TUOA 4CBPA 4I88A 1DQQB 3FRPB 1D9KA 3FTYA 2Z31D 3UTSD 4HPYH 2SODB 1FIGH 4ACPA 4Q6YA 1A7RH 3B1UA 4TNGA 4L4TB 4MD0B 1NUDA 4FKKA 2F5AH 4NQCB 2XU9A 4L8DA 3L1FA 3BIBX 1KT2B 2WUCH 3EJPA 3SDCB 4PD4K 4L1LA 1EMTH 1L9QA 4P3DB 4R2GC 2EINB 4MMXB 5ALBH 4H8WL 1YEDA 1TJIL 1W2KT 1YN7A 2QTVA 3PREA 2H7WA 4JFHE 5FYLL 5BW7A 4WUKL 5E94A 3HZ3A 1ITBB 1NMAL 2XIDA 1KYOJ 4Y5YC 1L7IH 2XN9B 4S1DD 1X5XA 5F2FA 1T7VA 2XPYA 3BWAB 2GCYA 4G8EA 4R4FH 1CXFA 1UEYA 2HLFC 3CZJA 1A1NA 3BE1L 4V1DA 3LQMA 2DQJH 4MCNA 4I89A 3AB0C 3B2PA 4PLJD 4B96A 1YDPB 4BRVA 4WY7H 2FNBA 2EVGA 2F7IA 4GSUA 4TM9A 2G5BA 4GUOA 4FXKC 1UWXK 3RL1B 4Z7VE 4YE0A 4X4XA 2MH4A 2ZWKA 4HD5A 2I26N 4JPQA 4EIUA 3L3DA 4JFFB 3BKJH 5D7LB 3INOA 1A1OB 2BZCA 3U83A 3TN0B 4IOSA 2E6PA 2DQDL 3PJLA 5AOIA 5HDQH 3HUJF 4IU2B 4Y4FA 3ARYA 3H4HA 3ZKMD 1CU4L 5DMYA 3GSNB 2PKDA 1PS3A 1T5WA 2CDEB 3EZ8A 3H9HA 2VDQL 4YBLC 1XIWB 1FCCA 4WNSA 5HP5A 2Q7NA 2QMKA 1ZLUK 5FO8A 1JF6A 3MNMA 3B9EA 3GXUB 3MRLB 3A0OA 5CLZA 4X7EC 2X2HA 4L9DA 1R5WA 2C26A 4LSQH 4XNZC 1KJVA 3EH1A 1SJHA 3CTTA 3SDAC 1BZ9A 1TZAA 4HWUA 4G83A 1M9WA 4HV8B 1AJ7H 3QR0A 1JYWA 2HJFA 3W39A 4P57B 3RIFK 2J6EL 4U4IA 3N44B 4WTZA 4F27A 3PWNA 4PRPD 1JWSB 1ADQH 3OG6B 1IC7H 4AGNA 5KUMA 2QBWA 1BMWA 4JDVA 4HS8H 2W9DL 5CCKH 1MCHA 1JF1B 1DP0A 5EF0A 1B6DA 4X7DC 3U2SB 2BW4A 2ZCLH 5ISZD 3BD5A 1BVKB 5E6IA 1ECYA 3CHPA 2VR5A 4GJTB 2GC4C 2ZJSH 1FFOB 3T04D 2K0RA 2GSGB 2WBJB 2YAEA 1MJ7H 3VWJA 2YC1A 2FT7A 3MLWH 1UZ6F 5K93A 4MMZA 3GJEA 2R83A 2DYPD 3HJ0A 3MRNA 4OCYL 3JWOH 3AXLA 1N5AA 1I3RA 2XXFA 4N0YL 2EDOA 4XPBL 3L5WA 4Z7OE 3GJFH 3UCQA 5GGSY 2ZSVB 1XMWA 1J9CT 1QZNA 5E1AB 2E6JA 2NRDA 2VDOH 1MG3C 1NGPH 2AEOA 2MCAA 3TV8A 3P2DA 1JWUB 2I9LB 3EG9A 4M8QB 4PRBA 2CD0A 2ZOUA 1KJMB 3VJ6B 2ID5A 4M7JL 1AIFA 1BEXA 2AK1L 3OZKA 4NN6B 5DJXA 4HJSA 1U91B 1YA5A 4JUSA 3IFPA 4ZOAA 4JRXE 1HHIB 1YSOA 3B4NA 4R26L 4QHLA 4KDTC 3V8OA 1E7UA 4GAJH 4JM2A 2C3VA 4PRAA 4R4FL 5TK2A 3CG8A 4ATTA 4C56B 5JNYA 4AQ8A 6TAAA 4HD9A 1A3RL 1I7TA 2GUOB 4JFDE 4LKXA 4DKDC 1M05B 3UGXA 4LOFA 4ZMQA 3PWUA 1QBLL 5DD1L 4PJAA 2F8XC 3TN0C 3CFEA 3RNKA 4AL8L 3O81A 2AEIT 1N70A 2AXHA 3W9DB 4FHJA 1TYEB 5IOPA 1ACYL 3IJSA 1KWKA 1G9NC 5EO0B 1MFNA 1SJVA 4E36A 5KYXA 1CG9B 1JFQL 4P5TB 2X44D 3FQNB 3RZCB 4PU2A 5AZ2L 2V7NB 3HEIB 4JN1H 2CHWA 2WIMA 3P73B 2H1PH 3FT3A 4O58L 4PP1C 3LRSB 1TMQA 3VXNA 2P5EE 4KDWA 4OQTL 4YDMA 5HHME 1BOYA 3BRDA 4HUXA 1BEYL 1P9MA 5LWYH 4JFDB 4YWGL 5TK4A 2DH2A 2ICEC 4HIHA 2X2UA 3CU1A 1K5NA 3FCSA 4NZUH 3UJIL 1IBBA 1FNLA 4X6CF 3NH7L 2ADJA 3EGXB 3WELA 1S7VB 5DD0L 2J25A 5I17B 1R3IH 2OL3L 1DFBL 4MD5A 3QJFA 5EFIB 1RMFL 2DN7A 4Z3HA 5I24A 2G3NA 5HDRA 4LRNL 3VTTA 4GQQA 1C5BL 4NQXB 1P4IH 2F0CA 2GI0A 1NH6A 3GKWL 2VIRA 4LP4A 4RGNB 5DXWA 1E43A 2C4FT 1XTLA 5E4EC 5MI0B 1MRCL 4OZHB 4FX5A 3R4RA 2VCOA 1WBZB 1T1ZA 3MRMA 2ZZUT 5FUZL 3ZVVA 5AVQB 1BVLA 1UXLA 2WVTA 5FUOL 4MXWH 1NGQL 2XWJA 4P46A 4JJOA 4K94H 1KB3A 1QEWB 2AJZB 2B0SH 2Y5TA 2TSAA 1QBAA 3D2UA 4G8GA 5ANHA 1SVCP 2PO6C 1RZ8A 2RACA 5DUPH 4GRWF 4J5VA 4ZJ9A 1OO2A 1KLFA 2V7HB 5TQ0L 2DWTA 2GJZA 4JFEB 1UM6L 3E6FA 5D7HA 5FGRA 3IMVA 2AJYH 2BRRL 1ZPUA 5EBWB 1GOHA 4K5OA 2E4FA 5J1AB 2WQ8A 1YRKA 3CWGA 3HRPA 3EO1B 4NN6C 5FDYA 1AGDB 1GS7A 1OAZH 1ETZA 3AADB 4LBEA 3O2WH 5DI8B 4CVZA 4IGBD 3EJCA 4L4JA 4YDJB 5B8CC 2LU4A 5J89A 1G4RA 1BF5A 1WS7A 1IM9B 1FI8C 5BRZD 3RJOA 2EXYC 1OOAA 1H6EA 3N42B 1Q0XL 5EZOL 4EIBA 5HGHB 2XCMC 3UACA 3TEZA 2GK0B 5J12C 1I9IL 2V2TA 1NAKL 2NX5A 2AJVH 3IDGB 3UJJH 1JBJA 1SLUA 2D0HA 1U8PA 5L4MA 3NIGB 4Q9CA 1EUTA 5I1CH 5I15L 1JPGB 2D7TH 1AXTH 3FTXA 4UOW1 3WY1A 3E6HB 4XP4H 3N2JA 3RG1C 1OY3B 2XT1B 2NNAA 4A1RA 4N0FA 2R9HD 2NT0A 3DRTB 4ZUSA 3N1MC 4BEIA 1XGZA 3C5JB 2K3TA 3BLPX 3IS1X 4PWHA 1NFIB 4M7KL 2DICA 5CIPB 4F7CA 4EE2A 1X5GA 1WT5A 4IKLA 3N55A 4WI6A 3ULVE 1TSRA 2A6IB 4YBLB 3NCFB 4HUVA 1HCVA 3HPJA 1HN1A 2IANA 1J48A 2EDKA 5IW6A 3MOBL 3EYQD 3T1FA 2C4FU 4ZUVB 1NZRA 4JY6A 5I6NA 2WXLA 5EC2B 3HRZA 4H0HB 4HS6A 2O26U 3BCFA 2FHCA 1JTTA 1NDGA 2ISDA 4P8QA 1JDCA 1NSNH 2RJMA 3TA3D 3TZVD 4M03A 1ET5A 3RWHB 3WFHA 1EBAA 2CZNA 2LAAA 4H0GA 1XF3A 2DIJA 4HUNB 4JFEE 2MOQA 2F8IA 1OP3K 2BS71 4N2AA 4ZK8A 1I9EA 1I3VA 5HHOA 3HN8A 1BBDH 3RAJL 3WXVH 1RUPL 4JL2A 5D9SB 2Z35B 2AQQA 1IEAA 4D3CL 2OL3A 3L9BA 2PYEA 4OD2B 1NA8A 3QCTL 5FV2A 5HBBA 2IWKA 4BUGA 3GTTA 5JTWA 4Y4KB 4S1DC 3HFML 2Y7MA 1YYLL 2ERJC 2GY7B 3BJ91 3ETSA 4TULH 3B7UX 1VDGA 3H42L 2NY0B 3D85D 4BKTC 3C6LD 3QZWG 1KTJA 3BPLC 3HG1E 2X4SA 4NQCE 5HI3C 3NCJH 3RIAF 1FH2A 5AB0A 3L5HA 1MIEH 3VB9A 1UZGA 2FX9L 3F65A 1DVFB 1W16A 1INDL 3QQ9C 2P1YA 3D69A 3QQ9D 1EX0A 1JDDA 3PGFL 1XSIA 4PGBB 2Y36H 1E28A 4LOUD 3KPRE 3LV3B 4NPYA 3UYRH 2C3HA 4K9JA 4HFWA 3CN2A 3PGDB 2CK0H 4WFED 3S0PA 3CLEH 1NKRA 4BZ2L 1W0YT 2AJYL 2BRRH 2XVGA 4GKNA 3US0A 2NUTB 5DK0A 5CP7B 4QJ4B 3L2MA 3P4NA 1TSHA 4ONGL 1VEOA 3FFCB 3GS4A 3H7BB 4WW2C 5IF0A 3ZE1E 2O61B 1JCVA 2FQFA 4MAYB 1A6AA 3BQUA 1J12A 1JFQH 1JNLH 1HHKB 1B0GA 3LKNA 5IB2B 3MV7D 4JFXA 2R59A 4R2GD 1KN4H 3LIZH 4NBXB 4DW2H 4G43B 8FABB 1R34A 4L0YA 1J9TA 3HZVA 2WQRA 2JMRA 5G4MA 4PW9A 3OGOE 5CJOL 3BLBA 3ENEA 1S3KH 3NIGF 2E8ZA 1TKWA 1KCUL 2Y7QA 4OV5B 3RUGE 5B1CA 4FNUA 4AEIH 4Z8FL 2NY3C 3MA9H 2XX0A 3TBYB 1DJYA 2EYTA 4YHLH 2BVUA 1A6VL 4RA3A 3SHSA 3AUVA 2JKSA 3KPRA 5C0EB 2OMXB 1D5ZA 4J8QA 4PV8A 1MIML 5D2LE 1KV3A 4PRID 2XOTA 3QQ4B 3M7FB 5EUKB 3V9EA 3VH8B 4XI5C 5DF0A 5GGQH 4EN3C 5HTSA 2VJ0A 3VRIA 3FQUA 4E9YA 3FN0L 4RWYL 1FIGL 3ZSTA 1ACCA 2PWGA 3OKDB 2KZBA 5IFHL 2Y5QA 1BZQK 1JZ3A 1P0SE 2C1OB 4IEFB 5D1QB 3MRPA 5DLMH 2Q8BL 2XV2A 4PBVC 4F7EB 4BGLA 2J73A 3EXJA 1AQKL 4BZYA 4PY7B 4A63A 2N01B 2HJLB 4ICWA 5DD6A 4DUVA 2R1YA 3AC0A 4PJ7F 5C0NC 1XXDC 1UYWL 3GMNA 1BGXH 2B1HH 3V7AE 4GRWH 2ZOWA 3HI5H 4A6YB 3E9TA 3VH8G 2OZ4A 3MV8A 1MH5A 1E42A 3ERXA 4CDHA 1DVFD 5JZ7C 1JGLH 4JM4L 2R7EB 3BKYH 4GSDH 1OARH 2CBQA 3S2AA 2EXWD 2H6OA 4ZMPA 4N2LA 4QOKE 4ODTL 3QEHB 3N43B 5I1IL 3RVTD 1DQDH 2RAMA 3PP4H 2E27L 1XH1A 2CO2A 3C87A 5IW1B 3DWTA 2F1AA 3JV6A 1ZLSL 4AWJC 5EC1A 1BQ5A 3MRRA 3GMMB 1PZ5B 1RU9H 4KNTA 4QHPA 5I8OL 4GBXA 3OL2A 3SBQA 4RGMB 1TZHB 1XH3A 2CXGA 3RX7A 4DQOL 3CDZA 1J5OL 1F8TH 3V6OA 3O41A 4Y1TA 3SPCA 2FTAA 4XVJL 5FR3A 2X89D 4YBHA 1X4ZA 2PTUA 3R8QA 4M5SA 3ARPA 4L29A 4UANA 4UOZA 2FBJH 3PPEA 2VO8A 2NX5E 3J7HA 4LLUA 4MB1A 4AEHH 4H0IA 1I1AC 2KQNA 3ZKND 4R9HA 2WQVA 4ISVB 4U1NA 3WJLA 3TC9A 4FQ1L 5AVUB 3HW7A 1MN4A 2R0KH 5F88B 3P4MB 5JYMA 2PCPB 1A7PH 2GSGA 1CXHA 3LKPA 5AALA 3VGDA 4UBDD 3BQUC 5ESVB 5I5RA 2WXFA 3S3DB 1UB6B 4G8FA 4XCEA 5FGCE 1AKJB 1NGXA 4NNXB 4P4KD 1N9PA 2CKBA 1I1AD 3AJ7A 4KGLA 3ZKNC 4F92B 3OKOB 4DCQA 1SYSA 1IRAY 4XBGB 2XNAA 5EWIL 3U46B 1HYSC 1DUZB 4Z95L 2QQLL 4LPXA 3VFPB 2WWOA 4GYBA 2EC9T 1A8JH 3QUKA 4AT6A 4NCC1 2IO5A 4QRAA 1DBMH 3S34L 4XAWL 4AIEA 2WB7A 1C16B 1JERA 4LLMB 2AV7A 4QHLB 2WKGA 2A74A 2AJSL 4DUXA 5IEKA 4JM2B 4UBDC 3PAYA 5BVPH 5I76B 1TXKA 3WG7B 1OAUH 2XYCA 3K6FA 3MUZ1 3HB3B 4B3EA 4WFHD 5EIQA 1MWAH 2UWEA 2ED7A 4KDTA 4X6CA 2H1XA 4D0DB 2ZCHL 1P7QB 3LN5A 2YSSA 2R1XA 2WLKA 5JW5A 3QJZA 3AB0B 3T0ED 1BWWA 3VGFA 4S0SD 2GJ6E 1AOZA 3LN9A 4YZFF 32C2A 1RVFL 1X5AA 4XN2A 1DVZA 1XF5B 2EXTA 2YAPA 4M1GH 1ND0B 3S3PA 4FQXB 5FS5A 4H2CA 3ZDYE 3NCCB 3KJ4C 4NC0B 3L9RA 1DCEA 2O6EA 3H4FA 4C59B 4X98A 4HOMA 3HHMA 4C55A 5AVRB 3MBEA 4JHVA 3VGAB 1WICA 3QJUB 4DKFL 3SGDI 5BNXD 1F13A 4LNRB 1CGYA 5LN4A 6PAZA 2EVHA 4KKLD 2FQDA 5F1NB 1ZT1B 3BD4A 1KENH 3GHEL 1OPGH 2BSSB 1UURA 1F3JA 5D6CB 5SWZB 4XB3A 1LE9A 4NQXA 2QELA 1ZAGA 2AQSA 2DBJA 2OR8A 2XV6B 3DECA 4HC1A 4L4VD 5B3NA 5CSZB 3MBXH 3BAKA 3ZRCC 1NEPA 5JOEA 4BH7A 3NIDB 4TSBH 5F9AC 5E9DE 4HCIA 2Y1YA 4RFOH 2IDFA 2RCSL 4NJ9H 4HS3B 5C0ND 2A73A 2CH8A 3QEGH 3SYOA 2YRLA 4ACTA 3K3QA 4A55A 3DX6A 1EFXB 2DYPA 2HFFB 2XWRA 1PY9A 4Q74A 3ZL1A 2C8NA 4P2OB 2Y7SA 2WM0A 3P3RA 4C4KT 4AITA 1YYML 1DQJA 4OFIA 4N25A 4P9HH 4H25B 4HCFA 1C5BH 2VH5L 2VWEC 2NZ1A 4MYWB 5AVVB 4PS4L 1MI5E 3TZVB 5E08H 3MA9L 4YSTA 1CD0A 2CUMA 3ZOAA 3RIKA 1ZHLA 4NSKB 3L7FA 4HXBL 1Q4NX 3CZFA 5E4OA 4LBEB 1WC7A 2XZAH 2JK5B 4R7VA 1D7FA 4U0RC 2WN3A 3GTNA 4KX7A 1NKGA 5DS2A 4QRRA 1D9KB 4QWWC 3KPPA 1FH5L 3B5GA 2H41A 4QKXB 3MCLH 5AQ0A 2CE6A 5DJ0A 1ZLEA 5JXAH 5HGAA 4TUJA 1QFUL 5ALCL 2VM9A 3K71A 5FYJL 5CEXB 4S2SB 4UV4H 1BM7A 2P8MB 4NQSA 4L18A 2X4UB 4DP6X 2XQYA 3EYFA 5AZUA 5HHXL 4NCC2 3DETD 3MROA 4ZS6C 3I9IA 3WEOA 5HHQB 4ZFFA 1L6ZA 1XGYH 2WVVA 4APXA 2D3VA 4DO4A 2LQRA 5I1GL 4GW5B 4UU9A 4OJEH 1NTDA 5INCA 3C5JA 1JJUA 3WAKA 3TIEA 1M7XA 5CIPA 5EIVA 3UO1H 3G6DL 4OTXH 5IEHB 3PS6A 4DESA 3WFEH 1RUAL 3ZIYA 1L7TL 1P69B 3QFDA 1KC5H 3CK0L 4F15C 4ZMAT 2O6CA 4R26H 1X6LA 2WIIA 1V7NH 1ZA3B 1RL1A 4LOEA 2NY0D 4M7LL 2AJXL 3GMQA 3H53A 4YAQA 4HKZB 5DZLA 3M1CA 4WW1B 3SBWA 1X7QA 4I87A 2PW2B 3TT1L 4NKIH 1UZ8A 1SBSL 3M8OL 1DQDL 4RZCB 3KPQA 3NVQA 4NFCA 1X4XA 1QSFA 5D2NC 1XF3B 1XGYL 3QGVA 1FIEA 4XX1E 1BYOA 4N0UA 3T8XA 5KJRH 2H4EA 3GSNA 4G59C 2HLFD 5AWNL 5D7KD 1BVNT 1T5WB 1VLXA 3H9HB 2HZHA 3DX7A 1TO4A 1IEAB 5D4QA 1K2DA 1JRHH 1UUNA 2VXSL 4A7UA 2CBPA 3DV4A 4NS0A 3SIKA 2VRQA 2F61A 4FLOA 4ZDHB 1G43A 1NBVH 4G8GD 3IJYB 2MKLC 1P84K 3L3HB 4QAMB 2KKQA 3RZWA 2W9EL 4M1CC 1CDJA 1U30A 4NJ9L 2C5DC 2BDNL 3ZDZB 2YMXH 2LFGA 2ZUQB 3HHSA 4KBPA 4DZ8A 1FCGA 5AW3B 2BCMA 5DJCA 4DKEH 3BUQA 1KPUB 2BNRD 3TNMA 5B3SB 4JCLA 4LMQE 4XCFL 3QXAA 1YEDB 1IKOP 1F6AB 2CHDA 2YXFA 3M17A 5J13B 2H45A 5C0AD 1O6VA 4F7TB 3WTUA 2K9FB 3O0RL 2F19L 1Q1JH 4QRUB 3SYQA 3JTBA 5E94B 3FQ2A 2M83A 1A6TA 5E6IB 2DLGA 2PCYA 5ANMA 4Y2LA 5DJ2A 1I3GH 2V2WA 4RGOH 4I9XA 4GMSL 2Q3XA 2OV0A 3BCDA 5I2IA 2J8OA 2GCYB 2VISA 3PWJB 2BSED 1A1NB 4JX0A 5K9QG 1UT9A 5MEOA 2YFNA 3BSZA 3F7PC 1Q9KA 4LPYA 1DEDA 1AE6L 2BO0A 3EDFA 1XCXA 4N2DA 3QT2A 3FF7A 3LNIA 3QDGA 3U36B 3GHEH 1WK0A 3QO0A 4MX7B 4YX2H 1AKPA 2EABA 5DRNA 3HMXH 3NAAH 3MMEB 4GUQA 3ZL2A 4F7KA 2Q6WB 1OAZL 2FQEA 4GQ9H 1H8LA 4GRMB 4JHBA 4X99B 5FO9A 3IYLW 5ADPH 3RZCD 4XCCL 3QXUA 2F19H 3WFBL 4CGUB 3KYMA 2EICA 4C56E 3CBRA 3J07A 3L3GA 1E3ZA 1U91A 3TBYA 2EYTB 4G6KL 5J1SC 5IMKB 4W70A 1AO7E 3T3PE 4P5KB 4I0CC 2KC0A 5FGBA 5J3HC 4OSUL 4F3FA 3ECUA 3NP3A 5FO8B 4NZJA 4C56A 5JNYB 2X53A 4M61A 3QUZA 1WAAE 4K3DL 2EE3A 4JVUA 2QHRH 1YAZA 2J57A 4AK2A 3QE5A 3T3MF 3OMAB 5IVXB 2B15A 3S88H 1YAIA 1W6WA 2APBA 4NKQB 1YEGH 4PGCA 5LJYH 1MQKH 3ZQWA 4UZGA 4MB4A 3NCJL 2K7PA 4CSZA 3I9PA 1QBML 2F5BH 1UVQA 3KJ4B 3NABH 1VFOA 1EZUA 5DJZA 4M7ZB 4P5TA 1YQ2A 1ZDQA 1SM3L 1Q9LA 1N2RB 3QNZA 5AYUH 4F33B 1P53A 4AC2A 1KPVB 3RFRA 4JFPA 4JRWA 1IGIH 2YUWA 3SKNB 1J0HA 9CGTA 1GXEA 4Y1SA 1JF1A 3BKCH 3D85A 3ZZ1A 1JZEA 5J57B 4FOMA 3O6FB 5KVGH 5IV2B 5CZXC 1I8UA 4ENEC 1UWGL 3MV8B 1T6VN 5DZNA 4K2UL 3MKGA 1U4FA 4J12A 4NO3B 5AYQA 5DWPA 1CGSH 4J39A 3RWFB 2MNJB 4M3JA 5F1OB 1LEGB 3VD7A 2Q7YA 2AQTA 5JPNA 4I18B 1H6TA 2OW6A 4AJ0A 2XICA 3AXLB 2G9HA 4KXDA 1WBXA 4K71C 2EIDA 5IQ7L 4ONFH 1I7UA 3DVNA 3QH3A 1QLEH 1RUAH 3GBDA 3NQKA 1L5GB 5IW1A 1A1MB 4J27A 1HCYA 3CSBA 5JHLH 1HHGB 2UZXA 5JIIA 2WXGA 5IUSA 1OB1B 1VZIA 3MRMB 3PJSB 5CN1A 2WLIA 4M5YH 1EAPB 1IGIL 5I8EA 2FL5B 1CXKA 1TZHA 2CBMA 2RA1A 2ROYA 1MJ8H 4HIEB 4M6ML 4ELKB 2CRZA 5M94B 4XN9A 3SGJA 3NRPA 2AAVA 4G8GB 4GMTH 3FN3A 5AG9A 3RFZC 1QR4A 5AD0B 3NTCH 4HAGA 1WD8A 4X8JA 4TQHA 4G7VL 5L8KB 5J6GA 5I1EH 3OX8A 2ALAA 2Q20A 3MRBB 5ALCH 5FK9B 3N41F 5FEBA 4YH6A 1OW0A 3RNKB 1QFOA 1XIWD 3PFQA 1HL9A 1UM5L 2DQHH 3PY9A 4Q97A 4AQ1B 1IBYA 3NJJA 2JI1A 3KCPA 2O1AA 3RU8L 4PRIA 5KOVC 1KB5A 2BSTB 2OSYA 3VI4B 1ZE3C 1E40A 3MRKA 3VSTA 3LD8C 1H3GA 3MYZA 3VGHA 3ZR5A 3E9UA 2BXYA 1U95B 1O7VA 4YDVA 2XNAB 4PJXA 1U6AH 4KK8C 1I75A 3VFPA 3QYNA 2M8XA 1ESOA 3QRBA 3MJ9L 2QVKA 4OKDA 3HBQA 3CXHK 5J0BA 3ARGB 4M62H 5T3XH 2NNAB 2A6JB 3GLDA 4WKZA 3UC0H 3IRCA 1KXQE 3ZYOA 4OF3A 3IMBA 1NCDH 3J27A 2GJ6D 3LZOA 3S3SA 5T3ZL 1G0XA 5JOFB 1AGFA 1OSZA 2ZG2A 2CXKA 1ZY9A 2F7OA 2VM3A 3R18A 1NBYB 4NGHH 5FHBH 2DM3A 1MCFA 5L2KE 1JWMA 1OAQH 1UZ6E 4YSRA 4D0DA 2YGQA 4NNYA 4WFEE 3E7JA 2ZOKA 3KWWB 1NCUA 1Y18A 2NY2C 3UBXG 4EZKA 5CGMA 3UABA 2DWDB 3FCTA 1GYVA 5IK3A 4UQ9A 2MTPA 4PVMA 5C71A 2HH0L 4HWBH 1MHEB 4HX1B 3ME0B 1V5JA 3NA4A 2OMWB 4OZIA 4FXKA 5DJ8A 5F9OL 4I48B 2F54E 3MUY1 3D4YA 4P46C 1W80A 4GQZA 3RWEA 2NLJB 2IPUG 3L9RB 3QBTB 1HSAA 3L3IA 4U1LA 4WU7A 5F21B 1UASA 3D3VA 2GY5A 3IVKA 1E4WH 1OAJA 2GK2A 1FO0L 4EUPB 2HRGA 2J20A 1IE4A 4PLJC 5T1LA 3IXTB 3KNBB 2H2PD 1T0PB 2J3SA 2RIKA 5BW7C 4H0LC 3MGAA 4GAAA 5IHWA 3BP6A 2Y1VA 3UG3A 1ODAA 2ENQA 1YZZA 3FT1A 1HSBB 2LU3A 4Y9BA 4KRPC 3C2SA 3L2NA 4LCCA 4IRZL 2Q5BA 4LIQE 2IGFL 1M71A 2EIEA 3B8YA 1D9KD 1BQLH 1U8PB 5CU9A 1P9MC 3OKLA 4KJWC 3ZRSA 4HS3A 4HGWA 4XPFL 3E2HC 2AQ2A 3N6YA 3Q44A 2LHAA 1MHPL 3HUJE 1AR1D 2JKIS 4FDWA 1HH9B 1MY7A 1K4DB 4TLKA 2MRYA 1DQJB 4TPRL 4PGJA 5H35A 1WP6A 2Y6TE 3C8HA 5J06A 3RIAK 5A2LH 1ILSA 1AKJD 4P4KB 2A6IA 4Y9EA 1S7RA 3CMOL 3VDCA 3QZPA 2O61A 2PPFA 4NEHB 5GGVY 2OZ4L 4RDQF 1QRNB 1GYAA 3QIBA 1JGUL 4X5PA 1FJ1A 3VWKC 2D3NA 4MJJA 2PXYB 4YO0B 1U8OB 1Z66A 5EORL 2CCLA 3UADA 3WFZA 3OKMA 3JVGC 4YHPB 1MFEH 4L37A 1H3TA 4Y2DD 1K72A 4RRPA 1CBVL 1FL6B 1U8JB 3SJVE 3KPMA 3UBXI 1ERNA 4N0CD 5HHOB 5F7FA 1A14L 4A7QA 4NJAL 4OM0H 5IB3A 1A6PA 5AAMA 1ZS8B 1W6LA 3LZPA 3NZUA 3CHRA 1Y1DA 2G60L 2XZQL 3KPRB 4G8IA 4KRLB 2OMXA 5HHQA 4DP2X 2NY2B 3V4PA 2WVVB 4APXB 5ILTL 3Q5OA 5LCVH 2GYSA 4FYSA 2AF2A 3RGVD 2P26A 3IDXL 1PYWA 5E4EB 4DGIH 4TQEL 3UPCA 1CFNB 1Q72L 2I9TA 1MCBA 2O6FA 1FNAA 2BVTA 2V9TA 3IF1B 1UD4A 1WITA 5KVGL 5A2JH 4YXKL 3ARBA 4G9DA 1B3JA 2IANE 3BW9B 5D1QA 1F1DA 1GGCL 1WISA 2LLLA 1CIDA 3EDKA 3GMQB 3KGTA 4W9EC 1E28B 4L1HA 2R1YB 3VW3H 3DROB 4G5ZH 5J4MA 5GSRA 3PGDA 4FXLA 1UZ8B 2YQBA 3P3SA 5FYKD 3II2A 5F7UA 1PTZA 1QSFB 2YOAA 2ZOOA 4L4VA 3QISA 4HISA 4X5XB 1LK3L 5CP7A 1RXLA 3VG0H 2FJUB 5GS1C 2R7EA 4AEFA 1S7TB 4LCIL 2EUZA 3SOBL 3T8XB 3WXWL 5D1ZC 1NCWH 2R2BA 2XY1A 1N59A 2R4RH 3U0TA 4KK9D 5DT1L 1I9IH 1MCOL 2ADFH 2ZUXA 5IHHA 3WY3A 1AANA 2EIBA 2ZOLB 1GGBH 4KQ3H 4OJDH 4F5CA 2DQFB 4GAYA 2OQJA 3NJIA 4OLZL 4FF9A 2WK2A 1E4XH 4NAJA 4W9CC 3FQYA 5EBGA 3VWJD 1RJCA 1RZQA 4O2FA 5HI5D 4QY8B 3NZSA 4BDVB 4PYGA 4GB9A 2Q76B 3UTZB 4FEIA 5AVTB 3TEYA 4DZ8B 3WN5C 4M4RA 5I9QC 1KBWA 4NN7B 4A38A 1MLBA 1LO2L 3E3QE 4K3GA 1JHKH 5C9JB 3O41B 5EMYA 1IV8A 3MXWH 3RPIB 3L3JA 1OCCB 8CGTA 1QHOA 4PGDA 1Q94B 2ZF9A 4UTBH 1W91A 3FT9A 1CFVH 4XN5A 2VERA 4PV8B 4L29B 3WUWG 4BCYA 4QIRA 2XUWA 1HNYA 4LLUB 4BSVA 4IOIA 4PWFA 3VG9B 4KV5F 1N6VA 3L3KA 3PUUA 1ET8A 5C6WH 2P7TB 1U3JA 4KKQA 4Y8DC 1OE3A 2JJVA 2VSCA 3P4MA 3NZHL 1J8HE 2JI3A 1CXIA 1JXKA 5TE4L 4IQHA 3D4GA 4OCWL 3EH3B 1NOFA 2QPEB 3MRPB 4Q58C 5IP4A 4X80H 5IFJB 1CDUA 3WHXA 3V6ZA 1FFNA 4B27A 2WO2B 4PBXA 3P0YL 2EDMA 1BA9A 3EJTA 1ZRUA 4AQEB 2WTPA 4EDXB 3LZNA 3OR6B 2FLBT 5L4FA 2NXYB 4N3TA 4XXWA 3TPUA 3D33A 1CN4A 3Q7JA 4CJ0A 3F7YB 3AVEA 2A3TA 4XNUH 2CIIA 4X99A 2BNRE 4YHLL 1DUYA 2IPUK 5F44A 3U7AA 3VXSA 3B7SA 3CE1A 4OCXH 3ZTDC 3BSZH 4XP5L 2NTFA 2JCCE 3G9AB 3IU4L 4YIQA 4G70B 5KYNA 1NAMH 2EIMB 3SE8H 1I1YB 3Q3GA 3ZMNA 5KSAB 3D08A 5MEQA 3IU3B 2XWDA 5LAPA 2JJSC 2JJWA 4FL4C 5AEAA 5JORB 5I1JH 1D5BA 1HXYB 4GKSB 4A67A 4H7VA 1F41A 2W60B 2X70A 4GQRA 4H1LG 4NUMA 3ZO0A 4UNIA 4WQOA 2YSSB 1QWHA 5I1GH 2JKXA 3LKSA 3NPSB 2C9AA 4F8TA 1FO0H 4W1TA 4QTHB 3AREA 5K1VA 4E9QA 5CD3A 1C5DA 5FW6A 2ZXEB 3QORB 5D7LD 2VZTA 2CLZB 3LSOB 3LDBC 5L9DH 4AUYA 4DT2A 4Z78B 1C8PA 1UJ3A 1HHHA 3BO8A 5I6KA 3EAKA 3TBWB 4PLKD 3UTSE 3NGBB 1SEQH 4ELDA 5F6HI 2DLEA 4Z7VF 1O7DC 3IN0A 4X9FA 2B2XL 2BNRA 4JRXA 2FX7L 1UC6A 3LPFA 4QXTB 2FJGB 5T1JA 5AW6B 1VADA 4HEMA 5FKAA 3BPOC 3VXUE 4FQPA 3G6AB 5GS0D 2PCPA 1AYRA 2HVJA 3T08A 2QVFB 1J86A 1SLWA 1NGWA 1RIUL 2HTKD 3PHQA 2Z7UA 4PIRF 2HUEA 4IRJD 2BP8A 2P43B 2Q7YB 4QLRA 1M2VA 3NSJA 2B5IB 1CFTB 1EXHA 3OHMB 3UL4A 1KV7A 1NGXB 4NNXA 3ATBA 4OLVH 3GNMH 7FABH 3EF4A 5GGVL 4F15B 4AOFA 2DM7A 1HHGA 2UZXB 1E4KC 4WO4C 1OM3H 3PXJA 5MEPA 3DA0A 5E6ID 1MCWW 1CVRA 1JNNH 4F58H 3EH5B 4JPWL 1A3QA 4AT6B 4R84A 4FCAA 2LOEA 43CAA 2VLKB 1EFXA 1CUOA 1U2HA 2FL5A 3GLAA 4HIEA 4ELKA 4HK3N 3VAEA 1BQHG 1FORL 2CA4A 3OPUA 3CPLA 4EJ1C 2Z7WA 2PNDA 3EGSB 2A38A 3K80A 4GRLA 2E86A 4ESKA 1CU4H 1R46A 2R29H 1TQWA 3A67L 4X8JB 1Z32X 4QCIA 4A7SA 2WLMA 2QZ5A 5EU4B 3WNIA 3EYSH 2XFXA 1B90A 3DGGB 1OVZA 4R3SA 4JRYA 3O0RH 2F8VA 1F4XL 4FCHA 2R1XB 3GWJA 3UMNA 5JW5B 2HLAA 5HXMA 3MLRL 3BKML 4XAKE 4FYTA 3GUTA 1YC7A 1RZPA 12E8H 3KCPB 2Y1ZA 4PRIB 1BQHB 1SLVA 4QRRB 4PRNA 2VQ4A 1KB5B 2BSTA 4U1SB 3TNNA 1HZLA 3LEYL 3D39D 5BV7H 3E38A 1ZVNA 1SHMA 1UXSA 4TSAL 2K6YA 1FFPB 5B1BB 5CWSA 3T2NL 1MJUL 1QFHA 2RQEA 2X87A 4GAFB 2CJ3A 5TH2B 1RPUA 3FTGA 1E0OB 3L95A 1H19A 2AAAA 1IFRA 5D1XB 3VFRB 1KJ2L 4IBYA 1TPXC 4ZFFB 2NNFA 4WI9A 3EO9L 1OSEA 5IHLB 4ODSL 5JW4Q 4N8VB 1NC4A 2C3WA 3FL7A 4GW5A 2OXHB 4NWUH 5C07E 3UMTA 3V4VL 1EAOA 2YA2A 4WO4A 5B38B 3MAWA 1FRGL 1NCGA 2YD2A 4LVEA 4RISH 4HLZG 3SGJC 1F6FB 1EANA 4P4RB 5EZJB 3LHPH 3QFDB 1OSZB 4LSUL 4BFNA 1BZOA 4Y16D 4IK6A 4RGMC 3DHJA 4BINA 5HSFA 2EO7A 1WA2X 3S4SB 2DLFL 2X4PB 4DJMA 5DD5H 1QSEE 4H13C 2HT2D 4WW1A 1JK9B 2GAZA 5E99H 4BZ1H 3T09A 1SEQL 3KPQB 4LL4A 5D8JL 1IGFH 5AAMC 3ARTA 1I1AB 4LEEA 4JDZB 1KIQB 4HKBA 1YPZE 1UQSA 2VDKH 4Y1AE 3HLKA 4TNWF 2OMWA 3PHSA 4PJIF 4OZIB 3FO1B 3CVIL 3D18B 3KPOB 4TL4A 3TBBA 5AZEL 1OKEA 3FXIC 2YBGA 3DXAB 4JFQB 2YZ8A 3VGGA 2UZYB 1B0RA 1U3YA 2D7QA 3AG4B 4TQ8A 1LD9A 3EJUA 1R47A 4JHAH 3HPLB 2EDHA 4OY9A 4ES8A 3LZQA 4ORGA 3S8GB 4JGUA 1RSFA 1XZ0B 5FOJA 1MXGA 3P2TA 4O5LL 5KYWA 4IU3B 1DL7L 4D3CH 4XAWH 5KANG 4M00A 2ITDB 5I1AB 1RK1B 1H5BB 3FB5B 3ZYJA 2P8LB 2V5RA 5EF3A 1MAKA 4K07A 4NT6B 1PG7L 2DQCH 3V0IA 1RUMH 3VU1A 1FAIL 2A7BA 2W1NA 2XA3A 3MLVH 5EWIH 1NLBL 3JUZA 3OJDA 3CCHA 2FEEL 2Z93A 3MRJA 1ID5I 3UZEA 4NZTL 1QW8A 4AYDC 4FTVB 4ZMTA 2YRZA 3T0EB 5CEXA 5IROC 2X4UA 3TT1H 3GLZA 3JWNC 3EYFB 1F6AA 4HBCH 4CADA 3M17B 1EIBA 4XB8A 3ARVA 5CD5C 4BCZA 5EZIL 5HYEA 4LLWB 1LQSR 3RB7A 1D6VH 2D73A 4LLDB 4LCVA 1NIBA 2DW5A 3MU3A 5AW9B 2O5YL 3WHE1 3MNZB 4Q52A 1YPZA 4GNKB 4J6RL 3SDXF 1KDIA 5JXEC 3T4YB 2YMTA 1QLFB 3TO2B 1UFUA 1MFDH 4PRDA 2VLLB 3AACA 3ROLA 4NWTL 2FX7H 1FUNA 2X1OA 5H4ZA 5FA3B 4JZNB 3IETA 5AVSB 3TF4A 3WD5H 4GBXC 5CEZD 5ID0A 1AC0A 1QRNA 4GOSA 1KYAA 5ADOL 5JHBA 4HKZA 1P1VA 3FHQA 1DO5A 4LFHD 5FLVA 1X7QB 4KX8A 5E8PB 2Y0SA 3N0AA 5TTRA 2DKUA 1Q0YH 1CB4A 4DN3H 2IPKA 2NY1D 4AUJA 4PJCF 1FDLH 2J71A 2MQGA 3INUL 4Y9CA 4ZSOB 3RFZB 5HVHC 2Z8SA 3T77A 4KH2A 5EEVA 2H3NA 5I0XA 5IY5B 2LVEA 4GQPH 2KBGA 3IKCB 1WWAX 4BFEA 4ECNA 4MNQB 5BJTA 4OBSA 3TA4D 5CM1A 2OTUA 1IC7L 1UA6L 1CLZH 3VXUD 3BH8A 3PDGA 4FNRA 5DJYB 5IBTH 3IDYB 1IAIM 1I3GL 3MUHL 4NC1E 2GHZA 3H2WA 2UXTA 5FGCB 3QDMB 4XCNB 1MI5D 5HYIA 2I9TB 3U2IA 3WTVA 5T5FL 5D7IA 1CDIA 2CR0A 2FSDA 4FFZL 2FVNA 4ZTPH 1BF8A 2V6HA 1NCTA 3AG1B 3EYUH 3O9WC 1UOLA 3G6JA 3W5NA 4KKLC 4MKTA 5DJZB 5LGYA 5KBMA 4PREA 3NH7H 3DUUB 5D1ZI 3RP1A 3FUFA 3NN8B 4PJHE 3OQRA 4LL1A 4EI5C 3KW7A 5B7FA 1A3LL 5CP3H 3S37H 2B59B 5EO1B 2J1ZA 2Q8BH 1TTUA 1IC5L 3NDZE 4J3OH 1XF1A 2YGOA 4GKOA 1KYUA 1NBCA 4Y5YA 1EVUA 1DE4B 1G6RH 3CHSA 4WHYH 2CIKA 5ANMB 4ZQTA 1XSOA 4FLRA 5DJ2B 3FUIA 2YAMA 3MFGB 5C0GB 1WH0A 3BZEA 3JYBA 2WQUA 4CN1A 2H8PB 2R2BB 4XNMB 2ARWA 4NKOA 3WNOA 2X0VA 1J5DA 5E8OA 3HN5A 4OB5H 5MEOB 4U3SA 3QIBC 2FB4L 5E4IA 2D0FA 3B3IB 1M4KA 4HC1L 4LSSL 4ZTEA 2B1AH 5JPNB 1G9NL 4IGBC 3FQTA 4O4YH 2OMZA 5I6MA 4MVBC 3OXRB 3B9VA 4MJ2A 2DQUH 4K3JL 2YD5A 1KBKA 3FPYA 2A6DA 1TJXA 4NM4H 5DWUH 1UUSA 1PIFA 3OC5A 3UAFA 1G94A 5I66B 1OB1A 2J44A 3ASNB 2AW2A 1ES0A 2HKAA 5FYLH 3T0DA 3CJJA 5HYQA 2QQNL 1AP2A 3CFCH 2NXYD 4F2EA 3CQPA 3D9AH 3QIBD 1S9VA 5BS0D 1HL8A 3Q2LA 2IXQA 3L4TA 1BIIA 1EMTL 3WS6A 4LCWB 1IGCH 4UQ2A 2UY6B 4E5XG 2AP2A 4Y7MA 3O11A 3OQ3B 2QSVA 5IG7A 5MENE 4ANXA 4P59L 4FG0A 3LS4L 5IVXF 2YEQA 4UV7H 3RJQB 4DVRH 3KG5A 1F45A 2OXGA 1U8IB 2CLVB 4P23C 3TN0D 4HUWA 1PX8A 3UOAB 3AMKA 5IB5B 1B2WL 3D1MC 2OSXA 1QFUH 1UM4H 3ISRA 1DZBA 3SDYL 3ZDYB 2J88H 4AZ8A 1FSKB 3MJ8A 3N9GH 4P2RD 4IJ3C 1S7UB 3MLXL 4UAHA 1J1OL 3I6GB 3VW3L 2BP0A 4ONHA 4LESA 1MCQA 5DUBB 1CL7L 4HKJA 3IFNL 4OZFH 2OP4H 3WKML 3O6FA 4WUUE 5LGJA 2A6KA 4MQXD 3TVMA 4EO5A 2EDJA 3S2CA 5C09B 3LH2H 1SDYA 1MKFA 3UYPA 3F7RA 3OKNB 3B7TA 3ESUF 1ORQB 3JXAA 4IBZA 3X17A 3FH5A 1OCWL 2FDBP 1P6AB 5EBMB 3AG3B 3A21A 4NPKA 3DI2B 1Z6JT 1KCSH 3QH3B 2FJFB 4JFZH 3FZUD 1NBYA 2FGZA 1JZHA 4A66A 1XX9C 1EAPA 2ZOKB 3KWWA 3V8CA 2VAJA 4E9RA 5K9KB 2VLME 1X9QA 3WD5L 4HJTA 2LT9A 4PM1A 1U3ZA 4Z0BH 1KUMA 3FTVA 1WZKA 4Z7WF 4WLCA 1B4JL 2GSIA 3CDFA 1GY1A 4WKXA 3ARXA 4NN5C 1VFAB 1YNTA 1MCLA 3ZT6A 1BFTA 5I6LA 5JHAA 4LSPH 5EZOH 1EVTC 5D1ZD 4RRPM 2P46B 3MJ7B 4N2OA 2W65B 1ZK9A 4M62L 5CFHA 1PCXA 4QOKD 3REVA 2EVJA 4F7PB 2FJGA 2W0LA 4P05A 3ZTNL 2OKMA 4DP9X 1RP8A 5AAPA 1YMHA 2YQ2A 4NHCL 2GKIA 5J9PA 3HZMA 3K0YA 4OKVB 4HBCL 3PDOB 1T6BX 5F0PB 1UA3A 4TSCH 4U05A 1T0OA 3CIAA 4I9WE 4MJ5B 4X7TB 2BP8B 3MGOB 4AE1A 2VQUA 4LQFH 2EDEA 3ULSA 5E2JA 3MRKB 2EUVA 1VGEH 1MFDL 4QHKI 4HJUA 3BVWA 15C8L 4ZOEA 3QP3A 5C09E 3QWOB 1FFQA 5EN2B 3WFCH 5JIQA 5C8JA 5CBAB 4LZKA 2QKIA 4IRZA 4H8QA 4PYHA 1I85A 2ZX8A 2DEXX 1ZT7B 2ENSA 3KR3H 1CCZA 4RMQA 4KDVA 3CZSA 5JOFA 2VLJB 4NO5A 5KN5B 2QV4A 4XNYL 3QUYB 4P4KA 5DVNA 3S36L 1PD0A 1NCBL 1IKNA 1UM6H 2IADA 4QXGL 5KWYC 4KZEL 5EU4A 3RUGB 2J5WA 4JM2F 4PJEF 3HE6A 1KULA 1P5UB 4WHDA 3SKMB 4CC0A 4JRYB 2NXZC 3VXOA 3CN3A 4F57H 5TE6H 3RVUD 2WXOA 4BQBA 3EJZD 3GM8A 4F9PA 2HVBA 4PJAF 4UI2A 4ADGA 1BEYH 1EO7A 5GJTH 1R3HB 5JMOC 4PFEA 1SDDA 3FU7B 4LCWE 2FWOA 2I5Y