3UIZA

Crystal structure of sefd_dsca in d2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
133
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIVGNKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
total genus 20
structure length 133
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uizA00
4OR1A 5D55A 2FVNA 2CO2A 2CO3A 3UIZA 2CNZA 2CO6A 2CO7A 2AXWA 2IXQA 2CNYA 3UIYA 4PHXA 2CO4A 2CO1A
chains in the Genus database with same CATH superfamily
2ICWB 3DX6A 4APQD 2OSLB 1V3LA 3C6LC 1ITBB 3QDHA 4BSVA 4F7PB 3RVXD 1ZA3A 2P5WE 3GLEA 3FO1A 2V7HB 3L9RB 5I1GL 2ODHA 2HFEB 5J56B 3RYMA 1CZ8H 3HMWL 4L37A 4D9QD 3RVWD 4HLZG 1KSRA 3SBWC 3B7SA 3WIIL 3WJLA 2IH3A 2FAUA 4Z77B 1NFIA 1BMGA 2EDHA 4UTBA 4AGPA 1KZQA 3FRUB 3WN5A 4WEBL 4CC4A 4D2NA 4AYMC 3KG5A 4ABQA 5CJ5A 2M26A 2VDLL 3SYOA 1QRNB 4GRLC 1ZT4A 4JRYE 3EJCA 1VCBC 2WBJB 3VWJD 2EDQA 4N90D 1OM3L 4YHML 4HS3B 2GSMB 4XO5A 4C59B 4DSYA 4X9FA 1B0IA 3QG6B 1A7OH 2X4OA 1XF3A 1DQVA 2I26N 4FEMA 4OJFL 4JFZH 1HXYB 1UB5B 1MDTA 3QWQB 4QNPF 1P7HL 4IBVA 5DUJA 4JO3H 2DMGA 5FDYA 3ZE2B 2APVA 3L3KB 5JW3L 2V2XA 2X0WA 1ZEAL 2TRYA 1MCPL 1DP0A 2F7RA 1RI8A 2AXFB 3CLFH 2BSSB 2HJFA 1J1PH 3FQUB 1UZ6E 2V17H 3KPQB 4S0SD 4ELMF 4Y4KC 5DSCA 1IBHA 1SGKA 5LGJA 4YL9A 3BLBA 2XT1B 2YEZB 3BH8B 4NNYA 1RUQL 2Z93A 2M8XA 3LQAH 4IBWA 5KAQG 4MJIB 1U8NB 2RCSH 1DQMH 3HS0C 3MNDA 4JB9L 5A2JH 2WVVB 2HFGL 3JT0A 5KJ7E 3DO7B 1CGSH 3CFDA 2HPTA 2YA0A 4XNQB 1TJHL 5T1MA 3LS5L 2C1PB 3CN0A 4BH7A 3T2LA 5F7MC 5HHXL 4DH2A 4NZJA 4BSWB 2XCMC 1FL5B 2X6UA 3FHAA 3AT8A 4PGCB 1S78D 4KOBA 4R4NC 4G5ZH 3KLAB 1ZLDA 4FG0A 2NXZD 4Y1AB 3MLPA 1FVEA 2PYFA 2WC7A 5J6HB 4AYBA 1GC1C 4O58L 5AVTB 4KU1A 3E8UL 3E80A 2DQHH 3BUIA 3GIZL 4JHAH 2WSPA 4P46A 3UBXG 1FNEB 4K7PL 5IFAH 1AGFA 3PF2A 2BY0A 3KM1A 4HC1H 1R5VB 4PS3A 1AKJA 4L8SA 2EKJA 2DQTL 3EGXA 1RMFH 5HI5C 5JUEH 2NXYC 3QORB 5DJ0A 3HZVB 4F2FA 4E68A 1HU8A 4I5BA 5DD6A 2XWJA 1KNOA 3G5YA 3RKPA 3ULUL 5C6WH 1CS6A 1HX0A 1F4YL 1OQOA 4TVPE 3V8OA 4L29A 1ZHLA 5L2JA 1S3KL 3S3DB 3TFBA 5L7XL 5BRZB 2QQLL 4NHUA 5DVLA 3RVVD 1LLAA 1YN7B 4PJXA 2PTVA 3EJTA 4TM9A 4N0CD 4OH2A 3HZYA 1AQKL 4HKBB 2VLLA 4Y4HC 4LF3A 1MPAH 1R3LB 1FG9C 3K71A 1SM3L 4P07A 1PX3A 3CFEB 4PRPD 4S1RH 3VFNB 4KZDL 5DEFB 3PHAA 5I9QB 1F42A 2F53E 4H8WH 5KTEH 1AGDB 3EH3B 1KLFA 3CFQA 4OJYA 1T20B 5SWZA 2B39A 4R0LB 4N2BA 2YAHA 4CMHC 4Z0BH 2J5WA 1E4WL 5FOBA 1CE6A 4P05A 5F7DB 3DJZA 3NIFF 1J5HA 4P23A 3BDBA 2AK1H 3SGDI 1J8HD 4GBXC 3TO4B 1IMHC 4RDQF 3IFNL 5IW3A 2B1AL 5DRWA 4ZW3A 3ARPA 2W0KA 3CCHB 3QC5X 3SDXA 3SD5A 1MJJA 1TTCA 1I9IH 3QPXH 3CSBA 1U3HC 4RMSA 2VQTA 2BVPB 3FU9A 1Q4NX 3LYRA 1KIQB 4FZ8H 1PZBA 4OGAD 3HNSL 2UUDK 5ID0B 2YPVA 3RWGA 2A6KA 3FHEA 3D39B 4QKXB 2MOQA 2VDML 4GW5A 2H0EA 2Z7WA 3DJRA 1QRKA 3TEUA 1LEGA 3H9SB 2YEVB 4APXB 2Z4QB 3ULVH 2G9HA 3ARBD 3IS1X 5FKAB 2YS4A 1G7LA 1YEFH 2IDTA 3D06A 2X05A 3TWCH 2VM3A 4AVHA 2J1XA 4H7VA 4U6XA 3GD1C 2HPOA 3PDGA 4N2EA 2VM9A 1BXUA 1WCQA 5F7HA 3QRFM 3LV3B 5I6XC 2WQRA 5DZOA 1D9KC 4F8TA 1WEJH 2H5UA 1M9SA 5D1QD 5AOIA 5BRQA 4ORGB 3UTSD 3ZT7A 2E6PA 2ZXCA 1UADC 3I6GB 3RAJL 1HL4A 2P9RA 3RDTC 2OMNA 3F8UB 3HG3A 2X6CA 2DQCH 1TOXA 3RWIB 2D0HA 1Q1JL 3VMOA 4G7YH 2A9ML 3RX5A 2HT3D 3C08L 4B0MM 2P8LB 1OVZA 1HQRB 5FYJU 3S48A 2QV2A 4G8GD 1MWAH 5DHMC 4GG6A 2A3TA 4AKOA 2FQGA 3II3A 1WZLA 2XZCH 2GJPA 1KLGA 1JRHI 2ZWNA 3BP4A 1SMAA 4XXWA 1VCAA 5GGQL 3V4LA 3VFSA 6CGTA 5HGDB 4MZ2A 2NDGA 1MHEB 1C1EH 1S4IA 1MCWW 3HVNA 5INDA 1FO0A 3GBEA 1R6VA 3INOA 3S2CA 4OUOA 2CXGA 2IWKA 3ESUF 4JZOA 1FFNA 2AJSL 3B7RL 5JORB 1HAWA 4FQJL 4X4XA 3PWUA 4AVJA 4WTWA 1CTMA 1TIUA 4MAYA 5MP6H 3FCSA 4BCZA 2P5EB 3ARFB 4LOEA 4MA1B 5HJ3B 4ZQKA 5A2FA 3IFOB 4PW9A 4KKRA 3JWOL 1SQ2N 3SY0B 4F7MA 2JKSA 3KXFA 1U8OB 4QRPD 2JCCE 4R8WL 4P5TA 5FYLL 3JUYA 3SPJA 2E46A 2W81C 3ZHNA 2WW8A 3QJUB 5I18H 4ADIA 4UB0L 4RMTA 1G7MA 2YSTA 3AM8A 4HZLB 5I19H 4FQ2H 1ZS2A 5L2KE 4OW6A 4HIHB 4QPEA 2CCLA 2XU9A 4CN4A 5KYWB 2OXHB 2BIIA 5GIRB 3CMOH 3MV9A 4B9CA 4UAHA 1A1OB 3LRGA 3GMMB 3A3YB 2NY5H 4IKIA 4ATTA 1BYNA 4X6CE 5EF0A 4JVUA 4OB5L 4AVIA 3MRDA 2GFBA 4MXVF 4G42A 3QI9C 3V4VA 3VFTA 1W8EA 1GCFA 3FU8A 3WUWA 1FFOA 2C9SA 4JEGB 4U1GB 2XWTA 4NRXA 2ZP9A 4W9IC 1NBVL 4KI1A 5TE6H 3GI8H 4MJ4A 2HG5A 2E0PA 3FQRA 4G80B 4XMKH 5LGYA 3GK8H 3OJDA 4IIQB 1SEBB 1DBAH 2C1OB 2DD8H 4X6BA 1KFAH 4BZ1A 3ULUC 4KK8C 3WDIA 4GSUA 1AD0A 5E2VH 2J8UF 4EN3B 5FO8A 3VWJA 5E1HB 2PO6B 4Z7AA 2VQ1A 5MEQA 4N0YH 3SKMA 4Q0XL 2WLHA 5AOZA 3EXLA 5E5UB 3UTZB 1N12A 4XMPH 2NYYC 1X9UA 1I4FA 3WIFA 4Z7NB 3HUJB 3RL2B 3ZRSA 3ATEA 4NJAH 3WTTA 3PCYA 4LSRL 2F15A 1LK2A 5BCAA 5IQ9B 1CLZL 4M5ZL 3CUPB 4PG2C 3IM1A 2NDFA 2WXRA 5GS0D 1T0OA 2YPLD 1FFPA 1L9SA 1LILA 2YOAA 4HJGA 4OUUB 1Q94B 4FNPA 4PWIA 5DUPH 1KT2B 1PKQE 2UV3A 5KVGL 4NUQA 1RY7B 1CGXA 1J1XL 1UM4L 5IVZB 5D1XC 4ZX5A 1I1FA 3CSYB 3L3DA 1GY2A 4LDOB 1JWUA 2X2JA 2DM7A 4DVRH 1XIWD 4WO0A 2NCMA 3RIFK 1ZTMA 4GAAA 3TVMB 4FG6C 3UMNA 4PIBA 1Z0MA 4XMVA 5ERWA 4PJ9A 3H9ZA 2CRIA 2XZAH 4FQLH 4LSVH 1JBJA 3RQ3A 4BFOA 4Y2DB 2EDRA 3DTXB 3TN0C 3VTMA 3WGVB 2CIKA 2NY6B 3AU1B 2XC8A 1EVTC 4L1HA 5F6HJ 1DN0A 1SF5A 5E99H 4OV5A 4HUKB 5MENE 4Y9BA 1PFCA 3NFPB 2P43B 4H44C 2IPUG 4G70B 1RUML 1GHFL 1JWMB 2VR9A 4RFEA 1XB8A 5F9WB 4JPVL 1W80A 2Z65C 4I0CC 1NMCB 1T04A 2XUWA 1A7NL 2W8CA 3G5ZB 3GHEH 5I23A 3ECQA 4EUPH 2EVIA 4KROB 2VZOA 2UZIH 2HFFA 3L2MA 3TU6A 3NEEA 1G6RH 4YHZH 5ELIA 1S7WB 4WWID 1YECH 2Y6SC 4B9FA 5I0VA 2Q86A 2ZUWA 5GGSY 3CHRA 1OAUH 2CDFB 3QG7H 4JRXE 4Z5RB 1OHZA 1E4JA 1HINL 1PJWA 1NOAA 2QLVB 1SXZA 3MUHL 2OTPA 5ICYA 5MI0B 5MERB 2EKSA 4OCWL 4HOMA 4QNPE 1Q0XH 4PRPA 1CL7I 1L7TH 1RZJL 2VMEA 5J8OA 4MMYA 1EHLH 1OOAA 2ZXQA 1N67A 3AXLB 2X41A 3QUHA 4Y4FB 4K3EL 3VA2C 1LO3L 2VXQL 3DHMA 2Z0UA 3BWZA 4P3DB 2FK9A 2PW2A 3US9A 4N5EC 5E1QA 5JDSB 2UVEA 1C7TA 4MDIA 1IKFH 1FG2B 1HILB 1NCDH 4ELME 1CTNA 1ZDSA 3BPCA 5JXEA 4JQVC 3ZHLA 3EOBB 4G6FB 5LDUA 2FSEA 5CD5C 1NM9A 4NC1C 3WIAA 2ZOKA 3SQRA 1XL6A 5EO9A 4FJ6A 5KSAB 2VLKB 2Q7YA 1W16A 4AGQA 4DT2A 4CVXB 5C86A 3WJJC 1OF2A 2V5MA 4OLXH 4YO0A 1P7KB 1JFQH 2IANE 4OFQA 2GEEA 4K3JH 3WAKA 2C3VB 2XQBL 2BK8A 1DVFB 2V7NA 2KZWA 1KXTB 3FN9A 4WI9A 3A67L 4MNHA 1W8OA 3CU7A 3M17A 5CZXD 5DJAB 1AHWC 3K6IA 1OTSD 5C09D 3ARBA 2GTWA 2GTZA 1VJSA 3P11H 1WC7A 4Z76A 1E6OL 1OEZW 2R1WA 1BQRA 4XPGH 2CLVA 1RIVL 3OGOE 1A6VL 1DLHB 2PWDA 2ZUUA 4IGBB 5HHOB 3W3BA 3WNOA 2FUTA 4WGVB 4R96A 3GSQB 2NTSP 3NCFB 4W9CC 1MG3C 4Z8FL 3FO2A 2HT4D 2YQ3A 5C2UB 4JG9A 2ZZUT 4X4YA 3AY2A 3JTBA 4LGSB 4TQIA 4XGZB 5DK2A 2E76C 4GW1B 3VCLA 4Y9FA 4E41D 3LEVL 3MROA 3LB6D 4PBDA 1EHXA 1MCQA 1KBPA 4LBAA 3AXHA 4KKPA 1W0YT 1HXKA 4WU5A 2CKBL 3KW7A 3I75A 1H15B 3VGDA 3HG4A 4JJ5A 2C7UA 3FFDB 1IE4A 3U1SL 2I9TB 2W91A 3L48A 4G8GA 1HHJB 3DIFB 4NAQA 5E8PB 4ZTEA 2WM0A 3B8YA 1HOCA 1MHPL 3L3IB 2FLBT 3C09B 3CX2A 2DQUL 1AMXA 1FIEA 1HHKA 2YARA 3BDYL 4LLWB 5INCA 3TX4A 4MSWA 1AO7D 4PJGF 5KG9B 1U33A 3J8F7 5DDHA 2ARJQ 3WMPA 2P45B 1F18A 4I2XB 4ZO8A 2MIZA 1WBZB 2WVTA 2UZYB 5TH2B 5B39B 4U1LB 4ICXA 3BGMB 3QR2A 2K45A 3IKCB 1JZEA 5FYJD 5JPMB 1BZ7B 3UYRH 3W5NA 2Z7YA 5E9DE 5HI3D 1MHCB 4IJTA 1J9TA 1DANU 3DJ9A 3DRTA 1A2YB 3NH7H 3LRMA 4QRPA 2ZWZA 4FE9A 1EERB 1CF1A 5LQBL 3VTTA 5GZOD 4RISH 2IDUA 3BSZH 2FGWL 1MRCH 3NK4A 4P5RA 1KEGL 1PEWA 2CGYA 2I7SA 3MYJA 1GGUA 4L4VD 2O5ZH 1EAQA 4HUVA 5IQOA 3H2QA 3INUL 1S9KC 4FQHA 4B27A 4K94C 4PP1D 4X7DC 3A47A 2M1KA 3K6FA 5AKTA 1DBKL 1IBBA 3FQYA 4O2EB 2J6EL 3QDGB 3BZ4B 3VYPA 4JFWA 4IU3A 2WAHA 4ZO9A 5BO0D 1DQLL 4HF5H 4MQ7A 3UTTD 4EZKA 2JXMA 3R1GL 2WBKA 4W4OC 2LU7A 3L5JA 5IW1B 2ZSVB 3RUGA 3QIUD 1W72B 1IQWH 3WNPA 4YDKL 3K4AA 4OZHA 5CUSH 1AZVA 5E51A 1U3ZA 4TUUA 2H2SC 1P7BA 3MJWA 3ELQA 1SNRA 2V3DA 3Q6GL 5CP3A 3LPPA 3VI3F 1A9VA 2PTTB 1YC8A 1CK0L 3LKSA 5DZVA 1PX8A 2VISB 4WV1B 2IC2A 4YXLH 1IKNA 2OA9A 2UWEA 3QS3A 1TPXB 3CXDH 1NUGA 2V5TA 3DJSA 3G04A 4WRLA 4P57B 1IRAY 2AANA 3B3IA 2MCPL 4EIZC 1EWHA 1QYGL 2Y1YA 1QSFB 4ABWA 4J3SA 4JO8A 3GMQB 2BERA 3MNVA 4LESA 1M1SA 1NCBL 2Q2LA 2WXFA 2XRAL 3NSXA 3QWNA 4JFQB 4XI5D 4HHAA 1AG0A 2J7LA 3DPBB 5M94B 4S10A 5D7LD 4Y5XB 2DRUA 4HJJL 4S1SH 2I7OA 3BAJA 1RZJC 5D5MA 5DJXB 3L8QA 5LXGL 4XP9H 1CC3A 2FTAA 3I85A 1R3IH 1RSYA 1TJIH 2YPLA 4MAUL 4ZAKC 4Z95L 3EYOA 3GINA 2W95A 1L6ZA 1IZKA 1I8LC 1OZUA 1PYWA 3KGUA 1ICTA 3NUKA 3AGVA 3MRLA 4MZRA 2GBVA 1CU4H 3IBOA 3TEZA 2EZ0D 2Y1AA 5B39G 3PL6B 1FYTD 1RZFL 4QHUB 1ODAA 2HVJB 2YAPA 1QASA 2B2XH 4U3XA 5FO2A 3S36X 1KXQA 4UNVA 2FT8A 3NDZE 5J1SC 1AGEB 3IDIA 1Q0YH 4OCXL 1MXGA 3U7WH 4NAJA 2FBJL 5DGRA 4O5LL 3TESA 1IBZA 5F7YC 1NCOA 5FS5A 3RIFF 1CF8H 4OQTH 3I2CH 1MKFA 2AI0L 2FEEI 2L3BA 1YMHA 2B1OA 2FH6A 3QRGH 2IVFC 1JHTB 2ENJA 3IJEA 5E56A 3T65B 2QGDA 3I9IA 4WI7A 2W92A 2HVKA 4NUGL 4PJ5E 3T77A 1FZMB 3PJNA 4H26B 1UUSA 5F6HI 5F1NB 2EYSA 4MXVE 4PUBH 4JM4H 1A4JA 1H6TA 5CILH 4FFYH 4N20A 3DPDA 2F1AA 1D6VL 3GSUB 4UYPA 1BZOA 3O3DB 3QQDB 2EABA 3Q8BA 4R7XA 3KE0A 4N2HA 5FGBC 4JFED 4ZUUA 3O4OB 4M6OH 4OLVH 4QRRB 1E5UI 2Q20A 3L7FB 3ZUNC 1YEJL 4ZFQA 4UTAL 2GUOB 5JZ7D 3KBHE 4OLEA 5FUOL 3O6FB 4H1LH 1ZWIA 2J8UE 3ZDYF 4JG5A 1M7IA 1Z9SB 4OJCA 4Z1PA 3PDOA 3BJLA 1A64A 3D3VB 3RJQB 4AV5A 3JXAA 3DETD 3DX6B 1TFHA 2PYEE 3UPCA 4UQ3B 1JZHA 4ANWA 1YMMD 4O4YH 2F58L 1ZTXE 3R4DA 4G6KL 1BG9A 4G8EB 4K73A 2QHLA 3B9KD 3QRBA 1VFAB 3FO1B 3ILQC 2XN9A 3QUMA 2K8QA 2CIIA 3HUJF 2IH3B 4R5TA 1P4IL 1NFIB 3TNNA 4NLHA 1DTUA 3PGCA 2WWMC 4TMPA 4DP6X 1DVZA 5ESAA 4JGUA 1TEFA 5D71H 3A23A 3JWNG 3S88L 4KVNL 1A3LH 3K6SA 3BVXA 3IDYB 5DMIL 1NBQA 5FYKH 4RAUA 3UAJC 1XF3B 4G1EA 1IV8A 4AIZA 4FG4A 1M6OA 2SEBA 2O1AA 4G9FD 4DK5A 4F92B 5IMMA 1SOKA 2V2XB 1MLCA 1LHZA 4GO6B 3W1ZA 5I1JH 1F5WA 1CXIA 5HJGA 1KJMA 4FA6A 4GKLA 5C3IA 4QYAA 3MC0A 3JQOB 3VM5A 3U82B 2XXMB 2CO3A 5DSCB 3VI4A 1YPZA 2E6QA 2CHXA 4E9RA 5CLWA 5HDWA 3VXSD 5C09A 2Z93B 1IC4L 3D6GA 3GB7A 4M6AA 1AZRA 1O7SA 1RJCA 2HVBA 3TTYA 2G3XA 4UT6H 2GI0A 3GSOA 3GMNA 2WANA 3ARRA 3NZSA 1RUPH 4BQ6A 3QAQA 4D0BA 4CN6A 1LXMA 2NY3C 3EZ8A 5G2NA 4KKBD 3IDNA 2ZNXA 1K85A 2XA3A 3HMXL 1DJSA 3W57A 1JPST 2IPTH 1QBML 5IBTL 2I85A 1QWUA 2AXGB 4FHKA 3T08A 4ZMPA 2CE6A 5EWIL 4E41A 3MRKA 1FVEB 2PYFB 3BAXA 1WO2A 4HPOH 4B60A 4MBOA 1JVKA 4HP5A 4NQEE 3WS6C 4FQXA 5D7HA 1XF2B 3HAEA 3F58L 3PWPD 4GO8A 3FAXA 1AGFB 4OT1L 1AKJB 1EO8L 5IMOA 3B43A 3EGXB 3BUDA 1LEKA 2PCYA 2HLFD 5FLUA 4NIKB 1FLRL 5FM4A 3WFBL 2VSDA 5DJ0B 4IRSC 4AI7A 1AO7A 4I5BB 5DD6B 1TETH 1DHKA 3BXNA 5LAXA 2XWJB 1HCVA 2HWZH 3VG0H 1YY9D 3PPSA 5JTWA 3G5YB 3P2DA 3UFIA 1CGYA 1WZ1L 1X5AA 1CBJA 2N7SA 2X1PA 2F0CA 4LRNH 4PRID 4DESA 5HD8C 1YYMH 3DUSA 1DLFL 4RWYL 3SDYL 3W2DH 2BW5A 4NHUB 4Q56A 4PTTA 4PJXB 3HRZB 3ARXA 1U8LB 3E6FB 2V6HA 3HZYB 1URZA 4QXWA 5ITBL 4J5VA 4YSTA 3K71B 3FU7B 1XGZA 1CLOH 3U9UA 2WWNA 5GZOA 1IC5L 3CZLA 2WBJC 5TD4A 3O6MH 3B34A 1KLFB 1YDPA 4I18A 4W93A 4XWGH 5SWZB 2I27N 1CFBA 4V2BA 4OD2B 3DIVA 5JW4Q 1CE6B 2NX5D 4LDEB 5HHVL 1L6PA 1FSKB 1T5KA 2CA4A 1AY1L 5EZPA 1JYNA 3PXLA 1USZA 4P23B 3TA3D 3SYQA 4WCYH 2GCYA 2JNZA 3SDXB 2OMXB 1CVSC 2TSAA 4OD3L 3NGBB 3QIUA 2FECI 3P69A 2EYRA 2YGQA 4AXWA 1EVUA 5ADPL 2G75B 2F5AH 2A6KB 3RWGB 4YSAA 5HVHB 4NWUL 4R90H 5DJCB 2BVOB 2IGFH 2EEXA 5EN2A 4GW5B 3VFOA 3ZL1A 1FAIL 5D70L 2LHAA 4JN2A 1LEGB 3HNVH 3X11A 1BZQK 4XB3A 1OOWA 4N2OA 4AV0A 4N0UA 2G9HB 1OPOA 5FO9A 3EFOA 3L81A 4BFBD 1E3FA 2B4CH 1G7LB 3KGSA 5EU3A 1GZHC 1S7TB 4GRWH 4L9LB 5LN4A 2VO8A 4U6XB 2KT6A 2QPFA 2IEPA 4PI0A 4HBQA 4JANA 4JFTA 3T6VA 3A21A 2XWXA 2HA1A 4ZOCA 4PJGE 1ANUA 3FZUC 5D7LA 4NNPL 3RVTD 4NAMA 2W88A 1W0WA 4TV3A 1DANT 1CGTA 3TNMB 4HWBH 4Z7OB 3QORC 1P7QD 4KGJA 1ZHNB 1XV8A 4UT7H 5E03A 2WKGA 3SE4A 1USQA 4NQCB 2Y2WA 2I9LB 2WWKO 1FYTA 1ZD6A 3QEQD 1SEQH 5AYQA 4Y9CA 4GG6B 1YVLA 1ZK9A 5EUOF 5JHLA 2RALA 1KLGB 3BP4B 1X7QB 2XXCB 5EDSA 1C08A 1AQHA 3M1OA 1NLBH 2OQJA 2Y5TA 1GMIA 4NQTA 4S11A 4Z7QB 1XZ0A 3LD8B 5INDB 4GUOA 1FO0B 5GISL 1MW1A 3B5TA 3ZQWA 3MV8D 1CXKA 1OAKL 3CTTA 1JNHA 1FFNB 2IFFL 2CK2A 3OD3A 2OLDA 3D33A 1Y6MR 1FGNL 4X4XB 5I9QC 3FCSB 2OTUB 3QC6X 1R34A 2BDNH 4H0LC 3AGWA 4AC4A 4BH8A 1RZIA 1MEXL 3QNYA 3Q3GA 1YNLL 2AJ3A 5KVDE 4PB0H 4F7MB 3KXFB 2WOYA 5AUMB 2BNRE 3Q13A 4R0LC 3GHBH 3SE8H 2G3ZA 1KJ3H 3PYCA 2JKJA 1WF5A 2EH8L 4QD2E 3WD5L 2DMKA 5E1AA 4KKQA 3WXVH 1LO0L 1ADWA 3OC8A 4JFEA 1SOSA 5DZNA 4BUGA 4JPSA 1G1CA 5KJRL 1E2ZA 5DHVB 2J25A 4YFEA 5C0RL 1ETZA 3PABB 1AE6L 2XKNB 4J3OH 2F8VA 4YZWA 2MHAB 1LK3H 3FBKA 3FSWA 4OKVB 4M43L 3VI3E 3F7RA 5CEZL 3KGRA 3C08H 4YHOH 4I89A 3V6OC 1KGCD 1OTUC 5IR1B 2YC1A 3ZYOA 2GFBB 3FRPA 4G42B 4LKXA 2AGJL 1JGUH 2ZCKL 4TSAL 4KGLA 3M6DA 3V4VB 1YMMA 4GI9A 3FUMA 1NFDB 3LRHA 1COBA 5DUBA 4JQIL 1FFOB 3MNWA 3NA4A 3B9KA 3DHPA 4NRXB 1MF2L 2ZWLT 3QK0A 4K5MA 1JZ6A 4JKLA 1A4AA 3LVTA 5IVXF 1MJ8L 3FN0L 3ZRCC 3FQRB 3NDYE 2EQDA 5HHPA 3OJDB 2YFNA 3KEDA 3WXWH 1KYOJ 4WFEE 2AEPL 4LHQB 1ZLVH 4O02A 1AD0B 1L0XA 2E3VA 3VWJB 4WTZG 5DWUL 1PS3A 3O3AA 2NY0B 2VQ1B 3O2DH 5MEQB 2HTKD 5CMAB 5KYNA 3SDDA 3JWOH 3AFLA 3BQUA 1Z5LA 4CAGA 1WBYB 2X4SA 2NZ9D 3DX7B 4Y1TA 3SDCA 2H1XA 5FDWA 3ILPA 3MBWA 2PXYD 4H88H 1I4FB 3WIFB 3VD9A 4FP8H 4PRAB 5AENA 3LQZA 4KUZH 1KY6A 3RGBA 2VN5A 5LCVA 1MW2A 1WD8A 3HHSA 3O9WC 2YXMA 3DVGB 4D9LH 1EMTH 4A2DA 3MLRH 3VXSA 4HJGB 5GGTL 1CE1H 1PG7W 2WUBH 1DVSA 3SGEI 3DV4A 4DP7X 5KBKA 2H6PB 1R5IA 5FUZH 5I73B 3NCYP 3SCMB 4FQPA 2P8PA 2CKNA 2D7OA 2H2PC 4EDWL 3UOAB 2VXSH 5GQBA 2IXQA 3D0VB 4UU9A 3BH4A 1OAQL 3K81A 2EO7A 4FGMA 5HI4C 4TF4A 2J1KA 5ERWB 4PJ9B 1MQKH 1B4JL 3ARFC 4ZS7L 2B8OT 2HRPH 4L5FL 1DCLA 1PLBA 1PSKH 2CIKB 3E6HA 5B38B 4H25B 3H85A 3SKUD 3J07A 2UZPA 3Q2WA 4HW6A 1MFDH 3V0FA 3L9EA 3ZDYE 3WE1A 4P9MH 3N43F 4H8UA 1VZIA 3QJTB 1CCZA 2A1WL 3WKML 3TYGH 4TUKL 4RFEB 5JXAH 1T04B 4NZUH 1BDYA 2VAJA 2ZAHA 2R83A 3TBSA 4BUQA 3DVFA 5CN1A 1S7QB 4PRIA 3WMQA 2V37A 2YSSA 5B1KA 4M5TA 2EVHA 4KKNA 1NDMA 4MB3A 4OTXL 4X5XA 3QHZL 1EEUA 3C5ZD 1JXKA 2O72A 5KANG 4L8BA 1J12A 3FQNA 2MKWA 3IU4H 1F3JA 1KIPB 2B1HH 3L08A 4FYRA 4Q58C 4MD0B 4U1GC 2FJSA 4JRWA 5L4MA 3SQBA 2Y36H 4JKPH 2VUKA 2WZAA 4XC3H 1N2RA 3PFUA 5BZWA 2DKSA 4AOFA 5GGVH 5ICYB 2ETWA 4IIQC 4D3CH 2ZUSA 5DS1A 1KOAA 5F9OL 3V52H 3ZDXF 4PRPB 2OTWB 3IMTA 4XN7A 4LAQH 3UZQA 1AR1D 4EN3C 4MA8H 3EJPA 4DPRA 4NDMA 2PO6C 2PW2B 4XMLH 5DR5H 1Q9LA 3WOVA 2VZVA 1R9FA 4MDIB 4AMXA 3K7UA 3OXRB 1ROCA 4HYTB 1Z9NA 3JV4B 3FT2B 2DBLH 3QXDA 3SOTA 2Q6WB 3NT0A 3BPCB 1ACYH 2NX5A 3MXVH 2J73A 4P0DA 1IM9B 3TA3A 4BZYA 3HG5A 2BOLA 2ZOKB 4ZSOB 5EO9B 1PPIA 1QP1A 2FVNA 2Q7YB 5ICZB 2OJEB 3PWVA 1XL4A 1FV1A 2QKIA 3ECUA 2ZSWA 4TTDD 1OF2B 4G59C 2NSXA 5G5DA 1XT5A 1LE9B 1U36A 2BRRL 4LSTH 3ESOA 3EJSA 2V7NB 3PXJA 4XX1E 4U05A 1JD9A 4G8IA 2R29L 4ZDHA 2VDNB 5IZ7A 1L9MA 5AZ2H 4YVNA 3ARBB 1WC7B 4ES9A 2BP8A 3TVMC 1OZTG 4QGYA 2DWDA 1FH5L 3KJ4B 1FPTL 5DD1L 5B38G 1HE7A 2KLTA 4MWFA 5D6CB 5C0EB 3DX4A 2JTDA 4UM9B 1UCTA 3P0YL 1I9RH 3QCTH 4OLYL 4Y2DC 3RY6A 5K9QI 4OI9A 9PCYA 3TS8A 5KUKA 3NESA 2NY6C 3VX1A 5SWQA 1SJEA 5D7IB 3SGKC 3IRCA 3RVUD 1I8MA 2GY7B 4DQAA 1M7DA 3VCLB 3MOBL 1W72L 3WFHA 3FSVA 2NUTA 3KWXA 5F9WC 3NMEA 2DQFA 5G4OA 1AI1L 4C56E 4E42A 4WU5B 4CADB 5CINL 1CFQB 1NMCC 1SLUA 1P7QA 3JV6A 4M48L 4WUUE 4X9YA 2F5BH 3I75B 4GMTL 4KROC 2C7UB 2WTPA 2E8ZA 2LU4A 3V6FB 5KS9A 2ZJSH 1BJ8A 1TVBA 2Q3AA 1UEYA 3VXTA 1HOCB 3ETBF 1U2CA 1FDLL 3GTNA 4JFVA 1U8HA 4EI6A 2AHIA 3O11A 4MSWB 4YN3A 3EH4B 3ZQ9A 1VFUA 2QL1A 2EC9U 4WUKL 3F3HA 1H8LA 4R9HA 3UX9B 2D3VA 4WHYH 3MV8A 3S34H 4I1NB 5SV4A 5MI0C 4I87A 2H0PA 1KTCA 3TP4A 1MFCH 2YN5A 2VDRB 1TJMA 3U6XA 4Z7WA 4O2CA 3KLHC 4HCFA 1FL3A 2NY7L 3OMZA 4MNGA 4Y4FC 3V0JA 4KUCF 2X9ZA 3QCUH 5F0JB 1AFVL 1NLDH 3EJUA 3IU3B 4JQXA 4BRJA 3QXAA 5ESVB 1P69B 3GMOA 4QRPB 3OMIB 4HUWA 2X3CA 2VW6A 3DIDA 5IM7B 5I1DA 1FN4A 4MXWH 4OGYH 5EMYA 3BKCH 4LCUA 1VADA 4HX1A 2JLPA 3DX0A 2VC2B 5KSAC 3HPJA 1U6AH 4OCSL 3B2UD 4DGIH 1T0MB 1TZOA 2BZDA 5FYKU 3FCBA 1CD9B 1E4KA 1T83A 2VSCA 3MYJB 1SDAB 4W68A 1KN2L 1F4XH 1OGAD 1QUNB 1SY6L 2VZTA 3QQ9D 4FFVC 1G9EA 4FQHB 3GSXA 3U9PH 4NS0A 4MA7L 3U1SH 2PP7A 1RHHB 2EXSA 2JKWA 3OBAA 1DVFC 1QMUA 1CLVA 4MB4A 4MQ7B 5DJ8A 2JXMB 4PR5A 1UYWL 5E6RB 5I2IA 1KEML 1KCWA 3RUGB 3OWRA 1IAIL 5F3HB 2G0LA 4PLJC 4K3DH 2R9HC 1E7VA 4BWTA 4QWWD 1UGNA 3GLDA 1TYJA 4GW4B 4HLZH 4ODUA 4OZHB 3QFJE 1QPKA 3PHSA 1KYUA 5D7JD 4BIKA 2AKRA 4IGBC 5EZJB 1NIEA 1T7ZA 5F7FA 3EUUA 4J4PC 3BP5A 3LKSB 3ZRFC 3WENA 1WBXA 3F7YB 2UWEB 1KDIA 1B3JA 2OMVA 3D2TA 3B3IB 3A4DA 1QLFA 4QO1A 5KYUA 5JIDA 5CCHE 1LNUB 1KV3A 3NEXA 5EUOE 3QJHA 4UQ9A 2EDDA 3MNVB 4RRPM 1U91B 1GGCL 1M7UA 2O5YH 4J3VA 2PXYA 4U1IA 4KQ3H 5DJDB 3GSVA 4ZW6A 1CFNB 4LPXA 4ODTL 1L3NA 3BIAX 3EYSH 4U7KA 4AEHH 1A6UL 2N0MA 2VDKH 1PL3A 3GPEA 2YPLB 5GRWA 1KBGL 3O2VH 4UINH 1LJMA 3MLUH 3R0NA 3MRLB 3T0XA 1NGXA 2G2NA 3O0RL 4RMBA 2DV6A 3U6XS 3QDAA 2R0LL 1V8HA 3FQWA 3OJ2C 3TURA 1BVNT 4ZUTA 4S2SA 3UCRA 3UGXA 1U3NA 5IP4A 2WPGA 4JO1H 1QNZH 2VLRD 5GGRA 2DAVA 5JPMC 2GIXA 25C8L 3U4BH 2X28A 5D8JH 2VAAA 5GRJH 5I6OA 4N25A 1HXMB 1WVZA 4JO2L 4V1DE 2L04A 1MCHA 1K2DA 3IJEB 4UWQB 3K6DA 1QLEB 2ADFL 4NM4L 1Q9WA 2Y4SA 3FUJA 2Y3AA 4NZFA 5EH1A 2H32H 3U1QA 3T77B 3NEOA 3BVDB 1BJ1H 1P5UA 3ZT6A 2FATH 4UILL 1A4JB 1SXSA 3I02A 4ZTPH 3BAIA 2XA8L 4N6QA 5IF0B 3KYKL 3KPMA 1L9RA 5C9JB 1T89C 2QBWA 1AG6A 4XVOA 1HS6A 1MAJA 3EO9L 1TMCB 4RNRB 4ZUUB 4BE6A 1NL0H 3CN3A 5IVXE 3O3BB 4ZS6D 5KVFH 3C5ZA 1MXDA 4X6DE 4PW3A 4HXAL 5J89A 1F4WH 1QFWL 2DLHA 1ZWIB 3VFVA 4EVNB 3P3SA 1UWXK 2QLYA 3PDOB 4JFXA 4MMZA 4WWOA 1AZZC 5F9DC 4NC0B 2P1YA 4LOUD 3I6LE 2FRGP 1G7HB 2HX7A 3EUDA 3GJFH 2WQAA 5KSBF 2IAMB 2ITCB 3STZB 3VG9C 4AEFA 3VVWA 4ZMNA 4ZFGL 2EEDA 3GI9H 4C4KO 4UUJB 2XN9B 3UBHA 4O5LH 1O7DC 1TPXC 2CIIB 4N1HB 1N18A 2F61A 3ILDA 2OW7A 2HB0A 1MAKA 2PPAA 3FCUB 3TNNB 2WNKA 4ZD3L 1NM4A 2ESVB 3PGCB 1T6WA 1II4E 5JHAA 3FQ4A 3I3BA 3UTOA 3J2PA 1LYQA 5DFVD 4XHJD 4FLOA 4I9WE 3B5GA 4Y5XC 2ED8A 2I32A 4FNTA 2Y1ZA 1RZ8A 3MMEA 3JWNC 3QQNA 2APTA 4GRLD 4RAUB 5DRZB 3GRWL 2D2CC 2VITA 3QHFH 4PJAF 2SEBB 1GA2A 1WRFA 2YMOA 1VDGA 3Q1SH 3V4UL 4KTDH 1YEKL 5A6IA 1MLCB 3U1PA 3KLQA 2DQIH 3UYOD 1JGVH 2AZUA 2MWCA 1N5YL 3MNMA 1KJMB 2R23A 3PL6C 3TOPA 4WI0A 4OKDA 5F7NC 3NPSC 2P47B 1YPZB 4P9HL 4OIIL 5BNXD 1N0LB 4UM8A 3GB7B 2XG4A 4LPCA 4PRHE 4LQFL 5HYSB 4IMLA 4U2ZA 3CFUA 4Y1SA 4DOHE 3GSOB 4D0BB 2MJWA 3UYPB 3QDJE 2X6VA 1UOLA 2Y6TE 3IDNB 1N0XH 3N50A 5I1HL 2LU5A 5D2LB 2VXTL 5ILTL 4ZFFA 1RKRA 5ALCH 2JELH 2WLKA 2LVEA 5DFWH 1AC6A 3D12B 2EDEA 3JVFC 4YJZL 3CVHH 4Y88A 4DWHA 2GJ6D 1WFOA 2NQCA 1KGJA 4NZTL 5CEXB 3V79C 2VSMB 3PV6A 3QIWC 3MV01 1CFTA 2YPVL 4FQXB 4J2QA 1T5WA 4L4TB 5DA0B 3RG1C 3ZHFA 1KYOK 5DMKA 1JHLL 3GM0A 2ED7A 3O4OC 4PY7B 3NSJA 3IJ8A 1FA4A 4LBEA 1MIML 2X40A 3VFMA 3OKLA 3ZDXE 3D5OF 3OQ3B 4W9LC 4EE2A 1AO7B 4WI2A 1RVFL 1SDDA 1WFTA 3O6FC 1WD9A 2BSCA 1ZIBA 3Q5TA 4JG1H 4PRDA 2NXYD 4PV8A 4RETB 4U1JA 4ZPVB 5HI5D 3GEFA 4OM0H 5ACZA 2J20A 3UZEA 2VJXA 5I5JA 2DIEA 4PJFA 2X1QA 5T3XH 1EUTA 3H4HA 1GTFA 4JDEB 4G8FA 4Q4EA 2R56H 2FYVA 4Q9QL 3U2SA 3IDMA 3UO1L 3IFLL 3IMWA 4EUPA 4YAQA 4AL8C 3LZOA 3K6OA 4HEPG 1RZKL 4ACTA 1H3PL 2YGOA 1IGYA 1WCBA 3LPOA 1G6RA 1OGTB 2A83A 3MRQA 4I0PA 3CPLA 3WJLC 2VLME 4PIRF 5C0CA 5B4MD 5BJTB 1WIOA 1PEZA 2R39A 3L6FB 4N8VB 4TL5A 4X7TA 4CC4C 1SBBA 2WQVA 1XF4A 3NZ8A 3U9UB 1LO5A 3UO8B 3GMLA 5AAMA 4NWTH 2BCKA 4DCQA 1C5BL 1T66C 3Q06A 1EDQA 2HJLB 3GTVA 3EO0A 4TN9A 2HUHA 1INDH 3FT4B 2ADJA 3IDYC 4I18B 3QISA 4CUCA 5BVPL 1MLBA 1S8DB 5CSBA 5IHBA 2B08A 1FO0L 3K8MA 4K7PX 2WXNA 3US0A 2OM5A 3VGBA 4OFIA 2YAEA 1KBBA 5IEHB 3B2VH 1RJLA 2GCYB 4UF7C 4WTQA 4QCIA 3AT9A 4IDJH 4GT7A 1QFOA 4JPKL 3QIBD 5GS3A 2KPWA 5AWNL 2OJZH 5T5FH 5HYSG 2EYRB 2W80C 3D52A 4AXWB 1MN4A 4HV8B 2VR3A 3MV7E 5DJZA 2JK5A 5DRXB 4FNLH 4FERA 5D7JA 5A1AA 4QTFA 4F2MA 5DMGC 5EN2B 3KPRE 4YSUA 3GBLA 1ZANL 1VZGA 3OKEB 4JN2B 1XWVA 2CD0A 3ZTNL 3ABZA 3X11B 3LN5A 1WDAA 1A1MB 3KPNA 1IBDA 4N0UB 3EFOB 3G6AA 2XFXB 4MLSA 2EC9T 4WY7L 5TQ2H 5I28A 3K0YA 4DUVA 3UAFA 2H3XC 4EJ1C 4ODVH 2BIQA 1UM5H 3ALXA 1JPEA 5K9JH 5F71A 4P46C 3BAWA 5D7LB 4XN1A 2ARJA 5DC4B 3NG5A 3V4VL 3UBFA 1W0WB 2IQ9L 1ZLSH 5C2BL 3RA7H 1JF5A 3MLXH 3ARVA 2G2RA 4L0YA 3NPZB 3RDTD 3MLZL 3T2OA 2VCOA 1P6WA 3LIUA 3R4RA 4K23L 4X98A 1FYTB 4BZ1L 3A4AA 3S6CA 3ZZSA 1FLTX 2OP4L 3FQ2A 1N7ML 4Y2LA 4AGOA 1MCIA 4U6YB 2ZAIA 1O9WA 1C08B 2OQJB 5CGYC 1QBLH 5FW7A 1XZ0B 2VLRA 4J1UA 4XPBL 1A6ZA 3AQDA 2R0WH 4XR8C 2O6EA 1HFUA 4N8VG 1K6QH 3EBIA 1T03H 3TASA 1JNHB 1N26A 2F8OA 3UJIL 5CBEA 1I8UA 2X0UA 1ZLWH 1IGMH 4FG2A 3VNYA 5K1VA 1D5MB 3N06B 3B2DC 1Y6NR 2J6WA 4HS6A 4P9HC 3CVIL 3SODB 1RZIB 3QNYB 3Q3GB 1B9KA 2AJ3B 3WHE1 2YHGA 5FFOA 1IM3D 2PPEA 2X5PA 5K59F 1GPOL 2MPAH 2JJSA 4OFYD 1CG9A 2BVEA 1FSKC 1NGWA 2CO2A 1VSCA 4NQDD 4P23C 1HHGA 4OZHF 1PG7H 3RZCB 1ETZB 3EO1A 4FDWA 1CVRA 2W0FB 3FYEB 2AZAA 3IXTA 2P44B 4QR7A 2QZQA 4AJVA 2NRDA 2QEJA 3NGBC 1DVTA 2ALAA 5HVHC 1DEDA 1VAHA 2YC1B 1EO5A 3FRPB 1C8PA 2DTMH 5DQ9B 2FB4L 4ZX4A 2BNQD 1AXSA 3NIDF 3FQTB 2GT9B 3VXNA 3TV3L 5IFHL 5FXCH 1AMYA 1G1YA 3QI9D 3U7YH 1XH3B 2PUQT 1WA2X 2P26A 4RGNE 4YBLB 1HZKA 2J44A 3PNWA 4L9LC 2YMXL 5D5MF 5HHPB 3BD4A 4FXGB 4GQ9H 4LARH 1SYSA 4JFSA 1N3NB 1F58H 1TFPA 2BWQA 2DQDH 3SBWA 2IDFA 3CNKA 1FGNH 4KQ4L 1UHVA 3EF7A 3LKQA 4FA7B 5LNDA 3OC5A 4KKCC 1L9OA 3RURA 4M1GH 4QXGL 4R26H 3O3AB 1CYXA 3PUUA 3W9DA 4W9JC 3SDDB 3BQUB 3L1FA 4LDCA 4JHVA 3ZXAC 2ENQA 4M7LH 4CBZA 5CKAA 3SDCB 1RZKC 1QEWA 4S1QL 1YUKB 4Z7VA 1NCCL 2F54D 3ILPB 5JIIA 1NMAL 4DKDC 2Y06L 3VD3A 3LQZB 4F2EA 3DNKA 4K5NA 3WKNA 3GO1L 1XHHA 2FHFA 2NYYD 5GGVY 1MCRA 4KMQA 4YLBA 3DX3A 3MNZA 4XXWC 1BYPA 5T3ZL 1LD9B 3MV9E 4GQRA 2AQRA 3LD8C 3SOBH 3DV4B 3BH9B 1CLYL 1R5IB 1S9WA 1IGCH 3B9EA 1XZWA 4B95C 4X4ME 1OL0A 2WTRA 2ZWKA 1HH6A 3HS0A 3ZBMA 1ZS8A 2DLEA 4QIRA 4UBDD 4FFZH 1M9WA 4GMSL 4WU7B 4OI8A 3MXWH 5D1XD 4KY1L 1CB4A 2LFEA 2ZX7A 1BIHA 1NICA 3QS2A 5F44A 2GJ6A 1BGXL 4ODHL 4Y8DC 4D9QE 2ZF9A 4JJOA 4FG6D 1KB9J 2PPDA 1Y1UA 5L4IA 3EYQD 4P5TC 2D7PA 3WE6A 3BP6B 1YAZA 1FFTB 3TN0D 3AM8C 3DXAB 5DWUH 3C60B 2IV9A 5HYEA 3N1QC 4DNLA 3MRIB 4N90E 2VDNL 4PJHA 5E2TL 3VW3L 2X4RA 2XZQL 4OQTA 1IILE 1MSPA 5IW6B 3ARTA 4JE4B 1IUZA 3QULB 4OZ4A 3GLZA 4K4KA 4NQVB 5AYUH 4AT6B 4DAGL 5KSBE 2G60H 3V10A 4XAKD 4FL4B 1CICD 1MREH 12E8L 5E6ZA 4PRIB 2YSSB 4Q9RH 1QAWA 2AQ2A 2EDOA 3H8NA 1OD7A 1W9XA 4JMNA 2AITA 3WNLA 3RVXC 3PNRB 2VLJD 4PREB 4W6WB 3HNTL 3SQBB 4KFMA 4B3EA 1N19A 5DHDA 2ODIA 3BIKA 3L4UA 1MCKA 1E3XA 4LPTA 3RE0A 2AJYH 3O4LA 3CDYA 4JUTA 4QRSA 3GSWA 4PJAE 2WGNB 4FQQB 4P49A 3LIZH 4H1LA 2DYPB 2E7BA 3UZQB 5F72S 4AKPA 4RFNB 3VWJC 3UTQA 3ZIMA 3OMAB 4PWJA 1T7VA 1Q9LB 2NY0C 4HIQA 2EDJA 1UWGH 4E5XA 2FCBA 3MCLL 8FABB 3VI4F 4G43B 5GJSL 2KDYA 4Z78A 4N5ED 2YKKA 1QVOA 5IROC 5F1KC 4FMVA 3CC5A 3GBDA 1XEUA 5GJTH 4PFEA 1HHIA 4KY2A 2ZXWB 2VDRL 2FQEA 4JDTH 2OK0H 4B0MB 5CF3A 3ARWA 4IKNA 3PWVB 4OU3A 2CRZA 3QIBA 4ANVA 1DBMH 3BJ91 2Q7NA 1A14H 2AS5M 1WAPA 5G5DB 3WJMB 2VO5A 3FULA 4K71B 4LVEA 3EDJA 3ABKB 1G7IB 2PCPA 3ISRA 3SCMC 1TNNA 5I73C 1YEWA 3CK0L 4B97A 3NFSL 4QJ4B 5FYLD 3MBED 2VQUA 2VUYA 3P0VL 1AOHA 4OCMC 4G8IB 4HJ0D 4YDNA 4ZDHB 5BUGA 3WFEH 3UBGA 2OSWA 1X5JA 2VC2L 3EOAB 3RWFB 4U3SA 1BVNP 5IJBC 5KZCD 1S78C 4PJ9C 2Z91A 2VN6A 1RZGA 1NCWL 2NXZC 3ARZA 5JLZB 4HLEA 4PJDA 4PBVC 1HSAA 4U6VL 2DLFH 4MMXA 1MNUL 5A2KH 4OI7A 4MD4B 1GGIH 5SWQB 1I7RB 5AZEH 3ATDA 4YHIA 3AROA 3CLEL 1I8MB 1M7DB 5AW1B 3W56A 2OMYB 3WFHB 4EBQL 4N6RA 3NZUA 1QNIA 2NUTB 4HK3N 5TF1L 1HIMH 1EQWA 4YWGL 2FX8H 3JV6B 4PJCB 3RDTA 5BOJA 1YEGL 4RGMB 1WTLA 3BSGA 2RD0A 5HHNA 2COQA 1ORSA 1IL1A 1X44A 5JHDE 2VDPH 4NPYB 2P7TB 1J8HE 3S9DB 1J8SA 3HJEA 4EI6B 1U8HB 4Z0XB 4KHTL 1P4BH 3O11B 4RAHA 3MGAA 1IFGA 1XMEB 3JVGA 4CDGC 4N0CC 1JK8A 3TIDA 5IQLA 3IVKA 1TTAA 2HX9A 5GRYA 5FIEA 3C6SA 1UT2A 2R29H 3T2QA 4WNQA 1AACA 3EFDL 4UIKH 3OXSA 2ZG3A 3IAQA 3WTVA 2WXJA 4ODBD 4QRQA 5GS0L 1ZHKA 4CGUB 2GITA 3IJHB 5AKRA 4LIQL 3NRPA 1ZV9A 5FWQA 5JMRA 3QXAB 1IM3A 3CFKA 3GMOB 5F89A 4NCDA 2ZKHH 4GEJA 3V9CA 1FF5A 1OLLA 5I1DB 5JXEC 1FN4B 4OFYA 4N8CH 2Y0SA 1T2QL 4OLUL 5D1QE 4NQDA 3HI6H 3IGAA 4LCUB 3HN5A 4HX1B 5GRUL 5IJVA 3MRGB 3UTSE 4F7CA 5JO5A 1NKGA 1YJDL 2ZIDA 2XSKA 1G94A 4FNRA 1JFHA 1DQQA 2PWHA 5EU7E 5ITFA 1KB5H 1N8ZB 5IBLC 4M48H 4XP6L 3X1EA 2DDQH 4QJ5B 5CJOL 4OGAC 5I15H 3GSXB 5F0MB 1DQJA 4U1MB 1GZPA 4EIUA 3FF7A 5DJ8B 2FH8A 4G8GE 4PR5B 4P2RE 3GMPA 1QLEL 2VDOB 1PZAA 4G6JH 4OIAA 2GB2A 3EBAA 3ARBC 3QI9A 4NERA 5DYOA 4TVPH 4CNIA 5JDJA 1EZVX 1LGVA 4LFHG 4JY6A 2ICCA 3CVCA 4KO9A 1XQ4A 2IH1A 4RFOH 5DVMA 5F96H 3EH1A 3ZE1F 4NENA 4QOKA 2H2SD 4JE0A 2EH7H 1WBXB 2CK0L 3MRBB 1AP2A 3DJTA 5AG9A 2VQ4A 4AY0A 1MCOH 2QQNH 3QBTB 1I8AA 4XN8A 1QLFB 4QO1B 1XB3A 5EU7C 3T0WA 5KYUB 2O61A 2XPZA 4EIBA 1BVOA 3QJHB 1BZ9A 2A0LC 4K15A 2F54A 5MEOA 3DOSB 4Z3HA 2PXYB 3BISA 2CXKA 2QDWA 2DYRB 2WZPD 4BWUA 3VWKD 4ORZC 3W0WA 2YAQA 2HJKA 2UYLB 3Q1EA 2JCWA 4YHPA 5C0AD 2NW3B 3EGDA 1XGTA 5I0ZA 2X0VA 3H0TA 4PTUA 5LG6A 2BC4A 2PR9A 2B0SL 3ARYA 1KMGA 5HYFA 3PP4H 3GSNB 1N6QL 1NGXB 3BX7C 2H47C 3W39A 5CAYB 1M3JA 1RP9A 3IJSA 4Q89A 5I26A 3FTGB 3WFCL 4HWBA 4ZUTB 4S2SB 5K59E 2ORBL 1HNYA 1U95B 4Y19D 5D1XA 5GGRB 4HWNA 3MUGB 2EE2A 4JRFA 1MWAB 4A7VA 2AC0A 1QG3A 2H9GB 1X9RA 2IBZX 2KI6A 2YRPA 3CN1A 4P5KB 4ZFZA 1NUFA 4BA8A 3GPSA 4I4WA 3SZKC 1K2DB 3I9AA 3ZTEA 1VEMA 4QLRA 5LAXB 1J18A 3IK2A 3Q2LA 3TN0A 4Z7UA 1Q9WB 2M2DA 3QNZA 4WKZA 4WW2A 2F19L 2W60B 5TE4H 4K9JA 1E9QA 3NIDE 3KPMB 1KPUA 4CJ0A 3WIHL 2Z34A 2XKUA 4M8VA 5DWPA 4U4IA 1CICA 3U9WA 4MHHI 1S5IL 1ZVNA 3STLA 1S7VB 4IRZH 3L5XL 5D5ME 3NJVA 3GGWA 3DYOA 3DX1A 3POCA 3V0AC 5C0FA 4NO2A 3BT2L 4H8HA 2YPLE 4W70A 1ZXQA 4H8QA 5D2NA 4XPTH 4P3CH 3SJVE 4F58L 2VLJA 3IGUA 4LLQB 1EX0A 2CM6A 1B0WA 5E5MA 5K93A 1WSST 4LCCA 4MCZB 2BSRA 1KGXA 1BPLB 4G82A 4K9EL 1TCRA 3Q43A 4H4NA 1F6AA 2R51A 5D96B 4TSBL 2B3IA 4PRBB 3CU1A 1KYAA 1KXQE 2WINA 4BK5A 1TNMA 4ZK8A 2ENSA 3PQYD 4FULA 2YQBA 25C8H 3D8MA 3FT1A 2KMWA 3A4EA 5EUKA 5ANMA 3UACA 4ZW8A 5I5RA 2X53A 3ARGB 1QW8A 2UX6A 3UP1A 4I13B 2WWMD 3VU1A 4OVVA 4YPJA 4G7VL 2JIXD 3K4DA 1OXYA 3VXTB 1HZHH 1RZ8B 2IBGA 1D5ZB 3MMEB 4B9YA 1AC0A 2VITB 1A6TA 5GS0C 4KKLD 5FYJL 2C5DC 2LW3A 5I1AA 3C9NA 2UZXA 1W91A 2YN3A 3E2HB 3PWJA 4GKSA 4JY5H 1DJGA 3UAJD 4HS8H 5ISZD 4LO9A 4AK2A 3ZZQA 1JK9A 2V5YA 3DGDA 4JM2A 4PCKA 3WJJA 2GY5A 1QO3A 4W9EC 3MBEA 4A2LA 1AIZA 4UQ2B 2GIMA 1CUOA 2AQTA 4G72B 4UM8B 4GUPA 2AK4B 4F1SA 2XG4B 3BKJL 2FWOA 2JI3A 3OAYH 4CSPA 1JDCA 1LVEA 2PR4H 1UQSA 3MRNA 4HPYL 5TFSL 3VFWA 3B8SA 3B1UA 3BE1H 4MJHA 2NY3D 3VTAA 2P42B 3G6JA 3KPOB 3D2UA 5SX5K 4POYA 2X38A 5HGHA 5B3NA 2R0KH 3W5MA 1XX9C 3NA9H 4YZFF 1ZT1B 1L7IH 4HOZA 3PV6B 2VRAA 4LSQL 5T1JA 1CFTB 1J0IA 1RZPA 1T5WB 4HU8A 2VB5A 4ZXBA 5I16B 1KCRH 3CMGA 1NKOA 2CUIA 3I6SA 4XC1L 3WY1A 4GUCA 4J8RB 3D4GA 4LZKA 4PCYA 4OLZH 4PV1C 5FA3A 2IG2H 4J27A 1LL1A 3L3HB 5K69A 5TE7H 4PJ7A 2AABH 2BMKA 4LBEB 3VFMB 3JV0A 1NGZA 2CR3A 3OKLB 3NQIA 3FCGA 3UCQA 4IOIB 3ML9A 4FQ1H 1JRHL 4PVLA 3GXNA 2MNUA 3IFPA 1YCSA 1SDDB 4TSCL 4PV8B 5LB1A 4AUUA 2QQKL 2EIKB 4U1JB 1LO4H 1H8SA 5GHWH 2CCVA 3L9BA 4G8FB 3T5WA 1Z3GL 3N91A 4TS6A 5HD8D 3U4EA 3EJZC 3VI4E 5F7AA 3U2SB 2IAMC 2OMZA 2PP8A 3IDMB 3KPSB 2FLRT 4EUPB 3NABH 3MLWL 3PWNA 1LP9A 5C09E 4XP1L 1L3WA 3Q2NA 1IGYB 4I0PB 1G6RB 2A83B 2VE6A 4ZMLA 5I76A 3CPLB 1YEIL 4GLRI 4JMXA 5C0CB 5MHSD 5AAWA 4AQEA 3ZR5A 3ETSA 5KBPA 4X7TB 7FABL 1XF4B 5IREA 5TDNA 3P4MB 3GMLB 2X4QA 4O9HL 2BCKB 5IUSA 3I9GH 1G87A 3EO0B 2AJUL 3UABA 3P4NA 1AGBA 4HQQH 4DN4H 3R7RA 2ADJB 2JKRM 4E9YA 1EH9A 2X6MA 2WBJD 3D85A 4E41E 4ZUSA 1MLBB 4PV9B 3SKJL 2J1YA 4LNRA 3LHPL 1RULL 5EOCH 1IZJA 4R83A 1RJLB 3TT1H 5IV2B 3C2AL 2VXUL 4QCIB 2OULB 1INQB 2CALA 1SJXA 5FGCB 1KCBA 5CBAA 1PIFA 2W0PA 5CZXC 3ZL4L 5DEJA 2WLMA 3P40A 3AITA 5AVUB 1AO7E 5DJZB 3WUZA 2E27L 1TZGH 5D7JB 5CSZB 4F2MB 2IGLA 4UNIA 4MJID 2R4RL 3GKWL 5EIVA 4NP4H 1EPFA 3T3MF 3I3EA 4P5MB 3OX8A 4PJIB 3KPNB 2QGBA 3VXOB 2JVUA 1WWCA 3EZJB 5C6TH 2XBTA 4YSCA 1PU0A 4DN3H 4PWGA 5KS9F 4AM0B 4ZYKA 1YQVL 4FQXC 4XNUL 4Y1AD 3E3QE 4K9EC 3GZKA 2WZPA 1WTGT 4MVBC 3VWKA 2K78A 5D72H 2OZ4H 4EDXA 4YBQC 4XCFL 5D4HA 5C0AA 4GQQA 2OV0A 3IDJA 4KC3B 2W65A 3HVDA 1TO5A 3KHOA 5DC2A 1G43A 1DQDH 1TEYA 3ES6A 4L4VE 4MGXA 5IVOA 4G83A 4KX7A 3CFNA 4Z7WF 1EFXB 2G0KA 2VXQA 1HEHC 1RZ7H 1F1DA 3O81A 3DRQA 2D03L 1JPSL 3BD5A 1RPQA 1RXLA 3UTTE 5ICUA 4IJ3B 4EUPG 5J6GA 1BQ5A 4GH7B 2DQGL 3OB0K 4B5EA 1ID2A 5AW0B 4Y19A 4MXQC 5FFLA 1UT9A 2IALA 1QPXA 3NP4A 3MO1B 2VLRB 2D31A 2ZOWA 3CDFA 3GUFA 4J1UB 4TUOB 5E6YA 5BRZD 3FKUS 1CURA 4DQOL 4GT0A 4DKEL 3BKMH 3CBRA 5IOPA 1OP3H 2EO1A 1DJXA 4NZ8A 4YEEA 1L4IA 2R0ZL 4Z3GA 1R0AL 1T6VN 5LCVL 4EPSA 3AC0A 4JPIB 5GZOC 1XH0A 1GGYA 1RU9L 4N85A 1NFKA 1U4FA 1OAXH 2QPUA 5IKCA 4F91B 4UV7H 4I18C 3LRSA 3TBWA 1VA9A 5L4FA 5I6PA 4YHYB 5J11C 1CG9B 4NP9A 5DQJA 1NGWB 4ONOA 1PG7X 1S3RA 4JDVA 2FHBA 1HHGB 5CCKL 5KYYA 2GIYA 4L3EB 2FJGB 4LOVA 1XBRA 3CN4A 3EO1B 5C2BH 2XWCA 4XCCL 1AKPA 5FGBA 3B6SA 3IXTB 3LRKA 2WKOF 4QAMB 1E40A 3TO4D 3ZE1E 4MNQE 3WS3A 4XNDA 3MLZH 2YBRA 5JOFA 2DICA 3D05A 1NKRA 5DS8A 5E9AA 1K72A 1F90L 4ZX6A 4R7VA 5JOEA 3DGGA 1BX2A 2W59A 4AH2A 1DUYA 2CHWA 1KN4L 2HX8A 5AAPA 3D39D 3VXNB 4K94H 3TYFA 3E0GA 1AD9B 1CL7L 2ZTBA 3MRMA 3PQYA 2X3BA 3FTSA 3H9SD 3VE0A 4QTHA 3PNWB 3RNKB 4UQDA 3LKPA 4Q52A 3ZMNA 3L7EB 5EZIH 3KR3L 3UJIH 4CW1B 2XY2A 3CFBA 4YDIL 4DJMA 3LKOB 3D87B 5EFIA 4FJYA 4JLRA 4XI5C 2ATKA 2KC0A 2WGXA 3LKQB 2CU9A 4NPKA 1TU2A 4TNWF 1NCAH 2JIXA 2YK1L 4P2AA 1W0VA 4I77L 3LTVA 5CNHA 3WSQH 2HH0H 4Z7VB 5EOCJ 1M53A 4NO3A 3UAJA 4ELKA 2R1YA 4BFKA 5EEUA 4AIEA 3SE4C 4DW2L 1FORH 5ISZA 1HWHB 5LKNA 2EZ0C 4JCLA 4CSZA 3WGUB 4JFEE 2KZKA 1FIGL 1PZUB 4BFNA 1DO6A 5KBLA 4DGYL 2H1PL 1EUUA 1B90A 4I8DA 2X4NA 3K91A 4JG0L 3AQXA 4KKAC 2RGSA 3MNZB 4BRVA 1AHKA 2IWGA 3GQFA 5EBWA 2I69A 4HIIA 4NUPA 3D0AA 1QSZA 1NC4D 2QGEA 5J1AA 2XQ0A 3T0EB 3MUY1 4B41A 3G5VA 1S9WB 5KN5A 3IMSA 1E9OB 3ZZ1A 1HH6B 1SXBA 1QSEE 1CZ8L 2HCZX 3TV3H 1XD0A 4WK2B 1YMME 1AQ8A 2H2PD 1R3HA 3KYMA 4TPRL 5E6IB 2J6EA 1CD8A 4JGMA 2YMXH 5CO1A 5JYLA 2OSXA 4YSSA 2P5ED 3VXUB 5IHZA 1BAFH 1ERNA 1NEPA 4FFTA 3OKMA 1SHSA 4K8RH 3WE6B 3D18B 2KZBA 4XXDA 3EF4A 1UOVA 1WFJA 1A7OL 1AQDA 1N8OE 3PJSB 4XHQA 4JFZL 3WS6A 1CYWA 2E59A 4JO3L 1JTOA 3ZTCC 3RZCC 4Z3JA 2Y7QA 4PYGA 1GSKA 3CLFL 5JZ7C 4OZ4B 4UDUA 1J1PL 3CIAA 4G9FE 4FF9A 4M5SA 1VESA 2V17L 4HK3J 4WFFE 3TXAA 1SLWA 1WZKA 5DUMH 5DZJA 2VSKB 2H32A 1D7BA 2J72A 3ZYIA 5L9DH 1EXUB 4BA0A 3ZO0A 3LQAL 3OKOA 2SODB 2IQAA 2RCSL 1DQML 1WHOA 2WXIA 3OKDA 5T3ZH 1CGSL 1NANI 1M05B 2YD5A 3B9KC 4RMWA 3VXSE 2OSLA 1B2WH 1S9YB 2DJMA 3JT2A 1DSWA 3RL1B 4BFIB 5B8CB 3BIKB 2H26B 1MCNA 2XVBA 3O4LB 3L9RA 2V7HA 4FXGC 2ZUTA 2HFEA 5BS0E 3GSWB 4KXZH 3N85H 4G5ZL 4WDIA 3FTXA 3OG6B 3OHXB 4H1LB 4Z77A 1CBVL 1EXHA 4N24A 1KDJA 3UTQB 3FRUA 3GXPA 5E94A 2DQHL 4JHAL 1CI5A 4R5VA 3SDDC 3BQUC 5FCSH 2WBJA 1PLGH 3BFOA 1V3JA 3LXUX 4G7SB 3SDCC 3GJFA 5IFAL 4HC1L 1GJIA 3HJ0A 1JP5A 4S0TD 3I3DA 3CC5B 3S8FB 1RMFL 4EXKA 1FUNA 5JUEL 5FB8B 3PWPE 1Q90A 3LEYH 3V0HA 3HHRB 2AXFA 3QIBB 1XVSA 1SFHA 2PWGA 5TF0A 3PIQB 3WNMA 4K2UH 4P2QA 1DR9A 1N59A 5TPWH 2PCPB 2YEZA 3MLSH 4M02A 4UNUA 5EBGA 1M2VA 4YZFE 4MJIA 5I30H 1U8NA 2GC7C 1R17A 3N44F 4NKOA 5CSGA 4G6MH 1JYXA 5EEWA 3MRRA 2OJ1A 1V5JA 3HR6A 3DO7A 1X6NA 4RESB 4N1CA 4U3SB 1MPAL 1SXAA 4XNQA 2C1PA 2Z91B 4DO5A 4S1RL 1ZTXH 4XNYH 1TTUA 4BSWA 4UTAA 3TVMD 4PJDB 1GOHA 2CPUA 1HSAB 4U49A 4UMGA 3U36B 4H8WL 4ZTOH 5KTEL 5ABDE 3IF1B 1IARB 4CDHA 5CEZD 4ZMTA 5EC1A 1FZOB 1A9EB 1EEZA 5FV2A 2NQDA 2NY6D 3C60C 4LLUA 1BF5A 1S9XA 4H2AA 4LEBA 4Z0BL 1OSPH 4PJFF 1HCYA 1FNEA 3T9WA 5JIMA 1RV6X 4LCYA 5D4JA 3DLQR 2AK1L 1R5VA 3GF8A 4H0GA 4WGKA 1SUHA 1YNTB 5KBMA 1TZHB 1VFMA 2NX5E 2ED9A 2YQ2A 5AW7B 5HHNB 4FL4C 1ORSB 3CVHA 1I9IL 3QPXL 3HZVA 3LNDA 4FZ8L 1PQZB 4DGUA 4IKLA 4KROD 4M7LT 3JWDC 3O6LH 4I0KA 2X44D 1JPTH 1BFVH 1EAPA 3NBNA 1VHPA 1P4LA 3W38A 1E8WA 1JK8B 4E36A 4G6AC 4MX7A 5BRZA 1YN7A 4JKMA 3IVKB 4HCRH 3ULVL 1OK0A 3HS8A 4U4BA 3C6SB 3FTWA 4H1LG 1JGDA 1OARH 1QI3A 1YEFL 3TWCL 4WNQB 3LSOA 4MRBA 3LXCA 3QR0A 1IT9H 1R3LA 2C7FA 1F8TH 4QRQB 4RFNC 5DLMH 1ZHKB 3DV6B 2ATPB 3CFEA 1WEJL 2E74C 3MR9A 4NGHH 3KLHD 4UQCA 5EU6D 3QUGA 5HPMA 1GIGH 4Y4FD 3KEHA 5F89B 1Y6KR 5DO2C 3TIEA 2VR6A 4ADGA 1MNUH 2L7QA 3OV6A 2X4TB 1T20A 3VGGA 4Y5YA 4N2MA 4X5LA 1I8KA 2VUOA 2DQCL 3QT2A 4HKXA 2FEJA 4NKIH 5JO5B 4EBQH 4PGEB 5F7DA 1RK7A 1GRWA 1TQSA 2ZKXA 4G6FD 4Y16B 4G7YL 5LAPA 5C71A 3QZNA 3HMXA 3L3OA 2ZOOA 4GIOA 4HUMB 5EOQL 3T3ME 3TO4A 2D0FA 1MWAL 3CE1A 2VLKD 4DVBA 1GXEA 2K9FB 4IRJD 2WXPA 2XZCL 5GS1A 4XMUA 4K71C 1OCOB 2BVPA 5KS9E 3QEQE 3HFMH 4BFFA 1K8IA 1C1EL 2XHNA 5I1EH 1BA9A 3D39A 3VGHA 1PLAA 5DRNB 3E1F1 1R19A 1GKOA 4EKXA 5I1KH 4O51A 1U8PA 1MCJA 2G2PA 1ET5A 3J27A 1A7PH 1F3RB 2Y22A 3H9SA 1D2PA 2PN5A 4JY6B 4PLJD 2Z4QA 4APXA 2R9HD 3ELAT 4AC2A 5FKAA 1BEYH 3JV5A 3MV8E 3RY6C 5MP6L 2HN7A 2IH1B 4PJ6A 5HJDA 3OAZK 4NENB 3RNQB 3F65A 4QOKB 4JX0A 3F12A 5HHOD 2A4CA 2R7EA 2C26A 1AP2B 4Z7WE 3LV3A 4J4PD 3RVTC 4XBEH 4MNGE 4EZLA 1G0XA 3H6AA 5AB1A 2O61B 2ZXEB 5I18L 4RA3A 1X5XA 1VKXB 3M8OH 5I19L 4FQ2L 3I6GA 4XMXA 1BOGB 1VEOA 4X7EC 5IG7B 1FE8H 8PAZA 5J57B 4RGMC 3OMNB 3R8BB 3W0WB 1X3DA 1PVHA 2VIRA 1SJVA 1ZXKA 3CMOL 4GRWB 2ADYA 2UUDH 4XNXH 1R24A 3C8DA 5AB2A 1EA9C 4YHPB 3EGDB 1MNNA 5B1AB 2PP9A 2P5WD 3H0TB 5IQ7H 2NY5L 4PTUB 3H9HB 2ATAA 2AV1A 3N6YA 5DVPA 2BNUA 3HBZA 4XO9A 3RTQA 1NC4A 2E5EA 3L13A 3QSKB 5KBNC 3D4YA 1UA6L 4QY8A 2LLLA 3IDUA 3ECVA 3QUZA 3WL9A 3MLTB 3W39B 1E5CA 1NTDA 1LMKA 3TH4T 4U1NA 1KGCE 5AOLA 4K7PY 5HGDA 1QI4A 2QHRH 2HUEA 5IGXH 3CVDA 3FAWA 5TE6L 5B3JF 3GI8L 1U8JA 4MZ3A 2DI9A 4XMKL 3GK8L 5AOKA 1WICA 2VERA 2DD8L 1DBAL 2BRQA 1G84A 1D5IH 1KFAL 3ZT5A 4JL2A 5E2VL 4JQXC 3TH3T 4PVMA 2P5EA 4ZFZB 2DM4A 1SYVA 3LN4B 1JE6A 2AJVH 3IFOA 1DDTA 2CCWA 2WJ7A 2VL4A 4N0YL 1LWJA 5I74B 1H3TA 3SY0A 2XQYA 4ES8A 4Z7UB 1U8OA 4HEMA 2HRHA 2Y5EA 4TRPH 3QNZB 4WKZB 1VGKA 2X87A 2K9UA 4WW2B 3S35H 2AAVA 4TNVF 4XMPL 4HZLA 1WGVA 1E4KC 1E9QB 1T83C 4NJAL 2XTJB 4HIHA 1OSYA 4XPAH 5AG8A 5EF2A 3BFQG 2NQ3A 3FB7B 5KYWA 5GIRA 1CICB 1NSNH 3IMBA 4X50A 4H8WC 3U0TA 1ZLUK 3ZDZF 2ITEA 4LL1A 5J9PA 1AVAA 2YGPA 1IGIH 3GGWB 4I48B 5C0FB 1ASQA 5DUPL 4IK6A 1JGEA 4YSQA 3QDGD 1TQWA 5D2NB 2BIMA 1UD2A 2C3XA 2VLJB 1N6QH 5E5MB 1TTFA 4M5YH 1WYJA 4LCCB 3U30C 1EHAA 2BSRB 4DVRL 1G5GA 3N40P 4GAGH 3TF7C 3A6CH 1UKTA 1QBAA 2EDBA 3V5HB 3QR1A 3ZPDA 3IXAB 4BM7A 3FTYA 4G80A 2FZ3B 2XZAL 4JM0A 4FQLL 4IIQA 2CSPA 1SEBA 2ICWJ 2C1OA 3KDMB 4LSVL 3VA6A 5HYQA 3FUDA 32C2B 2VGLM 4NEHB 2ZCLH 3B1TA 3D51A 3BGAA 5BMFH 2HTKC 1IBFA 5E99L 1UENA 4FTDA 4QT5B 3TBTA 2NZ9C 3MODH 1KXVA 4FHBD 2QPSA 3ULVC 3SE9H 1OSEA 2PXYC 1QSFD 4FNQA 4AENB 2E9IA 3K3QA 1LWRA 5DU7A 1DE4A 1DQIA 3GHEL 1A6TB 3RL2A 2DZEA 3X3FH 3QNFA 2UZIL 2ISDA 2UZXB 1Y07A 2Y9RT 4GKSB 3HOGA 2FECL 1G6RL 4QJ3B 4XPFH 3SBPA 4YHZL 1YECL 4OZGF 1JK9B 2EE3A 4JM2B 2ZYHA 1OAUL 3OSVA 3QG7L 4UYQA 3H3PH 5L8KB 4WQOA 4NHCH 1AXIB 1TJXA 3PL6D 3HEIB 3IPBA 4GUPB 5KZCB 3I50H 3WHXA 3CSYA 1NINA 2DQEH 4D9RE 1THCA 3T3PF 1Q0XL 1EHLL 1L7TL 4HCGA 4PJHF 3TVMA 1UQSB 2H7WA 3MRNB 5A16B 3VFWB 1LEIA 1O6VA 1BD2E 3P4OA 2EVJA 5F3BB 3N0PB 4YXKH 1IKFL 1NCDL 3D2UB 3AU1A 1S7UB 3I74A 4YSDA 3LH2H 4BQCA 2UXFA 5E4EB 1M3IA 2D3NA 4HJTA 3L16A 5F2FA 5CN3A 1PNCA 5E8EB 1NCIA 4FFZA 4YHNA 4YUEL 2LLNA 4ZXBB 2YOCA 1GCYA 4KK6D 1TQTA 3KLDA 3DC0A 3BT0A 5CD3B 4I3RH 4GSDH 1O9VA 3LZQA 4UZSA 1Q38A 3G5ZA 3MZGB 4XVJH 1CXHA 2BMKB 3MRJB 4OLXL 3FU0A 4B9JA 1NGZB 2EEFA 4B9GA 1JFQL 1N64H 4K3JL 2G4EA 3IFPB 4MMZC 3DWTA 3K1DA 4GAJH 4J3OG 4HG4J 2CDFA 43C9A 4Z5RA 4D0CA 4F8LA 3O6FD 2IMMA 4ZOAA 2YMTA 4DP0X 1KGIA 5EIIA 4P59H 5D96C 3BGFB 3U4EB 3D3VD 4XPGL 1JV2B 4LHUD 1HH9A 2QSVA 3VD7A 3WKYA 1AR1C 1JHKH 1LP9B 3L5HA 2NY5C 1WAAF 1WFUA 4XNAA 3V0EA 2VE6B 5I76B 5EU6A 4MDJA 1BOYA 4LKCA 3T09A 4Y4FA 4AQEB 3FFCB 4LE8A 1Z9LA 4OCRH 2GYSA 2X4QB 5HDQH 5TDNB 1WT5A 1FG2A 1HILA 1SQMA 3P30H 1E5ZA 2K6YA 2D4DA 3OZKA 3FU5A 3D85B 1T66D 5IESH 5IB2A 3LIZA 2A38A 5ALBH 1U8CA 3KPLA 5BZDA 3ENEA 3E2HC 3IGKA 4XODA 1V3MA 4XAWH 4IRJA 3UROR 1U0QA 4BUHA 1OK8A 4CVXA 3RPBA 2H6OA 2VDQH 3L1EA 5AVQB 1P7KA 5CBAB 4PJDF 4FTVB 2QTEA 2VKWA 5EO0A 4JZNA 5FK9A 5DQDH 1J5OH 5T1LB 3QJVB 2DMHA 5FW6A 1BWMA 1NAKH 4QTIL 5DJAA 3ABLB 4YLCA 3LKNA 5DMYA 2ZNWA 2PLTA 1YN6B 2EP6A 3CG8A 4K5PA 5F6IB 4U1KB 4PJFE 3FOLB 3UYRL 3OX8B 2YUXA 5IMLB 5L2KD 5HHOA 4HKZB 5PCYA 4DGVH 4J4PA 1MQ8A 1KIRA 1BBJB 3NH7L 4LP5A 3RVUC 2YRBA 3MX0A 3O45B 2EINB 3HLAA 5CCGE 4XGZA 4ZYKB 3K0WA 3ZX1A 1K5WA 1A6WH 4GW1A 1IB5A 4RISL 5JNYA 3BSZL 1WFMA 2BW4A 1MRCL 1OT4A 1ZV5A 3DROA 2VR5A 4ONGH 5I6KA 4J3XA 1BVZA 2AJUH 5F21B 1J87A 4EDXB 1YZZA 2O5ZL 4FOMA 4HK0B 1MI5B 3NJNA 4XT1C 4NCC2 3WLBA 3VXRB 4EN2A 1QFUH 2W65B 4AVKA 2P5WA 3CDZA 1BAGA 5B3SB 2I9TA 1HHJA 1AKJD 3ES6B 3IMUA 1NIBA 1OGAE 4HF5L 3L3IA 1SPDA 3E7JA 1KTLA 5IB5A 5SWSB 5KG9A 1MY5A 1IQWL 3Q8FA 5J6GB 4JRYA 4I2XA 3NSDA 1IAMA 4GG8B 5F7EH 3CFTA 1AR2A 5CUSL 1WBZA 4Y19B 4B9PA 2EDXA 5B39A 2D31B 1ADQH 1TENA 2Q8BH 3B7UX 1V7MH 5CGYD 3IKCA 4I0PC 4XN2A 2OCFD 3BRGC 2HLAA 4YXLL 2RB8A 5IOPB 3CXDL 1UD8A 4RRPG 4Q6KA 1MHCA 1RK1B 5AAMC 1A2YA 3II1A 4PP2B 2ILLA 5DEGA 1LWHA 1X7SA 3B2UC 3LRSB 2FX9H 1YQ2A 3GBMH 3MZTA 3TBWB 1OT1A 2R29A 3K2MC 4KNUA 3J7HA 1KUMA 1NA8A 4S1SL 5KEZA 2CRYA 2DOCA 3MA9H 3QQ9C 3QVAA 4XP9L 4GP5B 3MUJA 5DQJB 1O5PA 3P73B 3GRBA 4JDVB 5SWZD 1R3IL 1TJIL 4NQXB 1KULA 4UMSA 2IFGA 1CQYA 1T89A 3RRQA 2XKSA 4UNTA 4MS8C 5C1MB 3BPOC 3KPPA 3B6SB 1CU4L 1FZKB 3QDGA 4IOSD 3BZ4A 3HHMA 2VYRE 5JOFB 2B2XL 4PD4K 4QWWC 5IW1A 4MB5A 3H56A 2LR4A 3DGGB 3LZRA 1EZLA 1W72A 3BW9A 4ZO7A 5D7JC 3PREA 2IF7A 2XG5A 1Q0YL 3SHSA 1KB5A 3U7WL 3UBXI 2DF3A 3TYFB 4WEUD 2VL5A 1E6JH 1CF8L 1L0QA 2COVD 3PQYB 3I2CL 4OQTL 4RMQA 2LABA 3PV7A 4QTHB 2PTTA 3VE0B 3NIGF 1BXAA 3BP7B 3QRGL 4WV1A 2EE6A 2G3NA 3CBKB 3WELA 2MCG1 2ICWI 1TVHA 3CFBB 2VZUA 1HSBA 4P57A 2WSDA 4KHXH 4FXTA 2H4EA 4J6RH 4FI8A 4PUBL 4JM4L 3B5HA 3SO3B 1XMWA 4PJBF 4YEFA 5CILL 4FFYL 1H8NA 4H5SA 1GYWA 2H8PB 1BWWA 3DPBA 3EYVB 1W0VB 2NUPA 2FE0A 3QUXB 4KKCD 4UOW1 3CLWA 4AG4H 3TV8A 4X7CC 1GGBH 4HHGA 5DJXA 4CGTA 5B3JE 4NO3B 4M6OL 4OLVL 5JR1H 1KCUH 1NBCA 1OANA 2BZ7A 3MACH 7PAZA 2G5UA 4A04A 3GSRA 1UACH 3R18A 2YD9A 4U7MA 5FO7A 1IEAB 4F8QA 3K1KC 4I1RA 3A5VA 3LNHA 4MJ5A 2KERA 4NQCD 3H54A 1LTXA 3MUUA 1JCKA 4KH2A 2F53A 4IJ3C 2APBA 4WIQA 5EBWB 4FYSA 2QGCA 4HIIB 5J1AB 4FHJA 3C5SB 4GP8B 2FJHB 3G5VB 1Z1WA 4GPVA 4O4YL 5KN5B 1DL7H 4IBYA 5DI8B 2VDKB 4WW2F 2EUVA 2ZUQC 3OAUH 1KN4H 1SXNA 3L4CA 4X5WB 2FIKA 3N55A 2ADGA 4WFHD 3ZE0E 4WWPA 4WHYG 3KJ6H 2A9NH 3KYMB 1UJ3B 2FO8A 1DCEA 5IHLB 1F4AA 2EIDA 3LNIA 3T65A 3ZDZE 1H3VA 1KWGA 5IHZB 1A3LL 1FZMA 1P84K 3QB7C 1PBYA 2JJSC 1V3KA 3HG2A 4YHYC 1ITCA 5FYKL 1AQDB 3S96B 1E65A 1UZGA 4F9LA 1AJ7H 2ZKMX 3BAKA 5FKPA 4ZS6C 3UGEA 2WLIA 1CGUA 2Y7QB 2BWDA 5I1JL 3UPRA 2GK2A 1AS6A 4UDUB 3OWEA 2WHVA 4HWUA 1IGTA 4P5SA 4JCWA 3SBRA 2J5LB 2H32B 5EF3A 1FIGH 4Z18A 3O6FA 3SPHA 5C0GA 3F84A 4PG9B 3OKOB 2Z0BA 1CQKA 2IQAB 3OKDB 2HG0A 3D3VA 4UT6L 3MGOA 4LHUA 4EMZA 1RUPL 4UQ3A 4EZJA 4N9GA 1M2OA 3UDWA 3RWDB 3KBPA 4RVBA 4G8EA 4RA0C 1DFBH 4EI5B 1VFAA 1RSFA 2IPTL 3BFWA 1VENA 5FW8A 4WDIB 4XB8A 5DFVC 4XZUA 4XHJC 4TPRH 4HPOL 2F08A 4NYLB 5E94B 4JFPB 4GXUN 4OZGE 1EEQA 1FH2A 2GJ6E 4R4FH 3HG1E 1KJ2B 2XV6B 5I8CA 4KTEH 1D2OA 1Z5YD 2CJUH 3GJFB 2NY0D 3FPXA 2R2CA 3BLKA 5CR1A 4HUNB 4XNBA 5D7SH 5HDBB 1XGQB 1XCQB 1GYCA 2IBZY 3T3PE 4DKAA 5IROD 2WIMA 4GKNA 1TETL 4PJHE 2BOCA 3S3PA 4LSSH 2HWZL 3VG0L 3D30A 4LRNL 3ZHKA 1M7XA 1YYML 3W2DL 1BFTA 7TAAA 4P2QB 1R47A 3G6JF 3T0EC 1N59B 3LPGA 2VWEC 3P3YA 1M2VB 2NNAB 3PGFH 4PSPA 4NKOB 2XZZA 3MRRB 3SCMD 5L2KA 3UJJH 3OTTA 2G5BA 3CDCA 2WB7A 3F7QA 5LBSH 1F6FB 3GMRB 3M7OA 1CLOL 4BKSC 4PJ7F 1WFIA 2EE0A 5L8LB 3FQ1A 2AXGA 2BWIA 3H7BA 4M9PA 4PJ9D 3O6ML 4L18A 1FNLA 2V3EA 4X6CA 5EC1B 2D4FA 4XWGL 3OQRA 1RUAL 4M3HA 1EEZB 5B1JA 4LLUB 4A7TA 1S9XB 1XF2A 3HZMA 4LASH 5KVEE 1M6UA 4LCYB 4WCYL 2QADD 4JZJB 4XRCA 2YAMA 1A7QH 3CVHB 1WAAE 1KY7A 4BWWA 2XX0A 1PGRB 4YHLH 2CHNA 3BI9X 3V4PH 1NPNA 4DF9A 2F5AL 5KOVC 3U0PA 1EAPB 1C5CH 3LAFA 4R90L 1JG9A 5AOJA 2IGFL 1T2XA 1P4LB 3SYAA 3QXTA 2PPCA 1GYAA 1RHFA 3A0OA 4MX7B 3HNVL 3KZ8A 3GRWA 1Z2KA 3HRZA 4GAYB 3SN6N 1U8LA 3TBVB 2B4CL 1JGDB 3E6FA 5B4MC 3LSOB 2QMJA 1BLIA 2P52A 3OPUA 1MCDA 2XBDA 3OHXC 1CDYA 4LT7A 2QJDA 1HHHA 1A4KB 1ZKAA 1JL8A 3FU7A 1PTZA 3MR9B 3F01A 4XN4A 5HPMB 2OMWB 3AAZA 3TIEB 3HI5H 4LDLB 2NT0A 3P9MA 3KL0A 5T3ZD 3QZOA 1CI3M 4Y5YB 1S5HB 1I8KB 3ISYA 2JKIS 5B7FA 5EEVA 4HKXB 2VDOH 4N0RA 3PS6A 4HWBL 4OD2A 5JXED 3H2PA 4UZGA 4UT7L 5ENWA 4X83A 5J4MA 1IM9D 1ZJBA 3L3OB 4RH4A 3QIBC 4IOSA 4AQAB 4OGQC 1LE5A 1SEQL 3GLAA 4A2FA 4DVBB 1FHGA 4M03A 2OMXA 1T0NB 1I7ZA 5IBLD 5GS1B 1ZPLA 1WP6A 2GC4C 4HIJA 1NLBL 1K8IB 5C3TA 2G75A 4XE5B 2OX5A 5MENA 2GQHA 5DJCA 2BVOA 4O51B 3KVQA 4YBHA 1U8PB 2I60H 5LVEA 4HZAA 3N5AA 5KJRH 4LLVB 1BFOA 3REVA 3UIZA 2HN7B 5LGHH 1S7TA 4L9LA 4HG4K 2BDNL 3ETTA 4MMXC 3F12B 4HVBA 1V10A 4DIXA 2WNWA 1L0YA 4YNYA 2R7EB 4YGAB 4UM9D 2XJKA 4PB0L 2C8NA 3BZEB 3S37H 1IGFH 1E8XA 3Q6FB 2IO5A 5DHXB 3GHBL 3NP3A 3SE8L 1KJ3L 2WXLA 3GSNH 2BXZA 4JRXA 2XVGA 1F1GA 2DL9A 1E27A 2F1EA 2FX7H 3LVEA 3WXVL 2BY2A 3G7TA 1PDKA 4WTZA 4GOSA 3TNMA 2A0LD 4F7KA 2VIRB 5HVWA 5KBDA 2I07A 1LK3L 4NQDE 1ZHNA 1R24B 2OR8A 4E9TA 2IOOA 1B2YA 4NQCA 5DD5H 4L1DA 2I9LA 4YHOL 3QPKA 5EOQH 1JZ4A 5E08L 2AV1B 3BPLB 3GTTA 2BNUB 5C0BB 3MN8A 1Q9KA 1JCVA 3RTQB 4CU7A 1NC4B 1HI6A 2QSCH