3UIZA

Crystal structure of sefd_dsca in d2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
133
Chain Sequence
b'LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIVGNKAVVQAAVTIAAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
total genus 20
structure length 133
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uizA00
2CNYA 2FVNA 2CO6A 2CO1A 2AXWA 2CO7A 2CO3A 5D55A 2CO2A 4PHXA 3UIZA 2CO4A 4OR1A 2CNZA 2IXQA 3UIYA
chains in the Genus database with same CATH superfamily
1NWPA 4UT9L 3UYRL 5ADOH 1JI1A 4WRLA 3VXTA 1KTCA 1DJIA 4IOSA 4PJGA 2VQTA 5GGTL 1RMFL 2J2ZB 3PU7A 4JFEA 4IEFA 5C97A 3QQ9C 2CBPA 3MLUH 3B1TA 4OZGE 3ZW3A 5MERA 1Q0YL 1UXSB 1BQHA 3NCYP 5E6IC 1EHXA 3RDTD 1NMBH 3LN9A 4G6ML 4NKDB 2W0FB 3CUPB 2FEDC 2BNQB 2XPGB 4DCQB 1HEHC 2ITDA 3EO0B 3HFFA 4M8QB 5D7LA 1UWGL 3O2WL 2J3SA 1QASA 3U4AA 1MLCA 1T22B 4LCWA 4RSYA 1CGYA 3BZDA 2G2PA 2J1ZA 4ISVB 3WFBH 3BQUB 3QNZA 4GB9A 5HHNB 1LEKB 3WFEL 1BQKA 2XWJB 1QI3A 1XIWC 4I7ZC 4XP1L 3DX7B 5AW5B 2QQLL 2KI6A 5JPMA 3IJHA 4Y4KD 3KBHE 2XG4B 1NDMB 4UI2A 1AGCB 2CO7A 2GBUA 3NSXA 4KH9A 1TFPA 3P9LB 3VSTA 1KEML 4UIKL 2NYYC 1RZ8A 4GUOA 5E95B 3RWFB 3WNNA 3N40P 3UTOA 4X4MA 3S4SA 3TN0C 4NWUH 2PWHA 5BO1H 4ZO8A 3RJOA 3LXAA 1OARH 4WK2B 4B0MB 5CMAA 3V5DB 3MRCA 2W81C 3I9AA 2P1YA 2VB5A 2ZUTA 2O61A 2DQDH 5EO9B 1AGBB 5CEZL 1T83A 4CJ1A 1AD9A 3DIDA 4B5EA 3SOBL 2X4OB 3PHQA 2IQAA 3D85A 3NSYA 3RGHA 3UAJD 2UY6B 1AHWB 1EAJA 4NQCD 1UCTA 3OBAA 3GTVA 3B8SA 1EJ8A 1MCPH 1BVKB 4LPUA 4POUB 4P23C 5FW6A 3P4NB 1OCCB 4Y4HC 2R0ZH 4L0YA 2UZIH 4D0BA 1QHPA 1J0ZA 1H6FA 1V7NL 4K94L 4G5AA 4AV5A 4B7LA 3MJ9A 1E3FA 1WS8A 3ZX1A 4R4NC 3V4VL 4BQBA 5BOZG 1HOEA 1T1XA 5MEOB 2IPTL 2E47A 3IMSA 4Z77B 3VFRA 4KPHH 1EZVY 1IM3A 1E30A 2H1PL 1BEYH 4PTTA 1XMWA 4X7TB 4APXA 1NLDL 2WB7A 4I9WE 4X9IA 1MY7A 2WWMD 4FNUA 3ECBA 1TZHA 3OGOE 3GS0A 3GI8L 3TM6A 4RFEB 2D4FA 3VMOA 3VXNB 4UOJA 3BVVA 1EXGA 1NFKA 2HG5B 2OMWA 4U0QB 3RNKB 2AEIT 1RIHH 4FYTA 4QTIL 3MRDA 4UZGA 2OMTB 1OTTC 2VWEC 3W39B 1QSFD 5KS9F 3EGDB 4RFNB 1IBGL 1FJ1B 1RI8A 2ATKA 3CVHB 4JO8A 5I0WA 1KCSH 2FUTA 3FTYA 4HKBB 2WLLA 3GSQA 4JG1H 1IEAB 3MCLL 3JTTB 1FIGH 1TUPA 3F58H 1Z9SA 3T3MF 1ACXA 5CLTA 1I1RA 5D1XE 5BS0E 1CFVL 3FS9A 1LDPH 4ZBJA 2P24A 2JKSA 3VVVA 5L7XH 3CVBA 4DWHA 3IVKB 1E28B 1YG9A 5KVFL 4KKRA 1BZEA 1CJYA 4HVBA 2R8SL 4ZMTA 1LE9B 2W0PA 1M9SA 4KK8C 4XC3H 3C60D 3RIKA 1HHKB 4HWNA 1R24A 1NFDB 4D9RD 2QGBA 2K9FB 1R3JA 2WOYA 4JDEA 3VTAA 3IDNA 1R9FA 4LPWA 4J3VA 3L5XH 5GS0H 1TQTA 1EEYB 2WXOA 4FZEH 4M7JH 2FBOJ 4LEXL 3FO2B 4OM0L 2G0LA 4QOKE 4FQJH 4WO4A 1FPTL 3NTCL 4XB7A 5F3HA 4R97B 2DQCL 2H41A 5BW7A 5E00A 2YD9A 1FL5A 2G9KA 5HI3D 2Q9OA 3S36H 4JY6B 3GWJA 2HZHA 3PABB 5I66A 3HVDA 1U8KB 2C1PA 3AQZA 3FOLA 2PMZA 5IT2L 2ED6A 1YNTB 1IAOA 4XXWA 5DC0A 2ADJB 3L54A 3RFZA 1IARB 2KZBA 2QSCH 4LBEB 4JFQA 3RKDD 2AJXL 2Y7QB 2IWFA 1VAHA 2CA3A 5EOCL 1PZAA 1WE5A 4OBSA 1WA1X 1YO4A 1E6OH 4YXKH 4UAOB 3QZNA 4NUGH 3BO8A 1PCXA 4MYPA 4BSVB 3ESMA 1T4WA 4HFUL 3H9YA 3MA9H 3OQRA 3ZTDC 5ADPL 4UNIA 2EINB 1HINH 4P05A 3QBTB 1KG0B 1BLIA 5IVXF 1U33A 4U6XA 1I8UA 3QR0A 4MA8H 4Z3IA 2LVCA 4FERA 2P5WA 1B3JA 2W88A 3IFOA 3PNRB 2GCYB 1KY7A 4HKZA 3SPCA 1JCVA 1N6QL 5JPNC 5EU6B 5IHUH 1MDTA 1A7RH 5BUGA 1HNGA 4PPTA 3FN0H 4GXVL 2P5ED 3RAJL 4RQQB 4WI2A 2O93L 1UM4H 1XMEB 4ZG1A 2APVA 1DQQA 5AOKA 5AAMA 5BUAA 1BLNB 4U1HA 4TL5A 1CLZL 4G9DB 3GC3A 4AZUA 1PG7W 3MO1A 2ZCHH 4HIPA 4I3GA 4LCUB 3U0WL 2VQ1B 2EIMB 3MV9B 4E9RA 2ZWZA 4ZMAT 4ZMPA 2XWTB 4AV4A 4G6JL 3T0EB 1B6UA 2NX5E 2D0HA 1H19A 5T1MB 4KKCD 5EBLB 3H9SA 5LG6A 4JM2C 3HPJA 1KLFA 1M7XA 2BSRB 1FNHA 3SDAB 3I02A 1I85C 1NBYA 2ZPKL 5FYLE 4HIQA 1SOSA 2PYEE 5I18L 3IFLH 4IRSB 5IBTL 4KKZA 3UP6A 1VA9A 5DRZA 2Y9RT 4J8QA 2CRZA 4PR5A 4F7MA 1OE2A 2YGPA 4KITB 4HK3N 4NERA 5IJKA 2VQ4A 2N7AA 2VH5L 2WKGA 3PP4H 1D6EB 4NN6B 4R7NB 5LBSA 4F7CA 1JYVA 2D03H 4JRYB 4X9BA 1VGEH 2F8OA 1GGBL 4MNGB 5K39B 5C2BH 2VIRA 5E4EB 4A2MA 1MFMA 2FGWL 3S36X 3INUH 1OW0A 5JW4M 5HI5D 5KYXA 5HGHA 3O11B 4Y2DB 2HKFL 3P3RA 4KXZH 4MJ5A 5IMOB 1SBBA 3QEGL 2BY0A 4IM8A 4A2GA 3FFOA 1JRHI 2VDLH 3KR3H 1T1YA 1IL1B 2A6IA 1W72B 3TO4C 4XNZB 4H1LA 5DF0A 1QEWB 1SF5A 1B0GA 2CRIA 3D30A 2Y06L 5AFAA 3WTUA 4NNXB 1ZLSL 2CDGB 4BELD 4Z7VA 2AXGA 1NC2A 3BESR 3RVWC 2CA4A 2GABA 1LWRA 4AENB 3MA7A 4D9QE 5T1KD 1A4BA 4WI0B 2B4CC 1EGJH 2KERA 2PWEA 4FFVD 3FSZA 5T5FH 3FQYA 4M9PA 4GRLA 1QTPA 2AMUA 2JTDA 2RQEA 1CR9H 3C08H 3O3BB 4H5SB 4C59B 1D5XA 5H37A 4NZRL 2H6PA 3FUIA 4B9IA 4IOFD 1DBKH 3MV11 3GTTA 4TPRL 1BBJB 2BP0A 4E9QA 5C86A 3WS6C 3HN5A 3KH3A 5EFIB 3V5KB 4F8OA 5BZDB 3S2CA 2B8OT 4HXBL 1OGTB 4PJCF 4QRRB 5CBEA 2EDYA 1RZ7H 3HNTL 1HSAB 1JPSL 4FTVD 1P7QA 5GGTA 5GS0C 5CZRA 5F1OB 1YPZB 4PREB 2XBDA 1OAQH 4PJ8C 4WFEE 1CK0L 3B6SA 3ZO0A 4ELKA 1DBMH 3OL2A 3FU7B 4KTEH 5C8JB 1SM3H 4M5SA 4JRXD 4Y4FC 1A9EB 3BE1H 2WTOA 4XPTL 2VM3A 1ZGLB 4OIBA 2DQFB 2XTJD 5MEPA 2YMOA 4GQ9L 5GISL 4B53A 1OE3A 1YEGL 1I1FA 2WYTA 4K23H 5JHLL 2A5UA 3C2SA 4X50A 2FWOB 2V17H 2WQSA 1JUFA 2MCAA 5AENA 1GTNA 5K9QI 2HLFC 1I7ZA 2QBWA 5CJOH 4M5ZH 4H20H 4XN7A 2V5MA 5F8RC 2CJUL 3P4OB 3G6DH 1XL4A 3TBVB 4BWWA 5B1BB 4U1MB 5AW7B 2XWBB 4FABL 5F1NB 4UV7L 1X3DA 3ZZLA 3S5LB 3FOMB 4G8EA 2C9VA 4GYBA 2AXJA 4Y7OC 4GFTB 3QUZD 3K0YA 1ZKAA 3O6FB 2RTTA 4FNQA 1V27A 2WY3B 3MUGA 4EOWH 2XWRA 2QZ5A 3APCA 1QRNA 3PIQA 3QR1A 4MAYA 1L0XA 3DGCR 1C5CL 5DRXA 3UTPD 1T0NA 5SWQB 1UM6H 2FK9A 4PUBH 2DQHL 4GAJH 5DC9B 3V0VB 4UT6L 4Q6IC 2PW2A 3LPOA 4JREB 3GXPA 3HHRB 3MCKA 3R06B 1JHLL 1QNZL 2ZUQC 5AOMA 5KG9B 2X2HA 4HCRH 1CI3M 4IJ3C 4YVUA 1Q9WB 1SY6L 1A0QH 3ECVA 1FZKA 4KJWC 4HOWA 2X1OA 2ZUWA 1N0LB 3QIWB 1UD8A 1DE4B 3F00A 5K69A 3MNMA 2OP4H 3ERXA 4HK0A 2N0MA 2OJZL 4N25A 3LXBA 3QQ3B 3QCTL 2QGDA 3KPPA 4RIRA 1PYWB 1QLEL 3VVWA 1LO5B 1ZJBA 2X6BA 1Z9PA 4UZUA 4ZW5A 3PL6C 3UTSA 2FT8A 3RWGA 1KC5L 2KQMA 3IS1X 3BGFC 3GSUB 3MV7D 5LWYL 2PKDA 3OC5A 3WFDH 4JPIA 5E2WH 3AG3B 2AKRA 2VITB 5CGYC 3U9UB 1E4KA 4W1TA 3MBEB 5B8CB 3TESA 5E4IA 3L1OH 1UD2A 1IGFH 2BNUA 5LG1A 3T2QA 1T7WA 5KYWB 4M3KB 2JIXB 5I5MA 2FT6A 5IQLA 1KF9B 4FYRA 4HZLA 1E27A 2Q7YA 3EYUH 4OJYA 2IC2A 3L9EA 3K1KC 2BZ7A 3JUYA 3VB9A 1NLBL 5B4MD 5LKNA 4AK1A 4N0CD 3QCVL 5MENB 1DVZA 3NSDA 1IQDA 1XGRA 1HHJB 1T66C 3LKNB 4KV5F 2HB0A 3VWKA 4FZ8H 4LB8A 3FB5A 3G5XA 2VR3A 1S9XA 5LQBL 2W38A 3I6LE 3KGUA 3ECQA 1LQSR 1UM5H 3COOA 3SCMC 3VXQA 2FR4A 1KCUL 1HDMB 4UUJA 1CXLA 1JV5A 4N1HB 2GSMB 3MACL 3IGAB 4P2RD 1KENL 4XBEL 5D2LA 2ICEC 1AD0B 2EIDA 3NJIA 5F1SA 3TIEB 4S1RL 3ABGA 4F5CE 2DYRB 4LESA 3QH3A 2I9LB 1NCBL 1UT2A 3SB3A 4E41A 3S34H 2EVFA 2EECA 1P4IL 4C55A 5E03A 2CDEB 3I9GL 4PJ9C 4W6XB 5BCAA 4A68A 2QR0B 1Y6NR 1W16A 3QARA 2NY6B 3EFDL 3P11L 4K8RD 4XVSH 2V3DA 1QKZH 1YNLH 3RL1B 5GGRA 4EXPX 2WO2B 2XZZA 1Z2KA 4PGZA 1IC0A 1THAA 1LDSA 3EOBA 1JIBA 1QD0A 1GR7A 1CFSB 2XICA 4WUUD 4XN8A 4X7SH 2P43B 3HC3H 4ZFFB 4JGJA 2ZCLH 3BRDA 1JVLA 5DMKB 1NAMH 3C8HA 4EZMA 4UTBH 3DPBA 2WBJC 1DN0A 1QUNB 1D7CA 3L7FA 5GZOA 2NNRA 3AU1A 3WO3B 1AQMA 2KYIA 2PP8A 4NKMA 2AXWA 4PBDA 4ANVA 1OQXA 1JXJA 3GSXA 4D7PA 4PJBE 3PWJA 3TJHD 5I1JL 2IBGA 1B0RB 2ENQA 4N2OA 2PR9A 3KLAB 1CS6A 2EH7L 3QQ9D 5AALA 4BQ6A 3KJ6L 5E6ID 8CGTA 2JJVA 3C5ZA 4GRWE 5CUSL 5I1GL 5J13B 3E8UL 5I1CH 1MCOH 1SDDB 2FEDD 4FMVA 1KFAL 5AOZA 4WI6A 2VUKA 1Q94B 4XMXA 5FV1L 1OB1A 1MFVA 4FG4A 4MNHA 5DJ0B 5ESQA 1EZLA 1R5WB 5K9JL 2P45B 3MOBH 4Z7QE 1UA3A 1KGCE 4LPTA 3UJTH 4LARL 4KZEH 1XIWD 2IDSA 3GBML 4Q0XL 4NQEE 4YGAB 2BZCA 1SEQH 3QAZB 4F2MB 2FQDA 4W81A 3QQDB 4PI2A 5B39G 2X10A 1BJ1H 2Y4SA 2GJJA 2OR9L 4PJ6A 5T1LD 3ZKNC 4BJLA 2NYYD 1NGQL 2WLHA 3MX0A 1MPAH 4NNPL 2DWDB 3IAPA 3BMWA 4PJGB 2M83A 1CFBA 3ABKB 3MRNB 4JFEB 4XCCL 3TN0D 3RWCA 3FKUS 2DMHA 2WNKA 5TD4A 3UBXB 4MJIB 1ZS2A 4PJDB 2YOAA 3QSKB 1JGDB 1AKJD 1OLZA 1I1AC 5A2CA 1PLBA 3RPIA 3PWPE 4KQ0A 4ZMWA 2F68X 1MFUA 3MRHB 4NI3A 3B3IA 1RZJL 3SBWC 3WYRA 2V5SA 4MCNA 4YJZL 1C1EH 4WKZB 5EOTA 4CBZA 4QXUL 3VXSB 2D3NA 1S7XB 2R9HC 3WDIA 1P0SE 5T3XD 3U2SA 1XH2A 3ARGC 5AW9B 4FNRA 2D73A 1R47A 4EMZA 3RX5A 4HX1A 1EPFA 3CC5A 1HJCA 2VLJA 4RGNE 4W6YB 4YHZH 3V0IA 5JQ6H 1PZ5B 1BQHG 2OMUA 3OKNB 3QUYB 2IH1B 1ECYA 4P23D 4Y4HD 4B97A 1NH6A 5M7QA 4PJXB 1RH8A 3BH4A 5IKCB 2DJUA 3NJHA 4BYHA 2VMCA 4LAJH 2HVJA 3ZDYE 2CO7B 4JKPH 4R4ND 4WIQA 4BZ2L 1CIUA 4HBCL 3KPMB 3WBDA 1BFTA 4PWIA 3M46A 4DGWC 3JYBA 3CHXA 4XE0A 3SODB 5CMAB 2XVGA 3S2AA 3MRCB 4OLYL 5IB2A 2YMXL 2O61B 1I8KA 4JE0A 1AD9B 2RAMA 1OTTD 3W9DB 1L4IA 2CM6A 4QYOA 3PHQB 5CO1A 3AREB 5KWYC 1FBIL 4OTXL 3ZT5A 5BS0A 1CGWA 1X5YA 1NFIA 3TJPA 2DF3A 3HPLB 5F0LB 3S4SG 3IRCA 3VQMA 1FSKB 2OZ4H 4GG8B 2A83A 3FUMA 2B39A 1CF8H 4LLVB 3TNMA 4GS7B 4NRYA 2E76C 1ZT7A 1KLUB 4JFDA 5EO0B 1DJGA 5L2JA 3GKWH 1GYWA 1T1ZA 1XGQA 2GK2A 5J6HB 2CBQA 2JWYA 5C3LD 1E9PB 3SQBA 2XOTA 5LUMA 4HJGA 1T5WA 2CR3A 3ZU8A 1J9QA 4ONGL 2Z9TA 2GK0B 3FRPA 4KK8D 3WNIA 3EBHA 1IM3B 1T0MA 5IR1B 4PTTB 3CVHH 4PRHA 4QOKA 1XGUA 5I19L 3PWLA 4RMBA 1E9OB 5E7BA 3RX8A 4KVNH 3VD4A 1DSFL 1RUAH 3PHSA 3O4LE 5BXFA 5FR3A 3QZOA 3ULVF 4ZX5A 4NC1C 3L2NA 2JCCF 3F7VA 2OMWB 4G6AC 3CH8A 3P4LA 4OLXL 5FGSA 3Q2LA 1R0AH 2VLRB 3FQUA 2NY4B 4GAAA 3T8XB 5E8OB 4V2BA 3CDCA 2R29L 5AB0A 1AHMA 4N2FA 3GINA 5EF0A 3N91A 5ICZA 1QUPA 5T3ZL 3V7AG 5D6DA 4P04A 2OAAA 1JWSB 1KCWA 1MRDH 1IGTA 1SGKA 3HC2A 2Y7MA 1ADQH 2BHUA 4L9LB 3MPCA 1F02I 1RULH 4YXLH 4PGEA 4XO5A 1MIEH 4ZOCA 3N42F 4XC1H 3UIZA 1C08B 3L4YA 1LVEA 3S9DB 2HKHH 1R24B 3VXRE 5EOQL 2VYRE 2YHGA 5G4OA 3SE9H 1R3JB 5FYKD 4GRMB 4FS0A 2WGNB 4Z95H 4PMFA 1ZA3A 3IDNB 4X80L 5B22A 3KW8A 1S7WA 5D70L 1U8JB 1GMEA 4LRNH 4N86A 3CSPA 3JWDC 1AXTH 2B5IB 1AQDA 2JKWA 3T1WA 1B2WH 4PRIA 2ADYA 1BW8A 3D2UA 1MAML 2WQVA 5I6OA 2BVOA 1HWGB 1FL5B 4XN4A 4N2AA 1UEMA 4JFXA 5I1IL 4KRNA 2NUTB 4JKWA 4KAQL 1ND0B 3BQUC 5L88L 5DUPH 2BJML 2X5PA 3DX2A 4ANKA 3BAEH 1SBSH 3AW5A 3NCCB 2VXQA 4RESB 2OZNA 3RFZB 1YEJL 1E5BA 1BGXH 3X13B 1BJ1J 1FHNA 4JFQB 4XVJL 2PTTA 1SEBB 3QWRD 1CZ8L 2HN7B 3KD4A 3SO3C 3CLFL 1NCUA 3NCJL 4JM2D 4KO7A 3WFCL 1TO5A 4KK6C 3INOA 5I17B 1I3RA 1VFBA 4I4WB 5LGHL 1SVBA 3H2QA 1NBCA 3RHWK 3RTQA 1A9VA 4U6XB 1QNIA 1EXUB 1QSEE 3MRBB 2P5WB 1N12A 4NLAA 1RZIA 3DV6A 1KELL 5IGXL 1P2CB 2D3LA 3OC8A 5DQJB 3DXAE 2BVEA 1P6FA 2LTQC 2VSMB 4N9GA 5C09B 2Y6SC 4O58H 3KVDD 3RZCB 2Y3NA 5EEXA 1TQUA 1NCCL 3AS3A 4P46B 1O7DE 4QI3A 3GM0A 5CEYA 1IFHH 1A7PH 1DVUA 2DM3A 1RZFL 2IXQA 2P80A 3CCHA 3HHSA 2O5XH 4OFKA 4Z7NF 3C2AH 1A1OA 2PXYB 3KLLA 1Q0XL 3FFDA 1JMXA 5JW3L 3IDYB 3VCLA 1FO0L 1OQOA 1FZMA 2CGZA 4N8VA 3EJYC 4BZ1A 3CN1A 1LEGB 3NZUA 3BIKA 3HPJB 1KLFB 3QULA 3HHMA 3TO4D 5HHVH 2DL2A 3N44B 3QWQB 4JFYA 3I02B 5EPMB 2WZ6A 1S7VA 5KYYA 1WFTA 2BDNH 4F57H 4ZNCD 3RVWD 3SKJH 5DVLA 2WPGA 3CPLA 5E23A 5JNYA 4CC4A 4FNSA 2C9AA 4PR5B 4F7MB 5IFHH 3CZFA 5I1LB 1F13A 1L9OA 3ZTNL 1NGPL 1F86A 3D34A 5ABDE 4U1SA 1KMGA 4DAGH 4DK3A 2HRPH 4M02A 5AWNL 1OAKL 2VIRB 1RHHA 2EP6A 1W72H 2P8LA 3DVNA 4RFNC 4XMKL 2D7MA 2VXTL 1ILSA 1NCNA 2BIMA 3JVFC 3N40F 3O3EA 3QXWA 4L5FH 5IQ7L 5KYXB 3MCYA 4CC1A 1WAAE 2DQEH 1KN2H 3T0WA 5GS0D 1B4JH 1YHPA 4MJ5B 5TF0A 3HG2A 2V7NA 3H9HA 3I3EA 2NW2B 4PJ8D 4PWFA 3DA0A 4M7KL 5EH1A 1CDHA 3QYMA 1MHEA 4PTUB 3L1FA 3L3KA 3QI9A 4LFHD 4Y4FD 3AXLA 1URZA 3RWIA 1U36A 1U8HB 4WEMB 3BZEA 4H1LB 2W9DH 5FKPB 2DPKA 4Z3GA 3RTLA 1OM9A 4AWJC 1E8YA 3U7AA 2AXGB 3SKNA 3EH2A 3EGXA 4D0DB 4NCC1 3MA7B 4QRPD 1U8IB 4MD4A 5CJQL 5I8EA 2K3HA 4GKSB 1YYML 3ZL1A 4QRUA 2OTUA 4U6HA 2D9CA 4XBMA 4I13B 1DQLH 5DHYA 1S78C 4YUEL 5I82A 1T89A 2BCKA 4R97C 1Y7VA 4WHCA 1ZD6A 1FI8C 3HG1D 4J27A 5EUOB 1JN6A 1F4YH 1UQSB 3ASNB 2JXMB 3B37A 3LZNA 4H1LG 1DLFH 4UQIM 5AKSA 3DO3A 4JFZH 1CQYA 3LKSB 4RZCB 4OD3L 5CBEB 5EEWA 1T7ZA 3H85A 1I8MB 2ED9A 5F9AC 1OK0A 5BZWA 4L0ZA 3SGEH 4KQ3L 2G5UA 3D9AL 1BMWA 4DGUA 1SYVB 2QVFB 3HZYB 4JJ5A 3KPTA 1CLOH 1KGXA 5FUCC 1OGAD 1U8MB 5KJRL 4ELKB 4K9EL 2ZSWB 1MVUA 2G5RA 3PGFH 1GIGL 1PQZA 3E38A 3DGGB 5H37G 1OP4A 1Q0EA 3EJTA 4L9DA 4UAOC 4PJEF 1UOKA 2WBWB 4KJWD 1YJDC 1UZ6E 5MEPB 2EVHA 1PBYA 3KPQB 1WZMA 1I1FB 5I71B 2ENJA 3VFWA 1QSFE 5EIIB 1CFQB 1CD1A 1OP5H 1MLBA 3G6JA 2UUDH 5EG6C 1KBGL 3FSOA 3S3JA 2YQ2A 4DW2H 3D6GA 4I8DA 3RWHA 4H8WH 4M62L 3AQYA 4UNUA 3IN0A 2R15A 5CWSA 1UXMA 5D7SL 2I7OA 3CVDA 2IANE 2X70A 3ES6B 3PL6D 4PY7A 1CDUA 1HI6B 4MS6A 2FHCA 4OI9A 5CKGA 4PJHE 4MRBA 4GAYA 1HKFA 4LHUD 5IVNA 2WNWA 3DSFL 4LU5L 1RSFA 5CGYD 3SDXB 1KV3A 3CQPA 4L8SA 3HZVA 5FF6B 5DRXB 3GM8A 4MWFB 1FL3A 1SXSA 2HUHA 3TLRA 5JTWA 1K5WA 4PG9B 4MD5A 4Y5YA 2OR7A 1YYLH 3LNIA 3S37H 3T0EC 4TOYH 2PTVA 2B1AH 3O3DB 4RRPA 3MXVH 2WLNA 1QBLL 2E86A 1JK9B 3SDAC 5DUMH 4F3FB 2EIKB 2LFGA 4W9KC 1UA6H 1T66D 2BRRH 3IDMB 2JCWA 3QUKB 4IRSC 1AMXA 1MJ8H 3CFKA 2GPZA 1XXDC 2L4OA 4F8NA 2YO3A 1YEDA 4NN6C 3KPPB 1ZV5A 3CU1A 3LRSB 4N90D 3SCMD 4XI5C 5BJTA 4LCVA 3OMNB 1MWOA 4R5XA 3FRUA 1SXAA 4JDTL 1ZIAA 3AT0A 4DKFH 1SLWA 35C8H 4JX0A 1QMUA 3RWGB 1XAKA 3MNVB 3SKUD 5E4EC 3KXFB 1A9BB 2FLMA 4PVBA 3QDGA 1JGUH 1GS7A 4JPIB 3V4VB 4PJ9D 1IGMH 4NJ9H 1E4WH 2EDMA 1DLHA 2V3EA 4F1SA 4CSTA 4Y2DC 3GQFA 4AM0B 1ED3B 3I6SA 3FO1B 3MLYH 3OR7A 1TCRA 5I74B 3H2PA 3L5HA 3RVTC 1G0DA 4A39A 3U0PA 2HMIC 3C5JA 4HZLB 1T04B 5AB9A 2Q7YB 5JHDB 1GAFH 2XDHA 3QUGA 4XNZC 1DUYB 5E1AB 2IBBA 1F6AA 4LASL 4X7DC 5C0CB 3APNA 7PAZA 2C3VB 3N9GL 4B9YA 1V3JA 1NOLA 2IWKA 4ODTH 4YHNA 3VWKB 2P5EE 3FB5B 5D1ZA 3G5XB 4Y2NA 1WWBX 1GSMA 3QZWA 4OIIL 5FYKU 3SO5A 2WBJD 1LO4H 4PJBA 4X4ZA 3ETBJ 4LL4A 2FR4B 3PWNB 2OMNA 4UUJB 4OD1H 1ORSB 3MMEA 5KYUA 4XBGB 1P5UB 2FT7A 5D2LB 3RE0A 3BKJH 3DX4A 3IDIB 3BPNB 3D3VD 1I31A 4YHOH 3VI4E 4S0SD 2VLKA 5DEJA 2NZ9C 4E41B 1P4UA 1FGNL 1RUKL 3NPSC 4R8WL 4TTDC 2AZUA 1BG1A 2CHWA 1HXMB 3Q6FA 1KIQA 1H15A 3KBFA 3BLKA 3FUKA 5EZPA 1EXHA 1YEEL 3PFQA 2DAVA 3CX2A 4P3CL 5GSVA 4NP9A 4LNRA 4JPSA 1PD0A 2BIOA 4N3UA 1M71A 4HFWA 1E9QB 4QO1B 4X8CA 3CBKB 5A2JH 3V6ZB 4NQDA 4W9ZA 1Q8MA 2HX8A 1XTMA 5JQIB 2MFNA 2PCFB 3FUEA 4NQEA 5LXVA 4QRQB 2J6EA 5BOJA 4J2QA 4JO5A 4P4RB 3KYOB 1AO7A 4Z7AA 1YDPB 1WCBA 1JERA 2ZXWB 1KPRB 5KUMA 2CWRA 4CVUA 1WSST 3AU1B 3R0NA 4PG2A 3NYKA 3X3GL 1G6RL 4LSTL 1KWGA 1O9ZA 4AYGA 2WKOF 1DQTA 1MCFA 3RNQB 3ZKND 2H26A 1IJ9A 3SYCA 2VO5A 4C56E 1D7FA 3O6FC 3FT1A 3MFGB 4K9JA 4MCYB 1OO2A 4H8WC 3PWPA 1MAJA 4PVLA 1MCIA 1SJHA 4BFKA 5SX4H 5AVYB 1QLFB 3GUFA 3C5ZB 1I1AD 1EFXA 4HJIA 2V4LA 3WY1A 3CDFA 3QJRB 4BFIA 4LRIC 4JREC 1QPPA 3TEXA 5EA0H 4P9ML 3V95A 1K6QH 2NY2B 3SGJC 4LVHB 5F9WB 2R9HD 3D39D 3F12A 3N0AA 3IETA 4AEHL 4MNHB 3VD9A 3QPXL 3SZ6A 3ARGD 3QIWC 4G3YL 3SKMA 3NRPA 1N67A 3U82B 3IGUA 1QAWA 1BX2A 1X9LA 2MNUA 2G60H 1U95B 2K78A 4PFEA 3HNVH 3D4ZA 5I1KH 4RWYH 1QX1A 1MJ7L 3QJFA 3RWEA 3PFUA 3VFUB 4MNQB 3WFZA 3UZQA 5E08H 3PAVA 1XZWA 2XFGB 1FO0A 3BT2L 3LVTA 1AXSA 1MJUL 3LHPH 4A7SA 5JQHC 1FNFA 2CIIB 4OF7A 4PV9A 2JVUA 4J3OC 4JRXE 1KTRL 1EX0A 4XCNA 4LKXB 1H5BB 1V10A 3ML9A 5EORL 2HCZX 3RWCB 4MB5A 1FFNA 1JGIA 1OWWA 3D0LB 4ELME 3MBEC 5B8CC 4FNPA 1N0XL 4FFWC 4MSWA 43CAA 1PNCA 4N8UA 3ARXA 2X87A 3HW7A 1SPDA 4OFDA 4WU5A 2WQWA 4A67A 4YE0A 2YLHA 3EDKA 3VUAA 4UIMA 2BSCA 2SEBA 1OEZW 2FYYA 1P4LB 3IMVA 3L3HA 4OZGF 2QADC 5EOTB 3T2NH 4OFYD 1YMMD 3UOAB 3AY4C 5IB1B 3B9KA 1O6SA 2G5BB 2FWLB 2QV4A 2BP8A 1LL1A 4XXCA 5IM7B 2WXPA 1K85A 2IPUG 4HX1B 3T3PE 1HWHB 3OHXC 3CC5B 4PRPA 2VLJB 3CVIH 3QJHA 4LSPL 4XWGH 5AW8B 5GS2H 1AP2B 4TL4A 4GSQA 1Q1PA 1HCZA 4AGMA 5HHXH 5E8PB 3IJSA 2GSIB 3CN3A 2QGEA 4GSXA 4MXWL 4PB0H 1A3QA 4HP5A 5FXCH 1K2DA 1B88A 3RWJA 1GPOH 3LZLA 2DQMA 2NDGA 5B7FA 2P8MA 2QFPA 2A9BA 1J05B 2YJLA 3LB6C 3O4LA 4HSCX 1IBDA 2FJSA 4JQXC 5C0RH 5JOPD 1YEFH 4FCAA 1SHXA 4H25A 4HU2A 4L05A 4X0NA 5C07A 3EBIA 4XNXH 2NY6C 2YKLH 2LE9A 3QUML 4UOW1 4Z0XB 5LXGH 1SXBA 1TIUA 3ARFB 2IV9A 2NNAA 2YD1A 4FQ1L 4DFIA 4G6AD 1RURL 1DVFA 2V37A 3ZO9A 1JPTH 4OF0A 5KANG 1UADC 3ULUC 3FQ1A 4QYOB 5I0XA 1PEZA 3VNZA 4PBXA 2UVFA 3M88A 2V2WA 1M53A 2M2DA 4N0YH 4ZUTB 2VZSA 1NFIB 3QDJD 5C0NC 5LGJA 5D71H 5DD1H 1R34A 2FL5A 4L8DA 2JKTM 5E4OA 1YQVL 5EF1A 4BFOA 1ZT7B 1ML0A 2NY1B 4ZW8A 3U7YL 2G2NA 1ZHKA 1BAFL 2DH3A 1WFUA 3FO9A 4JQIL 2OCFD 3MV8B 3SQBB 3H6JA 4L2LA 4FN0A 4HSQA 4HJGB 4DP6X 3VXRA 1CDCA 1ZMYA 4U33A 2V6HA 3A6CH 1E4HA 2WJ5A 4ONFH 4OSUH 4ZYKA 3U36A 3QK0A 2XKSA 1RZKH 2E9IA 3MGAA 4TS6A 2OMXA 5DMYA 4PRHB 2JJSA 1U93A 3D18B 4XCFH 4DP9X 1YCSA 4HUKB 5CR1A 5EC2A 4ANXA 3NZ8B 5PAZA 4ENEC 3FONA 3P3SA 4ODWA 1E3XA 5J13C 3VA2C 1KSRA 2JB6A 5BXFB 2BNQD 4UILL 5KVEH 4LSDA 5CN2A 2ERJC 3GMQB 1LTXA 3GUTB 5EBMB 3BPCA 4ZUVB 4CC0A 3TBSA 5I8OL 4P2RE 5FM4A 5FW8A 3WTYA 4ZT1A 1PD6A 3FRPG 5CLYA 1U91A 2Y36H 3BQUD 3EFFA 4EZLA 1DQDH 2VR6A 3AUWB 3Q2NA 4YR6A 2Q2EB 4HXAL 5D2NE 3TVMA 1IGTB 3OF6A 3QAZC 4JFFD 2D31B 5KS9B 3JWOH 4OLVL 4XO9A 5D8JL 3MAWA 5TDOB 4YSUA 4JPWH 4QHPA 4NX0A 2ROXA 1XSJA 2IGTA 5KBDA 2CRMA 4KK6D 3GD1C 1GGYA 4Q9RH 1QSEA 4U1GB 2EKSA 3PDOA 1P6AB 4XMPL 3BW9B 3BUYA 5L9DH 3ML8A 1WLHA 3AC0A 1IAMA 4FQQB 3QFJA 3ILPA 4HG4J 5LNGA 3VGEA 1ZA3B 3VI3E 3SYQA 3DXAA 4LGRB 1S7WB 3FK3A 4LL1A 1ZA6A 2DLIA 3H6AA 1OP3H 4BE6A 3ARUA 1BCIA 3UTZA 5J1AA 1JTPA 1QLEB 5GRVK 1XAUA 1RJLA 4KZCA 5SWSB 2Y6SD 3L8QA 3NIDF 4MVBC 4QUOA 4E36A 3WDJA 5IMLA 5M95B 2FBRA 3QS2A 4GFXA 4RISH 1ZCRA 2C9SA 2P46B 5K9OA 2Z91B 1XGTA 1MJJA 2Y72A 3RDTA 1QVOB 3GRWH 1RK0B 4ZODA 1M2VA 3QC6X 3UROR 3QUYC 1DBAL 5DLMH 4N5UA 3X1EA 3FT4A 5E6SB 3VD0A 3EJYD 3LD8B 4IMKC 1QO3B 3RB7A 3SGEI 2E27L 4X5XA 4MCZA 2J71A 4UB0H 1F4XH 5E6ZA 1DBJH 3V4PL 3WENA 3LPFA 1R75A 1EK3A 1HWWA 4JAMB 3BGAA 4CGTA 4ZFOL 1LK3H 4ZNEA 1RUQL 1TO4A 2DWEB 2COVD 2J1WA 2NLJB 2R27A 3CFDA 1NAKL 4Y4KA 4AIXA 1HL8A 3MLRH 1JDAA 1RZIB 3DV6B 3ZDZB 1OSYA 3KNBB 3IJEA 3WY3A 3UCQA 4BZYA 2WB1A 3BKML 4MZIA 3STZB 4BE5A 1I7UB 1EH9A 5L4FA 3OPZL 5HPMA 1Y18B 1LD9A 3IK2A 3M17A 1BZOA 1YC8A 4YL9A 1EAQA 2IXQB 3HHSB 1FSKC 1Q1JL 4HF5L 4GS7C 3I50L 3WSQH 4KGJA 4TNVK 2AJVH 1MCRA 2XN9B 4NS0A 3OKEA 1MNUL 3FMGL 4X5LA 3VA6A 5CD5C 2H9GB 3W9EA 2NT1A 3EG9B 1WGOA 3BIKB 4U1LA 1ZVHA 4XE5B 4FQCH 1TJIH 5LAXB 3B34A 3UAJA 5LNEA 3EUUA 4EUPB 5A40E 2YBRB 5KYYB 4NQCA 4HIXL 5AZEL 2BSTB 2ARWA 5T3XE 3PJNA 4ACPA 1LM8V 3CMOH 3KW7A 1RERA 4BM7A 2X44D 1JPEA 3GB7B 2HP4A 3GDBA 3GSVA 3REVB 4BQCA 2BSED 1IAIM 4XT1C 2WIIA 3SGKA 3UJIH 1ZHBB 1S78D 3AS2A 2EYRA 3BHBA 5SX5K 4U1SB 3RHWF 2EXSA 4N8VG 4YHYC 2WVVB 3T0DA 2Q3ZA 3HMXL 2ZYSA 1RHHB 5DMIH 1ZE3H 2DD8H 4H1LH 4LO9A 1CDBA 2IIJA 1G7JA 3L3OA 2BIHA 4WWNA 1ETZB 2BIIA 3O3EB 5DZVA 4YWGH 4XMLL 5CGTA 3L4XA 3NGBB 2N7SA 4KXDA 5F7FA 5DI8A 1XSKA 1MHCA 1II4E 4NSKA 2V7NB 3H9HB 3BWAA 3B2MA 2VKWA 2RFXB 2XVLA 5TE7L 3KPRE 3FTUA 3L3KB 4L9LC 3UPRB 5FUOL 3BZEB 3MNZB 3HC4H 1QSFA 5EUKB 2OM5A 2I60L 4QCIB 5CSBA 4GH7B 2OXGA 2NY7H 4NYLA 4BUHA 3HLAA 1YMHA 1QBAA 3BDXA 4RBPK 3V4UL 2V3FA 3SKNB 5JIDA 2DQTH 2VWEE 5TPWL 3MUHL 3IU3B 3V0WL 1JV2B 4ZW7A 1JHKL 7PCYA 4UT9H 3UYRH 4QRUB 5GGTH 1BZ8A 1S7RB 1RMFH 2XY2A 1P5VA 1TOXA 2WTRB 4ZK8A 3RGBA 2B5IC 4PJHA 1Q0YH 2Q1EA 1K4CA 4UMGA 2BCKB 4ZPVA 4G6MH 2R1WA 4FQXC 5JLZB 5L8JB 3BIBX 4HV8A 2VRKA 2YD2A 2EQDA 3C60A 3QYCA 3MC0A 5SV4A 2F7PA 2VW4A 2YS4A 3HG3A 1KACB 4ZFZA 1UWGH 3O2WH 2APWA 3Q13A 1PEWA 3MV9D 4N2GA 2L7EA 5DJDA 3OKLB 1HIML 1A1NA 4ABWA 4F15B 3T0ED 1I9IL 4L8BB 3RURA 3WFEH 3WY4A 4U3HA 3T71A 4XP1H 3H4FA 2QQLH 3SDAD 2W9EL 5DJYA 5DJZB 5F7MC 1SN2A 2WXLA 5AD0B 4IRSD 4X4XB 3G6JB 4DPAX 3K2MC 1CICC 1KEMH 2DQUL 4UIKH 3GPSA 1NEUA 1RK7A 2X53A 5HGAA 3SBPA 5EF2A 1F2XK 1KGYE 2XFXB 2BVPB 4XI5D 5CWSB 4G6KL 4JRYD 2PCPB 2DDQL 4XPHL 4G7RB 1DO6A 3DVFA 1HQRA 3DHJA 3G04A 1W91A 4MMZA 1J8KA 4Z7WE 3BZFA 1FFOB 1IU1A 4M9OA 1EO8L 2L0DA 5AEAA 3RZCC 1N64L 5CEZH 1WEJL 1L0PA 4P46C 3ZMEA 5A16A 3SOBH 1RK1B 4AG4L 2B2XH 4U6YA 3R0MA 4YFDB 1FL3B 4HS3A 2GTZB 2PXYC 3RVTD 1NIAA 1PFOA 4I1RA 3ALWA 5E24E 3DSNB 3BVNA 3IDYC 2HMID 4IKNA 3FO0L 1S5HB 2F8IA 1T3FA 3IE4A 3QUMA 4NRXA 2P5EA 5SX4I 4DKTA 1T21A 1PNDA 1KCVL 4Z5RA 1XF2B 3OXSB 4AKQA 1JG9A 4KKAC 4GBXB 4XXDA 3HBQA 1V7NH 4K94H 3FH7A 4ZSOA 4TTGA 5F7LB 3MR9A 5BRZE 3V4VH 1D5RA 4XPAL 5BOPA 2QPUA 2IPTH 4EVNB 3VDAA 5IJDC 4XP6L 2UWEF 5BJTB 2H1PH 5IB5A 3VI4A 4MX7A 2W80C 1NLDH 4M1DL 1AIFB 2YEZA 1NGZA 1TVDA 4JHVA 1MFAL 4RRPG 3UBXI 2G2RA 3GI8H 5IW1B 4OAWA 3ISYA 3MRKB 3ZE1E 2NZ9D 4OFPA 1Z32X 1JWUA 1XH3B 2ZKYA 4AQEA 5IF0B 3HB3C 5D96B 4TTDD 3S35L 4QTIH 1VFAB 3US1A 4R7XA 3M8OL 1KB5L 1U3HB 3CNKA 4QJ3B 4WTZA 2EDQA 3OR7B 4ZQTA 1TCRB 3WHE1 2HAZA 4P2QE 3HE7C 3NQIA 3U0PB 3MCLH 4LKCA 4HIIB 4YHLL 4HHWA 1W6LA 2JMRA 1ZE3C 3VFNB 3MGOA 2KLRA 1CGVA 4YDMA 1CFVH 5FGCB 3JSSA 2F08A 1CMOA 1FV1A 4YDKL 3BN3B 4UQEA 4YHNB 1GJUA 2NZIA 3HRZB 1E2VA 2JK5B 3DRTA 1R6VA 3WKQA 4UQ2B 5D1ZB 2X88A 5KVFH 2R8SH 1DBBL 4P5KA 4KJYB 4FKKA 5D1QE 3CHPA 1GGTA 3MQIA 3UTTB 3MMEB 4Q2ZB 4F8PA 1CBVL 1WFNA 1GYCA 2GQHA 2X7LA 1XT5A 2YSSA 4MXQC 1RUPL 3FU5A 3O45A 5A6MA 2XZCL 4L8CB 4QTFA 3EJSA 5C0JA 2VLKB 4GW1A 4OM0H 2X2IA 4LEXH 3O6FD 4F9PA 2EDOA 2FECL 1FPTH 2DEWX 1GOHA 4X99A 2DQCH 4H0GA 1WBYB 2BHYA 2BRQA 4M00A 5T1KA 2R0LL 1XD0A 4GSDL 5EV7A 1RU9L 1E50A 4HUXB 3FL7A 3NP3A 3QZWG 4OUUB 3BCFA 3WE6B 3AG2B 3HR5B 4LNRB 4UMSA 1EVUA 2DJ4A 3LZFL 5IT2H 5FYJU 3UZEC 5KSVB 3MRFB 3TXAA 2GTWA 2YZ1A 4RFOL 4AE1A 1RZQA 3VDCA 5DZPA 1PSKH 4E42A 1ZANL 1NBQA 2WP3T 3QIWD 2AJXH 4Y89A 5EOCH 1LO0L 5HHME 4FTVA 5FM5O 2VM9A 1AO7B 1HZHL 1WCBB 4HFUH 5ADPH 3RYMA 3IXAA 4XNQB 4JRXA 2X2UA 4NO0B 2A9CA 4NKOA 4OCYL 4OIAA 4UDTA 1JYXA 5K1JA 3VXMB 4G8GB 3FQNA 1L7IL 2KLTA 4WWKA 1KJ3H 5JXAL 5E9DE 4J3OD 4ELMA 1N6QH 2CXKA 4U6TA 2ARJA 4R6UA 1U8CA 3HZMB 1BIHA 4LLAA 2AVFA 4GXVH 4PJBF 4QRFA 4LPCA 3RAJH 3MBED 2CLVB 4FFWD 4PHZA 4QLRA 4JGUA 1EFXB 4MHHG 1ZEAL 2JIXD 4QRPE 4QPEA 1CLZH 2VUOA 2Z0UA 1TQSA 4DP8X 2QADD 1XCWA 3U0WH 3QUZA 3RX7A 3ZT6A 2OQJA 2XNAB 3DV4B 4G6JH 4Y9CA 5MEND 3K80A 5EDXA 4UQ3B 2QTEA 4YFLF 2HVBA 2Z7ZA 4HKXB 3U4BL 5LN4A 3QFDB 2Z7YA 2BW5A 1BX2B 3JT2A 5D93B 2ZPKH 4KZ0A 3TBTA 1EJOL 2OFQA 5I18H 5IBTH 2AFNA 2HJFB 3E7JA 4W9DC 4BGDA 4I18A 2XWXA 3BWSA 3R19A 4UINL 1FO0B 4FFTA 5KVGL 3D25A 2VH5H 3E6FB 1DO5A 3HI1A 5FYKL 4PH8A 3N43F 4OLEA 3VMNA 4K94C 4K5OA 3LB6D 2W5PA 1GGBH 3Q3GB 1HH6A 4HWBL 2C9QA 1FFNB 3S3SA 2O5YL 3QWOB 2FGWH 1S8DB 4FX5A 2NY6D 4QRAA 4WGKA 1REIA 5D4IA 2OK0L 3PLYA 4WU5B 4Y5XC 3L4ZA 3LX9A 4CA4A 4UIMB 3DECA 3MJ7A 2HKFH 3WEXA 1SLVA 3QEGH 3ULUD 1HZLA 3MV7A 1A25A 1PZDA 3B9KB 2AEQL 5FA4B 4K3JL 1EUUA 3W5MA 2UZXB 1SJEA 4F33A 1EEUA 5AVSB 5C0ND 43C9B 3LKPB 4PRPB 3WEOA 5DUBB 3IDJA 3JZ7A 2Y06H 5C3TA 3LN4A 5AKRA 4FP8L 2ZCKL 1ZLSH 1CE6A 5DWUH 3AQDA 1FVDB 4LLDA 3DVIA 5BV7C 2YC1A 4OCRL 1P5UC 4JFOA 4HQQL 3X12A 1DUZA 3BPNC 4PU2A 1H6EA 1KYDA 3HZKA 4P3DB 4X2UA 3UAEA 2X0VA 3KLHC 3X1BA 3TOPA 1ZT1B 2MSPA 2P8MB 4YBLC 4NZRH 1PX4A 4NDMB 4H25B 2Z64C 3DURA 5C07B 1GCFA 3DK2A 4IGBC 5JUEL 4ENED 1R3IH 1ZK5A 1V54B 4HXBH 4P2RA 1MFCL 1JPSH 1DSYA 3P3UA 2FDBP 3IBEA 3QDMB 4OCXL 5T8IA 1GY2A 1F3JA 1OANA 1E4JA 1CK0H 2IOIA 2VERN 5CJBA 1CXFA 1C16A 1IKNC 4FG0A 1E67A 4XPTH 4MLSA 1G1OA 2QQQA 3NCBB 1MFEL 2VKXA 3WKPA 4GQ9H 5GISH 3CPUA 1YEGH 4XNDA 5JHLH 5I1DB 2R51A 4N2HA 3V0EA 1FL6B 2DIEA 2WMPA 1A6TA 5FPIA 2EDXA 2CJUH 2W07A 4WUUA 1W9XA 4FABH 4YK4B 5HYJD 4UV7H 5I24A 3U36B 2B4CL 3S8GB 3TJEL 5F96L 1JPFA 3CGTA 4MJID 1FAIL 3OWRA 5IB3B 4FDWA 5EZLB 5KSBE 5HDBF 4WNQA 1I9RL 3Q9QA 1EMTL 1ETB1 1OPGL 2YPVL 1XR8A 2PNDA 2ZWLT 3I6KA 3SYPA 3QS3A 5CCJA 3FT3A 2E6JA 5DU7A 2G3MA 1C5CH 3QZPA 5IROC 4LVHC 5F9WC 3GLZA 3CZNA 2DQHH 3VXSD 4UT6H 4HLEA 4Z7UE 4MVBD 3M7OA 4WHYG 1WAEA 1OZTG 2C4XA 1L0YA 5KBMA 1MXDA 4OF3A 4RMUA 3TGXA 5CKAA 3K2IA 1JHLH 1QNZH 2JKLA 1S7UA 2NUPA 2YUZA 2ZX8A 3BAYA 3KS0H 4QGYA 3WHXA 5E6IA 1FF5A 3HJ0A 3X14A 3NFPA 1SY6H 2JCCB 1BD2D 2N0KA 3EH3B 3BN9C 4UOZA 3A67L 3QUYD 3JVGC 4OV5A 1BAWA 1CL7L 3MJWA 2ISDA 3S98A 3AY2A 3I3BA 2VERA 4FXKB 1LO2L 2OJZH 3QCTH 3FULA 1W8EA 4HUCA 2KS0A 4PWEA 4XRCA 5EMYA 1FFPA 1QLEH 4G1MB 5CBAB 3PDOB 1GXEA 2AANA 2AHIA 4N24A 3TIDB 3BUYB 3JBG7 1BBDL 1XIWA 4UV4L 1KC5H 3ILPB 3QFJB 5GS2D 4O2EA 4NUGL 5LWYH 1E43A 4RSVA 2WOBA 4ES8A 2WXNA 5H35B 4JY4A 1DQKA 1TDQA 3H0TB 1HINL 3OG4B 5T1LA 2DBJA 2J8UA 3CJJA 2DQGL 3TTSA 3HFML 1UT1A 4TUKL 3EGSA 2ZT9C 1UH3A 3TN0A 4WTXA 3E1ZA 4PWHA 3JZYA 2EEAA 2NTFA 1KIUA 4ZMNA 1WPCA 1NLBH 3RDTB 2Z6FA 3GLEA 1CQKA 1AKJA 4IU2A 4I2XE 1M2VB 3QCVH 4KRPC 2PN5A 1LMIA 3MBWA 1G7QA 3Q8FA 2Q76B 5CD5D 4GKNB 2KQNA 3F5WA 4W4NA 4XMVA 4AH2A 5GGQL 1OM3H 1A2YB 5LQBH 3DJZA 3SPJA 3LPGA 3ZDXE 4OQTL 2ZCHL 5HGDA 4I48A 2YQBA 3CZJA 1KCUH 4WK4B 5FDWA 4GG6E 3MACH 4XBEH 1KENH 1T2JA 3D39E 4JEGB 1KBWA 5BO0D 4XVTH 1TTAA 3BGMA 4OFQA 4S1RH 3QXDB 1R3HA 2FWSA 5MI0C 4L29A 4P23A 5LLIC 3I9PA 4Y4HA 1NCBH 4A7TA 4X6BA 1P4IH 4DERA 2F18A 5C08D 3CFDB 3I9GH 1KYUA 3ARFC 4KROB 4Z18A 1I9EA 3GT6A 4FLRA 1JVOA 4UQ9A 3IJEB 3EFDH 3FFCD 3P11H 3I74A 2VLRD 2QPEB 4UQBA 2X4QB 4OLZL 1SNRA 2XBTA 1MFBL 1E65A 2EYSA 4OJAA 4CN6A 5HPMB 2X4PA 4PGCA 1S3KL 3EDJA 2QFRA 4EUPH 2ALWA 1YEHL 3JTSA 3M6DA 3NJVA 2E7LC 4NFBA 4L4VB 5HGGS 4AGOA 1G9MC 1O6VA 2NY1C 4B7IA 2CDFA 1WFMA 5AUMA 4BFNA 4DP0X 1SXZA 4U1NA 8PAZA 3W9EB 1UB5A 1WC7B 5TFSL 4S1QL 5B1JC 2FBJL 3IJ7A 4YN3A 2BFVL 1A66A 2OA9A 2ZICA 4MDIB 5J56B 1A1MB 2MNWA 5DJ2A 4EXKA 5FOBA 1G0YR 4YLQT 4LDEB 1FN4A 4Z7NB 4NQCB 3SJVE 1RJYA 2P7TA 1AH1A 3PG2A 4R5VA 1YMME 4JO4L 5IJCC 4FHKA 5GS3A 5I1JH 3VJ6B 3QNYA 4IHOB 5JDSA 3TBYB 1F97A 1TU2B 2B59A 1UWXH 4XZUB 2EH7H 3FCTA 2WIIB 3BHBB 3KJ6H 3DWTA 1U4EA 2VXUL 3BWUF 1G6RB 1HS6A 2OI9B 2ZYIA 4FQXD 3E8UH 3ESUF 5CUSH 5I1GH 2WXGA 1AQHA 4L3EE 1KFAH 3C6LB 4AE0A 2OR8A 2O6FA 1OAYL 3ALXA 3B7RL 4WHTA 1KUMA 3O8XC 4XR8C 1AMYA 4JM4L 4Q97A 5IG7A 4JFPA 3L1EA 2W92A 5D5MA 5K9JH 3O41B 1BSIA 1WF5A 5DWPA 2XKNB 2PPCA 1MHHB 1JF6A 2AJUL 3BZ4A 3PGDA 4LARH 4PJFF 3UMNA 2AAVA 2EVIA 3GBMH 1WAAF 4NUJA 4Q0XH 2NNFA 4TNVF 4NC1E 4NYLB 3QRBA 1J5DA 5HJGA 4WENB 1C5DA 1WV7T 4B50A 2OSYA 1IZJA 4U1GC 4H8HA 5J6SA 2BIQA 1WISA 1DJXA 2OR9H 4WI7A 1H3UA 3RY5A 1CICD 1L9TA 5J9PB 1NGQH 4NNPH 1NEZA 3V0JA 2F53E 4YZWA 3QDJE 2CBOA 4Z7WA 4XCCH 4NO2A 4FLQA 3CFCL 1K4CB 1DQML 2CNYA 3IMWA 2ZYHA 4ZPVB 4RGOL 3KS0J 1HOCA 2GAZA 5C09D 4CADB 3C60B 3MLPA 3RZCD 3BUQA 3B5GA 2W65A 4HGMA 1SOXA 1J5OL 1RZJH 2Y5TA 2HKAA 3BJ91 1T20A 4QXUH 4HZ1A 4R26L 1I53A 3EBAA 1J5IA 5IHBA 5MHSD 2PXYD 4HWBA 1BZ7A 2FH6A 3FJTA 1JXKA 3LAFA 4X9FA 4NIYE 1A1NB 5DJDB 1T6WA 3OAWA 4HCFA 5D4HA 2YGNA 1T0PB 3LD8C 4R7LA 2YUXA 1K8DA 4IS6B 4NN7B 2AF2A 2XSKA 4TF4A 4G7SB 1O9VA 2BNQE 4HUUA 3OQ3B 4N2NA 4FQ2L 1J0KA 4KKAD 3FCGA 2K3TA 4QXGL 1I1CA 4BZ2H 3K4AA 4EKJA 5HGAB 1KTDA 1U3NA 4PJ5D 3U1QA 2VT0A 4HBCH 2F9BT 2X4RB 4JO3L 1UZ6F 3GLDA 3QWRA 1KTJA 1XCTA 4G72B 1N2RB 4JM2A 4AJWA 3LN5B 1I85A 4OLYH 1CLYL 2YMXH 4HPYL 4EI6A 3AJ7A 2G75A 3RL2B 4WWID 3ESOA 1QR1B 1MCJA 3HB3D 4PJAB 1HCFX 1YN6A 2AV7A 3B9VA 2QJDA 4EQ3A 4UOW0 1U8PB 3L95A 4WK0B 2R2HA 1FBIH 4OTXH 4N26A 3ULAB 3K74B 3HE7D 2NR6C 3BVNB 4R2GC 4LT7A 1BA9A 2XG5A 1NTDA 3EUDA 3WTSA 1J9RA 1XB3A 2LLGA 2F7OA 4NRXB 3QUMB 4WSKA 1T3FB 4G71B 4N6RB 3ARPA 1PJWA 4XTRC 3VFOA 4P5MA 4PWGA 4NO3A 5HJ3B 1RUML 2H0FA 2ZKHL 3L1OL 3BWZA 4GQPH 5DEZA 2HRLA 4ODUB 1HESA 4OZFB 4W93A 2IALB 3EYSL 2F0CA 4ZSOB 2AZAA 5B7EA 3W0WB 3EYUL 4DFHA 4NZFA 2B14A 1JZ6A 4ONGH 4JL1A 3F2LA 2VXSL 3SQOL 4NBXB 4AQAA 5AVTB 3BEVA 3DUUA 4BQ9A 4GW4B 4TRPL 4E9VA 4RMQA 4PJIA 5I19H 4Z23A 2Y5QA 3TO4A 2YEZB 3B4NA 4RDBA 4MXQD 3Q2CA 4Y2OA 3N6YA 1DSFH 1B4LA 4OAWB 4TUOA 3EJQA 1UM5L 4W9LC 5AL8A 5F88A 1DVTA 1CO1A 3QJZA 3ZOAA 3CH1B 1N8OE 4KNTA 1FE8L 2XHNA 3NGBC 2EH8L 5D7IF 2R29H 1HHIA 1GJIA 3ASOB 1JZEA 2FZ3A 3FQTB 4IDJL 5ABZA 2LOEA 5T3ZH 2YPVA 1OTSC 1J1PL 4MMYA 3MGOB 5LHDA 1KXQE 3WS6A 3IMBA 2MKLC 3DTDA 5F7DB 3PP3H 4KI5E 2YLKA 3WN5C 2J57A 2Z93B 3ELQA 2RH0A 1GGCL 4HLJA 3FTZA 2R1YA 3BP6A 1UZGA 1UVQA 1AZNA 1DANT 3FQWA 2X0UA 1IAIL 4WTZG 4HBQA 4Z3EA 1CYGA 5IJVB 4YIQA 5EOQH 4Y4FA 3CXHK 3EHBB 4QD2E 2YSSB 1BPVA 4X80H 5F9JB 1URIA 4TSBL 4EEEA 4G43A 4GW1B 5D70H 4M1GL 1CDGA 1RPUA 1RPKA 4G8IA 5J3HC 4QRPA 3OJ2C 1PKQB 1PCSA 3D2TA 4XP5L 1MAMH 2E7DA 4G1EB 5TE6L 2R23A 3HAEB 2ZOOA 3IB4A 3VFVB 1NFDE 3VI4F 5I1IH 3FT2A 3BD5A 4MJ6B 1J8HD 1R33A 2P8PA 4KAQH 5L88H 2JFCA 2BJMH 5GRVL 4R5TA 1SF3A 3D69A 1EBPA 4S1DC 1UH2A 3K2UL 4P2OB 1YEJH 3I75A 1TVBA 1XWVA 1Z0MA 2DJSA 3THML 1RZJC 3UDWA 5I1CL 4XVJH 1CZ8H 5FO2A 5J12B 2DIAA 3SE6A 3WY2A 3WFCH 4FTVB 3CLFH 3OSKA 3NCJH 4RA0C 4ZX3A 3FUJA 1MWAL 3UPAA 1QFWM 1X4ZA 3GXIA 1OGAA 4Q6IA 5E56A 4X5PA 3PWVA 5LGHH 5DJCA 3L7EA 2AQPA 5CLZA 2DWTA 4FG6C 4UDTB 2XJKA 4J23A 2WXKA 3FQNB 2P47B 4MDJA 2F58L 3K6DA 3BI9X 3E2HC 4QY8B 3KXFD 1RIVL 2V9TA 3L3GB 4OQTA 2ARJB 3CSBA 2HXAA 1FNLA 1KELH 5IGXH 5EU7C 1OKEA 3D12B 3H7BA 3V4PB 1ZPLA 3HE6B 3JWDL 3FTWA 4NKQB 5ICYB 5I9QB 1NCCH 4ETQB 3A22A 1RJZA 3PL6A 4ZFOB 1RZFH 5DRWA 5JHDD 2GBAA 1GYVA 1TQVA 4GKZB 5KBLA 5LGKA 1EJFA 1Q0XH 3CSGA 3QUZB 4DNLA 5I1HL 5LDSA 3FAWA 5C0CD 5JW3H 4BH8A 5EU6E 1FO0H 4LHUA 2Z8SA 2VZTA 3F01A 4GBXC 2EEBA 4JVPA 3MRRB 2GJRA 2Q7AA 2DY2A 3Q7JA 3QP3A 1TTRA 2AJYL 1QTYT 4N0UB 3HLKA 5FM5M 4KGLA 4CRPA 4I18B 1FG2A 1VEMA 1TVHA 2VL5A 3NJMA 3MV9E 1KCRL 4XH2A 1GC1L 3D25B 3T0EE 1F1AA 5JQ6L 3QC5X 3ZTNH 3MLTA 2A9ML 3KLHD 1FNGA 2OMVB 3H3PL 2WZPD 2VDKL 2UZYA 1MY5A 5AWNH 1EWHA 3SHSA 2CJ3A 3VE0B 1OAKH 1L3WA 4IGBD 4JKPL 4JRWA 1U3HC 4NQXA 4XMKH 3K8KA 2VXTH 3SCMA 2OW6A 3ZHNA 1PTZA 4YSTA 5G5DB 2ICEA 3D4GA 3MI6A 5HYIA 4HEPA 5DS1A 1EVTC 5I6NA 1R5IA 3E80A 4JRYE 4BKLA 2A3TA 3Q06A 1TTGA 2A4ZA 2EDEA 4M7KH 3QDAA 4MNGE 4PJ9A 1SOQA 4ZS7L 2H8PB 3HRZC 1EGJA 5E9AA 5T5FA 3AM8C 3ZRSA 2QZQA 2NT0A 5FYJL 4H2AA 3D5OF 3C6SB 3T2PA 4DEPB 1VACB 4JANA 2YC1B 2XJLA 3LQMA 4LP5A 3NA4A 5CJQH 3T3PF 2GUOB 3DX9B 4QRSA 2Y6TE 1YYMH 3WJLC 4Z0BL 5KSBA 4W9IC 2ZE0A 4AKOA 2IJ0C 2CJTA 2DLEA 5J6GB 2I07B 3KPSD 4NHCL 4L5FE 2WBJA 1UJTA 4HS8H 3BP7A 1WAPA 4HCGA 2F8XC 2EO1A 3FU0A 4OD3H 12E8L 2Z8VC 4WI5A 1XGYL 4Z7UA 5GRYA 5BVPL 5CEXA 2X42A 2WLMA 2J5WA 4KQ3H 4OGZA 3D3VA 5IROD 3K7UA 3D9AH 3UYPA 1F3JB 2I25N 3QZMA 3BH8A 3G08B 3D07A 3GSWB 5KJRH 3FQXA 2X6CA 5JW4R 4K9EH 1EHKB 4WHYH 1YLBB 3OKKB 3LIUA 1GIGH 1HILA 4M1CC 2BH0A 3HVNA 4S2SA 1TF4A 2J5LB 3BN9D 4QRRE 1FYTD 3Q2VA 5DHMC 4UWQB 3FCSA 1SQMA 5I8KL 4CVXB 3MODL 2XXCB 4IHBA 1YPZE 1KBGH 3QR2A 4M62H 4D0CB 1EDYA 1MUJA 1B4TA 2CUIA 2F5AL 3CIAA 4WUUB 3SD5A 2WCSA 5D7SH 3VYNA 1JF1B 3VG0L 1I4FA 1V7ML 4K3EL 4JZJB 1JPFB 2HJLA 1B4RA 4DN3L 3LHAA 4FQHA 4DPCX 4DT2A 5SV3A 3UG3A 2X4SB 1WD9A 4CGUB 3DHPA 4NPYA 2NXZD 1N70A 1W80A 3HUJA 4LU5H 4XN1A 4CMHB 3FF7A 3DNKA 2BY1A 2GYSA 5DK2A 4ZUSA 1JZ4A 5E94A 4ZDHA 4TN9A 2AS5M 2ILLA 3K6IA 5ISZE 4XNYL 4YPGA 3IU4L 1QBLH 1TZIA 1I1AA 1M05A 1JOIA 1NGYB 3CE1A 1D5ZA 3P40A 4KRPD 5D93C 1HQ4B 4AJYV 1BZDA 4NQQA 2IADB 4YZFE 3W2DL 4WW2F 5E2VL 4IIZA 4B9PA 3SBWA 5IMKB 1YJDL 1N59A 3K71A 1AGEA 4UDUA 3D39A 3H7LA 2H1XA 3NG5A 1S7QA 4U3SB 2XX1A 3ARGA 2P52A 1NC4B 3BCDA 4JDTH 4NPJA 4OZHA 1TXKA 1LNUB 5HJBA 4OGQC 4KC3B 1XIWB 2P49B 3F7YB 3P54A 2FO4A 3ZZ1A 3WFHA 4FA6A 4AEIL 3L9RB 4PV8A 1JFQL 3ARFD 4R90L 3UGEA 1KY6A 5D1XB 4I1NB 1GMIA 3BVXA 5TQ2L 3EBGA 3ZHKA 2J8UB 3JTBA 4PGDA 4Z7IA 3VI3F 3UPCA 4DZ8B 2QSVA 1FVCA 1F42A 4X6FB 2NTFB 1QA9A 4LSVL 5I5JA 4LASH 3OXRB 3WHE0 2PPEA 3NZHL 2NY1D 1ZAGA 5DMGC 3ZKXC 5IBUG 3N9GH 4HISA 4JZNA 1G1CA 1KB5B 2IPKB 3NIDB 5EBWA 4OR1A 4BUGA 3F5WB 3MV8D 4AH2B 1M4KA 4OIIH 3GZOA 1KJ2L 4OFYA 1YMMA 2O5XL 4FMFA 1JPGB 4HJ1A 5GPRA 4ZZFA 5K9KA 5AOJA 5HGDB 3SE8L 1CC3A 2FJFA 4ANUA 1AAJA 2GC7C 4RETB 3IRPX 4KZDL 3PQYD 2IV8A 2CR0A 1I3UA 3LVEA 4YVNA 1OV8A 5MENE 1WT5C 3SGDH 2DLGA 2ED7A 3PNWA 3P02A 1NJ9A 3CDGA 3WKML 1FGNH 2XIDA 1RUKH 3V0FA 2QVKA 3B9AA 1KCKA 4G8AC 4R8WH 2ZONA 3SKJL 3DIFA 1F2QA 5DYFA 3WNKA 2D7NA 2OMYB 3KHQA 3MOQA 3O9WC 1GZPB 4BD4A 1YEEH 2P3YA 1NAMA 2EDTA 4P3CH 4PQXA 4E5XB 2EYSB 4G8FA 4AGQA 5L4IA 2UXTA 2H3NA 2X4PB 3NJKA 1JVKA 5KSUA 3QEUB 2BY2A 4K3GA 5ICXA 3S3DB 1ZT4B 1BPLB 3O8XD 4QT5B 4PYHA 5IIEB 2D7TH 1SXCA 4KO6A 2CDFB 3K72A 1KCBA 4U0RB 4DP5X 5K9QG 4GLRH 1TJXA 1A14L 3ATBA 3IGKA 3VXUD 2VDNL 1KGWA 5T1JA 2Z35A 5J7CC 2GSGB 3X3GH 4EE2A 1DANU 2Q6WA 1FN4B 1G6RH 4LSTH 2C9UA 1J11A 1RJYB 1NBZB 4GXFA 2OLDA 2P7TB 4KKQA 3QDJA 3UC0L 4P99A 5HYSA 5JZ7C 3MGTA 3G6AA 1SYSB 2COQA 4NQVB 1F90L 4X9HA 3QNYB 4UM9D 2ODHA 1FIEA 3VRJB 5AW6B 3FCTB 4AL8C 3RJQB 4JS7A 3H9ZA 1FLTX 3EH4B 1NGXB 2O6DA 2C1OB 1MH5B 3NJJA 1F00I 4PLJC 3HC0B 3T65A 2VAJA 3GXMA 2CZNA 3LEVL 5SWSD 3CFUA 1WFOA 4KXBA 3VRIB 4Z9KB 3S8FB 4P9MH 1IV8A 2H2PC 5E99L 1J0IA 3HS9A 3ULVC 4L37B 5BVJA 4BEIA 4NKDA 4AEHH 2W0FA 4FXGC 5IG7B 3JT0A 3MUJA 2VDQL 3CUPA 5DEGB 4BXSV 4DTGL 2BNQA 4G3YH 4DCQA 5BPPA 2APSA 3EO0A 2ITFA 2Y23A 4FXKC 3EDEA 1VIWA 4WI8A 5D1ZI 1MN4A 1T22A 4ISVA 2H32B 2Z8WC 1MJ7H 3BQUA 5HHNA 3KWVA 3CMGA 3EYVA 3AGVA 1VEOA 2XWJA 3BT2H 1MJUH 4P4KB 3CIQA 2RQ8A 1XFPA 2UVEA 3ASWA 3DX7A 4H4NA 4JFFA 4BA8A 1NEZB 5L2KD 1A5FL 5EORH 2JE8A 2PP7A 1NDMA 2XG4A 3ZL2A 4PGJA 2H3KA 1AGCA 4LP8A 3P9LA 3PAUA 2XUWA 1N0XH 1RZGB 4WFGD 2NZ1A 4XP4L 4F2ME 2EDRA 5D7JB 2V7HB 3RWFA 4DO5A 2GAZB 3S3BB 3IMTA 1ZV2A 4BH7B 2BLFA 1KJVA 1MI5D 1T20B 5G55A 4PJGE 3V5DA 5IZ7A 4JFEE 2XN9D 2X9YA 1BZ7B 4R2GD 4MJIE 1NEZG 1AGBA 4TMPA 5EO9A 4K7PL 1JHTB 1NUNB 3TU6A 4XTRD 2X4OA 2QEJA 3LNHA 4A7GA 4LSPH 4HUUB 2C9XA 3L4TA 2UY6A 4OGYL 1WIPA 3CSFA 1ZLEA 4GT0A 3S37L 3KPOB 4MHHI 3UG4A 3VXSE 4RDQG 2YUWA 4MXWH 2JI3A 3NJLA 4PM1A 1BVKA 2F5BH 3CV5A 5ESAA 3OKDB 1BFSA 1WWCA 2IG2L 4E9TA 1MCDA 2MEJB 4KROC 5TE4L 2EVJA 4BSWB 3GDCA 4QR7A 5B21A 2AP2A 3QUMH 3S7GA 1UURA 1N7ML 3MLWL 4FQ1H 3MJ6A 5AG9A 1BYNA 4X7TA 1YN6B 1X44A 2AQRA 3G5YB 3NUKA 1F58L 4OZFH 4I3SL 4DPBX 1F1GA 2XA3A 4X4ME 1PF3A 2B9AA 4RFEA 3F7LA 3VXNA 4KNQA 1KXQA 4CKQA 1LYQA 1OAJA 1WO2A 2ADGB 2HG5A 2XG5B 4W9FC 3RNKA 3P77B 4C4KT 1CFTB 4U4BA 5FKAA 1E4WL 3ALPA 4QF1B 4C83B 2OMTA 1OTSD 1YQVH 4Y1AB 5LAPA 3K2KA 2BHZA 4N87A 3W39A 3U6RB 3EGDA 1FJ1A 4JVWA 2V33A 4NO3B 3FTSA 3U7YH 4HKBA 4JQIH 1XTLA 5CP7B 1IEAA 1PG7L 1VENA 2CO3A 1CLVA 3CD4A 3JTTA 4FOMA 5DZOA 1TZGL 4HU8A 2GITB 2R69L 4QXTA 2BFGA 2ESVD 5BMFL 4AQAB 4ZMXA 1KFGA 3WAKA 4F93B 1FNSL 3IVKA 3UFIA 1N68A 1E28A 4PJIB 3TO4B 5AW1B 1Y07A 2JB5L 5CSZB 4TUOB 1HHKA 2IAAC 4UILH 3C6LC 2UWEB 5J3HD 2YGQA 5I8OH 1OSZB 2BSEA 1EEYA 2UY7A 2ZSVA 5J1SC 1SMAA 1AR2A 1HHIB 2X3CA 3CDZB 3FO2A 3SDCB 3ULUL 3W81A 4S1DD 1X4YA 3NJXA 4HXAH 4ODXB 4FADA 3ZQXA 1YA5A 5I0DA 4JY6A 4MQXC 1DR9A 4OLVH 2J8HA 2WLYA 5D8JH 3V9CA 1HJBC 4HULB 1L9QA 1DVSA 1U8KA 3A6BL 3BP5B 2VLRE 3BP6B 1YNTA 2LAGB 5DVPA 2ADJA 3VM5A 2K45A 3EH5B 4PJ8B 3FQWB 4JCWA 5KSAC 4XMPH 3HAEH 2Y7QA 4R83A 1ZGLP 4FG6D 4EI5C 5KVEE 4P9HL 1PY4A 1JZ5A 4PEEA 4ZRGA 3RQ3A 5A2KH 4GAGL 2YPLB 4M6ML 4ABQA 1KG0A 3FT0A 4NENA 3EJUA 1XX9C 3QWNA 4QRTB 4RX4D 2CGRL 2AJSL 3BH9B 1A4KA 2GCYA 3FT2B 4JDZB 2IQ9L 1E2ZA 1A4JB 3PXJA 2MJWA 4UANA 3TP4A 3U48A 2D3JA 3ZTEA 3LNGA 1VPOL 3WMSA 2JLLA 4LFHG 3VTTA 4NN7C 3HG1B 3Q2WA 4RQQA 1TPXC 1IGJA 3O6ML 1DBAH 2F54B 3BLBA 4CDHA 5FHBL 3MJ8B 1XGZA 1AZVA 3DI3B 5IUSA 3ABZA 3U1SL 4GBXD 2E27H 4G9DA 1K6QL 5E1IA 1NCOA 5GS1C 3R18A 2IGFL 4UOQA 3H54A 1S9VA 3MV9A 3V4PH 2AGJL 3B2PA 1OGAB 3T0EA 3O0RL 1NCWH 3HJEA 3PWVB 3QZLA 3KE0A 5T1MA 5EBLA 3MRLA 3KHOA 4IJ3B 3LNEA 3LSOA 4MDJB 2Q5BA 3SDAA 1VSCA 3ECWA 1BYOA 4KVCL 1JL8A 1RUQH 4XPGL 1NAKH 5I1KL 4IRSA 3A47A 3V5HB 1N26A 5TH2B 4OIFA 1UOWA 3H7BB 4HETA 3U83A 1DJZA 3BKMH 1U3HD 1EZUA 4ONOA 4R7NA 1D6EA 4ZUUB 4L4TB 2GI0A 3OPZH 4JRYA 4OH2A 5FA3B 6TAAA 4YFEA 4AMWA 2CO6A 3CWGA 4MNGA 5K39A 1Q1JH 2MH4A 2P5WE 4HF5H 3I50H 3DRQB 3E0GA 3BGFB 1MNUH 3BRGC 3ESVF 4LHUB 4K2UL 4DHLA 1GS6X 2KL6A 2X1WL 5JDJA 3O11A 4Y2DA 5C09E 5AYUL 3MROA 5IMOA 1V3MA 4M93B 1T4KB 4C8XA 3CQQA 1J7VR 4HIXH 5AZEH 3QJSB 1IKFL 1SFDA 1HX0A 1URLA 4KKNA 3UTTD 5T3ZD 1ILUA 4PI0A 1SHMA 1CGXA 1W72A 1INQA 3FYEB 3NN8B 1G4MA 1QEWA 5L4JA 1EA9C 3MLTB 3HN8A 5LNDA 2CDGA 1AYOA 1K8IB 1T6VN 4EO5A 4LHUG 4AENA 4OJCA 2UZYB 3KLDA 1W15A 4PVNA 2WLJA 3HMXH 1S9KC 4WI0A 4B9KC 3QIUC 3WUWB 4TVUA 3QJUB 2MCG1 2KDGA 2ICEB 2JKNA 4XMLH 3MBXL 2KZWA 4GSRA 1BBJA 1R5IB 1XD1A 3MTRA 5G4NA 4BKLB 4MJ2A 2EADA 5EFIA 3V5KA 5BZDA 1OGTA 3BXNB 4PJ9B 3MLVL 1FNEB 4IDLA 4YH6A 4BA0A 1HSAA 5FUOH 3QFGA 3WI9A 4M1CD 2ZUSA 3TF7C 1LK2A 2I60H 5AVVB 4PREA 4WW1B 4OFIA 5B38A 2X41A 3CBJB 3ESPA 3V4UH 5HYQB 2QKIB 3N5AA 5ID0B 3FU7A 5TPWH 2BIPA 2VLMD 5CF3A 4NO0D 4V2CB 3EHBC 3V0WH 1JHKH 3VXMD 5D71L 3T6XA 3TA3C 3L3JB 4N85A 1MREL 2DQFA 1AI1L 1QRKA 4O2CB 1QACA 3TWCL 3FZUC 4RAUB 1IB5A 3RI5K 1D6VL 2FWOA 4JFTA 4FA8A 2A99A 4A2DA 3CFBB 2WBJB 3P4OA 4Z7VE 5IFAL 4G11A 4U1MA 2XWBA 3DUHA 5F1NA 2RALA 4ZTOL 4MXVF 1TQWA 3S5LA 1Q9KB 3FOMA 2X1XR 3IBOA 4KXAA 2V8LA 4P2OC 3GMMB 3ZGHA 1FYHB 3O6FA 5TDNB 1W0WA 3PS6A 4FC3E 1SN0A 1HIMH 3GS7A 1H3GA 1I9IH 4PY8I 3WU1A 5EUOE 1HILB 1L7TL 2VRAA 4LGPB 3TCLB 1Q38A 1ANUA 2MOVA 3TEYA 1GVIA 3FBKA 3V0VA 1YECL 4X6DA 4R4FH 1OP5K 5LCVL 4OT1L 2P9RA 2YN3A 3BFWA 1FC2D 4LRIA 3KDPB 3R06A 3GO1L 4W9GC 5KG9A 3QGVA 3SGJA 1A6WL 4DGYL 3DUSA 3ZMRA 2DQUH 1Q9WA 5IMMB 2HFTA 2Y7NA 3VU2A 3JWNC 4LGSB 3Q5OA 4G6KH 1N0LA 3QIWA 3WIAA 2DDQH 4XPHH 5CXPA 2QLVB 2WINB 3IEAA 1OAXL 4GLRI 2Q86B 3QQ3A 5E6YA 2JSFA 3HE6C 2O6CA 1EO8H 4GPVA 1PYWA 1N64H 1SMDA 3N1QC 4H8PA 3OPUA 2WLIB 3G7TA 1WEJH 5I9QC 1LO5A 3SPGA 1M7IA 2QPDB 1E4XL 1TFHA 5DJAB 1F8TL 4LDOB 5E2UL 4AG4H 4JMXA 5L9DL 5L0QB 1INDL 2VR8A 4MYWB 5DK2B 4ZUSB 3GSUA 4GOSA 4WGVB 5F9OL 1PIFA 2GW5A 5HDBB 1QBBA 4IBSA 1TETL 3FO0H 4PW4A 4ZJ9A 1T0OA 1IAKB 4TSAL 3MBEA 5B8CA 1U30A 4DP7X 4JHBA 1M05B 1QFWL 3EO9L 5I2IB 1KCVH 5DMGD 3SDXE 5KYWA 4J2XA 2P42B 1CD9B 2JIXA 4EN3B 2FRGP 4WFHD 5D7EA 1OCRB 1S2EA 1AGEB 4XPAH 1RIUL 1BM7A 3AY4A 3STBA 2JH2A 4AUYA 2VMDA 4O9HL 5MENA 5C0AB 1JNLL 1HHJA 2XV0A 4OZHB 4M1DH 5CEZE 3OHXA 3V6FB 2CXGA 4A2LA 4F27A 1MFAH 3BUTA 4M43L 4FQLL 2VE6B 2FO4B 2CBTA 4V1DD 3ZHDA 1HDMA 4LVEA 4LVNB 2WUCL 4UU9A 3IGAA 3S35H 1J12A 1AD0A 3I2CL 1R4XA 3QDMD 3DMMB 2G9HB 3GHPA 3M8OH 3O9WD 3TIEA 1KB5H 3V55A 3NDYE 2UXVA 4H0LC 5F70A 3G9AB 3EADA 2OTWB 2ZUYA 5GZOC 4WTWA 2FB4H 5DJ8B 4YHLH 1VKXB 4JQXA 2QR0A 1D2PA 1JD7A 3IXTB 3GJFA 2EO7A 3KG5A 2I26N 3LS4H 4JG0L 5C0DB 3DO7A 3APDA 2XQ0A 3BJLA 3LQZB 3NESA 4NN5B 4YDKH 3ECUA 4PCKA 4AC4A 1OAUL 4DEPC 2GC4C 4NOBA 4LXFA 5HDQL 4GP8B 1DBBH 1LWHA 1JTTA 5GRWA 2ZWSA 1CFSA 1WFIA 1QYGL 1IBBA 1HN1A 5JHDE 1IILE 1NQBA 5DMKA 4NI6A 3OAUL 5JZ7D 1RUPH 5C0CE 1SJMA 2XZCH 5CP3A 1QUNA 4WJG3 3ZDXF 5IK3B 1NICA 4TKWA 3WXWL 3ZK0A 3VD1A 4DP1X 4GG6F 1ID5I 1NOAA 3DIFB 1SJVA 2R0LH 4GSDH 3QJTB 1RU9H 4PLJD 4C54A 1B0RA 4X5RA 2WWKT 3KLAA 3ZGIA 5D2LE 5LDUA 1OIOA 3LZFH 2H2PD 5HVHB 5B1KA 1KEGL 1RQ5A 4F2FA 2OSWA 3ULVD 3AWEA 4WV1C 5ICXB 4RFOH 4E41E 3DDGA 5KVFE 2EUWA 1HEZB 1ZANH 1SDDA 2HRGA 2CALA 1LO0H 1S9YB 2EIBA 2J1YA 5LJYH 1JYNA 5ID1A 2LT9A 1F5WA 4JGMA 1C12B 1HZHH 3ABMB 5JXEA 1CXEA 3UGUA 3T6QC 1A22B 4PLKC 5DJ0A 1R5WA 3S97C 2Q6WB 4S11A 4OCMC 4OCYH 4JZJC 3ZPDA 1L7IH 4J6RL 4HH9B 4EQ2A 3NCWA 3LCYA 5JXAH 3FSWA 5KAQG 1MWAB 1NSNL 1IGIL 5I28A 4CMHC 3QQDA 5FB8B 4C4UA 1DFBH 2XIIA 1F11B 3MYZA 5TGBA 3HG0A 4KRLB 5F2FA 3CXFA 2CE6A 4AIZB 2DWDA 1JJUA 1LLAA 1ZEAH 2Y1YA 1I8IA 3FU9A 1ZSDB 3MRNA 4P2AA 4X8GA 3UBXA 4TLSA 1NCJA 5MEQA 4MJIA 2A74C 2H32H 4PJDA 5BVJB 4HEME 5HYSG 1KYOK 2ZF9A 1JGDA 2W91A 4HA1A 4LOEA 2N56A 5F1KC 1IVTA 2KH2B 2AV1B 3MRHA 1I82A 3U4BH 4DZBA 4HUNB 4WKZA 3VXSA 1S7XA 4YSOA 2E3VA 1BQSA 4MA1B 4LLQB 4HIEA 1EJOH 2QLYA 4M5YL 1JXGA 1WJ3A 3MRPA 5J1TC 4EIUA 1HK6A 5B3NA 3EYVB 2NSQA 4X6EB 4UINH 3RPKA 4A04A 2PPAA 4UQDA 5KVGH 4PJFB 2AK4B 1PZ5A 3OKNA 4W9CC 3QUYA 4YDJB 2IH1A 5FYKH 4A6YL 4JFFB 5EZJA 5DVMA 4PJXA 1NANH 3LKQB 3NSJA 4KVPA 5IKCA 4HWBH 4IMKA 4AIOA 4KROD 5D1XC 3SO3B 3TX4A 2O5YH 4HCIA 1KZYA 3KLQA 5T33L 3K4DA 2OK0H 2J20A 1K3IA 3MV01 2DWSA 3C9NB 5FO7B 3KPMA 3US9A 3WLBB 4MNQE 1A7QL 1KJVB 1KTBA 1FDLL 4W9HC 4L4VD 1V3LA 1YUKB 2AEQH 4K3JH 2VDKB 5F1IA 3RUGF 1PLCA 2N3JA 1IBHA 3B56A 3ISWA 4AVHA 2CO1A 4ZTEA 4N6QA 3W9DA 2LTQB 4W9EC 2B2XL 4FP8H 2ZCKH 3AREA 5KZCD 4JRFA 3GXFA 2Q87A 4BV1A 1ZTXL 1X7QB 3HPLA 4OCRH 3LPPA 4HQQH 1AZRA 2J56A 4GG8A 1TMQA 4LLVA 3QQ4B 1KLUA 5EO0A 2ZYRA 4WWOA 1SRDA 3EO1B 5ESAB 5I6LA 5J6HA 3UC2A 1F56A 1PPIA 3KGTA 4QHLB 1E9PA 2VLJE 1ZHNA 4N9OB 2DKUA 2BVQB 3F83A 4J8RB 1Z9MA 2AABH 5JUEH 4P0DA 5JO5A 2GK0A 3Q1SL 5D6DC 1EIBA 3QA3A 1MFCH 4GUPB 5IR1A 4ENZA 4DK5A 1XR9B 3C6LD 1HH9B 3HR6A 4OCXH 3ZZQA 4JKMA 1E9OA 3B3BA 2AQTA 5C6PB 1A7NH 2VABA 3O6KL 5C08A 4U0RC 1Y6MR 4TNGA 2XV2A 2EDFA 5FKAB 4Q58C 2QSQA 5GIRB 2VLRA 3DROA 1MFEH 2IBZY 4ODSL 3T8XA 4ZPTA 4U05A 5E8OA 1U3ZA 4MQXD 4R84A 4G6FB 3FB8B 5D7HA 5IESH 2PF6A 3LEXB 4J3SA 2FNBA 4M3JA 3K81A 5LBVA 1N6VA 5BV7L 4QXTB 1JWSA 4LF3B 5KSAD 5L8LB 2VN5A 1HXKA 1NBVL 2B4CH 2JELL 2R56L 3TJEH 4L9LA 5F96H 3UO8B 1M7UA 4DEWA 2DW5A 4EI5D 4JFDE 1FAIH 5LCVA 5DZJA 4HOMA 1I9RH 1C08A 1EMTH 1OPGH 2YPVH 5T5NG 3MV8E 2ZXDA 4GEIA 4HAGA 3U79A 2FO8A 2XQYA 1XH1A 4GRMA 4GXUN 5GGUB 2A73B 1CYWA 2UY7B 1U8JA 4PRHE 2ZSVB 1IGYA 5E1GA 1YZZA 2EIZB 1L6PA 1JXDA 4FQXA 2CO2A 4QWWC 3A67H 1CL7H 1WITA 4HMCA 2NUTA 1ND0A 2MWCA 3L3IA 1QBML 3NFNA 5D7IB 5IW6A 1LO2H 3E3QE 1T80A 3NIGB 3BX7C 4ONHA 2MHAB 4P4KC 2AEPL 4L48A 3I6GB 5EU4B 2O4EA 4DVRL 4AYFB 1PSKL 1N8ZB 1HCVA 1G5GA 3X13A 5IQMA 4KI5F 5J0BA 1SEBA 5F3FA 1UUNA 1BQUA 2HN7A 2XPZA 1BBDH 4UV4H 5ITFB 5T5NF 2Y7OA 5KS9E 1R3KB 4QHUB 4GUQA 5D7JC 1M9WA 4NP4L 4UTAL 5I17A 4G7YL 3GRWA 4XO4A 4I4WA 1OPOA 4MQ7A 2Y5EA 3MKKA 2I9TB 1CICA 4NENB 1EXUA 2DQGH 3HFMH 3MRBA 4TUKH 1KJ3L 1GOGA 3AT9A 1A4KB 1KXVC 4X4YA 1EZSA 3WUZA 4GMSH 3N3EA 5EEVA 4PLOB 4XVOA 1ECZA 4KDVA 3PCYA 1P2CA 5DQJA 4AQ8C 1AFVL 3AG4B 5HGBB 1PU0A 1IGJB 5C09A 2OYPA 3RZCA 1GTFA 1NFDF 4HHAB