3UIZA

Crystal structure of sefd_dsca in d2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
133
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIVGNKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
molecule keywords Chimera protein of SefD and SefA
total genus 20
structure length 133
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uizA00
3UIZA 2CO6A 2FVNA 2CO3A 5D55A 2CO2A 2CNZA 2CO1A 2AXWA 2IXQA 3UIYA 4OR1A 2CO4A 2CO7A 2CNYA 4PHXA
chains in the Genus database with same CATH superfamily
1OGSA 4HUVA 5EC2B 1RURH 4N9OB 5F3HB 4J27A 4NCC2 5EUOF 1J0KA 1IGIH 3C5ZD 3OAWA 4LNVA 3OHXB 2BH0A 4ZJ9A 3VNYA 1XB3A 1GZPA 4L3EE 5F1NB 5CM1A 1MAJA 3P4NB 3GMRA 2MJWA 4MNQB 4MFHA 1QW8A 2XIBA 3EDFA 1YA5A 3MOAH 3SHSA 3QWQB 4X7FC 4QHUB 1AKJA 2WLKA 1AZBA 4EZMA 1RUPL 1FVCB 5LJYH 1O5PA 1O6SA 4O02H 3WKNA 1Z9MA 2ENYA 5DHVB 4HCRA 2AI0L 2K6ZA 4AJWA 2OI9B 2WQUA 1OCOB 2QSTA 2O61A 5F7FA 3FFDB 1MLBB 1O9ZA 1V7NL 1NGXB 5T1KB 3ULUH 1NINA 4Y16C 4Z7NF 4IK7A 3QO0A 3KHOA 2K3HA 3V0IA 5I2IA 5IR1A 1P7HL 3CLFL 4MCNA 4OFYA 3R0NA 4QI3A 4OM0H 3K5RA 4A63A 5DEFB 2P42B 4IRJC 2KUTA 5FF6B 5F3HA 4L5FE 2NTSP 1AQHA 4PVBA 4OCNC 3QFJD 3N44B 4CW1A 4FA7B 5CLYA 3MODH 3ZKSD 2R9HC 5C08D 4EI6A 1ECZA 4N24A 3FN3A 4V1DE 2X2HA 4K94C 3G5XA 4MJ6A 5T33L 1MFNA 3PXJA 2GTZB 2Z4QA 1DR9A 3WNJA 5TPWL 1BGXL 3NH7L 5DQDL 3DX1A 3OKEA 2ZT9C 4GT0A 4TULL 4MA3A 4W9ZA 2WSKA 4PTTA 2J5WA 3VW3H 5IEKA 5D1ZA 2HLAB 4MCMA 1J86A 2ZOUA 3QIWA 1MCFA 5J1SC 2CHDA 4UILH 4QEGA 2ITFA 4GFXA 1I8KB 3HZ3A 2XG4A 1HQRB 2JIXA 4HEMA 3EH3B 3PU7A 5DGQA 4BFOA 5MEOB 1YC7A 2OM5A 3V0DA 5A2CA 4JFFB 4H1LB 1YNLL 4LO9A 4AKPA 2P8LB 1CLYL 1ANUA 3DUSB 3FO0L 4NQDD 3VWKB 5DJCB 3WFEL 4MQSB 2ERJC 2X4OA 3F7PC 3P77B 1WIUA 3BZ4B 2Z1KA 4K7FB 3LNHA 4PTTB 4H26B 2WBJB 2VC2H 1HS6A 5EULV 1UOWA 4RIRB 1FNSL 2FX9H 3ME0B 1RPUA 3AY4C 1QI5A 2Z4QB 2AJZA 2IFFL 4KZ0A 4PRDB 4ZUTA 2EJ1A 4HWEH 5A2AA 4EXKA 2ADFH 4JCMA 3SO3B 3BPLB 5SWSA 5IBTL 3UTTD 2LV4A 5IEHB 1DJZA 1PJWA 2E9BA 1DJWA 2WZ6A 3BEWA 1I8LC 2X4SB 1S9WB 1WAAA 1WD8A 3FFCB 5DMIH 1A2YB 1LWHA 3F7VB 1A7OL 2H8PB 4FNTA 4QDGA 2C5DC 5D96C 2CXKA 3K3QA 4Z7WE 1ID5I 3QJFB 1G7IA 3ME0A 4IOFD 4YFLI 4CMMA 1ZLUH 5SX5H 4YNYA 3U9UB 1YMHB 4P04A 5KBNC 1N26A 4NGHL 5JIPA 3WIHL 3ZYIA 2XBDA 2XQYA 3EO9H 4LEBA 1EDYA 3TVMA 2QKIB 3EO1A 2I9LA 1K6QH 5E56A 3D12B 1PY9A 4PW9A 4WFFD 2NLJB 2NY5C 4FCHA 5K9KA 3IDIA 1XR8A 1AIZA 1KTBA 1OTUC 2LHAA 2WOBA 3AC0A 3ZKMD 5MI0C 1FRGH 2V2XB 1BWWA 5DUBA 4WGVB 4F2EA 2FHFA 5L2JB 4P2RE 4BDVB 1AMXA 3QIWB 3QNYB 1T5XA 2IWEA 3B2VL 4EVNB 3AUVA 3NCBB 4L2YA 2X4SA 3RUGA 5I17A 3TVMC 4KRPD 1I4FA 4OD1H 5C07E 3BP6A 4QJ4B 2VDOL 4HS3B 4GW1A 2D03H 3ZHDA 1YHPA 4GQPH 2ZCHL 2OS7A 2DBLL 2A6DA 2DBJA 1CC3A 2C9VA 3RVWC 3GLAA 3FFCE 1RJZA 2MMXA 1CICC 1OAZH 3PFUA 2JNZA 5CLWA 1IBYA 2F18A 2GYSA 1YEEL 2XY2A 3KH4A 2UY6A 4TUJA 2AXFB 1F1AA 2CO2A 1OZTG 5DJDB 1OAYH 5TQ2H 1JNJA 4M48H 3SDCB 2VC2L 4XVTL 1DQQB 3TEUA 4M1GH 4CSTA 2BVPA 3F58L 1TZ8A 1NANI 1NFAA 1H8NA 2EKSB 4TL4A 4Q9QL 3BVDB 2LW3A 2UVFA 1KBKA 3APDA 2X41A 3V6FA 1FN4B 1VEMA 1S5IL 1SDAB 3QJTB 4O2CB 5ICUA 3ZDZE 4UV7H 3WJMB 1KYOJ 4G8AC 2BY0A 5C0EA 4XMXA 5DD5L 1ECYA 4XE0A 1F11B 3V4VA 1L7IH 4AQ8A 5BV7L 3NZUA 1MCCA 3SN6N 2PKDA 1D3CA 5EO9A 4YK4B 1BYNA 1SOQA 2EEDA 2ZXGA 5FA3B 4G1MA 1U33A 4NDMA 5AUMA 4F91B 1E8XA 3T8XA 4YHLH 1Q1PA 3RVXD 3LN5A 1J8HB 2YN3A 4ODWA 3RX7A 2OBGA 4QXGL 4HS8L 5E6IC 3DX8B 3DO7A 3FCTA 1ODUA 2JJSC 4H0GA 1FPTL 4S1RL 4N87A 2GIMA 4JCLA 1E4XI 1TLKA 2PR4L 5LGKA 1D2PA 4WJG3 1Z3GL 1BMGA 3X3GL 3RPIA 3UZEC 1WC7B 3K46A 3ZQ9A 4OKVB 1CVRA 2WINA 3HAEA 1S46A 3KW8A 2D7QA 3EOTL 1DQML 3I9GL 2Y3NA 4TNVF 1JGUL 5DWPA 5PAZA 2UYLA 4PAZA 5TK2A 1E8WA 1JDAA 3CVHL 1L6PA 3S34H 1UEYA 1T1WB 4JZNA 2PETA 2YSSA 4QAMB 1X5IA 1IBZA 2IGFH 4J8RB 4FXKB 4UANA 3KBEA 4U1MB 3MHZA 3RIAK 2CDEB 1UXWB 1TJXA 4XZUB 5FEBA 4AT6B 4Y5XB 1FBIH 4KTEL 1YEDB 5D1QD 5I1HH 1X7QA 3V0HA 3E8UH 3QIBC 5A7EA 1M2VB 3KYKL 1BD2E 1JCVA 3NCWA 1RVFH 4R96B 5HPMB 4PEEA 4ELDA 4WK2B 4KPHL 1MF2H 2UXTA 3W9DB 2JQAA 4JRXA 4G6AD 4WV1B 1BFOB 3ARBC 5DMKA 2VW4A 1KN2L 4BQ9A 1MRFH 1S7RA 2GUOA 2WWOA 4ZQKA 1B90A 4JFEE 3OAYK 3FF7A 4IBZA 1MCHA 2IGTA 3MACH 3S3BB 3UAJC 3LKNA 4I0PB 4MNGB 1ZT7A 4LOUC 2CCLA 4MMXB 4UTAL 3ARXA 1T21B 5IIEA 1U8NA 4HPYH 1G7MB 2EDEA 3QUMH 3QAQA 3KPLB 4YDJA 5E2UH 2VDNL 3EOAA 1JYVA 3IS1X 3QHZL 2DEXX 3NSFA 4X98A 3IJHB 3UPAA 3WSQH 2HFGL 1R33A 3FTWA 3S3PA 4IMLA 4DCQA 1IIIA 4JFWA 4P5RA 4XZUA 4KMLB 1OF0A 4WV1A 3RIFK 1PZ2A 5C2BH 4TTGA 1DVTA 5KVMC 1HEHC 2AJUH 4XMPH 1H19A 4Y2DA 2LAGB 4UNUA 4ZFOB 3DGDA 1MFEH 5GRVK 1EVUA 1ESOA 2Z31A 1LILA 2OSLA 4NQSA 4PTUA 4G6JH 2XV0A 5EIIB 3SPHA 3RVTD 1ZS8A 4TQHA 5C7ZA 4JRXB 1R3LA 3FB7B 1ASOA 4OCYL 2ZX8A 3HAEB 4OB5L 1DVFC 1SDDA 2X1WL 4CBPA 4IMLB 4DCQB 2BOBA 2HYMA 4BQ8A 5EUOE 4JO8A 1MJJB 1NMCB 2ATPA 2BNQA 3MNWA 3VRLE 4AYFA 2CLRB 2OX5A 5DD0L 5CEZH 1EZVY 5CBAA 5DI8A 1SJEB 1JGUH 2DLFL 1BVZA 4OQ1A 5EIIA 3PHOA 4FGMA 5L4FA 2MCPH 3EHBB 2BHUA 3GHBL 5AW6B 2IC2A 4P4RA 1E8ZA 1LNUB 1HN1A 2UXGA 1P4BL 2XVGA 1I1CA 4W9IC 5CJOL 4O2EA 2A7BA 1OAQL 3KAAA 3WLBB 3CN1A 1NLDH 4HC1H 1SXCA 1CXLA 3P4OA 4WI9A 1XSIA 1FBIL 1RHFA 2LT9A 3IDYC 3IGKA 2J8UB 4POYA 4CC0A 1XCWA 4Q9BA 3KYKH 3NK4A 3L5WA 4HOWA 3DHMA 3HLAA 3F64A 4Z77B 3WL9A 1U3HC 4E41D 1NGPL 1E6OL 1QEXA 4G8EA 2BVYA 3MRGB 1THCA 1IBHA 2W07B 3ISWA 2EDWA 5FLUA 5I19H 4MMXA 4YSSA 4FFZL 1U3HB 1CS6A 1OGAE 4M43H 2X0UA 3VAEA 3VGBA 4PJFB 1M7IB 1PD1A 2E8YA 4JRXE 4P2AA 2BNQB 4XP9L 2N59A 1SXAA 1KIPB 1LO2H 2EDRA 4YBHA 1GPOL 1U8JA 3BH8A 3SDDB 1QEWA 3LZFL 4FTVB 2BIPA 4UTAH 3A4FA 4E9QA 3ARVA 4IKKA 4ZK8A 1MVYA 5FM8A 5IHLB 3RNKB 4PJEB 4Y19A 5IG7A 3RZCA 5B1CA 4IJTA 4PJGA 1Q9LB 4G71B 4XAKD 5J11C 3QJVB 1CYGA 2QFPA 1U3JA 4AJYV 3ULUD 2JQZA 4QXWA 4X9GA 4DKAA 4NO3B 1B2WH 3QIUB 3PL6B 3KVQA 4XN7A 3ML8A 4PJHA 2GJ6A 1LEIB 3FSAA 3QIUC 3US0A 1Y18B 4PGBA 5FGCE 5L8KB 1NMBH 1I8MB 4ENED 1A9BB 2XWCA 3NZHL 2VXVH 5BRPA 3WIHA 2FD6H 3VA6A 4J5VA 4GBXC 1F3DJ 1HT6A 5D6CA 1XMWA 1CTNA 5HGHB 1QRND 4HQQH 4AI7A 5CD5C 1CU4H 1U8CA 2BIMA 2V9QA 2C7UB 3W3BA 2EXTA 1AKJD 4NO0D 4XB7A 1BOGB 4XBEH 4ZAKC 1B2YA 5DD0H 3UBXI 5CEZL 4RH4A 4X9IA 3MLVH 4BHUA 7CGTA 4D0BA 2AEQH 3FHAA 1EANA 3GRWH 4QXTA 4X5PA 3M86A 4N68A 1JK8B 4GRLB 2GABA 1BQUA 4QTFA 3RB5A 4PUBH 4AXWB 1HWWA 5E94B 3H53A 4IGBB 3CLEL 1OAQH 2DH2A 2FWOA 4GO9A 3GTTA 1ZKAA 4ODVH 4XNXL 5TDOA 5ADOH 1MDAA 4Z7VB 1DFXA 1T1ZB 1NCWH 2EVHA 2WSPA 3OSVA 5CMAB 2F2HA 1JFHA 1UC6A 2H47C 2JI2A 4LVOC 4P2RA 5H94B 4Y9EA 4JFOA 3QPQD 1AS7A 1E4KC 1SMOA 3AS1A 3MMEB 4B3VA 4DP2X 3ZKQD 1YMMD 1MRDH 4WWKA 5ALBL 1XL6A 4FXGB 4DP7X 5TF1L 5IFJA 4RISL 3VXME 3WNOA 2OJZH 3KPSD 4G7SB 5IEHA 1U8OA 5T1LB 3KBPA 3R0MA 4JB9L 4BQBA 2QZ5A 5IFHH 4OSUH 3MN8A 1CI3M 4EDXB 5JW5A 3PAZA 1JWSA 1UCBH 3BH9A 2BDNH 3FFCA 1HAUA 4CU6A 1NOLA 4JM2F 3QIWD 2Q5BA 2GFBB 1XGRA 3KLKA 3SZKC 4ANUA 5GPRA 3MFFB 5C70A 1TVHA 3FCUB 1MJ7H 3HRZA 4O5LH 3UJTL 5D4QA 3KDMB 1HSAA 1MN4A 3FS9A 2A6JB 3CSYA 4G80A 4I2XE 8CGTA 2ESVD 3HB3D 3HNTH 4X4ME 1HHJB 1UCTA 3E6HA 4M4PA 1ZE3H 4KXZH 1XIWA 3GWJA 3D33A 4AQ8C 1FNLA 4NQDA 4TPRL 3QUMB 3B7RL 4A66A 1XFPA 3W2DL 1A02N 3JTTB 2P8LA 1XO8A 3C2AL 3KBFA 5IESL 4OQTA 1ZDSA 2PXYA 1BVOA 2C3VA 2GK2A 1MAMH 5IJDC 4MASA 5TFSL 4J7RA 1N7MH 2ZCLL 3QIBD 4X80H 4PJHE 2O5XL 3B2UC 4NAQA 5HDBB 1CK0H 2YAOA 4HXBL 1PJ9A 4ZDHB 3UIZA 3KYNA 3T6QC 2Y69B 1AH1A 3KDMA 4OBRA 2BPBA 4Z78B 3O3BB 3SDAB 4ZXBB 1D9KC 1S7UA 2EKJA 1U8MB 2WTRB 3MXVH 4LOFA 1JPTL 5CP3A 2CUMA 3VXMB 1HKLH 1LEGA 3T3ME 2CJTA 3JV4A 4U4BA 3S37L 3O4OC 1IEBA 2XJLA 4G6FB 3BLBA 4JLRB 2FX7L 5LQBH 5LNEA 5HHVH 1JHKL 2EXWD 2HJKA 3NOIA 1BD2D 3TF7C 4G82A 5EU5A 3KE0A 2NY0B 4H26A 4K7PL 3ISRA 3RGBA 3U25A 5A16A 4QAWA 3FTVA 3UCRA 3W0WD 2H3NB 3SDYH 3SD2A 2QPFA 2Z91A 4HJJH 4JDEA 4XHQA 3X11B 1CDUA 1GYCA 3B2UD 2NCEA 4PIBA 4BE6A 1KPRB 3RWHA 1YY8B 2OMVB 2BVOA 3OGCA 4JFYA 1HOCB 1AHMA 2L0DA 2NSMA 2NUPA 1C16B 3D06A 4AQOA 1N5AB 3B9EA 1A6TB 1I8KA 5EPMA 2IALA 5IMKB 3DVIA 5ENWB 4LPXA 2A73B 3LPOA 1FLRL 2EQDA 4B27A 1ZLUK 5MEQA 4XOBA 1UATA 4H1LA 3NG5A 2YK1H 4WJ5B 3V0WH 2VXQA 3BUYA 4BXSV 5EIIG 1ROCA 2PCYA 4GT7A 3U6RA 2NR6D 2ARJA 3MV8B 1DUYB 5GGQH 4NKMB 5BRQA 4Y7MA 3E6HB 5F9JA 3MRJB 5BZXA 2ADGA 1FNSH 3ELQA 5L4IA 1J18A 3PV6B 4L1TA 3FRPG 3CSBA 4PVNA 4R8WH 4EDWL 1EH9A 2BNUB 5EFIB 1WIPA 3T3MB 3ATEA 3ESUF 1SLVA 4LKCA 1G9EA 1E3XA 2VL5B 4QCIB 4P4KD 3MGTA 3A3YB 4ZO9A 1NFKA 1QFHA 2F08A 2Q8BH 5I6XB 4P8QA 5GGSA 1W9XA 5M94B 3PHAA 2X1PA 1JIBA 2ZD0A 1J8HA 4UQAA 5ABDE 3QJRB 4MCYA 1RZQA 4XNZB 1FFOB 4GXUM 4LCWA 3FJTA 5F2FA 4ZODA 1QPXA 1V55B 2F54E 1ET7A 2HKFL 1S9XA 4PVLA 1FE8L 1OTSC 5C0ND 5C0AD 3FQ4A 5GGRB 3HS0C 4GG8A 4XOEA 5IB5B 1OK0A 3DV6A 1YYLH 1AOHA 3Q6FA 5C0EB 1NSNL 4P59H 5B38G 1N18A 4UBDC 1A4KB 4Y4FC 1NCAH 2EVGA 4L0YA 1V54B 3IS0X 4FKEA 4WFGD 43CAB 2V17L 4Y5VC 4IGBD 5I2IB 3ISYA 2E9GA 1QFWI 2MHAB 3D85A 1RIHL 4GLRI 1QX1A 3LMJH 3LAFA 4X4MA 4ZS6C 3FTGB 1VPOL 4G59C 2XKNB 4PP2A 3PWPB 3ZR5A 5LG1A 1DANT 4XXDA 1LYQA 1DQDL 3AG2B 1IL1A 3QQDB 4XE5B 3WN5B 3C75A 3OB8A 3IT8D 4ZMXA 3WD5H 4QHNA 3UGXA 3ZMEA 1XF3B 4OFYD 4UQ9A 5AALA 5GS0L 2AK4E 3CLFH 1T21A 3FUDA 4M5SA 5IIEB 5GJTH 1LXMA 4TSBL 1WITA 2YEZB 4C54A 1J1PH 2JFCA 2MEJB 5FM5O 5AW5B 5AZ2L 3FN9A 4HK3J 3DV4A 3RQ3A 4YL9A 4D9LL 1F3JB 3S5LB 4GFTB 1Z5LB 4GXFA 3RGVD 3V4PB 1JUFA 3QG7L 1URLA 1UJ3C 3NA4A 3MRRA 3KS0J 3O3DB 1ZANH 3MUJA 3NH7H 4LT7A 4M03A 4DK3A 2G3NA 5CR1A 4GIAA 5FECA 3FB6A 1PG7X 2IH9A 3CTTA 1BJ1H 3TNMA 1VZIA 5D1XE 5FB8B 3DJ9A 1GW6A 4KNQA 1A25A 5BW7C 5T8IA 1OGAD 2OSYA 4FQLH 4PGEB 4YGVA 2ESVB 5MHSE 5E9DD 3TVMB 5ABZA 3CHRA 1SEBA 1NTDA 4B5ZA 4Y4HD 4QYOB 5CP7B 2H1PH 4PWJA 4DAGH 3O11A 5FGBA 4GQ9H 3QQ9C 4EUPA 4GI8A 2VGLM 2ZWZA 4UAOB 2HTLC 2RH0A 2CKBH 3HB3B 4PJEF 4ISVB 4RBPK 4HAFA 2X87A 2XSKA 1P5UC 4KGLA 3TZVC 4HS8H 3BEWB 5D6DA 2D9CA 3EOAB 3PHSA 5TE7H 2Q6WB 3BZFA 3IDGB 1NIAA 3QXAB 3NT0A 1YY9D 2IFFH 2JKSA 1EHLL 3BYTA 2QHRL 1QO3B 4X6FA 3M8OH 1KB5B 3KCPA 2ADFL 3P9WB 3A23A 1QPKA 3A5VA 3KWXA 1UT2A 3P0YL 3V7MA 2X6CA 2V17H 2C34A 4B7LA 2QELA 1TQVA 5I6NA 2X0WA 5D7SL 1EDHA 1IFGA 1FC1A 4E9WA 4QHMA 1GOHA 1A7OH 1D2OA 2CXGA 2AXGB 2ADIA 4XAKE 1YEJH 1IAIM 5C09A 1HJCA 5D1XB 3ZDYF 3G5VB 4NN6B 4NUQA 5E08L 2Y25A 3HHSA 3EUUA 4YK4C 2A74C 3W82A 4AJ0A 4CVZB 2XZAH 1TPXC 1CDCA 1P5UA 3PG2A 2YZ8A 5D7KE 5EBLB 4YHML 4FYTA 3MYZA 5KSBA 1SYVA 2ZXQA 5HI5D 4NO0B 5I6OA 2XQYG 2D73A 1JZ7A 1TPXB 1OGPA 5CN1A 2ITCB 1MCJA 3VXOB 4DQAA 1AI1H 4NZJA 2A4ZA 4U6HB 3ULAB 1I7ZB 1D6EB 3K6OA 4A7QA 4NNXB 4ZOBA 1AZZC 1EV2E 1RZJL 2OMUA 4FYQA 1YSOA 2RR3A 5K33A 2N7BA 1FNEA 2V4LA 1MRFL 4H1LH 3DSNB 1KGUA 4IU2A 4Y5VB 5LWYL 1QSFA 1QRNB 2VR5A 3B9DA 1A9EA 1I9RL 1XGZA 1TTFA 2R1YA 2LLLA 1ILSA 3VFRB 4ELMB 2DBLH 4OFVA 1RPQA 5E2UL 2CO4A 3T2NH 3O2DL 4GAYB 3QIUA 1KPUB 1U58A 3ZZSA 3ZUNC 1AQDA 3WHXB 1AGFB 1FZMB 2W0LA 1CR9L 3T08A 2PYFB 4OAWB 1WJ3A 4DPBX 1XDTT 4TSCL 3WO4B 5JPNB 1N6QH 1OALA 2K3TA 2R1WA 2UZYA 3CFJB 4PJCA 3KG5A 1AXTH 4GUPB 1H15B 3N91A 4U1KA 2RACA 5IKCB 5TQ2L 3ZYZA 1SXBA 4CBZA 4FTVA 3B2PA 3QPKA 3SKUD 5IHHA 2D7NA 2WXGA 3N85L 5E94A 4NWUL 1P2CB 4K5MA 5AB0A 1AR2A 4A55A 1PD0A 3ZR6A 3IN0A 5E0QA 4FNLL 5EBMA 4IOIB 2DQGH 2EE3A 1DN0B 3RLSA 2XTJC 4CU8A 4P3WA 4ABVA 3UTPE 3WJJA 4G8EB 1FO0A 2DKMA 3PHQB 2YUVA 3CPLB 3SOBL 3DHUA 4PJCB 4MQTB 2K7QA 3DIDA 1P6AB 3GT6A 3P02A 3SPVA 4HUWA 4NO2B 1A66A 5GSRA 4HIPA 4CILA 1N59B 2EIZB 3W81A 5JOFA 1L7IL 4KX9A 4HIJA 2NXZB 4GG6F 1IGML 4ONOA 5IVXF 2PUQT 4FZEL 4YEEA 3T0ED 2YXFA 3LX9A 5DJ6B 4OCSL 3GZPA 3M1CA 4AL8L 1A9BA 3SGJC 2BHYA 4MJ6B 1P7KB 5T3XH 1K8DA 1DLHA 5JIMA 4U7MA 1E3ZA 1NBZB 1PAZA 3OX8B 4JFOB 3V8CA 4E0RB 1MVUB 2PR4H 4YGVB 5CGYD 3FBQA 1YJDL 3BMVA 4YDZA 4GAFB 3ZK0A 4NOBA 2X0VA 4HD9A 5LGHH 3L4YA 5DFVC 3S35H 4I48B 5IROD 2MTPA 5D7EA 1AI1L 3GSXB 2MCAA 4WTZG 4EDXA 2VKXA 3V7AG 1CO1A 2XWBB 1IC4H 3PHQA 4GAJH 1IJ9A 2K4WA 4QHKJ 3CE1A 3NA9H 5FHAL 4MSWA 4M6ML 1N59A 2EIZA 4V2CB 2C4FU 1R6VA 4KXDA 2BWIA 2GUYA 4YX2L 4Z23A 1ILUA 1CD1B 3QDMB 4Y19B 1UASA 3Q5YA 5BV7C 1PG7W 2JELL 1OCWL 3QT2A 5EUOA 3K6SB 3EZJB 5HGBB 2VUOA 3QS2A 3GMMA 2NQCA 1ZHKA 1HJBC 1XXFC 2AQNA 2BVUA 5C07A 4K3EH 3N42B 3HPLA 1YEKL 4QRBA 4D8PB 4PJ7B 4GSXA 3AVEA 4UTBH 3P3YA 1P7QA 3BIAX 1BYPA 3ZOAA 3PL6A 4KQ3H 4ZFFA 4M00A 4NNPL 3IXTA 3C09B 3QUZC 3HLKA 1TJIH 4L48A 3QQ4B 5E9NA 2OTWA 3D4GA 4NQQA 5GRUH 4G3YH 1C5DB 5T1MB 2B2XL 2HTLD 3QWNA 1OTTD 4B50A 4LFHG 1JXJA 1U8PB 1NEUA 2DLHA 2F5AL 4TNVK 2F8XC 1NCTA 4P46A 3JT0A 4Q2ZA 4EN3D 1W15A 2FLBT 2F8IA 5HJBA 4HS6B 4PB0L 1I31A 2K6YA 2QQNH 3N0AA 4WFED 5EHFA 5DO2C 4WEBL 1BV8A 1T66C 3I75A 4AYEC 2RMNA 1Q1JH 3SDXF 4LBAA 5GGUA 4NQEE 2E7HA 3DJSA 5D1QB 4H88H 4M4RB 1QG3A 3A4DA 3E1F1 1MFUA 5FV2A 1EO5A 3HS0A 4FQIH 4LRIA 1GIGH 2Z7WA 5L0QC 4YUEH 5D70H 4N0UE 4E9RA 4IW4C 5HYJD 1X5MA 2CNZA 1HSBA 2EDJA 4K07A 4AWJC 1K4CB 2HVBA 1WP6A 2FIKA 5F8RC 5G4MA 4R6UA 3UBFA 3DX7B 4YIQA 3JWDH 4XO9A 5DLMH 2OYPA 4PRPA 1JN6A 2XIIA 1HH9A 3ARBB 1AG6A 4YBQC 5I66A 4IBTA 1FVDB 4RZCA 3AW5A 1ZTXE 2VM9A 3MLTB 1S3KH 4J3WA 1RZJC 4PJ7E 4R2GC 3QNZA 2FEJA 5AD0B 4U1KB 1IC5H 2CHZA 3PJNA 4LPWA 1BVNP 1MCWM 1IKFL 1T7XA 1GTFA 4DVRL 2AS5M 4RWHA 3DSFL 3MFGB 3ZE1F 1OCZB 4PLKC 1Y07A 4AEEA 3FFCD 4JB9H 3UPRB 4Q9CA 5FLVA 2X7LB 5IJVA 3NABL 4M6MH 3ZN6A 2G9HA 4G9FB 4ZFZA 3LS4H 3O4OB 2X53A 3GYRA 2EDFA 1DQIA 1KFAH 4NX0A 4OGAC 3MLWH 1XH1A 3UTTB 4UU9B 1FH5H 3ROLB 2HFFB 4L1LA 1G9HA 1L0QA 2YGOA 1W2KT 3I02A 1JGEB 3E6FA 4GAGL 2E75C 6FABL 3HBZA 1RK0B 1J9CT 5DQ9B 2BIQA 2R8SL 3LRSB 3LSOA 4MD5A 2VDKL 3LRKA 3VQMA 1Z32X 1UQSA 2GCYB 1E4HA 2DWSA 4OQTL 4XR8C 1O6SB 4LSRL 2WZPD 2X4PB 4DEPC 1DCLA 2VR7A 2XZQL 5A2IH 4P3CL 5JW3L 1NCJA 3CMOL 3DOHA 4W9DC 4AGPA 4ELMF 1FHNA 1NFDB 5BQ7A 1TJIL 2O72A 4IBWA 3S0PA 2ZG3A 1F56A 2CLVA 4WI0A 4XNMA 4FQCH 5GRZA 3I02B 2XA8H 1U91A 3QCTL 1E7UA 1A4KA 4FAAB 4AV5A 1BX2B 2CR3A 4ZMVA 1WFNA 5DK0A 5J0BA 1KTLB 3VFSB 1SYSB 3GPSA 4G5ZL 1V27A 4XO4A 3RZCD 3QRFM 3FHEA 4OTXL 5F6HJ 4P2OA 1BVLA 1R5IB 4HT1H 4JRYA 3QS3A 4KXBA 3RPBA 5DR5L 2GK0A 4TTDD 1CGSL 5ELIA 4LAQL 3L3HA 3UTQB 2ZXWB 4KRPB 5C71A 1ML0A 3K80A 1IGYB 4APQD 3T1WA 4H8WC 5K9OA 2J1KA 2YMXL 4OLUL 4XP4H 3H0TA 1WLHA 2DQDH 3PV6A 3NIFF 3SE3C 1KELH 4DGWC 5AW1B 2MQ0A 2RBLA 4OJEH 3VD2A 2O6EA 4NZFA 2JXMB 4Q0XH 4X5WA 3UAJD 2V3FA 2EZ0D 5JPMC 4UIKL 2V2XA 3DETC 4ZW6A 2Y9RT 4RMTA 1I3RB 2CDEA 3OGCB 2V8LA 4JFYB 1EUTA 3VSTA 5JA9A 4JGUA 3C6SB 3TIEA 3GSNH 4XX1E 4EIUA 3HZYB 3B43A 4QXUH 5ENWA 5B7MA 4HHAB 3IK2A 1IC1A 4KKLD 5GXBB 4FADA 3EBGA 4PWGA 1JXFA 2XKNA 1QUNA 3DRQA 5D7KD 2HRPL 2PABA 1UB6A 1TQCC 5HHME 3V5KB 4CMMB 1A6WL 5E1HB 4TULH 3ESVF 2OLDA 4YE4L 4JHAL 3KYOA 2IAMB 2WJ7A 1PG7H 3V4VL 2QVKA 4RGNE 4TQEL 4YDVA 1ZLWK 5I73C 2OCFD 4P4KA 4K3JL 1P84J 1DLFL 3ATDA 1QTPA 1K4DB 2ADJB 2YBGA 3C5JA 3KM1A 3ZTJH 2MOGA 2WQAA 3ARDA 2BVQA 3QZMA 4XWOD 3O3BA 4KMTH 1NL0L 5F7UA 4NZTH 2CRIA 3SDCA 5CCJA 2H0EA 1Z5LA 2XZQH 3C5SA 4NKOB 3WNNA 1UM4H 3DI3B 4DGIH 3NCYP 4XI5D 1HX0A 5TF1H 2GC7C 3KPSA 4GLRH 3IFNL 3I2CH 3LB6D 4L4JA 1ED3B 1OOWA 2A9ML 5I8KH 5DS8B 2WD0A 2VYRE 2ICEB 3FT3A 4GP8B 5F7DA 4XCFH 3L2NA 3S96A 2X4RB 1OGAA 3BKCL 2XQBL 1E9QA 1GTNA 4KRNA 3CK0H 2F5BH 4X6CB 2VMJA 3RL2B 2IH1B 3U2JA 4X4YA 1GR7A 4GI6A 3FQUB 4P5KB 1TTRA 2V9UA 1J0JA 3OC8A 3OKDB 2MCG1 3T2LA 5EBLA 4KHTL 3W2DH 2DD8H 4J4PA 3HG2A 5F1IB 3SKOA 2COVD 1T4KA 1EIBA 3MLRL 3N1FC 5I16B 2PXYD 1IFHH 1EBPA 2KT6A 3IF1B 1JF1B 5EN2B 4Q7DA 3D5OF 2F54D 2OL3A 3LPFA 4A68A 5JOEA 35C8H 4OZHA 4PJAE 4PVMA 3K8MA 4HDIA 5HVHC 3N1QC 2ZSVA 3UTPD 1NAMA 4JRWA 2RFXA 2W1NA 4XP1L 2X6VA 2CZNA 1AMYA 4IBQA 2EXYC 3QUZA 4G7QB 3ARRA 2F15A 5FCSH 5E8EA 4JG5A 4FFVD 1QP1A 1D5RA 2F1AA 4XB3A 2BP0A 4QRPD 1HCFX 1QZNA 4R90H 4TSBH 2C4XA 4JPVL 4WHTA 3QE5A 1I9EA 4MXVF 3RGVA 3SJVB 3ZO9A 2ZX7A 3CN3A 3BP5A 3SDCC 2R2CA 4CMHC 5C0FA 3UYOD 2Z91B 3X11A 5C09D 3ZL1A 3RI5K 2EC9U 2Y7SA 3FK3A 4MNHB 4R5TA 4AG4L 4LHUA 3MV9A 4UOW1 1P9MC 3RU8H 2R29A 3DC0A 3OKKA 4AZ8B 3MI6A 3DKHA 1BFVL 3S5ZA 2R0ZL 1PEWA 3L3KB 2ZKWA 4X6CE 1NGQH 4K9JA 1JZ5A 1DSFL 1C5BL 4RFEA 2NT0A 4D7PA 2IBZX 1Q90A 2CDFB 2ZCHH 1VKXA 4JFFE 4KZEL 3CFEB 2GJZB 4GW1B 4LSUL 5FO9B 4QGTA 2A83A 4J1UB 1JTPA 4WK4B 4ZBJA 1X9QA 1NL0H 4ZW3A 5I8OH 4ZAKD 4WW2B 1S7VB 3HA0A 3KH3A 4MNHA 1KTJA 2NY3D 4HIQA 4JN1H 2G3MA 1QR1A 2H1PL 3QJHB 2F7PA 4HUVB 1G0DA 4H20H 4HUUB 3APCA 3LH9A 3PWNA 3U2SA 4KO6A 5CBAB 2W0FB 5CP3H 4L3AA 4NBYB 1DE4A 4LE8A 4H0LC 5IW1B 4RMWA 3Q06A 3GSOA 1SXSA 5TDNA 3DBXB 4N9GA 1DYZA 3WFHA 4M61A 1MCKA 2E56A 1CFVL 4D9QE 2ICWA 1F6AB 2A5UA 5E4OA 2V3EA 3SKNB 2D31A 1GRWA 4KTDL 4OZHB 4LEXL 1QUNB 2VOTA 3DRQB 4U0RB 5DHVA 1ZS8B 3IPFA 1I1RA 1WCBA 1EAPA 1T89C 2W80C 3F12A 4TUOB 2IAMA 3T0DA 4S0TD 1MFCH 2JKWA 1SVBA 3EXLA 1F42A 2PWEA 2ZOLB 1T0MB 2J6WA 3KPOB 1J7VR 4NQEA 3U6XA 1H5BC 5E2TL 1EMTL 2LU7A 1WWWX 1X5LA 1YYLL 2Y1AA 1RXLA 3SPGA 3VA2C 5BS0A 3GUTA 1UYWH 3HVDA 4R90L 5AVRB 5J7CC 1TCRB 2W9DL 1OIOA 2E27H 4P2RB 4Z7OF 4EN3B 4I18A 3N06B 3GMRB 1OGTB 2OKMA 3N42F 5JHBA 1KWGA 3GMOB 2V2WA 5ESQB 4NM4L 4X5RA 3WLBA 2APSA 3CZSA 3SY0B 3UL4A 1SZNA 1HNGA 2A9NH 2JJTC 1CGYA 1W8OA 1DDHA 1AJ7H 1IARB 5I1EL 3HAEG 1R19A 1JTOA 3WFCL 2C4FT 2IH1A 3NEEA 4BH8A 1IEHA 4J3OG 2NXZC 4GXUN 2XT1B 1Z9OA 1FJ1A 5ALCH 3LN4B 3O2DA 1UENA 1BZ7B 3KVPA 3LS5H 4JY4B 3IAGC 1RY7B 2EUZA 4N0RA 4L9LC 1YN7B 4WWKC 2PTTB 3MRPB 2D3LA 5G4NA 2XXFA 4WK0B 3U0PB 3VFPB 3PJLA 5KG9B 2CGRL 5D5MF 3BDBA 3T65B 4NRXA 3O6FA 1JGLH 1UOLA 1DBAL 1DSYA 1KCVH 3U4KA 1RUQH 4X7TA 4PJGB 3MACL 5FO8A 4EI5C 3PDOB 4QT5A 1ORSA 3PJSB 4CAGA 4TNEA 3E9TA 4BUQA 5GGUB 4Z77A 4HV8A 4I9XA 4NXSA 1I3UA 1XT5A 1NBVL 1WZKA 4XODA 3FYIB 3NGBB 2LLNA 3ZE2F 2DMCA 2FBJL 3PIQB 5INCB 3U30C 2D7PA 3IB4A 3PWJB 5B8CB 1DVYA 4HWBH 5D4JA 4D3CH 1LNUA 5CGYC 2E7MA 1CG9B 2VT0A 4OCWL 1AKJB 1FG2A 1V5JA 3GBLA 3N9GH 1XR9A 4J3OF 1FZOB 1RU9L 4P5TD 5DWUL 4FKKA 3VFPA 3L4ZA 3VXSA 1LGVA 3GI8H 1AR1C 1F97A 3D3VE 4AL8H 4EN3A 2XYCA 3VFTB 2AJXL 4AE1A 5KYWA 3GMPB 2WB7A 5DJ2B 4ZUWA 5FUCE 1UYWL 2VXUL 2ADYA 4GS7B 3WFDL 1ZHKB 3UTSE 1S7WB 4EZLA 3QR0A 4UV4H 3HFML 4JFPB 5DVLA 2AJYH 3PJSA 4F5CE 4XB8A 3SGEI 1UKQA 3L3OC 4GJTB 3UPRA 3MKKA 4R7LA 2DKUA 1MJ8H 2VKWA 4PJ9B 1U8HB 3RILA 3HNVH 1FG2B 1CTMA 4Y88A 3F85A 4LSPL 3O9WD 3GHBH 2MCPL 1JP5A 7TAAA 3PIQA 1NLBH 4M3KB 4WJ5A 4MSWB 1HXMA 3CNKA 1NJ9A 1OSPL 4TVPD 4XMVA 1OD9A 4M3JA 4Z18A 1HILA 3OL2A 2KDYA 2QVIA 3APFA 4YHMH 3MBEB 1B0GB 1VCBC 4FFYA 3OPUA 2BSSA 4YX2H 4XNDA 3AGWA 3EFFA 1A9VA 3QQNA 3VI3B 1IGTA 1QTYT 2Y0SA 3DDFA 1AC6A 3UAAA 5HYSA 5I1GL 1M1XA 2K4AA 2GY5A 5GZNC 2FWSA 3QZBA 4OUUB 4PJ9A 4OGZA 1E6OH 2Y7OA 4JFEB 2B20A 1J5HA 3PFQA 5EO1B 2VO8A 2OR9L 5M7QA 3H6AA 3NZ8B 3TJEL 4ZW5A 4KQ4L 4A2HA 1U0QA 3D39B 3RWDA 3MGOA 2ZOOA 4ZFFB 1UM5L 2CUHA 3QIWC 1WS8A 2EUWA 1G1OA 1G9NH 3QUYB 4P3DA 4Q6IA 5CWSB 4APQC 1KEGH 3FULA 3CIQA 1BEYL 5E70A 5I0WA 1BQRA 1MFBL 5I82A 3FRUB 1E3FA 4KTEH 1S7SB 4NCDA 1MUJB 3CH1A 4PS3A 5EU6A 3KXFD 4D2NA 4FNRA 2BCMA 3MREB 3A47A 4KH2A 4GMTH 3IXAB 1DDHB 1P1ZA 2BRRH 4J23A 1HCZA 1DVFA 2YXVA 2VDPB 1ICTA 5DWUH 2X1QA 2Y36L 3LV3A 1ZGLA 3HUJF 4YUEL 2O5ZH 1CCZA 2CWRA 2IALB 5IMKA 5DTFA 4JVPA 2CR0A 1NMBL 2OJEB 2P5EE 5ANMB 4OJYA 2Y7LA 3KPQB 4I1RA 4A6YA 2WXMA 1T5KA 3VI3E 4UIMB 2WLHA 3TONA 3TWCH 1E5ZA 1HL9A 1UB5B 3TFKD 3Q8CA 2IAND 4MQ7A 3JWDL 4P2OD 2QHLA 1T7YA 3M7FB 4QMEA 2G75B 1WT5C 3QUYD 1A0QH 4WNQB 4U6XB 1U8LA 1S7XB 4FNLH 1JI1A 2MPAH 3CQQA 5DJ6A 3GF8A 1Y6KR 1CLZL 3VI3F 1F5WA 3LNGA 4YPJA 3LH8A 3Q6GH 4N0FA 3EDJA 3CX5J 1RERA 5CIPA 5DVPA 4EXPX 4JZNB 5SWZB 1J87A 2O6CA 3NFSL 2BOCA 1BQLL 4NKDB 3HPLB 2DIBA 4MAYB 4JFED 2NY7L 1IGMH 4JGNA 4CC4A 4I48A 2P52A 3ZDXF 3AWGA 2VDLB 3B34A 3DUSA 3UAJA 3BLPX 3VWKA 1RZ7H 3DMMA 4YQXL 5K1JA 2N56A 1OB0A 2C9XA 1TJMA 3MTXA 4EN2A 5D4HA 1KT2B 2H2SD 5GGSY 3I3EA 3TT1H 3WY1A 1WZAA 5E9DB 3N5AA 5DMGC 2JKLA 5FA4A 3P69A 1ZPUA 5JLZB 2R2HA 1IAKB 1G7QA 1OGAB 2FL5B 3OJDA 4W6YB 1UB5A 1FL3B 2BNQE 2PWFA 3BUYB 4HBQA 1DEEA 3MKGA 1WBYB 4PJ5D 3SE6A 3O9WB 4OU3A 4AIZA 3MDJA 3WI9A 4P3CH 3QYMA 2LVEA 4H8HA 5GHWH 3CMOH 5KSBE 4DKFL 2XDHA 3NIGB 3K6IA 4PJEE 3C6LA 3RPKA 3ET9F 4MCZA 3G5XB 5JQ6H 3TS8A 4N1CA 1U8QA 2BJMH 4R4FH 2UY6B 5F0PB 4S0HA 1LE5B 4DVBA 2IPUK 1S8DB 3QO1A 4CVXA 2I7OA 3N40F 2GSIA 3MREA 4J8RA 1K5WA 1TOXA 4GQZA 4O5LL 4JL1A 4PW3A 2DQEL 4ERSL 2H0FA 4TVPH 1JBJA 4FMVA 5KN5A 2DWXA 4FOMA 4XN2A 1IAII 4UTCA 1VHPA 4WO4D 3KM2A 4KDVA 2FO4A 2WKGA 1LO5B 5DVKA 2AMUA 5DJ8B 4FNQA 1ZTXL 3SJVA 5ECGA 4QF1B 5DUPL 2IWGA 2ZP0T 1M71A 2B1AL 2R4RH 2VLLB 2DDQH 4LF3B 3BZ4A 2OW7A 1NWOA 1T22A 5ID1B 1LO2L 4PGEA 2OMWA 4F7TA 1JZ8A 1MFAL 3C5ZA 1U6AL 3LKPB 3QCUH 3Q48A 1BJ1J 4L4VE 3IPBA 1KB9K 3ES6A 3MJ6A 4N2HA 4OLVL 1C1EL 3CGTA 4MYPA 3WNIA 1K4DA 2ADJA 3C5JB 4F9PC 4JN2A 3QJXA 5GRJH 1T5XB 2JCCF 1FYTB 5FGBC 3HHSB 3C8HA 1MLCA 3KS0H 2WW8A 1B6DA 2YPVL 4QRUA 2FJHB 3SKOB 5KSBB 2ZONA 1QBBA 1NCHA 3WDHA 1BM3L 3NCEB 3BCDA 5CJ5A 1OTTC 1NCOA 1TMCB 2DN7A 3EGXB 4MS8C 4PI2A 1S78C 2F9BT 3LJ3A 1BG9A 3QH3B 4NM8L 4A2LA 3FN0H 2YRZA 3NJFA 3QUZD 3ILEA 4PJ8B 2Y7QB 1T04A 3QGVA 2IH3B 3W0WE 1CGTA 1I7RB 5CINH 4JN2B 4XPFH 1JERA 4AIXA 3P4MB 4NBZB 2WWNA 1TNNA 4D8OA 2RAMA 5EU6B 5BZWB 2GJJA 2FSDA 4NQCD 1B0RA 3WKML 4YMPA 1A9EB 2R1YB 1RH8A 3FQRA 3NSXA 3V8OA 4LRIC 5D2NC 1W6LA 1OXYA 4LL4A 3NIFE 1IAOA 4QRTB 2OSWA 4XH2B 1T6WA 2YD4A 4J6RL 4GKSA 1YEFH 4BGLA 3M46A 3L7EB 5KJRH 3KLHC 5HHNA 4LKXB 2F1EA 3QZPA 2EC8A 3SE9L 2LR4A 2R69L 5JUEL 1BFOA 1YEHL 3VXOA 3U7WH 5I8KL 1NCCH 3CLEH 4F37F 5KYYA 4KUZH 3GJEB 1GYUA 4ZRGA 5I30H 3LS4L 2WYTA 6FABH 2YAHA 2MNJB 3S5LG 2WN3A 1O9WA 4XOAA 1BBJA 2C7FA 2EIDA 5AKSA 1OM3H 1LP9B 5B39B 4Y5VA 1RHHA 1HNYA 1NKGA 4EUPB 4PRPE 2CO7B 5JW3H 2XJKA 4FHJA 4MXQC 4WDIA 3X3FH 1E4WH 1M7DB 1QSEE 2C1PA 1IQDB 2EDLA 3W0WB 1HHKA 3I6LD 1OAJA 3MJ9H 4LLDB 5AZEH 3SPIA 5DJAA 5IFJB 3DBSA 2HVJB 3QK0A 2J1WA 4K23H 3NUKA 5DUJA 1SUJA 2Z31B 2XX0A 4PP1D 5GGTA 3QCTH 3LB6C 5HGHA 2KDGA 2UV3A 2QQLL 3SGDH 2W92A 3R4RA 4HU8A 3ZTEA 3HN5A 4RMUA 4WCYL 3EOBA 3W9EB 1M56B 4M7JH 4CDHA 3JWNE 3D87B 3AY2A 3DYMA 3UTQA 3KWWA 3BRFA 2B7DT 3CZLA 1UTDA 4LCIH 3V52L 3L6FA 5KVDH 5KSBF 1XF2A 3C60D 1JNNH 1GGBH 2Q2EB 5EIQA 2C1PB 2VAAB 1FL5B 1T0OA 1U8NB 5E2VL 3QDGD 3HRPA 2W65B 5EOCL 3Q9QA 3ARDB 1VAHA 3VG0L 5IQLA 4AYFB 2NY3B 3NPZB 2X3BA 1HYSC 1U95B 2AEOA 1DQDH 2IOOA 1YQ2A 2YOCA 5KYUB 2HJFB 4M5YH 4DP5X 1LP9E 3PP3H 1CXEA 4UOJA 1W0VB 1K72A 1XTLA 2WY3B 4QRSA 2CHWA 2VN6A 4Q0XL 3WNKA 3QC6X 4KVNH 1FVCA 2XHNA 4PR5A 4WFGE 4CJ1A 1EAJA 4ZXBC 4Q9RH 5HDQH 1IM9D 6PAZA 1BP3B 2AZAA 5IOPA 1TJGH 1ZLSL 4PFEA 3TBTA 4JE4B 2F58L 3F83A 4PJ5B 4LEOB 2W07A 3QXVA 4LMQI 5D1ZC 4XMKH 4PJ7A 4H20L 3KEDA 4GRLC 4AK1A 3M6DA 5FS5A 1XH3A 2J12B 3LHPH 4GRWE 1IEAA 4OW6A 1ZV9A 3LVTA 5E8DH 5D93C 1PCXA 4LB8A 3X2QB 4JFQA 3STLB 4OI8A 1W16A 1GAFL 5ESAA 5C7XL 1WSST 1MHEA 4ES8A 1VDGA 3BEVA 4XVSH 1DTUA 2HJLB 3N40P 2KLRA 5JYMA 5DD3L 3WE1A 3LDBB 4J8QA 4NJ9H 3LQAH 5DJAB 2VSCA 3FCBA 2W9EL 1JZIA 1VEPA 4FQXD 4ONGH 4X6CF 4UQ3B 1R46A 1JZ3A 2DQHH 2GBUA 2YBRB 2CJUL 4LEOA 1H0DA 2F54B 4WENB 5DK2B 3ELAT 5IB3B 1NWPA 3OXRB 2GHZA 1SRDA 5JPMB 3TO2B 4JAMA 5CFHA 3H2WA 5CGBA 5J3HD 1F1GA 3TZVD 3BRGC 1KPVB 3GMMB 3BAEL 4RCAA 4MHHI 3QWRD 3OQ3B 4OLYH 3V4UH 5ILTH 2F7RA 1RQ5A 3HE7C 2EILB 1TVHB 1NJ9B 3NK3A 5LHDA 2P47B 1AZRA 4UM9A 5BVPL 1MCWW 3IDNA 5TGBB 1S7TA 2CQVA 4Y4HC 1QASA 3CXHK 1JNNL 2GB2A 4NQSB 3WEAA 3ZDZF 4KKQA 1B0IA 1GJWA 5AB2A 5FXCH 3U1SH 3DPBB 4HJSA 4YSUA 4MA7H 1E90A 1UKTA 4P5TA 1G4MA 2C9AA 3EDEA 2YGQA 4YAQB 3ILPB 5ICZA 4L5FL 2X09A 2IQ9L 3QA3A 3VG9C 2EDBA 1CDJA 3ZTJG 1GY2A 4PBXA 3FT9A 1BZDA 5CSBA 3AWFA 1NPUA 4M5YL 5F7MC 2QSVA 3SZ6A 5AENA 1RL1A 4Z78A 2VLME 1NCNA 1L0YA 3I6KB 4HEPA 3NJMA 4PJDB 3SOTA 1M6UA 3MCKA 1E5CA 3VDAA 4QO1B 3BT2H 4AMKH 1AC0A 1SF5A 3QZLA 3CQPA 3AXLA 4H8VA 2KMWA 1R3JB 2R15A 1E4KA 3GC3A 2WXKA 4AENB 4ZMYA 4JLRA 4C55A 3X13B 3PQYB 4CUCA 4U7SA 1XSJA 2VJ8A 2E86A 5I66B 3MRHB 4NZDA 3D2UA 1B9KA 4PRAA 1Y1UA 5AKRA 4WSJA 4ZD3H 3UH8A 1MAKA 3VYOA 1U42A 2AEPH 5D1QA 4PJXB 2D4DA 2BFGA 2X5PA 3B6SA 4LLWB 4RRPG 4KDWA 1AQMA 2XV2A 5BS0E 5L88L 3BD4A 5AW7B 1PLGH 2Y1YA 4E41B 4DH2A 1SHMA 4OCRL 2ZKXA 3RL1B 1P5VA 5AOKA 1MFVA 4FXKC 4IBYA 3LKSA 1K8IB 3CSYB 4WGWB 5ADPH 1WFOA 4F2ME 2WK2A 1PKQB 3NCCB 2OTWB 1ETZA 2P46B 3ARTA 3BKYH 2CRMA 5E2WH 2HWZL 2WXHA 2GY7B 2BXZA 1DQTA 5IUSA 2NY6B 5C86A 2VLRE 3DIVA 4P46B 5C0JA 3OX8A 3MMEA 1N12A 5KBKA 3JVFC 3ULUE 1Q9OA 3ZMNA 3I75B 1XGTB 2NYYD 1QFPA 3OMNB 4NO3A 5EU6D 4OI9A 4NQTA 1Q0XH 3GXNA 4Z7VA 2YFOA 3BH9B 3CDCA 3BPNC 3KR3L 5FYJE 2HRLA 5LDUA 1VJSA 4LLUB 4APXA 4WI2A 4CN1A 3QUYC 5H94A 4GSDL 4BWWA 1P1ZB 4P4KC 5FOBB 3B9VA 4ILDA 3O81A 2AGJL 3S35X 4LIQH 2WUBL 4WI6A 4KY2A 4LESA 3MBXH 4F2FA 1I9JL 3NFPA 1TFPA 1K8IA 5DTFB 5DRWA 1M3IA 1XX9C 2DLTA 2QKIA 3D6GA 3EO1B 3VH8G 4KXCA 3FUNA 1FYTD 1ZHLB 2J21A 3V2AR 1S8DA 3QO1B 4CVXB 3LVEA 3WIHH 2GEEA 1ZK9A 2B39A 2XWJB 4K4KA 4GAAA 3BIKA 3F7YA 5TE7L 4JQIA 1NCBL 2ZQKA 2DQUL 4F2MB 3WGUB 4LLUA 4APXB 2WBJC 4Y9FA 3VACA 5I1GH 3FQTB 3HG1D 1U8CB 4LVEA 4B96A 1K2DA 5I15L 3AQDA 3AMLA 3ZDYE 4M7LL 1IFRA 1XGQB 5GGRY 5GS2D 3H9ZA 2VXQH 2KYIA 3D4ZA 3F62A 2OMBA 4JFEA 5A1AA 4Y4FA 1EHXA 3GXFA 3FAXA 4DK5A 1EZVX 2E6JA 4FFTA 4G7YH 4OJFH 1CE1L 4XVTH 3H6JA 3S36X 3G04B 4NENB 2YD1A 1MEXH 2G2NA 4H44C 4NLHA 5J57B 2HTKD 5ALCL 3G6JE 3IDNB 4POZD 1AD0B 1AS8A 1ZHNB 3QQ3B 3T4AC 4RA3A 1W91A 3LS5L 2EINB 1Z9PA 1MCSA 4F3FA 3VB8A 1BF8A 1FI8C 1UA3A 1FQ9C 5IY5B 5KBLA 2GG1A 2TAAA 3BGMB 5FUZH 4FQ1H 4OZIF 3WDJA 5I28A 3WKYA 3KYOB 1U4FA 1CVSC 2AQ1A 3BIKB 4F2MA 2Z0UA 1RZFL 2CCVA 1NDTA 2HPOA 2QV4A 2YUXA 3GZQA 4IKJA 4JJOA 3O6FD 1IQWH 4OLEA 1KIRA 2W0PA 5SX4I 2Z92B 4OH2A 4BA0A 3FUFA 3B7SA 5F7EL 2JLLA 3HZYA 4WRLA 4U6YA 3IGLA 1HINL 3L9BA 1EFQA 4NZ8A 3HC3H 2APBA 4YXLL 4X6FB 3WY4A 3IMSA 4UIMA 1ADQA 3TH3T 1A4JB 4L8BA 4PWKA 1HXMB 4WO4A 3T4YB 1ULVA 3VQ2C 4TVUA 2CH8A 4OZGF 5I76A 5TE4L 3V0FA 3MA9L 1XR9B 2UVEA 4L4TB 2XBZA 3D2UB 4JO2L 4ZMQA 2XVBA 3T0BA 4BFJA 2WIMA 3OG4B 5DRZB 4N0FB 3ULVH 3DTDA 1T1XB 4AH2B 4DP6X 2IPKB 2YJQA 1FNGA 5EZJA 2OXGA 5EU3B 5BZZA 3VXSD 1CYXA 3KPPA 3FTXA 4Z3IA 5B22A 4OY9A 5L9DL 2ROYA 2YD9A 2HUHA 3ARBA 3BP7A 3BYYA 2PCXA 1I7ZA 3HI6L 1OQOA 3P30L 3S88H 2WLNA 5AOLA 2NPLX 4PLNC 4L3CB 3OAYH 3BW9A 4IMKA 4Z95L 2DWDB 2WMPA 4QHUA 3VXUB 3TN0D 1WEJH 3RWJA 3UZVB 4GKOA 4PRIE 4H1LG 4DPAX 3GSQB 4HGWA 5HYQB 5AB1A 1FV1A 3ENEA 2FR4B 4XVOA 4DKEL 5B38A 3H9SB 3POHA 4JFDD 1EJOH 4JG1L 1CGWA 1D7DA 4I88A 3FCTB 4AC2A 4L8CA 1S78D 1QACA 1KJ3H 2BY2A 3ARGB 4DTGL 5MEND 2P45B 5BRZA 5IFAH 4BFBD 4WZ9A 5ICYB 4PPTA 2J6EL 3GXPA 4NP9A 3WN5A 4CSSA 3U83A 3S36H 2GUOB 3ZGIA 2BZDA 2ARJB 4NQUA 3KPRA 2VTFA 3O45B 4JS7A 4XCEB 4JO4L 3G5ZA 4NSKA 1PW3A 3WIFB 3I9AA 1FL5A 2ZOKB 4X8JA 1JVLA 5J89A 4L8SA 4BCZA 1A6UL 2BIIA 4QYOA 4RMBA 4TXVB 5CP7A 5DJYB 5DZPA 4UYPA 4W9JC 4U2YA 2OL3H 4X98B 2A4EA 3MGTB 3BPCB 3Q0HA 1I3GH 4M7LT 2VDRB 3KL0A 4NI6A 5AAPA 1RJYB 2EO9A 3PWPA 1V3LA 1CMOA 2VW7A 5I5RA 4NQEB 1PVHA 1VEOA 3LD8C 4FI8A 1PZCA 5ITBH 4G42B 5CS7A 3WJMA 2KZWA 3CCHA 4LPTA 2P24A 2FTAA 2BNRE 4E9LA 2V5RA 1OPGH 1S4IA 3G6DL 4XPTL 3TNNB 3SE8L 1YECL 4W81A 1KLFB 4L1BA 5T3ZH 1FORL 3FSZA 1QHOA 3V4PA 1TSRA 4ZYKA 3ZJAA 3KGRA 4K5LA 3STZA 4KZDH 2FHBA 3WG7B 1E43A 3AT9A 4OGXL 4UQIM 5FC9A 1PDKB 4OB5H 5GGVL 3PQYD 4BH7A 1PD6A 3HAEH 1NIBA 3QEUA 2YQ2A 1BZ7A 5AKTA 5HGDA 3GSNL 4DQOL 4HPHA 2DTMH 1AE6L 2MPAL 3LRHA 3UTOA 4MX7B 2WO4A 1RSYA 2Z7ZA 3GI9H 4LLDA 5BVJB 1BZ9B 2F8OA 1JZ2A 4LPYA 3U0WL 5FIEA 5KJRL 3ZSSA 4NN7C 1AZUA 1CURA 2DI7A 3WN6A 2N01B 2OYKA 4LLYA 5IVZB 2OMXB 2HA1A 2NSQA 3LKOA 3VWKD 1FFTB 1IZJA 4JG1H 4JFZL 5A2LH 4J3SA 5HDLA 3SDAD 4WW2A 1UWGL 1FDLH 1BIIA 2VE6B 5TK4A 2OPCA 2P26A 4K3JH 2H0JA 3PDOA 2LE9A 3F7KA 4QT5B 3X1FA 1XF3A 5JR1H 5LLIC 3ES6B 5KVFL 5KSAB 3VYPA 1BM7A 3FMGH 3F7LA 4JJ5B 2UY7A 5ETUB 1NFDE 3X1GA 1KYDA 4LLQB 2BWQA 3BH4A 4A6YH 1JV2A 3KPRE 4PJ5A 5LAXA 2WQWA 3DSFH 4LDEB 4WDIB 5A3IC 3TBVA 4WUUB 1H15A 2A9MH 3RIKA 3QNFA 4W4OC 4ZI8A 1F4HA 4AJVA 1UWYA 1NCGA 3LNIA 2FD6L 3ZBMA 3RVTC 4N0UA 4QRSB 2DYPD 4LFHD 3VU1A 2G60L 5AVSB 2WCPA 2VR4A 5I1AB 1B4JH 2A6IA 2FJGB 3ZE0B 1B4LA 3TBSB 3AUWB 5KVGL 2VLJD 1T22B 1I1AA 2W59A 1J8KA 4QHLA 1TCMA 3L6FB 4MMZB 2VDKH 5B39G 3PF2A 4MDIB 5KVEE 3TJHD 4EIGB 5J9PA 3FT1A 3HBQA 2W65A 5DUPH 1FFPA 3MRPA 4FFWD 1YMMB 3B3BA 2Y6SC 5EEXA 4GEIA 3IVKB 2NR6C 1JN6B 3D51A 5D1ZD 2B1HL 4P2QE 4Y7OC 4YHOL 5KAQF 3QSKB 2XA8L 3T0EC 1MHCA 1AXSB 3AABA 2AW2A 3V6FB 1D5MB 4WU7B 2YA0A 4LLWA 4OLWL 1EDQA 4GW5A 3L3DB 1VGKA 3FPXA 4JPVH 5D7IB 1XSOA 3HI5L 4FMKA 4JRYE 3X1BA 4FP8H 3WIIL 5J9PB 2Q8AL 3HUJE 3U0TA 3JBG7 4ZSOA 2PWDA 1E5UI 2ZUXA 2EIMB 2AEQL 2R4SL 3FSOA 4L37A 1CGSH 3FT0A 3QVAA 3EHBC 5IV2B 5D1QC 1H8LA 2Q20A 5DMJB 5DC4B 3RX8A 4I89A 3G6JF 4DSYA 4AK2A 3X12A 1FIEA 3DBXA 4N9GB 3WFHB 4HZLA 5E8DL 4QTHB 4YWGH 5IW6A 2V5SA 2IO5A 5DHXB 4B53A 3LPGA 4CVWA 1IILE 2ODHA 5I74B 3WEXB 4NQCA 2JJVA 4YVNA 3CG8A 3I50L 4JQVC 5K9QI 3KZ8A 4GKLA 3GBMH 5C0JB 3C2AH 1QSFB 5IESH 1CE6B 3ALWA 3D2UD 5A2JH 1E4XL 2P8MB 1A3QA 4FG6D 1MIMH 4TUKH 4RAUA 5T3XD 43C9B 4OCXL 1UZ6F 4IOSA 1TEYA 4I3RL 1F90L 5H37H 3TV8A 5C6TL 1N64L 4U1SA 3I6GA 5IW3A 5HVWA 1NC2A 1MWOA 5IW6B 3CN2A 1EZLA 3FHQA 1M9SA 2A38A 5F7NC 4P5TC 4UM9D 3ZIMA 2ITEA 1PG7L 3GS7A 3MZTA 5D7IE 3RWEB 2HZHA 2EEBA 3MLXH 3V4VH 1G4RA 4UAHA 4XN4A 3S5YA 2XCMC 3UEZA 1ZOXA 2C3VB 3ARFB 4FTDA 3INUL 1KV7A 3S3JA 1WAAE 2GBVA 4FQ2L 5BUGA 4N2BA 3UG5A 4KAQH 4P23C 4G6ML 4A2EA 3JYBA 3MZGB 3PHOB 2VNCA 3EXJA 1IC7H 3U7YH 4HK0B 4KROD 1PQZA 4NN5C 4X6DA 1WDAA 5AEAA 4XXWA 5TFSH 3BKMH 1ZIBA 1MWAH 4WIQA 3I2CL 2H3KA 1A3RH 2YMTA 4N8CH 5HI3C 5J6SA 2CD0A 1T1YB 2NX5D 4OD3L 5AZUA 3SJVE 1U2YA 2QL1A 1TKWB 4BRJA 5HGAA 2BFVH 4I18C 3WCYA 1GA2A 2FEDC 5MENB 1R24A 5EU7E 4EKJA 2IV9A 5ID0A 1NGXA 3ZRCC 4PJAF 5MP6L 3RYMA 3HI5H 1O6TA 3VE0A 5CN2A 1DJXA 3OMIB 4WGKA 3UGEA 4E9SA 5J1TC 3VXRD 1HKLL 1I8MA 4KHXL 2X10A 1OOAA 4LRNL 1I9IH 2O6PA 1HL5A 2APVA 3PGDB 3SPVB 4PRHB 4QLRA 1C12A 1SJXA 4F24A 4CW1B 3TO4B 4R83A 1JK8A 4GRLA 2I25N 4Y4KC 5JMRA 1KCWA 2K9UA 5EZPA 5HYSB 5CCKL 5LKNA 2AJZB 1A14H 5F6HI 1F1DA 1F86A 3EGSA 1JHTA 1UA6L 3HR5B 1BVKB 5C3TA 3QDAA 2JKXA 2HSIA 2C8NA 2MQ3A 4OZGB 1MI5E 4L4VD 1P4LA 5FUCC 1NGZB 3ZL4H 5EWIH 4GBXD 3DOSA 3E2HB 5IBLC 1YPZA 2F58H 3P4NA 1MG3C 4I77L 3HUJA 2B08A 4WHYH 4ODBD 4XHJC 5MENE 1FL3A 3TA3B 1S7SA 4L4TD 3MV11 2CRYA 3MROB 2F19H 2NY5H 3WS6C 4M8QB 5C7XH 1ZLEA 4OZHE 2XXGA 4BKTC 3IE9A 5JZ7D 4ZUSA 3FONB 4B6ZA 4OGQC 5EC1B 2CA4A 5IBTH 1Q0XL 1EA9C 3K1DA 2WWKO 5LBSL 4PRHE 3AXHA 1SN0A 3RHWK 1F13A 4JZJB 7FABH 2ZNXA 1WTGT 2XNAA 4FTVD 5B8CA 1AO7B 3QNZB 2A74A 4XCNB 5AD0A 1M7IA 2VDRL 3V4PL 1RU9H 4BWUA 1HILB 2IF7A 2GI0A 1KXVA 1W80A 4HF5L 4FL4C 1S7XA 2Q3AA 4OIFA 3ZX1A 2RTTA 4X5LA 5LDSA 1R4XA 3BQUA 5IVXB 3B5HA 3MOBL 2F7QA 4LSQH 1OWWA 2AK4D 3ZTNH 3GMPA 4DESA 1H3VA 3L5HA 4DP8X 2WV3A 4KDTC 4HS6A 3U1SL 3FO2B 4ADIA 1CFMA 2AJVH 3IJSA 3N41F 5H37G 1O0VA 3EYSH 4F7PB 5KUMA 4AV4A 4ONHA 2HXAA 2KI6A 4NC1E 1BMWA 4EQ3A 2G4GA 5T1LD 4KZCA 5D6DC 2ZUVA 4MD5B 4AH2A 1GGTA 2IG2L 3I6KA 3KWTA 1BVLB 1R5IA 3ATBA 2HN7B 3D0VA 4NSKB 2CU9A 3ATFA 1A3LH 1A1MA 3CZUB 4OD2A 3JWNG 2VW6A 3LKRB 4FQPA 5DQJB 2QTEA 3VGGA 3QULA 4LP8A 4Y1AA 1MHHA 2XV6B 1Z6JT 3BESR 2WQSA 3SYQA 4AQ1C 4O2CA 5GZNA 3BUPA 5F7KC 4N90D 5IBUG 1BA9A 1ZLVH 2FJFB 1KTKE 4ECNA 3KL3A 1KCKA 5DZVA 4AQAB 5FYKE 3TN0A 4IIZA 1JZ6A 4EF3A 2VN3A 5I0ZA 2OZ4A 1Z7JA 4L3ED 1ZSDA 5AUMB 4KQ4H 5DVNA 3HN8A 5FCUH 3W1ZA 3WNLA 5GRXG 1QTSA 2PPDA 3LIZH 2A9NL 4I3SH 4JPIB 2VQUA 4OZFB 5DQ9A 4BUHA 5EUKA 3UG3A 5ID0B 1NFIB 3AREA 2Q7YB 3H9SA 3D25A 2JF1A 3GEFA 4ZD3L 1O75A 4CL7A 1ZGLP 1BEYH 2XN0A 2PYEA 3FOLA 3OPZH 4OD1L 1GZHC 2DS4A 2QHRH 4PWHA 2CRZA 4I4WB 1C12B 3BDYH 1QPPA 3CFDB 4IQHA 2L7UA 5E2WL 4XPHL 4M1CD 3HRZC 2EDKA 2ZYRA 4ZOCA 2HAZA 1GC1L 5TF0A 2UXVA 4KK9C 1O5DT 4XNZC 5D2LB 4GSUA 5KOVC 5AVVB 4ZTOH 2DMKA 2Q1EA 2Y4SA 4ODUA 3CX5K 3CFMA 3T2QA 4M48L 1A6ZA 1RUQL 4OLXL 1JHTB 1QATA 3HR5A 3Q2NA 3QUGA 3T3PB 5C09E 3TWCL 4F8TA 3ABGA 2NX5B 1SVCP 4HSCX 3EJSA 1KY6A 5TE6L 2NDFA 3ZYJA 2XWTA 3W11C 1A7PH 5TJWK 2K70A 3NFPB 4KROB 1UWEH 5FHBL 3WNPA 3MUY1 2CMRH 2WXLA 3RUGB 4GSDH 5D8JL 1HDMA 4DUWA 3DOSB 5C2UB 2ENJA 4Z7UA 5BV7H 3OKNB 3C6LB 2A77H 1LO0L 1CFQA 3DTXA 3GMNA 5DD5H 1WCBB 5F9AC 5DMKB 3CX2A 4PMFA 5BZDA 3BQVA 4LQFL 3N9GL 4X0NA 4JZJC 1XMEB 1MXGA 3ZT5A 3OR7A 4KI1A 2FBRA 4LVNC 5D72H 3RURA 4LVHC 1J5OL 2MFNA 2XWTB 1KTCA 1GZQA 5CEYA 1NUDA 2J88L 2LTQC 1FYTA 3C60C 5DJDA 1A6AB 5LNGA 3E8UL 4H4NA 5HDRA 3PXHA 4XWOC 2HFEA 1CFNA 5HHNB 1BECA 4XGZB 4IHOB 4HDIB 3U4BH 1D9KD 3S8WA 5D2LE 2BS71 3JQOB 1IEBB 4U3SB 3ORJA 2G2RB 2DQFA 2X2IA 4D0DB 1XD1A 4DKFH 2WJ5A 2HRGA 2OTPA 2VXQL 2WQXA 3U7AA 2ARWA 1MEXL 2F61A 1UG9A 4HIIA 4CC4C 2B3RA 3D4CA 2CKNA 1DQMH 2YAPA 3IAQA 4K9EC 4HUUA 1YEIH 4R97C 1G87A 4X9BA 1PNDA 2X4QA 3CVHH 1FFRA 5DUMH 5EA0H 2OXGB 1R3IH 1P6WA 1VGEL 1CN4A 4TVPL 5L2JA 3T2NL 4X4ZA 3VO0A 1NAMB 1ZV2A 2BM3A 4NO0A 5I75B 4R0LC 1IQDA 2WBJD 4MB1A 4XMWA 5J1AA 1FFPB 5HI5C 1LO4L 4A1RA 1L7TH 4PJBA 2P5EB 1J8RA 1JL8A 2ZXDA 2YD3A 2EDMA 2J73A 4L9LB 5CBEA 3HE7A 5JNYB 1OT2A 3LCYA 3VDBA 4GYBA 2RCSH 1SF3A 1TDQA 3O8XB 2CBMA 3NEXA 2Y6SD 5DSCB 4G6JL 2JCCE 2CK0H 2HB0A 1JCKA 3RJDA 5B3SB 5AOMA 3K6SA 2L3BA 5EBMB 4LL9A 4WU7A 3FQUA 4P5KA 5CCGE 4ETQB 5E5UB 4ZS7L 4UQ3A 1A7QL 4OGXH 4JFUA 4HPYL 4PJIA 2X4RA 1RZKL 4E9VA 3WMSA 4I0KA 3HG0A 1AGFA 3QQXA 3DK2A 3QXAA 3L7EA 2WVSA 4PRNB 1PZSA 2J1XA 4BFGA 4APQA 4HG4J 3WSQL 1MZYA 1XVSA 4PV8B 1OLZA 4JO2H 3ULVD 2H1LM 3VGEA 1PX3A 1DZ0A 3IBOA 5E9DE 2R56L 4QPEA 5CKAA 2OSXA 1I4FB 1MHPH 1AGCB 1IM9B 2H2PC 1FF5A 4KX7A 4NQCB 4WHTB 4XBPA 4XGZA 3QQ9D 4Z0BL 2VM4A 1I7RA 3QJHA 5GS0D 4V1DD 1H6EA 1HXYB 1S7QA 1RUML 4PGJA 4M1DH 3JVGA 5IB2B 1O7DE 1NAMH 3NIGE 4LPVA 1PGRB 1ET8A 3US1A 5F1KC 4JW3A 1PSKH 4UINL 4WY7L 1IGCL 3AU1B 4P48A 4Q56A 4A2FA 2DJ4A 4LLQA 4UQCA 5TGBA 1WE5A 3VMNA 2OMZA 1H8OA 1FO0B 5AAWA 4UT9L 3MRQA 3MRNB 3QEQD 4OJAA 4GSQA 3GB7B 1EXUB 4P57A 2CCWA 3FUIA 4A04A 2IBGA 1JSYA 3HCVB 3S98A 2AABL 3HS9A 1DHKA 1JOIA 4DKEH 4JFDA 4EOWL 4IEFB 4UT6L 2NNFA 2DQTH 4NWTL 2XTLA 3MV7A 2BSTA 5D2NE 1V8HA 4HC1L 5B3NA 2EYRB 1LP9F 5JIHA 5BRZD 2Y1VA 3TBSA 2HMID 1OLLA 7PCYA 3OKLA 1F3JA 3S5LA 5AFAA 1JZDC 4N2AA 2MSPA 4MDIA 4L4VB 5J12C 3OV6A 2FECL 1JPSL 2WN2A 4KV5E 2FO1A 1R34A 3HMXH 3PWJA 3W0WA 1OF2B 5DEGA 3D08A 1T20A 5K69A 1KPUA 2Q76A 4GRMB 3BUDA 2CLRA 2OX5B 1C08A 5E8OB 4LASL 4ANXA 3WTSA 1UM6H 3EYUL 3F01A 4WUKL 4I0PC 5FYJU 5AAMA 1FL6B 1CZ8L 3PGCB 2YZ1A 3PWPD 3PNWA 1KJ2B 4N0YH 2UWEF 4LCIL 4QKXB 2CIIA 3L4WA 5D55A 1FNHA 4DP4X 3A24A 2PCPB 2VDQB 2YEQA 3BD5A 3E1ZA 1D6EA 4PJ8C 3QCVH 4QKTA 2J57A 2H9GB 1TF4A 1M05A 5C6PB 3QORD 4V2BA 1KBVA 2VITB 3DVFA 5EU6E 3EH4B 4KKPA 2R4RL 4XPTH 1XCXA 4EE2A 4UI2A 4E2OA 2J8HA 5ESAB 1N70A 5MEOA 3LYRA 4MJ5B 5D2NB 4YLBA 2XQYK 1MG2C 1OAXH 1TQBC 2NY2D 2JVUA 2F53B 4H5SB 1K5NB 3A4AA 3TPUB 1ZEAL 2BINA 1LDPH 1SXNA 3PQYA 3G3LA 4G43A 5DK3A 4EI6B 4ZUUB 1YPZB 4PJIE 2W81C 5I1AA 3MV9D 4FZ8H 1KEML 1UD6A 1GL4B 2QVFB 4OUUA 4WUUD 3UAFA 3HZMA 2D2CC 1BM3H 3B7YA 3HS0B 3PPSA 4MA8L 4X2UA 5MERA 4JHVA 3CSTA 3JWOL 4XT1C 5C6TH 4AUJA 3CUPB 5EOTA 1BZEA 2JJTA 4RAVB 1P0SE 2OMYB 4JDTL 4AMWA 2BMKB 2IANB 4AGLA 4FQHB 4IDJH 1PF3A 4QRRE 4KKCC 2WYHA 3MV8D 3UJTH 1CFSB 4KFMA 4XNXH 3OHXA 2DWEA 2AK1H 3LZRA 5JW4N 4L4VA 5DJ0A 4HUNB 3BWUC 5DS1A 1KTDB 3TYGH 3MCLL 3NTCL 2EDNA 3GHEL 4Z7QE 1NFDA 2DQHL 2O6FA 2Q76B 4GRMA 5DA4A 3Q1EA 2HH0H 4HOMA 5MERB 3WOVA 2OJZL 4RNRB 4JO5A 3HMXA 4L05A 4NRXB 2GBAA 5ALBH 4ZNCD 3L81A 5DGRA 2I9TA 2TSAA 1ORQA 1UCBL 4OF3A 3O41B 3GM0A 5LO7A 4V11A 1WBZB 5HGBA 1C9SA 1RJLB 5DHYB 5ILTL 3V4UL 3SGKC 5E5RB 3VFMA 5IMMA 4XX1G 5HGAB 4DPCX 1TKWA 4J3OH 5GGVY 4N26A 3T8MA 3LIUA 3X12B 1XGYH 1E6JH 4HUKB 3OJVC 1TMQA 4X8CA 3L9YA 4K9EL 3RWGA 3EADA 3EGXA 3QFDB 1F4XL 2VLJA 3FT2A 1MXDA 1PTZA 3V9EA 4XVUD 5IK3A 5EV7A 3MRQB 3MRNA 3T09A 5DR5H 2Q7NA 2FX8H 1E4WL 4L5FH 4LAQH 3MQIA 4NXKA 1T03L 1E0OB 5CGTA 2Y06L 4BZ1A 4ODSH 4QRRB 4PBWD 4GW5B 4XX5A 3RVXC 4NUGH 3FXIC 2H4EA 2R0KH 3GGWA 2FQDA 2QV2A 2QZQA 2B14A 3IGAA 4JPIA 4RSYA 4F8LA 2BCKB 4KKLC 5C0BD 4MWFA 5DK0B 4O2FA 1EAOA 4Y2DC 1A14L 2JKNA 3DX7A 3N44F 1A64A 1LWRA 1BOYA 1YNTF 3P3RA 4WKZB 4YIQB 4Z7QB 1LDPL 5E9DA 4YSDA 3BWSA 4FQQB 3V52H 1GYVA 3HB3C 2QADC 1GGBL 5KTEH 1G7IB 3RTQC 3IJEA 5IVOA 2ZG2A 4XCYA 5B4MC 2ZICA 3KPNA 2L7JA 4R84A 4BM7A 4L4TA 4KK9D 3GM8A 4Z6AT 5D4IA 4QTIH 2FX7H 4D9LH 4I77H 2B59A 4M1CC 4ZOAA 1DBJH 4UM8A 4HMEA 4KMQA 1RP9A 5TDPB 3TL5A 2F1BA 4FEIA 5HHXL 1J48A 4DVBB 4TLUA 5PCYA 2XTSA 5IGXL 1V7NH 3MX0A 5J6GB 2F5BL 4NN5B 3CZNA 3FU9A 2WNWA 4JVUA 1Y0LB 4JFXA 4NJAL 1XXDC 3GKWH 4YLCA 3QPQC 2FZ3A 4WTXA 5FDWB 4YSEA 3REWA 2WCGA 1UH2A 4S2SA 2MRYA 4WO0A 3DVGB 1X5KA 4GKSB 3Q2CA 4XRCB 5DD1H 3C8KB 1QLEL 3HG1B 2PPCA 5T5NG 4GG6A 2R2HB 1AGBB 1NM4A 1U30A 3H9SD 1LQBC 4IOSD 4YH6A 3SKMB 4AYGA 2YPLE 4KTGA 3B4NA 2YPKB 5ITFB 2WXIA 2DV6A 4UDTA 3JYCA 2GTWB 1HH9B 3C5ZB 3LKPA 4DGUA 4R4BA 1QNZL 2CGYA 4D9QD 3VD7A 3ZTNL 2BRQA 2Q86A 2JSFA 4WU5B 3Q01A 1OP5K 4TUJB 4EDWH 4HOZA 3MODL 1KT2A 3IJYA 3QG6A 5IMLA 4D7BA 5DZNA 4DP9X 4IKIA 1CGUA 1QKZL 1HHIA 2FJHA 4KH9A 2GFBA 5FO2A 4FABH 4Z3FA 4G9DB 3RBSA 3OJDB 1EJ6A 5CF3A 4E68A 3TBBA 1R24B 5I74C 3V4LA 1IFHL 3BO8A 4N8CL 2VDQH 1DJIA 1S9WA 1BFVH 2FH8A 3VXMD 4MRCA 4R7XA 1A3LL 3UC0H 4F3FB 3EJJX 1YNKH 2H6UA 4OLYL 5DRXA 1CLVA 2IPTH 2IQAB 5SWZA 4HIEA 5K59E 4PG2C 3HG1E 3ASNB 2DF3A 2EEXA 4WKXA 1KFGA 4XMLH 5MP6H 2ZPKL 5J6HA 1TTUA 1KXHA 3GZKA 4P99A 1A1NB 1EEYB 3AREC 1NAKH 3DX3A 3UAEA 1ZSDB 1U8IA 3V0VA 5BS0B 3GKZA 3HNSL 4G7YL 4OJFL 3ARED 3PCYA 4E41E 3EJCA 5LN4A 4U0RC 3KCPB 1UUNA 3OR7B 3ZE1B 1BG1A 1UVQB 4V1DB 5DRXB 3T8VA 4DEWA 1W72L 4K71B 2X1OA 4DN3H 4J3TA 5JW4Q 3FBKA 3M07A 3PWUB 3U79A 2BVTA 1OE2A 1VFAA 3MXWH 4N6RB 1CBVH 4BSWA 1U3HD 2OMXA 5DURD 2X05A 3V0EA 2VLRB 1AY1H 2EH7H 3T0WA 4JRFA 3FTSA 3GTVA 4XP6H 5LXVA 4DAGL 4QHMB 4K5PA 3FU7B 2H2PD 1FGVH 4QRUB 4C4KO 3C6EA 5SWSB 1BLNB 1VFOA 5HGDB 3CZKA 5F89B 3NQIA 3GSOB 3QEHB 4XXCC 3EJUA 4JDZA 3H2PA 2J55A 1A6ZB 2V9RA 2BVQB 4C56A 1NEZG 4Q8BA 3I3DA 5I0VA 1QW9A 2OQJB 1PPIA 4OF7A 2VXTL 5FB8A 4OGYL 5DJZB 3SQBA 2CBPA 3S37X 2HX7A 2JV6A 3WV0A 4XCYB 2IWFA 3WEOA 3AGVA 5E1AB 4NFDA 5ICZB 1JHLL 4U0QB 5D7JD 3SQRA 1JMXA 1LEKB 4Y5YC 4JUTA 1LO5A 3N6YA 4CNIB 3LZPA 2A77L 4O58L 3Q2VA 2QVMA 2YKLH 4NRZA 2A83B 2NY4D 4J1UA 5AYUH 1NBQA 1RJCA 5B21A 3VXQB 4GB9A 4OV6F 3F84A 3P3TA 4I1PA 4FHBD 5J6GA 2NY6C 5B8CC 1GSMA 2GPZA 3GMLA 4Z7AA 2QVTA 5F70A 1W8EA 4M1GL 5J6HB 4GG6E 3F58H 1MDTA 1U8KB 1D9KA 4M8VA 5JTWA 3VSQA 2B9AA 2R1XA 5BO0D 4Z7OB 1AYRA 3LIZA 5DT1L 1OAZL 5L4JA 5SWSE 4HSQA 3ZKNC 5IB1B 4CVUA 4W9HC 3UDWA 3UJIL 5HSFA 3AU0A 4Y2OB 5EF1A 5IOPB 3L3HB 4URKA 3AM8A 4UOQA 4AEIH 3T4AB 4QRPB 4ZQKB 1I9JH 4TLKA 4J2QA 3NJHA 1KGWA 3CMGA 1J0IA 2FBOJ 2RB8A 3X14B 4LL1A 2JI1A 2IEPA 3QARA 4NUMA 4F7MA 5B3JF 5T3XE 1Q72H 3QJSB 1IBDA 1TSHA 4P46D 2VXSH 3O11B 3BISA 1TTAA 1IEAB 1I82A 4JM2A 4O02A 1MPAL 3MXWL 3IMWA 2V7NB 1F45A 5GZND 5IFAL 3UYRL 3W38A 3QR1A 3O6FB 3GLZA 4Y5XA 1T7WA 4LARH 5ISZD 5FV1L 4GO6B 3BVTA 1X5XA 4ZFOA 3B9AA 4DNLA 1NEZB 2QKSA 5JYLA 3G08A 5I1JL 3QEQA 4N3TA 3TJPA 1SVZA 3S4SG 3JV5A 1F4WH 2W9LA 2J5LB 2PTUA 2ZAIA 3SKJL 2BX5A 1L9MA 4OI7A 1IGTB 4PR5B 3RWCA 3BLKA 5FCUL 3FUMA 4O00A 4BGDA 3ULVF 2J5LC 5MEPA 2OXHA 4N2MA 4PRPD 3DV6B 3DHPA 2VERN 2CHNA 4RGOL 4JX0A 5I1CL 4FE9A 3RDTC 4GKZB 2ADIB 4Z7OE 3C2SA 3F6JA 3Q05A 1AIFA 1ZGLM 4H8WH 1AANA 3THMH 4UV4L 2AJYL 1QBLL 2UZIL 1CR9H 1TEGA 5JIQA 1OP3H 2YPLA 5K9JH 1FVEB 2GSMB 3DX8A 3UYPA 3L4UA 1G94A 1SJEA 3FTGA 4ZPVA 1JGDB 4Q6IC 3W39A 1T0NB 4TSCH 1RZFH 3TBYB 3JTBA 4JY4A 1WA1X 3Q9PA 3RPIB 1LMIA 3ZKXB 3D69A 4ZUWB 1FORH 4YSRA 3KWWB 2XY1A 2F7OA 3PAYA 3QA3B 3LN9A 2ID5A 3IJ9A 2XWJA 2NNAB 4UQ2A 4BWTA 4H25B 4Z0BH 3ABMB 3P4OB 4OLXH 1ZV5A 3ESNA 3GSNB 5I8EB 4BSVB 2JI3A 1T5WB 3ZHLA 3QDMA 4KKAC 4A2MA 4PG9A 5FW6A 1PZ5A 4X5XB 1J8HE 1RVFL 4TUOA 4PRIB 2YHGA 1AYOA 5E8PA 3HFMH 4OFPA 2R2EA 4R7VA 5AW2B 2A6KB 2Y5EA 4XNBA 3BPNB 1N8OE 2N0MA 2HVKB 2XI9A 1PU0A 1X44A 2BMKA 3KLSA 5KYUA 5EZOH 2WAQA 1WO2A 4I8DA 5LCVH 4S1QH 4UQ2B 1EGJH 4UT7L 4E42A 4YDNA 3QDJD 2YD5A 1MW2A 3GRWA 3CXDH 1S9VA 1G7PB 2X9WA 3QUML 4R5XA 4ANKA 4FZEH 4PG2A 2CNYA 1WWBX 3NCYS 1A7RH 4NHCH 1WT5A 3QXDB 4Q2ZB 2JELH 5E9AA 3VSUA 1MVUA 5EH1A 4ZMAT 4V33A 1X5YA 1GOGA 3D2TA 1NCDH 2CSPA 2FGZA 4N8UA 1T2QL 4RFOH 4PREA 3AMKA 1WFIA 1MFEL 1GJIA 4FNPA 2HG5A 3V6ZB 3BKJH 3ARYA 1D7CA 2R39A 4AYBA 2A9DA 1G7PA 2DQMA 2CAKA 4UZGA 5GRUL 4X6DF 2GITB 5KSVB 2WNXA 1FFNA 4Z8FL 3QDJB 1J0HA 1HSAB 4G80B 1XBDA 4ZT1A 5F97E 4G8GA 4TKWA 1C08B 1J05A 3MRMA 4H8UA 3ETTA 5E8OA 1F18A 3HC0A 3M17B 9PCYA 4PJDF 3UO8B 1WGVA 1QBLH 2UZIH 3JV6A 4J3UA 5BRZE 3CU1A 4OIAA 4Y89A 4M8RA 3EYQD 1WZMA 2WZAA 3RZWA 4L18A 2F74B 1P69B 1IKOP 2K6WA 1W0YT 4HCIA 5I5JA 3S36L 2VQ1A 2QDVA 3VDCA 1IM3D 4X7CC 1IZKA 1INEH 2ZXCA 2WAHA 1DVUA 3C87A 3V7AE 4KNUA 5EOTB 2FJUB 2A99A 2ZUTA 1FFQA 1N67A 2DQCL 2ICWJ 3SCMD 1D5IL 1QBAA 3L4TA 4KTYA 3UJJL 4Z7NB 5CJBA 1B4TA 3VUAA 4UTBL 3ZPDA 1EHAA 3CDZB 5DLML 1DE4B 4KQ3L 5GRVL 5IW1A 1DQJA 3BP6B 1UHVA 2ZX6A 2ZWSA 2ZTBA 4JHZA 2PR9A 2DPKA 1ZHBB 4KI5F 4UM8B 5FO7A 4KVPA 4N8VA 1CLOL 3OGOE 3EO0B 3VGFA 5AYQA 4YBQD 1G6RA 4GBXB 4H5SA 1JPFA 3U36A 4IEFA 2ICEC 3GSVA 5EU5B 1GGIL 4FMFA 3O4LE 5L6YH 3C08L 1PQZB 2BNUA 3L5XL 1OK8A 4WFHE 4X6DB 5EUOB 3VX1A 3N43F 2HP4A 4L37B 1B3JA 5B3JE 2WKLA 1HQRA 5I75C 2XG4B 3L5IA 3QP3A 4N1EA 1PYWB 2WQ8A 3CFKA 3WMQA 4Y5XC 4J6IA 4YHIA 2NY3C 3ZZLA 4NPJA 3U4AA 3WYRA 4NZU