3UIZA

Crystal structure of sefd_dsca in d2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
133
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIVGNKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
total genus 20
structure length 133
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uizA00
4PHXA 2CO1A 2CO7A 2FVNA 2CO4A 2CO6A 2CO2A 3UIZA 2CO3A 2CNYA 2AXWA 2CNZA 2IXQA 4OR1A 5D55A 3UIYA
chains in the Genus database with same CATH superfamily
2F53E 3DECA 4BA0A 4ZRGA 3G6JB 4PJ8C 3VXTB 4P2RE 5GGVL 4TQ8A 4NQED 4ERSL 5HHQB 3TO4C 3S97C 4XOEA 2CRMA 2DMBA 3PABB 3GLAA 1NLDH 5C2BL 2NCMA 4EDXA 1O9WA 1E6OL 4U6VH 4UTCA 1BZ9B 1LM8V 4LLMA 5DUJA 3SO5A 5C0CB 4MA1C 4CMMA 15C8L 4N9GB 4NKOA 3UO1L 3SDYH 4WFGE 1QSFA 1G9NL 4LSUH 2P8PB 4R96A 4RFOL 3FB8A 1MLCA 3LD8B 3BUYA 2FJSA 5KTEL 1QR1B 3IWVA 2WO3B 2X38A 1YPZA 2EYRA 4C56D 3P0GB 4M7JH 4M9PA 4PJCF 3PAZA 3BIKB 3RHWK 3VGEA 2BY0A 3F6LA 4X99A 4R5XA 5L8JB 1JZ8A 5EU3A 3BGFC 1YEHH 3FTSA 4JQIA 4TUUA 4QHNA 5CCHE 4NC2B 2OMNA 3AU1A 4Z7UB 3VWJC 1ETZB 3L3OC 1MRDL 5MERB 1HOCA 3J27A 4P2RD 4ZW6A 5CF3A 4HIHA 1N3NA 5FIEA 5MEOA 3T8VA 2Y7QB 2HRPH 3UFIA 5ACZA 1DO5A 2OI9C 4X98B 1PZCA 5DFVC 1VKXB 2BCKB 2CHDA 4ZS6D 4GW1A 2YBRA 3BWUC 3V6OE 3U4EB 3ZE2F 1U9KA 2A0LD 4LHUD 1HKLH 3NZUA 3FFCD 2KMWA 1A1OA 2CBOA 4P46C 3MLVH 3O41A 5HGAA 1FFNA 2X1XR 3TN0D 1JYWA 1IAIM 4NT6A 4WFGD 5EOCL 5FYKU 1JV2A 3DV6A 2NW2B 3RWGA 4B5EA 2EACA 4PJAA 4APXA 3C2AL 1I1AC 5HHOA 1ROCA 3FMGL 4ZD3H 5G55A 1GJIA 2KERA 1B9KA 3CZLA 2NY0D 1L7TL 5IMLA 1D5IH 2XYCA 4L9DA 1KLFB 3VXUB 4XOAA 4OLUL 5CCGE 2HT4C 3MBWA 3W0WB 2FJGB 3M7OA 1J9QA 12E8H 5FKAB 3X11B 2OMYB 1U93A 5B4MC 1D5XB 1S9VB 1JPST 3TWCH 3H42L 4GOSA 2JQZA 1E4WL 3BWSA 3L7EA 2DI7A 3MKKA 1UASA 5TPWH 1UD8A 3MRPB 1KG0A 5JORB 1TEGA 4HEPA 3T9WA 4EDWL 5IBTL 4Y4HD 2R4RL 1Y1UA 3QEUA 5TF0A 3KCPA 4ENED 1DQMH 2ICES 1R5WB 1VEPA 2BVEA 2D4FA 3CSBA 5E6IC 1EIBA 3ULUH 4P04A 2YS4A 2HFGL 1VEMA 3MTXA 4AIEA 4XNUL 2KYIA 5JYMA 2FAUA 5KVDE 3FUKA 3D07A 2Z64C 3DGDA 4YHYB 1KCBA 1JV5A 3ZGIA 1HDMB 2B16A 4GXVH 1JHTB 1I7ZB 4KDVA 1I9JL 2G0LA 1EAPA 3WTXA 3BT0A 1CXHA 4YHNA 4Q0XL 4QRAA 1ZGLM 3FB7B 3WN6A 2HFTA 2P48B 1CL7I 3KWXA 4RMQA 5BOPA 3QUZC 1A6UL 2O5NA 4R7XA 2NSMA 1NC4D 2BX5A 5FLVA 1N0LA 4OZIF 4WZ9A 2E7LA 2IPUK 3E7JA 3KYAA 4XMPH 5DS1A 2FZ3A 4WTQA 3WEAA 4JG1H 4V2CB 5E2UL 3TO2B 3BSHA 4NUJB 1EEUA 2P8LB 2DY2A 3L4UA 4YHLL 2DM2A 1GW0A 3T8XA 1WHOA 3DJZA 1IAII 4PLKD 3TVMA 1BA9A 2YEVB 1H6TA 1P7KB 3UTQA 4YR6A 1FCGA 3B3IB 8CGTA 2GK0A 4KAQH 4QT5B 1OGSA 2V5SA 1N0XL 3HG4A 5DK3A 2J4WL 1E40A 3FL7A 4ZAKA 3X12B 3QPXL 2WTRA 2AP2A 3MRLA 3N6YA 4J1UA 1G7QA 3MXWL 3PAUA 3SZ6A 4CSPA 3TESA 2HT2D 1PQZB 2NY1B 3OGOE 3QDJE 4LLQB 1E67A 1UM6L 5AKTA 4U31A 2DD8H 3QJUB 3QW9A 4EOWL 4CJ0A 1DVFA 2NZ9D 5IBLC 1PZBA 5EC1A 2OAAA 5DZPA 4O02H 4X9IA 3MRJB 3MFFA 1UHVA 1BZ7A 1IC7H 4OF7A 5I1HH 1AH1A 3QIBD 2AI0H 5BZWB 3MCLH 1OGAB 1Y0LB 4X6EA 1DVXA 2XSKA 2IBZX 3GHEH 2O26U 3B9AA 1WTGT 4U6XA 5CJ8A 5E6SB 4KTGA 4CGUB 1KYAA 4AIZB 4U1JB 5EWIL 2Y5TB 3CX2A 4P2OC 5ISZA 3WHXA 3ARSA 5HYJE 3CTTA 3PV6B 4S1DD 3IDNB 2G2PA 3EJZC 3QHFL 2DDQH 2A6JB 2EYTB 2CCVA 2X12A 1GYCA 3IJ8A 5GRJL 5DT1H 5F1KC 3QDJD 3IXAB 4ISVA 3VI4B 3VFPB 3W39A 1AXTL 1PDKA 2DM3A 2X2HA 3IF1A 1N12A 5F89A 1W72H 1D6EB 4JRXE 4NKIH 5D4QA 4A68A 2FLBT 2FHBA 1AKJA 4MAUL 5HXMA 3ASWA 1CD1B 3HG1A 1MFBH 1BEXA 2W94A 2X0UA 4FXKC 1HEZA 4M8RA 1MWAH 1WK0A 1W0YT 4B9ZA 4AEIH 1EZLA 1KTCA 4FQHA 1HHHB 2R1YA 5DLLA 3P2TA 4QY8A 1FAIH 2WIIA 3AFLA 4WUKL 4ELMA 1RJZA 1LYQA 2XQ0A 4K94H 4RAHA 5HYJD 1P6AB 3IS0X 2OSLA 3CK0L 5C0BA 4TL5A 5T1LD 5AKRA 2CKBB 1RERA 2HJFB 5AOKA 3SPCA 1AZUA 4B6ZA 5CCJA 2BP0A 1J1OL 3BAEL 5LWYL 5F0JB 1F2QA 1BM3H 1OP3H 4UDTA 1BQRA 1DLFL 1V3JA 1MJUH 1TUPA 1FVCB 3PP4H 1KUMA 3QI9B 4JRXD 5GJTL 4Z7QE 4X4XB 1DLHA 2E4TA 5TDOB 3FHEA 2RJMA 3ZW3A 1LO4L 2BC4B 4KROB 2PR4H 3EJSA 3P0YH 4JKNA 1QI4A 4P5RA 2KDGA 1OGPA 2CIIB 3K5SA 2H41A 2IQAB 2A1WL 1MH5A 1KJMA 3GFUA 1IGTA 3Q8CA 1TZHB 4Y19E 1BAFH 1J0KA 4IRSB 1TQUA 1A6AB 1JHKL 3IFNH 1AXIB 1FHNA 2W9DL 2GAZA 4OD2B 2PCXA 4UM9A 3F7QA 5BS0B 4Y2LA 1E5YA 3PQYE 5DRWA 1IGIL 1AIFA 1MHHA 2A99A 2ED8A 4QF1A 3ZZ1A 5BO1L 1QPXA 2MPAL 2LABA 3TYFA 4DCQA 4BH8B 4N8VB 5GGSB 1OM3H 1O5PA 4S1QH 2DIEA 3T2LA 2VUYA 4BHUI 2MQ3A 1E42A 4OGXL 4IQHA 3V4PH 3Q43A 1Y6NR 4JY6B 3WFCL 3PJLA 3VQMA 4X8CA 1W0VB 1FL5A 4AT6B 4ZTOL 1F90L 2WXRA 3BLKA 5IHUL 1ZANH 3G6AA 2IBGA 3ATEA 5EDXA 1DL7H 4G7SB 1XGYL 5GRYA 4YK4C 3PIQB 5JHMA 1OALA 2WBJB 4R90L 1N5YL 4MAYD 1CU4L 1ES0B 3GXFA 3H3PH 3QPQC 5D4JA 5DRNA 3H6AA 4H5SA 2M26A 3W9EB 4PJXF 1AAJA 5L8LB 1B4JH 1WP6A 1N10A 3PHOB 4HKZA 5DJ8B 5C0RH 3PQYD 2HLFD 1A4KA 4BFOA 4YE4H 25C8L 2F74A 4NNPH 3J2PA 3BQUC 4K5LA 2VIRA 1C5CL 3L7FB 4ES9A 1DSWA 2N1KA 2HTLC 3LVTA 4MHHG 1YNKH 1BQLL 1PAZA 5E70A 3TT1L 3VFSB 2H9GA 3W38A 3RNKA 1SHMA 3DRQB 5DEFA 2FBOJ 4B41A 4MNQA 5FF6B 3QQDB 1T83A 3KG5A 1TCRB 4WW1A 5GGRB 4OZGB 4ANVA 5I6KA 1UCBL 4PRAB 3BLPX 1KPVA 3TCLA 3OR7A 4JKMA 4NQEA 3CZJA 3MBED 2CIKB 5FB8B 5D5ME 1HINL 4F7EA 4WWPA 2BY2A 4PRIB 1NCDL 4WEBH 5TF1H 3S48A 4ZUVB 1GZPB 3LSOA 3P30L 4IKLA 1H8NA 4HSAC 1EBPA 3UGEA 2QVIA 1B6DA 2DQHL 2OX5A 3EJTA 5LG1A 4KC3B 4Y4KB 1WEJH 3QEQD 2P44B 4JPWH 2WVSA 5BJTB 3AACA 3MVSA 4NDMA 3V9EA 4ANUA 4AGQA 1FIEA 4FQ1H 3SE3A 2EUWA 4W9FC 4C56A 2DTMH 4BFEA 1G0DA 3CXDL 2AEPL 4PGCA 5BRZE 1A21A 2BS9A 1I1YB 3NA4A 3QDHA 4XZUA 1PZ3A 3DDFA 2QTEA 2H1PH 2G3MA 1YRKA 4JZOA 3N43F 2PYEE 5KW9H 5JOEA 4EZLA 3V0WH 3ZE1F 1ZJAA 4G6ML 4P2RA 4WUUE 4GKZB 2OPCA 2JV6A 1LMKA 1UADC 1CGVA 2LU7A 5IVXB 1OANA 2XWRA 2GY5A 2A6IB 1BOYA 2HTKC 1IX2A 1RL1A 4LHUA 4NIKB 4Y5YA 2XWJA 3FFCA 3TN0A 3PWUB 3H55A 1N8ZA 1A4JA 1YY8B 2APVA 3GXPA 1S7VA 2HPOA 2YA0A 5K39B 3VG9C 3E8UL 2AHIA 5J6HB 4PCKA 3T8MA 3LEXB 4AQAA 1HAWA 3V0AC 2WN2A 2KC0A 5BVJB 5KS9E 1TQTA 2Q1EA 1MCRA 1WCQA 5IOPA 3CVDA 3SBRA 1KJVB 4DQAA 1VDGA 1IT9L 3X3FL 5BRZD 4M8QA 3FXIC 4TLKA 1JWUB 2BVOA 1TT6A 3BGMA 2ZKHH 1XAUA 4IRJD 5LCVA 1Q9LB 1NSNH 1REIA 2PYED 3DPBA 1GHFH 4HDIA 4LOVA 4HPYH 3MA9H 1U42A 3T0DA 4XNDA 4WUUD 3APCA 2EIDA 1NTDA 4GKSB 1RK0A 5E2VL 3QXUA 5SWQB 2QPSA 1IC1A 5F9OL 3G5XA 1CYWA 3LS4H 5KZCD 1T0OA 2VLLB 4LLAA 4LEOA 2FJHA 1GAFL 4Y4HA 4OLWL 5C0DB 3FUIA 3HJEA 3MGTA 1KCSH 4YGVB 1NAMB 5EORH 4ZW7A 1RXLA 2FO4B 1R3KA 2YGOA 4RDQF 2LAAA 4HIXH 1S4IA 3UEZA 2NQCA 5I1IH 1KTLB 1SOQA 2IADB 3CFJA 4L0PB 5K59E 5J11B 2AXWA 1W8OA 5CFHA 4GBXD 3GMQB 1BWWA 1DQJA 3TV8A 2R1WB 5KSBF 2X0VA 3OXSA 1YEKH 2YA1A 2G0KA 4YPGB 3QJVB 1X9RA 3ZJAA 4AJ0A 4N3TA 2C9AA 3HE6B 3RU8L 3OKNA 3AXLA 2NUTA 4AV4A 3LRLA 5F9JA 4MDJB 3EF4A 1S7RB 4L37A 2VDPH 3FQTB 1NC4A 3REVB 4IBTA 4J4PD 3I6KA 4I87A 4WO4B 4ZUSB 1U8MA 1U8LB 4N8VG 3UBXI 4UBDC 3ILPB 1DBJL 4BFJA 2P8MB 4DZ8B 3FU7A 3D05A 3HZKA 2BHYA 2XG5A 1A4CA 4KX9A 3ZE0B 4JM2F 2B59A 2VXQA 4QHMA 3ZIMA 1DTUA 4QRPE 4G6KH 4L8DA 2XZQH 3EYVB 4Z3IA 1U91A 3RFZC 4G80B 3NIDB 5HGBB 5L2JB 1Z66A 2WQRA 4H8HA 4J3WA 3SPVB 1ZD6A 5IR1B 2DIAA 3LN4A 1PEWA 3OZKA 2AJUH 4U3SB 2Z8WC 3EGXA 3I2CL 1CG9B 3W82A 4HUUA 4FAAB 1FQ9C 1M7IB 5KSAB 1TQCB 3WKPA 3TZVB 2FSDA 4M6ML 1YEFH 3LNGA 3MUGB 2K7QA 3AT9A 2NRDA 2Z31C 3KLAA 4Y89A 3UAJC 2D3LA 5GGQL 3HNVH 3IPEA 4HUKB 1CQKA 3HUJB 3IFLL 3ZK0A 4P3CL 5FO9A 1AP2B 4QHKJ 5IMKA 5JQ6H 4RDBA 1W8NA 3BP6A 2QSCH 4XBPB 3U79A 2B3IA 4KZCA 3K6IA 1ET8A 3LIZH 1I82A 2VQUA 2HXAA 1M6OB 3BUDA 2UZIL 4QRPD 2Q20A 3OC8A 4ATWA 4V33A 4ODTL 3DC0A 5DQJA 3NTCH 4GAYB 5KBNC 3VXQA 3CFTA 2CD0A 4DN4L 1IQWL 5TTRA 3OHXB 3CHSA 4NZUL 1NCWL 2RQ8A 3T1FB 4XCFH 2OS7A 3QDJA 5FUCC 4NQQA 2EECA 2CR0A 1IL1A 2HJKA 3T2QA 3APNA 1A22B 3BKCL 1EVUA 1NCIA 1R17A 1S5IH 4WJKB 1A2YB 4J12A 4S10A 1YMMD 4CDHA 4XNBA 1I8AA 1K8DB 2FX8L 3DMMB 1SEBA 1SJHB 1T04B 1S9KC 4QHLB 2EUVA 4ZTPL 3Q0HA 3LKQB 2Z7UA 2A9BA 5DVPA 3WN5B 4HJ0C 4S2SB 1ILUA 2EVHA 3QQXA 4HWEH 4LAQH 5HVGB 2CKBL 4JQIH 3AREB 2CJ3A 4O00A 5I15H 4QO1A 1NDGB 3CJJA 2Z34A 4FQIH 2GY7B 3NJJA 4NZJA 5ICXB 3DHMA 5HYJA 1UH4A 1JVLA 4BZ1L 5GISL 5BQDA 3S5LA 2A74C 5T1LA 4L1HA 4NRYB 5HHXL 1DSYA 3UYPA 3VMOA 1W0WA 5EU7C 5AUMA 3LY6A 2P5WB 1TJMA 3L3JB 1Y6KR 3MUZ1 2I26N 1NWOA 1ZV9A 4JRXA 1A1MB 1A5FL 2VL5B 1SUJA 5F97E 4UTAL 4X4ZA 5FYJU 4W9IC 1M05B 3V0HA 1S3KH 3VCLB 4LSRL 3MV01 4LGPB 3TBBA 4O9HH 4Q89A 3QUXC 4HK3J 4O2CB 1CFQB 4DP7X 5F2FA 1HAUA 2R83A 4NCC1 4P2QE 2D03H 3BPOC 4NI3A 1IEAA 2VITA 3RWFA 3OWEA 3OKKB 1BF2A 1LP9E 4K3JH 1SJEB 2E7HA 5I1AB 4QHPA 4ZO8A 5FOJA 2D3JA 3LKNA 1SHWA 4AVHA 1U30A 2AITA 2P43B 4HBCL 4IRSC 2GPZA 5DC9B 5GSRA 5SV3A 4J23A 1EH9A 4D9QE 1XTMA 2ZPKL 3E3QE 1JRHL 2F18A 3BMWA 43CAA 3MRGB 5DMJB 5DVKA 2E8YA 2N7SA 1D5BB 5BPPA 3OKOB 1P9MC 5FYKL 1EAJA 4PAZA 3G5ZB 1FIGH 5DJ0B 1S7XA 1A4AA 4FJ6A 1NMAH 3WS3B 4TSAH 1XSOA 1AGBB 1NICA 1X5MA 1VERA 3AG4B 1JPSH 2IFGA 2AJXH 2WCSA 2IQ9H 1TO4A 4PRBB 3PHQB 5ES4B 3PCYA 3VD5A 4MAYA 1IGMH 1XF2B 1NEZG 1UM5H 5JOPE 2RACA 4ONFH 4L29B 4P2QD 3ZDYE 5T33H 4F9LC 2DQGH 4OLVL 3OX8B 4R0LC 3D5OF 1FNHA 3TH3T 5F3HB 3PQYA 3FSOA 1UWGH 3MV7E 1YNTA 3TT3H 3BO8A 1PG7W 1EXUA 3MUUA 4JRFA 3S3SA 1DUYA 4CC0A 4D9QD 1AACA 1BZOA 5KOVC 3HLAB 1D7DA 4YHMH 4LEXL 3A6CH 5KAQG 5I18H 1HHJA 5GRVL 3ULVF 3U46A 3AADB 5IROC 2YD6A 2MKWA 4Y2NA 5L88L 5C71A 3TBYB 3OF6D 3A23A 5KBLA 1BXXA 1GS8A 3FAWA 2H0JA 5FUOH 1NIEA 4FMKA 1GA2A 1MQKH 3EJJX 3KPSE 3MBEA 3VH8A 5F93C 1IIKA 2B5IB 3GMRB 3NUKA 3FUFA 3WMQA 1QR4A 2MCMA 3BCDA 5JOPD 3HA0A 3WNKA 4BSWB 2RGSA 2JIXD 4MXWL 4EI0A 4IK7A 1C1EH 1XH3A 1S5HB 3ET9F 3MV7D 3QR1A 4BWTA 3QEQA 2YPLB 4H8WL 5HDQL 4U1SB 4XP5H 4XCNA 5B39A 1U8PA 1MSPA 2X70B 4R2GB 5JO5B 3MN8A 3U0TA 5ABAA 5EZLB 2JLLA 1ZPLA 3BH8A 3QJHA 4QRQB 3BFOA 4CW1A 4OF5A 2P1YA 4TUOA 2DQTH 4TQIA 4Y4KC 4X50A 4G8FB 4K7FA 3VI3B 4WK0B 4S1SL 4W9ZA 3WO4C 3T4YA 4KUZH 3PGDA 1NIDA 4RVBA 4YHIA 4CVXA 3Q6FA 5JPMC 3SDXB 5JXEC 2EDDA 3TV3L 2ZX6A 4ZW8A 3KPSD 2VSMB 1FO0B 1RUPH 3JV6A 2KDYA 3KGRA 4I2XE 4ZPVB 4DQOH 1WAAF 2AQQA 3GD1C 1RZGA 2WPGA 1FP5A 2IPUG 1MFEH 4IDJL 3UTSE 3WDIA 5CN2A 1IB5A 2BW5A 2AF2A 3TJHC 2C9PA 3NAAH 2ARJA 3PXHA 1NPJA 2DL9A 5F7LB 3OAYH 2EE6A 1XEDA 2R15A 4GXUM 4QLWA 4Q14A 3UH8A 4JHBA 2JKJA 1EO8L 4AE0A 1I9IL 4PJ9D 5L2KB 7PCYA 1FZOA 1GYAA 2AJ3B 2MWCA 2RAMA 3GXUB 4DGVH 1YC7A 5BRZA 2CH8A 5HDBF 1ESOA 1C5BH 2OYLA 2DYRB 3DX0A 3CMGA 2VR5A 4K23H 4IRJA 1XAKA 3EFOB 4QHUB 2PYEA 3WIFA 2ZT9C 4Z77B 2FK9A 1NAML 4WUUA 5TE6H 3SE4A 2IPKB 5HGHA 1M56B 2QV2A 4HJUA 2IH1B 1AZVA 1QG3A 3UTSD 1RIUH 1SYVB 1OB0A 1I8UA 3HZYA 4IHBA 4K3EH 5F7DB 3QNYA 1ETJA 2ZE0A 3NN8B 5D1ZI 3GNML 1H5BA 3CXHK 3UROR 2MOVA 2ZYSA 5D7SL 1XF3B 2K9UA 5FCUL 4TNWK 3BSZL 5KN5B 3FQXB 4KK6D 4K9EC 2Q7NA 3F65A 1P5UB 1Z5LA 2HMIC 2FB4H 4JFEB 4I48B 4GBXA 3HE7D 3C6EA 4LNRA 1CICD 1F8TL 4N86A 4QTIL 3VRJB 5BNXD 3IVKA 3WS6C 4ZDHB 2VLKE 1ECYA 4NYLA 4XCCL 3RWIB 4R6UA 3NCXA 6TAAA 4HAGA 1V55B 3SEPA 1ADQA 5DZAA 5J11C 1F6FB 1HEHC 2Z92A 1B4LA 1BXUA 1U8HB 2YAPA 5IHLB 2CLRB 5AOLA 3VFVA 4CKVX 5INCB 3VYOA 3EO1A 4GG8A 4J4PA 1RJYB 3RILA 1JAEA 1CQYA 5FO7A 3T0AA 4EMZA 2AERT 1T6BX 1CGXA 5ITFB 3U7YH 2Z65C 4NNYA 1AD9A 3HE6C 3EJPA 3LV3A 2AJSL 1FYTE 3FQWA 3PF2A 2B77A 3RQ3A 3HLKA 2AEOA 3CH8A 1UD4A 3QZOA 2OV0A 3CZEA 4IBSA 2W92A 1H0DA 4J8QA 1GOGA 1RUML 1U3YA 1VFMA 2FO8A 4DTGH 1HYSD 3SQRA 4AJVA 4XP6H 5KYXA 4WEMB 1THCA 1AS8A 1TXKA 5TQ2H 3V95A 3W9DB 3M8OH 3KVPA 1TDQA 2J20A 1R6VA 4MXVE 5L4MA 1KYOK 4XO3A 5J6GB 1INEL 2CLZB 3RVVD 1DQVA 1SOSA 3GRWA 4KI5E 2WXHA 2IXQB 2WWOA 3KGUA 2CK0H 3ULUC 1RURH 1OL0A 3GTVA 1T1XB 3WNOA 4OV5A 2NY4D 3VNZA 2YRLA 5KSAC 3CUPB 4F58H 5C8JA 5ALBH 1GKEA 4CGTA 3FO1A 2EDXA 4PHXA 3B5HA 3CH1B 4O58H 4UT6A 4WQOA 4EJ1C 1FYTD 4EVNB 1ZT4B 4DZBB 3KZ8A 3MX0B 3VXSE 4WI4A 1MCEA 2R69A 4HZAA 2N01B 5JHLH 4EN3C 3D09A 2UVFA 3M1BA 4QRPA 3SGDH 1N7ML 2QGBA 3T3MB 3BEVA 1IC0A 3EUDA 4GKLA 5GRWA 2VQ4A 3WLBA 1IGCH 4Y1AB 2B9AA 5GZOD 3LZNA 4OJYA 3ARDC 2QQNH 1JGUH 4M3HA 4UTBL 3Q8BA 4A1RA 4X0KA 4F5CE 3RL1A 4LLUB 3R7QA 4YC2B 1L4IA 4LRNH 4KI5D 3BD3A 5LNDA 4WY7H 5FO8B 2BZCA 4E0RA 5DTFA 1R0AL 5TQ0H 1N6QH 1AXSB 3OKDB 3BP7B 1JUFA 2CDFB 4Y9EA 1YMMA 4ZZKA 4Y9BA 3IRZA 4JANB 4AQZA 2KLSA 3QFDA 1WVZA 4ZUUB 5SX4I 1EMTL 4E41D 1B2WH 3KXFE 3VFUA 4KZEH 4L48A 2OYKA 3VXSD 1ITBB 1I31A 1C16B 3B7RL 4HHAA 4LPWA 1KXVC 1WBXB 3IYLW 2Z91B 5E0QA 2OMZB 1A6ZB 4X5WB 2OQJA 4N0CC 4HUWA 5ICUA 5CBEA 3EDDA 1KBVA 2VO8A 1KGYE 2YJQA 5EO0A 5A3ID 1U6AH 5J1SC 5E0FA 1T03L 2BS71 1UB5A 3AREC 1JZFA 1TVHA 4LVHB 5AYTA 3HB3D 3RGVB 2CBTA 2Y7NA 2A9DA 5CP7B 3D18A 2HP4A 3IMSA 3QP3A 4HS3B 3JV0A 1H8LA 3JTSB 3B9KB 3L1GA 2DJMA 4L1TA 4K8RC 2LVCA 4OGAC 1U8KB 5TGBA 1VSCA 3C8KB 1XR9B 4Y5VB 3NJMA 4MX7A 2L7UA 4F33A 3FU9A 2WLJA 3K7UA 4OJEH 4OGQC 2WZ6A 3CSPA 4DGIH 5SWZE 2EILB 3MV8B 1SHSA 1XGRB 2PO6B 2UX6A 3RKDD 2FX9H 3KXFD 3LPOA 3ESNA 2YXFA 3AM8C 4UINL 1FVEA 1FL3A 4LBEB 5DC0A 1BVNT 1Z0NA 2FQGA 4YAQB 5LCVH 2X9ZA 4NJ9H 1U8JB 1NLBL 2PW1A 4IM8A 5LG6A 1ZGLA 5D7IF 3PYCA 1PCXA 3BKML 4KVCL 4NXKA 1MF2L 1LO0H 3F7YB 4NQDD 4LCCC 2OTUA 1SBSL 2BFVH 2OSWA 3WJJC 1G6VK 2IGTA 1LXMA 3D0LB 1HXMA 5T3ZL 5D96B 4CU8A 4V2BA 1ORQB 1K8IA 1MW3A 1YEGH 1EJFA 4LU5L 2NXYB 2GQHA 3ESVF 5FLUA 3WTTA 3FFDB 1URLA 3DO3A 2ZONA 4QRSB 3QXWA 3QH3B 5DC4B 3PWPB 3CFEB 2W95A 5MENE 1JFQL 1CB4A 1QVOA 1U41A 2EIMB 4FZ8H 1A1NA 1KCVL 5SWZD 5HGDB 1CPUA 1EK3A 1QFPA 2EDTA 3SGKC 3LQAH 3ULAB 4OLZH 3QYNA 2X4SB 3IE9A 2GJ6D 5I0YA 1NBZB 5IJDC 3FO9B 1NMBL 3E1ZA 4G1MA 4P2QA 3RVUD 4FI8A 1F00I 5DLMH 3FN9A 4D9LH 4Z3JA 1LP9A 1U33A 1U0QA 3L81A 4LSPH 2LOEA 4PCSA 1AJ7L 1UB6A 1P4BL 1FZKB 2TRYA 5LO7A 5E5UB 4KRLB 3DX8A 7FABH 5I17B 3MPCA 3QO0A 4GPVA 4IKIA 1BD2B 1OWWA 2LU4A 5A7BA 2QV4A 5EUKB 4AYGA 3OLDA 4PB9L 2W0KA 3WY2A 2VXQH 3CGTA 2DS4A 3MJGX 4X9BA 4GG6F 2ZXCA 1R5VA 3OF6A 4LQ1A 3QDMB 3JWDH 3AC0A 5H2BB 4DK3A 2CGZA 3TNNA 3BWUF 1JYXA 4MMZC 2AQ3A 4XH2A 1QFWL 1ZAGA 5HYQB 3ZDZB 2IH8A 2JIXA 2BHZA 2UWEF 4LKXA 3S37H 3TFBA 4BHUA 5L4JA 1QRNB 3FO0H 4OKVB 4QGYA 4MQ7A 3MV7A 4I5BA 2GC4C 4JN1H 2W59A 4FEIA 4PJEE 4JG9A 4R7DA 3MOAL 4JFDE 5HPOA 2DJSA 1FN4A 2W65B 4GP8B 5DEZA 3RGBA 2X40A 3SY0A 3B2VH 2J12B 4EI6B 3QCUL 4GQ9H 2CAKA 5I9QC 4IJ3B 4MJIE 1NANH 3QCTH 1AHMA 4M7LL 1FO0L 5DHVA 3T71A 4N8PA 1U3HB 2HT3C 3KWWA 5GRUH 1KV7A 4HUXA 1X5XA 1OLZA 3GMNA 2MQ0A 2AGJL 2CGRL 4EUPB 3GXTA 3CDGA 4JPKL 4MS8C 3RL2A 4EIZC 5BOJA 3L1OL 1UKSA 3RI5K 3KPSA 1ZVSB 1QATA 3U2IA 4PRHB 1C08B 5DO8A 3DGGB 3QRLA 3HNSH 3L2LA 2QLVB 1A6VL 1MFCH 3N44B 5AB2A 3CFDA 1LO5B 4CC4C 1BFOB 4AYBA 2J8HA 4Z7NF 3KPRD 1MRCL 3BZ4B 1B3IA 1KEMH 4JY5H 5FEBA 2NY2D 4XMLL 4MMXB 5HYIA 4XN9A 4JPQA 1DDHB 3EDEA 5DD6B 3U7WL 2VMEA 2MHAB 1FGNL 3GEWB 3P4OB 4G9FE 4MJID 5DUMH 3AS3A 4JFOA 1L9NA 2YAMA 4PGZA 5KYNA 1NJ9B 1T0PB 5CAYB 4G3YL 1U3JA 3IDJA 2BH0A 3W5NA 4I18B 1KTDB 5JIHA 1TJGH 1ZTXL 3GIVA 2VDRH 4U1HB 4EQ2A 3Q8AA 1SQMA 1J8HB 3C6LD 4CA4A 1LE9B 3UZQA 4A2GA 1GJWA 1T89A 2XPYA 4I2XA 4PRPA 4U6HB 1LK2B 3CV5A 1JPFB 2DJ4A 2CPCA 5EHFA 3VAEA 2XQYK 4ODBD 3NFNB 1QYGL 3UTSA 4FYTA 2C9QA 2VZVA 3AZUA 1CS6A 2UZPA 3PPEA 5I8EA 1I9EA 1S8DA 1U8OB 4OLYH 1XGPB 2XZCL 4OFIA 3RVWD 2X10A 2V3DA 3B5GA 4Z5RA 1VCAA 2GJRA 4L3EE 4K5NA 1F4XL 4WJG3 4J39A 1ZHKA 2D7MA 2X1OA 3OKLB 3ZSSA 4DIXA 4OD1H 3HE7A 4G9FD 4PV9B 1CICA 5ADPH 4FULA 1IE4A 3N0PB 1DJXA 3MRNA 3RE0A 3K4ZA 3Q3GA 4LSTH 1E3FA 4ZBJA 3N0AA 5HHMB 5KSBA 1TR7A 3SKUD 3EIFA 2ITCB 4OBSA 1H6EA 4BKLB 3JZ7A 5DDHA 1Z32X 1FV1B 2NLJA 3GSNB 2JTYA 4ZSOB 3V0GA 1UH3A 2CGYA 4I3RL 2EE3A 2B3RA 2VN3A 5D6CA 4NO2A 4LRIA 3ESUF 3ROLA 1AQKH 4OFQA 2D7TH 2Y6TE 3FK3A 4NFBA 1HQRB 1UTDA 1SXCA 4GRLD 1E3XA 1JWMB 4L3ED 5FYJL 3BZ5A 4HF5H 4PJFB 1FGVL 2BRRH 2QHRL 2Y1YA 2V8LA 3BAWA 4NUGH 5FA4B 3P4NB 4WHCA 3L3IA 3HS0A 1KB9K 5ENWA 2CM5A 1QZNA 5D1ZD 4XBMA 3VMPA 2YAFA 1NMCB 4J3VA 1OIOA 3I6LE 1AHWC 5ECGA 3RDTC 1B90A 5C0FA 1V10A 1CZ8L 1IKFH 5CEXA 4N8CL 3Q6GL 3UGXA 2XZAL 3TBWA 1HK6A 4AX3A 2V5MA 4YXKL 3MLTA 1FYTA 4JHWL 2KKQA 1I8MB 3HPJB 1X5FA 3MXVL 3O45B 4IMLA 4HW6A 1UVQB 3KJ6L 1JTTA 2DW5A 3OJ2C 4D7BA 5E6YA 2Z7ZA 1A66A 4ORGA 4L4TE 4PJ7B 5C7ZA 4AVIA 1GZHA 1HOEA 4WHDA 2Z93B 4UIKH 2BVQA 3TPKA 1JZ5A 4X6CB 5GZOA 5F7BA 1BX2B 2PLTA 4KO5A 3LKSB 4NZRL 3GJFK 1L3WA 3BDYL 4JK0D 1WFUA 3L4VA 4I3GA 3KDMA 3V52L 3UTZA 3UBXA 3HMXA 4LP5A 1QACA 5L6YL 3CFCH 1HSBA 1TMQA 4YDVA 2ESVB 2VDOH 1TFPA 1Z9LA 3IB4A 4U0RB 4IGBB 3I6LD 1M71B 5E51A 1JYNA 4W9DC 5SV4A 4MKTA 3GJFH 3RIFK 4LLYB 3QQ9D 5IEKA 5KYUB 3QEHA 4ICXA 2JXMA 3FO2A 4OFVA 1SGKA 4E41A 3U2SB 1A65A 1FNEA 4H20H 3H9SE 3WNPA 5IWLA 2FJUB 5DFTA 1F4AA 2B1HL 4L4TD 1KY6A 1T6VN 2QPEB 3H2QA 3S2CA 2R7EA 2Q86A 3V0IA 5SWSE 4G6AC 5JDJA 1I7UA 2MOQA 2F8XC 1J05B 1JVOA 2JE8A 2EUXA 1JSYA 4DK6A 5AZ2H 1MI5B 3AS1A 4F5CA 4ZMAT 1MVUB 2NQ3A 5C86A 1OP4A 3SBPA 2P28B 2AEQL 3II3A 3R18A 1OTSD 3RRQA 4MDIA 5FK9A 4K7PY 2X4TA 4NHCH 4GQZA 3GUTB 3ZZLA 5MI0B 2A6KA 1PZSA 2JB6B 1U92B 5JNYB 1RLWA 5JDSA 2NNAB 5AW8B 1HHKB 1BV8A 1CDCA 2F2HA 3KXFA 4Y5VC 4YHPA 5F7KC 2Y1AA 4PY7A 2BVTA 3K2UL 3FYEB 1ASOA 1EPFA 4OFYD 4WU5A 2AV1A 2OSXA 3H9SD 1J1XH 2K78A 4TM9A 4EIBA 4ADJA 4FQ2L 3N1PC 3WL9B 1M7DA 1CE6A 3KH4A 2PO6C 4HKJA 2EXWC 3HC3H 4X7SH 3KBEA 3P9LA 3TYGL 1MVYA 1FNSL 1QSEE 2DQDH 4KKLD 4LNVA 5D7LE 5DHYB 4NQDA 5SWSD 4AYMC 4AQEA 2YSSA 3C5ZD 1U95A 2FT6A 4JKPL 3T6ZA 1R3LB 1FUNA 2FWSA 3WIIH 4L4VB 5I1GH 1L9SA 1AGCB 3D6GA 4P5KA 3FTGB 1LDSA 1NEUA 3FTZA 4YFLI 3ZYZA 3VA2C 3UPRA 1P7HL 1EZVY 1GMEA 1ZLEA 2AXHA 3HTLX 3SDAB 4W6XB 4G1EB 1USZA 4U1NB 4RWYH 4W4OA 3D52A 5D96C 2GJZB 4PJ8D 5SWZA 3BW9B 2NXYC 4FG6C 3V5HA 1TIUA 2VDMH 1IO4C 3D08A 3SCMD 2ZOUA 3TO4D 2FBJL 4RAUB 3G6JF 2GJ6A 1KC5H 4PJGB 4BELD 5I6XB 3ARBB 5JZ7C 1ADQH 2UZXA 4MJHA 3PAVA 4G43A 1RULL 4FA7B 3T65A 1RZQA 1YNLL 4HX1B 2ZUTA 1FVDA 5HVFB 4IMKA 3DYOA 2YPVL 2HWZH 5D7LD 1QSED 1MZYA 2FIKB 2J5WA 1KCLA 2IALA 2X6AA 4DOHE 4Z95L 2FTAA 2X7LB 4UT7L 3UOAB 3SJVE 3QAQA 3GSRA 2A9ML 3CBKB 4F7TA 4OZFB 2Q7YA 2K4WA 2H45A 4G82A 4YHKL 1YEIH 3VWJD 4FG0A 3A4EA 2QMKA 3FZUD 3TBVA 4K0OA 1F4WH 1PZ2A 2OL3A 2W0FA 3FQRA 3OZLA 3LKPA 4G7YH 4XMUA 2YQ2A 1S7WA 3SODB 1TOXA 4A7SA 5E4AA 3AUWB 4Z7UF 2MCG1 4HIEB 4D0DA 5CEZE 2E4FA 5DFVD 4PJHE 4UUJA 1TQWA 5I74B 1DR9A 5CEYB 2ATPA 1C12B 5CZVH 2E3VA 1CT8B 3HZVB 4P46D 2H6UA 4H2AA 4DAGH 5CGMA 3US0A 2HG5A 3RG1C 4HFWB 4P5MB 5F1IA 5KUMA 4KHTH 1HHIB 5LQBL 3CHQA 1TVBB 5CJBA 5IUCA 1I1AD 1WUNT 4WV1B 3BP4B 3MLXL 2WLIB 5IQLA 4F8OA 4XX1G 2BLFA 3STLB 3LQZA 4UT6H 2SEBB 5CSZB 2QQQA 3LH2H 2HRGA 1WT5C 5C97A 4FC3E 3SJVD 2HT4D 2YJLA 3IDXH 2R69H 4NQSB 4X83A 4G8IA 5B4MD 1KLUA 4MHHI 3QDAA 1SM3L 1EFQA 4GS7B 1CL7H 4TULH 1YSOA 1UOVA 3U0WL 1YYLH 4KY1L 4NWUH 2E7LC 5CEZD 1TKWA 4AENB 5A2CA 4FYQA 4H0IA 4H0HB 3S9DB 4XMTA 3UXFA 4ATTA 1DSFL 3CFMA 2GIYA 3O2WH 2CUIA 3A4FA 1MFMA 1CR9L 3IGFA 2AXGA 4MCYA 5EFIB 2LGNA 3CXHJ 3KPRA 3Q2LA 1IAIH 5E6ID 4Z8FL 2ZXAA 3SN6N 2OK0L 4F7KA 2AQNA 2VXVH 4UQ3A 1JTOA 1MCPH 1WBYA 1PX8A 2XA8H 4M00A 3WD5H 3MRBA 1E30A 1JHLL 4OM0H 1FG2B 1VGKB 4FGMA 4HS8L 4MJIA 4X5RA 4YDNA 1AQDB 3X13A 5EA0L 1GS7A 1P7BA 3OWRA 4R26H 3ZTCC 1NIAA 2DKSA 3U0PA 3BAYA 5C09D 2WXLA 3ATFA 3JWOH 1T2XA 2C7UB 3OZ9H 2WKOF 1DJHA 1XF1A 3M17B 3TIEA 2IWGA 5JHBA 5FYLL 2ENQA 3P77B 3C6LA 2Y07H 3QUZD 3E6FA 4FQXB 1MDTA 2DQIH 5KVEL 4I18C 1MCOH 5HHNB 2NYZA 1G7JA 3EYOA 9CGTA 2YRBA 3H9HA 1KYUA 3ARWA 4J8RA 4AW7A 5FW6A 4TUKL 4NERA 4O2EB 3EOAA 5EOQH 1CXKA 3FUDA 5L9DH 3D9AL 1VFBA 3RJOA 5H4ZA 1KPRB 2JB5L 3UACA 1MY7A 3X3GH 3VQ1C 5IW3A 2R0KL 3K6SA 4HSCX 1CDBA 4Z76B 1NGYB 4D3CL 2QBWA 2FR4A 1KIQA 3FAXA 2ITEA 1D7BA 3IFOA 3K81A 4XNMA 4WI3A 4G9FA 4N6QA 4HFUL 5E1AB 3S4SB 1BLNA 3GSNL 3RTQC 3EYFA 1D7FA 2AV7A 1UWXH 2GIXA 5A1AA 4LMQI 4B9CA 4Z7VE 3GBNL 3Q5OA 4QXGH 8FABB 1AMXA 1VA9A 4V1DB 3ISRA 5EBWA 4NWTH 2NY6B 2X9WA 1KIRA 4HLZG 5IBLD 2ITFA 3C2SA 2BSDA 5EO9B 1SFHA 4TLUA 2V5YA 3K1DA 1NFKA 5LBSA 5FDWA 2P24B 3ZYIA 2FECL 3RBSA 1TQBC 1Q0XL 5I1CH 4Z78A 2R23B 3SGEI 3SO3C 2ILLA 3MACH 3STZB 5T3XL 3N1QC 1K2DB 1N9PA 1XIWB 5FWQA 4GRLA 4KKRA 3NZHL 4L3EA 3O2DL 5F7NC 3GGWB 2GCYB 3OR6A 2I7OA 4IOSD 1PEZA 3KNBB 3NA9H 5D1XB 4RRPG 4DW2L 3EJZD 5H94B 3T09A 4YSSA 2CALA 3GXDA 4HUVB 5EIQA 5FGRA 1C5DB 4HU8A 1E4KC 4PYGA 2O5ZL 1M7XA 1P2CB 1YZZA 5D1ZA 3ZIYA 5K1NA 4FQPA 3HZMA 2K6ZA 4HJJH 2ZUUA 2KBGA 4WJ5A 5HHVH 2Y7MA 4PD4K 3VI4F 1KBKA 3WUWB 1E7VA 2VERN 3GJEA 5I19H 1KBGH 1R24A 3TBCA 4Q9RH 1NMCC 2WXMA 4ODWA 1OSZB 3NG5A 4JREB 4DGUA 1N4XH 3ZYJA 4NOBA 2V6HA 2WNWA 4QHKI 2M1KA 1TU2B 4OZFG 1SOXA 3DUSB 4G8GE 5G5DB 3VW3H 3OG4B 4GQRA 3NJLA 5AZEH 3WAKA 1FL6B 4B9GA 4OCSH 1JPTL 5EIIA 1NCAH 1OAQL 1TZ8A 4HWNA 4F37F 1OP5K 2R9HC 1AI1L 1DQDL 3MR9A 2F19H 2W91A 1PLGH 4NENB 1ZHBB 3FOLA 1E9QB 1N6VA 2WUBH 5ILTH 4FP8H 1WA2X 2CO6B 4C4KO 3WIHA 2BP8B 1FI8C 2ZUQC 5D9SA 1JNLH 3PREA 1PPIA 1ZK9A 2NMSA 3TEWA 1BF8A 2NXZB 1ADWA 4C4UA 2YQBA 1T4KB 4PUBL 3VRIB 2PW2A 1O6SB 2JCWA 2F68X 2JKNA 3OAUL 1KMGA 2R0WL 5AAWA 5FPIA 1BIHA 5IFAL 4OU3A 4U0RC 3L3DB 4L9LC 4IGBC 3VXRE 4JFQB 4JKLA 2NT0A 4MRCA 5DHVH 2NUPB 2W81C 3L3HA 4MQXC 5T1MA 5I8KL 3FOMB 4K3GA 1ZLSL 1EUTA 4G8GD 4N25A 1IFHL 3N42B 4L4TA 1A7PH 5B8CA 3TGXA 4YZFF 3WTUA 1A9BA 5HYSA 5JPNC 1R33A 3CZNA 3GMPA 1FF5A 1KTJA 1NGZA 1YQVH 3US9A 4EEEA 2VAJA 4JUTA 1ZA6B 4ZMXA 3O0LA 2VN5A 4X6DB 3HI6H 1R75A 4X8JA 4HGMA 3FUNA 3NP4A 1KTKE 2VABA 2VM4A 3B7YA 3HC4H 3IJHB 3AG2B 2GFBB 3SKNA 2OZ4A 3VD2A 1UUSA 5KSVB 3P9MB 2VMFA 3LN5B 1TO5A 3V0FA 1CURA 3EZ8A 2VAAB 1DBKH 1Q0YL 1D9KB 3JV4A 4XP9H 1EDHA 1NDTA 4R4FH 4HWBL 4AM0Q 4QYOA 3OD3A 1JPGB 2X3BA 1MAMH 4TVPL 1MFVA 2VISB 2WWNA 4UANA 3WJMB 3D3VD 4OFYA 2DQFA 4KX7A 3BP5A 3H9SA 4Y2DB 4BIKA 1DE4A 4E9LA 2VLJE 5A6LA 2VSDA 1E43A 2CJUH 3SHSA 1GIGH 3DI2B 5ABZA 4YIQB 3S96B 3E38A 1D5ZA 4PTTA 3WTVA 2P52A 3CDYA 5SWSA 4EI5B 3BQUD 5LAPA 5I5JA 5LHDA 3HHRB 3IAGC 3C5ZA 4MRBA 4KQ3H 1H9VA 4YL4A 2HTLD 4HLEA 3Q2NA 3BIBX 4BRJA 4G9DA 3U9UA 3CFIC 2WQVA 1H3WM 5CD3B 2PPCA 3LRSA 2FWLB 4N0UA 4Y7MA 2JJTA 1RPQA 2XXMB 4XWOC 1KLGA 1VCBC 3UMNA 4F1SA 1E4HA 2OP4L 4JX0A 5I23A 1UXWB 3F5WB 5MEQA 2O5XL 4JO2H 4IIQC 3QDGD 2CPUA 4PJ8A 3MLUH 5DS2A 2NX5D 4ONHA 4BQ8A 3SCMA 2EO9A 2ZZUT 4OZGF 3S4SG 3LKRB 1T3FA 1BMGA 2A9NH 43C9B 3DTXB 3DIFA 3QARA 2YC1B 4N2EA 3V0VA 3GBLA 1Z0MA 3HCVA 1Y18A 1LD9A 1MN4A 3GZQA 5DEJA 2VLJD 5LBVA 1G7HA 2H47C 2IFFH 4IBWA 2HPTA 3NJGA 3QIWB 5AOJA 5BZDA 3FQUB 1H6FA 5JLZA 3OGCA 4B50A 5D7LA 1QSEA 4TRPH 1R5IA 2Q87A 1J12A 5DJDA 5JIMA 2DQUL 4WFFE 3PXJA 1DQKA 2O6DA 2X2YA 2ZOWA 4LCIL 5D1QB 2XPGA 3DX4A 4FERA 1DUZA 4YVUA 1CDJA 2HH0H 3NEEA 3V8OA 4ELKB 1VACB 3ECWA 3P3YA 3UBFA 4H0GA 1SEQH 4XCEB 1G84A 1KT2A 2GTWB 1I3GL 4XBEH 1QHPA 1KCWA 3VWJA 2G3XA 4XPGH 1IBGL 4GG6A 1EVTC 5IB3A 2A4EA 4WWKB 3U9WA 1S7SA 1UQSA 4YSAA 2A73A 4JPIA 3ZKSD 2YUZA 1U8NA 2HTKD 3VXOA 4YVNA 5EBMA 4OSUL 4P46A 3VXPB 5IVXF 1VGEH 3LMJL 3C5JA 5TDNB 2OMTB 2OFQA 2UWEA 4PG9B 3U1SH 2QQKL 4BFFA 4O02B 3PHAA 1I1AA 2EH8H 3VFWA 1DBBH 3P11L 5DMIL 3ELQA 2I7SA 4ZOAA 4TOYL 4WFFD 3MO1A 4I1RA 4JQVA 4NB7A 3LZLA 1LILA 2O6FA 5CKAA 1I8LC 3QORA 4TNEA 3IJYB 4NQVB 3UMTA 3SJVA 2HKHH 3THML 4TQPA 4P9ML 3CDFA 1PFCA 2D8KA 4Y5XB 2MNUA 4N2MA 4F92B 4KH2A 4FLSA 4WSJA 2OXGA 1RUQH 1MIEH 2OJZH 4RQQA 5DD0L 1BPLB 2HYMA 4LSQH 1HEJC 3AB0B 2YEZB 4AZ8A 3TCTA 3OTTA 3BDXA 2J3SA 3UZVB 3ZXAC 3FT4A 4O2FA 1DN0A 4MD4B 3QXAA 2FQFA 3DHJA 3HMXH 4ZW3A 3B1UA 5IGXL 1ONQA 3KHOA 5IT2H 1WS8A 2XG4A 5KJRH 1AGFA 4QPEA 1FJ1B 1MG2C 1I85C 1K6QH 3BAKA 4OJDH 2EEXA 5E6ZA 4ANWA 5I1KH 5E6IA 1AZZC 1J8KA 2BNRB 1CLZH 3JWDC 1AD0A 3W56A 3DARA 3NIFE 2NZ1A 4N2GA 5INDA 3V5KB 4JG0H 2W5PA 1IEBA 2DQCL 1NUGA 5C09A 4NQXB 1SJVA 4BFIA 2UY7B 5K93A 4L2YA 5D93B 4NO3B 3TTSA 2EXSA 4OLXH 4S1RH 1JDAA 3U4AA 4HJSA 5AG8A 3QUZA 2WXOA 3FU0A 3MRKA 2B2XL 4RIRB 1F18A 2IEPA 1K5NB 3GS7A 3MLYL 4M03A 4QCIA 3WEOA 2NYYC 3GK8H 2DBLL 1T1WB 1FBIL 4KDWA 1TZOA 5D7JB 3EFFB 3HNTH 4JHVA 1T0MA 3S8FB 3Q9PA 4PWFA 4FQXC 4GT0A 2O6EA 2C1PA 1AOHA 2F58H 2GABA 2UXVA 3MLRH 4QWWC 1DJWA 3GBML 4BZYA 2VCOA 3SQOL 1AIZA 3FB5A 2UVEA 1QLRB 3MRDB 3ZE0F 1CMOA 1HFUA 5E00A 3A0OA 1N64H 4PGEA 2XVLA 2OMVA 2E86A 3P3TA 3QUKA 4NSKB 4X5PA 1OSYA 1Q1JL 1IGJB 1OD7A 1ZA3B 2K6WA 3NIDF 5DD1L 5EU6B 1RZ7H 1RJLA 2F7RA 4LVNB 5FUCE 1KB9J 3FDWA 2QVMA 3U6RA 1CD8A 4HP5A 4OD3L 5HD8C 2Z31D 1SDDB 2NCEA 3L95A 3FUMA 5CD5C 4YDMA 4PJ5B 1WH0A 3VXME 1AR1B 4NEHB 1ROWA 2R56H 2NNRA 3IWUA 2ZJSH 1AQMA 3VJ6A 3HUJF 3LKOA 2NY6C 4LQFH 1KCUL 4UM8A 4P06A 2B0SH 1XQ4A 4P4RB 3PPSA 4ZUWB 5CUSL 2EYSB 5E95B 4LMQE 1WFIA 2WV3A 5F3BB 2OKMA 4L8SC 3S3JA 1RZ8A 4RMVA 1PNCA 4ENZA 1CD9B 2IOMA 3MUHL 4IOSA 2ODHA 4KQ4H 4ZMZA 1XIWC 4GSUA 5AVTB 5E4IA 1SYSA 1PZ5A 3VDCA 2LQRA 2P9RA 2WUCL 4LGSB 5D6DC 5EU7E 5BMFH 1YQ2A 3WXVL 4XNZC 3GMMB 3IXTB 5JXAL 2CHZA 5D1XC 2AW2A 5MEPA 4QRUB 1KGWA 5DUPL 1T20A 2W9LA 5AD0B 3KE0A 3LCYA 4QRRE 4LLDA 2PMZA 1JL8A 1A3QA 1TJHL 3RX7A 2CDGB 4FXKA 4HJ0D 1NCJA 4U6VL 1M1XB 1JGDA 5HPMB 4E9QA 1BBDH 4X7EC 5JMOC 3ULVH 5IFJA 5BUPA 5E9NA 4BQ9A 5IB4A 3C08H 3N1MC 1JK8B 1XCTB 2WQSA 4MCNA 2ICEA 2G9HB 1GGIH 2OL3H 2E9GA 3T77B 1V3MA 1NBQA 3VU2A 4HOXA 2JF1A 4HKBB 5EUOE 1JCVA 3EYSH 1IC4L 3LPWA 1IVTA 1A6PA 1I3VA 4OI7A 2Q8AL 4HKXA 5HP5A 3QJTB 1COBA 2P7TA 1YEHL 5D2LE 4JFFB 2XHNA 3GPEA 5IJVA 4H44C 3REWB 2AXJA 1CLVA 2QSQA 2QMJA 2WMPA 1J7VR 3RWHB 4ZFGH 3L4WA 1NGXB 3V0DA 1NCBH 4Z1PA 4MAYC 3BT2H 1HHGB 3ARZA 3FQNA 3DRTB 2H26A 3QUXD 4UNIA 4KTYA 2NXZC 3F7VA 1F6AB 5JIKA 1HH9B 5FHBL 3GRGA 2IGFL 4G8GA 3L3KA 5CP3A 1QMUA 4KVNH 1JK9B 4PREA 1A7QH 2JJWA 2X2JA 2OJEB 3LB6C 3WOVA 1A8ZA 4IRSD 2YD5A 5DHXB 2GK2A 3ZGHA 3U36A 2YKLH 3I85A 4JGJA 3SKMB 5BXFB 2ROXA 1N19A 1WZAA 3E9UA 1KCRH 4ZMWA 3QNXA 2EIZB 3F12B 5I26A 1Z7JA 3FFOA 4N87A 5DJ6A 3VDBA 4I4WB 3UYRH 3MMEA 2ZSWA 4UMGA 3CFBB 3IFPB 2AXFB 3K8LA 3D3VA 5ESAB 4UU9B 1YN7B 2EKSB 4OZGE 3MYJB 1T7WA 5T5NG 4UQ2A 2EADA 4AK1A 5ID0B 3B2XA 2WXNA 1MAJA 5FM5M 3GYRA 1EX0A 2WBJD 3VWKB 3WKYA 4DSYA 1DQML 4XVSL 5FYKD 3UTOA 3BPNB 4CBZA 1AO7B 1GC1L 1WLHA 4U6YA 4FKEA 2OR8A 3BQUA 3IDMB 3GXNA 1RZKH 4YXLH 3L3GB 4IIZA 4DWHA 1LNUA 4NO5A 1FDLL 1HE8A 4IU3B 4YWGL 3NZ8A 3VVVA 4JM4H 3C8DA 5CHNA 5EZIH 3WFBH 2N1TE 5ID1A 3DX7B 3D48R 4YHOH 3OL2A 3IGLA 2IDCA 2WYHA 3QAZB 1I4FA 4K7PH 1BLIA 1CDHA 5HJ3B 1QLEH 5C0GA 2A4ZA 4UQAA 3B6SA 3IDIA 4M1DH 3QDGA 5CJQL 5DZOA 1EHLL 4WFHE 1GY2A 2NX5A 4L1LA 3X14B 3MU3A 5IV2A 5B3SB 3TA3B 3V0EA 1ZHNA 2FSEA 2RD0A 3AQZA 3G6JA 3VXTA 4AY0A 3Q44A 2QR0B 3K72A 2EDJA 3B8YA 3CLWA 1H3VA 2KT6A 2E9IA 1X4XA 4KAQL 4OIBA 5KVGL 1BZ9A 1JI1A 3EOTL 2MFNA 1PKQB 3WLWC 2Q76A 2BDNL 3OMZA 5LBSH 3AGVA 3RWEB 3UJIH 4P5SA 5KYWB 3QIWC 2P8PA 4M02A 4Y4KD 2B4CH 2FATH 5DFAA 4N9OB 4AJYV 2XLLA 2XWBA 5D1QC 2MOGA 2P80D 4XO4A 1NPUA 1FNLA 2PXYB 3P1VA 4KJYA 3VI3F 4FFYL 3BIKA 5JXED 4WFHD 3SE4C 5J1AB 4O02L 2AMUA 2Q3AA 3V6BR 5G4OA 3O4OB 4GSDL 5TFSH 4XP1H 4JJHA 3SDXF 1IAMA 1SDYA 2RCSH 2AEIT 1ETZA 2VDLH 3PJSA 3TJHD 1DVUA 5MERA 3MRQB 3CN4A 1KEGH 3QJQB 1C8QA 2C3VB 2O5YH 2Y7QA 1JBJA 4LCUB 3ILDA 1YEWA 4X98A 4HCRH 2WY3B 4L1SA 1UACH 3ZHDA 1CFVH 1X9UA 4LPXA 3T2OA 3U4EA 3OSKA 1KN4H 3GXMA 4R7NB 4P4KB 2OJ1A 2R4SL 3S98A 5AYUL 2IH3B 1V7NH 2CMRH 1S9XB 4KKAC 5CZKA 2A38A 2FNWA 3EYUL 1KXTB 4AIXA 4P59L 2DDQL 3L4YA 5AAPA 3VGBA 3IBOA 3I6SA 1JFHA 3CU1A 1QTSA 5DT1L 4YN3A 3JWNG 4E68A 5IHBA 3H2WA 3HHSA 2QGCA 4D9RE 3D25A 1QWHA 2PABA 1KLFA 2LAGB 5A2KH 5T5FL 2FX7L 4DO6A 2QKIB 2XTJB 3DBXB 4Y5XC 4AC4A 1WWWX 2BWIA 4EDXB 4MBOA 1KIUB 3X11A 4EBQH 1HYRC 2Y6SD 1MFBL 1D5XA 1FFTB 3AT0A 4LLMB 4RGOH 1E9PB 1W2KT 3ARRA 2O6CA 1XZWA 2OR9L 3IU4H 1JZDC 3BVNB 3S3CB 1KB3A 1QSFB 4Y9FA 2C8NA 1EBAA 1MLCB 3HIZA 4HD5A 4GRWB 5C0JA 3B7SA 5SX5K 5GGSY 1E4XI 3RA7H 5C3LD 4PJBB 1RIVL 3JBG7 2HMID 3OMNB 3LXAA 1XDTT 1DQLL 4R8WH 4X99B 3ATDA 3DVFA 3SYAA 1R5WA 5EU3B 3ARTA 1LEIA 1ETB1 3LDBB 3ORJA 3HKFA 5E8PB 5GSVA 2BIMA 3PNWA 2EEDA 3FTVA 4JDZA 5SX5H 3NIDE 4DFIA 1AZBA 1OLLA 3VD7A 4HIHB 2Y2TA 5MEOB 3PP4L 3UAEA 3ULUE 4HGWB 3V7MA 1UYWH 1HDMA 3EOBA 4NN7B 2YBRB 5FWRA 1I7ZA 1FNAA 3LXCA 2D3VA 2EDYA 2JK5B 3HE6D 4WI8A 3ABKB 2YKKA 5LGYA 1Z5YD 1JV2B 3RLSA 3RWGB 2OZ4H 3QWNA 3HUJE 5AENA 3RZCD 1Q0EA 4X6BA 1NAKL 3TO2A 3FCGA 5FFOA 4OQTA 5AAMA 3RFZA 1WC7B 3QZNA 4F7PA 3FTUA 4XVUC 3D85D 1KGXA 1ND0B 2RFXA 3MBWB 5ACLA 2PR9A 3R1GH 4JZNB 4M7KH 1P53A 3B3IA 1USQA 5GGRY 3X1EA 3SSGA 4QT5A 2V5TA 1U8IA 1OF0A 4PEEA 5FFGA 1MCJA 4X4ME 4YPJA 4LB8A 3O0RL 3FCBA 4F8TA 1YVLA 1PTZA 1KSRA 4I77H 2Z31A 4XAWL 3ULUD 1D5RA 5DZ9A 3SDDC 1YN6B 1TEFA 4DEPC 1KG0B 3NZSA 1CYXA 2E9WA 4N1HB 4XMKH 5KSAD 5LDUA 1PQZA 1ILSA 1DL7L 1M53A 1YECH 4PD4J 5G4NA 4UILH 1QKZL 2CHWA 3WNLA 1RUAH 3VUAA 1B0RB 3VQLA 3H0TA 3IU3A 4G42A 4RGNB 3PV7A 3JWOC 1AR1C 2Y5QA 1NCNA 3T3PE 1DO6A 2DWSA 2R0ZH 1EUUA 1UATA 1NOFA 2EDLA 4P05A 2EDHA 1GMIA 5C0RL 5JR1H 4PJDE 1NBVH 1XF5B 1Y0LA 3SKJL 4FNTA 5KSUB 1KV3A 4UV4H 2HRHA 2ITDB 2FJFA 3T3MF 1LK3H 1JV5B 4Y0GA 3VTTA 5I66A 2RALA 3OKMA 4MA8H 4Y1SA 3SYCA 4AM0B 1KDJA 1S7TA 3MJWA 2X0WA 3PV6A 3N91A 5I5RA 1D3CA 3P73B 5KJ7E 2A6JA 1QW8A 3E2HB 1BBJA 2CUHA 4KVPA 4KFMA 4IBQA 2FZ3B 4Q6IC 3IXAA 3VI4A 4KFZC 3VFPA 2JMRA 3K2IA 4H0LC 5D4HA 5GGVH 3T8XB 3UAFA 3UP6A 3DDGA 3SQBB 1J0IA 2AZAA 3IDGA 4YR6B 5C2BH 3QISA 4H26A 1E6OH 3NK4A 4GRMB 5DWUL 3UEQA 4ZAKB 4N0CD 1ZDQA 5F0LB 4KH9A 4UYPA 15C8H 5L4IA 1QNIA 2X5PA 1S9YB 3UO1H 1LO2L 4HJGA 3W3BA 1G9NH 2AK4E 2GJPA 4RFOH 4LIQL 2VC2H 1RZIA 3ARED 3O3DA 1HHHA 5GS1C 3K71B 1HL9A 3AY4C 3TEXA 2D31A 3HEIB 2P5PA 1RPUA 4Q52A 4XGZA 4FX5A 5I0WA 1DVFB 3NACH 1SUHA 4K8RD 4OJFL 4R9HA 3H85A 2EDRA 3WDJA 1RP9A 3MFFB 3ZL1A 4HJIA 5IESL 3L45A 2X2UA 2P5WD 3KEDA 4HOWA 4R4BB 4CMHB 1MRDH 4X6EB 4BZ1A 4JJ5A 3BVXA 4YXHH 3D7PA 3QUXA 3V4UH 4PS7A 1ZT1A 3FC8A 4AMXA 1MJJB 4P5TB 2BC4A 3GS4A 3WHXB 3BH9B 2R2HB 2NY3B 3MRHB 2CIIA 1OV8A 2IQAA 2QEJA 5EOCH 1EEQA 1TENA 4IRSA 4J3TA 1HNYA 4U3XA 1A6AA 2Y23A 3FMGH 4XX5A 3P0VL 5EUOA 1MHEA 1TETH 3H8NA 1RZFL 4ISVB 3F58L 5AW4B 1L7TH 1Q9OB 3W39B 1P9MA 3CMOL 4HK0B 1PDKB 5D2LA 4CAGA 5KOMC 4OLUH 2XRAL 4N8VA 1GHFL 1AKJB 4GSRA 5ANME 5GGSA 4HPYL 2HCZX 4FKHA 3HG1B 4AKQA 4Q4EA 2ADIA 1NUDA 1KIPB 3IMBA 1HEZB 4JY6A 1E4WH 3F64A 3N2JA 1A64A 1W0VA 1XZ0A 4AT6A 1EDYA 5DJZA 2G30A 3QQ4B 5AOMA 4EDWH 5I16A 3CCHB 5HJBA 4ELMB 3PIQA 1CI5A 2NY5L 2R4RH 2WBJA 4R0LA 1RJZB 4RMUA 1HSAB 3ARGB 1ES0A 3U2JA 1WBZA 2E0PA 1ML0A 4YSTA 2IBBA 4UAOB 2VE6B 4P57B 4CN4A 1CBVL 3HAEH 2HFGH 2BP0B 4WDIA 5IQMA 2VQ1B 1JZ2A 2BXYA 3PHOA 2C9RA 3T0VA 3HHMA 4XB7A 4UDTB 4DUXA 4YLBA 2B8OT 3I50H 1GTFA 2DICA 2DMCA 3L7FA 3NJFA 2FDBP 4XHJC 4WK4B 2ZWNA 5DU7A 5IBUB 4A6YB 3CXFA 4M5SA 5FR3A 5ALCL 1PY9A 1INDH 3VFSA 3DO4A 1UOKA 3DRQA 2DKUA 2AMGA 2RHEA 4P8QA 3SDCB 3M6DA 1A6UH 1KJMB 1CFTB 4QKXB 4YMPA 4WWID 1TCRA 3QUMA 4HMDA 2VXSL 4ZNCD 3QJXA 4OZGA 5J5EA 1IUZA 1KBBA 5E1GA 3FSVA 3RNQA 5E2UH 4JVPA 5F0PB 5DRWB 1D7CA 1AIFB 1MHHB 4YHLH 1CTMA 2BRQA 5FB8A 1GL4B 2X9YA 2VRQA 1MAKA 4QF1B 3TA3C 3STBA 3PWJB 3ZDZF 4KKCC 4NCDA 3NSFA 4G6KL 3TYFB 4PRIA 2IAMC 3KYMA 4JRYE 4YH6A 1GZPA 4JCLA 1UUNA 2FD6L 3PDOA 3UERA 1N0XH 2J4WH 4JM0A 4BUQA 3QPXH 1F4HA 4Y4KA 3M86A 3MXWH 1BAGA 2HT3D 5BJTA 1FL5B 4XO5A 3QWQB 1VZGA 4WI9A 4D8PB 3G6AB 2P80A 5DXWA 2ZNXA 5J4MA 1MCDA 3QG6B 1MEXH 1I8KA 3EADA 2X6MA 4PQXA 5JXEA 2PWGA 4MS8D 4EOWH 3SPJA 4EIGB 2ZCHH 3BGAA 2Z4QB 4YOKA 1HWWA 2QSVA 2WVVA 4JLRB 4UOZA 1MFAL 2PWDA 4HKZB 4YEFA 2EDKA 4CADB 1A4KB 1BW8A 5C07E 3N44F 4ADGA 4L0YA 1WFNA 1PYWB 3FJTA 4F2EA 2NYKA 5F7UA 4S0HA 3O4OC 2VIRB 4XTRC 3G04B 3L9RA 5HI3C 5TK2A 4PRNA 2A6IA 2EICA 3T6XA 4ALAC 4GP5B 4UQDA 4FA8A 5EWIH 1YY8A 2H9GB 2GI7A 3RNKB 2Q8BH 3SYPA 5DEFB 4PVBA 5K39A 2PCYA 3EGSA 3L5IA 4BFNA 3OMIB 4MNQB 3ABMB 3QHFH 2FEEL 4WW1B 4ZO9A 3MZGB 4P4KC 2COQA 3D2UD 2YGVA 4NZTH 1ZT7A 5GRJH 5CCKL 1IIIA 1KPVB 3TCLB 4NQEB 1KJVA 5A43C 3D06A 4DVBB 4JO5A 1AXTH 1JWUA 4F7EB 4X0NA 1Q9LA 1TVDA 1UH2A 3FUHA 2OX5B 5ELIA 2QKIC 3EBHA 4GKSA 3EGDB 5CZXC 1NFDB 5SWQA 2KL6A 4NDMB 4XB8A 4JM2C 4W1TA 4FQIL 3Q7JA 4LLWA 1BEYL 4IYKA 4K71B 3WU1A 1MCCA 4OCRH 4WUKH 3AJ7A 5F8QC 4YGVA 5F9DC 4Z3HA 2JKIS 3WS6A 1OCWL 1W8EA 3KBFA 3CK0H 3RY5A 4JZOB 2IADA 1E2VA 2F53B 5AEAA 3BWAB 4JFED 1J1OH 3BAEH 2D3NA 4P2RB 5KJ4A 2JSFA 4NFDA 3GMQA 4EN2A 3AG1B 4PBWD 4M6NL 3G3LA 3LXBA 2R1WA 3BSZA 1NEZA 5LVEA 4JW3A 5GJTH 4Z3GA 4LHUB 2V17H 1FZMB 5FYJE 3RUGE 2BSCA 2XWJB 4KXCA 3HE6A 1LO4H 1BMZA 1S7RA 3FQTA 1E90A 2X6UA 3QWOB 5IKCA 2ICWB 3LS5H 1WFTA 2A1WH 3QJOA 3RZCA 2ADYA 2G75B 2GBVA 4PI0A 2PF6A 4AH2B 1JHKH 3ILPA 3HC2A 1GZHC 2IF7A 5B1CA 2NY0B 3V6FB 2W9DH 3NJXA 4RMBA 1FC2D 1NKGA 2P8MA 4DZ8A 5C6PB 4RISL 3APMA 5IMOA 3D85A 1IV8A 1E3ZA 3X17A 1IGIH 5EF2A 4M8QB 2BVOB 5BO1H 4CSZA 3UPCA 2MPAH 2FL5A 3FKUS 4PJFF 3DPBB 2P5EE 4HDIB 4G80A 1J5CA 1J5HA 5HGBA 3I6GA 5L2JA 1A02N 2WCGA 3SPVA 1FIGL 4OGXH 2CO2A 4RRPM 3WFCH 3QT2A 1RK0B 5ABDE 4U3SA 4TSAL 3RDTD 4KY2A 5KSAA 1CG9A 4ZTOH 1M7IA 2JI3A 2R1XB 3G5XB 1F90H 1RJCA 2AJXL 3GI9L 2PWEA 2CNYA 2A3TA 4LEOB 5FYJD 1A3RL 1PG7X 3MUGA 4Y4HB 5CBAA 1XGYH 3MGTB 4RWHA 2P49B 4R90H 3ETSA 1N5YH 5C9JA 2FRGP 1UM5L 3SGDI 3HUJA 1CU4H 1R3KB 5IBUG 3C12A 3NBNA 3RBGA 3CFJB 3VGAC 3IMRA 4EAEA 4CVUA 3HG2A 1VF5C 3F7PC 4CJ1A 1QABA 4XBPA 4KGJA 1BGXL 5A3IC 4TS6A 2X6CA 1I7TB 1AC6A 1DQJB 1YY9C 4HBQA 4PJ7F 1R4XA 1OTUC 3JT2A 3OXSB 2P26A 3VMNA 1QBLL 4PJIE 3U30C 4YSUA 4B3EA 5EEUA 4X6CF 4X4MA 4RBPH 4GAYA 4PV8B 5I18L 2EUZA 2CLVA 4LGRB 1WQVT 1WCBB 3TT1H 2NUTB 4EXPX 1B0GB 5HJDA 3UDWA 4J3OG 1MCWM 5EBGA 4N22A 2VDQH 2MTAA 1X6NA 4X8GA 3T1FA 5I1JL 4CN1A 1MQKL 3FT3B 1UCBH 3FU7B 2XICA 2XN0A 2J1KA 3HZKB 3L9YA 5CJOL 4PWEA 1A2YA 3E2HC 1EJOL 1YUKB 1BZ8A 1HINH 4KJQC 4XI5C 1KXVA 2X4RB 1K8DA 3K6NA 4GMTL 1T04A 1XXFC 2Q0ZX 3OMAB 3IMUA 3LKQA 4H88L 3P30H 4NKMA 5F3FA 1OO2A 2EKJA 3WN5A 1EHKB 1TTBA 4S2SA 5KG9A 2DQHH 1U58A 4B9FA 4OF8A 4WHTB 1UOWA 2VXTL 4G6AD 2Y2YA 1IGYB 2BSSB 3C5SB 3AREA 1RK7A 1FNGA 1YPZE 1NDGA 1P6FA 5ICXA 2GW5A 4UV7L 1WO2A 1M1SA 3KLAB 3CXDH 2AEPH 2L3BA 4KDTC 4GFTB 3DJSA 4NM4L 3FULA 2ODIA 4G6JL 4KUZL 5KVFL 4NRYA 2BY1A 4JL1A 1ZXKA 4MQSB 1IE5A 1FSKB 2JKSA 2P5WA 3BP6B 3QIBB 2X87A 1T0NA 3PLYA 1HC1A 1Z9OA 4G6MH 1RUPL 3JV5A 4M1CC 4HIJB 3NGBB 4DQOL 4LARH 4F7MB 3AM8A 1JZ6A 4M93C 1MHPL 4KV5E 3BHBB 1U4FA 2ALAA 1M05A 5JA9A 4CMHC 5E2TL 2XQBL 2PO6D 4F2ME 4HG4K 3Q05A 2EXWD 3MREB 1KGJA 2WVTA 4C4BA 2IMMA 4PJAE 2DF3A 5DMGC 4O2CA 1CFQA 5HHOE 1EHNA 4JDTH 1K4DB 3K1KC 1JOIA 4BGLA 3GMLA 3ILEA 3E8UH 3X1NA 3HVNA 2VZ3A 4P5TC 3WJJA 2X88A 4YDLB 3AWFA 3QDJB 1TMCB 2TRHA 2HJKB 1IL1B 3OKKA 4PHZA 1MWAA 4RFNB 4Q6YA 1IT9H 3X3FH 4K23L 5E5LA 1OHZA 1N70A 3ULVC 4TN9A 1O7VA 3C75A 3I9PA 1SEBB 1WAPA 2HLAA 3MRGA 5E5MB 1BD2E 5TE6L 4E5XG 2NXYD 4FG6D 1IBZA 3G5ZA 5IIEB 2OCJA 3SGKA 1M2VA 1JPEA 5GIRA 1QO3B 5E2VH 3WS3A 5JMRA 4K3EL 1AGBA 3PWPD 4QO1B 2B9BA 5F9OH 5C0NC 4F1ZA 2VDRB 4FABL 1G9MC 4L3FA 5DEGA 1GAFH 3MC0A 5F1NB 5HYJB 3PHQA 2WSKA 4PJGF 1JXFA 5DYOB 2QL1A 4FQQB 5CWSA 1CE1H 3HR5B 5HHOD 2NOYA 5TJWK 3S5LB 3UL4A 2EQDA 5T1LB 5I6PA 2ZKXA 3F00A 1I9RL 2C3WA 4A6YL 3II1A 3UYPB 2FB4L 1W0WB 3H4HA 5AUMB 4S11A 3GQFA 1IAKA 4ZX5A 4JFXB 5F3HA 4F9PA 4O51A 4HV8B 4XN5A 1QSVA 4M5YL 3C9NA 2GEQA 3O8XC 1A7BA 4JRXB 3KM1A 3QJZA 1I7RB 2IG2H 1HWGB 3VVWA 1BVZA 5ANMA 4BYHA 1PJWA 2PPFA 1PBYA 4XXDB 2GYSA 4OQTH 1BD2D 4FNRA 3RU8H 1EGJL 1MIMH 1UENA 2MEJB 7TAAA 5HDOA 3R06A 4MMZA 3OC5A 4DKEL 3QYMA 2GB2A 4Q97A 4P23B 1QTPA 3HN8A 3TBYA 3UG3A 3V4PA 1NIBA 4H2CA 5DVLA 5GGUB 3RY4A 2NR6C 3SDCC 5FFLA 2OXHA 1XL6A 2FUQA 3GMRA 3CN3A 4NUPA 3FBKA 4BSVB 5GZNC 1LE5A 4KTDH 5GSRB 4DTGL 3QEGL 1F1DA 4BSWA 3MJ6A 1NANI 5EULV 2CKNA 3M8OL 1SZNA 2MPVA 4WGWB 3PFQA 1S5HA 2WSPA 2Z35A 3HBPA 4J3OC 5IMMA 3FCSA 4M7LT 4U1SA 1M6UA 1HWHB 1NGWA 3EH5B 3L4ZA 1J87A 2X70A 4Z7QB 3IEAA 4KRPB 3SE6A 2P4AB 2KUTA 2VLME 4B0MM 4F27A 3C6LC 2CK0L 5K9OA 3MRFB 3GMOA 1RZKC 4WSGA 2IOOA 3VSTA 1SXNA 2WQUA 5J13C 2OM5A 4F58L 3WKMH 4Y19B 1YEDB 3IFLH 5BZXA 4P3CH 1DVYA 5LNEA 3SDXA 1XR8A 4CC4A 3PQYB 1TNMA 3C60C 3AW5A 1D6VL 1EXUB 1DUYB 2EXTA 2QFRA 2UZIH 5ISZE 4KJWC 4ODTH 1IGCL 1TLKA 2Z7YA 2G2RB 3DHUA 1AANA 1OPGH 1DBAL 5I71C 2K8QA 4KMTL 3U46B 4DN4H 1FFPA 4GW4A 3FHAA 4BSJA 4NZUH 2UYLB 3D2UA 1A9EA 1MFDL 4WY7L 2QELA 3PP3K 3BJ91 4DP4X 2DYPD 3MBEB 5D7KD 1BOGA 4HCIA 3BKCH 4BBWA 1Z9SB 5I30L 3MNWB 3KR3L 1EO7A 1JE6A 2Q2LA 4QHUA 3ZT7A 4NGHL 2YSTA 3D87B 2FX8H 3CSGA 4ZTPH 1XTLA 4NAMA 5C6WH 3IMTA 5CZRA 2I27N 1WZMA 3K6OA 4XCNB 1U8PB 3EDJA 2Y69B 4AV5A 4PN6A 3WFZA 1OAUL 1SYVA 4QLRA 4QYAA 3ETBF 1JF6A 2GSIB 1EAQA 2BVPB 3HN5A 5DQDL 5F7YC 4BZ1H 4K7FB 1QUNB 5GISH 3Q8EA 2WWMD 3RTQD 1JZJA 4L3CA 1GYUA 3PGDB 3T0EC 1F3RB 1F58H 4CVXB 3Q6FB 3LJ3A 3EUUA 2FGZA 2D7NA 3KBHE 2HVKB 4JFEA 4I13B 4I48A 4NRZB 2WN3A 2AS5M 3VRJA 4ZDHA 2EC9T 3JV6B 3WDHA 5D5MB 4NN6C 3ZR6A 1BZDA 1DYZA 1RZGB 1DP0A 4NZDA 4N24A 1A5FH 4JBSA 4LKCA 1LHZA 1U8HA 5CFAA 5EU5A 1XGTB 4PGDB 5A6MA 4TL4A 1WS7A 3PE9A 4GINA 4LSRH 4PB0L 4XMVA 5M7QA 2VSKB 4CILA 1RJYA 1UC6A 4LZKA 4HLJA 4XX1E 3ASOB 2C3HA 3RAJL 5ITFA 3B7TA 4JFHE 3DSFL 2XCMC 5BZZA 4UI2A 5BRZB 2Q3ZA 1ZLWK 4KXAA 1O5DT 2Z3FA 4URKA 4HBCH 5LUMA 1S9WB 4G7QB 4IRJB 5CS7A 4ZFZB 3UC2A 3CQPA 4YSEA 1OT1A 3DWTA 1ZLVH 5B3JF 1JRHH 1YEGL 2ZKMX 1X5YA 2Y0SA 5ICZA 2I9LA 4WUUB 5FYKH 5T3XD 3S5LG 3KLHC 5HGHB 1X5AA 4GAFB 1AHWA 4U6TA 3RDTA 3VFTA 4MNHB 3U4BH 5J6GA 5KZCB 1MREL 1T2QL 2WAQA 3RUGA 4HJTA 1CDIA 2IXQA 1H5BB 4UZGA 5JUEH 4ZK8A 4E9VA 1T1XA 5I8OH 3I3DA 1AY1L 3CUPA 2F5BH 4CKQA 2YD0A 1FCCA 4PLJC 3KJ4C 3ZDXE 4ODVL 1LQSR 4JFHD 3GF8A 5KS9B 3EFDL 4EVNA 4GBXB 2VDMB 4OLVH 4LNRB 1ZT4A 2EO7A 4N5UA 4DZBA 4PMFA 3PU7A 4R7LA 5FGBC 3KMDA 1E5BA 2HKAA 7FABL 2J56A 1RZJL 1OCOB 4GO6B 4LEXH 3RVXC 5JW5B 3DJTA 1HNGA 2GI0A 4DERA 5E9DE 3EO1B 5E4EB 2JJSC 1N67A 2XWZA 3SE9L 3VFMA 4MAZA 3DK2A 5BV7B 2ADGB 1AD9B 3BFQG 4NNYB 3LV3B 4FI7A 4U1MA 4P3WA 5KVDL 1WDAA 2DMHA 5FUZL 5KYYA 5IM7A 2J1ZA 3FQWB 1S78C 4A7VA 4QOKE 1A6WL 2F8VA 3CFUA 5EOCJ 3VTMA 5CINL 3L5WA 1AXSA 2VJXA 2CDFA 3MLZH 4IGBD 2VMCA 4MQXD 5D70H 4GI6A 1JZHA 4FL4C 1E8YA 2AK1L 5KYXB 1RZJC 1TQSA 1XSJA 4XBGA 2D9CA 4ZUUA 5B1AB 4JN1L 4M61A 3TPUA 5C1MB 5L0QC 1SXBA 3N42F 1NZRA 3C5ZC 2HVJA 4H8WH 4P07A 5HDQH 3B2VL 2DH2A 2QFPA 4PJIA 2DWEB 2OMZA 3PWVB 4X5WA 3KS0H 4G70B 4C56E 5I73C 5L8KB 1MRFL 4MS6A 5I2IB 4ZFFA 3TWYA 4X6DF 1DJIA 3SBQA 2V2XB 5E9DD 4TF4A 4AI7A 3GHBH 4NBXB 4OV5B 3FH5A 3GZPA 4AL8L 5C8JB 4FA6A 1MI5D 3LPGA 4LDLB 4JQXC 3KPQB 3BQVA 4K15A 3SCMC 1U8KA 4QOKD 3F8UB 3MKGA 1XR9A 4Y5VA 3ES6A 4WTWA 1MFCL 2R39A 3FU6A 4XC1L 1FSKC 3RPIA 2C26A 4IDJH 4NQCE 4X4KA 3FFCE 1KNOB 4FLRA 3MV8A 2PO6A 3UBGA 3VB8A 4G8EA 1KEML 5F72S 4JO1L 3OPZL 4AL8C 4OI9A 2F9BT 3U25A 3BI9X 1EO8H 4GH7B 2E8ZA 1U8JA 3DTDA 5DUML 2DAVA 2GTQA 4ACPA 3TX4A 2BO0A 2W1NA 4E0RB 4W9JC 4LSVL 3IETA 4TVPD 3RIFF 1BFTA 3B34A 3F7YA 4XWOD 3NPSC 4AQ8C 4YDLC 3D0LA 4K9EH 2VDRL 3FZUC 3FRUA 4L4VD 4C4KT 1CFBA 3ECBA 3LIUA 2KI6A 1G9NC 2PNDA 4ZOEA 2PTTA 3QR2A 3ZKMC 3VFUB 4WCYH 4GSQA 3FFDA 3LHAA 4HHAB 3S88H 4QRSA 3JTBA 3ZLQC 1XGZA 3B8SA 2E27L 2R8SL 2BP3A 2XA3A 3CFEA 3PWPA 3R8QA 4AEHL 4XO8A 4NQCD 2OQJB 2XWDA 3GTTA 3P3UA 2ENSA 4OLYL 3FN0L 5HGDA 5C0EA 5CBEB 3IGKA 4G83A 4F2MA 4XRCB 1K3ZA 2D0HA 3GNMH 1X5IA 3M45A 5EO0B 5D7SH 1UB5B 5FCUH 1OSPH 1CF1A 3BSZH 4TPRL 3IKCB 4JQVC 4NP4L 2HFEB 3D18B 3SBWC 5I1EL 4OD1L 3OLGA 3QORC 1ZS2A 3HRPA 1F8TH 2XN9E 2F5AH 2EDNA 4FNLL 5TGBB 1B6UA 4LSTL 1Y7VA 3N06B 4XCCH 3L5XL 4BRVA 4F33B 4IRZL 1FZKA 3QZMA 4QKTA 2HRLA 4P9HL 4C47A 2F54E 1VEOA 1ZK5A 1BD2A 4KKPA 1RMFH 1FA4A 2PPDA 1FVEB 1FL3B 3GPSA 1Q4NX 3F84A 4R4ND 2WZPD 5KBMA 2GTZB 3D69A 2PW1B 4TSCL 4P0DA 5B3NA 4W6WB 5H2BA 2AJSH 3OJDA 2NSXA 5J6SA 2YK1L 4XPTL 5EN2A 3MV11 3R0NA 4P23C 1MLBB 4DEWA 2DQEL 1RUMH 2WJ7A 4HF5L 5GGTL 2XXCB 3DKHA 1HE7A 4QXTA 5IVOA 4XN8A 5FW8A 4OKVA 2L04A 3O2VL 1K8IB 3KPOA 4JHUA 4PTUA 3RWDA 1WT5A 5LLIC 2XN9D 2FE0A 4KO9A 4N2NA 4UQIM 4QJ4B 4ZMTA 3QG7L 3D30A 4NM8L 3QO1B 4EI6A 5IJCC 3BZEB 1A1NB 2F54D 3MGOA 5FM4A 1BYPA 4UMSA 4KHXH 1MW2A 2VH5H 1NQBA 4IS6B 2AKRA 3QXTA 5I0ZA 4PW4A 4XODA 4H7VA 5DZVA 2D9QB 2W07A 4FQCL 4G1MB 4KRPC 4O4YL 5EZOL 4P2QB 3S37X 2VXUL 4EPSA 1LP9B 4RH4A 4M4RB 3Q5YA 1R3JB 2JWYA 4Z0XB 1BFVH 3GI8L 1OF2B 1V7MH 1AMYA 1N7MH 3L2NA 3DX8B 4YLQT 1LO5A 1BFOA 3NSCA 3ILQC 2GSMB 3PDDA 1MHCA 3SE8H 1CBJA 3BZ4A 2OR7A 5DRXA 1GXEA 4MMXA 1HILB 4U7MA 3QNZA 5DD6A 3N41B 3O6FC 1F02I 3NRPA 1R5VB 1P7QB 4GP4B 1CGUA 1PL3A 4ZUTB 3S35L 2EABA 3P4OA 3ZTNL 2ERJB 2DYPA 3TNNB 3O6ML 1DZ0A 5T5NF 1CIDA 1RUKL 3CIQA 4I18A 1ZVNA 2W38A 2AEWA 2NYYD 3TH2T 4Z7OE 1CXFA 2KS0A 3NJKA 4LKXB 3ZDYB 4U1HA 1E8XA 5FA3A 4QUOA 3HRZC 1EMTH 3MV7B 4I5BB 4ZYKB 3NH7L 2Q5BA 4FQXD 4K8RH 2ZXGA 4U6HA 5FOBA 1LK2A 4DKDC 4KZDL 1JPFA 4QWWD 2VW6A 3SY0B 1ZWIA 3NFNA 3CD4A 1HH6A 5AVXB 4LDCA 2BXZA 5FDYA 1U8OA 4EO5A 4GMSL 1SLXA 5DHVB 2APBA 1XB3A 2BMKA 1T03H 3HMWL 1ZTMA 4HXBH 3RTQA 1RZPA 4HUXB 2ATKA 5AVUB 1QA9B 2OMUB 2V8MA 3OKLA 3CDGB 3RVTC 1PY0A 5H37G 1MDAA 1T1ZA 1QNZL 3KPSB 5HD8D 5D1XE 5CD5D 1L0PA 3HFFA 4N0FB 3V79C 4APQB 4XPHL 2X9XA 2AFNA 2QADB 1Q9KA 3O3AA 4JO4L 4A66A 5E1QA 2JCCE 3CFDB 4V1DD 3GWJA 2K1MA 4UZSA 4BKLA 2NY6D 1WISA 3ZTJG 3APFA 4Z7WE 1LLAA 2GVYA 3GSNA 4NRXA 1AS6A 1J1XL 3CN0A 2YUXA 3GDCA 4UINH 4ZSOA 4TNVF 5I5MA 1BYOA 1IJ9A 2WKGA 4PJ9B 3U6XS 5IEHA 4PS4L 2FBRA 2ICEC 3CVIL 3O11B 3RJDA 2X4QB 2Y24A 4PS3A 2DQDL 3BVTA 4KVCH 4PLNC 8PAZA 1HQRA 1CVSC 1XIWD 1JZGA 3H3BC 4RMWA 1RHHB 5I1GL 1JWMA 4MA7L 3FPXA 4QAWA 1E4KA 3GIVB 4Q6KA 3KPLB 3MBXH 3D1MC 5T3ZH 1DEEB 1OOWA 1SMDA 1V3KA 4X5XA 5DZNA 4LU5H 5EN3A 4HPHA 5D1XD 2XJKA 1VADB 4HUNB 3EJYC 1INQA 4L8CA 4UDUB 3K4DA 2XWTA 2XYBA 3KHQA 3K5RA 3V5DB 1LEKB 2ZUVA 2VDML 5I8EB 4KOBA 5AB1A 1HCVA 2PTUA 3R4RA 1KC5L