2E56A

Crystal structure of human md-2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
EAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Lymphocyte antigen 96
publication title Crystal structures of human MD-2 and its complex with antiendotoxic lipid IVa.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e56A00
2E56A 3WEBA 3M7OA 5IJDC 3VQ1C 5KWYC 1NEPA 3FXIC 3MTXA 2Z64C 5IJBC 3T6QC 1XWVA 4G8AC 1A9VA 1AHMA 1KTJA 3MU3A 2E59A 2F08A 3RG1C 3ULAB 1WRFA 3VQ2C 1AHKA 3WEAA 2HKAA 3B2DC 2Z65C 5IJCC
chains in the Genus database with same CATH superfamily
1UA6L 5LUMA 4FI8A 5D1ZI 2EEFA 4TUKL 2PP7A 1X4ZA 5I8OL 2F19H 2EVJA 4OZIE 1MXDA 5I75B 1J1PH 2PYFA 5GQBA 1BMWA 4AQOA 2X38A 4AQEB 4CDHA 5MEND 3JWDH 5C0GA 2IV8A 3O2DL 3ZHLA 2DB8A 3B2PA 3RGVC 1UYWH 1ACZA 4K7FA 4NO0A 5DQ9B 3O8XC 2P8MB 1MRDL 2DQUL 4P5TC 3TBYB 4M8RA 2CBQA 3IJSB 1SBSL 1J8HD 2CLRA 3P4NA 4JZNA 1B2WH 3UX9B 3DPBB 1H3GA 2XZAL 2FGZA 1AGDA 3ZJAA 3Q8AA 2DIBA 2B1AL 1P2CA 2I5YH 4MMZB 4UMSA 1MI5A 4IJ3B 5D1XD 4DEPC 3I6GA 3NIGB 3IFOB 4G2AA 3TH4T 1FNGA 3T1WA 5F7EH 5GRZA 3BT2L 4H25A 4QOKB 5SX4H 4DP1X 1L0YA 3GXTA 2PCYA 4UOJA 1WCQA 4DO5A 4Z7WE 4OB5H 1FL5A 2X70B 3U4BH 3UTQA 1LDSA 4WDIA 4DAGH 4GKOA 5ISZE 1Q1JH 2Q76A 4I0CC 4HCIA 4KO7A 4LFHG 1VCBC 4YDLB 3I74A 4BWUA 1BEXA 2ZP9A 2JF1A 3GPEA 5JIPA 4JQVC 2HPTA 3FQWA 1BZOA 4C56D 4YHZL 2DWDA 2FX9H 1JVKA 4U4IA 3MOAH 2I07A 1IZKA 4NKQB 3EFFA 3RQ3A 4K71B 3NDYE 2B4CH 1A9VA 2NXZB 4QAWA 2AERT 5E5UB 4XVJH 5EO0A 3TTSA 5A2CA 2VXUH 3ATDA 3Q5YA 4KMQA 2EJ1A 4FZEL 5J57B 3L17A 4P2OA 2WBWB 3G5WA 4CMMA 3CLEL 4M7LL 4AX3A 4G8GE 3UJTL 4WNQB 3VCLA 2YWZA 3PPEA 1RPQA 3ZKNC 3C8KB 3G6JF 2NY0B 1DFBH 5D2NB 2J6EA 4N90D 2Y3AA 3RWFB 5LG6A 3HRPA 2AJYL 1AZUA 35C8L 1XB8A 5EZPA 5TQ2H 3T2NL 1LEIA 4LEEA 5C0RH 2X6AA 1LE5A 1SYVA 3S4SG 1OWRM 3DRTA 4NN6C 3RE0A 3UROR 2FWUA 5ITFB 3T0XA 2YXVA 4KJPD 5J13B 3T4YB 4UTAL 5HHMD 4FD0A 3UTTB 3ARQA 2KPNA 2CR3A 3NSXA 1HZHH 3GDBA 3WUWA 2I32A 3PQYB 4NM4H 3SPCA 3V6FA 2WBXA 4JDEA 4JFFB 5G4NA 3RNKB 4UB0H 1BVLB 4ZO7A 2FHFA 4QRTA 2CWRA 2EYSA 4MS8C 4DP7X 1TR7A 3K2MC 3T0WA 2EP6A 1I1YA 2CD0A 4LGPB 1N3NA 4ILDA 4NN7C 4PJHA 4PV8B 2QLVB 2KLRA 1M2VA 2FT6A 2IPTL 4F24A 4UQCA 1WFIA 4N26A 4K15A 4CBZA 5IBLD 5F7YC 3ZO9A 2XN9B 4R4NC 2LQRA 1XCTB 2VLKB 2ZXDA 3EJCA 3L4YA 3L5HA 1YEFL 2ITDA 2CLZB 2QKIC 5F9AC 1HZLA 3QUKA 3GS7A 1QFPA 4HEMA 5SWZA 5DQJA 3KWXA 3BWZA 3T2LA 1VGEL 2VN5A 4TOYH 3C5ZA 2BNUA 3FXIC 3GI9L 3D0AA 2M8XA 4X6DE 1HTYA 3BKMH 2K8MA 3KVDD 5C0BE 5C2BH 1UENA 3BAEH 5IFJA 5I66A 2Q8BL 4OZGE 1UZ8B 4HS8H 3Q3GA 1XTLA 4DZBA 2LU5A 3KL5A 2VJ0A 1KPUB 5GZNA 5C0EB 4XO8A 5BRZA 1TJXA 4KKCC 4Q9RH 3FQRB 4WEUD 4JB9L 5F6IB 2Z35A 1SJHB 4ZXBA 3II2A 4UZGA 2YQ3A 4OZHF 2A7BA 2WN2A 3E9TA 5I6NA 3ZO0A 3JWNH 4FKKA 2CZNA 1IKFL 2W9EH 4OFDA 2NUTB 2Y6SD 3I3EA 5ANMA 2QGDA 3ALXA 3LZFH 2HJLA 3EYFB 2WIIB 2JJVA 3CZNA 4PRHD 1I9JL 1BQHG 4RWYH 2WPGA 5EBLB 3SGKC 2JKXA 1TZGH 2DWYA 2VDNB 3QUML 2LU4A 1WLHA 4Y5YB 3FB6B 3C60C 1G7HA 1CGSL 1KOAA 2NNCA 4H88H 4WO4D 1J48A 5C0FA 5GZOD 4ZUSB 5A7EA 4N1CA 1FNFA 1WE5A 4OLUH 3NA9L 3PIQA 1I1FB 3LPFA 1SFDA 3NP4A 5DSCB 3FU5A 5J56B 2NNAA 4P2QB 3K8MA 2D9CA 4UOW1 1SJEA 2CJ3A 2IMNA 1RZ7H 3OLEA 3MUGB 2QVFB 3WJLA 2ZSVB 5KZCB 5BV7B 4P9MH 4JHWL 3F7YA 4J3VA 4PJ7A 4PRIE 5I74B 5A2LH 5F3HA 2MCPL 1HDMB 1JPGA 1M7DB 1UZGA 1GC1H 3CDYA 3SBWA 1BFOB 2PCXA 4KO9A 4XAWH 3UC0H 4Z77B 2P8LA 1B6DA 5ALBL 2P42B 4AVKA 3HE7B 1MRFL 3LN4B 3CZLA 4BZ1A 2IALA 4MJHA 4XPHH 3HN3A 3PWVB 1JP5A 4OBSA 1BLNA 3SDXF 1Q90A 3TWCL 3BEVA 1MFBL 3QIWD 3ARSA 2VOTA 3HNSL 1IBDA 4KHTL 2Z3FA 4IOSD 5BUPA 4MXQD 4QXTB 1I7ZA 2GHZA 1Y07A 2GI0A 3FO0H 4KMTL 3N1MC 2VXTH 4NIKB 4URKA 3CX5J 2CDGA 1IGJB 2VLLB 5DVPA 3RWDA 1AQKH 5EUOB 5HBBA 1BAFL 1QUNB 2EC9T 1MHHA 1CE6A 4JQXA 4PRPA 2Q8AL 1SEBA 4M93C 3E2HC 5DR5L 4IBTA 1G7MA 5CZXC 3IM1A 3II3A 3QDGB 2XBDA 3MRIA 3O3DA 1MIMH 4PJFA 3QQ4A 1EHLL 5DGRA 1U8KA 3BAIA 3OZKA 4NO5B 4PJ8B 3TIEB 1CLYL 3HPLA 3DTUB 1JV5A 4CRPA 3C75A 2HN7B 1P53A 1D5MB 4U7MA 5DJYB 2WXKA 1KBWA 2YBGA 4U2ZA 3ARFA 3VGEA 4DEUA 2F54D 3I6LE 4M8QA 4G5AA 5E23A 4A1RA 5TE7L 2ICWA 1E5ZA 2O30A 2ED9A 5C70A 2VZOA 3SE8L 2NNXA 4KDTA 4JM2C 2JB6B 2XJLA 2CA4A 3SYOA 1GYUA 1FGVH 5JA9A 2BDNH 4O5LH 3UYPA 1RK0B 1KGCD 4X6CA 4XCNA 2IGTA 3BAJA 5LCVL 3POHA 2VT0A 3H53A 5AVWB 4Q6YA 1VGKB 5FGCE 3IBOA 1SNRA 3NJHA 1F8TL 4XP6H 3VI4E 5JR1H 4Y4KD 4AJVA 3GSNL 5L2JB 3VRJA 1KPRB 3MA7B 3PUCA 1HNYA 3HC0A 5C07A 4AEHH 2AABL 2G60L 4F7KA 1FHGA 1N7ML 4J3OH 2BIHA 3MNWB 3KLSA 4NHCL 5EOCL 2B39A 4ANKA 4CN4A 4OZIB 4YHIB 3MREB 4PJXE 3K4ZA 4CVZA 5ILTL 5B3JE 3JWOH 1Y0LA 1UOKA 1BFSA 4MS6A 4G3YH 4AM0A 1MLBB 3QORD 4R5TA 3E7JA 5E1IA 1TZHB 3ARBC 4Q52A 3DHPA 2HWZL 3WFBH 3M07A 2IGFH 4XI5C 4BINA 1KBGH 2A4EA 1JHLL 3BVTA 1IE5A 2BSRB 1M3JA 4WU5A 1TSHA 4U33A 4YUEH 2JIXA 3AWEA 1ZHNA 3VNZA 4UNUA 5KSBF 5J1AA 5DUPH 1CVRA 4ONGH 4NFBA 1H3PL 4N0CC 4N0YH 1AIFB 1JGLH 1H19A 2E56A 1N5YH 4PJ9D 2V9RA 4WO0A 1S7RA 2C3XA 3Q1SL 4RAHA 2L7UA 2R2HB 3QXUA 1NMCB 1SMAA 2Q7AA 4M1CC 4Z7WB 1UM6L 2EVGA 4K23L 1NM9A 1TCRA 2BS71 2F68X 5DTFB 3TNMA 2LLLA 3DC0A 5ISZB 1M56B 1DQDL 2VAAB 2UZIH 1TUPA 3O3BA 1EAJA 3QUXC 4GAGL 3CHRA 1SVCP 3ES6A 5CJXA 1BVKB 4ZAKD 1LYQA 2W9DH 2QSQA 3EFDH 4QRRA 3HCVB 4GXVH 3UJIL 6TAAA 3RZCC 5EIIA 1JGIA 1HSAA 2F7PA 1QSFD 4QNPE 4N5ED 5AD0B 5F0LB 4V1DD 3R7QA 2YKKA 1RAMA 3U36B 3U9WA 1L3WA 3FTWA 1V27A 1ZE3C 5D1ZA 3AXIA 1Q0YH 4XCYA 3C9NA 2VJ8A 1SDAB 1QA9A 1E0OB 4HUCA 5FYJU 1BVZA 2R7EA 1ONQA 3ETBJ 3S5LA 4HJ1A 2IPKB 1URLA 5ESQA 1LP9E 2DF3A 3RJOA 4ZFGH 4JQIH 1ML0A 3HFMH 3TVMB 1K4CA 1Q9LB 4G8GB 4PJ5D 1KJ3L 1ORQB 4M02A 4P49A 2XWBB 4YBQC 1JYXA 5T1DH 1RMFL 3U46A 1FBIL 4KITB 5I1JL 1NDGA 1U8HB 3KD4A 3F6IA 2Q7NA 2MJWA 4HUVA 4Z95L 1QKZL 3OF6A 2D31A 2VR7A 4AYEC 1P7QB 2CK2A 4AEEA 1RHHB 2BIOA 4AM0Q 1CLOL 3DPDA 4IRZL 3G5VB 2QHLA 5K1JA 3GXNA 5CZKA 1Q9OA 1MOEA 2B08A 3VFRA 5TGBA 3TO4D 2OAAA 1WZLA 2EKSA 5I6KA 4IDJL 1N5AA 1KB3A 2APWA 4OGXL 2L0DA 4YZFF 1TNNA 2GQHA 3QHZH 4EVNA 4IK7A 5I82A 1JV2B 2IH3A 4WKZB 1TVBA 2K6ZA 5EZJB 3AW5A 1MWOA 5AAWA 2J71A 3ILQC 1YC7A 3JT0A 3SJVE 3P0YH 1DVSA 1I3RB 5I9QC 1L0QA 4HCRH 4HETA 5D55A 5MENA 1A5FL 3FRPB 4GEIA 2JI3A 3VB8A 2V2TB 4YNYB 5HHOE 1KCRL 4DGYH 4I0PD 1NAKL 2OL3H 1WSST 1YYML 4DW2L 5EF2A 1G6VK 3NABL 5DMKA 5IQNA 2YD1A 4EKJA 3KPRD 3S35H 5HYSB 2GVYA 1XEDA 2XQYA 1GL4B 1JTPA 1SF5A 2YMOA 3KPQA 3L9RB 4X6DB 4WWNA 3X1GA 3ZPDA 5C0BB 1X7QA 5IKCA 2OXHA 5D96B 4MZ3A 4OZGB 2BHUA 4JPVL 2GABA 5I0ZA 5D1XA 4NKIL 4KK9C 4OJAA 5E8OA 4HKXB 4KKAD 4L8SC 3BPNB 3CSYA 3VM5A 2DYSB 3MHZA 5EU5A 3AQZA 5F1SA 4KQ3L 2Z1KA 3LH9A 4C83A 3MBWB 2NY1C 2F08A 1P4UA 3DMMD 1QI4A 3CBJB 2WB1A 5IHBA 3EOAA 1ADQH 2NUPA 2FZ3B 2QV4A 4OKVA 3QUYA 2FLRT 4W9IC 2X6BA 4O02A 2OQJB 3EKCA 2VW7A 5F9OH 2E47A 1IGTB 5EZOL 2EYRA 3GXFA 3P4OB 1JBJA 1IQWH 3ARGC 3K6IA 5I18L 3I2CL 5CCGE 5JYLA 4OD3H 1XZ0B 3CAFA 2ITFA 4P5RA 3HBQA 4P9HC 2OBGA 3TZVD 4K9EH 1HNFA 1V5JA 1T2QL 2UUDK 2HH0H 3H2PA 4FXKC 4HDIA 1LO0H 1FL6B 5EA0L 5BVPL 3AVEA 4YHKH 3UZVA 3ZMRA 2J1ZA 5LNGA 3ISWA 1G9ML 1W72B 4YXLH 2AP2A 3DUSB 1S78D 4U1NB 2DOCA 2BFVL 4G72B 3CH1A 1YNTB 4EMZA 4PRIB 1E7VA 4R84A 5D7IA 2CO1A 5EU7C 1C5DB 1JERA 2YZ8A 4LLUB 5C6PB 1AMXA 2HYMA 5FECA 1ZDSA 4IRJD 3BP5B 2YMXL 3W39B 3IDIB 4KRMB 3MNZB 2YS4A 1EXGA 3GTNA 1IIIA 1RFDL 3NN8A 4P4RA 4LOUC 1UD6A 3LKNB 1HIML 1OAZL 4MJ6A 4JFZL 4QKTA 2GAZB 3KWUA 4AV4A 5KVDH 3K4DA 3MLWL 4HF5H 4LHQB 4MCYA 5C9JA 3HJ0A 4Z78B 2Y2TA 4MB1A 4WUUD 3BKJH 2H26A 2Z93A 2K70A 4WI3A 1KCSH 3VDBA 1ECZA 4A39A 3UOAB 3V6OA 4MNGA 2AXGA 4N2LA 4PRDB 1BZ9A 5DC4B 2YGPA 4UDTA 4X9HA 1IC4H 5T1MA 1FNEA 3CLFH 4IGBB 1EJFA 1O9WA 4XCCL 1CFQA 2FX8L 4X4ME 4G70B 2VNCA 3HJEA 1CT8B 4QHUB 2R1WA 2A6KA 1F58H 3EYSH 2VDKH 3N50A 1G0YR 4PCSA 3ALPA 5I8CA 5DJDA 4OZFG 3RVTD 3IK2A 3EAKA 3MBXL 5FCUL 5IEKA 2VWEE 2WQAA 3ECWA 5JMOC 4YDKL 3OHXC 3CFJB 3CFDB 3FUIA 5CZVL 1J05B 1MDAA 1U9KA 5H94B 4GINA 2OFQA 4U05A 3VXTB 4ZMZA 2FEDC 4G6KH 3SOBH 4N20A 4XN2A 2GY5A 3SDAC 4CL7A 4HG4J 1KN4L 2J21A 1QQDB 1K4DB 3LH2L 2Z7UA 1DEEB 2GJPA 1DBKL 3QJFB 4YDVA 1SLXA 2KPWA 5E2JA 3B5HA 4HGWA 1MIEL 2CDEA 2WBJB 1SDYA 1RJLA 1A25A 2R69L 2K9FB 4J3XA 1N6UA 2IG2H 2JTDA 3L5IA 3FN0H 3VFMA 3WV0A 5FGCB 3AITA 2HUEA 4KQ4L 2H1PH 3VI4B 3WD5H 4EI5D 4R90L 4ES9A 5IV2B 1WD8A 1UQSB 4HC1A 4IBWA 5E4OA 1NCAH 2Y7OA 2Y06H 3CDZA 2IQ9L 4PRHA 1THCA 4JJHA 2DJSA 2BH0A 2DJMA 4Y7OC 3NSJA 4MTMA 4E41E 2Z92A 4PJXB 3PJSA 3X2QB 4B0MM 2YZ1A 2RGSA 4WO4A 4QLWA 4LOVA 3SBPA 3KLHD 3ZTJH 5DO2C 4QWWC 3M46A 1L9SA 1E65A 3L1EA 2H2PD 2JJSA 3DI3B 1FN4A 1GRWA 2P5EA 4V2CB 1LO5B 4LSPL 5HD8D 4GUPA 5E2TH 2VTFA 4XMUA 1FVDB 2Y5TB 3AQXA 5FA4B 4XC1L 3VWKB 4MKTA 5DLML 1IC5H 2IH1B 1D5RA 2NRDA 4M5YL 4NQXA 5KSAD 3SQRA 3RDTA 4MNQA 3VG0L 1U91A 2W65B 5E5MA 2FWLB 4MMYB 4IS6A 5ABDE 4K8RL 3O6LH 2FEJA 3LN5B 4NQED 1A6AB 4ZFOB 3S3SA 1R17A 2YO3A 1JE6A 1P5UB 3RIFK 5HGBB 1GS6X 3NJGA 5A2FA 1CBVH 3BD3A 2NY3B 2ADFL 3CN4A 1ZT4A 4TULH 2B77A 4K3DL 1JMXA 1JYWA 5DK3A 5E94B 3AM8A 3P40A 1D7BA 2APFA 4NQUA 4OM1L 3RTQC 4F57H 5JOPE 2XN1A 3QIWA 2CUAA 3L1FA 1NSNH 3Q8EA 1SXCA 5D7JB 2ARWA 3HPJB 2VDNL 5GJSH 1VPOL 4Z0BH 2BOLA 4ZT1A 1EDHA 3CNKA 4Q9QL 3O4LE 4J12A 2EQDA 4UQBA 2Y07L 3GNMH 3MJWA 3VRIB 5AG9A 3FSVA 4UQ3B 5C09D 1U3ZA 3QB7C 5EWIH 2WZ0A 4HWZA 3C6EA 4PTUA 5IF0B 2ARJB 2AXFA 2RBLA 1T0MA 4V11A 1LP9B 5EO1A 4WGWB 3EDJA 3K6FA 3PP4H 1A7RH 2NW2B 1JZ6A 2DQCL 2LTQC 1HQRA 5K9JH 1DN0B 3HLAB 1ACYL 1ESOA 1YMHA 3EOYG 4K0OA 1ZA3B 4AIZB 4YFEA 4U6TA 3RL2A 3EDDA 4PJEE 3ZTJG 4GRWH 4KXCA 3EH4B 1RK7A 3CVBA 2ZJSL 4HGMA 1HSBB 1KDIA 3FO1A 3MODH 1BZDA 3IXTB 4FQIH 2EO1A 2F54A 1OB1B 4BK5A 3R8BB 4LARH 4CADB 1FC2D 1YEGH 1S9WA 3BSHA 4NZRH 1CF8H 5F96L 4BQ9A 4MAYC 3D85D 4WW2B 3SE4C 4ZUVA 5DS8A 3T4AB 2B9BA 5DJ2A 2FWSA 2D7TH 1FPTL 2WTRB 5AKVA 2PABA 1JAEA 2GY7B 4I9WD 4X9FA 1WD9A 5I16A 1U30A 4K3HA 1KIQA 3L48A 1BIIA 3SD2A 4CNIB 1AQDA 2DIAA 4Y4KA 1N4XH 3ZL1A 2NDGA 3GJFB 1Q0EA 2ICEC 4O9HH 4S0TD 1CXEA 4ODTH 1R3IL 5IHZB 3OWEA 5FYJL 5IR1A 4JVPA 3SJVB 4JFQA 3LEVL 5JYMA 1W91A 1H3UA 2OJ1A 3L7EA 3QRBA 3L3OB 3ML8A 3QORA 4L4VE 1T80A 2NX5D 5HHOB 1MCQA 3KAAA 5HGDA 1CQKA 1QBAA 2X4SB 1MCFA 1YRKA 2P80D 1JF1B 4UILL 3LD8B 5CZRA 2DQJH 4YE4L 1MPAH 4IQHA 3VFOA 1V54B 3K81A 4AIEA 5JPMB 1JXKA 4AQ1A 3QDMD 3AT0A 3QISA 4XT1C 3T77B 5CO1A 1LE9B 2WXIA 2ADGB 5CKGA 3TS8A 3UO1H 4DVRL 5I1GH 3HS0B 2EIZB 3ZDXF 1AYRA 4KGJA 1P7HL 2LHAA 2CHNA 1NIAA 4LK4A 4H26A 1EAPA 3WXWL 2Y22A 4JRLA 2WLJA 4CKQA 3VXRA 1C08A 1V7ML 3FB5B 4JM2F 4Y1AB 2XUWA 1TZ8A 3UG3A 3FTGB 4ZAKA 5HDQH 3UACA 2L7JA 2ZUQC 3NPZB 5F72S 1N6QL 4EUPG 5IROD 4YC2B 3IE4A 3IWVA 4JPKH 2EH8H 4OY9A 4MA3A 1D3CA 3DOIA 4P46B 4X4YA 4IHBA 4AMKL 1NCOA 2A74C 3N85L 1JGUH 2X3AA 3OZ9H 1BXAA 1R33A 4J8RA 5F9WB 2OZ4L 1UATA 4AYFB 1HAWA 2E7LA 3SDDD 3VI3F 2G9HB 4TLTA 1S5IL 1WZ1L 1G7IA 3MRJB 3B9AA 4HHAB 4XWOC 5DO8A 1FYTA 4AQ8A 2UUDH 2DQDH 3RUGF 2AJVH 3N44F 5AYUH 1HFUA 4EIUA 4JY4B 2DQEH 4PJ5A 3MVSA 2VERN 3FUDA 3U0TB 1IKNC 1JRHI 2VDRH 4JE0A 4G1MB 5FOBA 2R4SL 5AKTA 1KJ2B 3PXHA 2QSCH 1K2DA 4RDQF 2CRYA 4ETQB 2X2UA 3T1FA 4AE0A 3FSAA 3ZU8A 3FT0A 4PWJA 3EOBA 4IOIB 2QVKA 1PZBA 4FA7B 5IMMA 4NPYB 2ZX8A 4CSZA 3JZ7A 2ZP0T 2YGOA 3I3DA 1FDLL 2WINA 3F83A 3TO4A 2P48B 4JFYB 1J1OL 5F7DA 1NCTA 5J1SC 1NDMA 3GMPA 3ZW3A 3OAUH 1R19A 1DSWA 4AVIA 5HYQA 4JN1L 2DI9A 3JWNE 2F8VA 2HT3D 3CQQA 3VYNA 5MEQA 2EICA 3V4VB 4JG5A 3Q7JA 1FAIH 4A6YB 4HJ0C 4DVBB 4BQ6A 2YD3A 4NAMA 2WSPA 2FO8A 1QFOA 1UM4L 2P1YA 2WTOA 3F84A 4LGSB 3QH3B 3QFDA 4G7VH 3BPLB 3LRHA 1T5XA 3W11C 1DO6A 5IB3A 2GIYA 4L3CA 1ASQA 1FJ1A 5ESVA 1HCZA 4FLHA 4I0PA 4ZUUB 2KQMA 1T4KB 4JO8A 5E56A 1R0AL 2OMUB 4LEXH 1LJMA 4Y4FB 4KXDA 3KPRA 1TEFA 1E9PA 2HLFC 5EOQL 4GKNA 2YAPA 3AS2A 1ES0A 4M03A 3PLYA 3VFNB 1I7TA 3WIHL 1WA1X 2R2BA 2X9WA 3VWJC 4RMTA 4XTRC 2J4WL 4XP4H 1NCNA 5JQHC 2NOYA 1RK1B 4GW1B 1JNNH 1OTTD 1DL7L 2JK5B 3GTVA 4EZKA 5K39A 1ND0B 2NXYC 1XSJA 2XWCA 3QARA 1YEWA 4F7PA 3QQ9C 3ZE0F 2BVQB 3S8FB 1AP2A 4HEPA 4NQDE 3QQDB 4RAUA 2ESVA 5EDXA 4N85A 3WLWD 3FN3A 4XNYH 4XOAA 3RPBA 3ECBA 2VH5H 3ABKB 5JDJA 3FCTB 3DMMA 3MLYH 3KMDA 1XH3A 2A77H 1DBJH 4NNYB 3DHMA 5EOCJ 1TZAA 4GSDL 4ODHL 5JHLH 2FATL 1WBYB 2IXQA 4L1DA 2BZ7A 3NA4A 3ZDZF 1NPUA 4EDXB 2QQNL 3LHPH 3VH8B 4ZNCD 3RWGA 2WLLB 2ITEA 4HS3B 3VAEA 4BUQA 3LXCA 3QG6A 4OD2B 2DRUA 4E41B 1THAA 2Q86B 5J11B 2VDQL 1NDTA 4H2CA 1E28A 2ZXEB 3V4UL 3GRWH 5BJTB 2WLKA 3TZVA 1X6LA 3DROA 2XZCL 1FZOA 3U82B 1IVTA 3F3HA 4ODXB 5JHMA 1YEKL 1ZGLB 3HAEB 1J5OH 2IC2A 4WENB 1E6OL 3S88H 4WKXA 1Y1UA 1ZWIB 4ZMTA 3LZOA 4UYPA 3DO7B 1NKRA 3RGVD 1IGIH 1CFNA 1I3UA 1A2YB 3HE6B 5GGTH 5I8EA 5DJXB 3G6JA 3QYMA 2MNUA 2XQYK 4AMWA 2A1WL 1QZNA 4HPOH 3R4DA 3UTOA 1JF5A 4J2XA 1SY6L 1ID5I 1FL3B 2OMZA 1X6NA 3HC4L 2F5BH 3ATFA 1N26A 2FL5B 4IRJA 3LJ3A 4Y5XC 4FQHA 3VXUE 5BZZA 2EDLA 2Z8VC 5F7KC 1AO7E 3QPQC 2RQ8A 1HAUA 3B1UA 5HVWA 4U3HA 5FW6A 1TVHB 3D6GA 4I4WB 1NUFA 3HMXL 4XMPH 3SE3C 1AY1H 3X14A 4Z7OF 5ELIA 2MIZA 1D5IH 4WUUA 1YQVH 1BAGA 3VSVA 2FHCA 3RWCA 1FE8H 5B38A 1VEMA 3QUGA 1DSFL 1R5WB 8FABB 3VW3L 4X99A 1A3LL 3GSUB 3LDBC 4JDTL 3F12B 4NKMB 2R0WL 4HZLA 1SFHA 5E2VL 1HNGA 5D71L 2WVUA 3CFCL 1F0LA 1CLZH 2CKBH 2VDOB 5ITBH 3HN5A 1F41A 1N8OE 3KEHA 3O4LB 4P59L 4TNVF 4XC3H 1AANA 3TBWB 3X3FL 4W93A 1G0DA 3CN0A 4OM0L 1CD8A 2Y24A 1SUHA 3QHTC 1NLDH 2CLVB 3NZHL 4KTGA 4AV0A 4JFED 3WUWG 4RCAA 1Z1WA 1W72L 1TEGA 2RFXB 2XPZA 3UMNA 5B39A 3MLXH 3AROA 2QQLH 3D05A 4HJGB 3ZYJA 1BP3B 2CAKA 1U95B 1ICTA 1WITA 4FX5A 3KL0A 2FEEI 4XNMA 4W6WB 4GYBA 4PJEB 5I30H 1L0PA 2OI9C 1G5GA 2FX7L 3HG1E 2EDYA 4MJIA 3FQNB 4DK6A 3ZKND 5EU6D 4QRSB 4I48A 3U7YL 2DY2A 2I26N 2XPGA 3AXLA 4PB0L 5IG7B 2APVA 1QLRA 4CSPA 2DQTH 1S2EA 4PN6A 3UTPD 2N1TE 1U2HA 2VL5B 1EEUA 4NKDA 1G4MA 3ZHKA 4Z8FH 1FFPA 3RU8H 3ZZQA 1HJBC 3D0VB 4OZHA 3ROLA 4K5MA 3OXRA 4AL8L 4ZFZA 1T21A 1X5IA 4A63A 4FL4C 4EI5A 2UVFA 3Q9QA 2XTJE 5IQ7L 3Q2NA 3NCCB 1QAWA 1ZVSB 1EJ6A 1OGAE 1QRNE 5FHBL 4MA7H 4G8EA 3FONA 1K3IA 1DQLH 5IW6B 4JO4H 5CILL 4MS8D 4LAQH 2AMUA 4L4VB 1BWMA 4JJ5A 1H5BA 2GEEA 4CVWA 2YD9A 3ABGA 3ESPA 4KUCF 2IH9A 2WGNB 3STZA 2OM5A 1IGCH 3TBCA 5KTEL 3H3PH 4EZMA 1JWUA 4R4ND 4LSTL 3SKNB 4AH2B 4LIQL 4HIQA 3QFJE 3HEIB 4WWKB 4UANA 1ZLWK 5HP5A 3MRCB 3QEUA 4PG2A 5TDOA 2OMBA 2OJEA 3EJZC 3T8XA 1DQQB 5KSAA 3L54A 4JPIB 4LLWB 2V7NB 2JV6A 3GPSA 3NJKA 4NQEA 5DFTA 3BEWB 3I9GH 43C9B 3G6AA 5LGHL 1GHFL 4Y88A 1NUNB 2L7QA 1DUZA 5T3ZD 1MVUA 4NQCD 1Z2KA 1KYOK 3S96A 1GOGA 3UERA 2J5LB 3TN0B 1UEMA 2R1YB 5B1JC 1L9TA 3LRLA 5LHDA 1MFEH 2BSED 4KKCD 3G04B 5FFOA 4ZQKB 2XHNA 5KYNA 4M8UA 3SDXA 1PFOA 4ZMXA 2WVTA 5CP3H 1FG9C 2EEDA 5C0AE 3THML 4M6NH 2O6CA 1DQJB 1XCQB 2XN0A 1Q94B 4G6FB 1DANT 3GMOB 4KKRA 3VDAA 3O81A 1BDYA 2AEWA 5AVSB 4DIXA 3I84A 5EORL 1WO2A 2VMJA 3OPZL 5C09A 4NQSA 1DBBL 1LO3H 5GRJH 3C60D 1DJZA 4A67A 4E36A 3V5KB 5IJKA 3WGUB 1HILA 2EXWC 4UQDA 5I75C 3CDCA 4ODSH 3KWWB 1EH9A 3CSBA 4DSYA 5T1KB 4MAUL 1OLLA 1IL1A 5FHAL 4UT6L 1FFQA 1HL4A 3T3MF 3UP6A 1GJUA 5LKNA 5ID0B 1P4IL 5CCKH 4EN3B 1BYPA 4ANXA 4GQPH 1ORSB 1QFUH 4KAQH 4Y89A 5A6MA 1EO7A 4FNLH 2OS7A 4MD0A 4U0RB 3WLBB 1DLFL 1OP4A 2YD4A 3SKJL 4PCKA 2NR6C 3D85A 3PGCB 4PBWD 3OMIB 2AK4D 1GAFH 1BEYL 4EBQH 2NSQA 3F5WA 4NCC1 4UV4L 3WNOA 4MMZC 3FQTA 4IJ3C 2R23B 4X8JA 1LWHA 4WFED 1J87A 3MRRB 1Z0MA 3MTRA 5CEZH 2EUWA 4YGAB 4I77H 1SOQA 3ZY7A 4GPVA 2P9RA 4BXSV 3P0VH 1UOLA 1ZSDA 2WXQA 2EDKA 3SPJA 1KFGA 2AKRB 1PY9A 3JYBA 4YDLC 3ARXA 3HUJE 3IDUA 3NT0A 4M7KH 4ISVB 5AAMA 1MCIA 1LEKB 1AXTL 2QDWA 2NX5A 3BN3B 3WKMH 2APBA 3K1DA 5E1HB 5I1EL 1IV8A 3BOVA 3LYRA 4HV8B 5KG9A 4HSQA 2AAAA 3BW9B 1G4RA 2RQEA 3L5XH 2P80A 4M1GL 1EGJH 5E7FA 5KBPA 2NXZC 4Z76B 4R96A 3OM3B 5CZXD 1YSOA 4OFQA 5HJ3B 3FFDA 1B0RB 5KUKA 2TRYA 3QDMA 5KSBA 3DVGB 3O4OB 3L3GA 4AK2A 3UTZB 3FO9B 5HDWA 3LS5L 1MFAH 2E4FA 2FR4B 3QO1B 2Y1YA 3IFLH 5EF3A 4FNSA 3BIKA 4H8WL 2NY0C 1UWFA 5D2NC 4JFPB 3QZWA 3HG2A 4NQDB 1SLWA 3H8NA 5AW7B 1RY7B 4OCYL 3V0VB 2Y25A 1PKQE 2ZZUT 1KDJA 4JM2D 4PLNC 5SWQA 4JRWA 4E0RB 3B4NA 4BCXA 1FZJB 2OX5A 5C2UB 5J13C 1EAQA 2LAGB 2VSDA 5KVDE 4JY6B 4RQQA 4E42B 3C09C 5IROA 3S3BB 1TYJA 3PHQB 4K3EH 3KXFE 3DI2B 2ZCHH 2BMKB 1PMYA 2FH8A 1RUAL 3GIZL 1M71A 3SY6A 1Q0XH 2EYTB 4WJ5A 5TF1L 4QYOB 3S3CB 2EABA 4LCUB 2C9AA 3GUFA 4EXKA 4S1SH 4H1LG 2C9UA 1Q9KA 1IIKA 3CWGA 4MD5B 1HHJA 4PMFA 3F7KA 5B8CA 1ZAGA 2K6WA 5B1CA 1TJHL 2PETA 3VDCA 3FFOA 5GISH 5EH1A 5IB2B 3O45A 4M61A 1PX8A 2VR5A 3ARBD 3IBEA 1FC1A 2ITCB 3T04D 1RZFH 5EIIG 4XI5D 3QCVL 2WCPA 4ODWB 3Q6GL 5HHPB 1PY4A 1A1MA 3HZKB 1MCKA 2AK1L 3IGLA 2YD7A 1S9XA 3B7UX 3DA0A 5AVTB 1ZJBA 4QD2E 3VXUB 3KYMA 1AO7B 2O5YH 4IMKA 2X6VA 4N0CD 3S5LG 4XRCA 5JTWA 1JG9A 4U1SA 2VITA 4MDJB 3UFIA 4AMXA 1AZVA 2Y9RT 3MGTB 1QLFB 4KJWC 4KRPB 2JI1A 3UZEA 4QTHA 5KBDA 4Z7AA 3D3VE 4MSWB 3VFVA 4M1CD 1E4JA 2MWCA 3ALWA 1U8CB 3MUUA 3OG4B 1MKFA 3QEQE 1CD1B 4NZUL 4J4PC 3WO4C 3ULUC 3NCEB 1ZS8A 3MCLH 5F6IC 5ACLA 1JZDC 3QUXD 4PBVC 2JQZA 4X80H 3JTSA 4OT1L 2DTSA 1NGWB 4NAQA 1MRCL 4D0DB 3IU4H 2VQ1A 4DGIH 1NJ9B 3FF8A 3MLSL 4QRFA 2WVSA 1YY8B 3Q13A 4LBEB 4M6AA 4HD9A 4O58H 2GJZA 3V52L 5DC9B 4O02H 3QSKB 1QR1A 1VFAB 1NCBL 2NLJB 3FU9A 1NCDL 1VENA 2G9KA 5CSZA 5INDB 1OAUH 4HUWB 3NCXA 4MX7B 1FVCA 5IM7B 1T5KA 1J8RA 4Y5YC 3TT3L 2WKLA 3ZZLA 3W38A 3UTSE 2GJ6D 1ZS2A 3OMAB 3GTTA 2YQGA 5G4MA 5HDBE 1FFNB 5T5FL 3K72A 1EDYA 3SD5A 3DX7B 1KJ2L 3KDMA 3WMQA 3D08A 2HKAA 3R8QA 1GSMA 3U1PA 3UL4A 3HG1B 3BO8A 3TEYA 4PR5A 4WFFD 5DRZA 1PNCA 2FWOA 1CTOA 3PGDB 4RNRA 3UAFA 4FLRA 4NUGL 4YBQD 1OPOA 5LBGA 5TH2B 1S5HA 4P2RE 4X6FA 4ADGA 3GS4A 5BV7C 1KCLA 4WF7A 3Q48A 2CUHA 5I74C 3A47A 4WCYL 4TQPA 2DI7A 4N9OB 3VXNB 3GS0A 3IKCB 3PNWA 3KCPA 4RIRB 5D6CA 2XQYG 4KI5E 4ALAL 3LZQA 5E4IA 1BMGA 4QI3A 4KVCL 2SEBA 5FO9A 4AT6B 1WFNA 2XTJB 3HE7C 4N3TA 3FH7A 2VLJE 3C5SA 4ZPTB 1PS3A 3V4VL 4A6YL 3BGFB 1SOKA 1OGAB 1QRNB 4S1RH 1RXLA 4F33A 3LEYL 3TASA 4PTTA 3PAUA 4L37B 4YBLB 4XH2A 1IFHL 2D73A 3ILQD 3BISA 2HCZX 2BXYA 1QBLL 5CMAB 1BX2A 2VXQH 5I1DB 4OGYH 4FLSA 1RI8A 3G7TA 5EN3A 5LG1A 5I1LA 1UB6A 1A7NL 3IS1X 3FYEB 1A6TA 3QFJB 4JJOA 3EO1B 2YPVL 3J07A 2AJSL 2E6QA 3QNYB 3CZSA 3K2UH 5HJGA 4JRYA 4LL4A 2W1NA 3AFLA 2YJLA 1I8LC 2COVD 3GB7B 4X4KA 1ZLWH 5LDUA 2ED8A 2ZCZA 5J89A 3L95B 4XPTL 3KYNB 4GRWE 1IBGL 3MRFA 1E3XA 1J1XL 2FYVA 2CO7A 3MLZH 4HUUA 4PJ8C 3OJMB 4KK9D 5I15H 2MH4A 3LXUX 4OF7A 4EI0A 1NANH 1I7RB 4FG4A 3H0TA 3EJYC 1TG8A 3KPMB 3QPXH 5GSVB 4W9LC 5F89B 3SKUD 1V55B 3KLAB 1OIOA 3L3DB 4HZAA 5HI3C 4BFBD 3P30L 1KUMA 1KG0B 4HIPA 5I0WA 4OF3A 4L9LB 1AZBA 2X3CA 2NY1D 3FUFA 32C2A 1ZHBA 3DETC 3EJQA 4BSWB 3BKCL 4JKLA 5C0AB 5IW1A 2NW3A 3ZN6A 4FQ2H 1E43A 4X6EA 1BHGA 3BZDA 4ACTA 1MHCB 4UAOB 5E6RB 1DHKA 4LLYA 1L9QA 2X0WA 4N2DA 2XZZA 3BP7B 1RP9A 1OAXH 3ARGD 2OYMA 1U3HB 4HQQH 3TLRA 1OT4A 4OJEH 1PKOA 4YWGL 1TFHA 3TBBA 5CP7A 3GBNL 3RNQA 4FADA 1DUYA 3KJ6L 1LHZA 2YD5A 3A6CH 3MRBA 1TTCA 2WM0A 1MFDH 4JRXD 4L1HA 4FHKA 1U8JA 2OL3B 4GAYB 3ZHDA 1TSRA 4D3CL 5CD3A 4N2BA 1A9EB 2XG4B 4MCZA 4B53A 1CDYA 4KZDH 4JFSA 1XF4A 3BH9B 5HJDA 5BQ7B 3H9HB 3D30A 1IAMA 3N1QC 5EU6A 2C8NA 4Z6AT 5IB1B 1LMIA 2IBBA 4QXGH 1T1XB 3VXMA 5E24E 3A0OA 3K71A 4EAEA 1CDIA 4NM8H 3LPOA 4R4BB 4G43A 1MVYA 2C4FT 4KHXL 1CK0H 1WRFA 1QEWB 4WJKB 4DGVL 4LOUD 2X2JA 2GUOA 4Q56A 3TURA 3N42B 1NIEA 25C8L 2C5DC 5TQ0H 3BZ4B 1QOKA 2RB8A 4E9VA 4PW3A 2FQEA 2JKNA 4EDWH 3S7GA 1M1SA 1D5ZA 2YPKA 5T3XL 5DRNA 1OP5H 1B4LA 2GFBB 2P47B 3EO9H 1NMCC 3J2PA 4G82A 3MYJB 3RZCD 4NQVB 4ORZC 2VDOL 1X44A 3E1F1 5DUML 5TD4A 4XNDA 3C6LB 4XBPA 3WIFA 2ZKHH 2WMPB 5E8DH 4LPXA 1UEYA 1ED3A 4ERSH 2F19L 1RVFL 4YHNA 3HUJB 3L4TA 5FYKH 5BZDB 5ANHA 2ZXBA 2K3HA 3MCKA 4HPYH 3JWDL 4RDBA 1JNHB 4NJ9H 4KUCD 3WNPA 4E9XA 1UYWL 2ZONA 5CBAA 4MGXA 3OSKA 4YMPA 3CSFA 2QKIA 2XTLA 3VA2C 1D7DA 2RCSH 1KXTA 2BO0A 3FUJA 5C0JB 4DO4A 1DZ0A 1HL5A 4UDUA 4DP4X 2LV4A 1B2WL 3MLPA 2WWKT 1KTJA 2FEDD 3KM2A 3PWLA 2UXFA 2OMWA 2XFXB 3TVMC 5J9PB 3BFQG 1DVFC 2I5YL 3SDAD 12E8H 4ZUWB 2PWGA 5D7LE 2BSBA 3M45A 1EFXB 5DWPA 5F3FA 5IOPB 2IWGA 2YAQA 1U2YA 3IDYB 5EFIB 1PKQB 3WFDH 3U4BL 4LQFH 2FIRT 2YA2A 4DAGL 4JFXB 3RJDA 1IGYA 3RBGA 1MI5E 1Q1JL 5E9DE 5I5RA 1T1ZA 4Q9CA 3KXFB 4PGDB 4AIXA 1CXKA 3FRUA 1NC2D 3Q05A 2OCCB 4WK4B 2PWEA 4Y1TA 5E6UB 2BSDA 2BP8B 4QCIA 2FX9L 2H0EA 1YJDH 1CCZA 2W8CA 4FKHA 1UVQB 2Z4QB 3SGKA 3ZOAA 5DMJB 3ZHFA 4XP9L 1SF3A 5GRUH 5DZPA 3TJEH 1EEZA 3ZMEA 1J0KA 2HPOA 4MZIA 2VXUL 1EEYA 2PXYB 2AGJH 4LCWE 4F7CA 2VDKB 3HS9A 5DO2D 4QWWD 4TL5A 3OX8A 2H6PB 2ILLA 1PAMA 1KWKA 3BYTA 2FSEB 2OXGA 3MRHB 4XXDB 4ZSOA 4NBYB 5AVXB 5TK4A 4Y2NA 2ZKWA 2ALAA 5GSRB 3FNKA 1NCIA 4APXA 2CIIB 3GGWA 5K93A 4DKAA 4UIMB 5TQ2L 3VD2A 3GZOA 4OIAA 1HHGB 3LRSB 4G6JH 4S1QH 5IEHB 1G9NL 1UKSA 2ZUUA 4H7VA 3ZE2E 1I31A 5E8NB 1ZSHA 2AK4A 4O2CA 5D96C 1H8LA 3HIZA 1SJXA 4AXWA 4H20L 5SWSD 4AVHA 2YQ2A 1WJ3A 3CHXA 3D3VB 3BRFA 2DM7A 3OXSB 3V0FA 1I8MB 1UH3A 3QC5X 4NIYE 4HOZA 3FO2B 4ZX6A 1HZHL 3SCMA 3QEQB 5CGTA 4HKZA 3BPNC 4NM4L 5ECGA 5EV7A 5MEPA 1TNMA 3V6ZA 5K9OA 5GGSY 1NWPA 3RTQD 5FW8A 5E4EC 3DXAD 3ETTA 1FFTB 4UB0L 3JV5A 1ZTMA 4NEHB 3Q5OA 1QWUA 3B9KA 5ICYA 2P5PA 1JZIA 1DJGA 2Y36L 3MLVH 4YHOL 5J0BA 1OPGH 3V10A 2AFNA 1MLCA 4M4RA 1MCPL 5GGSB 2XVBA 5J1TC 3OAYK 3OKLA 1S9YB 2GC4C 4Y2DB 2L3BA 1E5UI 3UTSB 1NGZA 2FTAA 4PWKA 4B60A 5HDBB 3TBTB 3WN5B 2J57A 5DHDA 5EEYA 4TOYL 3HNTL 3C6SA 3MZGB 1KB9J 4MA8H 2YMTA 3CZUB 1WEJH 4JFDE 3BKML 1G7QA 2MTAA 3BAEL 4PSRA 1OP9A 1UXWA 5AALA 1KIRA 2Y0SA 4HP5A 4DTGH 4P2RB 1IEAA 3G5ZA 3TFKC 3WY1A 2ZXQA 1A7OL 4CDGC 1LQSR 1TZIA 3E6FB 5EBWA 1S3KH 2K0RA 2IDSA 3D39E 1F6AB 1LVEA 2P45B 2GT9A 2XLLA 2XXCB 4U1KB 1W8NA 2DKMA 2FJGA 5IVOA 4MAYD 4ZYKA 3MJ8B 1YEHH 4JM2A 1AQMA 1ZY9A 3NQIA 3QXDA 1SUJA 5KVEL 2W9EL 1ACCA 3DTXB 1SXBA 2X4TB 4KK8C 5E8PA 4X42A 2VLJB 3NIGF 3T71A 2IAMB 4LLAA 5BRZE 3LZFL 2DQGH 4KKBC 3QT2A 2D3JA 4FFTA 4FFVC 4D9RE 5AUMA 1P7BA 3AU1A 4RWYL 1YG9A 4MJJA 4AL8C 1TZGL 3U0PA 3VGAB 2P7TA 4NLAA 4YHPB 5LLIC 4H88L 2ROXA 3VI3A 3ILEA 1BVNT 5C6TL 1EVTC 3H9SD 4IGBC 4PUBL 5ANME 5IB4B 2CBTA 1XGTB 3M1OA 4BWTA 3U1QA 4KJYB 4GRMB 3RUGA 4I1RA 1IO4C 5GIRB 3OKEB 5DJ8B 1JJUA 5DUBB 3ARBA 4UQ2A 3EFOA 2C3VA 4IIZA 3M17B 4LGRB 1T3FB 1T7VA 2HFEA 1RZ7L 4O2FB 1BQSA 4IKIA 1NEZB 2ZOLA 2YAFA 3NJFA 2C3HA 3NEOA 4GRWB 1MW0A 2I9LB 4GO6B 4EIGB 5H8DA 3VSUA 2VM4A 1FFRA 2A6DA 5DCCA 1GC1L 2WWNA 4GKLA 2B20A 5FYLH 1HINL 1P6AB 4WHYH 4XAWL 3UC0L 5B4MC 5EULV 1RZJL 4J23A 1A4JB 1Z9LA 1WVZA 2OKMA 1SVZA 3ZGIA 1GW0A 4XPHL 3UDWC 2FJFA 5I76B 2GK2A 3WAKA 3UAEA 4AUJA 3RX7A 3BLPX 3QEGH 4HT1L 4P2YA 3QUXA 2WBJC 5KVMC 1L6ZA 1A7QL 1E8WA 1V8HA 1G1YA 1JGVL 2Z31B 5IQMA 1XIWD 2DLIA 3VQ1C 3RZCA 3FO0L 3D0LB 1YN7A 5DI8B 1MREH 1RJZA 2VXTL 3V95A 2VIRA 3HC3H 2IWEA 3P0GB 2HRHA 1AQKL 3PPSA 1U8NA 1YN6B 2I85A 1N70A 1R5VB 4ZS7L 1JHTB 2XWTB 2AQ2A 3MC0A 3O3AB 1DE4A 2H41A 4XNUH 2DIEA 5HVGB 4XWOD 3V0EA 4YXKL 2JNZA 1P4LA 4WWOA 1MIML 2DLHA 5MEOA 4FQQB 1U92A 3DBXB 2HJFB 2WQRA 2CO3A 3BSZH 4MRBA 3W5NA 2NTFA 4TTGA 4Y16B 4PRPE 4MJ5A 2UYLA 3NTCH 4X4ZA 4WV1B 5KAQF 1T22A 2A99A 1HE7A 4IU3B 5CBEA 1BZ8A 5AVQB 4OV5A 3VWKC 1KT2B 3RAJH 1B0IA 1M57B 5DMYA 4PJFE 5MHSD 4YDIH 2KBGA 4FGMA 2VW4A 3L08A 3MRLB 2A6JA 2WLIB 1XGRA 2IANA 1KLUA 2ZYHA 3GMLB 5ACMA 1NGQH 3UMTA 1ROWA 4Y9BA 2BDNL 4O5LL 1JCVA 1P5UC 2FQFA 4L4TD 3MLUH 3DX0A 5I17B 2NY3C 5HHXH 1U6AL 3X17A 4XP6L 5IMLA 1WFTA 3AG1B 4AEHL 3FU0A 4FQCH 4N8VA 5DS2A 1JPFA 4LSQH 3BVXA 3D9AL 4G8AC 1H3XA 1ETZB 1S9VA 3JWOL 1YMMD 4HEPG 5D7JC 5F6HJ 1FG2A 4G3YL 1IGMH 4HJ0D 4RESB 1K5NB 4BDVA 2GTQA 5GRYA 1AHWB 3QIUB 3EIFA 3W11D 3WFBL 2C7UA 4A66A 2IGFL 3NCMA 3NSDA 4JM4H 4EN2A 5F7HA 3EXLA 1JXGA 2AEQH 1KBGL 3BUYB 4OF8A 5HHNA 5JHDA 4CJ0A 4FMFA 5JW4N 5IIEB 2YFOA 2XN2A 1E27B 4M48H 2HMIC 4YUEL 1Z9SA 5KYYB 4OCWH 4N8UA 1RZ8B 4RMSA 1ROCA 2HLFD 4FQLH 4E5XA 2VDRB 3UBXI 1QEXA 1E4WL 4NO0B 1GKOA 1GMIA 5DUPL 4RSVA 4ONGL 2X2YA 4Q4IA 3VWJD 5AL8A 4DESA 5D7LB 4XTRD 1NBZB 1A1NB 1F1AA 2YEZA 4N0YL 1JGLL 3O6KL 4DZ8A 4I1PA 3HB3B 4LLDB 4UT9H 5CLTA 4XB7A 1BD2D 3FL7A 2NXYD 2FUQA 3P9MB 1AGDB 4PYGA 1E4XH 3DIVA 3QQ9D 4TQEH 4CU6A 1CGVA 2Y7NA 3L3KB 3LN9A 1MI5B 5E9DB 2UZIL 4W6YB 3I6GB 4EQ2A 2UZYA 2YWYA 4WW2C 5JDSB 2W9DL 1FNGB 3WFHA 4QHLA 3EFDL 3T4AC 4GXVL 4H25B 3J27A 4ZPVB 5DRWA 2RA1A 3OGCA 2EC8A 4FFWC 4UBDC 1IAKB 3IETA 5CEZE 3ARGA 2FJHA 5I6XC 2DZEA 4NRXA 2WYHA 3B37A 3KPNA 1EPFA 1PTZA 1E5CA 2O6DA 4LCWB 4QRRE 2MRYA 4LLQB 1GMEA 3TBSA 1E42A 3WMSA 1J9TA 1GZQB 5B38G 2DWDB 4ZQTA 1T7WA 4QT5B 4ZFGL 4JQIL 3HFML 2X7LB 4JRXA 3US9A 3EFFB 3EO0B 3L3OC 1OGTB 4QRAA 2YEQA 5F1IA 4GG8A 5EO0B 4NKOB 1M05B 2VM9A 5EUOF 1U41A 4AYBA 5T1DL 1HH6A 5I5JA 5D72H 3OJDB 3IFPA 3QJSB 1HHHA 1AGEB 1WBXA 3AAZB 3ZE2B 5JPMC 3CVIH 1G1CA 4LDOB 5DHYA 4WU7B 4BA8A 3AGVA 5B39G 3SZKC 3QPQD 3PDOB 4HWBL 3NFNA 1LEIB 3HS0C 2N7AA 4LZKA 4FTVD 3DRTB 2YPLD 4L9DA 3QHZL 1TU2A 3A22A 5DFAA 4HX1A 5E00A 2WZAA 2ZSWB 3QI9B 1LNUA 2Z9TA 3ZYOA 1IAIL 1HHIA 4GIPD 2YUWA 1O0VA 2YBRA 3E38A 2CMRL 1X5LA 3P0YL 4G42B 4YC2C 5LO7A 3UGEA 1L9PA 4HCRL 4K3JH 1MCLA 5FB8A 2G4GA 4JDZB 4P46C 3O11A 5DD5H 5F7LB 3T2QA 3FFCD 3STLA 1ZTXL 5J6GA 3J7HA 1RZGA 4X0KA 5F9WC 2OL3L 4A7TA 4QRQB 3TYGH 1WUNT 4NNXB 2CM5A 4OZIF 1CFVH 2KHAA 1UM5H 3OAYH 3OHXA 5AW6B 1M2VB 5D8JH 3QYCA 2R56H 3S35L 3ZMNA 3WTSA 4JFDB 5HHQA 3T0DA 4D9QE 2P52A 1R24A 4LE8A 4PV9B 2OA9A 1KGXA 5DHMC 3O2WH 4K7PH 2WXMA 3OR6A 5KN5A 3BIAX 4Y19E 2J88H 5FOJA 2BIIA 2FIKA 3BZFB 5C97A 4GBXB 3D39B 1QNIA 4YZWA 2EXTA 5EC1A 4GQ9H 1XGZA 4PJAE 2PCPB 1CR9H 4IEFA 4BFIB 3JV6B 3U2SB 1MUJB 4OU3A 1TO4A 3NAAL 4N2KA 3V9CA 3VA6A 5DMIL 3BLKA 5BXFB 4ICWA 5AOZA 1DCLA 5BRZB 4HOXA 5CJQH 4NC0B 3DX8B 1NC2A 4MVBC 3VFTB 5I19L 2Z35B 4ZXBB 5F9OL 3O8XB 4X5RA 1IEBA 3QS2A 4JR9L 1URIA 5DJZB 4Z7WF 1I1CA 5D7KE 3B2VL 4P5TB 1U8PB 4OD3L 3QJUB 1BXXA 4MRCA 2CKBB 4ALAC 1OE1A 1YDPA 4K9EL 5DQDH 2HH0L 5ANMB 1Z3GH 1LO0L 1U8LA 2HFFA 3S2CA 1E6JH 5BOPA 4YHKL 3MOBH 1AXSB 1A02N 5HGHB 2V17L 4HIEA 2XV6B 4I9XA 3BPLC 2I24N 4UAHA 2NCEA 4H8HA 5ESAA 1W9XA 3HHRB 4QJ5B 3H7LA 3QJXA 3WJMA 3PIQB 3EJZD 2ZCLL 4NUJB 4ORGB 4Y4FC 1MJJA 3O2DA 3LKQB 1NFKA 1SJEB 2DW5A 4NJAH 3B9DA 3SY0A 1MHEB 2BNQE 2BRQA 2L04A 3MV7D 1TJMA 1PDKB 1UA7A 1A1OA 5SWSA 1EHNA 1NEPA 4G80A 2QQKH 4ZOBA 3H4HA 2H5UA 4JO1H 1HWWA 5KVDL 4XZUA 2WHVA 1JNLH 4WGVB 4KNSA 4OLZH 4W9CC 1IM9D 2QPFA 3BKJL 1YQ2A 2K9UA 4E9SA 1T1WB 1KCSL 2P8LB 2QPSA 3RTQA 4CN1A 3DXAA 2OTUB 1J88A 1XBDA 1T89C 1IC4L 1L7IL 3B2XA 3CLFL 3QZNA 4OJDH 4DKEL 3MKKA 5E1AB 4WQOA 2QTVA 4IBSA 1FUNA 1RJYB 4FEMA 4LL1A 3BZEA 1DLHA 3RFZB 3GSXA 5JW5A 4G11A 1AKJD 3I9AA 4TSBH 1F58L 3EYSL 2VDKL 4FXGB 2B59A 1ZA6A 4GSQA 5J6SA 3MRNA 5J11C 1RULH 1QWNA 4FULA 3CMOH 2GW5A 2WY3B 1I7ZB 2HX8A 1B0GB 2YLKA 3P4MA 3WSQH 1MEXL 2WVVA 2EXWD 2CDGB 5CAYB 3C2AH 2J7LA 3UEZA 2G5BB 4AJYV 3SOBL 3MDJA 1RIUL 5HYJE 3B56A 4PRPB 4OJCA 3OMZA 1PG7H 1R3HB 5BVJA 2G5RA 1LO4H 2WUCH 1G7MB 3HE6C 2QSTA 4PJFB 5HYFA 4XPAH 1W6LA 5JLZA 3MJ9H 3RKPA 4XNXH 2GCYB 4X6DF 1J0JA 3L5JA 4C54A 2O1AA 5AVVB 3SE4A 1RIVL 4OZGF 4M8QB 3FN0L 5G55A 4IHOA 2V33A 1ZVYA 2H1PL 3WD5L 2XA3A 4UINL 3B7SA 3QXAB 4LHUA 4OLVL 4AGLA 1NCAL 2OP4L 2QPDB 2Y06L 3U4KA 3FTSA 4NWUH 2ICEA 5F44A 3UYPB 1NMBH 1UJ3A 4ZZFA 4UTAA 3QZWG 2WKOF 4PCYA 3APFA 1DJYA 5KYWB 2E3VA 3V0HA 2C9QA 1A4CA 1XL6A 5I1AA 3H9SA 1DVZA 4QRPE 5IREA 1PQZA 2K6YA 3EJSA 2PMZA 4YVNA 2X4QA 3K5RA 1SXAA 2CU9A 3Q5TA 4FXLA 2XJKA 1TETH 4JHVA 3RWIA 5E2TL 2FBJL 2Z0UA 3HZVA 3MX0B 4CVZB 3PABB 4WUKH 4F9PC 3NYKA 4AM0B 1F3RB 5IMKB 2NXZD 4AG4L 3FBQA 4L8BA 4QHKI 3JWDC 1IC5L 1XH1A 1SDDA 1T66C 2ED7A 1EZVX 1F2QA 2ZWZA 3GLAA 4UTBH 3FPXA 4WGKA 3O6LL 2P5EE 2Y69B 4X5WB 3DURA 5ERWA 1AD9B 2F1AA 1DP0A 5K1VA 5LQBH 5LB1A 1LM8V 5F0JB 2JKRM 2Y7QB 4YL9A 1CE1H 1YNTF 2EEAA 2NY0D 1AJ7H 4TULL 1UT1A 2AXWA 1CPUA 3GMNA 1C5CH 4MNQE 4YHMH 4PGCB 2AQTA 3QXTA 4DK3A 4F57L 3U79A 2C1OB 5GS1B 3DX6A 1S7RB 2ZWYA 4N2MA 4K94H 1NSNL 2HRPH 3CD4A 3DRQB 4JCLA 2P24A 1XIWA 1GVIA 4IRSB 4MA1B 4GOSA 5GJSL 3DX2A 5FDYA 3UTTD 2IDFA 1TCRB 2Y72A 2EDOA 1M2OA 5IQ9B 1MY5A 3R18A 3KW8A 2A74A 4LPWA 3PQYD 1JGEA 3ES6B 2BCMA 3CDGA 3GNML 4OFKA 3TH2T 1G9EA 4QRRB 5EWIL 5FYKE 4JFFD 1YUHB 3L3JB 2DH3A 1HSAB 4LLMA 3LKOB 1ZMYA 1RSYA 3PP4L 1A7RL 4IJTA 3IJ9A 1JXJA 4M5ZH 4KX7A 2H3KA 5K9JL 2VZUA 3C9NB 5E51A 2B4CC 2OMTB 1YC8A 3QUMA 4I0KA 1IKNA 3KPOA 2JJUA 3GKWH 2XN9D 5IK3B 3QULB 2VLKD 4ZTOH 5ESQB 3L45A 3VJ6A 5I1KH 3MODL 4DPRA 4WWKC 1K4CB 1F11B 3EHBB 3B8SA 3X11A 3L1OH 4LARL 1FFOA 3DJTA 5JXAH 2W07B 1P7KA 2ADIB 1NM4A 1AZNA 4NZRL 2E75C 3RPKA 3P73A 1BBDH 4RMBA 5JOFB 4FI6A 2VLRE 4DPCX 4B27A 2FO4A 2D7TL 3D48R 1X5HA 4L4TA 3TCTA 2NY4B 2BVPB 4YVUA 4KJWD 5EIQA 2PR4H 3FHEA 4NSKB 3QDJE 1NPNA 2PTTB 4XO3A 2D31B 2J5LC 3TN0C 3NFPA 3QPKA 4K8RD 1D5BA 1N4XL 2QZ5A 3VFGL 1D9KC 4O9HL 2XY2A 3GLDA 4PG9B 3BXNB 1WFOA 3QUZB 2W0LA 3N40P 1K6QH 5DFVC 3ZYZA 4UIKL 3CVCA 3L2LA 5H2BB 1WAPA 1YMMA 4X9IA 4N2GA 1GPOH 5H37H 3CIAA 3PWNA 4EVNB 3VI4F 1R5IA 4LMQI 3H3KA 3T5WA 4CJ1A 4PRNA 4OV6F 2W80C 3ILPA 2VCOA 4F5CA 2XWDA 4PWHA 2MQCA 3KPLA 1MJ7L 1RZIA 4JZJB 43C9A 4PJXF 3RWJA 4DQOH 2K4WA 5D7EA 2DQJL 4XAKE 3SO5A 1JVOA 5B3JF 5I71B 5JIIA 3MV8A 2I27N 2NY6B 3JVGC 2CNZA 4P2CG 4RZKA 4BSVB 3QR1A 5INCB 3T8MA 3ZR6A 4S2SA 1Z32X 3VWJA 2DL2A 5AB1A 3AS0A 5F88B 3UO1L 4DK5A 3ZL4H 4P2QD 1ZIBA 4Y19B 1JWMA 5LN8A 4BH8B 5JW3L 5TDPB 4HKBB 1H8NA 2F61A 3KPQB 4EN3C 2B9AA 1BD2A 5KZCD 1H0DA 2WWMC 3RDJA 4PJAB 5IKCB 1D6EB 1S7UA 5IBUG 3IGFA 1UWGH 3APCA 2R27A 3KYAA 4DH2A 4DJMA 4U0RC 2EVFA 3SODB 1M7IB 3W0WA 4MZRA 3BGMB 2X4RB 1IGFH 2KS0A 5HDQL 3VFWB 1J0HA 5JO5B 3IF1B 3CSYB 4ZODA 1CFSB 4LOEA 1DJSA 1FO0H 2DJUA 4JPKL 2DM2A 2EH8L 1CI5A 3HE7D 4C83B 2CIKA 1U36A 3OKNB 1JGUL 3RBSA 4P06A 4OJYA 3VXRE 1Z6JT 3U0WL 2PO6B 4G7QB 3EOAB 2IGLA 3MV9E 3SE9L 4PBXA 5DD0H 1LWJA 3QUYB 1X5XA 3GF8A 1DVUA 2ODIA 4O02B 2PWHA 2QHRH 4HJTA 2JVUA 4LSDA 5LCVA 2WBKA 4TQ8A 3REWB 4QNPF 1U33A 2DQDL 3MRMA 2AJVL 3GSNA 4YLQT 5AYUL 3UPCA 2DQEL 3D06A 3MLTA 3FQ1A 1D7CA 1U3YA 4HDIB 2VDRL 5FYJD 4JFHD 3VGFA 4M7JH 4N6RA 4AQAB 5JHBA 1N0XH 1FYTE 5CIPH 5EPMB 3TJHC 1B9KA 2EE0A 1LP9F 1AD0B 1P84K 1KYAA 1UURA 4MNHB 3QDGD 1XGUB 2BNQB 3CH1B 4JKPH 3D1MC 3ABZA 2ENJA 3O4OC 3AABA 4PJ8D 4ZZKA 3Q8BA 2CCWA 5TK2A 1GZPB 2V9TA 4NFDA 3EJYD 1H6TA 4N0FA 3ARVA 4FTVA 2YPLA 3QNXB 4ZDHA 4JKNA 1GC1C 5HI3D 1L9OA 3QAQA 1TCMA 3OAUL 4F8QA 3PWUA 4BYHA 2ZP8A 3DETD 4WW2F 4BHUI 4U6YB 4C4KO 1OZUA 4O51A 4D7BA 3NJIA 1FAIL 4NENA 4TNVK 2UY7A 5FAAA 2PP9A 1MZYA 5IHWA 1R3LA 4W9JC 3DK2A 5B7MA 5DEFB 1Q8MA 4H5SA 4OIIH 3FFCA 3LEXA 5JOEA 5DJAA 5D4QA 4H0IA 5I2IA 2Y1AA 4ZMQA 4LEXL 1T7YA 2P5WE 3LZPA 2A6KB 4UZSA 4XMKH 4XP5H 1QASA 5HYJB 4PI2A 1F4XL 1VFBA 1YY9C 3CFNA 4XX1E 5SV4A 2OPCA 3LIZH 2OMVA 4XP4L 1EZLA 2F1EA 3RLSA 2DLGA 3GLEA 4PJIE 1MZZA 1JNNL 1TQWA 2FYYA 2EINB 4MXVE 1P6WA 3LNIA 4GT7A 5HGAA 4XHQA 4HJIA 5KS9E 3ML9A 1J10A 4GAJH 5ICZA 4J3TA 2YK1H 2XWJA 3W57A 4YSRA 1R3JA 5FYLE 1HOEA 4XNYL 3F6JA 2VH5L 4LP5A 5FF6A 1BPLB 4HOWA 2AJUH 3MLYL 4Q97A 1FZMA 2PTUA 1T5WA 4F1SA 3NFSL 4N8CL 5T33H 2ATPA 5JHLL 5L88H 1JUFA 2VDPL 2XWEA 4KRPC 3OKYA 4JO2H 2ESVE 4CSSA 3TBVA 4POYA 1DYZA 1MAMH 4P3WA 4PP1C 4IRZA 1WC7B 5KVGH 2OCFD 4P04A 4WZ9A 3VFMB 3GRWL 1BVOA 5ISZD 2GSGA 1S6NA 3MCYA 4KZEH 4ENEC 4QRPB 3D18A 4M62H 5HDRA 3TEUA 1J5OL 4AGQA 5HSFA 3CDZB 5GGRY 3CZEA 1UWYA 2I7SA 4RGOH 3B8YA 4NC2B 3S88L 3CHSA 4K55A 1DDHA 3U4EB 3JUYA 4CC1A 2CNYA 2JKWA 1NLBH 4L8SB 3PJSB 3HKFA 2BSTB 4J3OC 4R0LC 3L4VA 1EFQA 1IGIL 5CINH 5GGTL 3JWOC 2B1HL 4HYTB 4BELD 1T6VN 2XWXA 1UT2A 3MRKB 1WIPA 4HPOL 5GGRB 3VUAA 2P5EB 1BREA 3V5HB 3MCG1 2MCMA 2F5BL 3TVMD 3SGEI 2ZUVA 3S3PA 1AGBB 4G8GD 4HGKC 3IU3B 1EX0A 4UM9A 1QBBA 3UPRA 2DLTA 3PHSA 4AGPA 3M86A 1KIUB 3HHSB 4MNQB 3RDTB 2I9TA 1AY1L 5AKSA 1OTUC 4P57A 5B1JA 2UV3A 1IM9A 4OBRA 4L8DA 1FE8L 2IO5A 3LPGA 3OD3A 4Z5RA 5A16A 3WL9A 1C5BH 1E7UA 9CGTA 1P7QD 5JUEH 4FNQA 1ZT4B 3IMTA 1TTGA 1AKPA 1DANU 3BPOB 3FZUC 4UOZA 3ME0A 5I6LA 2CQVA 1CLZL 2CKBL 5CLZA 1W0VA 2R0KH 5B7FA 5EOTB 4XC3L 2XTJC 3FTXA 1M7UA 2FO1A 4MXWH 4KWUA 3BGFC 1OE3A 2PCFA 4LU5H 3WJJC 5FK9B 3KBHE 2H47C 4YPJA 5FA3B 4YBLC 3MLXL 2QQLL 4U3SA 3RVXC 3MXVH 2BWIA 1OF2A 1ZHKB 4IKNA 4CSTA 4XE5B 4AQEA 5I30L 3FT2B 4PTUB 2AXFB 1T0MB 3ULAB 2CJUH 1JIBA 1IC7H 4WHTB 4B9CA 4LPUA 5DQ9A 4N22A 2XI9A 4B9PA 2P8MA 1HQRB 1KBVA 4MD4A 4JLRB 1YMHB 2JKIS 3FBKA 4RAVB 3TBYA 1MFCH 3IJSA 3RL2B 1PCXA 1OANA 4WTXA 4YHYB 1NOAA 3DPBA 5JZ7C 2VLRB 3W37A 3PFUA 4Z8FL 5C0BD 6FABH 3ECQA 4MJIE 4PVMA 3WNLA 2LLNA 2WNGA 3FJTA 3QDJB 1S7SA 2K78A 5DWUL 2DEYX 3F62A 4HK3J 1XAKA 3IFOA 4KY1L 3BJLA 1YZZA 2G3XA 2X9ZA 4PS4H 1VIWA 1T04B 7FABH 4YSQA 4QOKA 3QQXA 5DJ2B 1MCDA 2X70A 1PVHA 4DPBX 1OXYA 1UOVA 3US0A 4L9LC 4MA7L 3TL5A 5GRXG 5I16B 2O5XH 1DQLL 4JO4L 4N2IA 4F58L 1J11A 5AZEH 3MTXA 3BUDA 1AQDB 5IFHH 1MN4A 3Q43A 3QA3B 4F2FA 3O3EA 1QW8A 1QUPA 4UAOC 4TNFA 4QO1A 4ZD3H 1PZUB 1N8ZB 1H6UA 3H3PL 3ULSB 2JLLA 1U3HC 1FLTX 1ZLEA 4ZOEA 3CC5B 2WZPD 1S7VA 4XP1H 3M6DA 4E9YA 4X83A 2V6HA 2HFGH 3PAYA 4OCSL 3TV3H 4CN6A 3PNRB 4AKOA 4PW4A 3S0PA 2FBOJ 4GXFA 3CVHL 3ZT7A 4BFOA 3I9GL 5FUCE 4B9JA 1GIGH 1HL8A 3GI8H 5I8KH 3VFOB 4WNQA 5I6OA 4YX2H 4AQ1B 4DO6A 1D2OA 3TFKD 4BKTC 3C8KA 4L0PB 4UQ9A 4PRID 5D2NA 3VE0A 1UXMA 3RWFA 1D6VH 2AJ3B 2CO2A 2PW1B 5DJ6B 4B9YA 4OI9A 1PCSA 5IVXE 4RDQG 4ICXA 5DHEA 2W9LA 5ITFA 3PV7A 3RHWF 5IMOB 3GIVB 4KK8D 2QDVA 1NFIB 1HN1A 3UTTA 4ZS6C 2YAHA 3VXRB 1C1EH 3LRGA 4LVOB 2EIDA 4FFVD 3PQYA 3MV9B 2Z7WA 3RY5A 3SDXE 1H9DA 2APTA 2R69A 3MACH 5FGBA 1EO5A 2AV7B 2PUQT 3C6LC 2GBAA 4JFFA 7PCYA 4JAMB 5GRJL 4MA3B 1T2XA 2VDLH 1BVLA 5L7XH 4OCRH 4JFWA 4IGBD 4WJG3 4A7SA 4ODSL 2ZAHA 4J8RB 4PV8A 3ZTCC 3GMRB 3U7WH 2EH7L 3Q6FB 4K9EC 1HXMB 2A9AA 2C9PA 3ESVF 4YLBA 3RVVD 2XN9A 1N19A 3DSNB 1FYTB 5CCKL 2E46A 1XCTA 2VLKA 3MKGA 2CLZA 4YO0B 1QFUL 1E67A 4OJFH 4KAQL 2P3YA 2J8UF 3DGDA 3ZKQD 2AHIA 4XWGL 2EIBA 4FNLL 5DC0A 3U7AA 1GOFA 4TYUA 2BHZA 4PJEF 3SOTA 2Q2LA 1GAFL 1T7XA 4EBQL 5B4MD 2WJ5A 4A2FA 1CU4H 4ADJA 1Y1DA 1UZ8A 1WA2X 2R0LH 3I6LD 4OIBA 4GH7B 2BC4A 2LFEA 3HVNA 2Z7YA 3IDYC 1KPUA 4I2XE 5FUZH 3KPTA 5CEZL 3BVDB 4BKLB 1NH6A 3T6VA 1SJHA 2WINB 3P0VL 4KBPA 2WBJD 4L2YA 1C12B 3CE1A 5F7DB 1FV1B 1YEEH 1VSCA 3GMPB 5DZJA 4XBGB 2NUTA 3NESA 5L9DH 1QACA 2FH6A 1BJ8A 2UY6A 3WKML 1EO8H 1TPXB 4NO3B 3EYFA 2WIIA 1AS8A 1N0LB 1DQTA 2XSKA 3N9GL 1EZSA 2E4TA 1HEHC 3L5XL 5EBLA 1GCFA 3CXDH 4G6MH 2R9HD 1EGJL 4PWEA 3WFZA 2P5WB 1XF2B 4I13B 4Y5YA 1TQVA 4XBEH 2OTWA 2PXYC 3DIDA 4N8VG 3SPHA 4EE2A 4L3CB 4TLSA 1KJMA 2ADJB 2VKWA 5ESVB 1RLWA 5CLYA 5K59E 3N1FC 3HFFA 1XB3A 3IJEA 4PJIB 5DYFA 1I1FA 1PG7W 5DSCA 3UGUA 4P2QA 1KEML 3IFLL 4MMXA 1ZLDA 3TYFB 1E9PB 2CK0H 1KN2H 5KS9B 3MUGA 3VWKD 4L1BA 4AITA 2YGQA 5EZIL 2K7PA 4YHLH 2KZBA 4RFEB 3M1BA 1UWXK 2EVHA 3U2IA 1HDMA 1M7DA 3QQNA 4EEEA 4RFOH 5J3HC 2C9VA 4XMVA 5I5MA 1BFOA 4E5XG 3R0NA 3KH3A 4Z77A 2NY3D 4K3EL 4PIBA 2Q3ZA 5AZUA 3HE7A 2ZCHL 2ESVB 3LN4A 3LVTA 4FQ1H 3PWVA 4BHUA 1TQSA 5C8JA 1XH3B 1Q0XL 4P23B 3II1A 5AZ2H 4AEIH 3CTTA 4PJBE 2QL1A 4AYGA 4S1SL 3WTUA 4Q58C 3MUZ1 3UBGA 1W6WA 2ZF9A 5LXVA 2KQNA 1NIDA 3I3BA 4P5KB 5D7JD 3ZKMC 3AMKA 3MXWH 4PP2A 4QXTA 5GISL 1BW8A 3GWJA 4Y0GA 2DWXA 2KMWA 2VLLA 2J55A 5EUOA 5DD6B 3HI1B 5FO7B 3RA7L 5AOKA 4KX9A 1QUNA 1KGJA 4Y2DC 1OWWA 2B16A 2C3GA 5AOMA 2HMID 2N0KA 3WN5C 3U6RB 3POCA 3NSFA 1I8LA 2DWSA 2ZUQB 2BHFA 5EUKB 2UZXB 3QDGA 2K7QA 2O5YL 1NEUA 4HWNA 5I8EB 4EKXA 2YUZA 4U1LB 4NO5A 4PJ8A 3TIEA 4F80A 2HN7A 5ADOH 1DVXA 1D5MA 4RX4D 3C08H 5DJYA 3FB7A 4FQHB 5F0PB 3V8OA 3K6DA 1SZNA 4KK6C 5IVNA 1QVOA 3MCLL 1JMZA 3IGKA 3BJ91 4L4JA 1PD0A 3IJ7A 4UUJA 2AEPH 2JB6A 3K0WA 4DGIL 3QRLA 5F9JB 2X88A 3HBZA 3FB8B 4O58L 1RK0A 1Z5LA 2HG5A 3RWCB 4D0CB 2ZXGA 4FFWD 4UBDD 2IAMC 3VU2A 3NH7H 1KV7A 3K3QA 5HXMA 3GMMB 3D25A 4GMSL 4JREC 1I3GH 3PWPA 5C86A 5L2JA 1IILE 1OAUL 2DYPB 4TSCH 1UFUA 3MA7A 1NFDF 1KLGB 2HTKC 1G0XA 3GINA 1EUTA 3EH5B 5HGGS 3VGAC 3X3GH 1RIHH 1NAML 3MNWA 3NCYS 5E99H 4OZIA 2Y1VA 4YHIA 3MREA 4GXUM 3SJVD 1KCVH 3FU7B 2OW6A 1IBHA 1QWHA 5AWNH 4AZ8B 4UCFA 2OZ4A 1MLBA 1SMOA 5HHOD 3ZTDC 1AOZA 5I8OH 2TAAA 2CPUA 2FVNA 2CRMA 2C4FU 1PAZA 3BC9A 3PRZA 3ZUNC 2BSRA 1FNSH 5F6HI 5DUJA 3KYOB 4Y9FA 4N86A 3F7VB 2D9QB 3GRGA 1CDGA 4MJIB 2XA8H 5I1IH 5ADPH 4NHUA 5E9AA 3DSFH 4I48B 3ZZ1A 1MW3A 3FOMA 3DK0A 1QLRB 4BCYA 2DBLH 1UUNA 3G6DH 3SEPA 4ZI8A 2EUXA 4PWIA 3NIFE 1FFPB 2EDRA 4Z7WA 2XZAH 3EYQC 4Z9KB 3ROLB 2EDDA 3B3BA 3OXRB 2EE6A 3CZKA 5D93B 4ZFZB 4PGZA 2XYCA 5DTFA 2B1AH 3SGJA 4G59C 5ISZA 2AF2A 2VAAA 4Y1AD 5LBSH 2F53A 3JXAA 1BVKA 1VEOA 1P5VB 2WZ5A 2Z31C 1ZIAA 4V33A 4Z7UE 2VXQL 1I7UB 4P46D 3VD1A 4XNBA 4UF7C 1PYWB 4Q9BA 2MOVA 3IDGB 3U36A 5JMRA 2RTTA 3D69B 4AGMA 4GSUA 3DTDA 4K5PA 3BCDA 1GZHC 3K2UL 3TT1H 3CFIC 2ZOWA 2K4AA 3PP3K 4ZX5A 1I9EA 3LKRB 1AGCB 2OMYA 3FT9A 4DP2X 3MROA 2DQIL 4P48A 2H4EA 3QRGH 5EEXA 2JLPA 4MASA 3S34L 3TVMA 2VR6A 1Q9LA 4XN4A 4G8GA 3MUJA 1H15A 4GKSB 1ORQA 4HHGA 1S7QA 2PTVA 3HRZA 5I15L 3TOPA 2HAZA 4JRYE 4Y16C 3T8XB 3NACL 2XWBA 4WV1C 3QPXL 1GJIA 4FABH 1HH9B 1QBMH 3WENA 2WXNA 3HC2A 4Z7IA 1O5DT 3WIHA 3DGCR 4PJCE 2UZPA 1L7TL 4U3XA 1DUZB 1JD7A 1NZRA 4M7LH 5IVXB 4Q6IA 4WW1B 4NZDA 1P7QA 3KH4A 1RHHA 4FQ2L 3TF4A 4L1LA 3WDHA 3G5VA 5JPNB 4MVBD 3T2NH 3ISYA 1VA9A 1CDHA 3SDXB 1OAXL 2WW8A 3R06B 4GG6F 1ET7A 3X13A 1OAJA 4KU1A 2XFGB 4TV3A 2J43A 4WKZA 1OW0A 2WXGA 2O26U 1Z0NA 3VD0A 4L1SA 5EZJA 2X4UB 2D7MA 1Q9WB 4FQPA 4KVNL 3SPIA 4K7PY 5L4MA 2XC8A 1ILUA 1H3TA 3E9UA 3FRPA 4J3OF 3O0RH 2O5NA 5DURB 3HKZA 1AHWC 1T2JA 3QIUC 5FWRA 4KZDL 4YNYA 1OCWH 4GRLB 3NZ8B 1JGDA 3DX3A 3QJHB 2QPEB 1OQOA 3P2BA 4HH9A 3ULUE 4FRWA 4Y4FD 4NM8L 4AQZA 2IPTH 3DYPA 5HYSA 3UO8B 4TQHA 4Z0XA 3L9RA 4X6DA 1F3JB 1CK0L 5KSAC 4W9EC 4I88A 1V3MA 3BDYH 1MWAH 2D3LA 4OZGA 4JG0H 4HAGA 3EZ8A 5TQ0L 5CKAA 2YD2A 3BWUC 1CFTB 3VXME 2Z4TA 4EDWL 5LVEA 1M9SA 3HB3C 1N10A 2V7HA 1SY6A 1KELH 4J1UB 4I2XB 4PV1C 3MMEB 1DJWA 2ATKA 3KW7A 3VB9A 1OKEA 2X89D 1CWVA 4XMTA 5D1QA 2ZKHL 1GGYA 4MJ4A 5E8DL 3T0EA 3MBWA 1UFGA 2WKOA 4ERSL 3HMXA 4AOFA 4ABQA 4BFEA 3N06B 1OK0A 4HPYL 1V3LA 2Q20A 1SQMA 4NJ9L 5D6DA 2OQJA 3D8MA 4MB3A 3BP6B 3D33A 1CDUA 1M4KA 3X12B 1ZSDB 3JV0A 3P4OA 4XN7A 1JN6B 2WSDA 4E41D 3KZ8A 4DP5X 1MNUH 3L7FB 2ICES 3DO4A 4U1HB 1XZ0A 1IKFH 3PXJA 4ELKB 4EUPA 2KZ1B 2WZPA 2P44B 4KNUA 3U83A 1H6FA 1FL6A 4GW4A 3GXIA 4V2BA 3MBEB 5GS0H 1RPKA 1I9JH 1U8OA 3H6JA 5J7CC 3I9PA 3QUMH 4P99A 12E8L 1E4KC 1W72A 2VKXA 3O2VH 3QHFH 4JE4B 3DUSA 4U1NA 3RX5A 3ZSTA 1DVQA 1RD6A 1QYGL 1XH0A 4B7LA 3ZK0A 1WPCA 3HE6D 1TLMA 1YNTA 1J5IA 2EDQA 1QRKA 1CDCA 4P2OC 3V4PH 3WFDL 4LQFL 1C5DA 4YDMA 1WZAA 4TL4A 2AI0H 4PU2A 3S35X 4LCCB 1P1ZB 1SHWA 3FSZA 4LSVH 3IDIA 3AMLA 2FT7A 3BIKB 2AXHA 3MV01 3RZWA 3W39A 4EI6A 1UWXH 3LKNA 4Y5VB 4ZW8A 2GAZA 3FQ4A 1CG9B 4LFHD 1YJDL 2Q87A 4Z78A 4QYAA 4U1IB 4PJBB 4JGUA 1G6RL 5JOPD 3EJPA 5GRUL 5D4HA 3QI9C 4PFEA 3OGOE 4PRDA 2AGJL 1W15A 4WTZA 3VD3A 4IGBA 2G0KA 3L6FA 2JJTC 4FNUA 3BGAA 3NZUA 4FXTA 1BZ7B 3O4LD 1CT8A 4APQA 3TWCH 1O6SB 3AREB 4TSAL 1MG2C 4JX0A 2BM3A 5DS1A 1XGPA 3K4AA 4KHTH 3DOHA 5D9SB 1UJTA 2CCVA 3HHMA 4M61B 1T66D 3CFDA 4YSUA 1J05A 1WWBX 4JHBA 3WY3A 4HOMA 3VXTA 1J7VR 5A2AA 1FCCA 4KZ0A 5DHVH 4RMWA 1BAFH 4I89A 1AR2A 3E80A 1S9XB 3ZRCC 4RISH 2COQA 5DDHB 1EQWA 4U1GB 1KY6A 2HVBA 4CC4A 4QTIH 1QQDA 4OCMC 4PM1A 2G3NA 3UDWA 3KYMB 3LRKA 2D03H 4GBXC 4OCXH 4XN5A 5FR3A 2A3TA 1EHLH 1SBBA 4U1SB 1CLYH 4D9LH 3QJFA 2HFTA 3UBXG 1NGXB 1GGIH 2WBJA 1R4XA 3L3IB 2QSVA 1KTDA 1UT9A 3LQAC 3N42F 1M3IA 3RVUC 3MLVL 1ZS8B 3VI4A 4ONFH 1D5XB 4ZXBC 5IV2A 1OPGL 5KVGE 2CXGA 1UQSA 3GXUB 3O6FB 1I1AB 3D2UB 1IARB 4E9LA 2EIKB 2JCCE 2VQ1B 4G9DB 4Z3EA 4ZMYA 4PJXA 3UCQA 3K6SB 1KCBA 4F15B 3HUJF 5AKRA 1B9ZA 5CJOH 5CSZB 1F8TH 2ZXCA 3GSNH 1NTDA 4L4VD 4MA8L 5GHWH 1WEJL 3K91A 4FNTA 2OR9H 4UMGA 1IAOA 1XR8B 2AABH 2G60H 2VR8A 5E8EB 3QCUL 4NHCH 4X7CC 4DTGL 3N0AA 1AZCA 4BBWA 1FVDA 2Y5TA 5FA4A 5ILTH 2ALWA 4WWKD 4AENB 2H32A 3ZIMA 4P0DA 3VWKA 5FFLA 1JYNA 4FLQA 1S3KL 2Y2WA 5DRZB 3PYCA 2IH1A 4U1MB 4LNRB 2FWOB 2A9NH 3RY6C 4UT6A 3ZL2A 3N1GC 4MMYA 3FCSA 3WDJA 1YEHL 3LN5A 3EG9B 5CN2A 1A6AA 3T9WA 3TO2B 1AI1L 1I8AA 1S5HB 3MUHL 3RPIB 2ENYA 3WJLC 4AGOA 3ZT6A 1F86A 5HGBA 3JV4B 5AOLA 4B96A 2DKUA 3NIFB 2ZNWA 3FU3A 4IBVA 1VESA 3TN0D 5SX4I 2OV0A 1BFVH 3HZYB 1EZUA 1YPZE 3BX7C 1DBAH 3GK8H 3SBWC 5E94A 4GI8A 3OQ3B 2MHAA 5FO9B 5ENWB 3P3RA 1BZQK 2UWEE 1L5GB 5G4OA 3CHOA 4Q6KA 3PJLA 4Z7UB 3G5XA 3WEXB 3V6BR 3BQUA 2J1YA 2C9RA 3HPJA 2VXVH 5C6WH 3P9LB 5ICXB 2F5AL 3RFZC 3GHEH 3FT4B 5F70A 4MLIA 1Z9OA 4G6FD 2OW7A 4FXGC 2EACA 3KNBB 4XH2B 3VRIA 4QJ3B 1IM3A 3VI3E 2IPUG 1T7ZA 3KVPA 3MRQB 5IF0A 3UJIH 2ARJA 3AQYA 3U30B 3VXPB 5DD1H 2DM4A 1LP9A 2Z91B 3PP3H 2ICWJ 2NW2A 3C09B 4CKVX 1DN0A 5FYLL 5DYOB 5T1KD 4AIZA 4JRYB 3ULVH 4JQXC 3L3HB 2DS4A 1UWEH 4RX4A 4JZOA 3QWNA 1HKLH 4X9BA 2HXAA 2LU7A 4EN3D 4PJCB 2WWMD 4XNAA 3IXTA 1MF2H 1O5PA 2A83A 3HR5B 3I50L 1FF5A 5DK2B 3S48A 1OB1A 2ZYIA 1VZGA 5IFAH 1KJ3H 3QEGL 1XH2A 2GC7C 4PVNA 3BIBX 5E5RB 3CFKB 4WW2A 2QVIA 5E1GA 2VN4A 3CLWA 4M8VA 5IOKA 3KWTA 4I3SH 3GXPA 2WTRA 2YUXA 5BZWB 1B4RA 1I85C 2X28A 4GFTB 3QXWA 4PWFA 5SX5K 4OQTL 4Z95H 2B2XH 1MREL 1ZHBB 4IMLB 4H8VA 4KH2A 3HC3L 5IW1B 4CNIA 4OFPA 2NW3B 3MRDB 4FFZH 4J27A 3COOA 4NBZB 5D5ME 5IHZA 2XZQL 3HZMB 4XNUL 4LLYB 1U93A 4UYQA 4FZ8H 1CGUA 1WIOA 3DARA 2PN5A 3E1ZA 3IEAA 4MKMA 5FGSA 3I02B 2MPAL 4Z3FA 3IDJB 3BSZL 3L3OA 5CGYC 4PHZA 2P8PB 5HHOA 5CP7B 3GSOB 5CFAA 4RFNB 5HPMB 3NTCL 1BOYA 3MRBB 3WO4B 3ZLQC 4U1JA 2X4SA 3INUH 1N59B 3VVWA 1WGVA 4DN4H 1JF1A 1S8DB 1HC1A