2E56A

Crystal structure of human md-2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
EAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphocyte antigen 96
publication title Crystal structures of human MD-2 and its complex with antiendotoxic lipid IVa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e56A00
5IJCC 2Z65C 1KTJA 3RG1C 1NEPA 3B2DC 2HKAA 1XWVA 2F08A 3FXIC 3VQ1C 3MTXA 2E56A 3VQ2C 5KWYC 3ULAB 3WEAA 2E59A 5IJBC 3T6QC 2Z64C 5IJDC 1AHMA 3MU3A 4G8AC 1A9VA 1WRFA 3WEBA 3M7OA 1AHKA
chains in the Genus database with same CATH superfamily
3C5ZA 4K7FB 1B0GB 3RPIA 4KI1A 5F88A 2VDPB 2Z8SA 3DYOA 1M7XA 2WXRA 3UMTA 3W11D 1ZLWK 5HPOA 1F6FB 1X4XA 3RWDA 3FT2A 1P2CA 2CU9A 3BKJH 1YC8A 4U7MA 3BAKA 1IARB 1L6ZA 5GRWA 1Q9KA 2Y2YA 3DWTA 1XR8A 5JYLA 4YSOA 3BVUA 5HI3C 3DIDA 4XP9L 2R23A 2FVNA 4PV1C 3N91A 4G83A 2YMOA 1FYHB 2D0FA 2GBUA 3NZSA 5A3ID 2WWNA 3NAAL 3UBFA 2IANA 1IIIA 3MBEA 1GY1A 3RVTC 2C7FA 1IVTA 4JRYD 2JIXA 5I8OH 2EIJB 2APVA 1TZGL 3JTSB 3U6RB 2HKHH 2AJYH 1SJMA 2WYIA 4UDUA 4BFEA 5KYYA 4PVBA 1LO2L 3OGCA 1IT9H 1JOIA 4NN5B 5IQOA 3FUKA 1GGTA 4Z0BH 3BJ91 5F7UA 4M5SA 2AK4A 3MUJA 1P6FA 3MNZB 4DGYH 3OB0K 5CWSA 3QO0B 4LPVA 5MI0B 5C0GA 3SDXA 3HBPA 1DDTA 4HGWB 1MCOL 2IBBA 4K8RH 4XH2B 4FL4C 1AO7D 2DLFL 5EUKB 4LVEA 2GCYB 4TUKH 3B7YA 1CVRA 5TDOA 2HWZH 5DZPA 4APQB 1WDAA 4HF5H 1NFDE 1NMBL 5AYUL 2IXQB 1IC4H 2XT1B 2Y07H 1UM4H 1U8KA 3NCCB 4KUZH 4ABUA 3ESNA 2Q7NA 2N56A 3G5ZA 1E42A 3DMMD 3ZXAC 5C9JA 5J89A 1JTOA 1IM3B 1C5CL 3UH8A 5E7BA 3PWJB 4X7CC 1G6RH 5F7FA 3U9UA 1JK9B 2H32A 4RGOL 1U3HC 1IM9B 5I24A 1J05A 1RJLA 1JUFB 5FYKU 4IRJB 3QEQE 4KI5E 3DGDA 2J1ZA 3BZEA 3KLDA 4MSWA 4JLRB 5KVDL 4HCRL 3UCRA 3BGMB 2ATPA 2BIHA 3EJRA 5GRUL 4KX9A 3H9HB 3D9AL 2KKQA 4RRPM 3U0TA 1A14H 1WE5A 1RJCA 3UZQA 3AREB 4UM9D 4J6IA 1PEZA 2O6CA 2NY5C 4FG6D 4KRPC 5C07D 2WB7A 2D7TH 4PV8A 1C9SA 3MRKA 3SZKC 5DWUH 3A23A 3G6DH 4L8DA 1WZ1L 4XCCL 3SKJH 1I1CA 2DMBA 2Q10A 3WKNA 3FQYA 2ZG2A 3GQFA 4QRTB 4HH8A 3WTWA 3E9UA 4U1IB 1AXSB 4LHUA 4ZUSA 2W65A 1YAZA 2H1PL 4Y19B 3S4SG 1DBAL 1JGUL 1RKRA 3GJEB 4JQIL 1BA9A 4DUXA 1FVEA 2ZOKB 4YHZL 2FLBT 1Z5LA 1TETL 4U1LB 2QMJA 4QY8B 2ADFL 4YOKA 1ZGLP 4ZFGL 1T4WA 5DI8A 4I7ZC 4FRWA 4WGVB 1IMHC 4UM8A 4X6FA 4XO8A 4P3DA 1KDJA 5ISZD 3SCMA 3NA9H 3IDXL 1VDGA 5C0BE 4P2OA 3Q9PA 3T08A 3ZMNA 5LWYH 1Y6NR 4O2CA 2EXWD 5I17A 3CJJA 3RFRA 1CGUA 4ZS7H 4OUOA 4U6YB 5MEQA 2W0FB 3KNBB 1RAMA 5E2TH 4GXUN 3WIIL 3IB4A 2NUTB 1GZPA 2FH8A 4FQ2L 4XZUB 1MIEH 3T0XA 4ZW8A 4ZUUA 4XBPA 2OMZA 2HRPL 2DBLH 4KNTA 4PJAA 2PXYC 4F57L 4Q4EA 5KTEH 5E56A 3ZDZB 2X0WA 3QJZA 3MLZL 1W0WA 3ZL4H 2BPBA 1QTPA 2UVFA 1OP5K 1DQIA 1OTUC 3FMGH 3IEAA 3BVXA 1XH3A 3I02B 4DP8X 5DSCB 5KBNC 3UTTA 1R3KB 4LDEB 4FZEL 3LNHA 1NKOA 1QFWH 4JFEA 2ORBH 5EN2B 1F3JA 4CKQA 1IGJA 2PYED 2AJ3A 3SDCA 2R0WH 3NQIA 5DR5H 1WF5A 4NPKA 2EIEA 2WP3T 3RY6C 2PWFA 3GBLA 4IRZL 3HR6A 3L9YA 3RGVD 4XO4A 1NC2A 3EG9A 4G2AA 3ULUL 5GGVL 4HJJL 1HOEA 4MS8D 3RAJL 2O5YH 5A1AA 1JNLH 1N7MH 3U36B 4ONFH 2G2PA 5GRJL 5DK0B 1JPGB 3GSUA 4JKWA 3C6LB 4LCYA 1TR7A 4NRYB 5KSAB 3RBGA 3BAIA 5DS8B 1S8DA 3TO2B 5E6YA 1BEXA 4B9KC 3U0WL 3VQLA 5D7JC 2B0SL 4MBRA 1P7KA 3JV6A 5DFVC 4PRNB 4NB7A 2D03L 4JKNA 1IC7H 1LQBC 1TXKA 3O0RL 2KZKA 4HUUA 4YO0B 3BPLC 4JFFB 4HVBA 2GBAA 3WEMA 4LCIH 1TUPA 2F58L 2NY5H 1M1SA 3IJEA 3T6XA 3UIZA 2X2JA 3BUIA 3DOSB 4PW9A 3RJQB 3AVEA 3BO8B 2OCJA 3N42B 4G5AA 2E7HA 3NZHH 4JO8A 3B9KD 7FABH 4KQ3H 3KW7A 1NMCB 4HETA 4J8QA 3K46A 2VZTA 2V17L 4B5EA 1J9TA 5INDB 3PDOB 5C6PB 3VYNA 5DMKB 5BO0D 2RIKA 5BUAA 1FZKA 1WBYB 4XRCA 4CC0A 4OZ4A 2Z7YA 3H56A 2P80A 1EVTC 2IOMA 1JGLL 1RUML 2CXKA 2EO7A 4PWFA 2KDGA 5C8JB 1LXMA 5L6YL 1G7HB 3FU9A 5FYJD 5G55A 4GAYA 3S35L 1L9TA 5B21A 3B2DC 3ZDZE 5DZAA 1CDYA 1G7IB 5KW9H 2BCKB 4UU9B 3GYRA 5CZVL 1TEFA 3A22A 3QJRB 3QPXH 3SE4C 5KVFE 4DZBA 5IG7A 1I7ZB 5B8CB 3IBOA 3JTBA 3BPCB 2XOTA 2VJ8A 1MCJA 3ARPA 1EHKB 3GBNH 5FX3A 1A25A 3VFSB 5T5FH 1RZGA 4YPGA 2DQDH 5CJ5A 2J71A 3IU3A 4RQQA 5F89B 1KIQB 1T1YA 3WN5A 3TBSA 2A6DB 2VLMD 1KPRA 2R0KL 2X4SB 4OZFH 5DA0B 4PJ8B 4S1DD 5E4AA 5IOPA 5I8CA 5C6TL 4G6AC 4R7NB 5JW3L 1CK0H 4Y9EA 5JHDA 3GMRA 4GPVA 4IOSD 3MZGB 3HC0B 4X50A 2EH7H 2Z4QB 4I2XA 1NBZB 5K9JL 1NIFA 2VXSL 4RDQG 4AYEC 2B4CL 5DMGC 4M56A 1R47A 4L2YA 1X9LA 4UBDD 2J8OA 5CHNA 1NC4A 1H3WM 3QWOA 3EDDA 1K5NA 4PP2A 5J13B 5EUOB 4MMYA 3PHQA 1H19A 2XV3A 4GMTH 5GPRA 3IKKA 3DX4A 3SY0A 3D39A 3ZJAA 2H8PB 3S5LA 4JEGB 5JHMA 1EGJH 1LQSR 2JKXA 5T3ZH 5CCGE 2VE6B 5I8KL 2Z31B 1T7ZA 1C8PA 1U8IA 2WXLA 4MA8H 4Q6IB 5IIEA 1XF3B 1I1RA 1QRNE 4N28A 2LAGB 4EUPA 3P3TA 1CVSC 3D05A 4JRFA 4LOEA 2YOAA 1OCZB 3SE3C 3QUZA 3ZHDA 2J2ZA 1L0QA 4JKMA 4NQQA 3VRJB 5I1CL 1IGMH 5E8DH 1RV6X 3FCTB 3VFVA 3VGEA 4PJEE 3QIUD 1PZ5A 3FFDB 3KYMA 4OCSH 3NSYA 2JWYA 1XB3A 5EU4A 2XA3A 2UZYA 5FWRA 4LCWE 4A7UA 3OM3B 3N40F 5I1HH 3ULSB 4R26L 1UFUA 5A16B 4FCAA 3FO2A 3D51A 4HLZG 3WDJA 1THAA 3CX5J 4U2ZA 1JTPA 3PXJA 1J8HE 4UTAH 5EEUA 3NRQA 2MEJB 2QDVA 1JZ2A 1W72H 1JZ7A 1TTAA 2HKAA 1OAUH 4FTVA 5CJOH 4N0YH 3L6FA 3IRZA 5SWSE 1CFQA 4LSQL 4P2RE 4U3HA 5D7KD 5TQ2L 1W9XA 3S3JA 4A55A 1ZTXL 2BP3A 1CICD 3APNA 3ZN6A 3ARWA 3K1KC 4KKZA 4PWGA 4XNQA 4XVTH 1B6DA 4OKDA 4B0MB 1T3FA 3BD3A 1FN4A 5J6HA 1N12A 2BNRE 4W70A 3ZDXF 3GMLA 4UTBA 5GS0D 3EFOA 3D3VB 1TKWB 5CLZA 1G9MH 1P84J 3AU1B 4XTRD 1MWAL 4YQXH 1OV8A 3K4AA 1YYMH 4HS6B 3BFWA 4QO1B 4X8GA 3NSXA 3VFWB 3DBSA 1QTSA 3L2NA 1FYTD 4L0ZA 1GJWA 3L7EA 1KWGA 3D4GA 1M3IA 2F54B 1JD9A 2OSXA 3MRIA 3W0WE 3BVTA 5B4MC 2BY1A 3P9LB 5CEZE 1L7IL 3AU0A 5FYLL 3NN8A 2WM0A 2BERA 5IMMB 4UINH 5CILL 2VDRH 2OMWA 1YMMD 1BIIA 2X4RA 2X4TA 1YQVL 5GHWL 4X42A 3C2AH 3T2LA 1JZIA 3MGOB 4JKKA 1GIGH 4CMHB 3BVNA 1ACYL 1ZA6A 4FN0A 2F5BH 3T4YA 3OXRB 4YE0A 2AC0A 1YO4A 5ES4B 3HHRB 5AVVB 3E2HB 3I6KA 4DCQA 3RKDD 4GP5B 2GTWA 5CEXA 5T5NF 3DURA 2X4UA 4DKDC 4DPRA 2OR7A 5CGMA 2IBZY 1TFHA 2P24A 3T09A 4A38A 2F1AA 1OSPH 1U91A 2ZCZA 4ABWA 3WAJA 5HTSA 4N2MA 3BEVB 5DA4A 1KMGA 3D7PA 43CAA 5A7BA 1A4JA 3QZBA 3TL5A 4DKAA 4PJAF 4GW5B 2HFEB 2R69H 3QZMA 4P5SA 3SQRA 4KOBA 4ODHL 4XPAH 1PU0A 1A6TB 25C8H 1OKEA 1AACA 5F7WC 2FATL 3QO1B 3WFEL 3IMVA 2WWMC 4K0OA 1T20B 3N41B 4D9QD 1MQ8A 1XZ0B 4HSCX 1MWOA 3NJMA 2Q86B 5MEOB 3QRGH 1ANUA 3EO0B 5FYJU 2VXTL 2ZCLL 5ANHA 2BNQE 3CFKB 4FLOA 5BNXD 1RZ7L 1T21A 5IR1B 4XP9H 5L4FA 1JPFB 1A2YB 1H5BB 3OPUA 3ARQA 2Y7NA 4X8JA 2DTML 3GHEL 4G7VL 3IN2A 3O11B 2VT0A 4PIBA 5IEKA 3NAAH 3QPQD 2WKOA 2FEEL 3VD3A 1U95B 3NZUA 3Q0HA 4FTDA 2P49B 2ZKWA 3IJHA 2Q8AH 5KSBA 2KPNA 3QI9A 4M7KL 2XY1A 1WA0X 3D3VE 4N87A 3TBYB 2OKMA 4D0DA 3S97C 4U2YA 5JHAA 2NY1B 1AE6H 3P3YA 3CC5B 1LO2H 2VDPL 3VH8B 5M7QA 3VW3L 1AZBA 3H9ZA 3PHSA 5IQMA 4X99A 5KSUA 2OSWA 3UC0L 1A7QH 1EJFA 2EDHA 3B7RL 4JMNA 1ZHLA 3AQYA 4QF1A 3A24A 4WI9A 5AD0B 1IKFL 4ELDA 4OFPA 4LHJB 5C0IB 1MCOH 1X5KA 1SJHB 5EG6C 3O9WA 4PB0H 4MJID 2DLFH 1BYNA 5I75B 1XBDA 1IGTA 2B9BA 3B2UD 3CPLA 3HBGA 3N5AA 4O02B 4F3FA 4GQ9L 4RFEB 3PG2A 5AYUH 1NMBH 1S5HA 2CRZA 2HG0A 5BZZA 4D3CL 1CURA 2NQCA 1S7WA 4PP1C 3ULUC 3FZUD 4P5TD 5AENA 2GFBA 1QFPA 3KLAB 2G60H 4X4XA 3UTOA 1OGAA 1C5CH 2V3DA 4YDNA 4KXZI 1MOEA 1REIA 3KCWA 3GJFH 3LZOA 3QUYD 1S7UB 4KJPC 2CHZA 4GP4B 2PTTA 3VXPA 4QXWA 3C8KA 5ID1B 3VFMA 4IIQC 4DK6A 1KGUA 2ZUVA 5BZDB 3T2QA 3I85A 4AZUA 2WCGA 2WTRA 5DWPA 5KVDH 1A5FL 2Z7WA 3CFCH 3L5IA 4ODXA 5AZUA 3D9AH 5D7JA 3MOBL 4R2GB 3CG8A 1E9QB 4MA7H 1OLLA 2DV6A 4JS7A 5E8NB 5LCVA 4Q9RL 1QZ1A 2VN3A 4JCLA 5FM4A 5GSVB 1AKJA 4GB9A 2Y2TA 2WLYA 4A37A 3OJDA 1BOYA 2ESVD 2G3ZA 4XCCH 4OZGE 3DDGA 4UT9A 5AVWB 4OLUL 1U8MB 4XXWC 3LEVL 4UYQA 5GGSY 5F7DB 3S0PA 1NBVL 1XV8A 2XVLA 4ZUWB 1DBAH 1JGUH 3EFDL 4W4OC 5ILTL 3TT1L 4H2CA 1HCZA 2VZ3A 4FI6A 1KXTA 4LEEA 4YHZH 3VGHA 4IRSC 3O41A 1SYVB 2HRLA 4LSVL 2ADFH 4TQEL 2P8LA 3KW8A 3ZE1B 1KJ3H 2BY3A 1YN6A 4I77H 3QUXB 1BYOA 4JDZB 4JPWH 2FBJH 3IDXH 2GK0B 2CZNA 4JO2L 4OF8A 1BZ9A 3O3EA 1HTYA 1NGQL 1HCYA 1WCQA 1J48A 2AJSL 4F93B 1QFOA 1AVAA 1DP0A 5DVOA 4A6YL 1KF9B 1NWPA 3MA7A 5KJ4A 3WIIH 4FQ2H 4HOZA 3QS2A 1N3NA 3F7RA 4U1MB 1MCBA 2Q3XA 4F7PA 4CAGA 1CD8A 4Z7UA 4PS7A 1EQWA 4PI2A 4GG6B 5E7FA 1L5GB 5E8EA 3LB6C 3BP5B 1VSCA 3IVKA 3ALXA 2GJ6D 2KMWA 4RNRA 1BV8A 3MLZH 4OGYH 1HSAB 3V0VA 1Q8MA 1FZMA 3W9EB 1TF4A 4DWHA 4X6DE 1WEJL 2P52A 2YXWA 4NQCB 3PQYA 3UBXB 4BSWB 2UUDK 3COOA 4FZEH 4KPHL 4JFDA 4I0PC 2CR6A 5D70L 3L13A 1PD1A 2DEYX 3KPSE 2BWIA 3DV6A 3HCVA 4KK8D 4XP6L 5F8QC 3NCEB 5EU6E 4NQSA 2XNAB 3DVIA 3JWNE 4IRZH 4GBXC 4KDTA 4YXHL 4L4VA 2WZ6A 3QDGD 3DSFL 1MDTA 4JPKL 3REVA 4Y2LA 3SGKA 5L4MA 3PWUA 5GGVH 4HJJH 1WCBB 3FT9A 4LEXH 5IW6B 1T6VN 2B4CC 1IGIL 3IGAB 2DOCA 5GRJH 2PO6D 1HE7A 3LNGA 4I4WA 3H1ZA 4W9EC 4PGZA 3HPJA 3MMEA 3QIBC 1X9RA 5GQBA 1C5DA 2BWQA 1HHIA 2HVJB 4ALAL 5KVFL 2B0SH 2I07A 1FJ1A 4NO3B 2QBWA 4WNJA 2IG2H 2AK1L 3Q5YA 2D03H 2PLTA 2OXHA 4FXKC 2OSLB 3ARTA 1NKGA 4N3UA 1B4TA 4FFVC 5DO2D 1YPZA 3JV4A 4UNVA 4U6VH 1NCJA 1DVZA 3QFJD 3MRCB 1F2XK 4EI5D 5LLIC 1RI8A 2VCOA 2DMCA 2F58H 3KEDA 2NXYB 1C7TA 1CFVL 3NDYE 4XHQA 5MHSE 2ITFA 2HLFC 3ROOA 4PLJD 1H6TA 1T5KA 3TIEB 3OL2A 2X2UA 5IOKA 3OKMA 3SE3A 3VXNB 3LRSB 1D5IH 3U46A 1SJEB 2H3XC 5AKSA 2HT2D 3ZE1E 5DFWH 2Y5TB 4CU8A 5I6NA 1N10A 1KBVA 1DVFC 2V17H 4WV1C 5A6IA 4JW3A 4WFHE 2W80C 5FV2A 4JFXB 5TH2A 4XNMA 4ELMB 4F7CA 3DK0A 2DH3A 3A4EA 5D7LD 4KZCA 4AKOA 5DQ9B 3G6JB 1JGLH 4AH2A 2YARA 1MFDH 1KGJA 1ZRUA 3CHQA 1S9XB 1KXHA 1P7QA 3RHWF 4GT0A 3SBRA 5HHQA 4L29A 4AQEA 4AEHL 3T1FA 3UPRB 3DJRA 4LLAA 2ED9A 4GI8A 1CGSL 1FV1A 1FF5A 2FX9L 2YD1A 2F74B 4JO3L 5CZVH 4HIEB 4MZRA 2WLKA 2AXFA 2FNWA 4NQCE 1RK1A 5IFHH 4OLWL 1N6UA 3MRGB 1KBKA 4TNEA 1EEZA 5IVXB 2QQQA 4AW7A 4TUJA 5DJYB 1ADQA 4AM0A 3CDCA 4OZFG 4G5ZL 5KVGL 2X1PA 3BT2L 4W81A 3MNWB 5CS7A 5JDSA 1WRFA 4DGVH 1TIUA 3NVQA 5KVEH 3BUQA 1JK8B 3VXME 3VTAA 5MEPA 1AO7B 2R0KH 2PPEA 2D3LA 3QEUA 5DJ2B 2A9NL 1MFMA 4O4YL 5A40E 5JW3H 4YHIB 3GSXB 4KROB 5HDBF 1I82A 4OZIA 1YHPA 1EEYA 2A83A 4I5BA 4LLUA 4Y16D 4FABH 1QPPA 4GI9A 3BX7C 2BH0A 3DMMB 5K9JH 5F9WC 1TLKA 3CFEB 4H44C 3T0WA 2B4CH 1NGZA 3HG1B 1J0HA 1QYGH 3Q5OA 1JS4A 4IMKC 4NS0A 2EINB 4M3JA 1AC0A 3PJSA 4WGWB 1LNUA 2NSXA 4Q4IA 4HCRA 4GS7C 3APCA 1R34A 4QR7A 4NRXA 1QFWI 2V5SA 4UAHA 3DVNA 3QSKB 1XCQB 4IBTA 3HJEA 4AZ8B 3DROB 3GUFA 4ZAKD 2WKOF 2QLYA 4Z3HA 1J11A 1FAIH 2HVKB 2PR4H 1F90L 3QARA 1UWXK 5I8KH 5C07B 4UM9B 3RDTD 5L2JB 2J56A 5IK3A 3VMNA 4Z7WF 1A7RH 5ESAA 1RZIA 4PGEB 4PY7B 3PWNB 2KUTA 1VEMA 3TYGH 4LT7A 3SKNA 2R59A 5I16B 2OTUA 3K0YA 4Z7OF 1K8IB 1N59A 1OE1A 2PWHA 5CEZL 4JQIA 4Y8AA 5D2LF 4FJ6A 1E8XA 5FA3B 5I1CH 1IC0A 1HQ4B 3RWJA 3EDJA 3RVUD 1FZOA 2LVEA 4NBXB 3TIDB 1QSED 4KRMB 4P46C 3OQRA 5KG9B 3NK4A 4NQDD 2K1MA 2CUMA 4L1LA 3C5XA 3S6CA 2X3BA 2DM2A 4L05A 3V5HA 4NNYB 3I6GB 5DD3H 5IJDC 5ISZB 4G82A 1LE9A 3SB3A 5I30L 4CVZA 2WLLB 4KI5C 1UXSA 1A7BA 4YEEA 1AG6A 4PRBA 4Y9BA 4CUCA 3F6JA 4XN7A 4MX7B 3WXWL 3IDYB 2ENSA 4G7SB 4S0TD 2UZPA 3M7FB 2YEZB 5I2IB 3TJHC 5LBSA 4JGNA 4NDMB 1UJ3C 1A7PH 3MOAH 3U9PL 5L0QC 4FQXD 1VZHA 5JLZA 3P2TA 3BQUC 4JZNB 4YSEA 4DP4X 5IVOA 1G7LB 3ESVF 5I76B 3NIDE 5CCKL 1RPUA 2XTJD 2E4FA 2CJUL 1XGPA 1AD0B 3H6JA 1EZVX 4PEEA 4OB5L 3I6LE 1UWEL 2PYEB 1LVEA 1B6UA 1PX8A 4XCFL 2Y06L 2P28B 2OK0L 5JXEC 4YBHA 4LF3B 1L7IH 4ZMLA 1EMTL 1LD9B 3ATAA 1IGYB 1Z2KA 1FNSL 1J5OL 5CILH 3SD5A 2ITCB 1CD1A 3RGVB 3ZE2E 4YFEA 3VXRE 4RMBA 5AUMB 2JJTC 1J1PH 5GHWH 2X6AA 3SDDC 3OAYK 4QYAA 4AJYV 1SHWA 4G7RB 1ACYH 1MLBA 4P9HH 3V52H 4Y5YB 3T4AC 2MPVA 4M43L 4IIQA 1CUOA 1A8JH 2IGFL 3LN4B 5I8EA 4HMEA 3GRBA 5MENB 4XBGB 4HKZA 1SUJA 4M29A 2DQ6A 1ZGLM 2IBGA 4TNVK 3CDYA 4PV9B 4X5WA 2CBMA 2OA9A 5H35B 1LK2B 4K3HA 4J4PA 4M7JL 4RGND 3SODB 4YHNB 2PTVA 2UY7A 4YR6B 4APQC 1ZJBA 1UH4A 4J3OD 1I8KA 2FQGA 4Z7UF 2I9TA 3IETA 2ADGB 1OP3H 3BPNB 3MA9L 4CSZA 3G7TA 4V1DD 1OAJA 3HKZA 4ODHH 4NKOB 4XXWA 1V7NL 2OI9B 1PSKL 2C3VB 2FATH 3P0VH 5F1SA 1NDGB 4QCIB 1AQMA 1FO0L 1MJUL 3PJNA 5DMYA 4CU7A 3B9KB 2APTA 3BLBA 2NOYA 5J9PB 4FQQB 3V5DA 3VD5A 1GY2A 5C0JB 1RJYB 3CLWA 4BH7B 5ADPH 3ABMB 2VXTH 4JGUA 2WKLA 3BSHA 3W56A 1YEKL 1T1WA 5DJXA 5CGBA 2ETWA 4GAGH 2E5EA 4HWNA 4E2OA 5ESQA 5BVPH 3Q8BA 2BIIA 2DTMH 3GHEH 4G7VH 3V10A 3T8XA 4BFNA 4RMTA 3VX0A 3HRZC 3TURA 4JFSA 4RLDA 2WN3A 2HT3D 2IADB 5CIPA 4M7KH 1X7QB 4Y4KD 1KJ2B 3ZE0B 3TU6A 3IGUA 2E47A 1L0PA 1KV3A 2VDPH 1M2VB 2NXZC 4XB3A 4HIXL 3BJLA 1W6WA 1U92A 1YUHB 2E4TA 4AEEA 1SYSB 3WMPA 5E6ID 4L2LA 1MXGA 1SDDB 3H0TB 4J3TA 4W6XB 5F1OB 4G72B 1FSKB 3TA3D 3V8CA 1EA9C 1YPZF 4DP1X 2WXJA 1AXTL 1WQVT 4I0PA 4OI8A 5F21B 3QR0A 5DC9B 3KWWB 1QFWM 1ZEAH 5IB4B 4HXAH 4PH8A 5DRXB 3RILA 5HHMD 4AQAB 3WHXB 4FA7B 3L9RB 2KDYA 2WSPA 1D6EA 3OC8A 5A2LH 4QJ3B 4KUCD 4X6CA 4F9PC 3KL5A 4UQDA 3CX2A 4KKBD 3GSNB 3NGBC 3ARUA 2GUOA 1A1NA 1R3LB 5MENE 2R1YA 3F7VB 1X6NA 4K55A 1PJ9A 5E1IA 2UXVA 3A6CH 4HIJA 2MJWA 3I3EA 1H9DA 2GB2A 4RBPK 3QIBA 3FTVA 3QZWG 3F12A 3MROB 4ALAC 1KXVA 3EUDA 2GYSA 4P4RA 1TPXB 4WENB 1A5FH 2V3FA 4DN3L 4LSUL 4HKJA 1O0VA 2QZ5A 5LBGA 5DMJB 4Y4HD 2C7UB 1L3WA 3S5ZA 4Q9RH 4FXKA 1NCIA 3L48A 5AYTA 4JCMA 1E5AA 2HLAB 4N24A 4CN4A 1WGVA 4O02L 5DTFA 3QA3B 4X4KA 3F62A 3B6SA 3IWVA 5HVGB 4I48B 2NY6B 2VLJA 3NG5A 4FLRA 3IAPA 3AAZA 1E6JH 1NBVH 3VVWA 4KMLB 2BSTA 4LXFA 2JCWA 4QTIH 3UBHA 1I1YA 3TT1H 3EFDH 1I8IB 1IQDA 2VGLM 5JORB 5ILTH 4KMTL 4PMFA 4NOBA 3TF7C 1SXBA 4TSBL 4LSVH 4WV1A 4TQEH 5DEJA 2E7DA 1HHJA 4IBWA 1XDTT 2VISB 4PRAB 5LN4A 3RDJA 1M42A 1KG0A 4L48A 3V4VL 1IUZA 2E7MA 2ZSWA 2V2WA 2EEDA 4U1KA 1OSZA 1TJXA 2XSKA 3UTSA 1J5HA 1UD8A 1VACB 3O4LD 3PUCA 5ACZA 4OZIF 2AJSH 4NZTL 2AERT 3ZE0E 3HNTL 4Y5VA 4MNQD 4YJZL 5SV4A 1O9ZA 3BIAX 3I84A 2ZOLA 2DRUA 3ZU8A 1W91A 3L16A 1HXKA 3GZQA 1CICB 2YPKA 3ROLB 4WU5B 5FO7A 4XVUC 4JO1L 5F96H 3NBNA 1HSBA 4XCEA 5IF0B 1I7UB 2EP6A 1B4RA 4HIPA 4AMKL 4PY8J 4PR5B 1MLCB 2ICWJ 3LPPA 1R3JA 1MWAA 3U82B 4L3EA 3ZSSA 2UYLA 1UXMA 2UY6B 5TF1L 2MKWA 4WJ5A 4KPHH 2PW1A 1WITA 3GMPA 4HULB 1FYTB 1WBZA 2D9CA 4IKIA 1OD9A 5D2NA 1XF5B 3DSNA 3JTTA 4XP6H 4FMVA 3P2DA 4NKDB 4J23A 2N0KA 4P0DA 4R97B 3RWIA 5I15L 2IPKB 2YAFA 3D30A 3EJPA 3OKKB 2WYTA 4JPKH 1PKQE 1E8ZA 3CMGA 3O8XA 3AGVA 4OF5A 3N1MC 3B7UX 1NEZA 3DETD 1YMMB 1KJVA 3PNWA 2GUYA 4DPCX 4X4ME 2DMGA 2AXGB 4NQXB 1IGIH 3FQTA 5F7BA 5PCYA 3QEGH 1EFXB 4V33A 5BS0D 4WO0A 4IMKA 4MCYB 2VQ4A 3ZQ9A 3PS6A 3CZSA 1CDBA 1IFRA 2XFGB 1AQDA 2PF6A 3K6NA 2FL5A 3WKPA 3RNKA 5KVFH 2I7SA 2CO1A 1RIHH 4D9RD 1UENA 1VLXA 3LHAA 4G43B 4YGVB 1JPST 4LPXA 3ARDC 2AK1H 4PWEA 1ZV5A 5FUZL 1Q94A 3VGFA 3X1FA 4RAUB 2FHCA 4G3YL 4Y9GA 2CO3A 3GHBL 4M8VA 2Q8BL 5IEHA 1CFVH 3AW5A 5D6DA 3OLEA 1TSHA 2M1KA 3MRRB 4U4IA 1WA2X 3CZKA 1OAZL 2YXFA 5CSZB 5F97E 3IFNL 3RWCA 3ZKNC 1NFDA 4LO9A 3CNKA 2OLDA 3LS4L 2DW5A 4P48A 2NUPA 1N67A 4R96A 1DSFL 1FIGL 2GT9A 3EOBB 4N2HA 5HYSB 4W9CC 3LD8C 4P46A 5CD5D 1IO4C 5L8KB 1TYEB 4PY8I 1I9JL 5FO9A 4OFYA 2ICWI 4DZ8A 2AMGA 4OKVB 4F7KA 2PUQT 4RMWA 1ADWA 2AQSA 1BQHA 2ERJB 5I18L 3EGXA 4NSKB 1VFBA 2JI2A 1MVYA 3HZMA 4TS6A 4WUUA 3RWEA 4NP4L 3RLSA 4AEHH 4XGZB 1BPLB 4G8GD 2W07A 4FNLL 5CD3B 2XN9D 3Q2WA 1BVLA 2XG4A 1H15A 1HWWA 2FX9H 3QDJE 2X12A 2CK0L 4JO3H 1KTLA 1WISA 3FB5A 3AQDA 5DD6B 2JK5B 6TAAA 4OLWH 4KAQL 4HJ0D 5DK3A 1FI8C 2WSDA 1NZRA 2OW6A 4NKQB 5IBTL 1ZT7B 1N2RB 1ZA3B 3H9YA 4U3SB 3BT2H 1XH0A 3SDAD 3DJTA 5FDWA 1UOKA 2HX9A 1TO5A 2B77A 1GGYA 4OF6A 4TOYH 4RZCB 3FUMA 4J5VA 4HIHA 1ZK5A 2R2BB 1C08B 4X83A 2J3SA 4MJIB 1G43A 2Y36L 4IGBA 3KXFE 4O2EA 3F7YA 2A9NH 4ZFFB 4LL9A 2XQYA 4NQVB 1N8ZA 4K71B 5MERB 1RZKH 1KGCD 4ELKA 1QUNA 2ZG1A 4ZO7A 3D12B 1CFTA 4J3OF 3LV3B 1I1FA 2JIXD 3F5WB 3LMJL 4CMMA 2JJTA 1DVTA 1JZEA 1FFNA 4GO9A 3SDDA 4XI5D 4POZC 2OMVB 2HX7A 4XAWH 3QUYB 2YSSA 3H3PH 4FMKA 2VR8A 5B38G 2J7LA 1CQKA 4JHWH 4KK6C 1CE6A 1UOLA 5HY9B 2P43B 2VZSA 2QTEA 5SWZA 4ZX4A 1LO5B 5I1LB 3R1GH 3MRJA 4P2QD 3VFTB 1JGVL 3KYKH 4BWWA 4S1QH 4OLVL 2K6WA 1F90H 2UWEA 2XG5B 2CGRH 1WC7B 3X1GA 4AIZB 1J87A 4JN1H 4NZUL 2XQBL 1RZQA 4PJBA 3E6HB 2CHDA 2EE6A 1OWWA 1KCKA 3NSDA 5CXPA 5A43C 3IAGC 3MBWA 4AK1A 3GSVB 4F8PA 5CEZH 3ZTNL 5JIPA 3JWDL 3FU5A 4CVXB 2RHEA 3MBXH 1CG9B 3STZB 4YHLL 1EUUA 3BZDA 3B83A 4XN5A 4HWZB 1R3HA 2ITDB 4JO5A 2XIBA 3QUHA 5DRWA 3SKOA 1OIOA 4XXCC 2NX5D 1A6WH 5I30H 2DQFB 2NR6D 4G9FD 3DUSA 4A6YA 4YSTA 1YY8B 1THCA 4X6CF 3VM7A 4B9YA 4OJFL 3WXWH 4L3AA 1M4KA 3HRZA 3NIGB 4APXA 5DHXB 1YNTA 4YC2B 3GMNB 2EYRA 3CVBA 4ZTPL 4PWIA 1XQ4A 5AW6B 3D48R 5HD8D 3SGDH 5D93C 1RHHB 4KUCF 5B3NA 4DVRL 4XNBA 2GJ6B 5IJVA 3IPBA 1DQQB 2KC0A 2BJML 1ZIAA 4C4KO 1KLGB 1T2QL 4LIQL 4WEBH 5C09D 3FYIB 1KTDA 4JJOA 1UEMA 3MCG1 4PYHA 1ZPLA 1UWEH 2J55A 4AYBA 3EDKA 2OK0H 3LKPA 1PNDA 2CIKB 3QNZB 3UTPD 1PFOA 1BGXH 3C6SA 4NN7B 4P2OD 1R1CA 1T5XB 4LMQI 1FNSH 1J5OH 3QDGB 4CSPA 1WHOA 4PRHA 5DZNA 2OX5B 2R0LL 4FJYA 4X5PA 3AC0A 5CCHE 4NT6B 2IWEA 1UM6H 2PO6B 3QJSB 4OBRA 1XGRA 3WNKA 4C83A 3B3IA 4M48L 1OT4A 2VR5A 5AVRB 2CKNA 3CQQA 1XVSA 2YGVA 4PJIF 5C6WH 1E4KA 4PJ5B 5DRZA 2PYFB 4JY4A 1UXWA 3WELA 2WBJD 4AYFA 4XP5H 1S78C 1WWCA 5JW5A 1E2WA 3MUGB 4M7JH 3CAFA 3QWRA 2VDQL 1N0LA 2DIEA 2CM5A 3EYSL 3LKNA 4NI6A 4BFJA 4EI5B 4P5KA 1P53A 4NAQA 4P05A 2HFGH 3DI3B 1B3JA 3DX6A 4Z7AA 3MA9H 4HOMA 4KHXL 3BZ4A 3WNLA 4RISH 3FKUS 3MJ8A 1V7NH 2FLRT 1PSKH 4J1UA 3V7AG 2N7BA 3JWNC 1GYVA 3LN9A 1MJUH 1U8HA 4WHTB 1NC2D 4FQ1H 5EBWB 3IMBA 1U93A 1TZIB 3ECUA 4BZ1A 5I6XB 2A73A 1O7VA 3OG4B 1DN0A 4QHMB 3L3GA 3KL0A 3NP4A 2ICEB 5E0FA 4OQTH 1QZNA 1VGKB 4CGTA 4GRLC 4DQOH 1XIWA 3NFPA 5D7LB 4JB9L 2DYSB 5TDNB 3BW9A 4EBQL 2DTSA 3D0LA 1LP9E 32C2B 2XXGA 3TP4A 1DJXA 3FONA 4NENA 3FTGA 3Q3GA 4D94A 1I9EA 1F8TL 3QYCA 4EQ2A 4U7KA 1UQSA 3T8VA 3IWUA 1OOAA 2A9CA 1I1AA 3MJWA 3QCUL 1DUYA 4HJTA 1E0OB 1RK0A 4HIXH 1ID5I 2BVPA 4MB4A 2C9RA 2W0LA 4ONHA 1E3XA 2DBJA 4F91B 3CVIH 4XNYL 3LKSB 4L4TD 2EDOA 3D69B 4X6EB 3T1WA 4UV7L 4PJEA 3B2VL 4U1SB 1BG1A 3BP6B 3OKEA 3WY4A 2PPAA 4PREA 4M4RB 1A66A 3V4UH 3NESA 4WDIB 5FLUA 5IESH 3LSOB 4G6ML 5HGBA 2H6PA 4U1GB 4QRPA 1SJVA 4Q2ZA 2EYTB 5KYXA 1KYFA 5LG6A 4Y16B 3GXPA 2XBTA 2QHRL 4PHXA 4K7PX 3UJTH 1J8HA 2ED7A 3DOHA 4XMZA 4NO0A 4NI3A 3LRGA 2R56H 3BGFC 4PJ5E 2EIKB 5LNDA 4RIRB 3R18A 1EAOA 1EUTA 2HG5B 3C60B 4P2RA 4ZODA 4YAQA 1UJTA 1OTTD 2MKLC 4WKZA 1MI5A 4YBQD 1P4UA 1FCGA 4DN3H 1K4CB 4HWBA 2DI9A 1QTYT 1ZVSB 4ZAKB 4JR9L 3ARDA 4NX0A 4Y2NA 1O5PA 1BEYH 3F7LA 3RDTB 2HRHA 3FTSA 3GINA 1F11A 3MRDA 4GQPH 4O02H 2P5EB 4QYOA 1MJ8H 3OB8A 5J12B 1M1XA 4WFEE 5DMIH 4HUKB 4O58L 1P1ZB 3W0WA 3MRBB 3Q13A 5IBLD 1T7YA 3RU8L 3HS0C 4MQ7A 2WB1A 4ZOEA 5ANMB 4MJ5A 3GSNL 1ETZB 3IDGA 2ZKYA 3JWNH 4BCXA 3EZJB 2DDQL 4PJDB 3QQDA 4HC1L 4KMTH 2X3CA 4TSBH 1RZ8A 1ZSHA 8FABA 4B9JA 4XNZB 4NQDB 2AXJA 2H0PA 4R4NC 3ES6B 3Q2VA 1FC2D 1IC1A 1DO6A 1MN4A 2VL5A 2JLLA 4FG0A 2UX6A 2J8HA 3WYRA 4NZTH 3SE9L 2H2PD 2BP0A 3SN6N 3NJHA 5FYKH 1S6NA 5JHLL 4CN6A 3FQXA 5F0JB 4X7EC 4RZKA 2EEXA 3FOLB 3POCA 4UDTA 1YMHA 3R0MA 2C9XA 3KR3L 4FHJA 4EZMA 3E9TA 3KE0A 3U9WA 2DQJL 2R1WA 1XSIA 2XA8L 4NHUB 3S37X 4YFLF 5E4EB 5EU7E 3HLAA 2OR8A 3IDJB 1P7BA 3EJQA 4FQXB 4AMKH 2G4EA 3MO1B 3WMSA 4HFWB 3QR2A 5GZOA 2WTOA 4U1NB 5H37A 4H26B 1P6AB 2UWEF 3MV8A 4OFKA 2XTJB 2C3XA 3M1BA 1E9PB 2CR3A 3GMOB 2C1OB 3VSTA 4PJBF 5HI3D 1O6SB 4I8DA 4M4PA 4GKOA 2FEEI 3O2WH 3REWA 4PGJA 2ZP0T 4QHKI 5AVYB 5BJTB 5F9JA 4EZJA 4ZDHA 1YNKL 3WKML 3VFGL 1FH5L 2IFGA 1BVKB 4X9BA 2NY4C 5EFIB 2H2SC 1G1KA 1K8DB 1DE4B 5AL8A 2QR0B 3UTZA 2K7QA 2V2TB 2BIOA 1W0VB 3GI8L 2P47B 3CMOH 4H40A 5C08E 1CD9B 1R17A 4GW4B 3TBWA 1T6WA 1PAZA 4FJZA 2AQ2A 4WTZA 2EC9T 3UAFA 3CGTA 5GIRA 5HBBA 4JRXA 5I1KL 2XDHA 3BE1L 2O6EA 2P5EE 4J3BA 2VMCA 4FNTA 3FCGA 5J0BA 1UURA 3DI2B 1EJ8A 1F6AB 1G7MB 4FXGB 4KV5F 3VCLA 2YPLD 1YNTF 5FUZH 5AEAA 3MZTA 1GKEA 4JL2A 4RDQF 3EHBD 2B1OA 1S7XA 4YZFE 3BAEL 5D7IB 2ZUTA 2WXHA 3GHBH 5I6PA 2WLJA 4N0CC 1LEKB 3AMLA 5DGQA 2Q8BH 4G8AC 1JN6B 1DBML 1OD7A 4L9LA 5DYOB 3PABB 3CPUA 4RWYL 4V1DB 1TFPA 4G8IA 2LV4A 5FUCE 1OOWA 2IAAC 3JWDC 3DO7A 1KGXA 1SXZA 3IFNH 8CGTA 1JGDA 1QBLH 4FEMA 2OMUA 3L5JA 4A7VA 3LS4H 4J2XA 3LPFA 2N4IA 1DSFH 1FIGH 3RWHA 2A5UA 3I50L 5FOBA 3BPOC 2EH8L 2JXMB 5F1KC 1I8LA 1G9NH 1TQBB 4IKJA 4P23C 1ORQA 4GRWF 3CK0L 4WI2A 2EDNA 3PL6D 4PLKC 1U3HD 2JI1A 4NKIL 1KXQA 4GLRH 1D5MB 3MYJA 4AQ1B 1XAUA 1TMQA 2KQMA 3PGCA 4N8CL 5LDUA 4A7GA 1I8UA 5I18H 1OCWL 2VLRD 3VFOA 1UH3A 2ZKHL 1GJUA 4M7ZB 1GZQA 2X9ZA 4PW3A 3NOIA 5J57B 1EZUA 2EDTA 1M05A 1S7VA 3VGDA 2GTZA 3W2DL 4NP4H 3RB7A 2GPZA 4DK3A 4BUGA 4FNLH 4E5XA 4I0CC 1GRWA 3L54A 4KRPD 1GAFL 2WIMA 1P5VB 5DJ0B 4Y4KB 1TOXA 4LLQB 5K39B 5ITFB 5DRNB 1J88A 5C0AA 3SDYH 2EXSA 3MODH 4MAYC 4KAQH 4AUUA 1IL1B 5LGYA 2FO4B 3IS0X 2L7QA 2DQCH 5IBTH 4XXDB 3DTXB 5F6HJ 5CN1A 4QXUL 4R5VA 3TA3B 3VWKA 3R4RA 3UYPB 3S3CB 5JYMA 1AZUA 4MZIA 5E9AA 2BIPA 2JKWA 1QNIA 1DQTA 1AR2A 4Y1AE 4JM0A 1VPOL 1GCYA 2NSMA 1PGRB 3EO1A 3L1EA 3NFSH 3QHFL 2APWA 3KCPB 1S5IH 4LPYA 4PJGA 5HHMB 7PCYA 3WXVL 4E41A 3FTZA 3IDYC 3KM2A 3GK8L 1HH6B 1QEWB 2WSKA 2NT1A 5EULV 3KPMA 4JG9A 3K71A 1TQCB 4AUYA 3WLBA 5IKCA 3RQ3A 3II2A 1L9RA 4J3UA 2FT6A 4AXWB 1AGDB 3GDBA 2R29H 4DP6X 2EVIA 1HT6A 4G1MA 1CMOA 2DICA 3U2SB 1FG9C 3WFBL 1W6LA 2JF1A 3QXVA 2PXYD 3FFCE 2DIBA 3U4BL 2HJFB 2Q7YB 4AENB 4PLNC 3P30H 1X7TA 2B3IA 4ATWA 4MRBA 4PJFF 4PTTA 5DJ8B 4D0BA 5JPMA 1JGVH 1U3NA 2WINB 1OTUD 3J2PA 4OFDA 3W9DB 3WTVA 5CJQL 4BE6A 2BVTA 2NPLX 1TVBA 3UZEA 3O3DB 4ZX5A 1MUJA 1KNOA 4FOMA 3G9AB 2VDOB 1ZS8A 2P26A 1NSNL 4O2FB 5IQNA 4M6NL 1CT8A 1NOLA 5BV7C 5CBAB 4IOFD 3MLYL 1JNNH 3ZTNH 3ZZLA 4PM1A 3DARA 2X7LB 4J3WA 3SKMB 4YHLH 2WYHA 4TULL 2CBQA 1TNNA 3FQRA 3KMDA 4Z76A 2VRKA 5GGRY 3WJJC 3I74A 2A1WL 3DXAA 5DJZA 3V4VA 1AD9A 1AC6A 4QGYA 3U7AA 5F6HI 4HKBA 3FRUA 2QV4A 4GRLA 2YRZA 2JQAA 5CZRA 2ADJB 3O4LB 5KBPA 3TPUA 1G6VK 4ZYKB 4H8UA 5T3ZD 1I8AA 1SEBA 4HUWA 1JWSA 4XPFL 5DFVD 1BZ7B 3FO1B 1T03L 1XGZA 3RIFF 3HB3D 3BPNC 1PTZA 2CNYA 5TE7H 1KULA 1JPTL 1ZPUA 1RPKA 2QTVA 4LDCA 3D0VB 4N90D 4FYQA 1T7WA 4W68A 3ZX1A 3ZTJH 3IMSA 1SVCP 3UYRL 3MCKA 3MRNB 1F56A 1RK7A 4JPIB 2P42B 4D8PA 1G7PB 5B3JF 5IVZB 4QXVA 3ZHFA 1A9VA 1ACCA 4PGDA 3MRPA 1S2EA 2JKIS 1CFSA 1X3DA 2YD0A 4FNSA 3S4SB 4W9GC 1T0NB 4EDXA 2YD7A 2FIKA 4L1TA 5HVWA 4ZUVA 2H3NA 1HESA 2X4NB 1SBBA 2PABA 1PX3A 2QLVB 3IDNB 4JM2C 4OGZA 1UZ8B 1NCCH 3JT0A 2VZUA 3VACA 3HE6C 4I18B 3DKHA 1GA2A 1P5UC 5T1KD 1GSMA 5I5MA 5EF0A 3T04D 2X6UA 4H1LA 1HK6A 1JE6A 2O5ZL 1CFBA 3KGSA 2EIZA 2WHVA 4M48H 3AJ7A 4R7DA 3V95A 4DPAX 4IU3B 4LOFA 3PPEA 1MXDA 3FOMB 4N0UE 2H0JA 3Q05A 2R39A 1HS6A 1HCFX 4YPJA 4U1JA 4GUPB 5LKNA 1HILA 3MXWL 2FBOJ 3WEXA 4BHUA 3PQYD 5CM1A 1G84A 3Q6GH 5H94B 1K2DA 3UAEA 3TCLB 4OM1L 5T8IA 4JFDD 5G4NA 1JFQL 2VDQH 3AZUA 3EYSH 1IBDA 3MNVA 1ITBB 3S37L 1WIOA 3LOWA 5GXBB 3R8QA 1S9VB 4XT1C 4NFDA 5DHEA 3K4ZA 1IZKA 4G6AD 1BBDL 2JKTM 3LJ3A 2LFGA 3QC6X 2DYPA 3N43B 3CSYB 4PGCA 1E28B 4BZYA 2BMKB 2D31A 4JFQA 1OEZW 3DRQB 2NYZA 3Q1SL 1PNCA 4IMLA 5DMGD 3RRQA 2J6EL 4BUHA 1JZ6A 1RURL 3NJIA 1TPXC 1SOQA 5I1DB 2VLKE 1D5ZA 2AI0H 4ZZFA 3OD3A 1JV2B 1A3RL 2K3TA 4U05A 4XNUL 3QIWC 3FU7A 4P04A 2H1LM 3SBWC 1SQ2N 4BDVA 4EBQH 3CSPA 4ESKA 1AHKA 1T4KB 2GJJA 4XVOA 1SY6L 1S7SB 3CUPA 4F8OA 2J44A 1XGUA 2W1NA 2BSEA 2ENPA 3FQWA 3RX5A 3HOGA 3CN1A 5FLVA 3FUEA 3D2UA 1F6LL 4OD2B 2OYLA 3QCUH 2VW4A 4LRIC 3OMNB 5E95B 4Z8FH 1MCHA 3VA2C 1MCFA 2WQVA 5AWNH 1KTRL 3HNVL 5KN5A 3ARXA 3RPIB 1AH1A 5F88B 4NO2A 2GI0A 3MNDA 4XNYH 3ECVA 5AW9B 2J43A 5MP6H 3O3AA 4HK0A 3EGDA 3RWDB 3FT2B 1FNLA 2J5LC 2O6DA 4UV7H 4EN2A 4UYPA 5F6IB 4XNAA 1HOCA 1Q9KB 1CGVA 2K8MA 4EN3C 4LESA 2W81C 1MCEA 4L0PB 4Y5XB 3VQMA 1V10A 1UUNA 3P77B 4XMXA 4M93C 4P57A 3V4LA 1CR9H 1UB6B 2MOGA 2R23B 2YN5A 3UO8B 4NZDA 5GS1C 3UABA 3V9FA 3X3GL 5I0YA 2FZ3A 4G6MH 2DD8H 1YEFL 5CAYB 2BVEA 3VH8G 1A4CA 1XCTA 1IFHH 2QHRH 4TVPE 3ULAB 4I9WE 3MBEB 1U8QA 4AGLA 1SLUA 2IMMA 2JIXB 3SGDI 2IH1A 3QAZB 4HMCA 1JF5A 1AXIB 2EDKA 4YLQT 4DT2A 1KJ2H 3EGSB 5D6CA 4F5CE 1OALA 2QHLA 5E94A 4ZMPA 2AJXH 4UDUB 1RUPL 5HGAA 4K3EH 1CFMA 2X28A 5KYYB 2WXMA 4N5EC 4A7GF 1ZT1A 4JZJA 3US1A 4XHJC 4MJHA 2EE2A 2APSA 5IQ9B 1AQKL 2VIRA 5F2FA 4MAZA 4JR9H 2AK4B 3KJ6H 4GSRA 3VXUE 3RURA 3KPOA 1E67A 4JDVA 4PRID 5CWSB 3Q9QA 4LCCA 3SDXB 5C0GB 2WZPD 4O9HH 3PIQA 5AVZB 4YHOL 1JG9A 3JWNG 3MN8A 4LLWA 5B4MD 3TNNB 2FJGA 3OX8A 5TDOB 3GXMA 3RU8H 2IDTA 1D9KA 3APFA 4TLSA 4V2CB 2F2HA 3H9SA 1VCAA 3GSNH 1IILE 4UMGA 2DDQH 5B3SB 4QHLA 2Q20A 1DVYA 5C9JB 1CZ8H 3FQNA 1FGNL 3WSQH 1RMFL 5D8JL 1I3RA 4P23A 3EOYG 4TKWA 4Z23A 1IEBA 4PJ9C 2IQ9H 2MFNA 4Z7VF 2QKIB 4NKMA 1L9SA 5J11C 2A6JB 4PJGF 1RIUL 5AG8A 3S34L 4MSWB 1WPCA 2ATPB 2CDGA 1CXLA 3D87B 4LLVA 1QR1A 3HG2A 1KYOK 4WNQA 2FD6L 4C56A 3UZQB 1DANU 3B34A 1C8QA 2ZONA 5L2KA 3BUYA 3EJCA 1J8SA 1WZKA 3O6LH 4Y9FA 3KR3H 4PV8B 3VWJC 5J8OA 4L8DB 2VN5A 3BSZL 1KEML 4KX7A 2W94A 1NGPL 1PZDA 2XA8H 3O4OC 1FNHA 4MAYA 1TYRA 3D08A 2E8ZA 3BUTA 4ZUSB 2WWMD 2Y25A 4GIOA 3TS8A 3RI5K 3CDZA 1DFBL 5ADOH 4HUCA 1BWWA 1QSFE 3BN9D 1FVEB 3K6IA 4WHCA 1Z5LB 5C09B 4GXVH 3O6FC 1Q1PA 1CS6A 2LTQB 5JQ6L 2IDUA 2PKDA 4KC3B 4B60A 4MA1C 5DI8B 3IS1X 1XAKA 3AG1B 2IANE 4UM8B 4QHPA 4X6FB 3T6VA 5IM7B 1UM5H 4P3DB 2IDSA 3CTTA 4MB3A 5AAWA 1I3GL 2OZ4L 3PJLA 4P2OB 4NAJA 3QUKA 1YNKH 2ARJA 2EDXA 3WKMH 5GRVK 4HP5A 1FH5H 4RAVA 3WJMA 4EIZC 2OCFD 3PP3H 4R7LA 3INUL 4U33A 1ML0A 1GZPB 4F2ME 5SX5K 2I60L 3GI8H 1A65A 1U2CA 4ZUUB 2BSCA 2OJEA 4XBPB 2AK4E 1E2VA 3IU4L 4PJAB 2P1YA 3LVTA 3W5NA 5DUBA 3RKPA 5I1KH 1AGFA 3SDXE 4BYHA 4X7TA 3BE1H 3BWSA 4L3FA 5B7EA 4BZ2H 1JI1A 3N55A 1KIRA 2BDNL 1WFNA 1M7IB 1JFHA 2WBJB 3QG6B 4FHKA 1XH3B 1ZDQA 3AG4B 4MJ6A 2Y24A 3UTTB 3MGAA 1I3VA 2FH6A 2I5YL 4JFEB 3RJDA 3POHA 1FFPA 1IGJB 2CDFA 4HH9A 2AJ3B 5K59F 1DBMH 1E4XL 4P2CG 2EIMB 1J1XL 1XSOA 2AV7B 1KYUA 1Y1UA 4EDWL 5EBMA 4PP1D 1KCLA 3UZVA 2HVBA 1NC2B 3EG9B 5HYJA 3UAJA 2EVFA 1T1XA 2EH8H 1ZHKA 2WZ0A 4KRNA 4OTXL 3ZDXE 3WJJA 1N70A 4C8XA 4L5FH 2VH5H 4KJPD 5JR1H 4G7QB 5GS3A 4NKIH 4LCYB 4XX1E 6FABL 5FPIA 1S8DB 4QRSA 3V0WH 2O61A 4N8CH 1OCWH 3CXHJ 4X9IA 2YKKA 2PW2A 3VM5A 4NM4L 3RUGA 4Q14A 3TM6A 1RL1A 2XJLA 3QEHA 1A4AA 1P7KB 2BC4B 4DUWA 1PEWA 3GBML 3JV6B 2XZAL 5AW8B 2K9FB 1INQA 4TSCL 2EDEA 4U6XB 1GAFH 3GIZL 4MDRA 1WJ3A 2K70A 4JHUA 4K9EL 3R8BB 3MFFA 4NNPL 1MJ7L 4PJXA 5IFJA 1S9WA 3MJGX 4WW2F 4QWWC 4OCXH 1E43A 4HUXA 1BSIA 3DHMA 3GMQB 3HBQA 4PG2C 3MU3A 1Z5HA 1T04B 1NUFA 2AEWA 2XIDA 3UDWA 1A9BA 2AV1A 5GGVY 4IRSD 5JPNB 1KPVA 1FORL 1QI5A 2WVVA 3B2PA 3L4XA 5HHOE 1CDJA 3BZFB 5FF6A 5F1IA 4NCC2 4KZEL 2W91A 5F1NB 5I23A 4XRCB 5GSRA 1HZLA 5L8JB 4HEMA 5K9KA 5KVMC 1VPOH 1WHPA 4M6OL 5JOPD 2OL3L 2VXQA 5I5JA 2F53D 1GTFA 3FF7A 3WXVH 5T33H 4I3GA 4W9LC 3TBTA 4BUQA 3TVMD 4PS3A 5FAAA 3U6XA 6PAZA 3RZCD 4GAYB 4PJAE 4YS4A 3F6IA 4P5MA 3T0EE 3L4ZA 2V8LA 5BQ7A 1OPGL 1CU4H 3BHBA 4ZTOL 5J5EA 4LOUC 2ZUXA 5B39A 3LDBB 3FUHA 3MX0A 4X9GA 4ADJA 3U4BH 3LB6D 3K81A 4BE5A 3OMIB 4PUBH 2ZG3A 3N50A 3UTTE 4JFEE 4K73A 1BXUA 5LB1A 1BF2A 3P4NA 1U41A 2D0HA 1PQZA 2AQPA 4OSUL 2VQ1A 5CJQH 2D9QB 4FQHA 4MXWL 4PRPD 4X0KA 1H8OA 2VW6A 5E6SB 3IU3B 2IV8A 4RQQB 4GSXA 5E2VL 5G2NA 3U4EA 4AVKA 1T1YB 4F8LA 5DJ6A 4GKSA 1IBFA 2V5TA 2YUVA 1MH5A 3ECWA 3RE0A 3MV7A 4M6NH 1KT2A 4UAOC 3U4AA 5IOPB 5I8CB 4WAFA 4GBXD 5JHDB 2B5IB 3OBAA 4PJCF 3GMRB 3ML8A 3GNMH 4HC1A 2F19L 4F9LA 1E5UI 1T2XA 2Q5BA 3QDME 1A64A 4RETB 4TULH 4Q74A 3EF4A 2N01B 2OMTA 4HD5A 1WH0A 5EB9A 4NZFA 5K93A 1YECL 2QSCH 2J88H 1ND0A 5CZXD 2BRRL 5CHNB 1NC4B 3L08A 3V0AC 3QZLA 2FUQA 3QIBD 3QWOB 4PP2B 4BHUI 3SBWA 2W88A 1ZGLB 4MMYB 3PHQB 4K7PH 1I4FB 2TRYA 3HUJB 2VDNL 3SY0B 1V54B 5JHLA 1EAPB 3S5LB 3UG4A 4H5SA 3V6FA 4XPFH 5HP5A 2CHXA 3FBKA 5C0CE 1T03H 2C9PA 4YHKL 3ZTJG 4FFVD 5J6GA 2EADA 2Y9RT 3WO3B 5C8JA 1DL7L 3DX7A 1U8IB 4MLSA 3C5JB 2VERN 2PWGA 5IIEB 1H0DA 1ZHNA 2C3WA 3CV5A 2Z92A 2HLFD 4EUPB 1JF1A 3UYRH 2CKBA 3OHXA 4E9RA 3X12A 1G1OA 3FH7A 5D1ZA 3GSRA 2NY3D 4LSRL 1Q0EA 2DI7A 3BDYL 3HEIB 3L8QA 3MRQA 4GLRI 2NCMA 4O5LL 1PZ5B 2IPUK 3KYMB 4YLBA 5FO8A 1DVFD 1JWMB 2UZYB 4TLUA 2B08A 2X2HA 1IEAA 1SMOA 2HX8A 4KWUA 4UB0L 1U2HA 5F7HA 1C1EL 2CGZA 4WWOA 1MCDA 4BV1A 1DEDA 3FO2B 2Y5QA 1BQRA 5T1MB 3ZYJA 5A2AA 5H2BB 1J8KA 1WK0A 3MPCA 1O6VA 2ZUQC 4K94H 3IRPX 2DWDA 1ZLEA 2BFVH 4FTVB 2G0KA 1F4XH 3L6FB 4NIKB 5IJKA 1CFQB 3PFUA 1OF2A 4KTGA 3V0FA 2O5ZH 2YD9A 4M1DL 2HPTA 1A7OL 4XNQB 4QRAA 1T3FB 4JQXC 5F9OL 2GSIB 3EH3B 1FN4B 4S0SD 3QWNA 4TVSa 1L9QA 2VOTA 3GMLB 2R2EA 4XMLH 2WC7A 3EFOB 3QC5X 2VC2L 1QFHA 4L1BA 1RY7B 3MXWH 4LNVA 5TE6H 3ARSA 4KQ4L 4BQBA 4JFTA 1DQLL 5JHDE 1FIEA 1HH9B 2PCPA 1JFQH 5EZLA 2X05A 3AG2B 4PCSA 5C7XL 4FL4B 2BNUA 2WPGA 3S37H 1D2OA 1KB5A 5DHYA 2WKGA 2J1YA 4P3CH 3MRIB 3G04A 4F33B 3QCTH 1NFIA 4I2XE 5JNYA 1K6QH 5CEYA 1TLMA 3NN8B 1S9YA 4X6BA 1J5DA 1XMEB 1E7VA 1N5AA 2C3HA 1R75A 3N6YA 5K1NA 1QEXA 2OMWB 3TCTA 1BIIB 4HCIA 3FSAA 4ADGA 4ETQA 3C60C 3NEOA 4XMPH 4PJ9A 3VU1A 3HI6H 1RURH 1U3HB 1ZA6B 3D39E 3N2JA 4N6RA 4X8CA 3T4YB 4NYLA 4OZHA 1A3RH 2HN7A 4NNXA 3FUDA 4XNUH 5CEXB 1M7UA 2WUCH 2IDQA 1B90A 2X4UB 2VLRB 4YE4H 4P4KA 2CRYA 1YY9C 5EPMA 4JANB 1P4BL 3U7YH 4J28A 2CIIA 2P24B 1SY6H 3LQMA 4QHNA 5DD0H 3V4PA 2J1KA 5IUSA 4LNRA 4KRPB 5GZNC 3ULVF 3V0IA 1A4JB 3VWJA 1GYCA 2VSKB 4EKJA 5JTWA 3BP7A 4FGMA 2BS71 5F3FA 5KSVB 2KBGA 1WP6A 5FUCC 4XNZC 5J3HC 1D5BB 4LGSB 1K85A 5JMOC 4AEIL 1KC5L 1ZTMA 2ZF8A 3CU1A 4BKLB 5E0QA 1JNJA 3GLZA 3ZMRA 1CF8H 2ODHA 5EIVA 1OCRB 3CSBA 4Y4FC 2VSCA 5DJAA 2XX0A 1T21B 3FU3A 3BVDB 3UEZA 4DGWC 1AANA 2VR7A 4R4BA 5DLML 4FTVE 3X3GH 3OKNB 4HG4K 2NY0C 4NP9A 1MFCL 1MFBL 2X2YA 3L3HA 1YEFH 3QEQD 4KI5D 4X8JB 3WL9A 3C9NB 3R06B 3TZVC 3WFDL 1KOAA 4GUQA 2VMJA 4XC1L 3S36L 4LQFL 1P9MA 2DL2A 3E3QE 5GGRB 2CA4A 5KSBB 3IJHB 3JUZA 4BK5A 4UQEA 4D0DB 3DDFA 3TJHD 1EX0A 4F37F 1RUPH 4Z7NB 3MREA 3LH9A 5DEZA 1ZLSH 2AQTA 3C5SA 2JCCB 1UVQB 3BQUD 3ALPA 4X99B 3TEYA 1YC7A 5KSUB 1AQKH 5FECA 4ZFOB 4Q9BA 1ZHLB 4QF1B 4UOQA 2G9HA 1U8NA 3CZLA 1FE8H 4GW1A 5C3TA 3QRBA 3O9WB 4YHOH 4PJXF 2YWYA 5JXED 1IGTB 4HJGB 2DN7A 1RZJH 2VABA 1S7WB 4IIZA 5C0BD 1HCVA 2BP5M 4KKLC 3QXAB 2GFBB 4X4XB 1OGAB 1WVZA 1RMFH 4U6HB 5D8JH 3L4YA 3TEXA 3IYLW 2DM4A 5I1GH 2KZWA 1XBRA 3Q8FA 5DEGA 2PTTB 4X9FA 3VXPB 1YZZA 4ZMYA 3C8KB 3LVEA 3JTSA 5BRZA 4FF9A 1IAIL 4KDVA 4K3DL 3DYMA 3B1UA 5IT2L 5KANI 1MNUL 2WTRB 1LWHA 3B5HA 1KLFA 3CU7A 4M6AA 3K7UA 4ODXB 4KK5C 4AW4A 5D7JB 5KYUB 4WSJA 2YR3A 3CFIC 3TESA 3N0PB 2IO5A 2HAZA 4S1RL 3T2PA 3BPLB 4K9EC 2EIBA 5KUMA 4APQD 2X1WL 1LK3L 5HDBE 1A6VL 3MNZA 3OJDB 3VA6A 1GOGA 2Z6FA 2WWOA 1KEMH 1NGPH 1QBML 5C7ZA 4LAQL 1IM3D 3L3OC 5FKPB 4HAGA 4BSJA 2HA1A 5D4IA 1DFBH 3GSOA 4YVNA 4OBSA 2IXQA 3UX9B 2QKSA 2NCEA 2XI9A 2YSTA 1BM7A 1QWUA 1D5XB 5JQ6H 2O5XH 3HHSA 3NABL 3O41B 4G6KH 4IRJD 5I82A 5KAQG 4RX4A 2YIHA 1AFVH 2PCYA 3FAXA 1NCOA 3OKDA 3FT3A 4YUEL 2BVQA 3AS3A 1DQDH 3QXWA 1OTSC 3VMPA 4OQ1A 2XBZA 5KSBE 4PCTA 1IM9A 1I3GH 1DR9A 1EHNA 1BZ9B 3RA7L 3O3EB 3ARED 1JUFA 3ESMA 2CBPA 4WZ9A 3VI4F 4QOKE 4KITB 1GPOL 4JLRA 5BO1H 5T1KB 2X6CA 5SV3A 3MA7B 1FNEA 1ZLUK 1PJWA 4GAJL 5C3IA 3L7FA 3NRFA 2OTWA 1AG0A 4OF3A 2IC2A 2AABH 2I60H 2Z8VC 3WV0A 1I9RH 1N3NB 4F7PB 1KACB 4WEEA 5FGBC 1OP9A 3IU4H 5E8EB 1TJGL 4TNGA 1FUNA 3EYFA 1RZFL 1DJWA 2NXZD 2YLHA 2YFNA 2ZXQA 4RNRB 5D4QA 3V0VB 1FZMB 2AGJL 2BDNH 4ILDA 2YXMA 1CLVA 4JFZL 2P5WE 4GEIA 1ILSA 1WSST 3PQYB 5EZIL 2ZF9A 4N9GB 4Y89A 2DWSA 3GJEA 4H25A 2MTAA 5DZVA 4JFDB 3P4LA 3HBZA 3BDXA 1A4BA 3MRLA 3NP3A 1AHMA 4U1LA 3HCVB 4B9FA 4F2EA 4QY8A 4K3GA 43C9B 4B3EA 3N1FC 4QI3A 4CL7A 1OGAE 1J1XH 4NQSB 4L4JA 4M3HA 2ZX5A 1XL4A 2D2CC 3REVB 1SLXA 4KXAA 2LAAA 3PWUB 1MW3A 1KCVL 4OTXH 1N0XH 2J6EA 1DQKA 3AACA 3JXAA 2W0FA 1I9IL 1TVHA 3DO3A 4U7SA 4MWFB 3K2MC 2DLTA 2ZYRA 3MMEB 4NHCH 4H0LC 1XH1A 3TCXA 4NM4H 3MXVL 3BKCL 3V0EA 5HHVL 2VZ1A 3FNKA 2FJFB 2I07B 5EDSA 4DVBA 3GBMH 2XZAH 5DF0A 4AMWA 4TSCH 4W6YB 1YPZB 3JV4B 4ZUTA 3U1SH 1ACZA 3GIZH 1LO3L 1W8NA 3I02A 5DSCA 5HYSG 1EK3A 4NNPH 1KCSL 1MJ7H 1DZBA 1OARL 3H2QA 4FNRA 3ROOB 5EN2A 4BQ8A 2AEOA 3V0GA 5ABDE 1OWRM 4HYTB 3V2AR 1Z6JT 1UA6L 2J8UF 4GUOA 4M5YL 2CPCA 1MCRA 3U46B 4BKSC 5IHZA 5KUKA 2W8CA 3G5VA 1JYNA 2XBDA 3UP6A 3GXIA 1FORH 5KSAD 2B3RA 3F83A 5BVJA 1C12A 4KZEH 1HVXA 3MJ9A 5LNGA 5TH2B 2NTSP 1H3UA 3ETBJ 3QQ9C 1JPGA 4XNMB 5DK0A 4F7CB 3C6LA 1XXDC 2FR4A 1QATA 3F05A 4AH2B 4K3JL 5DS8A 5I66B 3TO2A 1P7QB 4L3CA 5HHQB 4Z7UE 4FYRA 4U1HA 4L29B 5HGGS 4AQEB 4Z6AT 2V7NA 2CD0A 4HT1L 2DB8A 3T1FB 3QHZL 1CE1H 1OPGH 5C0ND 2F7IA 4PRNA 3IXTB 1FV1B 12E8L 5D1XE 1NGWA 1KN2H 4IU2A 1SQMA 2DQEL 4YO0A 4JFFA 4OZHF 2AXFB 3JVGA 4HEPA 3QP3A 4LSTH 4XVUD 1QRND 1UADC 1WWBX 1E9OB 3ARZA 3E8UL 1SN5A 5DUJA 3WG7B 5K9QG 5CBEA 1J0JA 3DOSA 2YEQA 3MV9A 3HE7A 4TUJB 3KPQA 4AIOA 4AM0B 1HNYA 4OSUH 4A66A 5LVEA 1EANA 4F7MB 5JDSB 1UA3A 1DQJB 1OSEA 4U4BA 1FNAA 4E68A 2R9HC 5FDYA 2V2XA 3ISWA 3QJXA 3A3YB 2R83A 1G7QA 4L4VE 1X5LA 4I0KA 1V55B 4ES8A 3PYCA 4MBOA 3MLRL 2FX7L 5MEPB 1RLWA 4LCWD 2K8QA 1TZHB 3KGTA 3QEUB 5D4HA 3MJ7A 2PCFA 1AP2A 3R19A 1WBYA 2X89D 3MKGA 4AITA 4DNLA 5TF0A 4Y2DC 3SOTA 1WYJA 1EEYB 2A83B 4I5BB 4I89A 3TN0C 1J8HD 2F19H 4J3XA 1P69B 5LGJB 1G7HA 2X6MA 4MA3A 1FL5A 1SHSA 2EQDA 2Y6TE 1QPKA 3MUY1 4ANVA 1GOHA 2LLLA 3UJIL 5SWSD 5IWLA 4P2RD 1JZHA 2BRRH 3GBDA 3L81A 2ZUSA 4DJMA 5B7MA 1G7IA 3PJSB 1LNUB 2EAEA 2GITA 4UU9A 3BDBA 1YPZE 1JMXA 3HS9A 2DWEA 2QQNH 4PWKA 2BNRD 4OCLC 2ICWB 5HHPB 5EA0L 2AF2A 5EIIA 1I7ZA 4OLXL 5B8CA 3EYOA 2X9YA 3K2UH 5FM5M 3TC9A 3BPCA 2QGDA 2R4RL 4YHKH 3U2JA 1CI5A 4PJ8D 1DL7H 5GZNA 4HUVB 4LKXA 1NDMB 3O2VL 1RZIB 3VFPB 1BAGA 4FKHA 4ZMWA 1LO0H 3MCLL 4M7LH 3SKNB 3F3HA 3OZKA 4GMSL 3W0WD 2A6DA 4MTMA 3VNYA 5CEZD 1N59B 4MHHI 5D9SA 5ERWB 4MNGB 2DLHA 3P4MA 1Z0NA 3FBQA 3ZKND 1I53A 2YLKA 3ELAT 5FB8A 3GXTA 3KPNA 3K91A 4LSRH 1QUPA 3RWJB 3N1QC 4DP7X 3MSPA 2K45A 3VFUA 3CIAA 3BSGA 5FCUL 4XO3A 3HC0A 3LN5A 1NBZA 5HXMA 1C1EH 2VYRE 4MGXA 4X80H 3V5HB 2OZ4A 1WFUA 3CVHL 2ZXBA 3TO4C 1GH7A 1LE9B 2YA1A 3M07A 4X7FC 2QDWA 4CVZB 1LGVA 3EJYD 2E9WA 2Z31D 2ARJQ 3ASOB 1CB4A 2PCXA 3TZVA 5EUOA 3FO0L 3H7BA 1PVHA 4NOFA 4PRBB 1WUNT 2NY2C 4ZMVA 2A9AA 3BVVA 2W9LA 4G80A 3NCYS 2WLHA 3DOIA 1HU8A 2OCCB 3C5ZC 4R8WL 1CCZA 4IBUA 1EO5A 1GR7A 2AJUL 1A7OH 1IGFL 2IQAA 5F9OH 1PG7X 1X6LA 3TLRA 3L4VA 4Q6IA 5L4JA 5HJBA 1XF3A 4ODWA 5D5MB 5JLZB 2N1KA 1MEXL 4GY4A 5AOKA 3T0BA 4HHAA 4L1SA 1P84K 1IAKB 4GQQA 1DUZA 1IKNC 2H0EA 4PTUB 5K1VA 2JTYA 4KQ4H 4HS3B 1XGPB 2OMYA 3W11C 4DN4H 1HFUA 3FCTA 1BFVL 2Y6SD 4OZIE 5C7XH 5F3BA 3F2LA 4PN6A 2AS5M 1IRAY 1QWHA 1AZCA 3AFLA 2BNQD 4JPVL 4Y1AA 3MBEC 4TQIA 5DGRA 4OGAD 3BMVA 5T3XE 2VAAA 4KTDL 1UACL 3TV3L 1ZAGA 2FECL 1J5IA 3LZQA 4R7VA 1PKOA 2DMKA 3EFFB 1O7DE 1K4DB 4XWGL 4QJ4B 5DT1L 1ID2A 1CYXA 2KQNA 2AEIT 4TVPH 1OM3L 4POZD 4N9OB 1QHPA 2YO3A 3PHOA 3NJJA 4DF9A 5E1AA 1E4WH 1JHLH 2WW8A 3D3VD 4KK6D 4NQEA 4UTBL 4IIQB 1XGYL 3ESUF 3ZKMC 5I8EB 3H85A 1OAYH 3FFCA 4BFBD 1AY1L 1GZHC 4NWTL 1MF2L 2K3HA 4HKZB 5IMLA 3GSQA 4X5WB 5AOLA 2NMSA 2GTQA 2F54D 2I32A 4WSKA 1I31A 3AU1A 3CCHA 4LHQB 2UY7B 5CFAA 3RWGB 1I8KB 3KGUA 3LQZA 4QO1A 3IETB 4K23L 4TUOA 1CF1A 4XO5A 3T3MB 1MG3C 3U2IA 2I9TB 4F15C 3VFWA 1OAQL 3HZKB 3STLA 2E59A 5L9DL 3ZDWA 1I3UA 2HYMA 5D72L 3FTYA 5B1JA 4RRPG 2X0UA 3P4OB 3HRPA 5F3HA 3WIHL 1JZ3A 4AEIH 4IRSB 5I74C 2P8PA 1XD0A 1HAUA 2XWRA 3F58L 3G5XB 2Y1AA 2KLTA 5ICXB 1U33A 2OL3A 35C8L 3HC3L 1T1WB 4X2UA 5DJXB 2XXFA 1LDPL 4OCRL 1ZLVK 1MFBH 3B9EA 1T5WA 3WFDH 2EYSA 3B9VA 3Q5TA 3L95A 4OM0L 1Y0LB 3S36H 4WU7B 3TH3T 5JIIA 5CIPB 3CLEL 3TOPA 3X1EA 4HUNB 1ZXQA 3KLQA 4OH2A 1X5XA 4IJ3C 4MMXC 1JHKH 5FA4A 2ZWYA 3RL2A 1U92B 1ZOXA 2IALA 4G42A 1A6TA 4PS4L 2K4WA 3B7TA 5I1EL 3QO1A 4M9PA 4OV5A 3ZO9A 3MLPA 4PRPB 2ZWLT 2YAPA 4I0PB 3SCMC 5C0DA 1XZ0A 1MCNA 1MFEL 2G5BA 3I9GL 3AB0C 4C57C 5MEOA 3ERXA 4V2BA 3ARGC 5JA9A 3EO0A 4MDJB 1NANH 1QOKA 1T66D 2J6WA 3CFKA 4ABVA 2NT0A 4GBXB 1A2YA 2Y22A 4JREC 5BUGA 4U49A 4X6CB 4DGIL 2BX5A 1OAXL 1XF2A 2M26A 2NY1D 2L7UA 1MQKH 1SFDA 1T6BX 2E56A 1INEL 2DQUL 2R1YB 1YEDA 1ROCA 4PLOB 5E8PA 2EO9A 4LRNL 1U95A 3T0EC 4HIJB 5FK9A 2DLEA 5HYEA 3QIBB 3GIVB 3F12B 1NGXB 3CFBB 2WAHA 3P69A 4K3DH 5IT2H 1D7DA 4P4RB 3B37A 5B38B 3CC5A 3GZPA 4CBPA 4N0UA 5F9DC 5C9KA 5DC4B 4FA6A 5SWQB 3CXDL 4TL5A 4S1RH 4BGDA 1MHEB 4FXKB 1S78D 3SDCC 4JFVA 4PJHB 5DTFB 1LK3H 1A6VH 4AV5A 3B6SB 3KPSD 3GUTA 5C0IA 2VLJB 1QBMH 1SJHA 2L04A 4LAQH 3K6SB 5LQBL 3AAZB 5EU6D 1NCNA 3EF7A 2AFNA 4RFEA 4QPEA 1I1YB 2UXGA 1IQDB 2F8IA 3WDIA 3D52A 4BEIA 3NCWA 2H32H 5IW3A 4F7TB 4WV1B 1DVXA 4WCYL 2QQLL 1HHJB 4MS8C 4WWKC 4YUEH 2XWTA 4ZS6C 5L4IA 4MMZC 1DCEA 5CU5A 1I7TA 1KIPA 3VFNA 1AAJA 2VLKA 2OSYA 3N40P 2ZSWB 2V2WB 4GRLD 5FGRA 3UTSB 3WLWC 5ID1A 3RA7H 5ACZB 5LCVL 5BZDA 5DUPL 1Z3GH 3D18A 1G5AA 1ICTA 2WXGA 5DYFA 4Z3FA 1GPOH 2RCSL 1IBHA 3PFQA 2DJMA 3D5OF 2XPZA 3P54A 4GAJH 5AKRA 1E9QA 1X4YA 2V7HB 2XXMB 4UT9L 2O93L 1RIVL 3K8LA 2D4DA 2YPKB 3TEWA 5MHSD 1RZFH 1HN1A 3ZLQC 2VDMB 5AOZA 5EU3B 1CYGA 2FWSA 1R3JB 1MWAB 3MTXA 4HZAA 4L3EB 2UYLB 3AABA 3P40A 4WJ5B 5DQJB 1EZLA 2PW1B 2YC1B 3BVWA 4HJIA 4RA0C 3GMPB 4KFZC 1MW1A 3MAWA 1SYVA 4Z95L 4ISVA 5HVHC 4KVCL 4WFHD 2BSBA 4X6CE 5D2NB 3BH8A 3DSNB 3JTTB 4TNFA 1RP9A 3RWIB 1COBA 1SVZA 2V5MA 3RG1C 4R90H 4Y2DA 3IJSA 2B2XL 3QUGA 2ZCKL 3M1CA 1CQYA 1L9OA 1URIA 1WAAF 1KTCA 1NEZB 5AAMA 1KJVB 1Q9WA 1KCVH 3PNWB 3UTQB 3D2TA 5F9WB 1A6UL 3FQTB 1SN0A 1TJIL 5EZPA 2X44D 1ASPA 1PAMA 5F7EH 3L5XH 1VFOA 1M7DA 4G8EB 1ZDSA 4AQOA 4ZNEA 3H42H 1AQDB 4GS7B 4NQCD 2DF3A 1IU1A 2FL5B 3BN3B 3QQ4A 3RNKB 2QADC 1OPOA 4K5MA 3MXVH 3BKCH 3BP5A 4MKMA 5EUOF 1KCRL 3WN5C 3KLLA 2VLJE 4YDJB 1Q94B 3LQAH 2BOBA 2VR6A 3VRIB 4MXVF 3G6AB 4WJG3 3UBXA 3VTTA 1PG7L 1KCSH 2B5IC 1OARH 5IEHB 3VXMD 5IGXL 1OY3B 2FSEA 4PW4A 3MRHA 1DLFL 2J57A 3LRKA 4A7TA 1UA6H 2ATKA 4YNYA 4M5YH 2C26A 3RWCB 3S35X 1NFDB 15C8H 2DYPD 2XNAA 2GEEA 2L4OA 4R96B 2E6PA 1OANA 2ARWA 2X4PB 3FU6A 4XAKD 4AL8H 3TYFA 2R2HA 4B53A 3UTSE 3WD5L 1R3IH 3KWXA 4P46B 4MQSB 4PG9B 1VGEL 4MCZA 3WN6A 3HAEA 4N22A 1K3ZA 5E08L 4DZ8B 3IGAA 1QA9A 1KBGL 3K6FA 3SYOA 1YG9A 2OTPA 3TO4A 4BFGA 1M6UA 4K07A 3RPBA 2CO6A 2YHGA 3EGXB 1SBSL 3QEQB 5G5DA 4K3JH 1VFBB 1PDKA 4PJ7A 3HZMB 5AVSB 3RVXC 3EYUH 4WUUB 2Y23A 3NTCH 3H6AA 3RWEB 2YA0A 4HT1H 1BZOA 5JHBA 3OKLA 1XGQA 12E8H 3QUZC 3PWLA 3OPZL 1KTLB 3ARFC 3WCYA 3FB5B 4L3EE 4M61B 1UJ3B 4X7SL 2R8SH 3A4FA 1XH2A 4HZLA 6PCYA 5L0QB 5GS2H 3E8UH 2FB4L 3BQUB 4MQXC 1IC5L 1MVUA 1QKZL 5E70A 3TIEA 4ATTA 3HKFA 3B2XA 2VL4A 5T1DL 1KPUB 3B9DA 2MMXA 2PPFA 5D2NE 3VXNA 5FYLE 1IKNA 1EZVY 5JIHA 1SJEA 5FDWB 1O5DT 4LB8A 2Y5TA 1QSFA 3GRWA 3O45B 4Z3TA 2CNZA 3S88L 1TTRA 4HG4J 4HIHB 2CUIA 2FX7H 1MW0A 3ZMEA 1FFOB 4BQCA 4O2EB 5EOCL 3DJZA 3F7YB 5CJXA 1N8ZB 1YYCA 2ID5A 5A2CA 3L2MA 1FVDB 3FN9A 3KBFA 4N2CA 3UIYA 4ELKB 2HTKC 5C0BB 1QUNB 1F4WH 3H7LA 4ELMA 1CFTB 1F4AA 4JKPL 2NY4D 3G6JA 5DQ9A 4JRLA 4ERSH 4CMMB 1S9XA 1X4ZA 2VJXA 3Q2CA 4JZOA 2W0KA 4KO5A 3SDDB 4A2GA 3E3QC 5KJ7E 4JRYA 4F2MA 3WNPA 3UPRA 3T4AB 2N1TE 1XEDA 1C16A 1QFUL 2EUWA 3WFZA 2F74A 1ADQL 3MR9A 1N5YL 1VA9A 5SWZB 4HIEA 2A6IB 3DIFB 3LIUA 1GZHA 3MRJB 3KS0H 4DFIA 2FYYA 1TZ8A 3MRGA 5L7XH 5TFSL 5IVXA 1E4XI 1AJ7H 2R4RH 1Z9OA 5DJYA 1PFCA 2UWEB 3L3DA 3QJUB 2H3KA 3MNWA 3WGUB 4XTRC 4N0CD 3OJ2C 1BVNP 4KROD 2AHIA 4EE2A 3I6LD 4G6JL 3MCLH 1U58A 4G9DA 3UPAA 3QULA 2LT9A 3MBWB 1AO7A 1NBYB 3GT6A 3VDAA 4KKQA 1CTOA 2Z35A 3HG1D 1A1MA 5IQ7H 3HJ0A 3RVVD 3ZL1A 3GSXA 4R4FL 5T3XL 2VRAA 3T71A 1AIZA 3VXRD 3SYCA 2YRPA 1XMWA 2F1BA 3HC4L 1BD2E 1EAJA 5I6OA 4KNSA 2WANA 4Q58C 4WUUE 5DRWB 3SKOB 2Y1VA 4MB5A 1XB8A 4FD0A 2C3GA 1OB0A 4BH8A 2E9GA 2VR3A 4A6YB 3NSFA 4M1CC 2GC7C 5FGCB 3RKDC 4FX5A 2YEVB 3FO0H 2B7DT 3KJ4C 4I1PA 3MV01 3HRZB 4LEBA 4APXB 1ES0B 2C4FT 2EYRB 4XBMA 4EUPH 1HNGA 1LM8V 4R8WH 1U8CA 3PP4L 2AJUH 4MAUL 5L2JA 1IGFH 4XN2A 2YGQA 4MAYD 3IFLL 2HJKA 4MMXA 2NXZB 3VG0L 5IJVB 2FRGP 3WFCL 2QGEA 3ZIYA 1R9FA 3L1GA 5TK4A 5I16A 4AGNA 1RUKL 1OVZA 1K8IA 4WY7H 1Y07A 4HSQA 4OR1A 1ED3A 3KBEA 5FA3A 2A77L 4GRWB 3EYQC 5IHWA 5HHOA 3VJ6A 3D06A 3ARGA 3LKPB 1BQUA 5CMAA 1A7NH 4JPVH 3VG9C 3I3BA 1LEGA 3ZR5A 5JA8B 3C6SB 4X5XA 2OMXA 4TUUA 3VGAC 2ILLA 3TV3H 3I6GA 5CGYC 5ISZA 3QI9C 2DMHA 2WLLA 1Z9NA 3NUKA 2HTLC 4FFYL 5DT1H 3NGBB 5SWZE 5LBSL 4WK0B 3SPCA 1OM3H 1UXLA 5E5RB 3VSVA 5F71A 3T0EA 5LHDA 2VXUH 4XCYB 3BUPA 4PD4J 1XGRB 4BIKA 1EEQA 4UTBH 2AVGA 4W93A 5HHNB 1VJSA 1GHFL 4FQCL 3B3IB 3HN3A 1XGYH 2UWEE 5I2IA 1JZ5A 4NDMA 1XTMA 4LP4A 1AY1H 5DVPA 3EJUA 3QORC 2HCZX 3F84A 4JY4B 1UXWB 4IHBA 4JM4H 1OCCB 4PJBE 3RZWA 4AGQA 3O9WC 4M8QA 4BKTC 1MDAA 2DQGL 2NZ1A 3LYRA 3AGWA 3S9DB 3LKNB 1FGVL 1QD0A 4ODTL 4K23H 4XMKH 1EO7A 4E9QA 3BZ4B 4P8QA 3WIFA 2PYEA 1OAQH 1QVOB 3G3LA 4LKCA 5EF3A 1T89C 2XICA 3K80A 3MJ8B 2HB0A 5T1LD 4J1UB 2Q87A 5L9DH 5D72H 3WNNA 1JWUA 1U8HB 3QFDA 1IGYA 2Z91B 1U93B 4QTHA 1ZANH 3K6DA 2JKSA 1NCWH 1CXKA 1G1CA 1DFXA 1U3ZA 2W9DL 2ZCHL 3QJQB 4BXVA 2A73B 3QDMA 3F58H 3DGGA 1UB5B 4WWKA 5FGCE 5MEND 4KJQC 4J8RB 3MV11 35C8H 3HC3H 1KJMB 1YEWA 2EXYC 4MD0A 1QBBA 4MMZA 5HJ3B 3ZE1F 1JXGA 4KV5E 1EV2E 3LZRA 4OCRH 4MQTB 2IWKA 3NFPB 2ZXCA 5I5RA 1IBBA 2YXVA 3BW9B 4UZUA 3FN3A 3D0LB 1Z9SA 3LN4A 3LNDA 1KFAL 4MNHB 3UJJL 3H4HA 1YEJL 4HAFA 3U83A 3FONB 4FI7A 4XBGA 3IJ9A 4NENB 1NMAL 3TJEL 3J7HA 3FTGB 3Q3GB 4KNUA 5C0CA 2MQGA 2H5UA 4H13C 5I5IA 3A47A 3VSUA 4RFOL 3CLEH 1UQSB 3QVAA 2BO0A 3G08B 2KHAA 3VFRB 3FC8A 4G8FB 4NPYA 3X2QB 2HP4A 4YHNA 3WS3B 3DHPA 4Z0XA 3IE4A 1QRNB 4N2NA 4Q9CA 2BVOA 1T1ZA 4GG6F 2BVPB 2DIAA 3LEYL 4GRWE 4MYPA 4ONHB 5EO9A 1X5FA 1CWVA 4L18A 2YAHA 2X6VA 3NACL 1B88A 5I1EH 2DS4A 5TD4A 4B41A 2QPUA 2YKLL 1JRHL 3BD5A 4LVNC 4PJEB 1BZ8A 3DX2A 2CRIA 3OKEB 4N4YB 3MHZA 1MFEH