2E56A

Crystal structure of human md-2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
EAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human MD-2 and its complex with antiendotoxic lipid IVa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Lymphocyte antigen 96
total genus 25
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e56A00
3ULAB 2HKAA 2E59A 3RG1C 3M7OA 1AHKA 2Z64C 5IJDC 3B2DC 1KTJA 3VQ2C 1XWVA 1NEPA 5KWYC 1AHMA 5IJCC 1WRFA 2Z65C 3WEAA 3FXIC 3T6QC 3VQ1C 3MU3A 5IJBC 4G8AC 2F08A 3WEBA 3MTXA 2E56A 1A9VA
chains in the Genus database with same CATH superfamily
2WVUA 2PYED 3DUUA 4RSVA 2QQNL 4J8RA 4JRYA 4HUWB 5L88L 1QLFA 3B2VL 3QUXB 4KKAD 1ZHKA 2WBXA 2VZTA 4QCIA 3RHWK 4U3XA 3OKMB 1HWGB 2NUTB 4B7IA 1PDKB 4BKSC 3PGCB 2NT1A 1JXFA 2P4AB 4BRJA 2BVQB 1C5DB 2QKIB 4S0TD 1KC5L 4GLRH 1ECZA 3CC1A 1FGNH 3RNKB 2AP2A 3VXRA 3E9TA 4PRID 5D1ZA 1OOWA 4KTDH 5IKCA 4LCWE 4M00A 2OMXB 1QKZH 2I9TA 1JNNL 2IPTH 3TA4D 1RERA 1V3MA 2DD8H 4KZCA 1WZMA 3TURA 3UEZA 4OY9A 1UXMA 3NJHA 3KXFE 4P3DA 4ZX4A 1HYSC 2J8UA 4NENB 2Y9RT 3VFWA 3NBNA 5IB5A 1QTPA 4UM9D 3H53A 2ZP8A 1BCIA 4HSAC 4LSRH 1EAPB 4W4NA 4Q58C 2NPLX 4X8JB 2BDNH 4F91B 1WZAA 2KDYA 3OKNB 4ZTPL 1U95B 5L2KA 1N5YH 1G6RB 1FPTH 1JVKA 4F15C 3T2LA 3K2UL 2IAND 2WWKT 2BSBA 1MHPL 5FWQA 2XPYA 3BQUB 3V0WH 2PXYB 4NJAH 1EERB 2DOCA 3NH7H 4B60A 4Z6AT 3JZYA 5I18H 3MRBA 4FG0A 2GTQA 2FTAA 2AEPH 3IDGA 1F02I 4GXUN 4KXZH 1RUKL 3IAGC 3BO8B 4U6VH 3ZTCC 3GKWH 4JHBA 1YQVH 1CXLA 3SGEH 4Z23A 4LESA 2VTFA 3EBAA 3TWYA 4QRPA 2JJTA 3QYMA 1V3LA 4UT9L 4KRLB 1AR2A 1DCEA 1TYRA 3FYEB 4IEFA 4X0KA 4JEGB 1I7RA 1KJMA 2NT0A 1JGUH 2I60H 4LQFH 2VXQA 4UQCA 3LQMA 2EAEA 3P2TA 3Q7JA 2G5RA 3WXWL 3TX4A 3R06A 4NDMA 2AK4E 2ITDA 3H4HA 4YXLH 1VB9A 3ZKXC 4QKTA 3MRPA 3QUMA 5HTSA 4AQ8A 1CURA 3CLEH 4QY8B 3DIVA 3FUKA 1HOCB 1MIEL 1RURL 1Z9MA 4ODUA 3QZWB 1DDTA 4YH6A 4D3CL 3ARGB 1ZWIA 1QRNE 4PJ9D 3S5ZA 1TCRB 1OTSD 3HNVL 3E9UA 4CMHC 3DGGB 3ZQ9A 5I5IA 1JERA 5DYOA 4EN3B 5HYSB 2DD8L 3NCJL 5L7XH 1PBYA 4FFWD 3UTTE 1E5ZA 5SWZB 4S1QH 1ZXQA 3MFGB 4IKJA 4QXGH 2OSLB 5EZLA 4CNIA 2GTWB 3JWOC 4GSUA 1IV8A 3CHXA 2YMOA 1OW0A 1J9RA 3DJTA 4HHAA 2QLVB 2HPOA 4QYOB 2NDFA 5AKVA 1QI4A 4KITB 2R7EB 2J88H 2VMCA 2Y72A 3DRTB 4HYTB 3LKOA 1OAJA 1CL7H 5IT2L 1AY1H 1IT9L 3AB0B 4XC3H 3K1KC 5IHZA 5GJTL 5JHDD 2XPZA 3UYPB 2WBJB 3RFZC 4AV5A 2EDYA 1ZD6A 2KL6A 1N0XL 4Z7UE 1HHIA 1T21B 4JMXA 1YNKH 3IWVA 4RRPM 1JPTH 2C26A 4D9RD 4KUZL 1KYAA 1AVAA 2AK4A 3ZR5A 2HB0A 2WNWA 4HAFA 1O0VA 4GRWB 1FIGL 5DCCA 2XVGA 4LEEA 1HHKB 4L3EE 4Q9QL 2L7UA 2YQ2A 2CNZA 3GEWB 1KXVA 3E6HA 3NFSL 4M1CD 3U7WH 1DBAH 4LVOB 4XZ4A 5AVYB 5IB1A 2NNCA 4A6YH 2JKIS 1QPPA 4J6RL 2DM2A 5EWIH 4ZXBD 2VGLM 4Z7OF 2NYZA 4JLRA 1AKJD 5C7XL 1IIKA 1I7ZB 1RZIA 4HZ1A 4NI3A 4IGBB 1RI8A 2ZX9A 3FTUA 4DJMA 3N1GC 4ZW6A 1UGNA 4AQEB 1JPST 5HHOA 3GHEL 1SDYA 3FF8A 3ZYZA 5C2BL 3ULUD 3H9SA 3NPSC 4ONOA 5JUEL 4CGTA 1D5MA 1QVOB 5D7HA 1BMZA 5AVUB 5I75B 2VN5A 3IWUA 4OGYL 3LXBA 4ONFH 1IIIA 5AYTA 4JHZA 1JF1B 3OKLB 4Z76A 2JLLA 4RETB 3MV8D 1QRNB 1RZKL 2YAQA 4S1DC 4C4BA 5MEOB 3T3PF 3QO0B 3HNSL 4O02B 2BP5M 5AKRA 1UM4L 3ZE1E 3GIVA 5HYJE 4UDUA 3IFOA 4MRCA 1F11A 3TL5A 4PJ6A 2VLKA 1W0YT 3RTQA 1A21A 3VB8A 3LPWA 5KJ4A 1D7BA 4MQXD 3KPSD 1K5NB 4KHXL 2ZCHL 4DPCX 2A9ML 5JTWA 1RIUL 3MLWH 2WIIB 3FTVA 4WNQA 1XXFC 1XO8A 4NNYB 4OV5B 5JR1H 2NY5L 5DJZA 5I1JH 5FOJA 5MI0C 3Q0HA 3SQRA 3S3CB 5CEZE 2UWEA 1PKQB 3H2WA 5DWUL 1EFQA 2HKAA 3JV5A 1NA8A 4C57C 3ARQA 2OFQA 4M7KL 4UYPA 3TU6A 3B9VA 4GAJL 4DHLA 2DDQH 4AW7A 5KG9B 2V7HA 2BVOA 4XMUA 2X2HA 4I3RL 2HJFB 2ATAA 1X9LA 4LF3A 1U3YA 3O3BA 3MRLA 5F0MB 3BKMH 5LCVH 4BH7B 3LKQB 5DRWB 2R8SH 1FYTB 2G4GA 3F7KA 5DK0A 2X88A 4OGZA 3VA2C 5BZXA 3HG3A 1O9WA 2B20A 3BZFA 2DQEL 3GBNL 4GXUM 2K9UA 3M8OH 3O45A 3W0WD 4B50A 3BMVA 4OGXH 1WCBA 2QELA 4HCGA 2AV7A 4BIKA 1CDUA 3BN3B 4KZEL 4D9QE 2ZX7A 3QULB 4M62H 1AYOA 2O5XH 4KDTC 1D6VL 4TYUA 2JCCA 2L8AA 5LNEA 5I1IH 2XSKA 1P4LA 4G72B 6TAAA 4E0RA 1SOSA 3ECVA 3CAFA 2NTSP 4MMZA 2IBGA 4RMSA 3E7JA 1R3KA 1OHZA 4I4WA 3BLBA 4Y2DC 4EQ3A 2JIXD 3QFDB 1QQDA 3AS1A 3P3TA 3CDYA 4R9HA 2UXGA 4H8VA 4DQOH 4PGBB 3QVAA 1H6TA 4NOBA 2IANB 1U8JA 2WXLA 2VN6A 1NCDL 3RVTC 1QO3B 5LHDA 5EBWA 8PAZA 1ACYH 2R2HA 4G8GD 4R4FL 2XFXB 3MRFB 3CPLB 3MA7A 2BM3A 1J9CT 4PRPB 3ZKMC 1DQLL 3CH1B 4N2FA 4PEEA 2BRRH 4YOKA 4F3FB 5B39A 1TTBA 2A4EA 1O6SB 3D2UB 5ADPH 5JW4N 4K2UH 4FTVB 5BS0B 3TJPA 1KYDA 3UADA 1A9EA 2C1OB 3P4OA 4KO7A 4DGYL 4XAWL 4M1DH 3QI9D 1AFVH 3T3ME 3OAYK 3JVGA 3DURB 3FB5B 5HYSG 5AYQA 2BOBB 5AZEL 4HUWA 2XX0A 2EDJA 2L7EA 2W8CA 3ZE0E 4POUB 1THAA 2ATPA 1HH9B 2VZOA 4YSTA 2AJXH 5GISH 4ERSL 4BWUA 5I1JL 2AQ1A 2P52A 4Q52A 1LEIA 2O5YL 2IANE 1DJZA 2C1PB 3VSTA 2X9ZA 2XLLA 5LXGL 3U0WL 1NKRA 1Q9OA 4XAWH 1EMTL 1JYNA 2Z31A 5CNHA 3II2A 3K6NA 1V3KA 4Q9BA 1UUSA 4G6AC 5KVGH 1ZVSB 4LBEB 1IFRA 3L5IA 3RIFF 3NIFB 3L9RB 4S1RL 3TBYB 4J12A 2ZSVB 1CG9A 2X2YA 4P4KA 1E3FA 3SE8H 1U8NA 3EFOA 2ICEC 4FA6A 2F19L 4HCRH 1UZGA 3EDFA 3L3OB 3T65A 1IBGH 1XTMA 1B4LA 2J8UB 4NENA 5G4OA 1NMBH 4P2QD 1AE6H 1Q94A 3IGFA 4KRPC 3IDIA 4Z9KB 4FQHB 2C4FU 1EH9A 1XCQB 1I9JH 2VXQH 3S5LA 3IGKA 1FO0A 4XXDA 4BJLA 3UTQA 4ENZA 1QLRB 5CBEB 3MU3A 2GT9B 5DJXA 4PIRF 4JMNA 1C7TA 2A9AA 2GK0B 5DDHB 2BNQE 4FNLH 4HPHA 2JH2A 5EWIL 5A2LH 3LNFA 5IUSA 3STLB 3U1SL 4AZUA 4YGVA 3OMIB 4AVJA 3NA4A 3X14A 3B7SA 5LDUA 3MLZH 2FWOA 1U3HC 3C6SA 3FZUC 4FA7B 1BVOA 3QZPA 4UAOC 2DWXA 4RAUB 4E36A 3II1A 3MNWB 4FQXA 1G7MB 1HILA 3WHE1 4JFSA 1BVKA 2DY2A 2ZP9A 1OAQH 4BE5A 5HYQB 2GSGA 3G6DL 3BEWA 3IJYA 4GAAA 4DFIA 1A6AB 1XGUA 4JZOA 2YA2A 2OZ4L 4FXTA 4Y1AE 5FYJU 1G94A 4FKHA 1LTXA 3MV9A 4MNQA 2GIYA 1A6WH 2VWEE 3DBXA 4A6YA 4ODSL 3H9ZA 3D0AA 1Q1JH 3D39D 4NUPA 1HJCA 2WCSA 4FL4B 3JV6B 2DTML 1MH5B 2HTKC 4J3OH 5EDSA 2UVEA 3UCQA 5DURB 1RFDH 1RIUH 4HJ0C 4ONHB 4X5XA 2A9DA 4KKZA 1PW3A 4JO3L 4Y5XA 4JVUA 1AOHA 2W91A 5B38B 2E7MA 5D7IA 5I8CA 1A4JB 4QDGA 2JJUA 3Q06A 3UBXG 2XBTA 4DO5A 1GGUA 5IF0B 4B6ZA 4EUPG 3MFFA 3APMA 3VXPB 4P23B 2GFBA 3SBWC 3TV8A 4UQDA 4PCYA 4HPOH 3TZVD 4BCZA 1EUTA 4GAYB 4ZS7H 3NIGB 1WFTA 3TF7C 1NMAL 4Y2OB 5AAPA 1KJVA 5BRZA 1SYVB 1CE6B 1A2YA 2KS0A 1EVUA 3DRTA 3O6FB 5D7JB 4XMTA 4Y2LA 5J9PB 3BAEH 3LMJH 3EOBB 2V2TA 1JV5A 1MIMH 1YEJH 1AHWC 1FYTD 3F7PC 3FNKA 4JM2F 5JDSB 2OR8A 1FNSL 2XXMB 5CINH 3T2NH 1B0RA 4LVEA 5MEPB 4FNLL 4R5XA 2V2WA 2PO6C 4HS8H 2PCXA 5ISZB 2C3WA 1INQB 1QWHA 2CRMA 5LG6A 3PAYA 5FO9A 3DA0A 1RV6X 2WZPD 1JZIA 4Y89A 4DP5X 2GHZA 4K71C 4ANUA 3CFKB 3QCTH 3DX0A 4YSEA 3ILPB 4EUPA 3KLSA 2CZNA 2DEWX 1E5YA 3NRPA 2KC0A 3W82A 1CDJA 2ZUWA 5HDQL 3DX6B 4X5LA 3X13A 4GAFB 4M6MH 1F4YH 4H2CA 3V8OA 1KZQA 4BFFA 3DGCR 2E4FA 4Z7WA 4XO3A 4XBGA 3UJTH 1S8DA 2QVIA 3QIBA 2WN2A 2LTQC 1OAZH 1BJ1J 5JMRA 1NAKL 2G9HA 3MLVH 2OI9B 5CN2A 3AUWB 3W9EA 3WIFB 1ZTXL 3K6SB 3MZTA 2Z9TA 2IAAC 2BIHA 1T22B 4FQ1L 2YQ3A 3F7RA 5K5YA 5I0XA 2AJXL 3GZQA 1NQBA 2Z7WA 1NCHA 4HUXB 4ADIA 5I1AA 2VDLL 3E0GA 3ZDYE 4CN1A 2VDRH 3TS8A 1RP8A 3EXLA 2QQLL 2OZ4H 4FTVD 2OMUA 1HXMB 4FG6C 5BS0D 1JPGB 4G1MA 1UYWL 4APQB 4WW2F 1I1RA 3HRZA 2IADA 3BAIA 4UOQA 2NZ9D 4LOVA 4FQJH 3NCYS 2WIIA 4WNQB 3COOA 1ZMYA 3KPMA 4S1SL 4KRNA 3KWWA 3APDA 1OTSC 4HWZA 4LPUA 1TVDA 2P80D 2Q3ZA 1HDMA 2EEAA 2EICA 3J07A 1TFPA 3CSTA 4YLBA 4KX7A 5AG8A 4APQC 3ULUC 5A6LA 4FXGC 1NIBA 2VDKH 1L3WA 5I1LA 3ALPA 3IDGB 4F7PA 4NO0D 4PFEA 5B7MA 1IX2A 3BX7C 4XC3L 1JTPA 3GWJA 4XB8A 3OKOB 4JQXC 1MHCB 4PJBB 4L9LB 3TPUA 5ESQB 4EI6A 3BP5B 4L18A 3AXHA 3QA3A 3C60D 2WKGA 3MRNA 5DZPA 1JWSA 2NNXA 2PABA 2YD3A 4XO5A 4XNBA 2DI7A 4MXQC 1IAII 4NJ9L 5IGXH 1GL4B 5J11C 1JZ5A 4BQCA 3ZHLA 3AQYA 1KSRA 4GMTL 4IEFB 4X0KB 4JM2D 4QXTB 5GZOD 4HWEL 3BT2H 2E9WA 4AXWB 3CD4A 4YBQC 3IMTA 3NOIA 3VX1A 4V33A 3ESNA 4DUWA 2WXKA 3RWFA 3PFQA 1MCOL 2ZZUT 5J7CC 4JZNB 4NQVA 2R15A 3VD1A 5CIPH 5KYYA 2X1QA 1OP3K 2DPKA 2CLRA 4DAGH 4RMWA 3T9WA 1IGFH 1CE1L 2X4TB 1IM3A 2HX7A 4UQ3A 3I9IA 1KYUA 2UZIL 1C5DA 4WHTB 2QKIA 3CHOA 2WWKO 3F8UB 4P0DA 5A40E 3TCLB 2F54B 4ZFOA 1CXIA 1MI5A 3RNKA 2BFVL 3V4PA 4N0CD 2VSCA 4Y16B 3P4NA 1N19A 3OHXA 3VA6A 4U1GB 5IVXA 5HYSA 2WYHA 3SE4C 2NQCA 4PWFA 3BUTA 3BJ91 5PCYA 3U48A 3GMNB 1BFVL 4PJ7A 4APXA 1EPFA 2EDXA 2X09A 1PEWA 5E4EB 4PJAF 3CXHJ 3CHQA 3PGFL 4GXVH 4E42A 4GRWF 2B08A 5E1HB 2R7EA 1UM4H 3UP6A 5CU9A 3G7TA 4F9PC 1LP9E 2BIQA 3MV8E 3MPCA 4PUBH 2LABA 3VWJC 1U8KA 1E27B 2FUQA 2NY1C 1NBYA 2YUZA 1WO2A 3SBQA 1LE5B 1GGBH 3TV3H 2O6EA 2C1PA 1HSAA 3UTSA 3X3GH 1OVZA 1MFDH 4MASA 3NIFE 1CXFA 1F41A 2ENYA 1KBVA 2EE9A 3QFJE 1KB5B 4U6XB 2YWYA 2IWEA 1YN6B 2XIIA 4HJJL 3V0FA 1RP9A 2Z31C 2YRBA 3OM3B 4Z3HA 1XL6A 3HPJA 2WINA 3HC4H 4FMKA 4X83A 5K1VA 4NKDA 1Z2KA 2AEWA 3MCKB 3WL9B 3EJQA 1JYVA 2IDUA 4K9EC 1NGWB 4LU5L 5CEXB 1XR9A 4AQEA 1AANA 3A5VA 4JFTA 3I85A 3NIGF 4RISL 2WXOA 4K3JH 4DN4L 4KUZH 2FH8A 3DX9B 4YR6B 4JGJA 2OMWB 4UI2A 3PLYA 3P9MA 5EZOH 4W68A 4ZUTB 3PJNA 1HINH 5DQ9B 3UACA 1OOAA 3AG2B 1L5GA 1J1OH 1KCVH 3HAEG 5F9OL 1JF5A 4WFFE 4EF3A 3FTGA 1MSPA 4R7LA 1BQLH 3C08H 2ARJA 3UIZA 4HMEA 1MCJA 4ELMB 5IMOB 4XOEA 2FR4B 4NBZB 5JXAH 1AQKL 4Z78B 3GSOA 4LAQH 4F92B 2ZYIA 4ES9A 4DGIH 1KACB 2OL3L 3DECA 1ZHKB 5F3BA 4FKEA 1SEQL 1UH4A 3OKMA 5CD5D 3MV9B 1I8KB 4YE0A 3OX8A 4U3CA 2OJEB 5IQ9A 2KZWA 2XN9B 2FEDD 4K7PL 4QJ5B 2E4TA 1Z9SA 1PEZA 1JWMA 1PJ9A 2HUHA 3PG2A 5JIHA 4AQ8C 2BXYA 5AB2A 3LIUA 3LN4B 4G1EA 4JR9L 1RUPL 4WGKA 5DFWH 1OQOA 3O9WB 4BCXA 2VXSL 4OCWL 1INDL 2PWGA 2Z64C 2N0KA 1GGBL 3IXTA 3LNDA 3PABA 2CBQA 4IBYA 4I18A 5DQJB 1GOHA 1TJIH 4A2GA 1AGEA 3SB3A 3VFOB 1AYRA 3O2VL 4QOKA 2R2EB 1IBZA 1WICA 4OZIE 2QQKL 1TLMA 4JFDA 3OZ9L 4XP4H 1ZGLP 1AI1H 4JJHA 4G8AC 5IB5B 4FJZA 3KPLB 1JMZA 3BVWA 5DSCB 4GBXD 3SPCA 3ULSB 1KWGA 1VENA 3EUUA 3PWUA 2HN7B 1BV8A 4MHHG 1QUPA 1UA7A 3LZQA 3E8UH 3I6LE 1Q72H 3OKNA 4ZMQA 2D9QB 4XMXA 1AR1C 1PPIA 1TZIA 2UZPA 1KV7A 1FNGA 3DUUB 4X6FA 2QVKA 4FEMA 4XMKL 1Q0XL 4YHKL 4YDMA 3RPIB 3HBPA 3N5AA 1ZKAA 1P5VA 3L4VA 4JLRB 4QHNA 1NMCC 2XPGB 3GZOA 2ZYRA 1X4YA 3G5ZB 3P3YA 5DJ2B 1NC4A 3O2DL 1SHMA 3HJ0A 4ZTEA 5GRUH 2D0FA 5T5NF 3VE0A 4DAGL 1GW6A 2WXNA 1A7BA 1U8CB 3WJMB 4S0HA 1XL4A 3BAYA 1RZGA 3WO4C 5AB9A 4KXBA 1LO0L 3KYOA 2NRDA 3PWPD 1KJ3H 3D2UA 2OSYA 3EDKA 1SM3H 1Y6KR 5F9WC 4AEEA 1CGWA 5HHPB 2IDSA 2X0UA 1KN4L 1JGVL 4YQXH 3L5HA 1FE8L 2DMHA 3CFCL 2RACA 2NR6A 3O2DH 3FZUD 3GHBH 1ET7A 2P24B 3RX5A 3QEHA 4OFQA 3UPCA 4PJEA 3B5HA 4DN4H 1I1AB 4JY5H 2ZWYA 3WIHA 3MOQA 1ZT4B 3VWKC 3VWKA 4LCWD 5T33H 4OAWA 1TQBC 4YL4A 3EAKA 3QB7C 2P7TB 1IM9A 1IUZA 2IQ9H 3NRFA 3HI6H 1KY7A 4P46A 3HB3D 2HT2C 2VR7A 4RFEB 4ORZC 5AAMA 1D5IL 4LCUA 1MAMH 4PYHA 3GMOA 5IEHB 3BGMB 2EEBA 3UEQA 2CO1A 1G7HB 1G7QB 2PO6D 3DOSA 3QXAA 3V4UH 4LCYB 3ARBB 5CR8A 3VI3A 4NP4H 2BSCA 3IN0A 4XR8C 4BZ1L 3KCWA 1GJUA 4PJDA 1F13A 2ZOOA 4GSRA 4BUHA 4D0CB 2ZXBA 1DJYA 2BWDA 1OT2A 3ILQC 3IPEA 2WQWA 3QC5X 1WCBB 5I24A 1RJLA 2AV7B 5IJDC 3QULA 1JZ8A 4J2QA 1YUHB 1MG3C 4RIRA 1F1AA 1H3UA 1U33A 3O6FC 3FT4B 3TT3L 1A3RH 4XNXL 3NACL 1HHIB 4LL4A 4ABVA 4U1SA 3AWEA 1KELH 5T1LD 1MXDA 4C56E 2ITDB 4JY6B 2YQGA 5T3ZE 3SKNA 2Y5QA 2EDDA 3EO1A 1QO3A 1MJJB 4WIQA 5T5FH 1J9QA 3MN8A 4K71B 4B9FA 4IOFC 3GRWA 5IEKB 1VADA 2P9RA 4Y4KB 5J4MA 2NZ1A 2ARWA 2F5BL 3PV6A 4EZMA 3D25B 5JW3H 3DK0A 3MRNB 4ZQKB 2D3NA 1JWSB 1MRCL 1JRHL 3VH8B 3ARPA 3C6LC 4FKKA 4MCNA 4FG6D 3IFPB 3O11A 3O6KL 2PW1B 3HC0A 2VIRA 4WU5A 2OSLA 3S2AA 5I8OL 2J8HA 3WXWH 4H4NA 1FVCA 3HG4A 3SPVB 1BD2E 5JW4M 1GPOL 4LVHC 1VEMA 1QFWM 1WA0X 2FD6H 2J1YA 4NQUA 3LDBC 3GSNA 3TYFB 4NYLB 1H8NA 1S5HA 1ZCRA 4CC4A 1MIEH 1YAIA 4NN5B 2VDKL 5KANG 1D6VH 3G6JB 2IH8A 1TJMA 3MMEB 3K81A 4G9FA 2CLRB 1OAQL 2WBJD 4G2AA 5HJBA 3ZPDA 4JQIA 2ENPA 1A3QA 5C70A 5ENWB 1XD1A 3ZIYA 3VXSD 3D0LB 3B2UC 4OD2B 4UU9B 4GP8B 1OKEA 2XICA 2UZXA 1IEAB 2L04A 5D1QA 3WFBL 4PWHA 3T0EA 3CVDA 3FUMA 4MAYD 4B41A 4W6WB 1VCAA 4Z7VE 3CFJA 4IBWA 2E7CA 2Q86B 4L3AA 4LRIA 3LKSB 1A25A 1AGDB 1C16A 1SJEA 1WIPA 5DJCB 3V2AR 4H88H 4N6RB 3NN8B 2CUMA 1I4FB 1WDAA 5CZXD 3U83A 4CVZA 5DJZB 4APXB 2X4SA 5IB1B 4EMZA 1MFBL 4G6MH 3GSVB 1DBKL 4AEIH 3ATEA 1MHEA 4TVPL 5EC2B 3U30B 1P69B 4ZO9A 4KROC 4HPYL 3WTVA 2BDNL 1D2OA 4YBLC 3MNVB 1E30A 3FN0H 4TRPL 4Z0BH 1JPEA 1URZA 1JZJA 5JR1L 3BP6A 4QTIH 1IKFL 5T3ZL 4Z7AA 4PJIA 3WHXA 1NLDL 1QVOA 5DDHA 5DRWA 3L5XL 5F3HB 2V9UA 4JE4B 5ABAA 2AAAA 5IBLD 3A6BH 2ZUQC 3MUGB 4MA3B 3CN3A 3KXFD 1DVUA 1EAQA 2KZKA 2G5UA 2Y1ZA 1M56B 4QRBA 1ZJAA 4P5TB 2E74C 4O2FA 5ETUB 1NCCH 2J1KA 3LHAA 1IJ9A 4P2RB 1X7TA 5E9AA 3RBGA 4HHWA 3P02A 1KN4H 4YQXL 3MNWA 2DYPD 5DWPA 2ED6A 5FYJE 1Z3GL 3OPZL 4NKOB 2GSGB 2XU9A 1FRGL 1DR9A 4JFFB 1LO0H 1V54B 1MFEH 1LNUB 3INOA 2BHYA 4NQEB 4QRTA 3CMOL 1N9PA 1I8AA 1SQ2N 4JPWL 4PS7A 5K59E 4L3CA 3EFFB 2G9HB 1BZ8A 4OV6F 5KJRH 2CHZA 2I85A 3WFCH 5IG7A 1EJOH 4U05A 1H6EA 1NC2A 4J28A 1R19A 3R7QA 1OARH 2HRPH 3FONA 4IMLA 4TMPA 3QQXA 2YO3A 5JPNA 5JO5A 4PJXB 4FP8L 4L8BA 4NHCL 5DEZA 4BHUI 2WZ0A 2DKMA 2GAZA 4KKNA 4P5KA 4WU7A 3VXUD 3QJUB 4CJ0A 4HG4K 4IK6A 3S5LG 3APFA 2NY7L 2OP4L 4Z78A 3WDHA 1A8ZA 3EO0A 5IROA 3O45B 3SJVE 2P49B 4F5CE 3VXPA 4DQOL 3VO0A 1E3XA 1OWRM 5FA4B 2QQLH 4UILH 5C0CA 5IJVA 2B1HH 2E5EA 1IFHL 4YLCA 5I66A 3SKJH 3WJJC 4EN3C 5DRXA 1W0VB 1N0LB 4ODHH 2AXGB 2B1AL 4G1EB 3LX9A 1MUJB 2DLTA 4AV4A 3FQUB 1S7QB 3DMMB 4PRHD 4QKXB 1NCAH 4B97A 1GSKA 4OSUL 4EOWH 2YSTA 3GBNH 2H6PB 1F97A 3ZZLA 3C2AL 5T3XE 1RKRA 2OTWB 2VRQA 3MRQB 5J1SC 2VO8A 3PREA 3I6GB 4EI6B 1M9SA 1EMTH 1Q94B 4KKBC 2QMKA 2WBJC 3POHA 4JO3H 1MW0A 3K0WA 4UV7H 2WJ5A 4GRLA 2C1OA 1RK0B 1OSZA 2PKDA 3KD4A 1O5DT 4K94C 4NSKA 2PUQT 4A39A 4YXLL 2X3AA 2Z4TA 2GI0A 2V17H 3F85A 3P73B 2I9LB 4N20A 4PS3A 4JZNA 3IFLL 4QHKI 5C0JA 2F1BA 2EQDA 2LOEA 2EE2A 3SDDC 2V5SA 4WV1B 2HG5B 2RD0A 4X4ZA 2X4TA 4UQ3B 5IQNA 2R69L 3F7QA 1AGCB 1NFIA 1JFHA 1VPOH 5FYLD 4P5SA 4QO1A 3WY1A 5GGRY 2AAVA 3W9EB 4ZFGL 3ABKB 4L2YA 3D3VB 1FUNA 3CDZA 1A6UH 1IBYA 1CUOA 1HZLA 2KZ1B 2F54E 1VGEL 3FRPG 1RIVH 3HLKA 4UTAH 3UZQA 3HN3A 4TNWF 3QUXA 4C8XA 5SWSA 3T04D 3FH7A 2NUTA 1Z3RA 4HUCA 3GI9L 3NH7L 3SDCD 3L3GA 1L3NA 1LO4L 3HS0C 4KV5F 1J5OH 1AO7D 2ERJC 3CMOH 4GIPD 3OJ2C 4X9BA 4BZ2L 4HK0A 5TQ2L 1WT5C 5D6CB 1E4XL 1GVIA 3NTCL 5HP5A 1D5BA 4PB9H 1XVSA 3K5RA 4FFZH 5J8OA 5IKCB 2DQUH 3MJWA 5L6YL 3QE5A 1BJMA 3CZSA 1XIWC 1NGPL 2I9TB 2OMTA 1B2YA 4HT1L 2WCPA 2FX8H 4JFOA 4EXKA 1M05B 3AT9A 1VACA 1EZVY 1I1YB 3WKQA 1PF3A 1U8LB 4LKXA 3BRFA 5CWSA 3CNKA 3D87B 4Q6IB 3VM7A 3W37A 1M7IA 2VXTH 4TVUA 2QTEA 2VC2L 4GXVL 4ZXBC 4UINL 4H1LH 5A16B 3WFHA 1VFBA 4WJG3 3S37X 1RJCA 1HE7A 1AIFB 1LHZA 1QR4A 4HWBL 5HI4D 5BMFH 1GAFH 4ADGA 1T03L 5FHBL 2I32A 3QCUL 1KWKA 3NAAH 4CGUB 4X4YA 4JHAL 1SNRA 5D7JA 4XCFL 4UQBA 3EJYD 2CBTA 4HFUH 1M6OA 4XTRD 5EULV 5LJYH 1JGEA 1YUHA 1K4CB 2Z4QB 3RI5F 5E9DB 5C0AD 5KS9E 3L7FB 2B4CC 3C8KA 3VQLA 4WHYH 4M3JA 4LEOA 4MNGB 4ZUTA 3QWRA 5ISZA 5C0ND 4DN3H 1UVQA 2XZZA 1RZQA 4K3JL 4WO4D 4AWJC 4ANWA 2I07A 4Z7VA 4N8UA 4GYBA 1FH5L 1M71B 4X99A 1FV1B 1BPLB 4XNQA 4CW1A 3MUHL 4JL2A 2EADA 3WO4B 5DUML 2Z3FA 1J8SA 1JRHI 1BF8A 4ZT1A 1E43A 1LO2H 2Z7ZA 5IEKA 1JS4A 1RUAH 4GT0A 3EGXA 1K4DB 5FO8A 1UT9A 3IFNL 4Y16A 3D4GA 1LO5B 4P2OB 4PVBA 1JV2A 1CMOA 1MKFA 1BXAA 2UX7A 4C55A 1EA9C 3JYBA 1H3GA 1INEL 2NSMA 4IHOB 2WSKA 2ODIA 5IROC 1VKXB 3O8XA 4MHHI 3DX4A 4AC4A 3EH2A 4ORGB 4U6YA 2MOQA 1DEEB 25C8H 3JQOB 2VLJD 2VLRE 3GSNB 1J9TA 4ODUB 3H9SE 3SDAA 3LN9A 2R1YB 2M83A 5BRZB 2EXTA 2APTA 2A9NL 3VTTA 3N91A 2JCCF 2P44B 2RIKA 3HZMB 3TC9A 4NX0A 4OGXL 5DLLA 2FLBT 4JCLA 2YD4A 4L1SA 4TUKH 3SSGA 3UDWA 4URKA 4HDIB 2GITA 3U4AA 3WJLA 1KGYE 1A6TB 5FO2A 4FN0A 3RY5A 1MCNA 4RNRB 5F7LB 2P5EE 4APQA 3LNHA 1ZK9A 1IGFL 4PBVC 4K7PX 3V0GA 1RUQL 1TNNA 4AY0A 2HRGA 2NW2B 5GGSA 1DVFA 1L9QA 4S1QL 3I9AA 1SVBA 3MUY1 4ZMPA 43CAB 5D2NA 5IQMA 1ZHLB 3WN5A 2GSIA 4HAGA 5DJ6B 4Z5RA 1PMYA 2O72A 1YN7B 2YPKB 1KPUB 3J27A 4FQ1H 4RGNB 2HPTA 4JPVH 4LLDB 4AEHL 4V2BA 2I27N 3MNMA 4M5ZL 2Y07H 3QIBB 4RQQB 1PSKH 1WIOA 3OLIA 5E6ID 3L13A 4N1EA 5JIIA 2AQRA 4W1TA 1NGQL 3RWJB 5CSBA 4YBQD 1OAKH 1KTLA 2KPNA 1B88A 4P2QB 1IAMA 4NWTL 3WSQL 4L4TA 2B8OT 3V52H 5DVLA 3VB9A 5I6LA 1KMGA 2G2RA 1IVLA 4MA7L 1BQRA 1YY8B 3JWNC 3HLAB 4QTFA 4YN3A 3QNFA 4A55A 1N6QH 4PJ8C 4KFMA 4MAYC 4TUJA 2WWOA 2ZONA 2BZ7A 3QIBC 12E8L 3B2XA 1J0YA 4FQ2L 4NO5B 4OIIH 2CHDA 3MRJB 2OMUB 2SODB 1EIBA 2IAMA 5DA0B 2VE6A 3GMLB 3GSOB 4CVWA 3IU4L 1BBDL 2EC8A 4FXKA 4RWYH 3CFEB 2F19H 2WKLA 4HCRL 4NT6A 3KLQA 2R4SL 5JHAA 1G7IB 3AREA 1NKGA 1ZY9A 4HX1B 3ME0A 1UHVA 5B8CC 4KPHH 5JHLL 3Q9QA 1SN0A 2P5WE 3C5SB 3QPXL 4BSJA 2X4PA 1XIWD 1F1GA 2BHFA 4OJCA 4IHBA 1AS7A 1LL1A 6PCYA 4HWNA 2L0DA 3WY3A 5CBAB 1IEBA 1W80A 3OXSB 1UB6A 3VGEA 3HE6A 4E41A 2BJMH 3QJVB 4L4VD 2KUTA 1I3GL 1GMIA 2VLKB 3RTQB 2BOCB 5HDOA 1BAWA 2XYCA 3CVHH 3W9DA 3ML9A 3VI3B 4L8SC 1MCBA 2WNXA 3L2NA 4R8WH 5C08B 5D6DC 1SJHA 1E40A 1QX1A 4NNYA 5ADOL 4MD5A 4OV5A 1QWNA 2R2EA 1K3ZA 2XTJC 1ORQA 4ZAKD 2KYIA 3L2MA 5GGRA 4J4PC 2VAJA 2QFPA 3FCSA 1T03H 2VABA 3X11A 4ZG1A 2DQCH 5IUCA 4AUUA 5HI4C 1K8DB 3ULAB 4X4XB 2KQMA 1EBAA 3RWEA 5MHSE 4UINH 1AC6A 1BAFL 5JMOC 2OR9H 3HAEA 2AJVL 2BS9A 3R4DA 3V7AG 1P84K 4L8SB 1U8MA 1KJ2A 4PBXA 1ZLSH 2AJSH 4U1SB 3MREB 3ZHDA 1IAKA 3K7UA 2XV6B 3MRLB 2YXMA 3AG3B 1B4TA 1G7JB 3FQUA 3QDJD 4X6DE 4LP5A 2IEPA 3D18A 4ZUWB 1H6UA 5DGRA 1PZDA 5E4AA 4WHTA 2HKFH 3SE3C 1LJMA 3QDMA 2FJFB 2VUYA 2B0SH 4IBVA 5TDOB 5GGVH 2CRYA 2VR4A 1RZGB 1KIRA 4GG8A 1T66C 2YD0A 2DYPB 4AIOA 2BW5A 5EH1A 3TT3H 4YHIB 5AFAA 1E6JL 1PAMA 2HTKD 1E4HA 4ZODA 4N68A 3T0WA 2VH5L 3AY2A 2KERA 3HZYB 4L4VB 2APXA 3QZOA 1KB9J 3MJGX 1JDAA 1JGDB 2B7DT 2JKJA 4TL5A 2X89D 3SEPA 2PETA 1DJSA 4NM4L 4RLDA 4GKOA 4ZFZB 3LIZH 3S36H 1QSFA 1YMHB 3ZDYF 4ZRGA 5EF2A 5H2BB 1CD0A 3DDFA 3MA7B 5FYJH 3VXRB 5KBLA 3MZGB 1V7NL 2HX8A 5IK3B 3R1GH 4PW3A 4QUOA 3MRGA 2D8KA 4P3CL 2Q2LA 3V4UL 4Q9RH 2V2XA 4XNZB 3OR7B 1MAJA 4H0IA 3T0EB 4OFVA 1E0OB 1I9JL 2VMJA 2VXQL 3MUUA 4LCUB 3BHBB 4LGPB 1WT5A 4WW2C 3HEIB 4PW4A 4FQ2H 4KOBA 2VXUL 1A4KA 1KB5A 4LLQA 3V9FA 3FAWA 1J1OL 4U6XA 2ZCLH 3BUPA 2GW5A 3QJHB 4IRZL 4PB0H 4C58B 2X4RA 2J3SA 1XDTT 4H25A 3WIHH 1DO6A 4XMLL 3D05A 3CU1A 3MYZA 2HFTA 4PRAB 3PAZA 3TO2A 1R5WB 4BHUA 3Q48A 1UM5L 3D50A 4KY1L 5L8JB 1UD5A 2WZ6A 4Q2ZA 2VC2B 3O9WA 4YUEL 4YFDB 4G5ZH 5F9JA 3FTXA 2H1PL 2DMKA 2AABH 2CK2A 2LVEA 2YGQA 4L05A 4FXGA 2ZCLL 3VXTA 2X70B 2X4OB 1CK0L 1GZHC 4XCCL 1TXKA 5T5FL 2C4FT 1FZMA 3VXQA 1XGTB 1M6UA 1A6PA 2PWEA 4MNHA 2JKXA 5IMKB 2UY6B 1CDBA 1J8HD 1NOLA 1L0QA 1PZCA 3MJ6A 4WKXA 3ULSA 4J5VA 3IDIB 4G7VH 4F33A 1VFBB 3FSWA 3I9GH 2QFRA 2DLGA 3VFPA 2G5BA 3UFIA 5T1DL 2K78A 5IW1A 3EO9L 3GC3A 5ADPL 3DX7A 1H3XA 2BVPA 2ZWZA 4KJWC 2YD6A 4R90H 4M93B 5DK2A 1YYCA 3NRQA 1NINA 3PDDA 4P9HL 1FSKB 2OLDA 3L2LA 3BFOA 3E8UL 3EG9A 5FDYA 1PS3A 2XN9A 3BYYA 2YN5A 2OJZH 3K8LA 1AG0A 1BGXH 1T1YB 3P0YH 4NZFA 4TSCL 3RX7A 5MENB 2F53A 5BXFB 4ZYKB 1XBDA 2BNRE 2VR6A 1YPZA 3OZ9H 5J6HB 1NGZA 3Q9PA 4M7LH 5KSBA 1EWHA 2I69A 3WV0A 4OLYL 3ZT7A 3BZ5A 3DTUB 3MV7E 5KVEH 5F1NA 2VCOA 3GLEA 4I3SH 3AROA 4LT7A 4LOFA 3QHTC 3LPGA 4UBDD 4X42A 4Z7NB 4P04A 3MKKA 1XCXA 4IRJB 1N67A 4A6YB 3KLHC 3X3GL 4NFDA 2X9YA 5F71A 2DAVA 4HBCH 4HXBH 3HCVA 2E8ZA 1PNDA 3KPLA 3TGXA 5C0RH 2I5YH 3L3KA 2H32A 2YAOA 5DS8B 4H5SA 2MPAH 2VLME 4JDEA 3QQ3B 2AI0L 4P2RD 3DUSB 2D73A 5ALBH 2K70A 1T0MB 1W91A 4FX5A 4O5LL 3EFDL 4BK8A 4QHNB 4KDVA 4OFDA 1XIWB 4OZFH 5T1KD 3BSGA 3G5ZA 5GJSL 2KBGA 5C0EA 5IF0A 2OM5A 4PJHA 4KUCF 2OTPA 3BD5A 4B9GA 1BQ5A 3AG4B 2N7BA 3DJSA 1NDTA 1HZKA 1UURA 2AZAA 2MNUA 4E9YA 1F4AA 4HJ1A 5TF1L 4MYWB 4Y9GA 4A7SA 3GO1H 4Y1SA 3WKNA 1USZA 3VG0L 1U9KA 1YEKH 1ID2A 2F6AA 4UQ2A 1HEZB 1GCFA 1O7DC 2C9UA 4X7CC 5IOPA 1HL4A 5FDWB 3NCYP 4UIKL 1EXUB 1NUGA 4GUQA 3RY6C 1AZCA 4NUQA 3OKKA 4PJEB 3UBGA 3KBFA 1H3PH 5TPWL 4NO3A 3UZEC 4P9MH 1MLCB 5C0JB 3VG9B 4IRSD 5EF0A 4NKMB 1BF2A 5CCKH 5IVZA 3SDDB 5KJ7E 2G9KA 3QQNA 5GS1C 4LLWA 4WY7H 4NGHH 2CBPA 4QRRE 2HCZX 4OLEA 4YDNA 3C5ZC 4NQDD 2YGVA 3N44F 4PCSA 4R0LA 4W9KC 4WJ5A 1DL7L 3MO1B 1A3LH 1C08A 2BP0A 2V8MA 1FAIH 2MQ3A 3BKCH 1RUMH 2PW2B 5LCVL 1G7HA 3QXAB 3S3BB 3VG9C 2ZTBA 5C92A 4L8BB 4D9RE 1CLCA 1SBSH 3OQ3B 3TXAA 2R51A 4EBQH 5HPMA 3QIWB 4DPRA 3MLTA 4R7VA 1K5WA 1NAML 4WWKA 3P2BA 1A6UL 2W59A 2OYPA 1NLBH 4ZUUB 4AIZB 3IJ8A 5CU5A 3TEXA 2WHVA 2D7TL 2J44A 3OKEB 4I0PA 2BC4B 4FLHA 5I74C 5KVMC 3N85H 1T6VN 3LPPA 2ADGB 5IBUG 5I8KH 1USQA 4OJYA 2HVKB 2R56L 2O1AA 5CJOH 2FH6A 1TKWA 3PWLB 4AEFA 4DP0X 5AUMA 4PBDA 4JG1L 4MJ4A 5L9DH 1L7TH 2WW8A 3S8GB 3CBKB 4LNVA 1HXMA 1JG9A 3HG2A 2Q86A 4I88A 5I74B 3EO1B 2CRZA 4HEPG 3SPIA 4GG6A 4XCNA 5CJ5A 1ZA6B 3V0VB 4UV7L 4A7VA 2K45A 3HE6C 4QXGL 3FFDA 3GRBA 1EFXB 2AF2A 2D2OA 3MLYH 4KVPA 5H4YA 2G0KA 5LGJA 1N3NB 1P2CB 4KI5F 4KKCD 3P4MA 2KI6A 1WZ1H 5EU7C 1GA2A 4KHTL 4N87A 3R8BB 3UOAB 1H3WM 4OZGB 3BCFA 4NLHA 1OSYA 2ZOTA 1NCBL 4AW4A 3MNVA 2I25N 4CADA 3KLHD 5FYKE 1E5AA 3IDYC 4JO1H 4O58H 1DFBH 3QG7L 4HIPA 4FEIA 2H0JA 3G5VA 4HIJA 1Q0YL 5CF3A 2IG2L 5D70L 3C5JB 4KDTA 1RZ7H 4KMTH 1JYWA 5E8OB 4CSZA 4A7UA 4NQCB 2B1HL 4CW1B 1TEFA 1SRDA 3T2PA 3KWUA 1AGCA 2L7JA 3LZFL 3QDMB 5JNYA 2YOAA 5D1QB 4KTGA 4AQ1C 3L7EA 3LVTA 3CFJB 2EO1A 2E56A 4MJID 2X9WA 1WWAX 3W5NA 2H4EA 3LXCA 3CXDH 2O61A 2XTJD 4ZAKC 1JGVH 2GYSA 3PHQB 1A1MA 2X0WA 1P5UA 1X5MA 1P5UC 4OUUB 3V0DA 2PCPB 3DVNB 4M1GH 1EZUA 5LWYH 3ZE2B 4BA8A 1VZGA 4IBUA 5F7FA 2VMEA 4DKFH 5KSUA 4OD1L 4Y1AA 5BZWB 4L0PB 3HI5H 3ML8A 2TSAA 1M3IA 1RZJC 1VHPA 3BH9A 4DT2A 2VC2H 1PYWA 2VXTL 2Y2WA 3LEXB 3RTQC 1CG9B 3TP4A 1BWMA 2UZIH 4YVUA 1M05A 4F2FA 5ANHA 1VACB 5E5RB 1XGQB 1A4CA 4TKWA 3QCUH 1NAMH 1T2XA 3AS0A 4P5TA 4NRYB 4UANA 3VXSB 1DQJB 2DL2A 2CM6A 3B8YA 1MAKA 3L9BA 4KRPB 4PHZA 2GJ6D 5EU5B 2DLFH 1LLAA 1JZEA 2DF3A 4UIMA 2VYRE 1P7HL 1QOKA 3FT2A 5DJ6A 4Z5RB 4M5TA 1A65A 5T3ZD 3IMWA 4ZPVB 2GK0A 4DK3A 1NCWH 4KBPA 3BGAA 2DJ4A 5DFVD 4L3ED 5F6HI 4FFVC 2Z35B 4UDTB 1JNHA 1HCZA 3DPBA 2B3RA 2FEJA 1A14L 3MR9B 4KVNL 5LAXB 3WKPA 4WF7A 3BE1H 4HOMA 2YFOA 4NZTL 1XF4A 4K23H 1FAKT 4JRXD 2CMRL 2ZX6A 3TJHD 1DQIA 5BV7C 2OTWA 3HFMH 2VL4A 1JZ4A 3PXLA 1LO2L 4K9JA 1FZMB 2TAAA 3N43F 3V7MA 1FGVH 4JKNA 3DHJA 2ZXQA 4TLUA 4Z7VB 5F96L 5DZOA 3MCKA 3WL9A 4XGZA 1TZHB 2WXJA 5E5UB 3E1ZA 1F3DH 4PD4J 3NPZB 3TEWA 2DEXX 1FZKA 1SOKA 3MRRB 2EILB 3FU6A 5IFAL 4OKDA 2LAGB 3IGLA 1V7MH 2OMWA 2KLRA 1NGXB 4JFQA 1U3NA 2BHZA 2VDNL 2TRYA 3EGDA 3HB3C 3C9NB 4FI6A 4O02L 4X5PA 7FABH 1UZ8B 3RVVC 4NN6B 3WFCL 5HGBA 4JW3A 1YVLA 3IB4A 2C9QA 1U2YA 1E4KA 2DBLH 3FH5A 4PJAA 5DRXB 3FUDA 1HQ4A 1OGSA 4J3XA 4FG4A 1IEBB 1P0SE 5JHDA 1L9OA 2ICWI 2W92A 1TJXA 1I1AC 3RAJL 4WEEA 4YFEA 1FBIH 1SFHA 2DMCA 4QHPA 1TITA 2X7LA 1W72L 3DRQB 1Q0XH 1TQBB 1WFIA 4PJ9B 4YHKH 4PBWD 3TA3A 4PJCE 1BM3H 4ETQA 4N28A 2OYMA 1PZAA 4KO6A 3VI3E 3NZHH 1R3LA 1GTNA 1GRWA 1ZVHA 3FQ2A 4K3EH 1TCMA 1VZHA 3VFWB 1ZT1B 4E68A 1E9QA 1KBGH 4W9FC 5FLUA 4TOYH 3U4KA 3BN9C 4CKVX 4JUTA 4NBYB 5D6CA 3QW9A 5DS8A 2X5PA 2CK0L 3BWSA 2TRHA 4XHJD 3UJJH 4JO4H 3APCA 5FO8B 5HHOD 1KN2H 3KH3A 2HLFD 4OZ4B 1KPUA 5IWLC 1TLKA 1S3KH 3KPRA 4FQLL 4X0NA 1LD9B 3FU7B 2OXGB 3MACL 1E4XH 3PQYB 2C34A 3IRPX 2XI9A 2D9CA 4XXCA 3NABL 5FUCE 3L48A 2HTLD 4AG4H 3NMEA 5D8JH 4YSSA 2ZPKL 5H94B 1AHWA 4YWGL 1CFBA 1DQTA 3EGSA 3DIDA 3ULUL 1AO7B 1JNLH 3VW3H 3IE9A 2G2RB 4YDJB 3WMPA 4X4YB 3NA9H 3TBWB 1K8IA 5I17B 5BUGA 3OG4B 1A0QH 1GYUA 5DZNA 4MCMA 1CZ8L 1FPTL 4H0GA 1JGDA 3SCMD 3OQRA 3BIKB 3FCGA 1LGVA 1HNYA 5DC2A 3SKUD 4FRWA 3LEYH 3X12A 1I1FB 4PV9A 2QVMA 1J0ZA 1WS8A 3FQWB 3NDYE 3QEQD 3FB7B 2AQNA 3MLWL 4A7GA 3HR6A 2I07B 5E2VL 2KLTA 3IMUA 4UOJA 2VERA 3C60C 1DLFL 4DKEH 5IVNA 2X42A 4BZ2A 4HUXA 5KN5A 2Q0ZX 1N8ZA 4FE9A 4DWHA 4EKXA 4B96A 3MXVL 2A38A 3K4DA 2NXYD 4P3WA 4DVRL 2AGJH 1FBIL 1TCRA 2BP0B 1GOFA 4K3DH 3UMNA 1G9HA 2C7UB 1FYHB 1NLDH 3PGDA 3CK0L 3ZKXB 2D31B 2P26A 3O3DB 5E00A 3C5ZA 4R0LC 2F8XC 1QZNA 4IHOA 3RWCB 5FPIA 3QQ9D 4F8LA 5I1EL 1JN6B 4NZJA 5FW7A 4A7QA 4R3SB 1ORSB 3BI9X 4F9LA 2WO2B 3L4TA 7FABL 1Q1JL 2OMNA 5ABZA 5CIPB 5GGRB 4W9IC 4DF9A 4Q2ZB 1UCBL 3F58L 1MY5A 5I19H 4BRVA 1HJBC 2J12B 3L5XH 4Q9RL 4N2KA 2DBLL 2XN2A 3BLPX 4F8NA 1T3FB 4HU2A 4FTDA 4M6NH 2XQYA 2ADGA 3FYIB 1KEGH 5E8EB 1P4IH 2UUDK 4QNPF 3CSPA 3FQYA 5KTEH 3AY4A 3AY4C 4AVIA 3VXTB 2XA3A 1G7QA 2DI8A 3DOSB 4GQPH 1FCGA 5AUMB 1GTFA 3AQZA 1T21A 5DD0L 3RWIA 3ARBA 4OJAA 4JFED 1KBWA 4IYKA 3K71B 4OTXL 2DH2A 4FFYA 1RK1B 5C97A 4LCCC 4I1RA 3QPKA 1HEJC 3V4VH 1U2HA 5DXWA 3BP5A 3ZTEA 3VFGL 5KVFL 1ASPA 2Q76B 4W9ZA 2PXYC 3QNXA 4MGXA 4NZRH 5CLYA 5EUOF 3BE1L 5DZAA 4MTMA 3IGAB 1HT6A 1FNSH 1QEWB 5FW6A 1ZHLA 4F7EA 2FCBA 1F4XL 2JQMA 1CTMA 1U8HB 2EDLA 4CSPA 4IBZA 2YPKA 4LGRB 3FO1A 3N3EA 4U6VL 5EU3B 3QZLA 5C0DB 1DVTA 1OGAE 1X7SA 3WEMA 2H6OA 2FUTA 3VD5A 1AZUA 4NQVB 5EOCJ 4GSXA 3LZRA 3E3QC 1S3KL 2VDLB 1DEEA 1VZIA 1LVEA 2JNZA 1Z9OA 1FVEA 1ZS8A 2G4EA 3T71A 4I8DA 4X5WA 4XXWA 2D03L 4ZNEA 2EYTB 3ESMA 1NGZB 4Q89A 4WFEE 4BM7A 1HS6A 1JE6A 3GJFA 4NM8H 1MRDH 4IGBC 2WMPA 1BAFH 2R2BA 4N2GA 5KS9F 2Z31D 3CZKA 1R3JB 3O0RH 1WFUA 1F6AA 4G6KH 4Z7UF 1BLNA 2ZOLA 4YHZH 1L6XA 1ZHBA 1TF4A 1J18A 5IFJB 1QR1A 1SBBA 2AK1L 4FYQA 2J20A 3L3KB 5TE4L 1G7IA 3AREB 3NIDF 1Y7VA 4HIXL 3ARGC 2HAZA 4J3BA 3O3EA 3ZZQA 3US0A 2ZXGA 1Y18A 1R0AH 3F12A 4GSDH 5I1CH 2WQRA 2NY5H 3ROLA 43CAA 1E7UA 4BQ9A 5KSAC 5AYUL 3VXOB 1DJHA 1PG7X 32C2A 2IGLA 3EH4B 2EYSB 2XACC 3IS1X 3CGTA 3OR6A 5B21A 5K1JA 1KIPA 1B6DA 4KNQA 3TVMB 3IVKB 2OCCB 3RZWA 3WIIH 2BOCA 3ZL1A 4PJHB 2E9BA 4Z0XA 5IESH 3G6JF 2FVNA 3DXAD 1QW9A 2IDFA 2VDRB 3SO5A 3VWJA 6FABL 1S46A 3F04A 4XMWA 3AQXA 2ZUVA 4ANVA 1EQWA 4E5XB 3S48A 3A6OA 4HLJA 1BREA 1V7NH 5E24E 1EHLL 4XXCC 2Y1YA 4X5RA 1TU2B 3QXDB 5I0YA 3FFCB 3ULUH 3VW3L 5LB1A 1HEZA 3DO4A 1AD9A 4K5MA 1NGWA 3FQTA 3IJSB 2VSKB 3CN1A 3NABH 3QIUD 4K9EL 4AUJA 1IMHC 3PDGA 2XBDA 4IKKA 2NNAB 3FT2B 4GUCA 4YO0B 1IGCL 1ZGLM 2ESVD 2UY7B 1R3IL 3HC3H 1B0WA 1RZPA 3MV7A 1PZSA 5DQDL 1T83A 2IPUK 4QHLA 5D2LB 1RIVL 3O4LD 1NFDB 2V3EA 4RZCA 1J12A 3K72A 3T77B 1E8XA 4HJ0D 3I74A 1ZLSL 3BSZA 5FYKH 1I3RA 3AZUA 2Z1PA 1WS7A 3FUNA 4XC1L 2F2HA 1EXHA 3U7YL 2OK0L 3VRLE 1AR1D 4D7BA 5E6IB 4G7RB 3D39B 4R26L 1ZDQA 2CO2A 3S34L 5AENA 1MWAA 4L1TA 3VXMA 2YBRA 2GCYA 2P42B 5E2VH 5I6MA 2AV1B 1LDPH 1JVOA 5EF3A 3JWOH 2GC7C 3O6LL 1E4KC 1WITA 3TLRA 1GKOA 3DNKA 3FQNA 3KGUA 4HKZB 3K6IA 4UZGA 1MJUL 3IJEA 3QZBA 2OJEA 4LLVA 3UXFA 4AK1A 4BFJA 2DL9A 4LO9A 5IQ9B 1ETZB 4V1DB 4F2MB 1DQMH 4JQIL 2IQAA 4TSAH 4IU3A 3N0PB 1CYWA 1K8DA 5E6SB 1WD8A 2LGNA 4RGNE 3IKKA 3UABA 4IKLA 3GMRA 1YEDA 1DBKH 1BEXA 3OD3A 4AEIL 1D5XA 3QH3B 4R26H 3S34H 4BK4A 4M5YL 4PY7A 1G1OA 1RD6A 3NJIA 4EVNA 2A4CA 4HISA 3IETA 1MZZA 3HUJB 1E9PA 5JW5A 2L3BA 3D3VD 3NFPA 2E6JA 3QUZD 4J4PA 4NCC1 4MDJA 5D1XE 1HZHL 4YSRA 2X6UA 3TH3T 1QHPA 2MQ0A 3EO0B 2VJXA 4TUKL 2H3XC 3M17A 2MH4A 3CSBA 4O9HH 2PCFB 3VD9A 1JD7A 1EV2E 3D85D 3FT3A 3SYOA 4NUJB 5LKNA 4N0UE 4MQ7A 3GIZH 1Z9LA 3MBED 1XT5A 2XTLA 3CJJA 3WN5C 5K9KB 4U0RB 2F7PA 1LK3L 3WGUB 3HG1D 1HHGA 1SGKA 3BSHA 5FS5A 1P5VB 3BPLC 3OAUH 2XWZA 2B9BA 3T3MF 1F6FB 2V5MA 3IGUA 3LZOA 2H2SD 3PWNB 1H8OA 3LAFA 3CHRA 4M62L 1MG2C 4IS6B 4AK2A 1OP4A 1EEZA 3SY0A 4Z7QB 3JT2A 4H1LB 3LZNA 4PGEA 2ZX8A 1Z5YD 3VXQB 4PJIE 1QMUA 3VFTA 1S78C 3WDIA 3KVDD 3WTYA 1W72H 3SDYH 2VQTA 3KYOB 1HESA 3VGAC 1RLWA 1FL6B 1NGQH 2YAPA 3TO4C 2EO7A 4WFHD 1EJOL 2YARA 5C08E 1BEYL 4EDXB 1G7MA 1CFQB 5CFAA 4LP8A 3OLEA 3SYPA 1X9UA 5IM7A 4X6DF 3KDMA 1ZVYA 2BVPB 1U3HB 1KT2A 5F7YC 1JBJA 3DX8B 4XODA 2I9LA 3U36A 3LNEA 4Y5XC 3N85L 1NWPA 4HIXH 4B5EA 3AMLA 5TD4A 3AC0A 2QSVA 1CQKA 5FGBA 5FGBC 4GAGH 4MAUH 4BUQA 5HVHB 5C09B 1CK0H 1N2RA 1CGSH 1CICB 4UBDC 3VWKB 1WYJA 4OAWB 4DO4A 4ZUUA 2H3NB 2P5WB 5FV1L 1YYLL 4HLEA 4PV8A 2Z93A 2NUPA 2YWZA 3M6DA 4KJYA 4X6DA 2E7LC 4WFGE 2XIDA 3UC0L 2ENJA 4M3KB 4DIXA 2CDFA 2LR4A 5EG6C 3OHMB 3LS4H 3S2CA 4EXPX 3DGDA 4J6IA 2NCMA 3NIDE 4RZKA 2X4OA 4OGAC 2HFEB 3LH2H 4NFCA 1FZOA 4PIBA 2EACA 3RDTA 1T5XA 4YSUA 5F6IB 5EHFA 1SLVA 5KW9L 4P3DB 5TE6H 4P23A 3IF1B 4DH2A 5CD5C 4OF8A 3HMXH 1GGYA 3D12B 4L37A 5D7KE 4HG4J 1DLHB 2YPLE 5FFLA 5GRWA 1JCVA 3SE8L 4HKBA 2FJGA 3DVIA 2XIBA 4UNUA 1TSHA 5INDB 2IMNA 1OF0A 2QLYA 2IG2H 5D70H 1KEMH 4M8VA 3QJQB 1YEEH 5ILTH 1I8MB 2PXYA 2BNQD 1A6ZB 1MIML 1YEJL 3II3A 4EJ1C 4UYQA 2MRYA 4I13B 4MZ2A 1MVYA 5JXED 1HZHH 4NBXB 4HIJB 1JWUA 1BQHB 1CL7L 2QPUA 3VRIB 2E7HA 2FO4B 3QIUB 4ODXB 4WW1A 4WFGD 3I9GL 3QNZB 3KPRE 5K69A 2ZUUA 3UTOA 2AXFB 3PV7A 2HH0L 4OVVA 4JPWH 4F8PA 1XB3A 3FFCD 5AW4B 5GGVL 3JWOL 2FHFA 4WHCA 4WEMB 4GQZA 5ICYB 4XVUC 5E9DA 4BFRA 1P7BA 3UYPA 1U8HA 5ACMA 4G8IB 1WGOA 2XQBL 4YVNA 2H32B 3ZE1F 2VM3A 3P9WB 3KDPB 2CLVB 5EIIA 5FKPA 4GQ9H 1LDPL 1PFOA 4WWKC 1HK6A 4HUNB 4PVMA 1IBDA 4X99B 4N90D 4XNQB 4X9HA 5FB8A 2N1KA 3RVUC 2CU9A 3HRZC 3R0NA 4LSUL 5I6OA 5EEXA 5TDPA 4C4KO 3M1CA 4LSSL 4Y1AB 1MFAL 2BSED 5BZWA 5CUSH 4LMQE 4N2LA 5B8CB 3BT2L 3WI9A 5IY5B 4FXLA 5DHMC 4GI9A 5I73C 3T1FA 3RGBA 4JHUA 5E2WH 3UO1H 4RBPH 4OGYH 2DQGL 4WWKB 5KBDA 2YPVA 5LBGA 2O5XL 2YEQA 3O8XB 1ZJBA 2WQUA 1MEXH 4AMKL 3BLKA 2CAKA 1MHEB 4CAGA 1FO0H 4XBPB 3A4DA 4NRYA 5CILH 3QQ4B 1QABA 2A1WL 2I26N 3RVXD 1B0IA 2ALWA 4Y19D 4NC1E 4UV4L 5EOCH 5DVNA 1YEIH 3BD4A 4X7TB 2P5EA 3BESR 3D0VA 4P46C 3AJ7A 1CLZH 1OE3A 3ULVE 5BZDA 3CVIH 1UCTA 4NQDB 5E5MA 2CXKA 3MOBL 4D7PA 1D7FA 1R17A 1OGAD 4KKCC 2DQGH 3D5OF 3IPFA 1P1ZA 1UXLA 3RVWD 2EDQA 3NIGE 1GZQB 5CFHA 2WB1A 3MR9A 1GPOH 3QORC 3B5GA 4XCNB 2FNWA 5DWUH 3B9KC 3B9KA 2VLRA 1S7TA 3QR1A 1D9KA 4N8CH 4Y8AA 1XH2A 3CSYA 2D4DA 1TQUA 1P7KA 1E9OB 2F68X 4FJYA 4AL8L 2WXMA 3FU9A 4HH9A 4OIBA 1VEOA 2W0FB 2VZ1A 1N59A 3RIAF 1N4XL 3P4MB 1G9NH 2XRAH 3QBTB 2APSA 1IGJB 3QQDA 1DN0B 1B2WH 1I3VA 5SWZD 3US1A 1QW8A 3QIWA 4GSDL 4IOSD 4AQAB 1IVTA 2OV0A 1ZLEA 2WXIA 1G5GA 3PCYA 4EN3D 4CMMB 5JZ7D 4NQEA 3HG0A 5IW3A 3DLQR 1WBZB 2BP3A 4CN6A 3OKEA 4XNYL 4XMLH 1JHTB 2V7NB 3RX9A 4Y88A 4JANA 2FGZA 2VO5A 4IIQA 5HGAB 3MLVL 2J8UE 1ZSHA 3NT0A 5ADOH 1CU4H 1XHHA 3RDJA 4N4YB 3VM5A 1YY8A 2WVSA 1IAOB 2J25A 3CC5A 3KXFB 4QRSA 1RUML 3B3IB 1BSIA 4WI5A 2QPDB 3H2QA 4NC2B 3O81A 2GAZB 2FJHA 4NPYB 1PZ5B 4U7KA 3WE6B 2LFEA 2ED8A 4N8VA 4UDUB 1R5VB 3IFOB 4PJDF 2JFCA 1RHHA 3P4NB 4HS3A 3C6LD 1PJWA 1W8NA 4HW6A 4P57B 1IKFH 5T3ZH 1CICD 5DFTA 2G60L 4OLVH 4JFDD 1CYXA 3LH8A 2BVYA 3PHSA 2OR7A 1OZUA 1JZDC 4LOUC 2J4WH 4WLCA 3UAJD 1YNTF 1J1PH 2VLKD 3RTQD 1FGVL 5LGJB 3RNQB 4OZIF 1P2CA 4Y16C 2V37A 3GM0A 5CILL 5ICXA 4XNUL 2EJ1A 2HRHA 2ZOWA 1CFSA 1PY9A 2EDTA 5GSVA 2JQAA 4EDWH 4B5ZA 1D6EA 1UXSB 2LLNA 2MEJB 2FYYB 3KG5A 3DMMC 3ERXA 5J56B 1PYWB 1DJWA 3P77B 2E75C 4IBSA 2VDNB 2EE6A 4LF3B 4P5RA 4QD2E 3IDJB 3WFBH 4UTAA 1OP5K 5FV2A 2ZNXA 1YECL 3NJKA 1UWFA 4JG9A 2WY3B 4YHNA 1KLFA 2CDGB 4FI8A 3D34A 4N0CC 3ZQXA 1HHJA 4G9DA 4YHOL 4E9XA 2P8PB 4PS4L 3M7FB 1X6NA 3OZLA 2ATPB 4GG6F 3QO1A 2FQEA 1JHKH 3JWNG 2YPLD 3GUFA 4FDWA 1OSZB 1TQCC 1JNJA 1DQDL 2WINB 1F58H 1NCBH 3EGSB 1WUZA 1KJ2B 1G6RA 3HMXA 3AVEA 3RUGB 3TFKC 3BAKA 1FNLA 4O4YH 1H8SA 5AOLA 3SKOA 5I8OH 4XN8A 2Z31B 1PTZA 5E2TL 2F58L 4FF9A 4M5YH 4UT7H 4LSRL 5LAXA 4Q14A 4MA8L 1IQDA 1WWWX 1I7UA 4GRWE 4HLZG 4RH4A 3VWKD 4ONGH 3CQFA 1L7IH 4GG6E 1DVSA 3FQWA 3A67H 1BMGA 3LS5L 4ABWA 2PF6A 4P46D 3UTSE 4M7LT 4YDIH 1R4XA 1KLUB 2VSMB 2ZXAA 2Y6SD 1FHNA 1E4XI 4ODVH 4P4RA 3CH1A 4FQQB 4PJ7E 4XMKH 1F6AB 3KL3A 4AENB 4G8GA 1TZHA 2XRAL 2A9MH 3U79A 3P4OB 3MOAH 4W9DC 3U1SH 5MERA 5F7AA 3AUVA 3WNJA 1IC5H 1TVBB 4L23A 1NJ9A 2NDGA 1ASOA 3HBQA 3L3GB 2IWKA 3IMBA 3C5ZB 4HIQA 4OZGE 3T2OA 5L4JA 5EO1A 5D8JL 3TNMB 5I71C 1YNLL 3ZYJA 4NDMB 5I76A 1KIUA 2I24N 4FP8H 4NHCH 3QWOB 3QDGB 3SOBH 4RX4A 3BFQG 2W9LA 32C2B 1DSFH 3MRGB 1HH6A 1AS8A 5K9QI 3GPEA 3IAQA 4N2HA 4AMXA 1ROWA 1UJTA 4AQZA 1CDIA 5HHNB 1DSYA 4AMKH 3OR7A 5E4EC 5F21B 1XSKA 4HZLA 2MSPA 3WTSA 2EKJA 3GLDA 4FQXB 5C0GA 1F3RB 4EI5B 3OL2A 2BVEA 2QADB 4UV4H 5EOCL 4Q6IA 4Q6IC 4G7YH 3W39A 2NMSA 1A64A 4JRXB 5B38G 4N24A 2IPUG 2E7LA 4ZXBB 3MNDA 4PJGB 2X4UA 3CFUA 3UTTA 4TXVB 3RUGF 4EEEA 4OT1L 3CFNA 4H8WC 2JXMA 3BO8A 4PRNA 1XF1A 3K91A 1UA3A 4IQHA 5T1JA 3K8MA 3TO2B 4QRQB 4MBRA 4AEHH 2UYLA 2JJSC 3EBHA 3N40F 2IDCA 4U1LA 3ELAT 3QEQB 4ZFGH 3SGKC 3ZOAA 1M6OB 2AGJL 4AL8C 1TZIB 5HDLA 4X6FB 3HHMA 2C5DC 3OMAB 4QEGA 3HPLA 1RMFH 2R0LL 4Z95L 2VMFA 3QI9B 4KRPD 4WCYH 3VFVA 5KVGL 4C59B 3BOVA 3D4YA 5KVDE 3KYKL 5BVJA 5HDBE 2F8IA 2X4QB 2Z8RA 1AR1B 1LMKA 2GFBB 3MRPB 3QHFH 3QUMB 1FV1A 3A0OA 5KSBF 1L9MA 4X5WB 1WK0A 3LS5H 1A1NB 2WWMD 4NFBA 3KH4A 3VRIA 4HUVB 1U4FA 3LNIA 4GOSA 3TO4B 1T2JA 2QSCH 3WS6C 1FFTB 3A23A 5ERWA 4FI7A 3DGGA 3DX7B 3AG1B 1R3JA 1SEBB 1NUNB 2R1WA 1ZLUH 2CCWA 3WMSA 4O02H 2OW7A 2RR3A 2LVCA 3ES6B 4GKSB 5HHOB 1QR1B 3OF6D 1I1FA 4XOAA 3V10A 1J10A 4I2XB 4M9OA 1QATA 3H56A 1MH5A 5D96B 4XVJL 3TIDB 5F9WB 2FATH 2E59A 1XZ0A 2OMVA 5T5NG 3N40P 2P8MA 2HFGL 2G3XA 4EVNB 2HZHA 5L2KE 3KJ6L 3ZGIA 5FB8B 3I2CL 1A7RL 1OE2A 3HI6L 3P69A 2R29H 3NFSH 4QHUA 2AW2A 5K1NA 3QUHA 1OAUH 6FABH 2B5IC 3APNA 1F90H 1MJ8H 2A6KA 4XPAH 1BX2B 3WYRA 5C6TL 2OXHA 4YDVA 4HP5A 4BGDA 2IFFL 4JRWA 3X1FA 3RZCD 2ZQKA 3C2SA 4NQCD 3KE0A 2ADJB 4AGOA 4P9ML 2FATL 3MUJA 1TZ8A 4K15A 4AITA 4PRDB 3Q1SL 2XETA 5E94A 3RILA 3T5WA 5F7MC 3T8MA 4ZTOH 5DUMH 3TBWA 4R2GC 1BOGB 4PJ5D 4JL1A 4S10A 4ALAL 5I2IB 3BQUA 1MFCH 1RZIB 2H41A 4N9OB 5I9QC 2D7OA 3H54A 4RIRB 2JLPA 5FK9B 1ZS2A 5JDSA 3QFGA 1B4RA 2DWEA 3IKCA 1EEZB 1FORL 4PGEB 3H9SB 2PPCA 1P7QB 4OQ1A 4AIEA 3K2UH 5BRZE 3K71A 3ASOB 4MS8D 2FL5A 3HW7A 1KELL 1UCBH 2FEEI 3F58H 1UTDA 5CLTA 2BFVH 3FK3A 4LRIC 1INQA 3G5XB 4JFHE 3D4CA 4HSQA 4U1MA 4JX0A 5F7NC 2IH1B 5DS2A 4BFBD 1NLBL 4QJ4B 5I1EH 3QNXB 4XX1G 4ZD3L 4XP5L 5MEOA 2LW3A 3ILPA 2AZUA 4KX8A 3WXVL 2BS71 4IW4C 1XGPB 4LPCA 1S9XB 5T8IA 4ANXA 1FN4B 4F8OA 1KJMB 2VE6B 3Q2WA 1U3HA 3GMLA 2VW4A 1JPSL 3OKKB 4FFYH 5DJAA 3VH8A 1MWAB 3QQDB 3NFNB 4AQOA 1IC0A 3RWCA 4Q6YA 4F1SA 2VIRB 4WU5B 5IVXF 4CC1A 3U9PH 4JPKH 4DERA 4UNIA 1ORSA 4UILL 2OMBA 5L8KB 2MTPA 3NP3A 5HGHB 2ZD0A 4PJ7F 3EF4A 4QY8A 2EKSB 2ISDA 4RFOH 1F4XH 5MP6L 1WBZA 4G83A 4JDTL 5CN3A 3ZHKA 3VI4A 3QZMA 4JANB 2A74B 2XOTA 4JFWA 2XZAL 1ZLWK 3WNLA 1NCGA 3L3IB 3D7PA 4PJBA 3G6JA 3MLSL 4NO2B 3T8VA 1YEDB 1WV7T 4DUVA 4FXKC 4C56A 4KI5E 3QUYA 4YHPA 2C3VA 4HJEA 3CWGA 4MNQE 1UWEL 3TTYA 1GC1H 5I1AB 5AVQB 5F0PB 2VZUA 2CBOA 5KYNA 3GUTB 2V33A 2JK5A 4JKWA 4JFEB 1T5XB 5SX4H 1ID5I 1ETB1 4BD4A 3LKPA 5I73B 2X2UA 1E3ZA 5E2JA 4P57A 4ZS6D 1E6OH 4U6HB 3CU7A 2VQ4A 5FUZH 2WLMA 4LZKA 5LUMA 2V6HA 3MV9E 4LLAA 3RWFB 3OAZK 1D7DA 2CJUH 3U2SB 4WGWB 2FLRT 5DEFA 1OARL 2HRPL 2Q8AH 1ZT7A 4FL4C 4L4JA 1LEIB 4YHLH 1HKFA 5K39B 5KTEL 5D6DA 1TENA 1FNAA 2SEBA 3QC6X 3IAPA 3TVMA 4MQSB 3MRKA 3IE4A 2XZQH 4FS0A 5E1QA 5GJTH 3S8WA 1CGUA 1IARB 1BECA 1MREL 3V5KB 1BQLL 5EBWB 2CKBL 1S2EA 2PMZA 3MUGA 4LSQH 4MA3A 3OKOA 2VQ1B 3E2HC 1S7XA 1JYXA 3BP7A 3HI1B 3L3OC 3L5JA 3OSVA 5CJXC 3T65B 5B39B 1N3NA 2X9XA 1LQSR 4YHNB 5HDQH 3K3QA 3R7RA 4B9IA 1BFOA 4OZGA 2ZCKL 5SV3A 2Y6TE 4UCFA 3RVWC 1T5KA 1M7DB 5EU6D 5IFJA 4ELDA 1U8KB 1T0OA 3RQ3A 4ATWA 4CVXB 3TIEA 1WSST 4JFFA 1FFNA 1ZA3A 2KQNA 2R2CA 3KDMB 4YBHA 4G70B 5E4OA 2AXWA 1D5MB 5FUCC 2IWGA 2NW3A 5KSBE 1FNFA 2TSBA 4L5FH 4JGUA 4LL1A 3DUHA 2D03H 4JM2A 4NIYE 2AFNA 2GHWB 2BIIA 4QHMB 4KROD 2RFXA 2HFGH 3D48R 3SJVA 1QA9A 3IK2A 2C9SA 3GSUA 4G8EA 4KV5E 5D5MA 3OC8A 5D7IF 1EHLH 1IGYA 1F11B 1QLEB 4BZ2H 1GXEA 3A4EA 1ONQB 4K5NA 2R0WH 2BY1A 4KJYB 3L7EB 4X6DB 4N8VG 1NDGB 1CF8H 3CLWA 1QBAA 3BEWB 3IJYB 3LHPH 4A2EA 1IM3D 1SLXA 2CGRL 5FA3A 1UG9A 4X9GA 3QJHA 4P4KB 3PHQA 1MCCA 5CLXA 4OCRL 4XWOC 5K9JH 5MERB 4GIOA 1MHPH 5J0BA 2QSTA 3E38A 3C60B 5KUMA 2X6VA 4NS0A 3QQ4A 2A73B 3V7AE 5AYUH 2HKFL 1Z5LA 3QRGH 4GT7A 5EB9A 1D5ZB 3PP3K 1OGAB 1CLYH 4HFUL 5C0CB 3ZT5A 1YCSA 1JPTL 2ZSWB 1MCLA 3L3JA 2YPVH 1RSFA 4JREC 4G43A 4MCYA 4TV3A 1O7DE 5BOJA 5JHLA 5D1ZD 3IETB 5FHBH 3RRQA 5J5EA 3LEXA 2X1XR 4M1CC 4PLKD 1BVNP 3F6JA 1ET8A 1YA5A 5B38A 4MDJB 1FLRH 2FQFA 5AKTA 1OAYH 5CEZL 4YGVB 2NTFA 3PP4H 3ZDZF 4LCCA 3SPGA 2YLHA 2WANA 1YRKA 4L29B 3ATFA 2AVGA 1M7UA 1PG7W 2V8LA 1FWXA 5F7DA 1I8KA 5SX5K 4QT5B 1P4LB 2ZXWB 3TBBA 3VQ1C 3F64A 3UH8A 3QNZA 5K9KA 2XQBH 4MVBD 1MCIA 1QRKA 4YHLL 3NESA 2APBA 3KNBA 3FQXA 1P53A 2FAUA 5ITFA 3T0DA 3P0VL 3PAUA 3U6XA 5AWNL 1HN1A 5DI8A 2AJZA 3V95A 4ODWB 4YZFF 4PB0L 4KK9C 4NQXB 3FMGH 4OZFB 4ZYKA 4NIKB 3PWVB 4AJWA 4QOKB 4NN7C 4F3FA 5AD0B 1CDHA 4WV1A 3VSQA 4F1ZA 3QCVH 2GUOB 3UP1A 1TYJA 4KTYA 3W38A 4WO4B 3WNPA 1DBJL 5D1QE 1VFUA 2WUBH 5B7EA 3QJFB 4HF5H 4N5EC 5D7IB 2YEVB 1KFAH 1ADQL 2VZVA 3FDWA 1J0HA 3PGFH 4G9FE 4HGWB 4XH2A 1E5CA 2OP4H 3DX6A 2GABA 2X87A 4YZFE 5D71H 1FI8C 1W72A 3LMJL 3MRIB 1NIDA 5BQ7A 5JOPE 2R4SH 1H5BB 1GYWA 4Z7WB 3VYOA 3RGHA 5DF0A 4RGOL 1U2CA 1BD2A 2H0FA 4LSTH 4AYDC 5KSAA 3HHSB 1K6QH 3C87A 1HQ4B 4Z7NF 4XN5A 1BQKA 1X6LA 3QFJA 2E76C 2Z93B 4PV8B 3VFRA 5JLZA 3D6GA 3PL6D 1G0YR 2HWZL 3L16A 4KXAA 1SXSA 2XNAA 2AJSL 3JWDL 3M8OL 3QXVA 1AZRA 4EI5C 2QHLA 3RE0A 2CUAA 1CJYA 4LAJH 5KBNC 3P11L 2AS5M 2CALA 2YEZB 1WEJL 1AGEB 1WZ1L 4N3TA 4WI7A 3MXWL 2HLAA 2RA1A 4UOW1 3UG5A 1B3JA 5LVEA 2QPFA 4F57L 1CDYA 2OXHB 3ABMB 1MCEA 1UT1A 1XQ4A 3O3UN 4YDVB 1FL6A 2VZ3A 3JV4B 4Z7NE 1CGSL 4EDXA 2MQCA 2YJQA 1IZJA 1TJGL 2YKLH 4TQ8A 2APWA 4PREA 1XCTB 5FDWA 1DVFC 1QLRA 2AITA 3B9EA 4FNPA 2IPKA 3PPEA 5CBEA 1TNMA 5HYJD 4D9LL 1V5JA 2Q1EA 2P28B 4GBXA 4YIQB 5BO1L 4Z7UA 4GKLA 1JZGA 2VDQH 5EA0L 2YXVA 1OO2A 1PVHA 4ICWA 3EHBD 4FULA 2E9IA 1DBML 2DWSA 1WAAE 3TO4D 2OXGA 2Z8VC 3L7FA 3NJNA 3S6CA 4EIBA 3DO7B 5JOFA 3WJLC 3SDCC 4L8CA 1G9NC 2H3NA 2P5WA 1SXZA 2WK2A 4LCYA 2EVIA 2EVJA 3U0TA 4JM2C 1LEKB 2ICEA 1GS8A 4QF1A 5HGDB 4I1NB 1YJDC 4JG0H 3WIFA 1BVKB 1DSWA 1OGPA 3S0PA 4NNXA 1BOYA 3P1VA 3TPUB 4KGJA 2K1MA 1Q72L 1XV8A 4FNQA 2EXYC 1FA4A 2BERA 1L6PA 1JI2A 5D7LD 4NRXA 2J73A 2W0LA 4PJIF 3DXAB 5DGQA 4YWGH 4RDQF 3DV4B 4AGMA 3PUCA 4R83A 5CP3A 3SE6A 5F7HA 5LQBL 1BQHG 4HCFA 5EORH 1T4KA 4F7KA 4KC3B 2FX7L 1ZV9A 4DGUA 4PJCA 1YEHH 4ZDHA 4JDZA 4OZIB 3L45A 3NCXA 3QDGA 5GGUA 1RPQA 4HV8B 3KWWB 3H42L 1Q9KB 3SKNB 4ZOEA 3RNQA 4TOYL 3KPSB 1IM9B 5SWSE 2BVTA 1ZV5A 5EF1A 4NWUL 2Y36L 4JO1L 5INDA 1X5ZA 3Q8AA 2H7WA 3BZEA 4RFEA 1HWWA 4FQXC 3S3SA 2H1PH 1YNLH 5JHDE 2F54A 1VADB 1QFOA 1RFDL 2D4FA 3MFFB 4RA0C 2OR9L 3QXTA 3IDMB 4KK9D 4E2OA 1E2VA 3S37L 2Y4SA 3GHBL 1NBZB 5SWZE 5DD3H 3UTTB 1MFVA 5E1AB 1H0DA 1BPVA 3HNTH 1FVCB 1MQKH 5JPNC 2WVVA 1OAXH 4N0UB 4D0CA 4MVBC 4QXUH 5CCHE 1QYGH 2VAAB 1Y6MR 1Z0NA 3QJTB 1SY6H 2R69A 5DEFB 1XF3B 1R5IA 1NDMB 3OJDA 3UTZB 1MXGA 3QI9A 4FG2A 3VFVB 5I0DA 3WAKA 3NGBC 2A9NH 3G5VB 3GQFA 3RUGA 3D0LA 1EBPA 3C5JA 5FYJL 3EJTA 1HQRA 5DHYB 3UBHA 3CPUA 1QSZA 3K2KA 5DHXB 3FBQA 4AM0B 3QNYA 5DTFB 5DJCA 1X5KA 1OB0A 4EUPB 1I9RL 5GRYA 3D1MC 1P7KB 2HKHH 3KYMB 2VQ1A 4LB8A 2VL5A 5DA4A 2YRPA 5EN2A 2XVBA 4BH8A 3ASNB 1EO7A 3G3LA 3EYSH 4E5XG 4ZQKA 1SEBA 4TUJB 4AENA 4YHMH 3IFPA 3O11B 3TZVB 2VW6A 4P4KD 1SUHA 3AS2A 5IBLC 4IBLT 2B59B 4PRIA 5C0CE 5C3LD 4IU2A 3GSNH 3IU4H 4PJGE 1MFDL 4OI7A 3M88A 1K72A 2JKTM 3T08A 2Y25A 2IOOA 4FLRA 4A63A 2FB4H 3QUZC 4F5CA 3KBEA 2CO4A 5C6WH 5FHAL 3QWOA 2QSCL 4GUPA 3FTGB 5CBAA 3VDBA 4GMSL 5ENWA 1A5FL 5FECA 3V79C 3VDAA 4FD0A 1I8UA 4J3OF 3V55A 3SQBA 2AEPL 2MCG1 1AXTL 4EI5A 3S96B 4G9FD 2WLLA 3I75B 3MBEC 5IIEB 1BFVH 3ISYA 5HGGS 4BXVA 4TS6A 2K9FB 1ZTXE 2FWUA 5CP7B 3TBVB 3VXSA 5D5MF 1DQJA 3ETBF 3PNRB 5ANME 4IDLA 4ZO8A 3RWDB 3KCPB 1WLHA 2R56H 5DJ0A 1BZ9A 3F12B 4I0PC 2RQEA 2JXMB 4PRNB 5M95B 4X4ME 3FJTA 2ZE0A 5F88B 1I85C 4ZK8A 1Q9LA 4NKDB 2J71A 2EE0A 2UWEF 2CCVA 2MCPH 2NYYC 2YA1A 4TSBL 3PWPB 3T6WA 1OP5H 2WGNB 2HG0A 2ZSWA 3O9WC 1AMXA 3Q1SH 3SE9L 5DO8A 1U8QB 4OCXH 5CMAB 1NBVL 1QWUA 2V0AA 1FL3B 1CVSC 4QRPD 2GJZA 1KEML 1VCBC 3BXNA 2EC9T 4NZUH 4XCEB 4LRNL 5E08L 1D2PA 4LKCB 4RGMC 1YJDL 1IFHH 5CKGA 3QAZC 4RRPA 4ALAC 1G9NL 1HHJB 1ODUA 2JKSA 2BSRB 2P8PA 4G9DB 4F93B 3OSKA 1ULVA 1NKOA 4R96A 3ZT6A 1R3HA 5GZND 5A2BA 5FM5M 4BFIB 4UOW0 2HMIC 2G3MA 1AZVA 1FN4A 4LXFA 2VNCA 3L1OL 1PLGH 5EBGA 4NKOA 3ARWA 3Q8EA 1RUPH 5EC1B 4YHIA 4YSPA 1NCJA 3OGCA 5LQBH 3DTXB 1J87A 1OGTA 2XVKA 5HGHA 2XG4A 5FKAA 3LS4L 2HT4C 4F37F 3RPKA 1KTDA 2JJTC 1TYEB 1CFSB 3WELA 3ZK0A 5GSVB 3LIZL 1I1CA 1EZLA 1U8CA 2AKRA 5I5RA 2VMDA 1K2DA 2DEYX 3B2MA 1G6RH 2NY4B 3IRZA 1V05A 3MI6A 3PHAA 4FZEL 4HC1A 4LOUD 3UAJC 5IVXB 3T0EE 4WEBL 5C07D 5ESAA 1N5YL 1NMAH 3VXNA 3F6LA 4GRLB 5HHXH 2ZKMX 3LKPB 2OL3H 3BHBA 4WTXA 3V0WL 4X50A 3L3DA 2C4XA 4E42B 3QPQD 1T1XA 4H26B 3CZJA 5JYLA 3T8XB 3Q2LA 2WZPA 3RGVB 3VXUA 1I1AA 2WQ8A 3ZMRA 4GO6B 3KZ8A 1RH8A 3PWUB 2PP9A 3WEOA 1EVTC 2H47C 5LGHL 4OM0H 3RIFK 5KBMA 5ID1B 2A6IA 3B37A 1KGJA 4CVUA 5IJCC 2KMWA 3GHPA 3TN0D 4HZLB 3LIZA 5FHAH 2YGPA 2AQPA 4J3OD 3NFPB 4HH8A 5F9JB 3D9AL 4A2DA 2GJPA 3ZKQD 1G7LB 4PGDB 5GGQH 3FUJA 3SE4A 3SYAA 1YN6A 4HKXB 2V3DA 3TNNB 1MW2A 3VJ6A 4ZXBA 4M4RA 2I60L 4LQFL 4HU8A 5IMMB 2C7FA 2X3CA 2GY5A 1VGKB 4XVTL 4P4RB 3ISRA 1AHWB 4GMTH 3GSQB 3SBWA 4XP6H 2K6WA 4N8CL 5J12C 2PO6B 2FNBA 3OXRA 1BWWA 1DSFL 3PJSA 3L5WB 3E6FA 5I1HH 4KOCA 4OF5A 5F1SA 4PJBF 1RVFL 3PWNA 1BZEA 4PAZA 2XXGA 4KROB 3B2VH 1LILA 5EU4A 2D7NA 1T0NA 3IXAB 4ZFFB 4I0PD 1UH2A 3GXMA 1G9ML 3HS8A 2R1XB 4B9YA 5CWSB 1TJHH 4PJDE 3KMDA 2NY2D 4PJHE 1B9KA 2F53B 4Z3FA 3VG0H 5JIMA 4YEEA 4WENB 2MOGA 3DROA 1A6VH 5HJ3B 2ZUQB 4WI0B 3HFML 3T6ZA 4OCSH 4ELKA 3ABLB 1MEXL 3BGFB 4LPWA 1MPAH 2CQVA 4MXVE 4Y1TA 1Z9PA 4CC4C 2DQMA 5IW6B 3W39B 3NJXA 1TJGH 2J7LA 4K8RC 5DVPA 2WM0A 1EO8L 5E03A 4NO0A 2JCCE 4M61A 3ZUCA 3KPNB 4KRMB 3GD1C 1P6WA 1JXGA 2EIZA 3GI8L 4N3UA 4XNDA 5KAQF 2HJKA 4LEOB 5B1JC 4XX5A 9PCYA 1RJLB 4PJEE 2MJWA 3DUSA 3Q2VA 5GZNC 1F4YL 1KXQA 2YHGA 2ZKWA 4XPGH