3AABA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form i crystal
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
ELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1653
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
total genus 21
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aabA00
1WH0A 2BOLA 2MNWA 4I88A 4PCKA 4YLCA 3QORB 5LUMA 1X5MA 2JKIS 2CG9X 2WJ5A 3GT6A 2Y1ZA 4MJHA 2KLRA 3AABA 3J07A 3GLAA 3IGFA 3QORD 4FEIA 1EJFA 2Y1YA 4YE0A 4YL9A 2WJ7A 5DS2A 3W1ZA 4ELDA 4JUSA 4M5TA 3VQLA 3L1FA 1SHSA 3N3EA 2K8QA 1RL1A 3Q9QA 2RH0A 1GMEA 3EUDA 2N0KA 4JUTA 2O30A 4ZJ9A 2KMWA 1WFIA 1WGVA 3AACA 4YLBA 5DS1A 2N3JA 3VQMA 3GUFA 4PBDA 2XCMC 4RZKA 4M5SA 3QORA 3Q9PA 2CR0A 4YDZA 2Y22A 3L1GA 3L1EA 3QORC
chains in the Genus database with same CATH superfamily
1XWVA 4PJ6A 4OM0L 1KXTB 3H4HA 2Q2LA 3KPLA 3O6FC 3SYQA 3UCRA 3KPSB 2QSTA 3GBNL 3L95A 4QHLA 5BVJB 4GNKB 3N43F 4ZOAA 1WIPA 2JKJA 3I2CH 1DQJA 3CU1A 1YPZA 4JQXC 4QTFA 2O1AA 1A3RL 4Q9QL 3O8XA 1FUNA 3B7YA 4OLVH 3QEQB 1J05A 5JPMB 2ZX7A 3S37H 4Q58C 1OHQA 1P5UC 4JRXA 3GMQA 3KEHA 4M43H 4N0CC 3F7QA 1ZE3C 1OCWH 4I1PA 2V9UA 3FT1A 1K8IA 3SDAD 1HH9A 3ZDZF 1N59B 5KVGL 2JK5A 5MP6L 2WINA 2AV1A 2BFVH 4TOYH 4MNHB 4P4KB 5K5YA 1WV7T 2P52A 3BCDA 2J3SA 3KCWA 1KCBA 4GAJH 1EXHA 3FQXB 2MQ0A 3QXVA 5DCCA 2VDKH 3KJ6H 4XWOD 3QXAA 2D9CA 3EHBD 4YDVA 4UOW1 5IWLA 4A55A 4U1NA 4J3TA 5EHFA 3IJSB 5CBAA 3VFRA 2GJ6B 5IREA 4GRWB 2LLNA 4EI6B 3FQWB 3IMUA 1P53A 1SLUA 1NCBL 5MEOA 1BZ9B 4R8WL 2ZYSA 5JO5B 5KJRL 2J5WA 4Q56A 2AQ1A 4F80A 5IVXA 1DN0A 4OQTA 3TESA 1F00I 2MCAA 4FMKA 2A6DA 2YAEA 4ZPTB 4LVNC 2K6WA 5JHDB 2L7QA 4LLUA 3REWB 1FZJA 4QXWA 2ZF8A 1JTPA 4I1RA 4GAGH 1YECL 4LOEA 5ILTL 2Y7MA 4X7FC 5ICYB 4HLZG 3OKOB 3K0WA 5HHME 3EUUA 2NDGA 4X5WB 4HKXB 2CQVA 1LP9F 4OJCA 1VPOL 2Y5TB 3HMXH 2X05A 1OT2A 2ZXCA 2BW4A 3Q8AA 1BXXA 5F7LB 3MJGX 1UXSB 2B9AA 3ARGA 1FFQA 4O51A 2MKLC 1Q9WB 3FONA 2VDOH 5FDWA 3FQ2A 2AVGA 2BHYA 2FCBA 2WTOA 4AW7A 4BFKA 1SJVA 3WTVA 3V5DB 1YMHB 2B1HL 5IMMB 1TFPA 2O6PA 4Z7WA 3VCLA 2PETA 3ZR5A 3QQ3A 3MV9D 1OGAD 5AL0A 2VW7A 1KWKA 3NIGB 1D5MB 4GMTH 4ODXB 5D7LD 5KEZA 4XNMA 4JFQA 4L48A 1I1FB 3VTMA 3WS3A 2H1PL 3RL1A 1DJYA 1AGEA 3U2SA 3QFDB 1KIRB 1J1XH 1TTGA 5CILL 5IQNA 4XPFH 1YEWA 3VXMB 2VXSL 3O2WL 4M6NL 1UZ8B 3L6FB 1QSZA 4Y1AE 2K7QA 3VX1A 5IEKA 1OCCB 3V79C 5DHEA 4YSPA 1DO5A 1GH7A 3OAUL 4J3OH 1DQML 2J55A 2HVJA 4ZTOL 1CWVA 4J39A 4LLWA 3D87B 3PWJA 3B7SA 1R4XA 3EF7A 3HI6L 3KPOB 4W9DC 2FO1A 1OF2B 1TLKA 4QYAA 1IC5H 5I1KL 4GXUN 5I6LA 1WAAF 3P9MA 2K70A 1EO8H 4AG4L 4MKTA 4AXWB 3EG9A 3Q2LA 1VGKB 2OJ1A 1GYVA 2XXFA 3F04A 4PBXA 1URLA 4GKZB 3BKCL 2X4SB 3HAEH 3II2A 4RSVA 1S9YA 4IKKA 5CZVH 1MKFA 3NIFB 3G6DH 2QZ5A 4XN2A 5DMJB 4RAUB 1UEYA 4WIQA 8FABB 4OFPA 3FBQA 2OI9B 4LCVA 3EYOB 5FOBA 3SHSA 1AQKL 4JFDD 3ARXA 2R15A 2C7FA 5HHPA 1QTYT 3GMOA 4NRYB 2P5PA 3QNZA 3OLEA 1JZ4A 1MY7A 3N9GH 1LYQA 1O9VA 1UB6B 1WZMA 1XD1A 3BH4A 3SQRA 2CUMA 3EJCA 3PGDB 5KYUA 4DN3L 1ASQA 1NGXB 2JH2A 4XXCC 4RMVA 1BQHG 2PCFB 3IDXH 5BUGA 5IUSA 3TJHC 1DUYB 4IRJC 1CFQB 4X4ZA 2WANA 3ZY7A 1Y18B 4JM4H 4QTHA 5D2NB 1H5BB 4I1NB 1LEKA 3VD5A 2H32A 4JQXA 5AOMA 2G2RA 5TTRA 3ARTA 2TRYA 1G1KA 4IKLA 4MXVE 3DURB 3VI4E 1U6AH 5I8OL 1IT9L 4HD5A 3AG2B 4H0HB 1PNCA 2J2ZB 3GJFB 3R1GL 5FO7A 5KSUB 25C8L 1J8HA 5C0DA 3B2UC 4Y9FA 3MXVL 1YQVH 4IBZA 2OXHB 1CYWA 5IB4B 1SPDA 2WTRA 4A7VA 1NDGB 1HCYA 3MJ9L 4DVBA 1ERNA 1YDPA 4FFZL 3KEDA 4MDJB 3X3GH 2ZQKA 2BIMA 3I02A 3QAQA 1KYDA 5I5RA 1FVCA 3EYQD 3SKOB 3VSQA 3FUIA 3FCSA 1LLAA 5HGDB 1R5IB 2ZUTA 4NZ8A 3SPVA 1T2XA 3VI3A 4TSCL 3QJUB 4Z7OF 4HUWA 3G08A 4NOBA 1BYPA 4XP1H 1XXFC 2A9AA 1KLFB 5DD3H 1GYCA 1HN1A 4FL4B 4MX7A 1T5XA 1DSYA 2QFPA 5C6PB 2IF7A 4HIXH 1MVUB 5G5DB 3ARBC 4PLJD 1QACA 1T66C 4MNGA 2WM0A 6PCYA 2X4OB 3GQFA 1FNGB 1AOHA 1S7TB 4Z7QB 5TK4A 3CSPA 1P9MC 3KGRA 3UAJD 1DUZB 3BT2L 4LLVB 4FXLA 1UD4A 5E00B 2YMXL 3ESOA 4PJIB 4AZ8B 1HHIB 3T08A 1PZSA 3X14A 3U46A 2XETA 3VXOB 4M93C 5J57B 1NFIA 4G9DB 4ELMB 4UB0H 2R59A 3QDJA 1NIDA 2NY0B 3HB3C 4TF4A 3QA3B 4U7SA 3S34L 2XTLA 3L7FB 4YHKL 3ARZA 2Z92A 4U6XA 1RP9A 1JNNH 1H8LA 3BQUC 3CJJA 3OTTA 2HPTA 2R1WB 5EBGA 2NY6C 3NCXA 4QLRA 3RWJB 3OJDA 4E41E 3UGXA 3PWNA 1KJ3H 2PTTB 3D48R 3ECUA 1HILB 3FKUS 5D2LB 3GHPA 3QZNA 4MNQB 2GJZA 4XP5L 1DVTA 3RWEB 1JVKA 4N2HA 4NN6C 4P5RA 4WV1B 3ZE0E 4O2FB 5BZXA 2FECL 3T71A 2EDOA 3OR6B 4PV9B 2OW6A 5C0RH 2C3VB 3ZE2B 4HCIA 2YLHA 4I48B 4TL4A 5BZWB 5TH2A 4HS8H 2APXA 5D7SH 3EJPA 5IHLB 2CH8A 2FQFA 2G4EA 4FCHA 3QDME 4JZOA 2BSSB 1IGYB 3O8XD 5GIRA 1ZLUH 4L1DA 1KLGB 5H35A 4I3RH 3BZ5A 1F4XH 2B3RA 4JRXD 2ENPA 4OFQA 3RUGE 4PRNB 1ZT4B 3BGMA 4U6YA 5BXFA 1TYJA 3NJJA 4QNPF 1MFVA 1M05A 1W2KT 1TZ8A 2IVFC 3DRQB 2FEEL 1HNGA 1VDGA 4UT9A 4A67A 4H5SA 4OLZH 5C0BB 3WFDL 5DLMH 3LN4B 4NQDB 4NKOA 2X6BA 3L3OB 3OG6B 5FW8A 3LPWA 2R29H 1JWSA 2RIKA 4KJYA 4X0NA 5I9QC 5DJXA 2Z35B 1ZVSB 4MB1A 4QAMB 1WH0A 3CK0H 5KWYC 4DKFH 3LKPB 3T0EB 3J7HA 4RRPM 5C0CB 2ZXDA 3BFWA 1ETJA 3SPIA 2WHVA 4GRLC 5FYLE 4YE4H 2VLKA 3E2HC 3LRGA 2XTJB 4GQ9L 4PGDA 2GW5A 3T8MA 4NWUH 4ZUSB 4HWEH 1CIDA 3UTZA 4XNZB 4OAWA 5IQ7L 4NO2B 3B56A 5FCUH 4MQXD 4M56A 1OEZW 4M9PA 1XZ0A 4RIRA 4XBPB 1YUKB 4XXCA 4LU5L 1IFRA 3HNSH 1USZA 5C09B 5GGRY 1WAPA 4TRPH 2VJ0A 3ROLA 3ZZQA 3O45A 1WWAX 1QTSA 3GMRB 1KMGA 2R23A 4Z3HA 3KWVA 2X9YA 2WWKT 1UADC 3TF7C 4QHUB 1OAXH 1YNTA 1V3LA 2AJZB 5IBUG 1KCUL 2C4FT 3FU9A 5IMKA 3NJKA 4YWGL 3QO0A 3ARGD 2NZ1A 4Q0XL 3UOAB 1CFSB 3BP5A 5C0GA 5HHXH 1BXAA 2OZ4H 3GSUA 4KWUA 2DDQH 2X2UA 1YSOA 3HZMB 3Q01A 3HUJF 1IKFL 4PUBH 5H94B 1TZHB 3SPJA 3GSXA 1MAML 2F58L 3HTLX 4NPYB 2ALAA 4UNVA 1URIA 3DJRA 3PQYE 4GW4B 3K4DA 3V5HB 5JHBA 1L0YA 1KGXA 5T33L 4BDVB 4PYHA 3F6JA 3LHAA 3GT6A 5F3BB 1C1EH 4IOIB 4KOCA 4W9KC 2R9HD 4JW3A 5A16B 4R2GC 2ZAGA 4M6ML 5IF0B 3CSFA 3NSJA 2D4FA 4XPHH 1AG0A 1MWOA 3SOTA 2R56H 1BJ8A 5K9KA 2I9TB 3DVGA 1XGUA 1AYOA 4LKXB 4PJGA 3ZIYA 2VRKA 3MLSL 4J2XA 4IK6A 1GIGL 1NTDA 2QADC 3ARBA 2BZ7A 1WEJL 2OFQA 3P2DA 1CGWA 2OA9A 5CIPA 4UQBA 4FI6A 3K74B 2UZIH 2VKXA 4I85A 2WWMD 1P9MA 2A83B 2W8CA 4Z7UF 5PAZA 4KKCC 1EFQA 4XGZA 1B2WL 3IDUA 2UY7A 3EH5B 3R18A 1H6UA 1MG3C 3BUIA 3QJFA 2QGCA 4GAYA 4FYSA 3QPXL 3KW7A 1RZ7L 2DQEH 1DHKA 2EICA 1I8KB 4JHAL 1IQWL 4XTRC 4W6XB 2IAMB 1B6UA 1IAIH 2Y36L 4NNYA 2R39A 3ULSA 3EFFA 5ESVA 1E4JA 3BKJL 4NX0A 2ZKWA 3DUSB 5KBLA 4GUPA 1OGPA 3BQUA 3QR2A 4IGBB 3KBFA 2VDRH 4KRNA 4MQSB 3VFSB 5I1EL 3CLEH 1A1MB 2GCYA 5HYQB 3OQRA 1F3JA 2FYYB 3I6GB 2Y7QA 4QOKA 5ENWA 3CFDB 2WUCL 4PJEE 4LMQE 1ITBB 1P7KA 4K94C 5D96B 4UILH 5KG9A 3HS9A 4MLIA 5DI8A 4O02A 1GZHC 4PR5A 3BZFA 3BGAA 2DKUA 3L4ZA 1R5WA 4JHWH 1DLFL 2CD0A 5D7HA 4EIUA 2FX7L 1BBJA 4I9WD 3U0PA 4LEXL 4K7FB 5GGVH 3Q06A 3UYRH 4PRPE 2OSLB 4N0CD 1J8HD 3SKJH 3L54A 3QIWC 1HXYB 5GGTL 1VEPA 4U4BA 1A3LH 1OT1A 2FX9H 2NQCA 3V4VA 5D4JA 1PD0A 1MLBA 4N9GA 3ES6A 4WFHD 1N12A 4NRXB 5D1XB 2EACA 4D0DB 4OJAA 4Z7VA 2GY7B 5E6ZA 4A66A 1AXSA 4AV0A 1JZ3A 4NO3B 1HL4A 4QJ4B 3TPKA 1OB0A 3GHBL 3LXBA 4LVEA 1WZ1L 2Y06L 1QRNA 2AZAA 4BELD 5FC9A 4C4UA 2R69A 5CUSH 3A4EA 1GAFL 4DKEH 1RIUL 3NCYP 2WZAA 2BFVL 3OLDA 1J48A 1YEKH 1BFSA 5CSZA 3ZZSA 2DKMA 5L6YH 1TJIH 2K3HA 4X6DF 2YSTA 4G83A 2HJKA 2HVKA 2ZXEB 4OZGF 4WWPA 3IDMB 1LQBC 2VN4A 1XH3B 5K59F 4AV4A 4HF5H 5DSCB 5DQ9A 2Z64C 4DEUA 1J5HA 4G7RB 4FNLH 3TYFB 4HUXA 2FBJH 2Q2EB 2WBWB 5DMIL 3ECWA 2AK1H 3TBTA 5MI0C 4Z0XB 5CLZA 1BM3H 1FCGA 3H7BB 4OZFB 5SV4A 1TVBA 2KBGA 1G4MA 4HG4K 3GIVA 3TP4A 3ALWA 4L29B 4QI3A 3BAEH 2KS0A 4HFUH 3OPZH 3QDJD 5E9DB 1FL5B 1ZMYA 2WLIA 3KR3H 1O6SB 3NSYA 2ORBH 1KIUB 4WLCA 1FN4B 4H8QA 3ZYZA 4RFEB 1S7VA 3L4YA 4BH8A 4HIEA 3VXRE 3DTDA 4AM0A 5MEQB 2WO2B 2J20A 2BM3A 1NEZG 1VFOA 4JRLA 2KUTA 2ZG3A 4K3DH 1KTDB 2WIIA 3L2MA 3ZL4H 4QJ5B 2JB5L 2VWEC 5HDQH 4XP6L 1OP9A 4GSDH 2BSDA 5FA3A 3G7TA 1DR9A 5IOPA 1LE5A 3VFNB 3W57A 5CU5A 1MVYA 2WMPB 3WSQL 4O5LL 2OMVB 1NGWB 1SM3L 5FCSH 4HDIB 4BSVB 2MFNA 5I1HH 4DP7X 1IX2A 1T2QH 4YBHA 1CYGA 1SOSA 3VWJC 4JFWA 1KGCE 2EINB 1PLCA 4HC1H 4MJJA 1F58H 2P3YA 3TASA 3B3IA 1HYSC 5E5MB 1A2YA 1IBBA 4PJFA 5E23A 3CFJB 1JD7A 1OF0A 2LV4A 2EIKB 4HV8A 4N25A 1IEBB 3AZUA 4NO5A 4OF3A 5ADPL 5BJTA 1SY6A 1LDSA 2A73B 5EIQA 4R7LA 3C6SB 4WI4A 2PYFA 1PNDA 3LAFA 3WEXB 2DIEA 2GY5A 4DT2A 3GK8L 2YRLA 5T1JA 4QRPB 4KZDH 3VXUB 1M7DA 1FRGH 3M1OA 5KVEH 3OV6A 1IGMH 4HXAL 5E6SB 2P48B 4BK8A 4P2RA 32C2B 4FLRA 4PJHE 2DQHH 1S8DB 4MXQD 1WC7A 5A2AA 3SYAA 3VYPA 4A68A 2VXTH 3U9UA 4I13B 3J2PA 3WL9A 2CO4A 4V2BA 2FLMA 2IMNA 2ITCB 3P77A 2UYLA 4KAQL 3TO2B 1IQDA 1KB5A 1X9RA 3QHZH 3CUPB 2HJFA 2CGRH 1PIGA 1GKEA 1VLXA 1A7OL 3EGDA 1LL1A 4JKNA 1OK8A 3LZNA 4UNUA 4EDWL 1I8UA 2NUPA 4JZJC 1WBXA 4PY8J 4D9QE 4KY1L 1FVEB 2HFEB 4PJXE 2EH8L 2JCCE 1ZT7B 1A1NB 3LNHA 43CAA 4FOMA 4IDJL 3TJHD 4IRJD 1GZHA 2N7SA 4XOAA 4M6AA 1E5CA 3SD5A 1FE8H 1U8JA 1CK0H 4NKMB 3S5LA 4KX7A 5SWSB 3N9GL 4WNQB 3IKCA 2YOAA 5TGBB 2PCXA 3QIUC 2QBWA 1BIHA 4W4OC 4HKBB 3D3VB 2J6WA 4IU2A 1UOLA 3KYOA 1Q1PA 3GSQA 1VAHA 5JHLL 3VQ1C 3QIWA 3RG1C 3REVB 2ITEA 3TT1H 2YD2A 5L8LB 4JFXA 2DPKA 1MCEA 3N55A 3FFCA 4U7KA 1VADA 2Y6TE 3BC9A 3N1PC 3E6HB 4Q6IB 5FGCE 4OTXH 4F9LA 3SY0A 1VFAA 1FGNH 4S1DC 3I6KA 4F2ME 4FZEH 2CIKB 1A7QH 2WAQA 3MLPA 5A6LA 4FXTA 3PHOA 3F7LA 1L3NA 2YXVA 4NM4H 2IFFL 3X3GL 2Q6WB 1NUDA 3DOSB 1C7SA 3GPSA 3B9KC 2NZ9D 2KDGA 4KO5A 3Q8EA 4MCYA 5BO1H 1YQ2A 5ID1B 5L4IA 3ARBD 2BVQB 3BRFA 2C9QA 1SOKA 3C5SB 3H2PA 3CZGA 5TDOA 4F5CE 1DZ0A 2QVFB 3MV8A 4AQEB 4KFZC 3ZDZE 1C5BH 3EJRA 3OL2A 4WTZG 2Q86B 1V7NL 2CGZA 3H3PL 3KPRA 3QCVH 1KBGL 1KLUB 4JL1A 1LEIA 5AB2A 3X2QB 5I0VA 1CE1L 1TLMA 3DSNA 1V54B 4WUUA 4I77H 3HB3D 5IFHL 3BP7B 2A6IA 1CQYA 2FJFB 1J1OH 4PH8A 1U3HC 1JBJA 5A1AA 3BQUD 2BLFA 3DUUB 2Z7YA 1M2VB 1SUHA 2NY6D 2YEQA 4F33B 1FZMB 3H9SB 3BKMH 1V7MH 3K4AA 4X9IA 3IDNB 5EU6B 3ZTNH 4QOKD 4WW2B 5B22A 7FABH 2E76C 2CALA 1TITA 3QUZB 5GGUB 4AYID 3CWGA 4FG0A 1BFTA 5JIHA 1C5DB 4GY4A 2J43A 4OCRL 1YEDB 4OD1H 4NKDB 4WQOA 4B9ZA 4L37A 4FFYH 2Y22A 5IIEB 1YC8A 4FE9A 4PW9A 2AK4E 2DL2A 4UZSA 1XSKA 1G0DA 1X4ZA 1U91B 3VWJA 1CURA 4LCWE 2GK0A 3KD4A 1PD6A 1T1ZB 3EOBB 5ICXA 3NABH 4Z3IA 4U1JA 3A6CL 3DX0A 2FJHB 1LP9E 1LMIA 3OKDB 4BQ8A 5LAXA 4LOUC 4UMGA 1SVZA 3ZL2A 2E7CA 1CF1A 3GI9H 2L0DA 3ETBJ 4I0CC 3G3LA 5B1CA 4QCIB 2F5AL 2UZXA 3T8XB 1HVXA 3PY9A 4H88H 5L0QC 2KQNA 1MCRA 1BA9A 2ESVA 1DJXA 3FRPG 1EJOH 5C0AE 4OCSL 1BZ7A 3SBRA 1QRND 3BZ4B 4NZUH 3TJEH 4C55A 4AY0A 2ROXA 2PLTA 3GSRB 3V6FB 5C71A 4PJIF 3JTSA 5F0PB 5CD3A 1BF8A 3JWNH 1TTBA 1CCZA 4GH7B 3CQFA 3RWIA 4QRFA 3LVTA 4WEUD 2CA3A 3GKWL 3BAXA 3M8OL 2X70A 4PLOB 1CC3A 5IVZB 1OWRM 1QRKA 3VFPA 4PJ7A 4G7VH 3QPKA 2NNFA 3O3EA 4L8SB 4PJDA 2YXWA 3CZFA 3SBPA 1QLEB 1FGVL 1DQLL 3JVGC 3P4NA 4OB5H 1P4LB 2FUTA 1F6AB 5D2LF 5CGBA 5JTWA 4AEHH 5KZCB 4ECNA 1RZQA 2P8PA 2JTYA 5LG6A 1GHFH 3L3KB 4YAQB 4P5MB 2VH5L 3JV6B 4ZD3H 1NBCA 5F71A 5HGGS 5AAMC 2EVFA 4HXBL 1YEFH 4KDVA 1WAAE 2NXZC 2JELH 5D93C 1UGKA 2VLRE 3QIUA 4F1SA 1WA2X 1L9TA 2NY1B 4AMWA 2LAAA 3TOPA 3P69A 1OT4A 1W72H 1EGJH 1X7TA 4Z3GA 4TRPL 2RJMA 3TBSA 2Q1EA 2AJSL 2EILB 2ATKA 3K2UL 4R26H 1JVLA 3C5ZA 1J0IA 3ULVL 5EDXA 2M1KA 1XH1A 2OYMA 1NGZB 2EZ0D 3TO4C 3S8WA 4U1SA 4L1SA 4ONHB 4KGLA 5FWRA 2PXYB 1OP4A 4W4NA 1YVLA 3DK0A 5FKAA 1FNFA 3LN5A 4R2GD 5DR5H 1WZKA 3K8MA 3S96B 5JXEA 4XB7A 4KZEH 4NKQB 4WI9A 1X7QA 4Z7NF 3FB8B 3STZB 1N68A 2CRYA 2IG2H 4GFXA 3LNIA 3DXAB 4Q2ZA 3H6JA 5E1QA 3D0AA 4OCLC 4OZIB 5HGHA 3DRTB 1ILSA 1LK3L 2EYTB 2YJQA 4YHYC 2EKJA 3DVIA 4PY8I 4I3SL 2WBKA 4IEFB 5I1JL 3FUHA 4R4NC 1UXLA 1BECA 4XPHL 5DEGB 4H2AA 2ZT9C 4KKCD 5AD0A 3K6NA 2R8SL 4P2RD 4L9LB 1BREA 2Y4SA 3S4SB 3QO1A 1WGVA 1Z5LB 3ECQA 2OTUA 3RHWF 5FM4A 4XTRD 3RBGA 3ABZA 3ZYJA 5DHDA 4JDZA 1MFDL 3MRDB 4QXTB 2XWBA 1G9EA 4YQXL 4WSJA 1MFNA 2K45A 1XGPB 3X3FL 5E4IA 4Z7OE 5IJKA 1BQLL 1RJZA 5EPMA 4KUZL 4OFDA 1TEGA 3OAYK 4RFNC 4H4NA 1U30A 3NJNA 5AW2B 1G0XA 1KJ2A 5GRVL 4C83B 2HUEA 2YBRB 3KM1A 3PHSA 1ETB1 4GXVH 3FT2B 1EO5A 4OD2A 3RWDB 4A2HA 1NLDH 1KXVA 1YY9C 2R27A 4JRFA 3T04D 4DKAA 1KDJA 2NNCA 4Q4IA 2SODB 2ICCA 4YHNB 4LEBA 5EUOA 1JF1B 2GT9A 3QZOA 1OGTB 1HWWA 3G5XA 1NGQH 1INEH 3B9VA 1R5VB 3OD3A 1XF3A 4FZ8L 3KWXA 4JE4B 5GGRA 3WYRA 5I28A 1NAML 1TYEB 1CLVA 3O2VL 2NSMA 1GW0A 3KG5A 5I2IA 3BP6A 3KXFB 1H15B 3QIWD 1S9XB 4A1RA 4KJQC 5I0XA 1H8NA 4LARL 1FAIL 5ABAA 3AUWB 4NQXA 1DCEA 4YGVA 2JJVA 3FFCD 4OV5B 5IGXL 3MVSA 1ZK9A 2V7NA 1BG1A 1EEZB 1R3HA 2KZKA 3DX6A 1RXLA 5EU3B 4GUOA 3HMXA 4MYWB 4DWHA 2VSMB 3OR7A 4R90H 5DD0L 2QQNH 1Q9KB 5IHUH 1I8MA 3X1NA 1UKQA 2FQEA 3PJNA 3FMGH 4L3CB 5CR8A 1BOYA 2ZX6A 3GBML 4O4YH 2C5DC 5AAWA 2O5XH 3NCWA 3M17A 4PWKA 1LXMA 5F7NC 3TH4T 3MV7B 5IVNA 2IANB 1SBBA 5F7UA 1UEMA 3CMOH 4ALAC 2VIRA 3VSTA 1AGBB 4L3EB 1KTLA 3L9EA 3JVGA 3QYMA 1F42A 4GG6B 1EBPA 2XNAA 1A22B 1YEKL 3WJJC 5D1QB 1L9NA 4HBQA 3MV8D 4QNPE 2FSEA 3LV3B 3BEWB 2OQJA 5E8OA 3FB7B 4ZMPA 3KPRD 2JKIS 2YD1A 4QIRA 5AAMA 3GDCA 1AO7E 5F7FA 4LVOB 1NMAL 2HG5B 1T0NB 3MUHL 4ANKA 3KVQA 4WUUD 2CLVB 3PXLA 4KITB 4U4IA 2BRQA 1EEYB 2WUBH 1YJDC 2ROYA 4E9LA 4LIQH 2BY0A 2P5WA 3AS3A 4GP4B 1CFVL 1B4LA 2M83A 3AVEA 2QHRL 5I8CB 4LPWA 5C08B 5AB1A 3WKYA 1BD2E 4GMSL 4HPOL 4PS4L 5EC1A 1BZ8A 3HNVL 3ROOA 2HLAA 3WBDA 2VZTA 1MHEA 3BXNA 3MROB 2KZ1B 2LTQC 1DEDA 2OSYA 3PP4L 3TO4A 5ITFA 2DTSA 1W15A 1JAEA 3HAEA 2W0PA 4BH7A 3U30C 4JO1L 4RWHA 2YIHA 1MIML 5JQIB 1F4WH 2IALB 4YHIB 5D5MF 3ZRCC 5F8QC 2CUHA 3L48A 4PGEB 3VWJD 3IFLH 1JGVH 2ZJSL 4Y9CA 2C3XA 1ZXKA 3MX0A 3TT3H 3VWKC 5HPOA 4Y16B 1U3ZA 2AAAA 1PKQA 1ZSDA 3QHTC 1W16A 2ZOTA 4HOZA 5C2UB 3L1OH 4HPYL 4K15A 1MRFH 1OARH 2VN6A 2R2HA 4AGPA 1S7WB 2Q76B 5L2KE 1JZ7A 3TCTA 1TQBB 2E4FA 3RVTD 5GISL 3Q8FA 3RFZC 1J8RA 2NPLX 4ACPA 3HUJE 1KC5H 1KWGA 1KB9K 4KKRA 35C8H 5E1AB 3C9NB 2J7LA 2L7UA 4BE5A 4R7VA 3DIFB 4Z77B 3PL6B 4X9GA 3SZKC 4GKLA 1DQTA 4JM2B 4ZS6C 5ES4B 3MLRH 4ONFL 3IJ9A 1UTDA 2CKBL 2EE9A 4ODWB 2VZ1A 3FSOA 2FWLB 3MFFB 3KYMB 3NQKA 2WQSA 3NACL 1ZHBB 3N91A 1OAZH 4JREB 5F0LB 5GHWH 5L8JB 1MRDH 1SMOA 2XBZA 3MO1A 4H8WH 1U58B 2VXTL 5IBLD 4WEBL 4OT1L 4QEGA 2B0SL 4WU5A 3VNYA 4AQ1A 3B4NA 1U2YA 2F54E 3KHOA 4HK3J 4BEIA 4XMZA 1ZT1A 4ZRGA 1CJYA 4AKPA 4LBEB 1FH5H 4PS7A 1MCWW 4YLBA 4YK4C 1ESOA 1FPTL 1TUPA 4Z7UE 2NCEA 3FT0A 3KLLA 3C8KA 1P4UA 3OGCB 4WJKB 4YO0A 1IV8A 4FQXB 3QIUD 1C8QA 1G7HA 1TU2A 1FZOA 1TSRA 1YN7A 4PAZA 3MOBL 4YBQC 3G5YB 1HHKB 1KFGA 5BMFH 3TYGL 2YUWA 3K72B 2Y1YA 5ECJE 4XXDA 3MRJB 4OCMC 3HZ3A 4TNEA 5C2BH 4AUYA 2WN3A 3C5ZD 4GYBA 1U8IA 3CZUB 2P80A 3T77B 1UVQB 3RWFA 3M1BA 5JIMA 5TPWL 3GXTA 3BGFB 1DLHB 4PLKC 4AYFB 1QTPA 1C08B 1ZPLA 1N3NA 2HZHA 2VN5A 4UINH 1A6AB 4NIKB 4TQEH 3FQYA 3KJ4B 4JEGB 4UQ3A 5ISZA 3VGBA 2BJML 3WI9A 3H6AA 4M1GL 5AZEH 3HCVB 4MQ7B 3RDTB 5JXED 2FEDC 1EMTL 3NRPA 3JYCA 3KVPA 3B5GA 3ZDXF 4R9HA 2UWEA 2R0KH 2W95A 1I9EA 2GI0A 5HHOE 2XY2A 1OGAB 4GLRH 4ODBD 4YXKL 1X7SA 4MDRA 1ORSB 2X4NB 1UOWA 4GLRI 1KB3A 4DGYL 3ILPA 4FZEL 2R0LL 1YEGH 5HDOA 1NLBL 2BHUA 3DTUB 2ENSA 4PJAF 3LH8A 4BFIB 4DGVL 4ORGB 2IXQA 2PTUA 1WE5A 1XGQA 1SOXA 4GW5B 3U7YL 1FJ1B 2XX1A 4P2OC 3BAYA 1JZGA 1GW6A 3CXDL 2ZWKA 4YUEL 3MBEA 1GSKA 2ZPKL 4Q97A 1ZVHA 3L3IB 4L05A 3DJSA 5EZLB 4URTB 5J6HA 1HEZB 3QCUH 5TDPA 2ILLA 1CICC 1LE9A 4UT9L 3SJVE 2BSBA 3BAJA 5FFGA 4OLEA 5MHSE 1JSYA 1QUNB 4XCCL 4UTAL 4X6DE 3TLRA 4OZGE 4YSDA 5IHZB 4PG2C 1ASPA 5F96L 5FXCH 3D4CA 1ZGLP 3OG4B 3EBHA 5K59E 5AKTA 5DJCB 5E9AA 1AFVH 3PIQB 2R29A 4YNYA 2H6UA 5DJZA 4KQ3L 1P4BH 1NOFA 2DQMA 3DVFA 3GJFH 4MJHA 4FTDA 2H2PC 4NQUA 2J21A 2E7HA 4LF3B 4QXGL 3LEVL 4YDJA 3ZTNL 1DVZA 4PIBA 1PL3A 2DTMH 2EIZB 4QHMB 3VWKA 3ALXA 4Y4FC 1TIUA 1PSKL 1A6TA 3T0BA 4U6VL 4ZAKB 5IHBA 5TK2A 2YLKA 4LOUD 1T03L 1S7XB 3N40P 1NFDB 2FO8A 2HX8A 3MJWA 2AFNA 2AJUH 1JZEA 4NN5B 2ZYHA 3ABKB 4BCXA 3QEQE 4OGXH 3ARUA 2PF6A 4DK3A 2VDMB 1ZEAH 3NEOA 1SXSA 3MRGA 3CFBA 3RI5F 3LSOB 1XHHA 2IMMA 1WISA 3SB3A 5I75B 4HT1L 1M1XB 1BBDH 2FX8L 3AM8C 3A6BH 5J3HC 4O2CB 2B08A 1E8XA 3QJRB 1Z3GL 3WDJA 4CNIB 2EC9T 5JOPE 3IDJB 3RTLA 4EXPX 1SFHA 4N22A 2XYCA 4X9BA 4KI5F 2VABA 3S3JA 4U6HB 4APQB 3ARFA 1PQZB 3HBPA 5HD8C 4U49A 4EUPB 4Z5RB 4CMMA 3F58L 2XPGB 1SF3A 3RB7A 1IAKB 5HHNB 1X5HA 4HK0A 4U33A 4Y4HB 4AJWA 1V55B 4XR8C 3O11A 4GXUM 2NXYB 4UTCA 1KPVB 3MNWB 4WW2F 1HNYA 2HKFL 2VSDA 3B1UA 2BOBA 4IRSC 1FHNA 4LCYB 4YHPA 5T1LB 5JHDE 5IMOB 2V9TA 4BKLB 4XMUA 1BMZA 4XBMA 2H6PB 5DRXA 2NX5E 2H0FA 2VLJE 5DD6A 2VM3A 1JOIA 1TJGH 4J3OD 5AAPA 3QIBB 3QQ9C 4PREA 2P5WD 1KV7A 4Z78B 2YAOA 3EJJX 1SGKA 3VJ6B 3C5JB 1KYAA 1F4YL 4E9XA 4LT7A 1J86A 4ANVA 1VFBA 4OGYH 3WLWC 2EVHA 4TLUA 2NW3A 4NQEB 4LRNL 3HG1B 3GXMA 1A4KB 1R9FA 1F90H 1R3JB 3TO4D 3U0WH 2H0EA 5DWUH 1PFOA 3QJOA 3OMNB 2GAZB 2ODHA 1QI5A 5CU9A 3ATFA 4XCEB 2OAAA 5DZPA 1LVEA 2B1OA 2YGNA 3CFEA 3FFOA 1G6RL 4RGNB 2D0GA 4UDTB 2QTVA 3F7YA 3RFRA 4F7EB 2AGJH 5K39A 2A4CA 1NCIA 3IPEA 3CZSA 5I1CH 5LUMA 3SBWC 5CXPA 4G8EB 5EU4A 3IS1X 3TBYA 4FQHB 3T6VA 2G5UA 4GO9A 2X1OA 1PCXA 4QHNB 2V2XB 3KPLB 3QR0A 2WGXA 3ZT7A 5EU7E 4B7IA 1CTNA 5B3JF 3SO3B 4S2SA 5JW5B 2F68X 1P7QA 3ZVVA 2HXAA 1IU1A 3PQYD 4E9SA 4R4ND 2E9JA 5BRZA 5KAQG 1UWGL 4P2OA 2Y69B 4GT7A 1CGSL 1J05B 4YDKL 1X5IA 1I85A 3ZZ1A 1MXGA 5D8JL 5IR1A 5TE6L 5E5LA 2NYZA 3PUUA 1SJMA 4PCKA 5HHVH 2VNCA 3BIKA 5B39A 2WBJB 1AGFB 1SQMA 1IC1A 3SZ6A 1CICA 5DJ8B 4JR9L 1TO4A 4P48A 3UAEA 5CN3A 1U95B 3PFUA 4OVVA 3H7LA 1BGXH 1DN2A 2QVIA 3F7RA 2WXFA 4RGMB 5FV2A 4N1HB 1MREH 3L5WB 3VXQA 1E9OB 4PG2A 1T1YB 5EUKA 4WVRA 4JKPH 3VFRB 4AIOA 5DJ0B 4PB0L 1O5DT 3HZVB 1N8ZB 2Z65C 1YY9D 3V9CA 5HXMA 4KTDH 1ZAGA 4P2QB 4WSKA 1A8ZA 1KT2A 2N0MA 2FEJA 2X7LA 1MZZA 4L1TA 1WS8A 1RULL 4R84A 1KY6A 3L3JB 5KSBA 1AJ7H 3BUYA 1WTLA 1FYTE 5FO8A 2YD6A 3C87A 4FP8H 5C3TA 3RL2B 1VZIA 3QQNA 1TJHL 4C58B 4Y4FA 1UURA 5JZ7C 1JDCA 3K46A 1JV5A 3MLXH 2Z0BA 2V7HA 1K9TA 3EO0B 3EYFB 5FK9A 2YEZA 4I5BB 3OXRB 1A7RL 1C12B 2GTWA 1JYNA 1XD0A 1GY2A 4B27A 4K9EH 4KJQD 1U8KA 3PJSA 5CBEA 1IC4L 4K8RC 4NQCA 3SPHA 2BS9A 4OZIF 1BVNT 3FOLB 2P80D 1BFOA 1WBZA 5HYSG 1B0WA 1CO1A 1YC7A 2P7TA 1JL8A 5E2JA 5D4QA 1H0DB 1MLCA 5E2VH 1XV8A 4OVUA 3AM8A 4A38A 3FTZA 5ISZD 1XF4A 1ZGLM 3P0YL 1XX9C 4DN4L 5GGQH 3HC3H 2VZUA 4KY2A 4Q8BA 4Z7WB 3AGWA 3D06A 1MAJA 3FT3B 2YD5A 3GMMB 3H8NA 4RCAA 3CVIH 4W9JC 2HSIA 1L7IH 5F9WC 4WI0B 1EJ8A 4UAOB 6FABL 3VXSE 4FMVA 4FQPA 3RL1B 4J5VA 2EDXA 3C60A 3IMRA 1IFHH 1DJZA 2ZKMX 4LLAA 3DV6B 3IN2A 1L5GA 1ZS8B 3BO8A 2I27N 1QBMH 1RUPH 2WVSA 1I53A 1SY6L 3MBED 4IRSA 4HC1A 4WCYL 3L9RB 1YNLH 5IEKB 1F11B 3A6OA 3FFDB 2LW3A 2BIIA 3OWRA 1UM6L 1NJ9A 1PX4A 1WJ3A 2YMTA 4JFVA 4M7JL 3P3RA 4G1MA 4MA7L 1DANU 4DUVA 3V9EA 4F58H 5I73C 3FC8A 3HS8A 4XB3A 2HFGL 4ZZFA 5D7KD 2HP4A 1H3WM 2LGNA 1MCQA 4JY6A 3TN0B 2ZAIA 3MNZB 4X0KA 2AXHA 1OCOB 3IE9A 4KVPA 4LOVA 3EG9B 4R5VA 5DUML 3FH7A 1ZANL 1AZNA 4DVRL 5CM1A 5IUCA 1VGEH 2DWEA 1IE5A 4WHTA 2ZIDA 1E28B 2FUQA 1BQUA 4JFOA 2P1YA 2GSIA 3G6JB 3D39A 4HWBH 4FYTA 5D2LE 4MNQE 4U05A 4LDEB 1ZD6A 2VDLB 2B1AL 4PHZA 2K3TA 1RQ5A 3VWKD 2E7LC 15C8L 1ZHKB 5IHHA 3SBWA 3CSGA 1YEEH 3LZFL 1MELA 3FQRA 4R6UA 4P57B 1PY4A 4OJYA 2X10A 2DQCL 3MGAA 5I6OA 2CBTA 3N50A 1U92B 3HC0B 3HKZA 5D71L 1DBJH 3O6ML 5DDHA 4ZQTA 1E4KC 2QKIA 3IFLL 4QTHB 5DT1L 5F1IA 1I3RA 1UD8A 1CF8L 2H32B 3OKLB 1X9UA 1MAKA 4DO5A 2Z93B 3GEFA 4O9HH 4P3CL 1BQSA 1HL8A 4PV8B 1QASA 3HEIB 1IKOP 1FIGH 2JFCA 2LOEA 4OCWH 3ESMA 3HZKA 2BINA 2VXQH 4TUOB 3ARFD 5FPIA 1USQA 1E6OH 4I89A 4QGYA 3V6ZA 4Z7NE 2B2XL 1T0PB 1QR1A 2BNQA 3KLQA 3QEHA 5E56A 2H9GA 1OSPH 5HYSA 5K1JA 2ZYRA 4KQ0A 1HEJC 2JQAA 1AZUA 3JTBA 1QWUA 1UD2A 3WUWG 5B1KA 4YHZL 1JCKA 4A7UA 3VI3B 1U8NA 5C0CE 2OL3A 3G08B 5CWSB 4Z3EA 2D3JA 1UKTA 1BVLA 4PJ5D 2FATL 1F8TH 1QSEA 1MCFA 2XTJE 3AITA 2A77L 2JKNA 4CW1B 1I7TB 3NSXA 5IV2A 4K71C 4PJCB 5E8DH 2DLGA 3RKDC 2ITDA 1P0SE 3FCUB 4MNGB 4DEPC 3BEVB 4YBQD 4X4YA 5E94B 3RDJA 1KBPA 1UYWL 1XB6A 1SJXA 1A9BA 5FYKH 2EABA 2Y07L 3G6AA 4UQ2A 4GKSA 5D6DC 4YXLH 3VW3L 1A6ZA 1TKWB 3FS9A 4TVPE 4N2LA 3QDJB 3D34A 5CKGA 4PEEA 3TONA 3ULUC 1DBBL 2XWRA 1L3WA 5DHVB 4YHML 4UI2A 4LEOB 1KCRH 3BUDA 4PLKD 5AZUA 1CGYA 2WCPA 3T2NL 4Z8FH 5FGRA 3QDGE 5T3XH 2V9RA 2HB0A 3PGFH 4N3TA 5CS7A 1KPUB 5LG1A 1OHZA 1JPST 4ISVB 2VXUL 4G5AA 1XF2A 4FLSA 2DQDH 3CHOA 3PWNB 1UJ3A 3MUUA 2QVKA 2R51A 3JVFC 1RZ8A 3F85A 3K6FA 4F7CB 4MJ6B 4PGBA 3T4YB 2X1QA 5IQ9A 1VACA 2J6EL 1CDYA 3Q3GB 4OKDA 2ZX5A 3EO9L 1PZCA 1BX2A 1QVOB 2Z9TA 4XVUC 4Z7IA 3FU0A 1JXGA 2F08A 3FYIB 4K3EH 1P7QD 2CBPA 5TH2B 5TQ2L 3WO4C 1SHWA 4FFYA 3MRNB 5BRZD 3M6DA 4P2OD 1CDCA 3QUXC 2F7PA 2I24N 5AOLA 1MWAB 3RIAF 4I0PB 3F00A 4MD0A 3UEZA 4JJOA 1FBIH 3GSWB 4EBQH 1H19A 1PJ9A 1HINL 1A66A 4JMNA 2OZNA 4U31A 2Q0ZX 3VG0L 1CICD 1BQHB 4POYA 5F3HA 5DTFB 2H2SD 3OF6A 4H5SB 3ABGA 3D05A 4N0YL 5CP3H 5HYJA 4DP6X 3C8DA 1TXKA 5LGHH 2Q8BL 5TQ0H 1A4JA 1A7PH 1WG3A 2J71A 3VE0B 1NCWL 2OR7A 4U1KA 2G0LA 4MD5A 2BOCB 1PTZA 4S0HA 3DV4A 4IOSA 2BIOA 4W9EC 4FF9A 5AUMB 4J7RA 3RZCC 3MNVB 1QLRA 2F15A 3EJYD 3IJ8A 2H2PD 2CDFA 1AE6H 4G6MH 3SDXF 2VLKB 3I6LE 3E80A 1WTGT 4DGIH 3UTZB 1TVHB 1H6FA 4YPJA 2E7LA 4Y4FD 4PD4K 3GBEA 2OXGB 4GG8B 2PABA 3WN5A 3N1GC 4JKKA 4FKHA 4XNYH 3UZQB 4F7MA 4JG1H 5I71C 2E9IA 5F93C 4UTBA 3O45B 4NQCD 4FQIL 1L0PA 2EYRA 4JFZL 5DQJA 2H41A 4XPGL 5C70A 3H42H 4LE8A 5C92A 3LIZH 1Q9OA 1ACYH 4I3GA 5IJVA 3SDCC 8PAZA 2XTSA 4PP1D 3MA7A 2JJTC 5JIDA 2PYEB 4AJ0A 4JG5A 2HFFA 4WWID 3QJSB 5ESQA 3VD1A 2XWXA 2OMTB 1X5KA 4F57H 5J3HD 1RSYA 3WXVL 4ZXBB 4BA8A 1F13A 5F89B 5MERB 2EDHA 1FVDA 1W72A 2PR4L 3IEAA 1EGJA 3P4OB 5ALCH 4G9FA 4KXBA 5D5ME 2H26B 1MCKA 2NYYD 4DETA 4MA1B 2PW1B 3BLPX 1N0LB 2UXFA 3DX9A 2J1YA 3IRZA 4LSRH 4PW3A 1ONQA 1WBYA 4DGUA 2OTWA 5JPMC 4AVIA 4JO8A 2V33A 1TF4A 2X89A 1TQCB 3C60D 2F74A 2RACA 5GSRA 4BGLA 1P2CB 4HS3A 3NESA 4IRSD 5E8NB 4HLEA 4C4KO 4P4KC 3OX8B 4EDXA 5EO0A 2YHGA 4PJGB 3TNNA 1U8MB 5CLTA 5IB1A 4WK2B 1ED3A 2CHNA 1L6XA 2J8UB 2XX0A 4URKA 2I32A 5CIPB 3TCLA 3WFHB 3CFMA 1J5OL 1OL0A 2HT2C 3QQ9D 5I76A 4D7BA 1V3MA 4ONGL 2AEWA 2LR4A 1IGIH 1IEAA 3MCKA 2FHBA 5IQLA 5E9DE 4P46B 4WGVB 1OIOA 4MJ5B 5D6DA 1GGUA 1HOCA 3QJFB 3WLWD 3ENEA 4A6YL 2EXYC 1JGEA 1IGCL 1S5IL 1NFDF 4GKNA 3VGDA 3CE1A 2GBUA 2FZ3B 5EFIA 1RHHB 1DE4B 5EO1A 2W0FB 3EZJB 2P5EA 2QVMA 3D39D 2VLRD 1IGJB 1KJ2L 2GCYB 2JJSC 3MLWL 4Z95H 4QXUH 4C8XA 4ELDA 2A9MH 4HETA 1RLBA 2YAFA 3TV3L 2V2TB 4KMTL 3OBAA 3VQ2C 4H20H 2YK1H 1ZPUA 3W0WB 3CX5K 3F5WA 4UYPA 5D7JA 3ZK0A 2R0ZL 3KAAA 3O9WA 3MRQA 2B4CH 5C07E 2OMNA 2CMRH 1ET7A 3MI6A 3N1FC 3IMTA 1CG9B 3LQAC 2ZSWB 2DJ4A 4M6OL 1TZGL 1ND0B 1JK9B 1U33A 2P24A 3DGGB 1NC4A 3PNRB 1RKRA 5EOCL 3RX5A 3LQZB 1IRAY 5AOZA 5A6IA 5E6IA 4AWJC 1QLEH 1OO2A 1UXWA 5B3SB 2LHAA 4QRRB 1CD1B 4B97A 2DV6A 2WXRA 5CZXC 2XQYK 3KL3A 4Z7VB 4JAMA 3ZDXE 5KTEL 2W5PA 2AV7A 2ZWYA 2BNQD 4HEME 5FA4A 2VN3A 4ZFOA 1BEXA 1YCSA 3K7UA 4GOSA 5IBUB 5EO9A 4PI0A 4IK7A 4RA0C 3ATAA 4R3SA 2JE8A 1OAYL 4L4TA 4OCXH 3WAKA 3UO1H 5I30H 4PJAE 3HI5L 1AG6A 2HVKB 1BGXL 1GGYA 1QSED 2ED7A 3D9AH 5K9JL 1N5AA 3FU7A 3HPJB 1T1XA 5EF3A 4XBGA 1L7TL 1OKEA 1EFXA 1C5CL 3MR9A 5HBBA 4UOQA 5CCHE 4WSGA 5JZ7D 1CLZL 4PRIE 4NT6A 5ALBH 5LGYA 4PVMA 3TBTB 2OMXB 1KGIA 2XN9E 1E8ZA 1IL1A 1TVBB 3GRBA 4K7PH 2YKKA 4NZTH 1IM3A 4HBCL 4OF5A 3GIVB 2D8KA 1NGYA 3QSKB 4J3VA 1N7MH 1T5KA 3U4EA 2VTFA 2C9AA 2OI9C 5EG6C 3D3VE 4HOWA 1MFAL 2IPKA 5FYLL 4KKZA 1KGWA 4I9XA 4LFHG 4NNPL 4N0UE 4BH8B 2JJTA 3EH2A 1XR9A 2AXGA 1YPZF 3Q2CA 3BP4B 3QCTH 3MLTB 2BNRE 2H45A 2WZ0A 3CDZB 3KBPA 2VERA 1KXTA 3MLYH 3WFZA 1VSCA 1JNHB 3GUTB 4B9FA 4H0LC 2WZ5A 4XPAH 3GEWB 2HPOA 1OM3L 3KPSA 3D51A 1A7NH 2D7PA 5BVJA 5D2NC 4P2YA 5I74B 3TEYA 4OCYH 2TSBA 1DO6A 3F83A 4AW4A 1JMZA 2EVIA 2X9WA 2NY3D 1NGPH 4N0FB 4MJIB 2VKWA 4UT6H 4JGMA 4TYUA 2E27H 1RK7A 2IH9A 5E7BA 3HIZA 2F19H 4AYGA 5BVPL 2RB8A 4D3CL 3QQ4A 3RGVB 2ZUQB 2R83A 3CVIL 2F5BH 3QRBA 1CLOH 4MNHA 4HUMB 4P4KA 3TZVC 1N2RB 5DMGC 4Y2DA 3FQXA 1KGYE 1WA0X 1VJSA 4YX2L 5IVXF 3BD5A 3BE1L 3VFVB 3EJTA 1B0RB 1JNLL 1KBVA 2BZCA 3IJSA 1SOQA 2JKRM 4N90E 2GJ6A 3OF6D 3RU8L 5B1JC 4EI6A 3FQWA 5HYJD 4KKAC 4YZFF 1BZ9A 5JO5A 2VDPB 5F6IB 5JR1L 1MCPH 4UF7C 4FL4C 3F6LA 1Z66A 3WL9B 3ZMEA 2KH2B 4ZPTA 2Y2WA 4IOSD 5ID0B 3MV01 1HU8A 3TA3B 3REWA 3COOA 5BV7B 1CZ8H 2FWUA 1SRDA 2H47C 1FFPA 2AANA 2WXMA 4ETQA 2JJSA 5B1AB 3EYSL 3GIZH 3MGTB 1A5FH 5EIVA 2VM9A 5ICYA 1OSEA 1KGUA 1WBXB 2QELA 3DVNB 1ES0B 3OKOA 1EAOA 3D69B 2PPEA 3E3QE 4X5WA 4FKKA 4TUJB 4XO5A 3LS5L 2AQ3A 4NCC1 1L9QA 4NZRL 2NY0C 2Y5TA 1YMMB 2YWZA 4KZ0A 1SJEA 4LSSH 1Z9SA 1I1AB 1CFBA 4Z7WF 2WXKA 5I1GL 4FJ6A 1KCSH 4PRHE 1UXSA 3JT0A 1JIBA 1MW3A 3CXHK 4DPBX 3GM8A 3RURA 3SN6N 4JKWA 2Q3XA 2C7UA 5DD5H 3CBJB 2DWTA 4RVBA 3L8QA 4MS8C 2VAJA 4NI6A 2E86A 1F97A 2EH7H 3QRLA 4V1DA 4ZUUA 1YMHA 1N6QH 4WI8A 4F27A 3TEUA 4BSWB 3GSQB 5AKSA 1EO7A 4OLXH 4UMSA 4FG6C 1D5MA 4ODXA 3K4ZA 5HVFB 3P0GB 1T6VN 4XVSH 3QG7L 3T3MB 1JPTL 4G9FD 3DWTA 1QABA 2WIMA 4J3WA 1DL7L 1IAIM 4LPVA 4JX0A 1MCOH 3QFDA 1AC6A 1KIRA 1ACXA 4J4PA 4M9OA 3AS1A 4ZSOE 2PWFA 3SY0B 1T4KB 2CLRB 4AK1A 4HS6B 3VXMA 1UZ8A 3L6FA 2XSKA 3I6KB 3OKMB 1A3ZA 3WV0A 2X89D 1WS7A 5FECA 2AQQA 2PR9A 5B3JE 1FLRL 1NEZB 1KEGH 4IBLT 1UENA 4I18B 3MCYA 4ALAL 4HVBA 4F92B 5KYWB 2LE9A 3KPOA 1OF2A 2Y2TA 5DJ2B 2DLIA 1J1PH 4XMXA 1GMIA 3V6OA 3V6BR 3GMLB 3L3OC 3S5YA 4AXWA 3GSNH 4ZNEE 1BPVA 2ZONA 1FG9C 1QBAA 3MV8B 1M42A 4NXKA 3T4AB 4I87A 1PLGL 1ULVA 2X4SA 3V55A 1UACH 3EZ8A 1M4KA 3T0EC 2X40A 3OAWA 4RAUA 4WWOA 8FABA 1PKOA 3ULUD 3EYOA 1YJDL 4DH2A 1IKNA 3HNTH 4N28A 4Y5VB 5AYUL 2GB2A 2XTJC 3QRGH 4HIJB 4NRYA 4XP4L 5LO7A 1QBLH 1R19A 4XNZC 1UB6A 2P5ED 1QG3A 5A3IC 5TE7H 3PGDA 5LJYH 4EN2A 1QX1A 1NGXA 3FN9A 4LCCB 2PCFA 5DRNB 1ZGLB 1DUYA 1MNNA 4ODVL 1CFQA 1IBFA 3Q5TA 3VH8G 1Y18A 1NWOA 3D0LA 4M5YH 5D2NA 3JXAA 1H5BA 3VFWB 1PYWB 3H4FA 3ZQXA 3T2QA 3GXNA 2R4RL 3EGSB 2DEXX 4L37B 1CVSC 1SEQH 3DURA 4IOFD 4OLUL 4XVUD 3O9WD 2J2ZA 3GJFA 2R0WH 3MLVH 4LLMB 5KSUA 3DXAE 3IXAB 2RBLA 4NENB 1CL7L 5ICXB 3MSPA 2OXHA 3MAWA 5SWZB 2FGWH 5IB4A 5HDBF 1NC4D 1NDGA 3VI3F 3W5MA 1YRKA 1SHXA 3LKNB 4QRAA 4CADB 4JGNA 1Z9PA 2P8MA 5E6ID 1XR8B 4LASH 4MDJA 2UX6A 4WUKL 3F12A 3DHPA 5E08H 2CR0A 3QB7C 5KVFE 3V0AC 3JBG7 1FNEB 1BPLB 3SKOA 4K9EC 5CN1A 3BFQG 3ESUF 2N4IA 5FW6A 3P30H 1CXKA 1R5IA 2DQJL 2YKLH 5FDYA 5HGDA 3ZIMA 5B1JA 2ESVB 4GQPH 2RFXB 4KXAA 2WCSA 4XZ4A 3UABA 3S2AA 2I07B 1G6VK 5D4IA 2DBLL 1KLFA 4ZYKB 3KVDD 2DL9A 3AMKA 3SEPA 4XMPL 2YPLB 5AOIA 1XGYL 5MENB 3QH3B 3WFEH 1XGZA 3S7GA 5G5DA 2GUOA 2X4OA 2X70B 1FNGA 4AL8H 1S7TA 2LU3A 2YZ1A 4PJ7B 1A14H 1G7JB 4YL4A 1DUZA 3N5AA 4LLVA 2D03H 1EFXD 4PJIA 1XSOA 4AZ8A 4J1UB 5DVLA 1B6DA 5CJOH 2JMRA 4G9DA 4NOFA 4ELMA 3BUPA 4E0RB 4P05A 1KTCA 5IP4A 4H26B 4L1LA 1LO3L 5DS8B 2IAMC 2P8PB 5ICUA 3QA3A 1IM3D 1IM9B 1VFMA 3L7FA 3LRMA 4F8NA 3OHMB 5CEZH 1U42A 5D7EA 4DGIL 4IGBC 4DESA 4ACTA 5C0EB 2R1WA 3WD5L 3RWJA 2BCMA 3EJSA 2P28B 2VZOA 3V8CA 4AYSA 3LD8B 5D55A 3F7KA 3I74A 1HILA 2IOMA 2X2HA 5EN3A 3AMLA 3Q43A 1WLHA 5FIEA 3RWEA 3S3CB 1EJ6A 2CJ3A 4WV1A 1N64H 2AF2A 3I9GH 4KV5F 1FFRA 3ALPA 5D96C 3OR6A 4PV9A 2GBAA 4ZMZA 2ATKB 2C3VA 2XWEA 3KPSD 4LP5A 4I48A 5BZWA 1E4HA 5KW9L 3JYBA 4W9GC 5EDSA 1IBGH 5DEZA 4AIXA 2ZUWA 2BSSA 1IGYA 5LWYH 1NOAA 1G7PB 2WVTA 4UT7L 4JM0A 3U25A 2O26U 4BZ2A 2B16A 4G43A 2JTDA 4PM1A 4NERA 5CD5C 4PRNA 5F9DC 1ZT4A 1BHGA 2B20A 4Y2OA 3UBXG 2V5YA 3BVUA 1D7FA 4TPRH 4P4KD 5FR3A 5J1SC 5D1XC 4Y2DD 4E41A 1MDTA 1RIVL 3VA2C 4RH4A 5C0BA 5IESL 1HZLA 1YEIH 1JMXA 3NPSB 3LN4A 2EDMA 4NQDA 3UG5A 3W37A 3L3OA 4PTTB 2CO6B 4XMWA 1ZSHA 4F15B 4KVNH 1TTUA 2HT2D 4LXFA 2GJ6D 4JFEB 5EZOL 2Z35A 1ZVSA 2IGTA 4CKQA 3QR1A 4G6KH 4X5QA 4MJ2A 3E6FA 3LKPA 1R3IL 5H2BA 3T0EA 3T3PB 3ABLB 2ZKYA 1NANH 4LGSB 2EXYD 2G9HB 1JZHA 3MACL 4XAWL 2HN7B 3MNDA 5IFAH 3GLZA 1NANI 2OX5B 3VYNA 4ZUSA 5LNGA 1MJ8L 2G4GA 1DQDH 2XWBB 3EKCA 5DC0A 4LHUG 1P1ZB 4FNSA 3QK0A 4BFBD 4NO2A 3BH8B 5C08E 5CF3A 1YNTF 1D7CA 3QJQB 2AP2A 4XBPA 5IG7B 4QF1B 5C09A 3BPNB 4PSRA 4XVJH 1T0OA 3NJFA 5FYJU 3K91A 4IIQC 1ZHLB 3DETC 2WD0A 3GMRA 2CO1A 4NPKA 1KGJA 1QKZL 5IVOA 1OLLA 3QISA 4OV6F 4K3JH 4QHUA 3KWWB 4TSAH 3NN8B 2AJZA 2GT9B 1R47A 3DHMA 4S10A 2FGZA 4GEJA 1CFSA 4YHLH 3D85B 3FQUB 3FF7A 5K9OB 4XRCB 4XE0A 3ZE1F 4N2CA 5EEXA 4K2UL 4EUPH 1NICA 5H94A 5JW3H 2NT0A 1TZHA 4V1DD 4NO0B 5I6PA 4HUNB 5C0JB 1E7VA 3ZUCA 4GW4A 3DYOA 3T2LA 3QW9A 3V5HA 4FD0A 4ICWA 4RETB 4BDVA 3Q9PA 3VFTB 4PJGF 5F3BA 1DJGA 5CZXD 1MW0A 5HYEA 1G7IB 4IOIA 1HH6B 2K9FB 4PJBE 5A16A 5HVHB 1R3HB 3WXWL 2XPZA 3VD7A 2CPUA 4J4PD 1G9MC 5IF0A 1KG0B 4LNRB 3BSZH 4X6FB 3VXMD 1RUQL 3MA9L 3AREB 4QRQB 2I9TA 1A21A 2DLHA 2Y3NA 5AW6B 2VDOB 3S48A 4AV5A 2EVGA 1AIZA 2R7EB 4PG9B 2HTLC 3B7TA 2NOYA 4ZMWA 3W56A 3SDDC 4B9JA 4GSRA 1N9PA 4FJYA 3MRPB 3IFOA 2A83A 1FFOB 1RPQA 3G5WA 3WKML 1VIWA 2BNUB 4OI7A 2W1NA 1VZGA 1RVFH 3E7JA 2BC4A 1BWWA 5BS0B 2FAUA 1I8KA 1KELL 3D9AL 2IAMA 4GSXA 1RUAH 3PWPB 2NMSA 5E8OB 3DPDA 2QV2A 2A9CA 2E59A 3DUSA 1OAUH 5GRUH 4H0GA 4IGBA 3VFSA 3V0FA 1E7UA 3GMPB 2P8LB 3BX7C 1SEBB 1A1MA 5CCJA 3W9DB 5HYQA 4R7DB 3QHFL 1WUZA 2FYYA 3I6GA 3ASOB 1ECYA 1N18A 4Z3JA 5C6TH 3PF2A 5AZ2H 1RPUA 2DS4A 3CFDA 3NTCH 4KHTH 5C3IA 2VMEA 3IDGB 2Q7YB 1Y6MR 2R2BA 3EOAB 4QTIH 4BBWA 2DI7A 3SDXE 1MHEB 3BXNB 3WS6C 1E4WL 4XVTL 4BUGA 1Q8MA 3HFMH 3LEYH 4X9YA 1R34A 4Z7VF 4HCRH 5DVKA 3UAAA 2BVOA 2OSLA 5DK2A 2JIXB 5DGRA 5AVUB 2P43B 2OV0A 1EHNA 1HXYA 1OGAE 3DJTA 3MV9E 1TTCA 3HVNA 3WJLC 3LPPA 4X8JB 3Q48A 2VSCA 3P3SA 4H2CA 2UVFA 5D7LE 4ZOEA 2WGNB 2HKAA 2A9BA 1EAPB 1AH1A 5DMGD 4NRXA 5D1XA 3B1TA 4D0DA 4TNGA 2R2HB 3V4UL 3SE8H 4BKTC 1OPGL 4N85A 4Q6IC 5J6SA 2C9PA 5KUMA 2CPCA 1EBAA 4FMFA 1M57B 3GNMH 3MCLL 1CR9H 3SKUD 2FSDA 1L9RA 3HLAA 5TFSH 2EKSA 4KKAD 5GXBB 1JHLL 5FB8A 2A74A 1G1CA 1XH3A 2ARJQ 1ETZA 4P9HC 5DSCA 3B83A 1KEML 3CN1A 3D52A 3R7RA 2FB4L 3TYFA 1M6UA 2IH8A 1ID2A 3O0LA 2VXQA 3IGFA 3SYOA 2P42B 1EDQA 3H7BA 4OZFA 3MO1B 4UUJA 1JPSL 5F0MB 1UM4L 2DICA 4KI5C 3K3QA 2OL3L 4L29A 4AQ1B 2G3NA 2DQIH 2E9GA 1FL5A 4PBDA 2NY0D 1O6SA 3CFKA 4JFDE 3GRGA 1KIUA 3ZO0A 4L0YA 4RFEA 4A2EA 5L9DL 2PUQT 3LNGA 1SYSB 2NY4B 4KNQA 4CILA 3C8KB 3CFTA 3FB6B 4I2XA 2QQLH 4P59L 1KTDA 2YO3A 1DJWA 1TU2B 4MS8D 1KFAL 2G75B 2OK0L 4C47A 1Q0XL 1NFDE 4OJFL 4WW2C 2ZXGA 2VSKB 2AMGA 3QUZC 1PGRB 2PCPB 1KN4H 5I18L 3S88H 4JK0D 3CLFH 5E0QA 2W60A 4K8RL 3VFNA 4PJFF 1IC7H 1BFVH 4FG6D 3TH2T 2WMPA 4FADA 5KANI 4U1IB 2E6QA 4WGKA 43C9B 3U6RB 2OMVA 1NGWA 4HQQH 2ZP8A 1G1OA 3EIFA 3ZDYB 3EBGA 4PJ8B 4KK6C 1U8PB 3DX3A 2JVUA 3NAAL 1ZVNA 5E5MA 3CFJA 4UQ3B 5DZ9A 3UP6A 1BLIA 3ASNB 3L08A 1IEBA 4U0RB 4D9LL 3KLHC 4RA3A 2LU7A 3FAWA 3BSHA 3C6SA 1X9LA 3EXJA 3QUMH 3EOTH 2EIBA 3K2KA 1JG9A 3ET9F 5F1OB 4QRPA 4OGAD 3VXUA 3OHXB 3ARQA 1HXKA 3UAFA 3OMZA 4XMKL 3GZPA 4N8VG 5C0BD 2NUTB 2OP4H 2Z31B 3UTTB 4NQDD 1Q72H 1F18A 5LDUA 1OTSC 3GTNA 3DO3A 1FSKC 1S8DA 2IXQB 1HFUA 5FUOL 1QEWB 3BWAA 4UM9B 4YSUA 4CL7A 2B4CC 4HD9A 3HW7A 3RVVC 4X80H 4AIEA 5K9QG 3LH2L 3T0ED 2ITCA 4YHOH 1SBSL 3TO2A 2FLRT 3VRJA 2AEOA 4N2FA 4B5ZA 4L8SC 3BSGA 4PIRF 4Y9GA 2AQ2A 1CLCA 4MASA 5A3ID 1IGFL 2XWJA 1DVSA 1FVEA 2HFEA 4HAGA 4L8DB 2GUYA 1NBVH 1ZT7A 1A1NA 1NL0L 1UWEH 4C59B 2DM7A 5C09D 1G7LB 4DP8X 5CP3A 3RIFF 1DZBA 2FQDA 3AABA 4NKMA 4OBSA 1WVZA 1QBLL 4XXWA 4YNYB 4WNQA 5SWSA 5DJZB 5JIQA 3P3TA 4HUUB 5F9OH 5TGBA 1EXUB 3R06B 1K4DB 3NA4A 4GAFB 3V7AE 2HRPH 1FG2B 3LNEA 4TS6A 1VA9A 4ODSH 2KPWA 1MHPL 4YDJB 1AHWB 3H2QA 1T7XA 3WJLA 3REVA 3KLSA 4HLZH 3UPCA 2Q10A 2XKNB 1E65A 3LS4L 2XQYG 4R7XA 2FR4B 2EDBA 4UTBL 5D72H 5M94B 3ESPA 1ZVYA 1UXMA 2VR8A 3E6HA 3NJLA 4Q6IA 3K6SB 1JXKA 1YPZE 5JYMA 1UCTA 4P9MH 2VB5A 4HSCX 5AVRB 1U8OB 2PXYC 3QNFA 2CIKA 2F8OA 4JRXE 1M9WA 3MRGB 3G5ZB 4FQ2L 1HXMB 4LASL 1WD8A 1LM8V 1MIEL 2Q6WA 3DOSA 3IKKA 2K6YA 1D7BA 2MCPH 3C6LB 4KK5D 1QWHA 3EJZC 1P5VA 2JLLA 1W80A 2VLMD 3AUVA 3MOQA 2BVQA 4FFTA 3M1CA 3C5SA 3NZHH 4E42B 3QZBA 2X53A 3GGWB 4AQEA 1ACCA 4XNAA 5JUEH 3WFBH 1O7SA 2Q86A 1GGIH 1KLUA 3DTXB 1A6UH 5FUCE 2IV9A 3CFCH 4PBVC 1A3QA 2IDCA 5IVXE 2VDNH 2IAMD 3BP7A 3L16A 4HGKC 3FT4A 2FJFA 3CV5A 4YHPB 2MSPA 1B0GB 1BVZA 2XICA 3DUUA 4IGBD 1M2VA 3EAKA 4GS7B 2R1XB 2HFTA 4F33A 1PX3A 4YZFE 1FZMA 2IO5A 5I1IL 3H9SA 1LO2H 3IDNA 4G8IB 5EU6A 3D12B 2D31B 1AMXA 3KPQB 1Q0YL 3QUZA 5GGUA 4ADIA 1C5DA 5A2FA 2JB6B 4KNSA 2UZPA 3EO1A 4L0ZA 3FH5A 3WS6A 1YEDA 3ULUL 2ADIB 4N1CA 4NKDA 1Q1JH 1G1YA 4PJ9B 5IIEA 4IYKA 2O6CA 1ZLWH 1U91A 1MWAH 2X2JA 1YZZA 3RHWK 3EOBA 1N64L 4Y5YB 4HZAA 5I0YA 3LRSA 4D7PA 9CGTA 5JORB 4WEEA 2GC4C 2FJHA 3UJJH 5C86A 1ZLWK 1MJ7H 5CD5D 1RMFH 4X4MA 3VFGL 4QRTB 3US0A 1E40A 4FQCH 1YEHL 1DQVA 5D1ZB 1NIAA 3O2DA 3IBOA 3T8XA 2CJUL 1TDQA 2BDNL 4OLYH 5EN2B 3DARA 3IYLW 5D1XD 3SE3C 1NAMB 4CC4C 4ZMQA 3Q1EA 4S2SB 3S3SA 3BZ4A 2EXTA 1AZVA 4PJDF 4PJ7F 5T3ZH 2CSPA 4GO8A 3GSRA 3V6FA 2AABL 3TWCL 3U4BH 3DROB 1FL6A 4N4YB 4M8QB 3CTTA 2IBBA 2MPAH 2IC2A 2XA3A 4WTQA 2QMJA 1XT5A 4IJ3B 5IVZA 4I0KA 1D5IH 2W59A 1TSHA 4XO8A 5AVWB 4U1LB 3RVWC 3B2DC 2JKTM 4L8SA 4JY5H 2ZCLH 4FCAA 4ZO9A 1EZUA 1FZKB 1DFBL 4ZUTB 4BUHA 1P4LA 2YFOA 5GSVB 2NY2B 3AACA 2B39A 3KL5A 5D1QC 4ZFOL 1F6AA 4RISH 2XIBA 3X1BA 4YC2C 1JFHA 3L3KA 4PWEA 1OCZB 1NDMA 1UQSB 1JGDB 4P5MA 4XVOA 2J8HA 5EUKB 3WELA 2MOQA 5GRXG 1M7XA 4YDNA 1W0WB 2VL4A 1WIUA 1CUOA 5E9DD 2KZBA 4NFBA 4N2BA 2K6ZA 3QUKB 5GRZA 1KT2B 3IN0A 4KUCD 2X7LB 2XT1B 3K5RA 3IDYC 4XVJL 3FTWA 4L4VB 3QEGH 3B7RL 2DQGL 1WYJA 3H56A 2MCMA 1JV5B 4JDVB 4LCIH 2QQQA 3L1GA 2IQ9L 1MQKH 5C0FB 2Y0SA 1UUNA 4P5KB 3N0AA 1KYFA 4NQCB 4LPCA 2JI3A 4OM0H 5FYKD 5IM7B 1GTNA 1I9RL 4I9WE 1I8IB 4ONHA 1BFOB 5J9PB 2PXYA 3GBNH 2X42A 3S96A 2P7TB 1J8HE 1PX8A 2EDNA 4KPHL 2DEWX 3GXFA 4ZFGL 5GS0C 3FB8A 1KBWA 4Y16C 1OE3A 1A3RH 4Q9QH 2LQRA 3MJ7A 5IK3B 5T3XD 4WFHE 2EYTA 1GA2A 1CI5A 3C2AH 4NJAL 2LFGA 3L1EA 4NWTL 1DBKL 4IEFA 4QRPD 3VXUD 2AEIT 4WO4A 5MP6H 3AT8A 5KVGH 3KNBB 5DEGA 4DOHE 3OZLA 3FT9A 5HDBE 3VI3E 1A9VA 1PMYA 1S9VA 4L9LA 5F1NB 4RBPH 3S4SA 3PL6C 3LYRA 3VDAA 4LCUB 1GC1H 3UJIL 5C8JA 5AYTA 3M88A 4JM2C 4UT6A 5IHWA 4B9YA 1DFXA 4QXTA 3VDBA 2FNBA 4MNGE 3BVVA 1NCBH 5CZKA 5KJRH 1NJ9B 3EHBC 4E9RA 5EUOF 4C83A 1AKJB 4CSSA 2BVYA 5EF1A 3DYMA 3FT2A 4GQRA 3RWDA 2P46B 3LPGA 2BSCA 4LZKA 4X0KB 1XSJA 3QDJE 4H40A 1XBRA 4H44C 5E5RB 2JLPA 1YECH 3ML9A 4RDBA 4XH2A 5IB5B 4YHNA 2QQKL 2F6AA 3ZSTA 3K71B 5ILTH 3PDGA 4KXZH 3VG9B 1OGTA 3GI8L 1NSNH 3R19A 4NNXB 5SWSD 5I8EB 3WIIL 3Q5YA 3FQ4A 4KXZI 1MUJA 4NI3A 4WHTB 1IBHA 1LDPL 1R5VA 1JE6A 4FQXC 4YSQA 1VPOH 4D8OA 2GSIB 3BAIA 2NTFB 3OB8A 3QPQC 5I23A 3KXFA 5HJBA 4AQAB 2PWHA 1S9XA 4IRZL 4X6CB 4D9RD 3BVNB 3RGHA 4CVXB 3AXHA 1M7IB 1WFUA 3GBLA 4G3YL 4MB5A 1CXHA 4FNQA 1UG9A 3VQLA 2OMZB 4OV5A 2B1HH 5LCVA 3IFPA 2IBGA 1ZLVH 3BGFC 1EEZA 4BZYA 2GG1A 2CDGB 3JWOC 1YEJL 5EU3A 5DDHB 4XCFL 1BAFL 2XXMB 4KV5E 3LQAL 1Q9KA 4XNUL 4UU9B 4KXCA 4AYEC 3N44F 3H55A 1ZLVK 4PRDB 3RDTC 2H1PH 1W8EA 2NQDA 1BZEA 3MV7A 3QWQB 2IANA 4XX1E 5GZOC 1MNUL 2VAAA 2WQ8A 4NQTA 5CILH 2O5YL 2VXSH 3O2WH 4M6NH 3MRRA 3O4LB 5ANMB 1HE8A 2V9QA 3O0RL 4RRPA 4L3EA 2Q20A 3ME0B 2EEBA 1F41A 2ATAA 4RESB 3OAUH 4GG6A 1DQMH 1JTTA 1EK3A 4ZTOH 3U0TA 5D1QA 1U8QB 3KPPA 1D3CA 3RX8A 3OB0H 3HI6H 4MZRA 3VMNA 3QEHB 2H9GB 5HYSB 3LV3A 2WP3T 4J3OF 1BXUA 3BEWA 4PB9L 4ZW7A 5I1KH 3UP1A 2RD0A 4ZO8A 4U1HB 3AG4B 2W88A 1D9KB 4KI5D 4POZC 4AG4H 1R24B 3OB0K 1RZIB 2HG5A 1T0NA 3UTPE 5IB2B 1MI5B 2CLVA 3QFJB 2Z34A 5J6GB 3TM6A 3BKCH 2DF3A 2VLKE 1U8CB 4EN3B 4TNWF 1ET5A 1HT6A 3PDOB 1JS4A 2MNUA 3LZLA 4ZMNA 1PD1A 4DPRA 3H9SD 5I8CA 1AQKH 5L2JB 1J8SA 3JT2A 1UUSA 3CN3A 5EU6D 1NEPA 1JV2A 3UG4A 3MRIA 1O0VA 4NQVB 3L5XL 3QUZD 4NEHB 5EA0L 4ES8A 3MROA 4DAGL 3G6AB 3LOWA 4M7ZB 4MQTB 4UQ2B 4DN3H 4N3UA 3NZ8B 2P4AB 3LB6C 3LZPA 5LNEA 2QQLL 4L2LA 1KNOB 4YSSA 3V0WL 4BINA 4YHIA 4H1LG 2EXWD 4Y19A 3TFKC 4BJLA 4PGEA 5JW4N 4N2GA 4KK6D 1B9ZA 5D7IA 2O72A 4Y16A 4G11A 3KLHD 3FCTB 3EH3B 4ZAKC 4F8QA 1UJ3B 1IT9H 1ZTXE 2X4PB 5I8OH 1ET8A 4P5TA 3R1GH 2V3FA 4XCYB 1RZ8B 25C8H 1B4JL 1S7WA 4WI3A 2Q76A 4FTVB 1UD3A 4PGBB 3UZEC 3MXVH 4NN5C 3ZKQD 3S36X 2IAAC 3ZE1E 2W9DL 8CGTA 2AJ3B 3MJ9H 3S97C 4FFZH 4L8BB 4F9PC 2W07B 5I75C 1FNHA 5T1KB 5E1AA 3C9NA 4Z77A 3DIFA 4X99B 4KGJA 4AYDC 2G5RA 2K8QA 4JM2A 5CO1A 3H53A 4PJGE 4ZQKB 3HS0C 4APQC 3WMSA 2I26N 2IEPA 3RY6C 4ODWA 1CPUA 4F8PA 5JQ6L 3MFFA 3KYMA 1CE6B 2XA8L 1ZHBA 4G71B 2JF1A 5TDNB 2CM6A 2W92A 1U58A 1N4XH 4JANB 3H9HB 1JPFB 3SOBL 3AB0B 5KZCD 2NXYC 2TAAA 5IHZA 1NA8A 3BT2H 4TUKL 1RZKC 3RI5K 2YMXH 3BRDA 1BIIB 2G60L 3CZEA 3ESNA 4X5XA 2APSA 1TJXA 3OGCA 4FQXA 2FWOA 2EECA 1N67A 2DQTL 4FAAB 2BHZA 4KROB 2NY1D 3S34H 1AQDB 1RZJC 1HHKA 5I8KL 4W1TA 3QP3A 4QOKE 2HG0A 4RGOL 4YHKH 3UAJC 5FFLA 4E9WA 3HE6B 4BQBA 4EMZA 3K72A 3EJUA 4BZ1L 4M7LT 4WRLA 4ZFZA 2IOOA 2A4ZA 4F37F 4JQIL 3TXAA 1HIML 3T77A 1UVQA 1UFGA 5KVDE 2UWEF 1PFCA 4XP5H 1U3JA 1SJHB 2VR3A 2PKDA 3WUWB 1RHFA 1DLHA 4AYFA 4CA4A 1K72A 1Y0LB 4ODSL 1O7DE 1C08A 2C4FU 1I82A 1NC2B 5H37G 1CFTB 4WK0B 1J7VR 3STLA 5T5FA 3FUKA 2PXYD 5CEYA 1A6AA 2FECI 3B5TA 3WIAA 1Q4NX 5DC9B 4RGNC 4LB8A 3RDTA 3HCVA 3N85H 2WXNA 4JQVC 4MQ7A 3CVBA 3S35X 1TETL 3C09B 3BD3A 4E5XG 5GZOA 1QSFB 3D4GA 4MVBD 2PCYA 1ORSA 2X4NA 4P9ML 5T5NF 1W72B 2OMYB 3EJZD 5E2TL 5BRQA 5ESAB 3Q7JA 3SO3C 1PDKB 1RJLB 2E0PA 2ALWA 1QRNE 4BFIA 2J88L 1G6RB 2CJTA 3NFPA 4ORGA 3DMMB 3U82B 4GW5A 1V5JA 1FJ1A 3O8XC 4BZ2L 2BO0A 4B7LA 1RU9L 1ONQB 1WBYB 3WFDH 3FN0L 5EZIH 2YD7A 2FEEI 3FPXA 2F1AA 3L3IA 3RVXD 4ZW5A 5EZLA 4ZX6A 1HEZA 1W8OA 2WBJC 3MBWB 1NPJA 1XGRB 2WC7A 1IVLA 3NMEA 4YEFA 4E9TA 4I4WB 4KBPA 1A0QL 1QUNA 4AMKL 2XACC 5BNXD 5IB1B 4RGMC 7PCYA 5G2NA 1MH5B 3CFCL 5A40E 1J0HA 3MV11 4P8QA 3VGEA 1ZS2A 4FQ1L 2KERA 3NGBB 4GQ9H 4M03A 3SYPA 1FHGA 5IQMA 5DJCA 2YD0A 5I76B 5IQ7H 4EJ1C 3PIQA 1BVNP 3WTXA 5I66B 1HOCB 2CK0L 4LU5H 5CSBA 4X98B 3UDWA 3RWGA 5EF0A 1D6EB 5JOFB 1P4IL 2R2EB 3T8VA 4HH8A 3SY6A 3WIFB 2EIZA 1I3UA 3ARRA 3SE9L 1FFTB 1FO0H 3BPOB 4YL9A 1KCUH 4H8PA 4ZAKA 2QPUA 4YWGH 3KXFD 4Q0XH 2CK2A 1S7XA 1R3LB 3BH9A 4GRLB 4G2AA 5D4HA 1XL6A 3VSVA 3JSSA 1IKFH 4TVPL 4R97C 4CSPA 1MAMH 5D7JB 1MFUA 2F58H 2XVGA 4F9PA 3LSOA 3F05A 3N2JA 4YLCA 1M1XA 4OI9A 3FSVA 4G80A 1J12A 4EIZC 5HGAB 4PJFE 4O2CA 4YSEA 4Z3TA 2A99A 3GLAA 4BFGA 4CNIA 3MDJA 5F70A 4HEPA 3VFMA 3IDJA 1CVRA 3T6QC 5HJ3B 5KBPA 3MV7D 2QLVB 2CBMA 2IAND 1FC2D 4M6MH 4U6HA 4W6YB 4EUPA 4Z5RA 2XPGA 1IAKA 4L3ED 3AFLA 1AS6A 2VZSA 3IGAB 5HHNA 1DTUA 3MLSH 3QDAA 2R9HC 2N01B 1GIGH 2F53B 4HWZA 4P2RE 3MLUL 4V2CB 1WEJH 1CD0A 2MPAL 3HR5A 4Y4HA 2AV7B 5D1QD 4R7NA 1QW8A 2HT4D 5FA4B 3MNWA 1MHCB 4G8GB 3L3GB 3QZWG 5T1LA 1E0OB 4NBYB 5IMOA 3BSZA 2BSTB 1B2WH 2A5UA 4BKLA 4B3VA 4L4TB 4P23B 5CFAA 1DDHB 2D4DA 4JFFA 4E5XA 1EERB 2QEJA 2H6PA 4YPGB 4D94A 3QPXH 1RZ7H 4JHAH 1IQWH 4JNXA 2Y36H 4J28A 2EAEA 3FU7B 2ZXWB 1IFGA 4GB9A 3BKJH 2QDWA 2WWMC 1JK8B 2XWZA 3QIBA 3A4AA 4Z78A 3L5JA 5GZNA 3TN0C 1MCDA 4B41A 3VNZA 5I1EH 2C3GA 4APXA 4GBXB 3VJ6A 3C5JA 1OPOA 2HH0L 1JXDA 3THML 4NT6B 1U36A 3BZEB 2QADB 2PW2B 1MFEL 4NQEA 2H4EA 3HG1A 1A4KA 3TURA 4N9OB 4XMLL 1R3JA 2WUCH 3QWNA 3QEGL 3GRWA 2K4AA 1PVHA 4OZHB 2GAZA 4AQ8C 4B9GA 4XCEA 1DBAL 1KY7A 4RMTA 4BV1A 5JXAL 4UDTA 1MFBL 1PIFA 2V37A 1DLFH 4LRIC 4QPEA 4WHDA 5EZJA 2AXGB 3EFDL 1X5AA 4Y16D 3TIEB 2FX7H 2AEPL 4G8EA 1TFHA 3QFGA 3F8UB 4LEXH 2XXCB 4FQHA 4QHNA 2V2XA 3FFCE 4P5TD 4BQ6A 4F8OA 2O6DA 3FHQA 4E68A 4MHHG 5GGTH 5JW5A 4JJ5A 4UQDA 4FA8A 4C56B 1EDYA 4JLRB 1AQMA 3N42F 1D6VL 1BP3B 1CXFA 3EDFA 3PP3K 1QI3A 3S3DB 5IW1B 3C2SA 4HZ1A 1NBYB 2UUDK 4R5TA 1LHZA 2OMUB 3GHBH 3FBKA 1WZ1H 2Y06H 3JUZA 3C2AL 3PL6D 4HCRA 3UTSB 4N24A 3UMNA 1VENA 1S9WB 3QQ4B 1GAFH 1L9OA 4JM2D 3ATBA 1RIUH 2WBJA 1AGFA 4MA3B 1J9QA 3OM3B 3ZKSD 5DJ8A 4Y2DB 4PHXA 2IDUA 4HKJB 1U95A 4NHCL 4D0BB 1QNZL 4DUWA 2JV6A 3MV8E 3V0EA 2YPVA 4JRYB 1I9JL 3BPLB 3L5WA 5EEZA 5KSBF 1E9OA 1GCFA 1GC1L 1T1YA 2XV0A 3KPRE 5DJ0A 3HZVA 3MKKA 1N8ZA 5L8KB 1WRFA 5K1NA 2Z91B 3CVHL 5DMIH 1JJUA 4P2QA 4WUUE 2JXMB 4WFFD 4RFOL 4XWGH 4HAFA 4JCMA 5I19L 3ZT5A 2SEBB 3ARWA 3B2PA 1SYVB 3L3JA 1IAOB 4LQFL 4O2EA 2ED8A 3RL2A 1SVCP 4UOW0 4FQXD 4B9PA 2EADA 4X7TA 3OZ9L 1JGUL 2QPSA 4GIAA 5HY9A 2ATPB 3IGKA 1FFPB 3EO0A 4BWTA 3S37X 2VWEE 3EYFA 4ETQB 3QPQD 4D8PB 4I5BA 1PEZA 3OXRA 2ADGB 2DI9A 1IIIA 3EYVB 1C12A 3L4XA 1NFKA 4WI6A 1NSNL 4KK9C 5HDRA 1DANT 2ENQA 3MODL 3FOLA 2JB5H 4XP6H 4J3BA 1R3KA 1SJEB 1Z9SB 1DP0A 3FF8A 1HJCA 1XDTT 3K2MC 1LO4L 2BY3A 4S1QL 1H0DA 5KVEE 5FF6B 1QPXA 2DD8L 3WSQH 2BVTA 5CEZD 2F8XC 2C7UB 4O5LH 3TBWB 3BN3B 5DRWB 1SM3H 1MOEA 3RDTD 2ENJA 5E9NA 1K6QL 2VO5A 4QO1B 3CXFA 1QI4A 4V1DB 4ZUUB 2XYBA 1RD6A 5GZOD 3X11B 2C26A 3FT3A 3IK2A 3GMMA 3ULAB 4FXGB 2Q5BA 4JO3L 5ADPH 2WYIA 4R4FL 1JZFA 4WI0A 2AXJA 2WLJA 1M71B 2ESVE 2C9SA 3UC2A 1ZA3B 3LH9A 1G9ML 4HMEA 2K7PA 3GK8H 4OJDH 4N86A 2HRGA 3T9WA 3DV6A 5DU7A 5EORL 1ZS8A 2MNWA 2XVLA 3SYCA 1RFDL 5HHMB 1UFUA 4HXAH 2KT6A 5EMYA 1CLYL 3L9RA 4POZD 1F11A 4I0PC 5FECB 3FFDA 3US9A 2ZP0T 1MPAL 2J8OA 3Q1SL 4PJ7E 4PJDE 1T7WA 1Z1WA 1BJMA 1GMEA 1JI2A 4HJ0D 3QUMA 4UV4L 1DVUA 5EULV 4KAQH 3TN0A 3ZJAA 3MNZA 1PAZA 5CGYC 1AI1L 3NFSL 1A7OH 4JPKL 4MB4A 1GJIA 4MXQC 2XZAL 2AZUA 4EDWH 2H7WA 3HOGA 5K93A 2G3ZA 4KY1H 4WHYG 5L88L 4W93A 2EH8H 1HOEA 3DECA 1E28A 3KPMA 3LB6D 4AQ8A 1FP5A 1OZTG 3G6JA 2VR7A 4IDJH 1Z32X 2PWGA 5ADOL 5TE4L 1C7TA 1IIKA 2WPGA 4GEIA 3RIAK 3RP1A 5LGJB 3TFKD 4WW1B 4LRIA 2F8VA 5CNHA 1ZHKA 4Y1AB 3VGAB 1K3ZA 1T04A 1LWHA 4OF0A 4ZAKD 5DGQA 3QUGA 1CU4L 4P57A 5JHLH 3JV4A 3VM7A 1U92A 1XO8A 3HC0A 1E6JL 3NA9L 2RGSA 4ODTL 3D0LB 3SQOL 4OD3L 4JZJB 5DHXB 3OKLA 3I50L 4Q14A 3FHAA 3WTYA