3AABA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form i crystal
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
b'ELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1653
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
total genus 21
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aabA00
3L1GA 4JUTA 3L1EA 3QORB 4PBDA 4YL9A 3QORC 2Y1YA 1GMEA 3GT6A 3L1FA 4I88A 3Q9PA 4RZKA 3GLAA 3QORA 3Q9QA 1WFIA 3VQMA 2K8QA 1SHSA 1WGVA 3EUDA 3IGFA 1WH0A 2N0KA 2KMWA 2N3JA 2CR0A 3J07A 4ELDA 4YLCA 4ZJ9A 1EJFA 2Y22A 2WJ5A 4YE0A 5DS1A 4M5TA 2JKIS 2MNWA 4YLBA 3W1ZA 2XCMC 4M5SA 4YDZA 1RL1A 2BOLA 3QORD 3N3EA 2WJ7A 2O30A 2KLRA 2RH0A 5LUMA 4PCKA 4JUSA 4MJHA 3VQLA 1X5MA 5DS2A 3GUFA 3AACA 2Y1ZA 3AABA 4FEIA 2CG9X
chains in the Genus database with same CATH superfamily
4BFJA 4PJHE 3DGGA 3RWEA 1F4XH 4UIKH 3V4UL 4P5TB 4Q9RH 1M05A 3IFPA 4HUWB 2GIMA 1QSVA 3AREC 2X42A 4X9BA 4ONFH 4M1CD 4PLJD 2B59A 1EXGA 4DP4X 1NEZB 3BPCB 4HC1H 4X80H 4O2EB 4Y2DB 3B9AA 2P5WA 5K9JL 5DC2A 1VCBC 4M8RA 4WZ9A 5KAQF 2C7UB 1MCPL 5I18L 3IYLW 4PRIB 4QRTA 3QIWC 4LASH 4RFNB 3MJ7B 2JJUA 2XZQL 1F3DJ 3LZFL 4PB0L 4YDIL 5F71A 4J3BA 3Q6FA 3CIAA 5KBLA 2TRYA 3LN5A 4GQ9L 1UOLA 5FUCC 1I9IH 4H0LC 5K59F 4PSRA 4G8IB 5F3BB 3FB6A 4HEPG 1ZGLM 4AYBA 1GS8A 2DKSA 5I2IB 5AB1A 4UF7C 1CU4L 2KQNA 4JG5A 5D7IA 2AK1H 2V4LA 3CHRA 5ENWB 5IW3A 3ZYIA 4YAQA 3MLUL 1SRDA 4JFUA 5TFSH 3MV9A 4IRZL 3TNMA 1C5DA 2PABA 1Y6KR 1KEML 3CFEA 3KW7A 3L3JB 3STZA 4NKOB 1E8ZA 1H6TA 3D3VA 5AALA 3VXOB 2H4EA 3GXIA 3KHOA 3MRNA 1LK2A 4GRLA 2PR9A 3ARDD 3NCFB 3V4PH 3IXAB 4I8DA 4MA3B 1KLGA 5KYYB 3CFUA 5AVVB 3RWGA 1ZLVK 2BVQB 3MUGA 3OXRB 3ZHDA 3V6ZA 4WUKH 3WTUA 2F54A 2VZTA 3PP3H 4MJ4A 3RDTC 1A1NB 2VUYA 5MENE 1GYVA 1DQLH 1KPVB 1C5BH 5I23A 5I66B 4MTMA 3S36X 1SJEA 4QDGA 1EWHA 3QWOA 5TQ2L 4AJ0A 3C8KA 3WEMA 5I24A 4G11A 3PP4L 1BZ9A 4APXA 1NGPH 3WLWD 2W80C 1YVLA 5D55A 5AW6B 2YBRA 1S9XA 4KY1L 4LNRB 4NZJA 1D7DA 1JVKA 3F6LA 5J1AB 3IFNH 3SE4A 3U46A 3ASNB 3D39E 3QPXH 5TE7L 2YAMA 5DJZB 1HEZB 4U7KA 3VWJC 3BLKA 4I3SL 4PGBB 3Q13A 4FLOA 5I73B 2YK1H 3C09B 5HHOE 5DWUH 1XGQA 2CO2A 4BCXA 5C0AA 1UM4H 3P0YL 2NXZB 3T4YA 4G5ZL 1JFQL 2XCMC 3L5JA 1NCCH 1G7PA 3SDAC 2GJPA 3B8YA 1TQCC 5KVMC 3AY4A 4CSTA 2HJLB 5L2KD 2Z4TA 1H3VA 1LXMA 1AKPA 4LCWD 1CICB 2CBMA 2E47A 4MMYB 4B9IA 4OGYH 5BZDA 3ILPA 1NCUA 3KPSD 3PWUB 4JGMA 4H2AA 4Z0XA 1SOXA 3T4AA 3VXRA 3QDMB 5L4IA 1OTTC 2UXFA 5T33H 4XR8C 2L7QA 3HZMA 5E8OA 1PAZA 4OGAD 4A7UA 2BCMA 2VN4A 4U1NB 2IQ9L 5F9JB 4YHKH 4ZFOB 1HYSC 1KGUA 2QADC 4ZS6D 2C9PA 4ZUVB 5GSRB 4WHTA 4R7NA 1QEWB 3RVWC 4CKQA 3KNBA 5FW7A 5SWZB 2GT9A 1D7FA 1CBJA 3DSFH 3S5LG 5L7XL 4JUSA 4YC2C 2EADA 1YY9C 5E5RB 1NBZB 5HSFA 3ZDWA 5JPNA 2XFXA 1SQ2N 4FJ6A 4HK3J 4Q9QH 3MV7B 2M2DA 3IDUA 5EO9A 4DF9A 1NEUA 3HI1B 3IDNA 1HESA 5IOPA 1R5IA 2KLTA 3OC8A 5IMMA 4DPRA 1R5VA 2GSGA 4DTGL 2ARJB 1FI8C 3PWJA 3H42H 5D1ZI 5DFAA 1F97A 4BYHA 1P84K 3LSOA 5BUAA 2HRHA 2RQ8A 4E2OA 3V0EA 1ADQA 1KBGL 3LY6A 2B9BA 1NUDA 1HH9A 1QWNA 5CBEB 1WFMA 4HAKA 5F3HB 5JZ7D 3WCYA 3OJMB 3HRZC 3TEUA 4B41A 3US9A 4OLZH 5FFLA 2XXFA 1GMIA 1R24A 2DIAA 2CZNA 2Y2TA 3BGMB 3IAPA 3N42F 1FAIH 5D7JA 5FUCE 3HFMH 4JL2A 4GQPH 3CXDH 4OFIA 4I7ZC 3AJ7A 4JO2L 3VM7A 4G1MB 3N42B 2XUWA 1KG0B 1LD9B 2BWIA 1JI2A 1M42A 2DQHH 2ZAIA 3IGFA 4KPHL 4JFOA 2ZOOA 1FGNH 4NFCA 2F53B 1HAUA 2LFGA 1W0YT 3LKOA 3VX1A 1VKXA 3GXNA 1I8IA 2VAAB 2CKBH 5DZOA 4DW2H 3MOBL 5DK0B 2MTAA 3RPIB 1EZLA 4FQCL 3C6LB 5KVGL 4RA0C 3IDGA 3FO2A 1WIUA 2G9HB 2VTFA 4Y9BA 5HHPB 1SNRA 3SJVB 1JF6A 1UH4A 4K9JA 4LQFL 1KN4L 3O4LE 4FKEA 4KXZI 1DDHB 4OLXH 1TVDA 4P2RB 5GRJH 4CW1B 4PR5B 1FNGA 2ZT9C 3P4NA 1VADB 7PAZA 1TLMA 3OX8A 1QVOA 4UZSA 5CJ8A 3KLHC 2Y22A 4ZDHA 4OD2A 4XCFL 1T03L 1AQDB 2WWOA 4PRHE 4JRXA 3AU1A 2FIKB 3FOMA 5I6KA 3FQXB 5DZPA 4BA8A 2IQAA 4FFYL 2VXQA 3PQYE 5J9PA 4TQIA 5LCVA 2KERA 3CN4A 3GINA 3B9KB 1BX2B 2W81C 4XCNA 1CFMA 4NCC2 2HPTA 1LDSA 1MQKL 4YHPA 4NGHH 2VO5A 1N26A 3WIFA 3WLBB 2BOCA 4YZWA 4GG6A 1DVFD 4HS6B 4UNIA 1DVSA 5ICYA 2LTQC 1XB8A 4EI5D 4ZXBA 4ELMF 4O2EA 4NUGH 2XVBA 4P05A 1U8QA 2C7UA 5JOPD 3F58L 1TFHA 1PKQA 3T2NH 2DKUA 5MEND 2F5BH 4LPUA 5DYOA 3UZQB 1P9MA 3G04B 1S3RA 2FB4L 2WXKA 2XA8L 4G3YH 5MERB 4ELMB 1XD0A 2ZWZA 4IMKA 3SKMA 1VESA 4H4NA 1GS6X 3WJLC 5DA4A 4U3HA 4PS7A 3AAZB 4YZFE 4XX1E 2VB5A 5CEXA 4N6RA 2K45A 1BQ5A 2VRQA 1XF3A 3MCKB 5TPWH 3V4PB 2GEQA 3EJSA 1PJ9A 4B5EA 5SV4A 3V8OA 3GHEH 4F24A 3D39D 4YLQT 3E7JA 1PZ3A 4OGXH 5EIVA 1OM9A 2IVFC 4JG1H 1IEBB 3CFJB 3EGXA 1TQWA 3EO0B 3PY9A 1FN4B 4G9DB 1VPOH 1ED3B 4H1LB 4N2BA 4FTDA 5E4OA 1VFBA 4UOJA 2VMFA 3H85A 2ZXBA 3TVMB 1V3LA 5JXEA 2CJUL 4PJDE 4CRPA 3CFBA 1IGTB 4RMWA 3V9FA 4DPCX 1P1ZB 1M7DB 1U41A 2WAQA 5AB2A 5J6HA 2BVQA 3SDDC 5IOKA 3NSDA 4A37A 4JCWA 3CFNA 2MHAA 3S7GA 1JZ8A 2I5YL 2VR3A 4YVNA 5DRWB 1TJHL 3CGTA 3EHBC 4HSCX 1DVQA 1NANH 2ATKB 2X70A 3F64A 3I75B 2HT3D 3QH3B 5BZZA 3SO5A 4FABH 5ICZB 4KX9A 5C0GB 3HC3L 2WWKO 1ERNA 4HJJL 4OGZA 5E99H 3S37H 3WE6A 4GFTB 1XB6A 2EE3A 32C2B 3DJZA 3HMXA 4H8WL 3MNVB 4HLZH 2V2TB 4N85A 4X6CE 2N0KA 1NGWB 4QHKI 1WEJL 3ZTJG 2QVKA 3VFPA 1HINL 4C8XA 4MCYA 4WWNA 5KYWB 3ARED 4FFTA 4PU2A 4DIXA 2B2XL 2X4PB 1X5MA 3T5WA 4MDIB 2ID5A 4JM4L 3RHWK 4LU5H 5K9OB 12E8L 1T80A 2BIHA 4N1CA 5E6IB 2X6BA 4PJ5A 4XP5H 1U2CA 2EDLA 5DJ8A 1PQZB 6FABH 1SXNA 3A23A 2NX5E 2Z4QB 1E8YA 3QIWD 4HS8H 3CVIH 3QI9B 1C12A 4KTEL 3ARFC 1S9VA 1RPKA 5M7QA 2EH8L 3FO0H 4CVWA 2OI9C 1UXMA 1M6OB 4NERA 2DI8A 5E00B 5F7NC 5BPPA 4UQEA 3WEXA 3CK0H 5F9JA 5KJRH 1ZGLA 2GITB 2HG5B 1AHWC 1AE6H 3HC4L 3SOTA 3WMSA 4A67A 4JFPB 4ECNA 4B95C 2VL4A 2AQTA 2MQ0A 1N6QH 3QUMA 4ZX4A 5IEHA 1LP9E 5IY5B 4HJ0C 5JW5A 1D5IL 3QORC 4NJ9L 3MV7A 1PD1A 2Z64C 1N59A 1GL4B 3HNVL 3WIAA 2PTTB 3O6MH 1OM3H 5ETUB 4P57B 1C8PA 1RZQA 1BAGA 4XPGH 2ARJA 5SX5H 4ANVA 5JW4M 4X4ZA 5DI8A 4N2DA 3O4LD 5BS0B 1KV3A 4UB0H 1NJ9B 4GP4B 1S7QB 4DVRH 1EJOH 2VABB 2P48B 2DAVA 3IM1A 5CZVH 4LCCC 5F1SA 4FYQA 1W2KT 5TE6H 3IDIA 1AZCA 1A5FL 1JGIA 4P3WA 3RDTD 4A2EA 4YK4B 1JVOA 1F5WA 4PJGF 5I30L 4PRHD 1RZGA 3UACA 3BGMA 2TAAA 3LRSB 4KQ4H 4NYLA 5I1LB 4GXUN 3Q6GH 3ZTNL 5TD4A 2IAMA 4TUKH 3K4DA 4Q0XH 3PQYD 1JZFA 4KI1A 3H0TB 5E9DB 1ZS2A 5D7LD 5DMKA 1A6ZA 3QEUB 4HHWA 2A0LD 4KNTA 1CN4A 3ZKNC 4DN3H 4WW2F 3L5XL 1JZ3A 2AXHA 2FD6L 4KI5F 1CZ8L 4FKKA 1RULH 4MXWL 5I17B 3D0VA 1D5ZB 3GK8L 3LN4B 4XAKE 4OJEH 4GUCA 3VI4F 3VWJD 4WW2B 1CK0L 4Y88A 4G6JL 4QGTA 3ZYZA 1WA1X 3VI4B 3SKJL 3FW6A 3VJ6B 3SY0A 5I8CB 3QRGL 4P9MH 5KVFL 4RWHA 3CZNA 1AY1L 5AVSB 1NC4A 1WHPA 3SDAD 3WYRA 4PRAA 4XWGL 1GPOH 3REVB 4CW1A 4H8WC 4WHYG 1V7NL 2AQQA 4WV1C 5FGCB 1ODAA 2AMGA 4IDLA 2DLFH 3EJRA 2XBTA 1KCSH 1X4ZA 1OTTD 4I2XA 1AQDA 1CF8H 3FHQA 3KBEA 3O45A 4NN6B 5KW9L 2R56H 1A14H 1OB0A 4X5XB 4KJWC 3ZYOA 3FFCA 4I18B 1HL4A 1RHFA 4HC1A 3F5WB 1HYSD 1SXSA 2GUOB 3V0JA 3O2VL 5CM1A 5E8NB 1QHQA 5KVGE 2QADD 2ZCKL 4G8EA 4LGSB 5GGRA 4NBXB 4Z77A 2FCBA 3RVWD 5DK2A 2DTML 2E75C 3AG3B 1OSEA 4LEXH 1DDTA 1IKNA 1DJGA 1BVKB 1KLUB 2J6WA 2R0LH 1MREL 2YN3A 3KAAA 4EZLA 4JM2F 4PJ7F 1YY9D 1RZPA 2Y2YA 3ABLB 3IWVA 2EEFA 2GY5A 1TITA 4L9LC 1OAYL 3MLYL 5PCYA 2Q76B 1S8DB 3T8MA 4PJ7B 5IB4B 1AQ8A 3T77B 4PJIF 1CR9L 5GS0C 2UXVA 4BFFA 4XVUC 1KCUL 4LL4A 1G9MC 5DEFA 3T6WA 1F13A 1M7UA 5A2AA 3EFOB 4PJIB 4TOYL 3SQOL 4TMPA 3RGHA 4OKVB 1C7SA 2XSKA 4LSTH 1YO4A 2OXGA 5GGSB 3I74A 4L5FH 4ZO7A 5D6CB 2WZ6A 3VI3A 2F7OA 5LXGH 3MCKA 1ID5I 4XVSH 2B9AA 3M6DA 1LO0H 2F58H 5I1HH 2FIRT 5C6WH 1DHKA 3TN0B 2FWUA 4L3CA 3OKDB 2YC1B 3VMNA 1KGCE 3HMWH 3D48R 1PG7H 1EO7A 4PPTA 4QRUA 4L0YA 3MV8E 4QYAA 4MYPA 4R97C 5C97A 3DRTB 1U3HB 1WDAA 3KHQA 5IB2A 3E1F1 1SYSA 5LN4A 4UBDC 3CN2A 2PWEA 2CR0A 2CXGA 1S7SB 2EYTB 3SD5A 3F62A 2I27N 3UP6A 1P1ZA 1M7DA 2J8HA 4NAMA 2OMTB 4E41E 3DV4A 3ARBA 3LNEA 4KOCA 2I60H 2EDTA 3CMOH 1E4WL 2NX5D 4BA0A 2WXOA 3NCMA 4ZUUB 1CLZH 3MREA 1NPJA 4JHBA 3DUHA 3RGVB 2JTDA 3HLKA 1C16B 4NSKA 1KTLA 1LQBC 3FBKA 4R4FH 1PZ5A 5H8DA 4XPFH 4JKKA 4MB5A 5T3XH 4YDLC 3TV3L 4IQHA 3K2KA 3U36A 1KJ3H 3AMLA 3ZLQC 3WFEL 3IK2A 3KLHD 3SOBH 3QNYB 2G5BB 3B4NA 2FT7A 1BJ8A 3PS6A 5IB3B 4S1SH 2JCCF 4FXKA 1P84J 3EUDA 3U7YH 4GFXA 5E1GA 1FGVL 1WG3A 3I6GB 1BWWA 4G6AC 1KJVB 5I8KH 5JQ6L 2BNQA 1JRHL 2OXHB 3OAUL 4PJAF 2FX9H 3UTTE 1JGEA 3QJHA 3QUXC 3TIEA 2VDPL 2V7HB 1HI6A 4A2FA 4PJAB 3ZXAC 4CKVX 1R3KA 5HYIA 4K7FB 3EW3B 1UATA 5DQDL 1BYPA 2X4PA 3B2MA 4W9JC 3HAEH 4O2CA 4R2GB 4D8PA 2B1OA 3IKCB 4GKNB 4JFEA 4LPTA 4HYTB 5F44A 5E6IA 1KDIA 1A3ZA 1ROCA 5DSCB 2DLEA 1BCIA 3FCTB 4FF9A 2AJZA 4M7LL 1MFCL 4HEMA 3WV0A 4UM9B 3QI9A 2D9CA 1BFOA 2R8SL 4M8VA 1I8AA 1QSFA 4AGOA 3GSOA 4HA1A 4BFKA 1H6FA 4UDTB 1WZAA 3I9IA 2GITA 4M6MH 1QLEL 2HG5A 3WNPA 5JQHC 4XMXA 3FHAA 5IP4A 1BZQK 3F00A 4NO3A 4LSUH 1FA4A 3GMQB 2OL3L 3NA9H 3DOSB 5DFWH 4G83A 3CBKB 1FLRH 3ZTDC 4MZ2A 1GC1H 1A6PA 3DX6B 4CC4C 5C6TL 1DUZA 4NZRH 1I9JL 4P57A 4M00A 5KVDE 2XN0A 3KYMA 3L4CA 2J56A 2XWBB 1U8CA 3JTTA 4TSBH 2ZE0A 5F7LB 5C0CE 3ZHKA 4TVPE 4PREA 1YA5A 3CCHB 1C5CH 2VABA 3FTGA 3SDDD 3F8UB 3V0VA 1CLYH 4R26L 4TNVK 1OTUC 1U42A 2CKBA 5L6YL 2HT4C 3D1MC 3KPSB 3EHBD 1EEZB 3GJEA 1L5GA 4ONOA 5HI3C 3NH7H 2EDOA 3MI6A 4FZ8L 4R0LB 4ANKA 3H0TA 3MBEB 1QTSA 1YPZB 1BBDH 3VSQA 5EC2B 3ULVH 3ARGA 3VQLA 4G6KH 5IJKA 5EORL 4GI6A 2XN9A 1BM3H 3PCYA 4G7QB 4WF7A 3RUGF 5FHAH 2V5RA 3EO9H 5GZOA 1DANU 2B1AH 5E2WH 4F7EB 2AXWA 5EEUA 3I9GL 1F4YL 1TJIH 4N2GA 4QMEA 3RUGB 4TNEA 2RCSH 4NZ8A 4E9XA 3B43A 1B90A 2R1XA 3GRGA 1LVEA 3ROOB 3QUHA 1HL9A 2RJMA 1FQ9C 3L4YA 3VNZA 1IE5A 1UFGA 4DGYL 1YYMH 1IAIH 5JO5B 1S7TB 4YR6A 2HRPH 4GW5A 2KLRA 5KBDA 4J6RH 4JQIL 3ARFD 4LPVA 3DX9B 1S9YB 2AQNA 1GAFH 1M7IA 4XMPL 3SQBA 3IETB 3GRWH 4BZ1H 1I3GH 2L4OA 3CHPA 5IB1B 1E30A 4ADIA 1CVSC 3QHZH 2I9TB 1KGCD 4XOAA 4B9JA 2XETA 4PJHF 5FA3B 3WUZA 4DEUA 3SDXE 2HH0L 1BVKA 2DM7A 3MV8D 2DIJA 2WLYA 5GS2D 3RFZB 4HJ0D 5F72S 2J73A 2EEXA 4QCIB 3QORD 4PJHB 2AI0L 3OAZK 4H7VA 1JHTB 1E43A 4DFIA 1BFSA 2XHNA 4J3SA 3ESNA 3L4ZA 4UZUA 4R4BA 2QFPA 3CD4A 4ZYKB 3ZK0A 2PCPB 4E41D 1RZFH 3KLQA 3MFFB 1NIFA 1F1GA 3MZTA 1TKWB 3GB7B 3N44F 3MNDA 1CQYA 4CU6A 3EYSL 2OK0H 4NQEA 1XGPA 4OZIE 2CSPA 5AD0A 1ZA3A 1AOHA 1MLCB 5JOFA 4NNPL 4XO5A 3N44B 3C60B 5GGSA 2YD3A 5GXBB 1IGMH 5D6CA 4GUQA 4YJZL 1T3FB 3OHXC 4LSQL 3EOAB 3QXAA 3WU1A 3DOIA 5CMAB 4P4KC 2X0WA 4X6DB 1F90L 2CCLA 2X4RB 1M57B 3ULSA 5LBSA 4QLWA 3IDMA 2F8XC 3M8OL 2CH8A 1FUNA 2ZUXA 3UTTD 3RNQA 5FYLL 3ZKND 1I7ZB 2XICA 5HYJA 1JPSH 1Y18B 1F4HA 3L7EA 2MSPA 2VLRE 1Q9WA 2OMVB 1HILA 2VIRB 1RJYB 4RRPG 4Z3IA 4AIEA 1AZNA 1XGRA 1J0HA 1Z5YD 3QJFB 2ZZUT 3OKOB 5F7WC 3X14B 3NQKA 3NJIA 1S7SA 2EYTA 2X4UA 4FCAA 3REWB 1A0QH 4YL4A 5DRXB 2H0PA 5F93C 4MNQA 5AW3B 3FN0L 4E5XA 5EC1A 4EI5B 2ZKHH 3STBA 3GSWA 3HZ3A 4U3SB 4P3DB 3TT3L 1TZIB 3L3IB 4HULB 5HYSG 3L3DA 5EBGA 1RIVH 2WZ0A 2VE6A 3NEEA 4ZMYA 4JFWA 3HAEB 1BREA 1RH8A 2WHVA 3PJLA 4I1NB 1EFXA 4KJWD 5DJ0A 4YHZL 1E28A 1ETB1 2I7OA 4F7MB 5K69A 2XY2A 3CPUA 2BOBB 5ID0A 1BQRA 3E2HC 3ARUA 4NKIL 4AM0Q 4DKDC 5IFHL 1IAIM 1MFEH 1B2WL 3K80A 1UD3A 1C7TA 3D39B 4KROB 6PCYA 3GDBA 1N12A 2DTSA 3HBZA 5KSUA 3PHOA 2PPDA 3MN8A 1UACL 3B9EA 2CHDA 3VMOA 1G43A 4ICWA 5HHOB 5FO9A 2PYFB 4F7KA 4WU5B 4Y4FC 1U8KB 1D7CA 4AWJC 4QTHA 1PLGL 2PP8A 4QHUA 5GS0D 2R1WB 5K9QG 4XVUD 1HSBB 1NC2D 2OP4H 4F9PC 4R6UA 4UV7H 3G5VA 5ESAB 5DDHB 5FGSA 4LPWA 2VM3A 3DPDA 3KPOB 3TP4A 1HQ4B 5DJDA 5JHBA 1SM3H 1Q0YL 5LUMA 4UUJB 1UEMA 4K8RH 1S9WB 1MEXL 3ZT6A 3AROA 1YUHA 4XXDB 4BDVB 4KITB 5D2NC 1KBBA 4M4RA 1J88A 4LRNH 4NEHB 1QNIA 3GIZL 3MROB 2EKJA 4AQ8A 3F7YB 3OR6B 3BWZA 4PBXA 4ZOCA 1JHLH 1TYRA 5DD0H 2YA2A 2Z34A 5JHLH 3LHAA 4V2BA 3T6VA 1NPUA 3WSQL 5BOJA 4WDIB 5ALCL 4MQ7A 3IFLH 2Y3AA 2BSBA 1B4JL 3VE0A 5CINL 4Y1SA 4KQ0A 4XWOC 1JNLH 3WNOA 3HE7C 3MCYA 1CF1A 5KTEH 1L9NA 2BK8A 4UBDD 3OPUA 2BP8A 4WIQA 2XI9A 2Z31A 1PDKB 1RU9H 2EO7A 3L6FA 4M61B 4YN3A 1MHCB 3VXSA 4UNTA 2X28A 2EDRA 1ZMYA 4TYUA 3QG6B 1MWAB 5C9JB 3IJHA 1QKZH 5IEKB 3GJFK 3W9DB 2YEQA 1CPUA 5KSBA 5A7BA 3QIWB 1YN6B 5D1QA 1X4XA 5KG9A 1EEZA 1OGAE 4QEGA 1ZANL 2FX8H 4D0DB 3MVSA 4YDJB 2ZOTA 4LBEA 4DEWA 1SXCA 1NIEA 4P2CG 3DC0A 3I3EA 1KGYE 4HBCH 5KYXB 2XV3A 3OZ9H 3KBPA 4H44C 1AYOA 4G6AD 1NFDE 4Z7WE 1NMCB 3G5YB 4TULL 5HHXH 2EXWC 4HPYL 4LKXB 1ANUA 2X2IA 3QUXD 1HE8A 4PGDB 4OLYH 5ACLA 3RDJA 1TQVA 1V5JA 1OQXA 2OLDA 1MCWW 2G75A 3P4LA 4K73A 1UURA 2YPKA 2GJZA 4MX7B 3QA3A 4GMSH 2ODIA 1T7WA 4LRIA 3WTSA 1K8IB 2C7FA 2LLLA 1KJ2L 2PF6A 3F7VB 4JG9A 4RQQA 3O4LB 4ZK8A 1B6UA 3DURB 3U2JA 4EUPA 4WFFE 2FUQA 3NJLA 5IQ7H 3I3BA 4C4KT 5B1JC 5MEQA 4PV8B 4R3SA 1PZSA 2NNCA 2E9WA 3DX9A 3KCWA 3MLZH 3RWFA 5CP3A 2WBXA 3O2WL 1NCOA 4F7PA 4PRHB 4CJ1A 1PLBA 3FRPB 5F7UA 4L8CA 4Z9KB 4KKPA 2I9TA 5DJYA 3PQYB 3OPZL 1DN0B 2K6YA 3AXLB 1INQA 1YAZA 1MFBL 3UAFA 2V9UA 5FA3A 4DAGH 1A8ZA 1JS4A 4XVOA 3PDGA 3VFTB 3VXME 1EHLH 2VLRD 4DGUA 5B38A 3WENA 4QCIA 2CXKA 1L0PA 5D70H 4PJCA 3GF8A 1JHTA 1F11B 3PU7A 1NMBL 4DP6X 3HUJE 4P9HL 1T1ZA 4K2UH 2YPVH 2R39A 1R9FA 3GMLA 2B16A 1EANA 1YEIH 1UGNA 4NO0B 5IW1B 1E4XL 1NAKL 1OAJA 4NRXA 1TQCB 3GNML 1MLCA 3D9AH 4YZFF 1OTUD 2A77L 3C60A 2FYVA 2B8OT 1ET5A 1I9RH 3QNZA 5DD1L 2HT4D 3GMPA 3T6ZA 3HS9A 3ESPA 1ZT7B 2Q7AA 4KH9A 4LARL 5FM5M 2OMXB 2Y25A 2VM4A 5CMAA 3LHPL 2N7SA 4HZAA 4Q2ZB 4AIOA 5HI3D 3UXFA 1TIUA 2ZP0T 4XO4A 5IV2A 1FCGA 1ZXKA 4Y7MA 3QYCA 3ZIMA 4TPRL 2QADB 4D9QE 2G0LA 4JPIB 4XCCL 5E0FA 4YNYA 4AT6B 1Y18A 1X5AA 3MFGB 1T5WB 5FYJE 5EF3A 2OMVA 2Q6WA 4Y5VB 4XCEB 4XP4L 1QHOA 4YC2B 1T22A 4PJDF 3NA4A 2MQ3A 3QJFA 4UAHA 2OMUB 2VXSL 5JLZB 2XV6B 2N7AA 4QTIH 3WHXB 2PW1A 4Y4KC 4H26A 3BUPA 4AXWA 1KIPA 4PJDB 1UA6H 3FTZA 4PWFA 4M03A 1SVCP 2BINA 1BOGB 3DVNA 1VFUA 2HFEA 3JV6B 2EACA 4XOEA 2EXTA 2HLFC 4JRLA 2WZ5A 4OIIL 1JHKL 3TBBA 4QRBA 5FYLE 3UYOD 2ZAGA 1TZIA 3GXTA 5DD5L 4AZUA 2AV1A 2Y7NA 3UGUA 4FAAB 1IBHA 3DX1A 1AHMA 4KZDH 3KLAB 3CLEL 4MAYA 4FQ1H 3UH8A 3AT0A 4ZS7H 4X6CF 2KQMA 1A9BA 2NY0C 4JE0A 5EULV 2HUEA 3P0VH 5E08L 1ACCA 1BZ7B 1EGJL 2CGYA 4B50A 3MTXA 3U48A 2WV3A 3K46A 4HIIB 5B22A 1ZLWK 2A5UA 1X3DA 5IWLA 1GW6A 1DBML 3HG1B 3QYMA 2XOTA 1MCKA 1CI5A 1SJVA 2ETWA 3TBSA 4AIZB 2R23A 1SN5A 3OKLB 2ZX7A 5FYKH 2R1WA 3L5IA 2FGWH 2XDHA 1WS8A 4ZOEA 2X9YA 1YN7B 2KUTA 4LE8A 5IVXE 1AR1B 5IMOB 4RWYH 2FZ3A 1RZJC 3IE4A 5DCCA 3MBWA 4WI2A 3KPOA 1YEHH 3GMOB 4JQXC 1HQ4A 2ICWJ 1VFAB 5GISH 3TASA 1FE8L 1O6SB 4C57C 1S9WA 3L3HA 4GXVH 2J88L 1OO2A 3BVVA 1QPPA 4DCQB 2GK0B 3FQNA 3QWNA 4XXWA 4P9HC 2G5UA 1ORQB 1J1OH 1Q94B 5AW1B 5T1KA 2FWSA 2OSLB 2NRDA 4P4KD 1FG9C 3QT2A 5DHVB 5DTFA 4ALAL 2YUXA 2GC7C 1M2VA 1LP9F 1QAWA 4DZBB 3X12B 4ZMTA 3MBXL 1QEXA 2F7QA 2LVCA 4IBSA 1P7KA 1A6UH 1UG9A 1QP1A 4WI4A 3GLEA 1XGYH 3BWUC 1T20B 3FB7B 1OLZA 1QBML 2VLKA 4QXTB 2N1TE 2HKHH 3CVCA 4HCIA 3MXVL 5L9DL 4OCXL 3WIHA 2WMPA 5TH2B 1MHCA 3FU5A 2PTVA 2N56A 4DUVA 3FFOA 2FATH 5ICXB 4WFFD 2LTQB 4EIGB 5B7FA 3KLSA 3QG6A 4A68A 2WO4A 3KYOB 4NQQA 1SF5A 1JGUL 3VCLB 4PWEA 1QATA 4WCYL 1QO3B 1G9NL 1BYOA 3PRZA 3K8MA 2C3GA 4NXKA 3NSXA 3SKNB 4WI0A 1ACYL 1E27B 3I50H 5E2JA 3UIYA 4NNYB 2L04A 4PTUA 4HOZA 1GGIH 3L1GA 4TLTA 1YNLH 1FZMB 3KXFB 3IGAA 4YDVA 3W38A 2ERJC 2Z8WC 1DJHA 4A6YL 1DLHB 2Q86B 1FNSH 3C2AH 3VXMD 5I76B 2DBLL 1NMAH 1QRNE 4L9DA 3BKMH 3UTSE 4HIHA 3S8WA 1LO4L 3G9VA 4LEOB 2FX7H 4L2YA 1JZIA 5LNDA 4JFXA 2YIHA 3GRWA 5I1CL 5CFHA 3MUUA 4U1SB 4Y4FD 1A7QL 4MX7A 3OB0K 4B9CA 1NBYA 1FPTL 5CHNB 4AZ8A 1BA9A 3QO0B 4XP9L 2MPVA 3DURA 3WOVA 2DQEL 5H4ZA 1K8DB 4BSVB 2ZXQA 4NQSA 4HU8A 1S3KL 2C8NA 3LQMA 4XAWH 3SDDB 5F0LB 2CHNA 1TFPA 3ARSA 3ZUCA 5DHMC 5T3ZH 2A6KA 4P59L 3C2SA 4FTVB 5INDB 3OKKA 5JNYB 1SFHA 2NR6A 2VW4A 4BE6A 1ZHBA 3LD8C 3BH8A 5EF0A 3G08B 1KELH 3BUQA 4IRSA 1UT2A 1XH3B 4F15C 4JO5A 1OD9A 4D9QD 4OZHB 4D0CB 2BVPA 4LSVL 1VEOA 3C8HA 5FYJD 2AEOA 4HXBL 4YBQC 3AC0A 1F11A 3MGAA 2JI3A 4XWOD 3T3PF 4KDWA 3HE7D 5EZIL 4N4YB 4PGJA 4LVEA 5EDSA 3M7FB 3VYNA 2F68X 1OT2A 2A74C 5I28A 2IDUA 1NL0L 3HI6L 3T3PB 5HDBE 4KK8C 1IJNA 1TSRA 3BGFB 4M43L 4BZYA 4WJG3 1Z9SA 1R3LA 2DLTA 5FYLD 1YYLH 2WBWB 4HV8B 4JZNB 4ZX6A 2VDMH 4L3AA 4LHUA 5D72H 2FEDD 2VL5B 3QIUC 5EBLB 1MJJA 4ZMQA 3GLZA 3VXUE 4M7LT 4WEBL 4BFOA 4FQIL 1RJZA 4U3XA 3FUDA 4DN4L 2JQAA 3EYQC 3P0GB 5EO1B 2PXYA 2D3LA 3D12B 5HHVL 1IL1B 4P0DA 5GGVY 3S5LB 3NEXA 3JV5A 1AHWB 2KC0A 1T2XA 2C1PA 3CZLA 1SEQL 1UYWH 5I74C 3IDXL 3I9AA 1T5WA 1K5NA 1IV8A 1JF1B 3MV8B 3QZMA 2EXWD 2XG5A 4K7PL 2O72A 4MRCA 4TNFA 2DD8H 4X9IA 4J28A 2KH2B 5EPMA 2Q7YA 1WD8A 2L0DA 1EERB 1AP2B 1MXDA 2DWSA 3FU8A 5H37H 3WHE1 2I7SA 2PP9A 1Z3RA 4J1UA 2XKSA 1CXHA 5I8EA 5I6PA 2R0ZL 1ZTXH 4E41B 1UB5A 2LLNA 4WO4B 5B39A 1XL4A 3MLVH 3OMAB 5FO8B 5KJ4A 4Y9EA 1E4KA 1KT2B 1SOQA 4P23C 4YX2H 4ZFFA 3CU1A 4RA3A 4BH7A 3GTTA 3IN2A 1KPRA 1UUNA 1SHWA 4HBQA 3SYOA 3E8UH 1QSEA 1PU0A 5GS1A 3VGBA 3DX0A 2H1LM 5J6GA 2R0WL 2VZUA 2Z8RA 2IDQA 4H20H 3O3EA 3ECBB 4CN1A 3KLAA 1DBJL 2A3TA 4GG8A 4NS0A 2GSIA 3CFDB 3WBDA 2DQJH 3CSBA 4HDIB 4HIXL 2AAVA 4KK9C 4UCFA 3JWNG 3WKNA 1RQ5A 1T04A 2C3HA 5C0EA 5HYEA 3I85A 4WEUD 1G1CA 1KNOA 2NY5L 1DVXA 2ITEA 5IQ9B 3QEHA 2NY2B 3IS0X 2ZAHA 3VG0L 3DKHA 4GEIA 3MGOB 3MRIA 2EKSA 4GOSA 5GIRA 5C2BH 1NIAA 3RQ3A 2J6EL 3HG1A 4K5PA 1WSST 3ASOB 2CIKB 3U25A 3GBML 1VFMA 4R84A 3OKLA 1EXUB 1OIOA 4NX0A 5JHLA 2EDQA 4PWIA 1S7WB 3QB7C 4G6ML 1W72L 2GJ6B 3GMRB 5FO2A 4HIEB 1GOGA 2NTFB 1RP9A 1TZAA 3DHJA 1VFAA 3FH7A 3LMJL 4G7SB 4JFZL 1RPQA 3HKFA 4I13B 4U2ZA 5ESVA 4M5YH 3QBTB 4HSAC 1DUYA 4XO3A 3B8SA 4FCHA 4NRYB 1C08A 1F3JA 5IESH 4JPKL 3S3SA 3MQIA 4N2KA 4XNUL 4XB3A 2G60L 3BQUC 1TYJA 3KJ6L 4ZAKC 3T3MF 1CIUA 4Z3JA 2R2CA 1TTCA 3MLRH 3S97C 2O5ZL 4J27A 1QRND 3HNTH 5T1MB 3T0EC 2FJUB 4CSZA 1J05A 4ZTOL 2UY6A 4LPYA 3UTSD 4FZEL 3T3MB 2K9FB 2L7UA 1T20A 4KH2A 1W8EA 4PJXA 4U7SA 1AIFA 3VFUB 4OQTH 5C8JB 4M3KB 5BVPH 1XXDC 4X5QA 4X42A 2FAUA 3LEXA 4L9LB 4L1SA 4Q6KA 4AUJA 4Y4KD 1ZSDA 4WTQA 1AANA 5C0CB 5ITBL 1XR8A 3VGGA 2DJUA 3P9LA 2VSMB 1UD8A 1QLFA 3H7BA 1NC2B 3VH8A 2HLFD 5ANME 3A6OA 2BNRB 3ILDA 3DROA 4IKIA 5L4FA 1TQBB 5CGBA 4X7SH 2EICA 4F37F 4PJFF 1FZJB 3BAYA 5EZJA 4JBSA 1PX3A 4LCUB 5JMOC 3ZDXE 2QQNH 5J11B 2YJQA 2N3JA 3J7HA 3NZ8B 4N3UA 4PJFB 1KSRA 3K2UH 4X8JB 1K9TA 2WBJA 1JPFA 2WXRA 2D0GA 2OTUA 1Q0XL 5D6DC 4JNXA 2UY7B 4WJKB 3BKJL 4WFEE 5I76A 2NY0D 4QHMA 4BSWB 4URKA 4HOXA 3S36H 4JAMB 3ZKMD 3Q05A 1X7QB 4LEOA 5D4QA 3WTTA 3NACL 2NNRA 1CL7L 3MRBB 4LVOC 4MD0A 5FUZL 2CBPA 5DRZB 1RIHL 3C9NB 4RZKA 4M7ZB 3MCLH 3TPUA 1A7PH 3DX7B 7FABL 1DLFL 3ZTCC 1K8DA 3MRJA 4R96B 4MJ5B 3NYKA 3ZR5A 4A2HA 2IPUK 1BQSA 2MMXA 4KHTH 2NY5C 4LLUB 4HJGA 3KS0J 1U6AL 5EOCL 3T0WA 3GBNH 3NMEA 4K5NA 1UXSB 1HEJC 1CE1H 1KTRL 3VXUD 4FTVA 1WFOA 1ZPUA 2OJZL 3EOBB 3ZHLA 1PNDA 2QV4A 4QUOA 3JWDC 2CGRL 4Z0BH 1KTCA 1ZHKA 1N64L 4JFSA 1F56A 5IQMA 3NZHH 1CYXA 3BVNA 3L95B 3QJXA 4OZHA 2P8PA 3UAJA 1NFAA 4PGEB 2KHAA 2Z91A 5EHFA 1ORSA 4YE4L 5F7FA 5DD3H 3DX2A 3FN3A 2VDMB 4FFZL 2VQ4A 2IDTA 1BZEA 3RB7A 1USZA 1MI5A 2ICEC 3NFPB 1QFOA 4HT1H 4U1IB 5G4NA 1NGXB 4K94H 5CSGA 5CZXC 5INCA 4HAGA 5DUMH 3QZNA 4N8UA 3UL4A 5EU5A 1AXTL 4OZIF 1K3IA 4JLRA 4OZFG 4HF5L 4GXUM 2A6DB 3NOIA 1F8TH 4EZKA 4OZIB 3GM0A 3OF6D 2R1YA 2RALA 2E6QA 4IOFC 1I8MA 3TTYA 3W57A 2BSED 3WKPA 3KGTA 2ATAA 5JR1H 1GGCL 4GBXC 5EO1A 5DURD 4L1HA 3MRCA 4ERSL 4HKJA 3D52A 1DCEA 3TXAA 1E65A 4I89A 1E6JH 3AMKA 4Q7DA 2XWRA 1JCVA 2PR4L 3FT0A 2N59A 3MJGX 3T0EE 4N87A 3NCJL 3SYQA 1URIA 2VLRB 1RUPH 4JZJA 1CBVH 1IIIA 2Y5TB 3VWKC 3ESMA 4QHPA 2FQDA 4C58B 4NENA 4X5LA 3ATFA 4K3DH 1ZEAL 5GGQH 4EE2A 2XPZA 4JRYB 3Q2CA 3BPOC 2WUBH 4N68A 4XP1H 2EDJA 3BAEH 2JJVA 4HX1B 2DYPA 1CG9B 2L3BA 1NOFA 4HPOH 5DFVD 4AL8L 2B1HL 4ENEC 4FQ2L 2WSPA 3JWNC 5FKPB 4A2LA 1UJ3B 4N90E 2Q8BH 4OTXH 2MRYA 1L7TL 1V3KA 1X5HA 8FABB 4P07A 4HDIA 3LTVA 4CBZA 4GRMA 3K2MC 3QFJE 3HHSA 3KWTA 5C07E 3MOAH 5GGTL 3FH5A 2BWQA 1M56B 5ECJE 1NUGA 5T5FH 1A4BA 4IDJH 3V6OC 5LKNA 3DUUA 3GSUB 4NQCE 4PCTA 2HA1A 1OW0C 4YBQD 3WXWL 4BQBA 2BNUB 1VEPA 4OJCA 3JWOL 3EBGA 2E8ZA 3GMNB 4M3JA 1GHFL 2A83B 4ABUA 4XNYH 2RD0A 1RZIA 3SGJA 4MDRA 2H32A 2L8AA 2OR9H 4KX8A 4QRSB 1NCHA 4QAWA 1E50A 4KDTC 2D4DA 2XYCA 3FT9A 2BPBA 4ZW3A 2ESVD 4KK8D 4I77L 3BQVA 3UDWC 1Z66A 4DP2X 2W0FB 2QV2A 2PN5A 2ZPKH 4KKAC 1K6QL 1JJUA 2W8CA 2JIXB 2C5DC 3QRLA 5F7EH 3NJKA 2V7NB 4XPHL 4A2MA 4GMTL 3IJEB 3WNMA 3P3TA 3QIUD 3IBEA 1XBRA 4QPEA 1DVZA 2GBVA 1IZJA 2ZOKB 1ZE3C 1FP5A 3CZKA 4HW6A 1T0OA 4LB8A 3VD3A 1MNUH 1G7HA 2IBGA 5G5DA 4EPSA 2F7PA 4QXGH 4WFED 3WL9B 3SPVB 3D18A 3WJJA 4PQXA 4NJAL 4DP9X 4PWJA 3PGDB 1SLUA 2OSYA 4MDJA 5KVEL 4POUB 5C8JA 1TJGH 3LEVH 4WK4B 5IJVB 3CVHL 4RGOH 5FK9B 3UBXG 2HX7A 3FCSB 3P3UA 4Y16A 3ZQ9A 5B8CC 3H3KA 3CE1A 3M88A 3DHPA 1GJIA 3OKNB 2HAZA 5FOJA 2P42B 1CFBA 3GZOA 2X12A 3RLSA 4LLDB 2X3AA 3L1OL 2YKLH 1A3RH 1AS7A 4BEIA 5LDSA 5LN8A 3WFZA 1WE5A 3C87A 1NM4A 3ZL1A 2BNRA 1QWUA 2WYHA 2MH4A 3A67L 4U1HB 2CRYA 1RUKH 4HG4K 3EGDA 3V52L 5KSAB 2R29A 3TWCL 1OGAB 1FZJA 3GS4A 3VQ2C 3TJHC 1HH6B 3A3YB 1WCQA 4WWID 3PDOB 2HSIA 3ZX1A 1JNNL 1GGTA 3X1FA 1DSFH 3OHXB 4G7YH 2O6FA 2B0SL 4Q6YA 1NFDF 3ZSTA 2VDLH 3ZN6A 1E5UI 3H53A 4FQHA 2UY7A 4KK9D 2XN2A 3AM8C 3C6EA 1HZHH 2OJEA 3C5ZC 4LIQE 5I19L 1XCQB 1NFDB 5K39A 1JPTL 1A3LH 5BUPA 4OI8A 2F19H 4PS4L 5F89A 3BDBA 3NRQA 4IJ3C 4BK5A 2ADYA 4Z3GA 3V95A 2B15A 4KVNH 5EU6D 3WNLA 4AL8C 2AW2A 1KTDA 1OCWH 1RZ8B 5A16B 4D7BA 4Y0GA 2AXJA 2NW3A 3OG4B 3WJMB 2IANE 1NBVH 4MNHB 4M02A 4PBVC 1VGKB 4DGVL 3OJVC 1RERA 3TA3A 4JL1A 4WUUA 4EMZA 2OFQA 4NKDB 3WDHA 2NQDA 3JWOC 4OLWH 3EOBA 3G5ZB 1MPAH 3FMGH 4LMQE 1Z5LB 3CIQA 4TUOB 1BMWA 3JWNE 3EOTH 2XX1A 3RWDA 5DC4B 3GMMB 1FF5A 4CADA 1UCBL 2CLZB 4ZAKD 4AV5A 1VGEL 1OV8A 3IE9A 1XT5A 1XF5B 4OM0H 4ES8A 2C4FU 3T0ED 3AG1B 4TQHA 3HUJF 3VO0A 1P7QA 3GEFA 3V6OE 2ZX9A 3TF7C 2IPUG 2H0FA 2Q2LA 5LNGA 4FL4B 3GO1L 4APQB 3QK0A 4N0FB 4Z7UA 3TFKD 4HUVA 1N8ZB 4L8SB 4HQQH 4N0UE 3LH2L 4MCNA 1TT6A 1UZ6E 2BP0B 3RWHB 2OTWB 4XB7A 1OP5H 3W0WE 2O5YL 1INEL 1YMME 3CTTA 1XZ0A 1A6VL 4AQAA 4EDWH 1KF9B 3OKMA 2EEAA 4OSUH 1P4LB 3FONA 4RISL 5LGHH 4FOMA 2BRRL 1ETZA 2NW2B 5SWSA 1SVZA 1I1FA 1IGIL 4NKMA 3MRGA 4DNLA 3EFDH 2AV7A 2QVMA 2WYTA 4EBQL 1M1XA 5H37A 4FNSA 1H8LA 2XWJA 3KWUA 4QLRA 3BVDB 1T6WA 5AOLA 3MGTB 3QXUA 3QHFL 5C07D 4XPBL 3LPPA 4NPKA 3SBQA 4FE9A 4NRZA 4LLVA 3BP6B 1RI8A 2E4TA 4NQCD 3SGEH 1BXVA 5AKSA 5EUOE 1WVZA 5E8EB 4U7MA 1ASPA 4AM0B 5I1IH 1A4KA 3VRJA 3AS2A 2WNXA 1OQOA 5JW3H 4AQEA 1UOKA 3D07A 4PP1D 2V6HA 3HE7B 4QRPE 1FIEA 5EIIG 4M29A 1AGFB 1AS8A 1FCCA 4HXAH 1LDPH 4M7KL 2W9EL 4FKHA 3N04A 2NLJB 3INOA 4HX1A 3B2VH 1R3HB 3OJ2C 3EOYG 4NM8L 5F6HJ 3L3KB 4GJTB 4AYSA 1SY6H 5C71A 3GGWA 2ZUQC 2CE6A 5DD6B 3SODB 1SBBA 3D08A 2OZ4H 1OZTG 4XPTH 4GT0A 4LESA 2A1WH 3L7FB 5TDPB 4FADA 4IOSD 4HKXB 3BO8B 3HEIB 3J27A 4Z3HA 2C1OB 3SO3B 5CD3A 3OB8A 2VCOA 2KYIA 4XH2A 3JV4B 4G80B 3WIHL 3ZMRA 5AENA 5C6PB 1AOZA 5A2KH 1VZHA 2WW8A 1F2XK 2BNUA 3BE1H 2IADB 3Q5OA 4YUEL 4QJ5B 5C86A 1A7NH 2BLFA 1YEFL 1XGTB 1MHHB 4G8FA 3BIKB 3QDJE 1T83A 1B2YA 4UT9L 5IVXF 2P5EE 5DJ2B 5CZXD 1NLBH 1JWMB 2Z7UA 4L8DA 2VJXA 5FKAB 4LSPH 3VM5A 2FJFA 5IVXB 4FHJA 2V37A 3VFGL 1PZBA 3JZYA 4LOFA 2YFNA 3BXNA 1ZCRA 3HRPA 2DMKA 1KXVC 2VLJA 1ZLUK 2MCMA 1P4IL 2ZP9A 2I26N 3SE8H 4FFWC 1D5BB 2ADIB 2CCVA 3BWAA 2MQCA 3C5JA 4IOFD 1E9PA 3N1QC 2EVGA 3LVTA 3NCEB 1ITBB 2APVA 4XI5C 1JPGB 2XWXA 2WD0A 1EPFA 1WZMA 4ORGA 1F18A 4GBXD 4Q14A 1TCRB 4EN3B 4IGBA 2G2RB 1T1XB 1T4KA 4JFDE 1A1OA 2TSAA 4O02H 4KO7A 1T0MB 1U36A 3W2DL 1FVEA 1KY7A 3D51A 3II2A 4QRQA 3V6BR 4LAJH 2CDFA 5DK3A 2F5AL 1WBYA 4LZKA 4PJEA 4KBPA 1KDJA 1OP3K 2GBAA 1S9KC 2X4SB 1MW3A 3FCSA 3VWKD 2H9GB 3QJSB 3V0WH 4W9IC 1EHAA 1WK0A 1ZY9A 2DM2A 2A4CA 4WENB 5JHAA 4B0MM 2D7TL 4KVPA 3WGVB 2IAND 2NUPA 2VDLB 4CDHA 3EYFA 2DS4A 1FSKB 3QIBB 4XBEL 4RZCB 5I1DB 4G9FE 2G4EA 4AYMC 4O2FB 3NJJA 3QDGA 4W9EC 1CGSH 1AKJA 2ENSA 4JVWA 4G42A 1A1MA 3KM1A 4HWBA 1DBBH 4M5TA 4YBLC 1HH6A 4ENED 5KVEE 2KLSA 4NOBA 1I75A 5E2VL 3QO1A 3TIDB 5AVXB 3OR7B 4YHOL 2D7NA 3PGFL 1Z5HA 3UTZB 1XCQA 3BAJA 2AEIT 3D2UB 2KKQA 2CALA 3VX0A 4AEIH 2PO6A 3EIFA 3HA0A 1WGVA 2CJ3A 5LJYH 4X5RA 2BVOB 4B3EA 4AGNA 2A73A 3PDDA 4KRPC 5JYMA 1Z9OA 5E2UH 1UXWB 1UVQB 1P5UC 1YMMD 2DJ4A 4PJGA 1PY0A 3V5DB 2A9AA 4UANA 2X09A 3L17A 4PRPA 2ZYRA 3DO4A 3O8XA 4XBGB 3N3EA 4Y4KB 4GP8B 2XWCA 4MNHA 1VGKA 5FWQA 2YAEA 2QKIC 2E27L 2BY1A 1UWXH 1GR7A 5AQ0A 1CUOA 5T1DH 3NCBB 3BT2L 2CPCA 4X7TB 1J5DA 3G5ZA 4TUOA 3LCYA 1CLOL 5BV7L 2DQCH 4OVVA 1INDL 1G7QA 2D4FA 3DMMA 4L05A 5DRNA 2FBJL 5TF1L 3IU3B 4Y4HC 3PYCA 3FAWA 2DOCA 1XF5A 3RE0A 3UJJL 3IU4H 1N7ML 4F33B 3A5VA 2ZSWB 3K6SB 1JFHA 1YNKL 5CZKA 3NJFA 2WVUA 1A21A 2DQUH 2EH7H 3TO4B 5AAWA 4NQDE 1F6FB 1N8ZA 1I1AC 5D8JL 1BD2B 1CI3M 4JY5H 4MXQD 4L48A 2YGNA 5HDBF 3O2DL 4HZLB 4QRPD 3RILA 5J5EA 3G5WA 4K7PX 3RL1A 3WO4B 2I9LB 5CSZB 4EEEA 4MLIA 5C7XL 5HDBB 1RIUH 4G43A 3VSVA 1AJ7L 3BPLC 1R19A 5DC0A 2Y5EA 2X9ZA 3FSAA 1FO0B 1WCBA 3ARQA 1LL1A 4MHHG 3MNWB 4JN1L 2J72A 4B27A 1DO6A 1RSFA 4JCMA 4CN4A 3VXUB 2EC9U 4JM2A 3TJHD 3DK2A 5CP7B 2R69H 3V5KB 4EVNA 1K85A 1VHPA 4L3EB 1KBPA 1OB1B 5DHEA 2EIZA 4U1MA 4DQOL 4O51B 1MCLA 3U6RA 1OP4A 4LF3B 5K93A 1V3MA 3BWUF 3CZUB 3C5ZD 3FB5A 4M93C 2QELA 4BK4A 1AYRA 5D1XB 4WI7A 1E3ZA 4UTBH 1I7UB 3BN3B 3Q2WA 1I1YB 4YHNA 3QDJD 4MMXA 4A7VA 2P5ED 4MCZB 4ABVA 4P2QE 3KBHE 2R2HB 1YY8B 3S9DB 2OV0A 4UAOC 4E9RA 5I1AB 4PJ9D 1YJDC 1IGJB 1W80A 1R3HA 4GT7A 1LO2H 3WNKA 1JGDA 1QD0A 3LZQA 4FQQA 1E5BA 1HX0A 43C9B 5IR1A 5A2BA 4R90H 4UQCA 2AJYH 2JLPA 3GKWH 5C08A 3S5ZA 2FSEB 1ZVYA 2RB8A 1TTGA 4LVHC 5TE4H 2QSTA 4X50A 4W9GC 2O6DA 2E9JA 2ZX6A 4ZNCD 4TNVF 2GYSA 4HKXA 3V4UH 5DS2A 5DURB 4B9PA 5C2UB 3R06B 1AFVL 3UAAA 4OF0A 4Y2OA 4G80A 3KYNA 3FQUA 5KOMC 3B7SA 4OZGE 5MHSE 3H9SB 4JY6B 2IADA 4NZFA 1LMKA 5LXVA 4HG4J 5F7MC 5I18H 1IAOB 2G30A 1DFBL 2ZKWA 3FO9A 4HH9A 1JNJA 3MO1A 2ENPA 5CLWA 4J7RA 5BV7C 4J39A 3LZFH 4K5OA 4ZSOE 4BIKA 4NZTL 3GSQA 1O7SA 4PB0H 4G7VL 1RJCA 1NAML 2X40A 2V5MA 4W4OA 1EVTC 2D31B 4G9FD 4YGVB 2IXQB 1IE4A 1T89A 2QVFB 5AVRB 2OM5A 3B6SA 4MD5B 5JIQA 5SX4I 3CX2A 1OGSA 1UM6L 1DJXA 1IM3D 2WLMA 2ICWB 1CU4H 1XIWA 3TURA 4OJFL 5B1AB 5KAQG 3BHBA 1FVDB 5I1EL 3MLUH 3BWSA 4K9EH 2CO6B 2EIBA 5DMYA 1KEMH 3GIVA 1CXLA 4NCC1 5DJXA 1MUJB 1T1XA 5T1JA 1ZIAA 4JFYA 4N2LA 3WFHB 2VN7A 3ARDA 4IJTA 4I0PA 2GHZA 5KN5A 4AKOA 2ED9A 5JPMA 2V9RA 5IFAL 1VACA 4Y9GA 3DI3B 4GRLC 4IMLA 2HRLA 2JNZA 3L9YA 5IB5B 4PRNB 4X7EC 4AC4A 5KYNA 4GRWH 3U9WA 3FRUB 1L4IA 4TQ8A 3SKUD 1O0VA 4NQXA 4W9LC 2X4TB 1BQHA 4X4KA 2EECA 3DHUA 3GXPA 4GSUA 3FQWB 1VZGA 3JT0A 1IM9B 3FDWA 2A74B 3H7LA 4M9OA 1ECZA 4ZOBA 5IBLC 3VRIA 3AS1A 1F45A 3SDYH 3BMWA 4AYFB 1MOEA 2WYZA 5CJBA 2RFXB 3HZYA 3ZDXF 4Q74A 4NIKB 4PV9A 3SDCC 4FNTA 3D85B 1SN2A 4I3SH 1A6TA 3QGVA 4FEIA 3SE4C 4AYID 3QIUB 4JDVB 4KUCD 2OX5B 3LKPA 2JELL 3LB6C 5ESQB 3KPNB 2VQTA 1AC6A 3P0YH 3UTZA 1GZQA 2K8QA 2WINA 1JFQH 4U1LB 3DO3A 5L2KA 2UZYB 3S4SA 4LCWA 4KNUA 2YPLD 1OK8A 2CD0A 4NQDD 4MB4A 1U8MA 4LLYA 1XCTB 4PTTB 2ZWNA 4TL5A 3PWPA 3HB3B 2HKAA 4NLHA 5EF2A 4LAQH 1VEMA 2RACA 2K8MA 1GKOA 2CMRL 2EDXA 3VTMA 3DO7A 4BRJA 1M7XA 2QJDA 3DX8B 3ABGA 2J71A 2IQ9H 4R5XA 4S2SA 5AWNH 5EO0B 3G5XA 3DHMA 2X44D 4P23B 2C9QA 3II3A 4F8TA 1I1CA 4FFWD 5L7XH 2OW7A 2AKRA 5FB8B 1BIHA 3GSXA 4QOKE 2ZUYA 4CILA 4XI5D 3IU3A 4GSRA 4JMXA 5EN2A 4AEHL 1N0XL 3GTNA 5JPNC 4GSQA 1M9SA 4WRLA 1NTDA 4XMKL 5GGRY 1IFGA 2Z0BA 3L81A 1K3ZA 2G3MA 4F33A 3M1CA 2WQWA 2OZNA 4Z5RB 1KXTB 2BY2A 4JN2A 3X13B 4Q6IC 1KBGH 1UT1A 3TO4A 1U58A 3CDZB 4GKZA 2N0MA 2ZXDA 1UOWA 4P2QD 1I8KB 4CVZB 4GUPB 3KPMB 1EBPA 2P5WE 3HVDA 1HAWA 4S11A 2EUXA 1M2OA 2ZKXA 1QHPA 1QNZL 3MJ9L 2VERN 3AITA 4UV4L 1XR9B 1HHJB 2GI0A 4MNGA 1EX0A 5D7JC 4GY4A 4Z3EA 4KQ3L 4K71B 5BRZA 2DF3A 2NY6C 4KPHH 3KYKH 3OKEA 2BMKB 1EEYA 5D7SL 3SSGA 4C83A 4FYTA 1A7OL 5D7IE 4NHUA 5CP7A 2BZ7A 3MOBH 1MSPA 3FULA 1IB5A 1N70A 3EG9B 3KH3A 3MV9E 4HCRA 4FQCH 3BQUB 3W1ZA 5F7AA 4ZAKB 5MHSD 3DV6B 4TLSA 3ASWA 3CSTA 3GXDA 5D1XA 4NN7B 3LKSB 4LQFH 3D3VE 4XMLL 1KN4H 1SY6A 4KKLC 1AG6A 1I3VA 3MRMB 1I1YA 1M6UA 3VXPB 5J7CC 1WAAA 1KIRB 2FWOA 1UOVA 4GSDL 3CZGA 5ERWA 2QDVA 4KRPD 4AJWA 2R2HA 1YY8A 4MA7L 2OMZB 3BMVA 5HY9A 1T0NA 5C0JB 4R7DA 3S3BB 4JREB 3FQRA 4Q97A 3JT2A 4XCFH 1T03H 2GAZB 2Y7MA 2ZJSL 1KIUA 5E5LA 3RVVC 2DQTL 2NSXA 3M1OA 4HK0B 3VMPA 4FFYH 3NIFB 3EH1A 2DQMA 1ZDSA 3FUFA 3K72B 1MRCL 4PAZA 3QEQD 1Q72L 4HS3A 1TVHB 4P8QA 3KDMB 2RGSA 3DX4A 1MQKH 3WY4A 1DVFA 4NT6A 1CDUA 2QPDB 3SE9L 3QFJB 1O6TA 4GAYA 3HBGA 1RLBA 1ZVSB 4Y4HD 5C07B 4HCFA 4P5TC 3LN9A 3Q9QA 4PY7B 3WFDH 3JBG7 3FCGA 3H9SA 1XEDA 3RTLA 3S6CA 4GKSB 4ZFOL 4QT5A 5MENA 3W39B 2COQA 3LNHA 3SPHA 2I69A 3F58H 3ZGHA 4U6XB 4Y2DC 3V5HB 5GS2H 3GBDA 2FB4H 1NUFA 2XA8H 3O3DA 3QUKB 4A2GA 1N5YH 3HHRB 3LZPA 1I1AD 1P9MC 3QULA 4UT6L 4J3VA 4MYWB 3L13A 1DJIA 1Q9LB 2A99A 4IHOB 3LX9A 1OSPL 4LVOB 4U1JA 4Z7OE 5JHDE 3IF1B 3NJMA 4O02A 4N9OB 1LEIB 4CNIA 2XNAA 3L5WA 5E6YA 2DMCA 2H8PA 3VD7A 2EIMB 3BVUA 3PV6B 3K0WA 3UZVB 4DHLA 3R1GL 1I4FA 5AZUA 1R0AL 1LQSR 1JK8A 1V27A 3BKYH 3B2XA 3MRQA 5E6SB 3T9WA 2VJ8A 4IS6A 5E1AB 1I8UA 1CFVL 4KK6C 1WFJA 2AVFA 2HFGL 3V8CA 3BZFB 3WFHA 4FQJL 1KEGL 4MZIA 4X6BB 1U92B 3MRDB 3NIGE 3STLB 1SQMA 4YXKH 4NOFA 2CJUH 1E90A 3LZRA 4Z1PA 4OAWB 3I3DA 5IKCB 4OLEA 4WWOA 3RVXC 2WWKT 3RA7L 1GJWA 5AOJA 2W88A 1JTOA 5F1NB 3MJ8A 3BH4A 3JTSA 1GH7A 4X9HA 2I5YH 1P2CB 3SHSA 1ZWIB 4MKMA 4BZ2H 1KB5B 1TJHH 1JP5A 4W9FC 4LOVA 4QF1A 1TCMA 5BCAA 3CDYA 5JORA 2FO4B 3AT9A 5FUOL 3RI5F 3HC3H 1Z9LA 3EDDA 4HJJH 5DO2C 3WFBL 2IWKA 3V7MA 1D5XA 5C1MB 4AW4A 4U6VL 1U8OB 1FORH 3NPZB 3T2QA 1B9ZA 2V0AA 3O6FA 4HWEL 3CXHK 3PFUA 3FHEA 1TZ8A 3RAJL 3G6JB 2F8VA 2VXUL 2AJUH 2DH2A 4QOKD 5CIPH 4LLQB 1BJ1H 4EDXA 4XPAH 3FK3A 1WEJH 2IH1A 3F7QA 5ESQA 5GGUB 1HINH 4JKWA 5CAYB 2OSWA 4HGWB 2HJFA 3AREA 1Y6NR 3C09C 4ZJ9A 4U1LA 1BXUA 2B2XH 2UZYA 3WTXA 3B34A 4JM4H 4WKZA 12E8H 2NXZC 2JK5B 1B0GB 2XACC 4F5CA 3Q06A 4H25A 2UV3A 1MJ7L 5DEGB 2P5WD 3MYJB 4KTEH 2ZCLH 4XMVA 3VWKB 5CF3A 3O3AA 1U3ZA 3RY6C 4N26A 4Z7IA 4JFFA 3CZSA 4NDMA 4HJIA 3HG4A 3DX8A 1EZVX 2DBJA 3PGCB 4PJBF 3U79A 4PM1A 2J55A 5IZ7A 5EO0A 3ROLA 5DEZA 1U3JA 5C0IA 1CCZA 4HMEA 3RWCA 1IRAY 4PJBB 5E9NA 2AK1L 1Q90A 4MLSA 4UDUA 5H2BA 2GBUA 4NJ9H 2WVSA 2DIEA 2X1QA 4LL9A 2P49B 3PWVB 4G5AA 2H2SD 3MV9D 4MJIE 3ZHNA 3U0PA 3T8XB 3BW9B 4POZC 3ZDYB 1FYTB 4ODUA 2W65A 4L4JA 2JJWA 2H47C 4XX5A 2O26U 3V4PL 3ULUC 4GG6E 2EINB 5EUKA 2V5SA 4GRLD 4PJ8A 4QHNB 1UZ6F 4WTZA 3MRHB 3RDTA 5D7LB 4ZO9A 1WGOA 2WQRA 4GUPA 3KPMA 1A5FH 4U0RB 5C0RL 2R69A 2W07A 4PRIE 4UINL 3W0WB 5HPMA 3B2UC 4Z7NE 2AXFB 1YMMB 2R59A 3ZTNH 2VJ0A 1FFOB 1A9EB 2V2WB 1YDPB 2XG4B 4H88L 3Q7JA 5D7LA 1YNTA 5HJBA 1ML0A 2FK9A 3GSVB 5IBLD 2ZOUA 4PS3A 2CU9A 2JF1A 4HJEA 3C12A 3L5XH 2FD6H 5GGSY 1FZOA 1CZ8H 1ES0A 5ITFB 4EOWL 4PGCA 4MXWH 3VWJA 5GJTL 1K5WA 3GK8H 2H3NA 1GZPB 3SDCD 4DKFH 1X9UA 3H56A 2YRLA 3RKDC 2O4EA 5FPIA 3LB6D 2DL9A 4PVMA 3S34L 1FG2B 4X9YA 2WXMA 5EUOF 3EH5B 1YHPA 5DWUL 3SKJH 2CLRA 3SDAA 3QRGH 1ZLVH 4XNZB 5KVFH 3BSGA 4PHZA 1AY1H 3C6LC 2FHFA 4OV5A 2GG1A 3MODH 3RIFF 1KFAH 1NCCL 3BIBX 4XWGH 2HG0A 1IQWH 3MRMA 4I3GA 1HKLL 1V7NH 3DXAA 1MVUA 2BH0A 1JZ6A 1OAXH 4BFNA 1NDMA 1KYFA 3E3QC 2QHRL 4QRPB 5JHDD 5B8CB 5KW9H 3Q01A 2DLGA 3C6SA 4ZUWB 4UMGA 2XVKA 4OB5L 4I4WB 5BW7C 1QTYT 3QZOA 1ROWA 3TBWA 3IMBA 1RK0B 1GYWA 1BVLA 3O2VH 4OFKA 4RAVB 1J5OL 3S5YA 1A02N 2E9BA 1GZHC 4Q8BA 2DTMH 4P5MA 1UASA 1IQDB 1MREH 2VISB 2WB1A 5DZJA 4FI6A 1P7BA 2DLIA 1IKNC 4Q9QL 1OAYH 3MLYH 4UNUA 1ZVSA 2AEQL 1FC1A 1MCFA 2FDBP 3F7PC 4YFLF 4PY7A 1CR9H 1ICTA 3AU0A 2VR7A 5B7EA 3W39A 4N22A 2D03H 4WFGE 3C5ZB 4EIUA 3V5HA 1G1KA 3IMUA 4TOYH 3SQOH 4JKMA 4IRZA 4IRJA 3HRZA 2LU3A 2HVKB 4IHOA 2P5EB 4PJ5E 3TBTA 1NGZB 1IEAB 1KWKA 3Q43A 2F1BA 3IAGC 3KDPB 4OF7A 4UTAL 4OLZL 4LSRL 4N0YL 5HHME 1PZUB 1FAIL 5DVPA 5DHYA 4LO9A 4X0NA 2WSDA 4X6CA 3WXVL 2Q3ZA 4UQDA 5D7JD 3E6FA 4S1RL 1J1XL 2NY6D 4CVXB 5TGBB 2YQ2A 4D0BB 1L3WA 3BZFA 3OGOE 3CDGA 5F7BA 4X6BA 1L9OA 3MRDA 4PVNA 1WAPA 3DYOA 3STLA 4CMHC 4JFDB 4OFPA 1RURH 3LS4L 3GC3A 5KYUA 3MV7E 5AUMB 1TMCB 1CDYA 4OAWA 3TVMC 5K9QI 2D2OA 1AXIB 1A47A 1E4WH 4KKLD 4R5TA 4NQVB 2UUDH 2SEBA 4WI9A 3ULUE 3ARBC 2I07A 1P2CA 3DJ9A 2DWYA 4OU3A 2GHWB 5LB1A 3HZKA 3TV3H 4OZFB 4A7GA 1W0VA 1X5XA 2KPWA 4QHLB 4JHWL 3MMEB 4ZZKA 5LDUA 4HLZG 3RVVD 3O3UN 1J5CA 1BECA 1FGVH 1LP9A 1VIWA 1IM3B 2Z8SA 1CLVA 2E8YA 4FXKC 1IO4C 3LIZL 3GHBL 1JRHH 3A0OA 1UTDA 3OAUH 2OCFD 1EQWA 4ILDA 4MJID 3NP4A 4JY4A 4B60A 5A1AA 2AK4B 2EYSB 2W60A 2F53E 4NGHL 4W1TA 5DQDH 3MLTB 2KZBA 5EBMA 4P5TD 3GUTB 3ZRFC 4LPCA 2VDOB 1N2RB 1EJ8A 1BBJB 3QC6X 5E6IC 5DEGA 1MFCH 1OCRB 4Y2DD 2FL5A 1S7UB 2F5BL 2R8SH 4G3YL 1MHPL 4FI8A 4PRID 3WNNA 4JO8A 3ISYA 4POYA 3QI9C 2WBKA 2J2ZB 1FL5B 3E3QE 2GVYA 1QLEH 1QMUA 2DPKA 5D2LA 3WO3B 4KKBC 4PY8J 3ARXA 4I2XE 3KWWA 4AH2A 4M56A 2OL3H 4A63A 3NAAL 4JGUA 4KUCF 4DOHB 4JG1L 2ED6A 3EYOB 3US1A 2LV4A 1WIOA 4YSQA 4KK6D 5C6TH 2FO8A 2NQCA 4QWWC 1I9JH 3LKRA 2WLJA 4X6FA 4MJ6B 1GA2A 3QXDA 2I25N 3BZ4A 4B9YA 3VSUA 3RVXD 1R34A 2V5TA 3MRHA 5DUBB 3CU7A 2JKNA 2ZX8A 1OGPA 4R26H 1BDYA 3GXMA 4MMZB 3P30L 5L6YH 3UERA 3GZKA 1RAMA 4DWHA 1JDAA 1OCOB 2AXFA 1CC3A 4YK4C 1T1YA 2XLLA 3NJGA 2VITB 1FFOA 1A9EA 3FU6A 1YDPA 3OJDB 3QXWA 2W38A 5EB9A 4CGTA 4FZ8H 3MCG1 1SJHA 2PWHA 5DO2D 2YSTA 1NDGA 1L9SA 3S37L 3F6IA 5T1LA 5IF0A 4NPYB 3VI3E 1QBBA 3ENEA 5ITFA 2HTLC 4IEFB 1DCLA 1DQQA 1L9QA 5EORH 2F74B 3ARGC 1RMFH 2EXYC 4HSQA 1MRFL 3DTDA 4HFUL 3I9GH 1F4YH 2DMHA 3MRFA 1G7IA 5GZOC 1FRGL 3BEVB 4FFYA 5JW4Q 4FNRA 3TJEL 4WFGD 5LBVA 1AGEA 2NXZD 1UQSB 3UBXB 1LE9B 2XKNA 1HHGB 4H5SA 1EDYA 6FABL 4GW1B 4JANB 4AE0A 4PJ5D 3DRQA 4JQIH 4PLOB 1UWFA 4P2QB 3VGHA 4LLMA 5JIKA 2X05A 3P9MB 4XMPH 3QDMD 4ZUWA 5ALBL 5HHMD 1RD6A 3ABZA 3HS0B 4NN6C 4Z7QF 5JDJA 3FS9A 1MW0A 4N24A 1OWRM 4PFEA 4ICXA 1J8SA 4YWGL 4ZD3L 5AOKA 1AE6L 1N3NA 4Z7QB 1N0LA 1OD7A 2DRUA 1WYJA 2HH0H 3N2JA 1IQDA 2WQVA 4JJ5B 4FXGA 5EN3A 5SWZD 4YBLB 5ISZA 1SHXA 4YDKH 2AI0H 2BNQE 2DEYX 5DZAA 1IT9H 2J21A 4OZGF 5EOQL 5HGBA 1ZHLA 1GW0A 3FQYA 4POZD 3MV7D 2I32A 1DZ0A 5KOVC 3O6ML 4MSWB 5IJBC 2NOYA 4XPGL 4F3FA 1XF4B 1YEDA 4OF3A 4IIZA 3ULUD 3PAZA 1X9RA 1X5JA 5D5MB 2X1OA 3EAKA 1TENA 1EJOL 4JFEE 5CZVL 1ZSHA 4NNPH 1JV5A 2HVKA 2PWDA 5TE6L 1FFTB 3KPPA 4UU9A 4LFHG 3CC1A 1Y6MR 4HEME 3B2UD 4LSQH 4BXSV 4KQ4L 1UXLA 1F90H 5DS1A 1Z1WA 3K6OA 4JKLA 3BLPX 1F58L 3UEQA 3AGVA 1OF2B 2GTWB 3UTTA 2D7OA 2BOLA 2QKIB 2XBDA 5IFJB 5DJAB 3TN0C 1SYVB 5IW6B 2BHFA 4GP5B 4OFYD 2X0VA 2X88A 4RGMB 4DN3L 5K9KB 3PUCA 2JKTM 4Z23A 1L7IH 4P2OB 2BFGA 1C9SA 3CG8A 3FQ1A 4Y1AA 2F53D 3GWJA 2COVD 4DUXA 3RKDD 1YC7A 1U3NA 4ZUSA 2W1NA 2ZNWA 3HR6A 1CGYA 5E7FA 1IIKA 1RK1A 2NYYC 2VNCA 1ECYA 1JL8A 3FN0H 3C6LD 2F15A 5JYLA 1I7TB 3E80A 1GGBL 3QZBA 3MA7A 5LAXB 5KSVA 1GPOL 2JLLA 5FOBA 3SJVD 5CIPA 4L0ZA 3WN5B 2XQYA 4P2RD 5BS0E 3NFNB 5C09A 3OZKA 3RGVC 4HWZA 3IFOB 3TT3H 3X1BA 4QJ3B 4BRVA 3DSNB 1I1AB 2DLFL 2CDGB 4F91B 1WZKA 1AHKA 1PYWB 1U8PB 2BIOA 1BGXL 1CF8L 2IH3A 3CWGA 4ODHL 3VFNB 5A3IC 1IX2A 4X0KB 5C7XH 3BFOA 1MY7A 1EIBA 1X6LA 3A21A 2WTRA 5CILL 4YHZH 2R2EA 3U7WL 3TNNB 4AQ1B 3FQ4A 4YBHA 2XV0A 4NKIH 1T5XB 5IGXH 1SHMA 1B2WH 2BY3A 2G5RA 2FQFA 3IDJB 4IOIB 3VD0A 3QCTL 5CN1A 4LEXL 3GTVA 4ZBJA 2WKGA 1U8LA 4GPVA 3HAEG 3B9KD 3TLRA 4RFEB 2VLME 2MNJB 2C4FT 3M17B 1YLBB 2BM3A 2KS0A 4ELKB 1WJ3A 5IT2L 1JN6B 1NM9A 2ATPA 2YRBA 2JB6B 3L9RB 1PLGH 4JPQA 3PL6B 4OD3L 3X1EA 5IQOA 1Q1JL 2OL3B 1SXAA 4PUBL 1HQRA 4M93B 1WS7A 5EIIB 1S7UA 3RWIB 4NUQA 1OHQA 1Q0YH 5EZLB 1AGCB 2B4CH 2OA9A 5FGCE 1U2HA 4L5FL 1TU2B 3H3PL 3RX7A 1EAPB 1Q1PA 1O9WA 2GQHA 3GIZH 3THMH 5DVLA 5LXGL 2VQ1A 2IALA 3B37A 4UAOB 1LILA 3RGBA 4AQ8C 1AMXA 5ALCH 3R7RA 5MEOB 2OSXA 2ZUTA 1PG7L 1B4JH 1NFKA 5CINH 5E6ZA 1PS3A 3ARVA 1SDDA 4J8RA 5CJXA 1KLFB 1SDAB 3DVGB 2P52A 4NM4L 4WNQB 3UYPB 1AGDA 3FUIA 3CSFA 4MJ6A 3UYRL 3GSNB 4LNVA 1CXIA 2EYRA 2OCJA 2Y23A 4L37A 1FVCA 3DGGB 3TZVB 4DVBA 2C3VB 2R9HC 4RETB 3TVMD 3PAUA 3IFPB 2Y1ZA 4PJ7E 1RUMH 5DUBA 1WBZA 2B59B 3CFCL 4GI9A 1W6LA 3RTQB 1BWMA 3BD3A 2VXQH 3ARBD 3C75A 1S6NA 3OWRA 4OCLC 4EAEA 1MRDL 1A6AA 3ELQA 4R4FL 2LQRA 2ZG2A 4IM8A 2P5WB 5LCVH 3TH3T 5BOPA 3DVIA 4PJIE 4QRTB 1ZANH 4KXCA 4KFMA 2LU5A 4XHJC 4PWKA 5D1QC 1QTPA 4LP4A 4XO8A 3VUAA 4JZOA 3NDYE 3BUIA 3SDXA 3Q6FB 4S1SL 4R0LC 4WJ5A 3LN5B 3VD2A 3MBEC 2Z65C 3U7YL 5D7IF 3ETBJ 3FB6B 1YECL 2ZYHA 3AQXA 3PAYA 4BFIA 4TULH 3D7PA 3P1VA 1HE7A 3DIFA 3HG3A 4HPYH 5D7IB 3QSKB 3ILQC 4YEFA 3MJWA 4YAQB 3Q1SL 2VDKB 5DUPH 1U8IA 5ANHA 5HYJE 5F7KC 1UWGL 3FXIC 2WLIA 3BEVA 3X1GA 3TNMB 1C5DB 3CFEB 4UMSA 4YO0A 2ROXA 2YUWA 4PBWD 1KJ2H 4XT1C 4AMWA 1AQHA 3D3VB 4NN5C 4WNJA 4LRIC 3MRNB 3RRQA 1LK2B 4G8GA 4GRLB 5E6ID 3APDA 2Q1EA 2ITFA 3DTUB 4MNQE 3KWVA 1KLGB 2ZONA 2W9DH 2QEJA 4LLWB 3RWGB 1BLNB 2ZOLA 5HVWA 3MUGB 3OMNB 3P9MA 3V6ZB 3QI9D 2F54B 3O2WH 1CFQA 2AZUA 2WGNB 2E6PA 4WKXA 2X4NA 3D0LB 4M6ML 1SJEB 2Q2EB 4KKBD 3QWOB 3C8KB 1MFBH 5G55A 1VAHA 3RVUC 2P24B 2FQGA 1BZ9B 1MFAL 1KV7A 4APXB 1SBSL 1HXMA 4DEPB 1S9XB 2E6JA 1X5FA 2QGDA 2EP6A 3FRPG 2KZ1B 1YEGL 2LU4A 4UQ3A 2A6JA 1NMBH 4FX5A 3U46B 2E7LC 4AJVA 2IBZY 5TQ0L 1HN1A 3P4MA 3K5SA 2W0KA 3FJTA 4MSWA 3VU2A 2EJ1A 4HUKB 4X7DC 5L0QB 2Y69B 1KYOJ 4YL9A 1XGQB 2QDWA 4YHML 2YD9A 1E4XH 4FEMA 5C0AB 1NAKH 5D5MA 5BS0D 3T4YB 2FLRT 1W0WA 3GNMH 3CFKB 3N9GL 2DWXA 1G7PB 1CLYL 2A77H 4Z7OF 4KTYA 1ADWA 4F7TA 2MKWA 4LARH 3C60C 3BVXA 4OD1H 1A7RL 3QQDA 3ZL2A 5BZDB 3ILPB 3LHPH 4ZTEA 4XN4A 2ENQA 3AQDA 4Z0XB 3T4AB 3VXRB 4CC1A 2AQ1A 3P2BA 4LMQI 1TETL 4Q9CA 4PRBA 2VRKA 5DF0A 2O6EA 3HZMB 3UTQA 3PABA 4WGVB 5E8OB 1HNGA 3OG6B 1CL7I 4TPRH 5E9DD 3E6HB 4JGNA 5JHMA 4XNDA 2HTLD 4XCCH 4P2OA 1MWAL 3AFLA 2SODB 1QA9A 1YEEH 1EHKB 2VGLM 5IMKB 3NIGF 4FXLA 2HT2C 3WKYA 4WHTB 4R7NB 4XP4H 2X2UA 1EVUA 1BHGA 3IRCA 1OY3B 2EXYD 1RZ7H 3KNBB 3EO9L 2B1AL 5TDNA 2GT9B 2VXSH 1P1VA 3KR3L 3NIGB 5GZOD 1G4MA 5JPNB 2JKXA 2XFXB 1FFQA 1MFMA 3IGUA 3M07A 4Q58C 3ZUNC 5EO9B 5I1GL 3IDNB 4TNWF 4KO6A 5IOPB 1R5IB 5IMMB 3HE6A 1R5VB 2GSGB 2EDBA 2PUQT 2WXPA 3PWJB 1DQVA 4OIIH 4XMUA 2DY2A 2VZ3A 3LSOB 2CKNA 5DD5H 4FA6A 1HH9B 1XQ4A 4B3VA 5EG6C 1GCFA 5F7YC 1WUNT 2EO1A 1CGWA 3HBPA 5B39G 3QFGA 1VFOA 4BZ1L 9PCYA 5D1QE 1TJXA 2DB8A 4G8AC 1R24B 3N40F 4UIMA 5D7JB 3ESUF 1YPZE 5L4JA 1PZAA 2CO7A 2NY6B 4GAAA 1PY4A 5E08H 3VD1A 1EGJH 4KROC 4UM8A 2DJMA 1S7RA 3SQBB 1DBMH 4JFOB 4ONHB 2AITA 3CXFA 3LKOB 3WDIA 3UJIL 2XJLA 1U8NA 3PL6A 3MHZA 3X17A 1RZFL 4ZMXA 1MCQA 3K71A 2OL3A 2ZXCA 3FU7A 5HGAA 1KBWA 3DX3A 3I02A 5HYQB 4XC1L 3TA4D 3ZMNA 3AWEA 1U3YA 3FO2B 1CD9B 4YMPA 2E59A 5FS5A 4KU1A 5F8RC 2FE0A 4PCKA 3ZR6A 2J88H 1QR1B 1GC1C 2OTPA 4YHYC 1WA0X 1MCCA 5AVQB 4X5PA 4Y2NA 4QKXB 1FNGB 3P4NB 3PWLA 4V11A 1QOKA 2CBQA 4ALAH 1ASOA 3OX8B 1QVOB 3QR1A 3D5OF 1F86A 2E4FA 4OD2B 4Z7WA 2O6CA 4JRXB 2WCSA 3AU1B 3FOMB 1BXAA 2EC9T 3ZW3A 1SEBA 3TN0D 1E2WA 4JHAL 4DH2A 2NDFA 3ZO0A 3B83A 4KJQC 2NY7L 5J9PB 3AB0B 1KXHA 2V9TA 4K0OA 1KLFA 3D50A 3W9EB 5IHZA 1CXFA 5HYJD 2R7EA 4JE4B 3TO2A 4XCNB 1WT5C 3GUFA 4GG6F 5L9DH 3MXVH 4OCXH 2GFBA 4L5FE 3TZVA 4QRFA 4YHPB 2C3VA 2X6MA 3NN8A 1FL3A 2NYYD 1RJLA 3SYCA 3WIFB 2BOCB 4L8BA 4GG6B 3NJXA 3KG5A 1S7VB 3OGCA 3RTQA 5ICYB 3U2SA 4F37K 3ULVC 1B0WA 1JGUH 2R4RL 4P46A 5HGHA 4BCYA 4Z7NF 4ZXBB 4WCYH 1G9NH 3RGVD 6CGTA 1I53A 4KHXL 1U8QB 2UX6A 4P49A 1L9PA 1PKQB 2VQUA 4Z7NB 1ACYH 5DYOB 1ZA6A 3CSGA 4KV5E 3SKMB 1RXLA 5A3ID 1GYUA 1MIEH 1UEYA 1O7VA 1QBLH 3VXMA 3HG0A 1KJMB 3QCVH 3INUL 2XFGB 1MF2L 5CEXB 4X6DE 1UKSA 4N6RB 4ODTH 2DBLH 1XF3B 2LW3A 4UYPA 5E4EC 5FFOA 4K15A 1NGYA 2DQFB 4JQIA 2P45B 3VD5A 3ZE0E 2XYBA 1OKEA 1NMCC 1FH2A 2ZCHL 3D05A 5E7BA 2WZPD 2P47B 2E7MA 3QWRA 4DP0X 2FJGA 4ZQTA 4Y4FA 5T3XE 5I1CH 3EGXB 3C8DA 2WXHA 1E6OL 1A7QH 4X5WA 1H3TA 1KWGA 4M62H 1KIQB 1FPTH 2NPLX 2Z1KA 1L0YA 1F1AA 4R2GD 1VFBB 4M1GH 1BEYH 2X87A 2DQEH 3RL2B 4RIRA 4UV7L 1CMOA 3CFBB 5J6HB 3QXTA 4LLWA 4BHUI 1BLNA 3VW3L 2GI7A 4UM9D 2DWDA 1CTNA 3BDYL 4H2CA 2MHAB 5D2NA 2KI6A 4QXUL 4DO4A 3D0LA 1WWBX 3LRGA 2D0HA 4ATTA 2AXGA 2NR6C 4LRNL 1CURA 2A9MH 2X70B 4OF5A 2P24A 1F4AA 1NDTA 1U4EA 2FNWA 2PYEB 3IRZA 4XO9A 1NQBA 4LSVH 3WE6B 4HPHA 1HHHA 4HXBH 3BP4B 2J43A 5K5YA 2APWA 3X11A 15C8H 4NUJA 1ZS8A 5EZIH 4R8WL 3TCTA 2R2BB 4UNVA 3S88L 5IJDC 3VFPB 3VQMA 1JYNA 4CAGA 2PCFA 4NI6A 3HI6H 2XTSA 1SLVA 2K6ZA 2R9HD 4G72B 4MCYB 4M43H 4DFHA 4YHIA 3HCVA 3CFKA 2H0EA 1XO8A 4RMVA 1B3IA 2DZEA 3HHMA 1W8NA 4PJ5B 1MFUA 2IO5A 3DDGA 4HKBA 5DJ8B 2VC2B 2VW6A 3V2AR 4FQIH 4DN4H 3SBRA 1C12B 4XHJD 5HHMB 1S9VB 2D73A 4OVUA 5D1QD 5F7DA 5HHVH 3FTUA 3DBXB 3MBED 2PXYC 4Z7VA 4HBCL 4JQVA 4OCWL 3E6HA 3WEXB 1PVHA 1SEQH 1OAKL 1ZGLB 3IDXH 4A38A 2EDEA 5IMKA 5KZCB 2NY4B 5HYFA 2IBBA 4K7PH 1O5PA 3L4WA 1MW1A 3ILQD 3MRRA 4JJOA 4Y5VC 5CSBA 3QUMB 1PF3A 5IEHB 3SE3A 1TNNA 4FA8A 1AXSB 5JW5B 3QFDA 3QYNA 2R0ZH 3QWQB 4G7RB 3ZL4L 3ULUF 1GY2A 1N59B 3PV7A 2NY3B 3GJFH 2JB5L 3RG1C 2LT9A 5B1JA 3NABL 1FHNA 5JW4R 5I6XB 5DI8B 1SN0A 2BP5M 5CN2A 1TZHA 1E4KC 3EFFA 3ULVE 1DQTA 2VZOA 2XJKA 2R0WH 4BFBD 1Z0NA 3MLZL 3FCBA 1IFHH 4OGQC 5GS1C 3IDIB 1CB4A 4HIXH 1RZGB 3HOGA 4K5MA 4NYLB 2D3NA 2IAMB 4M8QA 4I0KA 4GQRA 2BVTA 4C4KO 4DAGL 2AJSL 1ZLEA 2CK0L 1MLBB 2R27A 3RZCB 3VG0H 3APFA 1UA3A 3GPEA 5DMKB 1A6ZB 1EHLL 1D9KB 1MDAA 1XDTT 4DPBX 4ONHA 4K8RC 3UBXI 2J6EH 1G7MA 3L2MA 4LEEA 3GBMH 1KENH 3D0VB 4E9YA 1E9OA 1NCBH 5CUSL 1PIFA 4QRRA 1NCNA 2YPVL 3P54A 1PEZA 1PLAA 4U1GB 4ZO8A 1H3PL 1YEIL 2HFTA 4G6MH 1W72H 4LFHD 1JXDA 3X3FL 5HYQA 1AR1C 4HU2A 3SY0B 2WKOA 1XGUA 3OQ3B 3LMJH 4PI0A 1NC4B 1Y1DA 4ONGL 5EFIA