3AABA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form i crystal
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
ELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
molecule keywords Putative uncharacterized protein ST1653
total genus 21
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aabA00
1RL1A 4FEIA 3AABA 3W1ZA 2JKIS 4ELDA 2KLRA 2Y1YA 4YLBA 3GT6A 2O30A 2MNWA 4MJHA 4JUTA 1X5MA 3Q9PA 3J07A 1WFIA 3L1GA 2N3JA 2CG9X 3GLAA 4YE0A 1GMEA 4ZJ9A 2Y1ZA 3QORD 3QORC 4M5SA 3N3EA 3VQMA 4JUSA 2CR0A 2BOLA 3EUDA 2WJ5A 3GUFA 1EJFA 3L1EA 2RH0A 3L1FA 3Q9QA 4YL9A 1WH0A 1WGVA 4RZKA 5DS2A 3AACA 5LUMA 2K8QA 4PBDA 5DS1A 4YDZA 4I88A 2WJ7A 3IGFA 4PCKA 1SHSA 2KMWA 2Y22A 3QORB 4M5TA 4YLCA 2N0KA 3QORA 3VQLA 2XCMC
chains in the Genus database with same CATH superfamily
1K8DA 4YHML 1EPFA 3FONA 4JZJB 5CUSL 1A2YA 5DS8B 3UC0L 3WEAA 3WMSA 1KG0A 5T5FA 3T0EA 2ZCLH 3VX1A 2WBJC 5CJOH 4UOJA 5ISZE 4LCCC 4XCYB 5DQ9A 2V5RA 4L3EE 1FE8H 3WFBL 2JF1A 1ANUA 1NCDH 2H32A 2Y5TB 2AXGB 3HC0A 5BO1H 1TVBB 4BK8A 4WY7H 1RPQA 3DX6B 5L88H 5F9AC 2BO0A 3BEVA 4M8QB 2ADFL 3SYQA 2BP8B 1ES0A 4L3EA 5AWNH 1J9TA 4F9LA 4ENZA 3RVWD 1TZHB 1NMCC 4LLDA 5LGJB 3MNVA 4BINA 1ZA6A 1DL7L 4HC1L 1D7CA 2XG5A 3NAAL 2KL6A 1UM5H 2ZE0A 1HJBC 2H1LM 3CVHB 3LPPA 3EGDB 3VO0A 4U1JB 5AOZA 2DLTA 1WAAA 3H1ZA 3TPKA 3S2AA 1PZ5A 4DK3A 5MEND 3LV3B 1CU4H 3KYKL 2YC1A 4K9EC 4QOKA 2HXAA 3RAJH 2ZCKL 3F7VA 5B22A 1J86A 3B43A 1MREL 1KLUB 3C2AH 2R0KL 4FN0A 3BQUC 4AV0A 4J8QA 4ANWA 5IFAH 4UQEA 1L6ZA 1LL1A 4EZKA 3B6SA 1H15B 1RFDL 1NFAA 3RZCC 1WEJH 2NYZA 2BH0A 3EFOA 3PPSA 4WFEE 5GGUB 1C16A 4A6YL 5KG9A 1PD6A 4JPSA 3LKSB 3ARGD 2CBMA 3CU7A 5T1LB 3HG1E 3WEOA 1Q0YH 3RFZC 2ATAA 1CD1A 3T4YB 3DI3B 1TYRA 2EDXA 2ADIB 2QFPA 3M45A 4H26A 2NYYC 1LXMA 4CVZA 5IEKA 1NJ9A 1PBYA 1R24B 5GGQL 2BERA 4G6KL 2WJ5A 2H2PD 4GKNA 1YUHB 1UZ8A 2BNRD 1YEIL 2KH2B 1IGTA 4ELME 3UERA 3FQXA 1HL9A 5TE4H 5HPMA 3HHRB 2G0LA 1MFBL 3LH2H 2ZXBA 4HK0B 1IFHL 1USZA 1P5UA 4LP8A 3GSXB 5DRXA 1PJ9A 1OCWH 3C60D 5EZIH 3QFDB 5T3ZH 3FL7A 3S4SG 4IBVA 1OWRM 2P7TB 1UM6H 2QVKA 3OAUL 5IQNA 1J9RA 1XDTT 3IYLW 3G04A 1BOYA 4JFDA 2DL9A 3ARZA 3ILQD 2IH8A 1WYJA 1T1WA 1XSJA 1SM3L 4Q2ZA 4RISL 5E8PA 3QUHA 5ICUA 4KXZI 3T2OA 3WY1A 5IREA 3IAPA 3VD4A 1EJ6A 3MREB 5HDBB 1FG2B 1MI5A 3LPOA 4P2QE 4XVJL 4J2XA 2QSTA 2R51A 1QBLH 4TL5A 3HW7A 3WLBB 2PPDA 1R5VB 1Z6JT 1AD9B 2YMTA 5DXWA 3FT2B 4GFXA 5T1MA 2B5IC 4I48A 4NZRL 3TEYA 1NAMH 2Q2LA 4BBWA 3TZVB 2HG5A 1R0AL 1XO8A 1LDSA 1AO7A 1N8OE 2F19H 3A21A 3U0TA 4DKFL 4YHNB 2AXJA 5J06A 4AW7A 1EZVY 1M1SA 4BELD 1F90L 3GXUB 2H7WA 3H3PL 2QJDA 1IE4A 1KUMA 3ASNB 4LLUB 5CZKA 3UC2A 4GBXB 3JWDC 5HDBF 2KPNA 1U3ZA 5JNYB 3NP4A 2ZAIA 3N04A 4Y5XA 5KSVA 1XF5A 2N7AA 2PO6B 3B7RL 7FABH 5C71A 3FT3B 4MCYB 4NKIH 2V9QA 2OMBA 1DSYA 3IJEB 2K8MA 2A9NL 3BP6B 4QCIA 4RGNB 4BUHA 1GZPA 3H0TB 2AZUA 2ICEC 4EN3C 3ILPB 1ZSHA 5CJQH 3RUGE 1OWWA 1Z5YD 4BXVA 1EO8L 1XWVA 5C0CA 2JB6B 2GTQA 4ERSL 1AG6A 4LVNB 2ZPKH 3NIGE 5FUZH 2XJLA 5BOJA 4OV5B 1HINH 2CGYA 2HFEA 5I15H 1EVUA 4APQB 5GQBA 3HHSB 4OCSH 2D3LA 3GD1C 3LZNA 3GMRB 4LK4A 4G1MB 5D7KE 1J0HA 2WLJA 2F5BH 4K55A 2TAAA 3QAZB 2GC7C 1XH0A 5DYOA 4KWUA 4R7DA 2YAEA 3UTTD 4B9GA 2GHWB 3ZL2A 4LEXH 5KVEL 3BGMA 3TJHC 5KN5B 4NQUA 1UQSA 3KD4A 4LHQB 5ALCL 4J3OF 2E27L 2IWFA 3HG4A 1PG7L 5FYLE 5CEXB 1OSZB 2JNZA 4JANA 4AJVA 3BZEA 3V0VA 4FQHB 2XQBH 3FN9A 1IBYA 2HFGL 4O2CA 1UXSB 4JY6A 4Y2DB 2PCFB 3GMNA 3O8XA 1V7ML 5CJXC 3QZWB 4OT1H 1JZ6A 3N0PB 5HHNB 5MEOA 2DYRB 4BQCA 1QSFB 4NO2A 4FA7B 3SD2A 4E9RA 3S48A 2LU3A 1GY1A 2B3IA 3WGVB 4CSPA 1AGEB 3QJVB 2RQ8A 4E41B 1RZ7H 4MX7B 2DWYA 1YJDC 4ALAL 1DVXA 1E5AA 3F6LA 4M5YH 1PEZA 4AITA 3R19A 1JNNL 2HT3D 4OM1H 4FL4B 5DMKA 3ZDZE 3MNMA 4N2BA 3UPRA 2LR4A 1PZCA 4JFYB 3ZZLA 2G5BB 3MLZH 5IHLB 2DWSA 1PIFA 1YEFH 1R17A 3HUJA 4XVUC 4CSTA 5IVNA 4H0LC 2YFNA 3UZQB 3ABMB 3RZCB 1AQKL 3LEXB 4J8RA 3H2QA 2JQMA 1Q72H 1F8TL 3BAYA 1G9HA 5C9JB 1SNRA 3L3KA 3ZKSD 1E5CA 2O6CA 4L0ZA 2FGWH 3MJ6A 4LARH 4J5VA 4FI6A 3D09A 2V3FA 5EO9A 3HPLB 3IDUA 4GIAA 2OBGA 1UWXH 4X5QA 3KZ8A 4QHMA 1J0YA 3AREA 2LW3A 1J10A 2YRBA 4ECNA 3RGVB 4JG9A 4HLEA 1EHKB 1X5YA 3BZ4A 4W4OC 1E4XH 4L9LB 1F45A 2XN9D 1EEZB 4AEHL 1CBVH 3RE0A 4PGDB 4NPJA 1VADA 4OFVA 5F0PB 3ZSTA 1HC1A 3IPFA 1HQ4B 4EOWL 1AH1A 2P8MB 4MSWA 3FHEA 3D50A 2E76C 3Q9PA 2X4SA 4D3CL 1VERA 5CU5A 2R0LH 4EIGB 3OB0H 5HY9B 1OY3B 1DJZA 1TVHB 5J13C 1RSFA 2GSMB 4X5LA 5ACZA 3LN5B 3QARA 3MXWH 4V11A 3EKCA 2ATKB 3ME0A 5HYSB 2WXNA 3IS0X 3X1GA 5EC2B 2BOBA 4JFHE 1ZEAL 2GJ6A 2LHAA 2FX8H 1LHZA 3AG1B 3O6ML 2NZ1A 3EO1A 4JZJC 5H37H 5FYJD 1KBWA 4ZFOA 1SY6A 2X6CA 2BNQA 4D8PA 1OHZA 1FL6A 4POUB 3KNBB 3P30L 2YPLB 3CX5K 4P5TC 1NGZA 3FOLA 4W93A 3NG5A 1LE9A 1KLFB 1EWHA 2DB8A 3OKLA 3QFJA 4LAQL 4LSTL 5C2BH 1EO7A 1OP3H 2XJKA 3KL5A 5ETUA 4PJHF 1SFDA 4BA8A 1L0PA 1T6BX 3QFJE 4PB0L 1KJVB 5I1EH 3WFBH 5DD5L 3FQTB 4DUWA 3PGFH 4IKKA 3QYMA 5I19H 1EDYA 4BUQA 3D3VB 1HE8A 1YEFL 1B4JL 3SO3B 4B95C 4HGWA 3S96A 1HWHB 1Q1JH 4ZMZA 4AEEA 2HUEA 4PJ8A 4S0TD 5C0EA 1RPUA 2UYLA 3VXNA 5HJ3B 5KS9B 4AIZB 4Y1SA 3K2IA 5EC1A 4UBDD 2DN7A 1Z0MA 2Y69B 3Q0HA 4NO0B 3LZPA 2FDBP 4FQXB 3P4OA 1IIIA 1KCVL 5B3JF 3WL9B 3WEXB 2BIOA 5L2KD 2IOMA 4H5SA 3UP1A 3IN2A 4J3OH 3MMEA 3S35H 4XO3A 3V7AG 1SLXA 3TS8A 2NNCA 1T20A 2IGTA 3MBEA 2V2TB 5I30L 4YDIL 1RL1A 2FT8A 5SWSB 5GIRB 2G3MA 4WJKB 1UXMA 1JV5A 1H0DB 4H20L 5IP4A 3IFOA 4LKXB 1KN4L 2Q3AA 3KEDA 5EIQA 1NCGA 3QFGA 5AAMA 3EJJX 1UJTA 4JKPH 5I8OL 3B56A 2J8HA 3S9DB 1JN6B 1PX3A 1XSKA 3AUWB 3BSHA 5JLZA 4MA7L 4U2YA 3P69A 5DFVC 5IBLD 4LIQL 2W07A 4ODTH 4A7VA 1UFUA 3PWUA 5D1QB 4MQXC 4AVHA 1IAKA 3CZGA 1BZQK 4ZO7A 4FFYH 3WMPA 3GMQB 1ZLUK 1M4KA 4GG6A 3T4AC 1SJEB 2X4PB 2FR4B 3CFEA 4QRSA 3OQRA 5AQ0A 3O9WA 3VI4E 1MY5A 4LSSL 4L0PB 1NCBH 3WNPA 5DZVA 3MDJA 1E4KA 3OAYK 5KEZA 4Z3FA 2CMRH 2IVFC 4RESB 1A6AB 5AOLA 1BBDH 2IPKA 2X4OB 3RILA 1L9TA 1JF5A 3NSXA 7FABL 4KHTH 4HS3B 3HRZA 3PDOA 3FNKA 1P9MC 4MMXC 5F3HB 2HP4A 5IROC 3V0JA 3UTQB 4QAMB 1XGRA 2WPGA 3O4LD 3X3FL 5I0XA 4ZYKB 25C8L 3ETSA 1AP2A 2PXYC 1QASA 3OR6A 1DQML 1LQBC 2ICEA 4GRLD 4LQFL 4U33A 3BP7B 4ZX3A 3ML8A 3CJJA 2IWGA 3D30A 1ZS8B 3T6WA 1DEEB 1LD9B 4GG8A 1BFOB 3CK0L 3CPLB 3K6DA 3RL2A 1F4WL 3OBAA 4PJFA 4TSCL 4XXWA 5C0RL 4FLHA 5CLWA 4QGTA 1SY6L 3OLIA 1TZIB 3SDXA 4H1LH 5JPMB 1S7RA 5ICYB 1OAYL 2O5YL 2C1OA 3HS0B 2E47A 2A9BA 2MSPA 3CZFB 5FGCE 4O2EB 2BW5A 5ANMA 1H3UA 2W59A 1UM6L 3OAUH 3WNIA 5IFHH 1SJXA 4B9JA 1FJ1A 3QORD 4MNGB 4PB9L 4MNHA 3RDTC 2DM2A 4JM4H 3WKYA 1KTDB 4OZHA 4UT7H 1FH5H 1UKQA 3G5XA 1SZNA 3SGEH 1LE5B 3GIZL 4XN2A 4NJ9L 2I7OA 4NZJA 5F7EH 1UADC 1UHVA 1INQB 3BOVA 4UTCA 2FQGA 1C5DB 4FNSA 1XH3A 4TQ8A 2Q86B 1OSPH 3A3YB 4U1KB 4UOQA 4WTXA 4NUJB 3THMH 1DBAL 1FL5A 2P80D 2EEDA 4OZFH 2BCKB 5IKCB 1MDTA 1T7VA 3HG1B 3BRDA 2YRZA 1LMKA 1TZGH 5I8EA 4TPRH 5GZOC 2IWKA 2CKBA 2VDRB 5CFHA 1ETJA 4OZFB 1L0XA 4FQJH 1QSEA 2FJHA 3DYPA 3VRLF 4NENA 5KTEH 2K9UA 4RNRB 5AZUA 2FAUA 1RFDH 5EU4B 1QACA 4KAQL 3GDBA 5DJZA 1L6PA 4PRIE 1NAKH 3RX9A 3CVCA 5KJRL 3GBDA 1BM3H 5EIIG 2AJXL 2Y07H 5B7MA 3VVVA 2W95A 3LDBB 4MWFA 2H0FA 5TH2B 1GZHA 3CCHA 1B9KA 3SDCA 4QAWA 4L4VB 2E9WA 3RDTD 1U6AH 3VGDA 1ZWIB 1NWOA 4WVRA 5KSUA 1HAWA 2A9DA 3SBPA 2PTTB 4HV8A 3PGCB 4MA3A 3EJYD 1D5MB 3KDPB 5C0GA 2QGCA 4BZ2H 3CVBA 3K4DA 2EE6A 1UA6L 5SWQB 2IH3A 4K07A 4HWBL 5F7WC 5I74C 1PZSA 3WFCH 3BDXA 4LPVA 4N25A 2W65B 5E56A 3U2SA 1ZSDA 4ZOCA 2E8ZA 1T89C 1X5JA 3GXMA 3T2LA 4XVTL 3QEGL 1CD9B 1JJUA 3V4LA 2FYVA 4DOHE 2R8SH 4HFUH 1FVCB 5F7AA 2FQDA 2XI9A 3BIKA 1TZOA 4O02A 1OM3H 4WWID 2VR6A 4JFXB 3RIAK 3FSVA 4JCMA 2V0AA 3OAZH 4GW1A 5F0JB 1WUNT 3KVDD 4U7KA 3OZ9L 5DJYA 1IJ9A 3B5GA 2Y2YA 1XGQA 1TQCB 1B3IA 4Q6IB 2J56A 5B1KA 1CE6A 4ZW6A 3FCBA 1I1FA 2F7RA 4MXWH 2XY2A 2ZSWA 3CFNA 4KTEL 5HYEA 3CZLA 5ITBL 2DQUL 1QAWA 2H8PA 5DJCA 1KTKE 1UEYA 3IDYC 4AQ8C 3LH8A 2LVCA 4RMQA 3BIAX 2NTSP 3T1FB 3OGCB 3GTNA 1GJIA 3ZKQD 3KYMA 2SODB 1C12B 5GSVB 4BQ6A 4GINA 2I24N 4XP9L 2WVVA 4P59L 5EU6A 3WG7B 4DKEL 4G6FD 3TN0A 4TNEA 5TD4A 2BSSA 5D1XB 3M8OL 1WGOA 4PRID 3QUYC 4OV6F 4XPFH 5DEFA 4Z7OE 1RK0A 1FFPA 3QW9A 4HIIA 2X6AA 1OB0A 5INCB 2P24A 4G42B 4GO6B 1XBDA 2EILB 2NX5B 4ZMPA 1EHLL 4FG2A 1FFRA 2F68X 5GZNA 2VXQA 3VNYA 5ADOL 5JIDA 3QT2A 3LX9A 1OZUA 5C8JB 3HBPA 3K6NA 2X38A 3DX2A 5HHXL 1T7ZA 2RBLA 5IW6A 1LP9A 1RUPH 2O6DA 4D9QD 1RJYA 4QHLA 2PW2B 2XA3A 3FBKA 3LAFA 4PIBA 1PZBA 5KBNC 4FKEA 1MKFA 4PJGF 4MMZB 1IQWH 4M6MH 4BUGA 2NNXA 1I7UB 4K3DL 5LAXA 4G80B 1S7QA 2PP7A 3CZKA 5I9QC 1GS7A 4ETQB 3RWHB 2CIKB 3CFMA 4WGKA 1X4ZA 2D7QA 4R2GD 5AKRA 3R7QA 1JFQL 4A7GF 3F12A 4AZ8B 1ETZB 2Z8RA 4WNJA 2ZSVA 3RWGA 2YMOA 5E03A 4K0OA 1XFPA 4C56D 3P0VH 3JTTB 2E4TA 2AS5M 1DQJB 2VZ1A 1WDAA 4YDZA 4YSRA 5IWLC 4WUUE 2Y1VA 4MBRA 1N6QH 3K72A 3RJOA 1N64L 2IPTL 4WI4A 5JIQA 4B96A 5L4FA 1ZS2A 5D2LF 1NCAH 1PKQB 1RP8A 4KDVA 3MOBL 3HPJA 5DJXA 3P0YL 1JZ3A 2R2EB 1BBDL 2VJ8A 1H5BB 5CLXA 3D9AH 5HHOA 4ALAH 1NCHA 4P2YA 2I07B 3NBNA 1ACZA 3U0WH 1ZANL 4JPWL 1CF8L 1HCZA 5BS0D 1R33A 1NCBL 3O41B 2C3XA 3PWNB 4NWUH 1FCGA 1MLCA 5DS2A 4AL8H 3MBWA 1G9NH 2XFGB 4MJID 1KGIA 4WIQA 3SN6N 3HE6D 3P9LB 1RLWA 3DROA 1D5ZA 2PYFB 4PJBE 1SEBA 3F7QA 2EDRA 2KDYA 5F21B 5AYUH 5C2UB 5CF3A 4G7YH 1JCVA 4FULA 3T0EB 3BYYA 4OCXL 3N1FC 2KKQA 4A7UA 4WI7A 1WC7A 5LHDA 5ESQA 1Z9OA 1DANU 4OI9A 3AM8A 3KYOA 1KB5B 5CJBA 3VWKC 1C7SA 2WTPA 2R4SL 3HE6B 3C6SA 2WLZA 6CGTA 3QG6B 4MJIB 4JFFE 4CNIA 2M2DA 5DD1H 2JTYA 5CJ5A 4HC1A 2H1PH 1AO7D 5I76A 3BKJH 4JO3H 3UL4A 4OZGA 1U3NA 4LSSH 5TGBA 2V2WA 4HDIA 5ESAA 2RGSA 2R1WB 2XYCA 4M8UA 3LQZB 3DX9B 4OB5L 5I75C 3QVAA 5I74B 4OCSL 2JSFA 3AB0C 3FO0H 4QHUA 3ZDYF 1E4WH 1J1PL 1ZA6B 1TXKA 4FD0A 5HHVH 1AD0A 4HIJB 2C1PB 4L9LC 4RAUA 2PR4H 3B34A 4NI3A 3WN5A 1BFVL 3EYFB 2EXTA 3LS5H 3NK4A 1FFNA 4G9FA 3U30C 1EO8H 1X5HA 1JXGA 1TEGA 3O3EB 4R2GC 2B7DT 5I1CH 1EZLA 5AB0A 4Y4HB 4IGBA 3TYGL 3TBSA 4C56B 5JDSB 3WD5H 2A83B 1ORSA 3H2PA 3Q6GL 3QJSB 4H20H 1Z7JA 2JK5A 4LSVL 4A63A 1PG7X 2MJWA 3AZUA 3HC2A 4IJ3B 4XVSH 2F53E 1LM8V 3ULVF 3QWQB 3T3MF 1U8JB 4GJTB 5T1LA 4NUMA 1NDGA 1GOHA 3TV8A 5IW3A 1MVYA 4NRYA 5DLMH 3SDDD 4JRLA 5JW4R 4ZNEE 1U8NA 2ZUXA 3O2VH 4UWQB 1VFAB 1AZBA 1GMIA 1S7WA 5IQMA 3P2DA 4HS8H 2MMXA 2JIXD 5T3ZD 4YHPA 3QQ4A 5CCKH 2J8OA 5DD0L 4OCWH 3UJTL 1QP1A 4U2ZA 2I60L 2FEEL 1KCRH 2YD5A 3VRJB 3OKEA 3FQNA 1CI5A 4M9OA 4LBAA 2WO2B 1P5UB 4WRLA 5DI8B 3ML9A 2ZUWA 3TFKD 5J9PB 1PY0A 3IXTB 3W5MA 4U1IB 1ZVNA 4XCNA 2O5NA 5JOFA 3M1CA 3FB7B 2R59A 4Y4HD 1XCXA 5FR3A 1VFBA 1WHPA 4PHZA 2D03L 4AL8L 4F33A 5ALBH 3RWJA 5A2BA 5E24E 5C86A 5IOPA 4NUGH 2ZJSH 3S3JA 3GO1L 3HNVH 1P5VA 5TE6L 5K9KB 5I6XB 3QULA 5GGVL 2WO4A 2NPLX 3P0YH 1RMFL 5BRZE 5JUEL 4M6ML 1TNMA 4XMTA 2DTML 3BO8A 3VU1A 5EIVA 1AO7B 4PRNA 5ISZB 1KFAL 4FKHA 3PFQA 4OLEA 4P2QB 3V95A 4A2LA 3GJFA 4TUKH 1RJLA 3CLEH 1TLKA 2YAQA 3VMNA 5FDWB 3V0DA 4KOBA 3UBXI 4QIRA 3ARTA 2YXMA 1F0LA 1UOVA 1DVSA 1BBJB 3MROA 1MJ7L 3GEWB 1AGCA 3TT3L 2HT2D 2VDKB 4EIUA 3DV4A 5I1JL 2AQNA 5KVMC 1J05A 1I1CA 4WW2C 4JRYE 3X14A 1ZKAA 3C12A 4N0CD 3ARBD 2YEVB 4E68A 4TVPH 1JE6A 2DQDH 4FFZL 3T0BA 4DO6A 3DHMA 4CILA 3NRPA 4GMTL 4JRYA 5L0QC 3JWNH 2Q3XA 1YEDB 2GBUA 4WQOA 3FT4A 3MN8A 2OLDA 3CLWA 2BNUA 3FO9B 4YSEA 3LMJL 3HKZA 5IFAL 1W16A 4P46A 4FDWA 3WGUB 3B2UD 3X1FA 3C2AL 3L5WB 1O7DE 1AXTH 3FUKA 4B50A 5CEXA 1M6UA 3OZ9H 4HU8A 5H4ZA 1G7IA 2UZXA 3CQQA 2ZX7A 2PCXA 3NT0A 3O2WL 2H45A 1BQLL 3MNDA 1AI1H 2EC9T 3CHSA 4RGNC 4R3SB 3ARGA 3MV8E 3FO2B 3NA9L 5C0DA 4E5XG 1BG9A 3HAEA 3SYCA 4LKCA 3D08A 2CSPA 1C8PA 4P2OB 4AVJA 3U9UA 4PJCB 4PTUB 1PG7H 3WBDA 3RZWA 4G7VH 3L3GA 3PHAA 5IK3B 3NSJA 3T8XA 2WQSA 3HBQA 2VITB 4POYA 5C0AA 5HYJD 1XTLA 1FYTD 5F7NC 2PP8A 1F3DH 3VFSA 2N01B 4DP1X 1C08B 4K7PY 1UURA 3EDDA 4UT9H 3TH2T 4CAGA 2ITDA 5DURD 2VLLB 3FN3A 3MKGA 1YJDL 3QWNA 3ULVL 1PAZA 4KRNA 5E5LA 1U4EA 1D7FA 5TDPA 4NIYE 3OZLA 3LQAH 4YXLH 3L5XL 2WZPA 2DY2A 3QORB 4FTVA 5D8JH 2ODHA 2R29H 3APFA 4UU9A 5C3IA 4UTBL 4UAHA 5CR8A 3QJQB 4IOSA 2P42B 4P23D 3VE0A 4N2EA 4TSAL 2HRLA 1BJ8A 3DJZA 4YDJB 1ZMYA 4C8XA 4PJXA 3KPRD 4X99B 2GG1A 4GS7B 5A6IA 4BDVA 1TNNA 4NQED 2VLJB 4M4PA 2GI7A 2IFGA 2ZT9C 3UG4A 3MNZB 4KJWD 1DVFC 3L3OA 2J5LB 3IFPB 4PYHA 3UPCA 4DKFH 2MPAH 4R26L 4WFGE 5FUCC 5HGDB 4G3YL 3MLVH 4MJ6B 3UTZB 1DO5A 1NCWL 3NIGB 4JY5L 8FABB 1NFKA 1HWWA 2Y07L 4PRPE 5G4NA 4L1DA 4F7EB 1R5IB 4HPOH 3OSKA 1FNAA 2P5EA 3MGTB 2ROYA 2VSKB 5T33L 1H3PL 5IFJB 4R8WL 3GSVA 3O2DH 4NRXA 4IMKC 4PJAB 1CE1H 3HZ3A 1KF9B 1ZHNA 4XN5A 3FZUD 5D71L 4MMYB 5D2NE 2HT3C 1LWHA 3SKJH 3RPIB 3BD3A 3L13A 3GDCA 4Y16C 3ARXA 4HIEB 3AT0A 3HEIB 1KTRL 2W60A 1U8PA 3B9DA 5D7JC 2B4CC 4PV9B 1NAML 5ES4B 2FWOA 4K4KA 3UO1H 2F0CA 1KOAA 3SGJA 1JRHL 1XB6A 5JW5B 3HZMB 5KUMA 3JWOC 4JFQA 3VXTB 4HALA 2X1WL 1DEDA 2OYPA 2J21A 3RDTB 2O6EA 5ANHA 3QA3A 3BW9B 2FEDD 2NZ9C 4L8BB 5J57B 4FXKB 1I7TA 2IPTH 1RZFL 1G7QA 4BZ1L 1JWUA 5A43C 4I9WD 1MAMH 1FZKB 4NGHL 1QR1B 2A3TA 4OLUH 2E3VA 4AIZA 1B0GA 3DX1A 3O3AB 1TCMA 1M2OA 3KPRE 4OKVB 2LOEA 4BCXA 4XC1H 3AU0A 4NHCL 3KYKH 4ONFL 1E7UA 3FW6A 1DVFD 1UD2A 1XF2A 3APCA 4X7CC 4NO0D 1XIWB 3NVQA 1RH8A 1FHNA 2QPDB 4YPGA 4NT6B 1Z32X 3U0TB 3LN9A 4M00A 4CADB 3HR5B 2W9EH 4GRMA 3LKQB 1S4IA 2AW2A 4RVBA 5EF0A 1W8EA 1DJYA 4J23A 1T03L 1G9MH 3T0VA 4ABWA 3AQYA 1NIFA 4K8RC 3RWIA 4B3EA 3MX0B 1QLRB 1ZGLP 2QELA 2ITEA 4U7MA 3QDJB 3RTQB 1ILUA 4ES9A 1XSIA 3V0IA 1WZKA 1E67A 3OXRB 3DURA 1NCWH 5HHQA 5CR1A 5LGKA 2WGNB 2CUMA 4KQ4L 1FNHA 3SPVB 3G08B 5HI3C 1N8ZA 1HZKA 4JMNA 4RIRA 1KB3A 5K1NA 4I0KA 1N0LA 2IQAB 1CZ8L 1S9VB 1E5YA 3GB7B 4U1SA 4A68A 1AQDB 2O6FA 3MUGB 4BJLA 1JPGB 3B1TA 1IMHC 1CFTB 3SYPA 2X53A 3OHXA 5FM4A 3NACH 5F96H 3UDWA 4S0SD 2DIAA 1IVLA 2OI9C 4PJ7A 5TTRA 4AE0A 3L4UA 5ILTL 1W9XA 3FCTB 4HWEL 1OO2A 4LHJB 1XH1A 4NKOA 2N0MA 4M6OH 5AW1B 3ISWA 1QWNA 2DKMA 4ONGH 3PUUA 4TRPL 2Z35A 4BQ8A 5FF6B 3Q5OA 1NOLA 1OV8A 3BD4A 1KCBA 1A9BB 2XLLA 4PJ7E 1T0MB 5GGSB 1GTNA 3GZPA 1LNUB 1YRKA 2PCFA 3GMNB 3ARFA 3L1GA 3LNHA 4GQRA 4NQQA 4UDTB 1WBZB 4JAMA 1O9WA 2VDML 3OR6B 4KI5C 2MEJB 4DESA 2DI7A 1D5IL 4OZIA 3DSFL 1A3LH 3IFLL 1AFVL 3SE9L 3RGVD 3NTCH 2LAGB 2M8XA 1CC3A 4CUCA 3RP1A 4H8VA 4WWNA 3BZ5A 4HJEA 2X4RB 4QUOA 2XG4A 4XP1H 3MZGB 1KCUH 4PW4A 3K0YA 5BQDA 1SVZA 1EFXA 4XNXL 1IAIL 2WY3B 4R0LC 1XB3A 1GOFA 5T1KA 2WXGA 3ZOAA 2Z65C 3FPYA 4PR5A 4B9IA 4WUUA 1WZMA 2YA2A 1NGQL 3D2UB 5DEGA 2I32A 3QXVA 4Z7IA 4CJ0A 2BX5A 1JPSL 1PCSA 1XR9A 2CLVA 4OLXL 4GAYB 1F3JA 3BAIA 4MB1A 3V7MA 3MO1A 2GK2A 4NYLA 4LRNH 2YSTA 1U8KB 3FU6A 5ADPH 5ID0A 4WK0B 1OAUL 4FNPA 5F93C 3PU7A 1BVNT 2G3ZA 1U58B 2FT7A 4YHLL 3MCLH 4AXWB 3I6GA 5L7XH 5HHME 3Q2WA 2OSWA 1LP9F 2C9PA 2FLMA 2YD8A 4Y9EA 4E41D 3WAJA 3JTSB 5FO7B 3RTLA 1RHHB 1SUJA 2VRAA 3MACH 3BGFB 1XF1A 1GH7A 5A7BA 2OZNA 3ESUF 1IGJA 1B0WA 4YHZH 5DD6B 4ADJA 4D9LL 1HH6B 5I28A 2GK0A 4QTIL 3FYEB 2JJUA 4K5OA 2XKNA 1HHKA 4ZDHA 5KYXA 2CLZB 2CLRB 3SGDI 3VSTA 2EUWA 4LLVA 3ZTJG 3MRKB 2V5MA 5F9OH 5F0MB 4GIPD 4PV8B 2JCCA 4Q0XL 1CR9L 1H6EA 1SDDB 1YEWA 2GKIA 4RFEB 5K39B 2CJTA 4KV5E 1PZDA 1QA9A 3RB5A 1XF3A 2Y36H 4G70B 4NNYB 4HKZA 1UJ3A 4Y4KC 3V5KB 1JL8A 5KANI 1N6VA 1WLHA 1MPAL 4NLHA 3IDIA 1MFUA 4M5YL 1ORQB 1PEWA 1NSNH 1BD2E 3VGBA 4JRWA 5AL0A 5C09A 4JZOA 5JW4N 5C0GB 2CMRL 3ZVVA 1ETA1 3EJUA 1S7TB 1AGDA 3F7YB 1K5NA 1S7SA 5C08B 1MRFH 5F9DC 1ECYA 2VDOL 3D85A 4HUVA 4JY5H 1C8QA 1RIVH 1E9QA 1KIUB 4X7TA 4HUNB 4AT6A 2NW3A 4N8VG 1MFEL 2AEQL 3O8XC 3SDAD 5F70A 4X5WA 2Y2TA 3HFML 5M95B 3X3FH 1S5HB 1FC1A 1FNGB 3UG5A 2FQFA 4UYPA 4BSJA 3SDYL 1GGUA 3I02A 4KXDA 4MCZB 4FGMA 2Q7YB 3AXLB 2G75B 3FSOA 1WUZA 2WKOA 4ILDA 1V10A 4NQCB 4HZ1A 3TBYB 1QKZH 1IGFL 2B9AA 4Z7VE 1N0XH 2ZX8A 3D0VA 2G9HA 5IGXH 3CAFA 3OB8A 4A55A 1WFTA 1UB6A 2C7UA 2XQYK 2JKNA 3BUYA 4H8WH 2C4FU 4N1EA 4WV1B 3UTSA 1MHPL 2YMXH 3BSZH 5IBUB 4NO0A 3WUWG 4U1LB 1AR2A 4L9DA 1EQWA 2JELH 4I2XB 2CZNA 4X4ZA 4KV5F 3U30B 1G43A 1H6TA 1ZT1A 3RU8L 2GIXA 5HHVL 5LGJA 1UUNA 3KYMB 5AVZB 3GTTA 5D2NC 2YARA 4I5BB 2WVVB 3S34H 2QDVA 1PZ5B 2X42A 5LDSA 5GZOA 2X7LA 4HH9B 3VFWB 5A16A 3S3BB 3RNKB 1ZXQA 4JDEB 4RZCB 4YBQC 2WP3T 3UP6A 2G5RA 2CM5A 3JUYA 4PS4L 4PGBB 4X6CE 2Z8WC 5JLZB 3QWOA 1V5JA 2IOIA 3NIFB 4GI6A 3V4PL 3ZBMA 1D5XB 4F8PA 1V8HA 4JM2C 1QFHA 2PTVA 3A6CH 4YXLL 1BFVH 1CFMA 1ERNA 5D5MA 2ZUTA 3T6ZA 5E94B 2V5TA 5JO5B 5JZ7C 5JW4Q 4U6TA 3PL6B 5B7EA 1VFOA 2YSSA 5K1VA 3WS6C 3TYFA 3KPOB 3ARFC 1AHKA 3CXHJ 3MXVH 1JG9A 2QSCL 2LT9A 4C57C 2QV4A 3HG2A 3OD3A 3IKCB 4MMZA 5D5ME 1NUNB 3QS3A 4QRPE 3F7KA 4DTGH 5IZ7A 2ED8A 4C4UA 3OJVC 2B0SH 2B9BA 2XG5B 1P7BA 2DYPD 3RLSA 2F61A 3QC5X 3UAJC 2Y7MA 2XVGA 1BIHA 4TULH 5BUAA 2OJEB 2F7PA 1E3ZA 1GJUA 3BDYH 4UQ3A 4L05A 3GZKA 4G8FB 5CHNB 2H1XA 2J73A 3U4AA 3K80A 3RWGB 1XIWC 3Q8CA 3Q44A 4P2RE 4POZD 4RFNB 5FCUL 3FSWA 1IC5L 3H9YA 5F9WC 4FQCL 1JZIA 3GSXA 5GS0C 3GZQA 2BVYA 3HNTL 2QZ5A 1OK0A 1CICB 4NN7C 1F4XL 2TRYA 4PJFF 5MENB 5EBMA 1EUUA 1W80A 2H26B 4OGZA 4S2SA 3EYSL 2GSIA 4XNUH 4DGWC 3UIYA 1O7DC 3DA0A 5A1AA 1PKQA 4HLJA 4P2RA 3REVA 2WLIB 3EH4B 2ZYIA 1U3JA 3FHQA 3FFCB 2R2BB 4XWOD 4R9HA 3P77B 3RL2B 4GQZA 1Z3GL 3Q6FB 5JZ7D 1NJ9B 1OW0A 3O6KL 2R4RL 3T0AA 1D2OA 2KQNA 5C9KA 2Y06L 5IQ9B 3ZDXF 4ICXA 4EN3B 1FGNH 1KENL 2HAZA 3MC0A 4Z7WB 2WCPA 4OF7A 1FDLL 1OGTA 3CG8A 1UFGA 4ZPTB 5C07B 1A1NA 4Z5RA 4A2MA 3ZLQC 3GUTB 4F7CB 3MLTB 1VPOH 4PG2A 3WJMB 3MV8A 1UT2A 2PW1A 3OC8A 2C8NA 3TNNA 5D5MF 1TJIH 1KPVA 3AXIA 3P0GB 4XPGL 2F8XC 4GBXD 1H3WM 2ICWB 3ES6A 3IJEA 2AQSA 3F5WA 4JHVA 5CNHA 1NM4A 3HZKA 4G7QB 5KZCB 2GSGB 2K7PA 3F7PC 5C0AE 5CKAA 2HX8A 2HJKA 3IJ8A 1I7ZA 5CEZH 2DAVA 1HH9B 1IBGL 3DX9A 1K4DB 3TONA 1LILA 1EAPB 2VQ1A 4MVBC 4QRPB 4W9HC 4XP1L 5CGMA 4JQIA 1PAMA 1UB5B 4PD4K 1N12A 4N0CC 4LEEA 2R23A 3RRQA 4HAGA 1J8HE 4FLQA 3V0EA 3JVGC 3UJJH 4WO0A 3VD5A 3KLSA 2RCSL 3ZZSA 1Q9WA 3ULUD 3EYSH 2WLMA 2IPUK 3UBXG 3I9AA 2CPUA 4HS6B 3NJGA 4XI5D 4L1TA 4G8EB 1U3YA 4MQXD 4YO0A 3B5HA 4O2CB 4DO5A 1Z0NA 3ECQA 5IR1B 4PJXF 4YEFA 3DTXA 5F88B 3TO2B 3EGDA 1SEQL 5E8EB 5BVPL 2HRHA 3WLWD 4X4MA 4QXTA 5D9SB 4F9LC 1QQDB 1PZAA 4PAZA 4N86A 3NOIA 3V52L 1MW1A 1FVDA 2YC1B 4QOKB 4X6FA 2NNAB 1EEYB 2KS0A 3FU5A 1OGAE 1FIGH 1FZOA 3RVXC 2DEXX 5GGTL 3F58L 5HYQB 1HEZA 2DOCA 4ABQA 2GJZB 4YHOL 1B9ZA 4RMWA 4U6YA 4MGXA 2NY4D 4PJ6A 4QOKE 1VEPA 1ZHKA 3VRJA 4R7NB 2NW2B 5DT1H 1J9SA 2I25N 4P9HC 3LKSA 5ENWB 4A7QA 3QIWD 5KSAD 5FKPA 3UGUA 5KVGL 3QEGH 3CU1A 4L1SA 1JZ5A 3L4CA 5MHSE 3RZCA 1XXFC 2HWZL 4Y1AD 2DQCH 5KVDL 1E9PB 1WE5A 2DM4A 3UABA 4MXQD 4EBQL 1JZ2A 1YUHA 1IFRA 2BRRL 3TP4A 2WK2A 1GSKA 1TVBA 1F1DA 1MWAL 4QXUH 3SO5A 1O7VA 2WQVA 5FW6A 1UH4A 4ZMLA 2KYIA 3EZJB 3SDYH 4I7ZC 4PJBB 3C5SA 2HPOA 5GS3A 3CE1A 4LVHC 3T77A 5B3JE 3GINA 1IT9H 3B7SA 3D2UD 5E2UL 4YE4H 4I3RH 1ND0A 1OHQA 3DVFA 3LTVA 5EO1A 3PWPD 3OZKA 3QFDA 4U1JA 3VCLB 2W0FA 1J8HD 5J12B 2UUDK 4OSUL 2H9GA 1CXFA 5EUOB 2G5UA 3GXDA 4LL9A 1YPZF 2BSSB 3KMDA 1JDCA 3F7VB 5F9WB 1X5LA 1TU2A 2JXMB 1I1YA 5AALA 1EGJH 3G9VA 5FKAB 5BNXD 1RURL 2ERJB 2ZX6A 4JW3A 1J05B 4JM4L 4QLWA 3MCG1 3L3HA 2ATKA 4OCXH 4GSXA 1K72A 1Q9LB 2YWYA 3GSWB 4YXHL 2BC4B 5LWYH 3ESNA 2XWBA 3V4VB 2C9RA 4FKKA 4TNFA 4M56A 1JNLH 4OFYA 4I77L 5F7YC 1QTSA 1AKPA 2JCWA 4WI2A 1PF3A 4R4ND 4KKLD 5H37A 4HJ0D 4FOMA 3WIHA 4XPBL 2VLKE 3BZ4B 5AD0A 3FO9A 3SB3A 3QCTH 3D9AL 3BUTA 2WYTA 3R0NA 4CA4A 4K3DH 1HQRA 1JWMB 2A9MH 4FNLL 5H2BA 3VH8G 4Y4KD 4PHXA 2VMDA 1X6LA 4I0PB 5GRVL 5IUSA 3HCVB 4KPHH 1IIKA 1Y18B 3LN4A 4DZ8A 4DGYH 2Z7WA 1KJ2L 2YWZA 3VSVA 2JKLA 2ZOKB 3X12B 1H3PH 4QKXB 4Z7NB 1RZQA 3O3BA 3P9WB 3QIWA 3SDAA 5KSAA 2HMIC 1I85A 3BPLC 1P84J 1JD9A 5G4MA 1THCA 4GB9A 1MREH 1H5BA 5L6YH 1QBMH 4Y4FA 3QDJD 2Y3AA 1BEYL 3MA9L 4R97B 3IGLA 1FL6B 2OR7A 2AHIA 2FBJL 4LNRA 3HE7C 3N40P 5FV1L 4C83A 1FRGL 4JO1L 4YFDB 3SBWC 4M62L 3FYIB 3WKQA 5E5UB 1U91B 1H3GA 3VFSB 2CJUH 5EU7C 4DW2L 4ZMTA 2WOBA 1E9OA 3SCMB 2QKIA 5HHPA 2OW6A 3GEFA 1UXSA 4LDCA 2UWEA 3BSGA 3TC9A 2Z64C 3L1OH 3CHQA 1XIWD 2ZP8A 2CA4A 5MEOB 1U2YA 3U25A 4AUJA 4FQLL 4KJYB 3DUUA 2P5WA 4GSRA 4WEEA 3TBCA 2O5ZL 4L4JA 1WICA 2KBGA 3D8MA 5FECA 4LDEB 1E27B 3ZO0A 1SF5A 4L4TD 1KIQA 1JPSH 4MMXB 1BAGA 3FQWB 1P7KA 3JUZA 1M2VB 2VLKB 1K2DB 4KITB 4C4BA 5TJWK 3BUPA 1KEGL 1Q0XL 3F7LA 3EH2A 1YYML 4GW5A 4F24A 4X9FA 5B3NA 2FATL 3OAZK 5FA4B 4UYQA 1AR1D 2ZKHL 3U7AA 4N0UB 3AJ7A 3VFMA 1NEZG 4KKNA 3ZKXC 5DYOB 3S36X 1E28A 3BAWA 4WUKH 5B4MD 3AM8C 3VFOB 2R69L 3MRCB 2HJFA 1M71B 1MCJA 2PWDA 3DVNB 4TF4A 5BVPH 2FT6A 1YEJL 2F54B 4KRLB 3D39B 1ASOA 4AE1A 1PSKH 2EKJA 3IFOB 4LKXA 3BEVB 1OSZA 4ODHH 5IOKA 3APDA 3B9EA 4UV7L 1FAIL 3ZQXA 4PJIF 4ZT1A 3BDBA 4WUUD 3SPGA 5DHDA 3FJTA 2RALA 2IQ9L 3CFBB 1D9KB 1P6WA 4K94C 3RI5K 3QI9B 5BOPA 4Y2OB 5KBMA 4JMXA 2RCSH 3S35X 3CFDB 3C6LC 1SUHA 2FD6H 4E9LA 3LH9A 2A9CA 1WFUA 4QRFA 4KGLA 5F71A 5HYFA 3NQIA 4MJ4A 2WWMD 4ENEC 2J43A 2NCMA 5AVUB 1HS6A 3FQ2A 2H2SD 4K9EL 2IDSA 4YZWA 3ME0B 3V4VH 3L16A 4ODVL 2CGRL 2BOBB 3EG9A 4L8DB 4NKQB 3ARFD 2XWRA 4H1LA 2XZAL 2XA8H 4JFYA 1PQZB 2OTUB 3CD4A 2IDQA 5M7QA 1ADQL 2VIRA 3BWAB 3X1EA 3ZYIA 5DD5H 4KVCL 2VLJD 2ZYSA 3VRLE 2ESVA 4HMEA 3RI5F 2B14A 4J6RH 3HLAB 2YR3A 4JDVA 1L6XA 4MDRA 4WHYG 3INUH 3TXAA 4WJ5B 3DLQR 4L4TE 4UQDA 1BD2A 2GT9A 1IC4L 2VC2L 4R4FH 1K3IA 1A0QH 1P6FA 5E6UB 3QUMA 3QIBC 5IVXF 1IGTB 2B59A 5DK2A 4EOWH 3D33A 2EH8L 2E7BA 4FYTA 3W2DH 4GSUA 1DEEA 1LD9A 4ZXBB 3CXDL 5GRVK 5IBLC 4DKDC 1FGNL 3I50L 4DGVL 1EFQA 4OCRL 4JR9L 4X6EA 4PREB 1XCTB 3BLKA 2O5XH 4M62H 1Z9LA 3QCTL 5DURB 5IQ7H 3EJPA 4OZFA 4RGOH 2P47B 1XL4A 3D4CA 3GRWL 5FM5M 2DQGL 4LEOB 3CFQA 3GJFK 4DWHA 4K71C 4KUZL 3T8VA 2C7FA 1MFVA 2XIDA 3HA0A 5DJ2B 3WLBA 4ACTA 5HYSA 2IANB 1ASPA 4RZKA 3MKKA 4P2OD 2PTUA 4ZS6C 5CKGA 2BY2A 3VW3H 5TH2A 2BSTB 5L8KB 3D51A 2QFRA 4PJ9D 43C9A 3EO1B 4UQCA 2KZ1B 4JX0A 1IM3A 1T20B 3MBEB 4CMHC 3GGWB 3DX7B 2Y7QB 2BHZA 1LGVA 4PLJC 2WBJB 4RRPM 4PFEA 3MLRL 5AVYB 4LCCB 3PXHA 4PSRA 3ZN6A 1O5PA 1UM4L 3S2CA 2EIMB 4XMUA 3C8HA 1ZHBA 4B97A 1S7XB 3JTBA 3QO0A 4HCRL 2ITCB 4J4PD 4MYWB 3ESMA 3ILPA 2RA1A 4J3SA 5HDQH 1CFVH 5IJDC 3GSNB 2YD3A 1U8QB 3MLXL 3EOAA 1WZ1H 5FW7A 5F1NB 2OJZL 3KHOA 4C4KT 3QP3A 4ZAKC 1ZOXA 1JP5A 1JVOA 2IGFH 3VU2A 1B2YA 5IBUG 5T33H 1IGCL 3ARBB 4JE4B 5FYLL 4XBGB 2J72A 1U8HB 5C6PB 5IGXL 1NTDA 4FMKA 4F92B 2XV0A 3QJFB 2DQTL 4PJ9A 2R29L 3BLBA 4IU2A 3OG4B 4WHTB 3SPIA 4PQXA 2P80A 3T4AA 2ALWA 3P4LA 4G3YH 5C0AB 2IH1A 2QPEB 1A5FL 1NANI 3HB3D 2IPKB 2X4OA 1XZ0B 4P9ML 4KO9A 3IWVA 1JFHA 4JFPA 3PNWA 4PTTA 3LKRB 2F1EA 1BMGA 2G2RB 2BM3A 3FB8A 5EU3B 3A6CL 2H41A 1W72H 1E4HA 3Q6GH 2RR3A 3H42L 5C0BB 2FX7L 3G6JB 3L5IA 4NNPL 1E5BA 1S9WB 4RGNE 2UXVA 3KR3L 5CSBA 4B53A 3AGVA 3UZVA 5T8IA 4YDJA 4ZPVB 3UJIL 1PZUB 1I53A 4RGMB 2AEPH 2BVQB 4OQ1A 1WTGT 3RVWC 1U0QA 1S7RB 4TUJA 4OY9A 4LPCA 2I7SA 4MAUH 4NQVB 2BFVL 2XWJA 2OCJA 3QXDA 1F6AB 4AG4H 4M8QA 3WTWA 3G5ZB 1I8LA 2W0LA 1JGUL 2ESVD 5GGTH 1YG9A 2CDFA 3A4DA 2CR3A 4AQOA 3II2A 4UBDC 4XVUD 3CFKA 3S0PA 2AKRB 2PWHA 4ZFZA 4X6DB 4X8XA 1CI3M 3LZFH 3CLEL 1IKFH 3N91A 3M6DA 4FC3E 1C5DA 4PJEE 4YBHA 2Z31D 4YDLC 5I6PA 4TUOA 1SYSB 4IDJH 3DSNB 1D6EA 2OJZH 1KLUA 2VJXA 5DWPA 1P4IL 3SGKC 1RMFH 4HIIB 1KNOA 3RGVA 2BVEA 2DKUA 4KX7A 9CGTA 1Z3GH 3V5KA 1I1AA 4J1UA 1AZZC 3QPQD 5JHDB 5MEPB 1R46A 4LLWB 4YZFF 4OJEH 3IDIB 3TLRA 2JLLA 4KUCD 4R96B 5TE4L 4NO3A 2A6IB 4YLQT 1HQ4A 1UOWA 4B7LA 1FN4B 1SDYA 1XGTA 2XX0A 3KGTA 3VACA 5F1IB 4LSQH 4KVCH 4BQ9A 3WKNA 2CNZA 3FUHA 3SDXB 4JR9H 1E9QB 1URIA 4X80H 4JY4A 3MBWB 1CBJA 3P30H 3RDTA 2UX7A 3EIFA 3B5TA 1MWAB 3QAZC 1MUJB 4Q9QH 3MCYA 5KYWB 2OMUA 4FXGC 2F8VA 5IMMA 4YUEH 2XTSA 4X9YA 2YZ1A 3BKCL 3V5HA 3ZRFC 5A7EA 4OM0L 3DX4A 5EFIB 2MHAA 2WINB 2WLHA 3QG7L 1FIEA 2E7LC 4CU7A 4GG6E 3KWWA 1Q94B 1QR1A 2X4TA 4OCYH 2CBOA 4JFEE 3RWEB 1CDHA 1EVTC 4WCYH 3CN0A 3WEMA 3IDNB 4E9TA 4PJ5B 1AHWC 4KUCF 2F1BA 4NBXB 3US1A 2YAMA 5G4OA 4MAUL 3KG5A 4LCVA 4NFCA 4HVBA 4LLYB 2WQAA 4P9HL 1RZKH 1HHIA 1HT6A 2VDLB 2DBLH 2DMCA 1KBPA 1QVOB 2YUWA 3QXTA 1AHWB 5HJDA 4OCWL 2YBRB 1OF2B 3LY6A 4HWEH 1J0IA 1YYLL 2XFXA 4TULL 5DQ9B 1P9MA 4K2UH 5FGSA 1YNLL 4OF3A 1NEPA 3BAKA 4NCC2 3FQRB 1A3RH 2DQEH 3U36A 2HLFC 3QIBB 1HJCA 1TTCA 2YQBA 3WDHA 3WOVA 5L2KA 3LEYL 4TLSA 3WKMH 2HFTA 2AJUL 5D93B 3NFSL 5HHQB 1A5FH 1E43A 1X9RA 1DDTA 2DQHH 3F84A 4CN6A 1N59A 4OZ4B 3QUXD 3ALXA 2V2TA 3QXAA 2HG0A 4IEFB 4G8GE 3CMGA 5L2KE 3U6RB 1AZNA 1WA1X 2ZP0T 5F3BB 5JQHC 1K9TA 5HD8D 3OG6B 4ZUVA 1ZJBA 3QPXH 5SWQA 2DJ4A 5H4YA 2WYZA 4PVLA 1K3ZA 3GMRA 1XX9C 1RP9A 4PCTA 2MNWA 4G7YL 4LCUB 2AANA 1ZHLB 3F04A 1KWKA 5ACLA 3S37L 2EJ1A 4OT1L 4KU1A 4PD4J 5K59E 2AK4B 5I0VA 2EDOA 3MFGB 2B77A 4F2MB 4NQSB 5DMYA 3HOGA 4KJQD 3VGGA 2NY2C 4Z0XA 4IKJA 2LQRA 1XMWA 4ZMXA 1RZGA 2ALAA 5LB1A 4UDTA 4X5XB 2TSAA 2VDNH 5HVWA 4OQTH 4FQ2H 1RQ5A 4M48L 4YSPA 2WNXA 3OHXC 2WWMC 5L9DH 2RMNA 2J12B 3WIIL 1CE6B 5DEZA 4JHZA 1JOIA 3KPPB 3ZT5A 2QQNL 3FFCA 3L7EB 4XBEH 1DBKL 4B9CA 3IXAB 4ZSOE 1SGKA 1IL1A 5T5NG 3W9DA 5K9OA 2WHVA 5F6IB 4DP7X 1YNTB 3AWEA 4NP4H 1AVAA 1FO0L 4PS8A 3SZ6A 3FO1A 5E2VL 1MFEH 2CUAA 3SCMC 3FCGA 3TT1H 4P57A 1RZ8B 4KKAC 4YFLI 4FXTA 4N87A 5EOTA 2WLKA 2JH2A 5GZND 4CN4A 1GGCL 1GIGL 2WBXA 3EZ8A 3F2LA 4D0CA 2EUXA 2Z93B 5D1ZI 2NQ3A 3GBNH 1A02N 1KGCE 3EFFB 4IJTA 3VH8A 1F6FB 3SBRA 2HTKC 4YGVB 3VXSA 4UM8A 3JQOB 3K2MC 1QKZL 4PJDA 4I4WA 1N6UA 4P4RB 4JCWA 4AC2A 1KTBA 1IQWL 3C08H 3HKFA 3L1OL 2YGPA 4LF3A 4LSRL 2NR6A 3UTSD 3SY0B 5F7MC 2E86A 3MRJA 1A3QA 4FQJL 3D39D 3FFDA 1DQKA 2ZONA 5J5EA 2F54D 4JK0D 4KXAA 1NOAA 5AZ2H 1OD9A 3RFZA 4K7PX 1UTDA 1KT2B 1IFHH 2YUZA 4WU7B 2VC2H 3VX0A 2O5YH 4QHMB 5FC9A 2HX9A 3ARPA 4ONFH 2BS71 5F9OL 4HHGA 2N1TE 5LNEA 1MCCA 1FWXA 1HH6A 2JJVA 3U4KA 3CSBA 4XPTL 4EUPH 2YLKA 3PGDB 2CRMA 3S4SA 1KPRB 5ABDE 3MYJA 4AENB 4EQ3A 4JHWH 3ARVA 3VMPA 1QSZA 5DFAA 1EJFA 4F15B 2DL2A 3V4PB 5BO0D 1NLBL 3ULSA 3N5AA 4P8QA 5ESAB 1JBJA 3S88L 5JPNB 1TYJA 3GHEL 1BPLB 4Y9FA 3VD7A 1IBDA 4U4BA 3PABB 3X14B 1RURH 4APQA 1AD9A 3RBSA 3B9KB 1AD0B 2XBTA 3F64A 1G6RH 3JBG7 4JFFA 3UDWC 3JWOH 2CKBB 3DMMD 2C1PA 4KH2A 4IHBA 1JYVA 2BXZA 3VQ1C 1WD9A 5TF0A 3QIUD 3VFVA 5E9DE 1MRDL 3IS1X 2IQ9H 1M6OA 2BOLA 2OMYA 2XA8L 2VXSL 5F7HA 1YAZA 3U4BL 1C1EL 4Z0BH 4M7ZC 1XF5B 2UZPA 4HZLA 1GGIH 1BEXA 3GBML 4QF1A 4ZUUB 3DROB 1PDKB 2VZVA 2APFA 5I8KH 4AMKL 3MRMA 3GSRB 3BWSA 3DBSA 5LXVA 4AGLA 5J3HD 1WEJL 4J3XA 2DQUH 4TN9A 1DVTA 5B39B 2Q7YA 3Q01A 3LXBA 1YMME 3BVUA 2WMPB 4QT5A 4Q4EA 1EHLH 4UAOB 5JOEA 3QUYD 1ZE3C 4FP8H 4IYKA 4MD4A 5EBWB 3EYQC 1DUYA 1UYWL 1VGEH 5D70H 2RFXA 5DUJA 1G5GA 3QEHA 4XMLL 4UAOC 5FM8A 3MA7B 3OPZH 4OUUB 3UBHA 3ZYZA 1TCRA 2Q8AH 1ZT1B 2MOQA 1A4CA 5DMKB 3CNKA 2X41A 4Q89A 2VITA 3N41B 3NEOA 4H5SB 5DI8A 1KXVC 3U6XS 2B4CH 4MJ6A 3RA7H 3RX5A 2DQMA 2W0FB 4EZJA 3BGAA 3VFGL 2GHZA 5D96C 3O3EA 1ZT4A 2V4LA 1FZMB 4Z7NE 4OGAC 1CGXA 4YGAB 5I26A 4ZZKA 2AXFB 4OCLC 3HPLA 2ZSWB 3G6AA 5E9DB 4GW4A 4YAQB 4F5CA 3WEBA 1U8OA 2XN1A 3QCVH 2PLTA 3VE0B 4NQEA 3ZUCA 3DARA 4Z95L 2ADGA 1P4BL 4IRJA 3AMLA 3UMTA 5D1QA 2BDNL 1NMCB 3DIFA 4HCIA 1YC8A 5CGTA 4YVUA 4F5CE 5ICZA 1J8HB 3KPNA 3EXLA 3B8SA 3KJ6H 1DHKA 1BD2D 1K8IA 2L8AA 4K7PH 4OVVA 1K4CB 4FE9A 4P2AA 4ANKA 5DEFB 3FQ1A 1I9IL 2IXQB 3L6FB 4H0IA 5DZJA 3BZDA 3S88H 4Q6YA 3MR9A 5F7UA 1NCJA 4MD5B 4XCYA 4ONHB 2NTFA 4WFHD 3SO3C 2OSYA 1O6VA 3CVIH 5E4EC 2QTEA 3SJVE 4HKJA 2GJ6B 3IPBA 5DCCA 4WFED 3VI3E 2CM6A 5LCVA 4OZGE 1WCBA 4OF5A 4XCNB 3MXWL 1EX0A 2YXVA 4Q14A 3UCQA 3X12A 2R2CA 1BM3L 5AVXB 4MDJB 4QMEA 3UROR 4PJ8C 3L3IB 3VI3A 4AJ0A 1G7PA 4I77H 2A0LC 3FTXA 4O5LH 2EO7A 1MEXH 1VADB 2X89D 3LV3A 2G4GA 2NY3B 4LHUA 5IFHL 3IJHB 1J0ZA 1EDQA 5E8DH 1LK2B 1X4YA 4Q9QL 4GMTH 1WT5C 3F12B 4TLUA 4AZ8A 1BFOA 2F53B 1BAWA 4XMXA 3BZFB 3I75B 1S7VB 5AW7B 4EAEA 3NN8A 4YPGB 5AW5B 1V3LA 1DBAH 1X5KA 2A4CA 2VLRE 2XWCA 3O6KH 3SDDC 3U0PA 1FFTB 2N4IA 1WFNA 3VFPA 2LVEA 1NBYA 3C60C 2OI9B 2TRHA 2VDMB 3T6VA 4QYOA 3KCPB 4MCMA 2VAJA 3EFOB 3NCFB 3V0GA 1IGMH 1NDMB 4OAWA 1WFOA 1CLZH 5E1GA 4XE5B 1NFDE 3DOSB 4XNMB 4ZSOB 1BVKB 2VLRA 4AV5A 4TSBH 5H8DA 5DJ6B 1UOKA 4HKBB 5PAZA 4F1ZA 1J87A 2HJLA 2HT4C 3QEUA 4ELMF 2CBQA 1QX1A 3E1ZA 4QHKJ 3CXFA 3I6SA 3EOTH 3PWNA 1MH5A 4JO2H 3GK8H 4YK4B 1UWEH 1INQA 1UD4A 2L7UA 1HH9A 5IESH 1YN6A 2ITDB 2JI1A 1IM9B 1L9MA 2AAAA 3NZHL 3ZT7A 1R3LB 1HXMA 2BZCA 4PEEA 3ROLB 3RQ3A 2NUTA 4MJIE 4WF7A 3BP5A 4KJWC 3E3QC 4QRPD 1N26A 4XXCA 3Q2NA 1IJNA 3WYRA 3LXUX 3S5LA 3VFOA 3SKMA 5MP6H 4DK5A 1JN6A 3IDGA 1QSEB 2FJHB 4XNUL 4YE4L 1DQMH 3EF4A 2QSCH 1AQKH 3G04B 4HWZB 4MJIA 2FBRA 2YPKA 3EDJA 1NUFA 2BY1A 5F6IC 3VG0L 4EQ2A 3RBGA 2GJRA 2G4EA 3FT1A 5EU4A 1XR8B 5DJZB 4DN3H 1KB9J 1OQOA 3GF8A 3NABL 2QQLH 2YPLD 3AG2B 4F58L 3Q8FA 2AEIT 2JB5H 1Z9NA 1TETH 4FQ1H 2QSVA 3QB7C 4LIQH 4H8WL 4Z8FL 4NKDA 5F88A 4AKOA 4MCNA 2NR6C 2MQGA 5IHZB 2FSEA 5E2WL 3EYOA 4YHNA 5I8OH 2HVKB 2CK0L 5TDOA 1TETL 3D4ZA 4FQ1L 1OP5H 2NMSA 3UZEC 5I1DB 3O0RH 1KB5H 3LQAL 3PCYA 1UQSB 1A6AA 3VGAC 5DT1L 3Q8AA 1P4LA 4JFSA 3NUKA 4GAJL 1NGWA 4UQAA 2LLNA 2OQJB 5AENA 2X89A 4GP8B 4M43L 3SDXE 3KPSA 4D9RD 4FFYL 4U6YB 1DE4A 2AJZA 5T1KB 1U92B 4WW2A 2XN9B 3I2CH 2J3SA 4AWJC 3H4FA 4TS6A 4JLRA 4UT9A 1KCVH 1TEYA 3D2UA 3PHOA 4XB8A 2B1HH 1NDGB 2AAVA 2NY1D 3QZLA 2GAZA 4UANA 2GJJA 3L4VA 2MOGA 4O02H 3GMMA 2BIHA 5DO2C 2BP0B 4YC2C 4GW1B 1S7WB 5E1AA 3RUGB 2UZIH 3L3OC 1IZKA 2HKAA 4MNQE 1MCPL 3BLPX 4HJ1A 4JFQB 4HT1L 3VXTA 2C1OB 3GRGA 3HS0A 4R4NC 3SPCA 1N2RA 1IGIL 1R3IL 2Q9OA 3D87B 4P46C 4UM9B 4X4XA 4L8BA 4OTXH 4WNQB 1KEMH 1JGVL 4L0YA 4BCZA 2YD2A 2I9TB 2P5PA 2OA9A 3QC6X 4LOFA 1KYAA 4YPJA 4HF5L 4DZBB 4K7FB 2WZ6A 4IGBD 3I6LE 3LXCA 4N8CL 1SXNA 4AJWA 4L8SC 3GKWL 1QSEE 1PX4A 4J28A 2NDFA 4JFTA 2YPVL 1KXTB 2X10A 1QFWM 2XXFA 2HT4D 4HUUA 4KHXH 4RISH 4B5ZA 4HWNA 5BPPA 3O4OC 4EIBA 2WYHA 5F7FA 1EA9C 3BYTA 5CZVL 1XF3B 4MXVE 3DJ9A 2R4RH 4PRHB 3TCXA 1DFXA 2BSED 3ETBJ 3PHQB 3DVGB 3I6KA 3KPRA 3LH2L 4MNGE 4LL1A 2VXTL 2JKIS 5D96B 1W6LA 1HDMA 1OTUD 4LB8A 1ODUA 1MCOH 1HU8A 5KBPA 3U7YL 4FXGB 5JW3L 4MYPA 5PCYA 1VZIA 3OQ3B 5JW5A 4MNGA 2A5UA 2ID5A 4JDZB 3RWDA 1NQBA 5EZJB 1G1OA 4M8RA 5CBEB 2XKNB 3UTTB 2E5EA 4F3FA 1GKEA 5JXEC 3E0GA 1SN0A 2CLZA 3DJSA 5C9JA 4PJXE 3NJXA 4I8DA 3CDGB 3N44B 4JVWA 3OJMB 3BN3B 5HGAB 3TV3H 3BKYH 5FYJE 4JRYD 2WWOA 3KS0H 4DHLA 4FZ8H 4F93B 5J1SC 2ATPA 2PYEA 3QZNA 3I84A 3FOMA 5DEJA 1GYUA 4G8GA 5J6SA 1D5MA 1D7BA 5EEXA 1G7MA 1KIPB 3TH4T 3QFJB 1XMEB 3VXPA 5I18L 1Q9KB 4P2CG 2IH3B 3NQKA 3U79A 3N43F 3QUZB 4Y4FB 4MNQD 4KI5D 1W8NA 1JGDA 4XX1G 4Y4FD 2K3HA 4LU5H 4H40A 4KY1H 3MRBA 3GXPA 4ODVH 2ZOLA 1S3KL 1AQ8A 5FO2A 3QFJD 1XZ0A 2ZX5A 3AROA 3HN5A 5GS0H 2HH0L 4LDLB 2F7OA 2PP9A 3KPLB 4KHXL 1ZVSA 3FU7A 3TBTA 4OR1A 3WD5L 1J8SA 1UCTA 2JJTC 3W0WA 3TCLB 1E6JL 3PP3K 2X05A 1OPGL 4MLIA 1QSED 3HAEB 3TZVD 5BZDB 5LKNA 3VXNB 5DSCA 2OCCB 2H47C 5F97E 3LS5L 6FABL 4OJDH 1O6SA 1HYRC 1CZ8H 1JGVH 5TK4A 4HX1A 4JO5A 1NGZB 1E4WL 1J1PH 3FOLB 1EZUA 5LUMA 3OPZL 4DUXA 3N9GH 4XMLH 3BWUF 2XQYA 1F6AA 1EZVX 1ZSDB 1UYWH 1SFHA 4BSWA 3B7TA 5DGQA 2BFGA 3GB7A 5CCKL 3TYGH 4IRSD 1NLDL 3ECBB 3K5SA 4A37A 2E9GA 2GCYB 1RZ7L 5FLVA 2ADFH 5E6ID 1CFTA 5D1ZA 2JB5L 2PUQT 2YD9A 5AYTA 5A2IH 1JDDA 2XBDA 4HIJA 2K70A 4LGSB 3MO1B 4NYLB 4HGWB 1WA0X 3D7PA 4X6DA 4PJDE 2BSBA 4FLRA 1J1OL 1ZLUH 4IIQA 3BD5A 3VFWA 2IPUG 4S1SH 5L4JA 2VKWA 3ARWA 5DVMA 5D6CA 4GI9A 4KDTC 2HPTA 2PW2A 2Q76B 4HUMB 1JHKH 4X6DE 3WL9A 3K6FA 5DJCB 3L3OB 1QBLL 2O5ZH 1VSCA 2EKSA 4UM9D 5CN3A 4U1GC 3CDCA 2ZXCA 4JG0H 2EDYA 3CFDA 1F56A 3MV9D 4IBSA 4Y9CA 2RH0A 1MPAH 1HKLL 1T03H 4NQCE 3QDJE 2ZOWA 2YGNA 4AQ8A 1KJ2H 1KYDA 4ETQA 2EVJA 3CBRA 3FRUB 2L04A 5FYJL 3UEQA 2IAAC 1I9JH 2IMNA 3DOIA 3PQYE 5GRJL 2VR3A 2NY1B 2WZPD 1F11B 4I0PC 2DD8L 5F3HA 4KQ4H 1MAKA 4ZOAA 4UMSA 4TTGA 1T4WA 1ZK9A 4UQ3B 2H1PL 5CP3H 4ZW3A 3POHA 5DQDH 4DEPB 1YN7A 3MV7B 3EJCA 3VFNB 3K6SA 4DPCX 2CLVB 3IF1A 2DH2A 5JHLL 3AG3B 3M7FB 3N06B 3B2MA 5DHYA 4MASA 3AACA 3EO9H 4WJ5A 5ID0B 3VWKA 3R7RA 2PNDA 5D7JD 3C5JB 4GRWB 3LEVL 3WO3B 4PB9H 5LWYL 4S2SB 2ZUYA 3H9SB 4GKNB 3P9MB 4OLYH 2NSXA 1QW8A 1F4YH 3DO3A 5BCAA 5IVOA 3BW9A 3VD0A 2N56A 3OKMB 4L3CB 1J5IA 2V9RA 1D5ZB 2E4FA 1URZA 1ZCRA 4KUZH 1GCFA 1G7QB 1ETZA 1JS4A 3GMLB 1Y0LB 1FNSH 3GSQA 4ONOA 3AXLA 5BV7H 3MBXL 4MD0B 3HE6C 1I3UA 1F1GA 1HHKB 3CX5J 2IFFH 1UKTA 3NH7L 1EXGA 2FWUA 12E8L 1SHMA 3NZSA 4RMSA 2WNKA 2XTJB 3GUTA 1TQTA 2WIIB 1O5DT 3AQZA 4J3OC 4Q9RH 3ZTDC 4EN2A 3GM8A 1MCIA 3MRPA 3SD5A 4ZTOL 1FAKT 5C09D 1AGFA 3RTQD 3SQBA 1JI2A 5EMYA 1WAPA 4CVWA 1X7TA 4LSRH 4WGVB 3SE9H 1CDUA 1RULH 4Z7AA 3E8VA 4BHUA 4Z7OB 3MV9E 5D72H 3HVDA 2WBJA 3IE4A 4JFVA 3DO7B 3D2TA 1J5HA 1P4BH 1W6WA 4ZX5A 3WU1A 4KRMB 3MV7E 3IVKA 4LVEA 4L4VE 3IAGC 4YSSA 2OMXA 1MNUH 1SXCA 4NS0A 4BE6A 4R26H 1DVFB 3IU4H 1CK0L 2DQFA 5EWIL 3SEPA 4KK9C 3VYOA 2GJZA 3FXIC 2MH4A 5KYUB 3OXRA 4KFZC 4PJHE 4HISA 4M6OL 1U95B 2EDBA 4K94H 3VRIB 5IG7A 1GZPB 3H0TA 2KPWA 3WUWB 1AIZA 1QBBA 3RVUC 1FL3A 3LYRA 2EUVA 2RACA 2HKHL 3GXFA 1S9VA 4U1SB 3QISA 2I26N 4OFQA 1D9KC 4G8EA 5GS0D 1UT9A 3QRLA 5F44A 4EI5B 2A77H 2G9HB 3BE1L 1TJMA 3HMXA 3EDFA 5D8JL 3HHSA 3NIFF 5HDWA 5JIMA 1JHKL 3ZTJH 4IU2B 3KPPA 4XGZA 1MIEL 2X5PA 1NCCH 4GI8A 5IROD 3OLGA 3C5ZA 2QQKL 1FFNB 1YEGH 2HA1A 4WI8A 1P69B 4RNRA 4HLZG 5IB2A 1HNGA 1A6ZA 1FZOB 2MPVA 2ZIDA 3DXAA 5E4OA 5JDSA 4NQDA 2VDQL 4DN4H 1G0DA 1CDBA 5JOFB 3NJMA 5GISH 2V7NB 1CICA 1S7UA 3AWFA 1E6OL 3FCSB 2DMHA 3RFRA 1GHFL 4XNAA 5IM7A 3ALWA 4F33B 1BX2B 2XTLA 4P2RB 5A2KH 2EDKA 4P04A 1W0VA 3U9WA 4DFHA 1I1YB 3DX3A 5FKPB 1JUFB 4I4WB 4P4RA 5GS0L 5C09E 1HFUA 4IOFD 3ZL4L 4AYMC 3QE5A 3QDMD 3QK0A 3WFDL 1IAOB 3QJXA 2B20A 5F8RC 3VB8A 3T1FA 3GI9H 3BP4B 2XZCL 1VFAA 1F3RB 1DJIA 1D6VL 2FBJH 1PTZA 1WS8A 4JNXA 3BO8B 4RBPH 3KGSA 1UUSA 3IDMA 4QGYA 3DX8A 5LDUA 5BRPA 1AXTL 4X99A 3HI1A 1MRCH 4GH7B 4ZPTA 5C07A 2CCVA 3UADA 2VDOB 4ADGA 2D7PA 1X5ZA 2XNAB 3AY4C 3DTDA 4OUOA 4U6HA 3WE6B 3WJMA 4ZUSA 3W39A 3T6XA 1F3DJ 2R15A 1Z5LA 2VLME 3BKCH 3CFKB 2FGZA 4OLVL 2TSBA 3NIDE 2E6QA 3TN0D 8CGTA 2H6OA 4JKMA 2YAFA 1QMUA 4XP5L 4GLRH 4Z3EA 2HLEB 3HE7B 4OJFL 2QHRL 4HBCL 4Q7DA 4UQIM 4PJAF 5FKAA 2OYKA 3NGBC 4RBPK 3SBQA 5JA8B 3HMWL 1I1AB 4J1UB 5HHMD 3CMOL 1E40A 4NRXB 4PJAA 4ZAKD 1EAPA 2VQ1B 5C0BE 2XIIA 1L9PA 3GJFH 3VDCA 2Q1EA 4ETYA 1NMBL 1TZ8A 3EOBB 3QIUC 4X8GA 4NQXB 1CFSA 3TT3H 1TMQA 3EJTA 1S7QB 2Z91A 1MAML 3MJ9A 3BEWA 3QCUH 3CHRA 4FQQB 3I3DA 2WANA 5DHVH 2BSDA 4WEMB 4C58B 4AYBA 4LNRB 4C83B 2GTZB 2DBJA 3LIZH 4LBEA 4PRAA 4L3ED 3DRTB 1S9XA 2OMYB 4PV8A 3FMGH 1A6UH 2ZSVB 3K6OA 3QUYB 5E1HB 1CD8A 2WTOA 1XAKA 2UZXB 3UJTH 2YPVH 2CXGA 3NH7H 1XH2A 1QI4A 1OSPL 3NJVA 2EDHA 3QZWG 4HPYH 4TVPD 5GGVH 4NRZA 3V5HB 4F7CA 4HS8L 1J9QA 3S8GB 1TSRA 5KW9H 4PJ9C 2BHFA 3W9EB 2XV2A 3W3BA 1XGPA 1RJCA 4N2KA 4MQTB 4N0FA 5KSBE 4NXKA 5CJ8A 1A1MB 2CBPA 5FOBA 2WB7A 2Y6TE 1CD1B 1HOCA 4XCCL 1UD5A 3MRNB 3T4YA 3D48R 2B8OT 4UNUA 5G5DA 5C3LD 25C8H 2A99A 3B3BA 4H2AA 5F9JB 1YEDA 2WKLA 5E99L 3BESR 5FCUH 2HJKB 2L4OA 4N5ED 2RTTA 4RAVB 1MWAH 1IKFL 5JUEH 3WIIH 4PS4H 4MA7H 2E27H 1MELA 4JPVH 5JIIA 3CN3A 2EDQA 4RDQG 3KLAA 4H0HB 4U7SA 4L37B 1RUAL 3JTTA 2FECL 3DMMC 1MI5E 5LN4A 3S34L 4P07A 3TX4A 2ZUQC 5B38B 1LK3H 3CDYA 3TT1L 3W11C 3MXVL 1UB6B 2HLAA 3BUYB 4NHUA 4JFFD 1QTYT 2MKWA 4M7LT 4CNIB 5I15L 4GT7A 1KLGA 2YXFA 1AO7E 1I8LC 1ZT7A 2MWCA 4RGMC 2AV7A 2P5WB 2XACC 3IJYA 3T8XB 1NC2D 1T4KB 4X8CA 1IBHA 2ZX9A 4PJBF 3IFPA 2N7SA 3V6ZA 2A73A 1A7BA 2WVTA 1MLCB 4BSVB 1RUQH 1UEMA 3DJTA 5AOKA 5EDSA 5HDBE 1T5XA 3V0WL 5D7JA 2PYFA 2XDHA 5K1JA 1SDAB 2C5DC 4M7JL 2AVFA 1YA5A 1ROWA 1EEYA 1MCEA 4LLUA 4Z9KB 3QDMA 4KROD 3ZPDA 4B41A 5E9NA 1DSFH 2ZKXA 3SGKA 1PX8A 1S46A 2DIBA 3BJLA 3GSVB 4A2HA 2D8KA 3L3HB 4LCWD 1G7JB 1M71A 4WWKC 3N42F 2NW2A 4HKJB 5CIPA 3CVHL 2VDOH 5E2JA 4NQSA 1WBXA 4D8OA 2OXGA 4KVPA 4OBRA 3PWUB 3AVEA 4HIEA 5E2TH 2WV3A 3LKPB 4HEME 5C0CB 4AQZA 4NLAA 5IEHA 4ODBD 1E3XA 2VUKA 2EC8A 5E00A 3EBHA 2BZ7A 2WXRA 4UV4H 5H37G 4XB7A 2CNYA 5I5RA 3CUPB 4YSQA 2GQHA 4F2FA 1KELH 4YHPB 3NZ8B 3HZMA 2H32H 1S2EA 3W9DB 3S36H 4RSYA 2QSQA 2DIEA 3O9WD 4U3HA 2EVHA 2VQTA 1LK2A 1QYGH 2EE3A 1AQMA 1EZSA 4ZRGA 3N1QC 2AXGA 3HC0B 5FB8B 1B3JA 2XG4B 4XMVA 5KAQG 1XCTA 2Z31B 1SQMA 3CPUA 1C7TA 4MXQC 4L2LA 2QVIA 4UF7C 4Z7VF 2AK4D 1N3NB 4CSZA 1SBSH 4QO1B 5J11B 3K46A 2VE6A 3UO8B 2N59A 2VM3A 4YS4A 4XODA 3ILEA 5ERWB 5CWSB 1LO4H 1NDMA 2BY0A 3WI9A 1ITBB 4Z7OF 4N28A 3GHPA 3D18A 2J1WA 1I8UA 1CXKA 2ESVB 4QYAA 3C9NB 4JHBA 1MN4A 1SBBA 4UOW0 2XRAH 1EBAA 1V3MA 2M26A 1R6VA 1U8NB 1KJ3L 2DICA 2KZBA 2OSXA 5EF2A 3O81A 5AAWA 4UTAL 3SCMA 1G9NL 2AV1B 3DX7A 4LARL 3UEZA 4Z7UE 2QEJA 1WISA 3ZE1F 4XP6H 1UG9A 3U46A 1ZANH 2IGLA 3ULUL 2YRLA 2C9XA 3QG7H 4FXKA 3F85A 3PWVB 4K15A 1OAKL 1HNYA 1EJ8A 5LG1A 1CU4L 1QHQA 1F4AA 2NY0B 1AHMA 4EI6B 3MX0A 4WJG3 3DV4B 4F1SA 4DGVH 3REWA 2ZCZA 5J4MA 3DYMA 1JWMA 5H2BB 1RUKH 1R24A 1T3FA 2FNWA 3AQDA 4J8RB 3ULVD 4DGUA 5DD0H 5J13B 3SPVA 1H19A 2HN7B 4PMFA 4R84A 5I6XC 1XB8A 1I31A 2JCCB 4XN9A 3TVMC 4JQVC 2A4ZA 4JFHD 2FE0A 5C0AD 1BVZA 5ADPL 5D2NB 2FGWL 2OX5A 3ARBA 4YMPA 3T0ED 2CJ3A 5CM1A 2WKGA 4Y88A 43C9B 3OHXB 4NT6A 3B2DC 3TVMB 2ZWSA 4WENB 2NY6B 2D7MA 4XHJC 2XPYA 1OM3L 3S36L 2JMRA 2AC0A 4E36A 1R34A 4TYUA 2XU9A 1A7QH 1F42A 3WENA 4C4KO 2YK1L 2VR4A 1RCYA 2FJFB 3IGAB 4PTTB 1VIWA 3LZFL 1DE4B 2AJZB 5JORB 1DLHB 5ALCH 3STBA 4WW2B 3RTQA 2J8UE 2CO6B 3DMMA 2BIMA 4FAAB 4QWWC 3UGEA 2CKBH 2IEPA 1OAZL 2K9FB 4PJCA 2WMPA 4G5AA 4WWOA 3QO1B 4LCIL 1QLFA 2EDTA 5FECB 4XN1A 1DUYB 2PN5A 1KIQB 1LO2L 1NBVL 4L8CA 1M2VA 2VLKA 3TBYA 4ZOEA 3S98A 5J56B 3A22A 5KYYA 4FYQA 2BNUB 3O0RL 2CDGA 4FX5A 1HYSD 4FHJA 4F7TB 2A77L 1YEJH 5DJ8A 3ESPA 4HXAH 5ICXA 3FUEA 3Q7JA 1U8LA 1PZ2A 3EJZD 3R1GL 4N2NA 3TNMA 1E28B 3A67L 2JB6A 4QXGH 4XCEA 3HLAA 4E0RA 4JFUA 1OCRB 4OV5A 5GGRA 1EEQA 2Q20A 3GBMH 3M46A 5DRWA 5CXPA 1HN1A 2YO3A 2XKUA 4IBUA 3SYAA 4CVUA 5FM5O 5AG9A 4PJCF 3K3QA 4DGIH 2EDLA 5EO0B 2X12A 4PRPB 4FQXC 2IMMA 3QDGE 7PCYA 1GAFL 2EEAA 4FNTA 2V3DA 3QRBA 3UYPB 2EH7L 5BW7A 1BJ1H 2CAKA 1ND0B 2HUHA 3MMEB 2D3VA 1JZFA 5TK2A 4G6FB 5GJTH 1C12A 1V3KA 4NKMA 3QQ9C 1K8IB 4QTHB 2UWEE 1K4CA 4JZNA 3QI9C 4LLVB 4DGYL 1N64H 2PPFA 3O8XB 2E59A 1WZ1L 2CDFB 1BZ9B 3PAUA 2V9UA 5AYUL 3ZMEA 5C3TA 5JIPA 4MD5A 1YY8A 3MRHA 3UZEA 4H1LG 4JY4B 3L54A 3UTTA 4Y5YA 5FA3B 4A7TA 2QGBA 1JFQH 2KT6A 4FFWD 5FUCE 1U8KA 1BQHA 3D39E 2NX5A 5CGBA 3IGUA 4DCQA 4WI6A 4JPWH 3C6LD 3V4VA 1IILE 1JHLH 2UY7A 4Y0GA 4M7KH 1INEL 4Y1AA 1LWRA 2G2NA 1SRDA 1T83C 2FB4L 1D6EB 2VOTA 5CU9A 4H44C 3O4LE 1H6FA 2VCOA 1SPDA 4JZOB 1AG0A 2D7TL 4OCRH 1NCAL 3UPRB 1JNLL 1FH5L 3UAJD 3HG3A 4HP5A 1MWOA 4PLOB 5JHDA 3JWNE 4W1TA 3IDNA 4LLMB 1N7MH 4Z7UB 3REVB 1M42A 2O26U 3Q9QA 1KIRA 4A39A 3CBKB 2WKOF 1NKOA 1T04A 2ORBL 5LBSH 1FLTX 1I7TB 1AKJA 3HS0C 1CLZL 1R3HB 5ELIA 3BPNC 3FU7B 3I02B 3TBTB 3ZQWA 1WFMA 5CFAA 1JZEA 3D06A 4HCGA 4UILH 5I1GL 3S3SA 1JIBA 3DX0A 5F2FA 5KYWA 3RA7L 1NGQH 1X5MA 1CT8A 1A1NB 3BPOB 4PJFE 4CC0A 3HUJE 2XZAH 1M9SA 2PXYB 2MHAB 2WINA 1BVKA 1Q38A 3CVIL 32C2A 4CKVX 2E7CA 4KGJA 4BH8A 5BUPA 1N4XL 1U8PB 1WP6A 4X6CA 2PMZA 2UY6A 3NSCA 4CC4C 2CK2A 4NWTL 1HILB 2ZXAA 5I5IA 1QW9A 2QQNH 3K2UH 4PJFB 5F72S 3ZYOA 2AQPA 1YEHL 1A0QL 1OEZW 1OB1A 2Z31C 4CADA 5HYJA 1QG3A 3WLWC 1T66C 1CG9B 4WY7L 5EULV 1A4BA 5AVTB 4NPYA 2R39A 3VXUB 3EJZC 5EOQH 4OGXL 4AT6B 4N3UA 1TQSA 5C0RH 3RPKA 4L4TB 2UWEB 4QKTA 4CVXA 2IAND 1DQTA 3L5XH 4DGIL 4QRPA 3VDBA 1A21A 2FJUB 3LS4H 4CC1A 1YDPA 2CU9A 2R23B 2Y2WA 3AS0A 4XXDB 3GRBA 4LL4A 5B8CA 2QQQA 5A2LH 1BJMA 4G6JH 4XNBA 1KB5A 4HIHB 4C55A 2PETA 3H6AA 1HOEA 3HC3H 3OKKB 3QNYA 5E5MB 5AEAA 2AK4A 4TUJB 2IH9A 5IY5B 3C6SB 3V6BR 3H4HA 4AVKA 4OI7A 4U0RC 4LSUL 1L3NA 1SOXA 3L3JA 3MSPA 3NK3A 3HNSL 3GFUA 1MJJB 5BO1L 1KULA 3ETTA 1KJVA 4HIPA 1S78C 1ZV5A 4KDWA 3ZUNC 4HIXH 4ELKA 4OFPA 4PJ7B 5K93A 2Q0ZX 3L7EA 3TESA 3WHE1 3EYFA 3BVDB 3B83A 3FRUA 4R5VA 3ECWA 1JZDC 1L9SA 2VWEE 4L29A 2CGZA 4Y4HA 1LEKA 5KVDE 4MAZA 5GZNC 4ORGB 5HJGA 2H0EA 1ORSB 1AE6L 4U4IA 3WY4A 1KXHA 2YBGA 3BQUA 2VLRD 4JQXC 5HGGS 1E6OH 3OR7A 2GABA 3IN0A 4NM8L 2H2PC 4DVRH 3DURB 4PBWD 4OLZL 4A2GA 5F7KC 5F6HI 5C0BA 5IB1A 3STZB 2FL5B 3FUDA 2EC9U 4WTZG 2ADYA 4TPRL 4U6XB 3C09C 3PGCA 2GVYA 2DQDL 3FBQA 2XPZA 2PKDA 1JTOA 1HEJC 3SY0A 2VAAA 3O45B 2E0PA 4YR6A 1T89A 3MYZA 3DV6A 5DMIL 4O4YH 1I3VA 3SDDA 2D2OA 3ALPA 4Q52A 3V0FA 5G2NA 2OZ4A 1LO0L 4HMCA 4QDGA 3C09B 3ECUA 5DJDB 3S35L 4KRPD 1EXUA 1MQKL 5L6YL 5I1JH 3NIDB 4BD4A 4MMZC 5K9OB 1PQZA 1BQ5A 1T2QH 4JG5A 2W07B 3A6OA 1NINA 1GTFA 2NNRA 4KMTL 1E6JH 1DQIA 3NJKA 1FVCA 1WTLA 1ODAA 1OE1A 4ZAKA 5AUMA 4MD0A 1MCWM 5KSBA 5DFVD 4O02B 1I9RH 2YQGA 4A6YB 2ZYRA 2ZUQB 3MYJB 4X7FC 3FB7A 5CGYD 3U1PA 4F7PB 5GJSL 5D1QD 1FC2D 1I1AC 2B59B 2EDMA 4S1RH 3QAQA 2E7LA 4G7RB 1EGJA 4DSYA 2BIPA 4NHCH 5K9KA 1G1KA 1UATA 3PE9A 3U2JA 4RMVA 4XH2B 1NC2A 5JW4M 1FSKC 1KB9K 2H8PB 4YDLB 3I3EA 4JFEA 2AXWA 4K23H 1AR1B 3ZGHA 2NYYD 5GGSY 4FADA 1CFBA 3GSWA 4LDOB 3BN9C 3K2UL 4JE0A 4XAWL 3VGEA 1K85A 3H85A 5EU6B 4FXGA 1TT6A 5J1AB 5JTWA 4YBLC 2I5YH 2HSIA 4KO5A 1UD8A 2OULB 3ABKB 2PW1B 1MW3A 4RX4A 3RHWF 4RFEA 5K39A 3RWDB 4GAYA 3NJFA 1N5YH 4OIIL 2OAAA 4Z7QE 1MUJA 2EIKB 3V7AE 4D9RE 2DLGA 1M9WA 2BSTA 4FG4A 4ZUWA 5B7FA 2DF3A 2IBZX 3DTXB 4I0PA 3HNVL 3SCMD 4YL4A 1LP9B 5AVRB 1DQDH 3KW7A 3FF7A 2DD8H 4HUWB 3Q48A 3D3VD 4AYID 5JHMA 3AS3A 3T3MB 3V6OC 1QYGL 3OTTA 5DK3A 1NIBA 3V6OE 4DVBA 5CEZD 1QLEL 5SWSE 3VGFA 3BXNA 3A6BL 1HXYA 3G5XB 2VGLM 4KTDH 2NW3B 5D55A 5I9QB 4AM0A 4AMWA 4HFWA 1VJSA 3WELA 4HGMA 4XPAL 5K9QI 1ZHKB 3UBXA 5C97A 5IQOA 1O7SA 4QR7A 4JKPL 3UCRA 1BVOA 3TCLA 3G6DL</