3AABA

Small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form i crystal
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
ELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIAGTSVFKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Putative uncharacterized protein ST1653
publication title Dimer structure and conformational variability in the N-terminal region of an archaeal small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 21
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aabA00
2BOLA 3L1FA 4FEIA 3L1EA 2Y1YA 4I88A 5DS1A 3Q9QA 2XCMC 1WH0A 2O30A 2KMWA 3GUFA 3QORA 4PCKA 2K8QA 4YLBA 4ZJ9A 4YE0A 1GMEA 4PBDA 1WFIA 2N3JA 2Y22A 3QORC 2Y1ZA 3GLAA 4RZKA 2WJ7A 4M5TA 3VQLA 5DS2A 2CG9X 4M5SA 2MNWA 4YDZA 2JKIS 3AABA 3N3EA 2CR0A 1EJFA 2RH0A 4JUTA 4JUSA 3EUDA 4ELDA 2WJ5A 2KLRA 3L1GA 3QORD 3QORB 1X5MA 3VQMA 1RL1A 4MJHA 4YL9A 1SHSA 3W1ZA 4YLCA 1WGVA 3IGFA 3GT6A 5LUMA 3J07A 3Q9PA 3AACA 2N0KA
chains in the Genus database with same CATH superfamily
1FNGA 4PLOB 4TM9A 5EU3A 2QVFB 3S5YA 5FECA 1QVOA 3MA9L 2XJKA 3FTZA 1A7OH 1GIGL 1GZPB 1KB5H 4FG4A 4XP4H 1P1VA 4R84A 3ZSTA 3SCMC 1MRFL 2JIXA 3MV8E 4IBSA 4X5LA 4PLJC 1C16A 1IGCH 3C5ZA 5IBLC 2WZAA 2H45A 3FU7A 3ES6B 3FAWA 3D18A 3QDMD 1HE7A 3F7VB 2NCMA 1SEBA 1KIQB 3UACA 1PZ2A 1QR1B 4N2IA 4OFQA 4ZUVB 1GYCA 4PJHF 3SDAC 3OGCB 1ZD6A 2W65B 1YPZA 4NHUB 4P2RB 4DGUA 2UWEB 1VIWA 3VFRA 1PQZA 2QQLH 1AP2A 1JPFB 2X3CA 3EH4B 4LQ1A 2Z8RA 1MI5E 2B3RA 1FWXA 3CZSA 3TONA 4U6VL 3C6EA 3ETTA 1PEZA 3VB9A 3IE9A 3EO0B 1H15B 3CZUB 4YQXH 3FQXA 3L9EA 1A7NH 4LLYB 1NGYA 1NMCB 4XCEA 3TBBA 2X9YA 2GBTA 2X89A 4G72B 4LLWA 4TVPE 5B1JC 2EVFA 5E6YA 3MV01 1M1SA 3ASNB 4YXKL 3PS6A 4Y4KB 1HWWA 3A47A 3PWLB 1B9ZA 2R1WA 3IETA 1T83A 1PYWB 3ELQA 3MLVH 3P9MB 4DO4A 5C0BA 5AUMB 5CM1A 3LKPB 1CFQA 2VLJD 2XWXA 1Y6KR 1NFIA 3RAJL 4JM2F 3OXSB 2HFEB 3RVWC 4FQIL 2NZ9C 4QEGA 3VX0A 5I6NA 5JOPE 2W0KA 2M83A 3UJTH 1QLRA 2Y2WA 2A6IB 2A77L 5A2IH 1XD1A 1IBHA 3G3LA 5C8JB 4QWWC 5I17A 2X2HA 5DD0H 3G5ZA 2Q20A 2XTJB 3FPXA 2D7TH 4W68A 3RVTC 4TXVB 3FU6A 3ENEA 4PN6A 2HFGL 5ESAA 2AQPA 1XF5B 4J8RB 1G7JA 1OSZB 3ROLA 2UX6A 4OLVH 3ESPA 5JIKA 5CEZL 1UQSB 3QIBA 2I85A 4HUXB 4DESA 3UAEA 1DHKA 3OMIB 3SGDI 5IFAH 1M3JA 1ILSA 1YEHL 2GW5A 3I84A 4NKQB 1BYOA 4DUVA 2KDYA 1YYLL 2MCPL 3JWOL 2PCFB 3ILEA 3QEHB 3Q7JA 3MLSL 1UACH 4WHTB 4C47A 5JLZB 2DQTH 1X5HA 2P45B 2Z7ZA 4MXQD 1NL0L 4QHNB 4XNXH 5IQ7L 1DTUA 3HZYA 2HJKA 1ECZA 4M93C 3V6ZA 2FWSA 2HN7A 2ICEC 3CN2A 4X5PA 4K9EC 4E41A 3VRLF 2BNUA 3PUCA 3BZFA 3WD5H 4UNIA 2WC7A 3KYAA 4X5QA 3CMOL 2VM9A 2ZWLT 4Y88A 3VCLB 2TSAA 4NZUL 4PTTA 1MLBB 1YEKH 5DD3H 2XZZA 4U1JA 1NKOA 1IT9H 3HOGA 3VJ6A 4FI8A 2Y3NA 2ZOKA 4JN1H 4XMTA 5T33H 4PV8B 4Y4FC 4G42B 4JGUA 3HHRB 3P4MA 3ZN6A 3NZ8B 1TCRB 2KDGA 4QXGH 5ITFB 2W92A 1SHMA 4UT9L 4RMUA 3JWDL 3TNNA 4XAWL 1U58B 1UZ6F 5KYXB 1F90L 1QFWL 2GTQA 3PL6C 3PPSA 4H2CA 4NOBA 4ONGH 1SHXA 3DV4B 4ZG1A 1X7QB 3K8KA 4L9LA 4POUB 4N6RA 5E2VL 1TU2A 3FMGL 4G6FB 4DAGL 1QBAA 2EVGA 4HV8A 4DP6X 4AJVA 1IGML 5IP4A 3OHMB 5E9AA 3RL2A 3CTTA 3S7GA 2NY6C 2IJ0C 2QDWA 4HC1A 3HFML 5L9DL 4JFZH 2G30A 3RA7L 4KKZA 3JV6B 1U36A 3PWPA 3GNML 2F8XC 1A3RL 4K3JH 3UAJC 2PR4H 1L3WA 1F11B 3VXRA 4XXDB 3IEAA 3MRBB 4K3EL 2BRRH 4WQOA 1RZFL 1J1PL 2E59A 3RG1C 2YEZB 4PGZA 3QPXH 1RZ8A 1ONQB 4PGEB 3QDGE 1XMEB 3KVPA 4PJIA 1CE6A 4G6ML 1HYSC 2DIBA 4OFDA 2W91A 5TDPB 4Y1AD 5A43C 3C8DA 2CBPA 1HSBB 4GAFB 3OKKB 3AU1B 4TNGA 1XGRA 4I89A 3EYSH 1TTUA 2IPUK 1JYNA 1VZHA 2A73B 3MV9E 3D0LB 1WAAA 2IANB 2Y4SA 4J4PA 5D4IA 5D7SH 3QR0A 3TTSA 1ESOA 1KENL 2K9FB 2YKKA 5HVWA 1ZSDA 1T3FA 3QXDB 4HJ1A 2H26A 2YJQA 3VTTA 5GZOD 3KLQA 1O7DE 1PFOA 1A25A 3KAAA 3L2MA 4YHML 3MNVA 5JIPA 1SQMA 2R69H 1HOCB 2R7EB 1CPUA 1BFOB 3IDYC 2WBWB 1JZHA 4ZUWA 1R5WA 1KV7A 3PHAA 2RQ8A 2V17H 1BVKA 3AU0A 4KGLA 4A2HA 3KLAB 3PDOA 5EO1A 1GGIL 2AQNA 3QIUC 4FS0A 1Q1PA 5TK2A 3X13B 4CDHA 3TASA 2MRYA 4GXUM 1L9SA 4PJ7F 1NAMA 1QSEA 3NCYS 4HH9B 3G04A 1KCBA 3OHXA 5ICUA 4B7LA 3HG2A 4KQ0A 2NY3D 3K6FA 1JYWA 4UTBL 1DJXA 4ERSH 1IFRA 1NLBH 2Q9OA 3FN9A 1URZA 1LE5A 2FJFA 2WLIB 1EFXD 2ZG1A 2GBAA 3WU1A 5AAPA 1SY6L 4ZS6C 3MJ8A 5D7KD 1R33A 1DVYA 4NJ9H 3SYQA 3O81A 2VC2L 4WW2F 4PVMA 5IIEB 1H5BC 1XCWA 3BEWB 3BVWA 1GMIA 4NSKB 3QAQA 4KKLD 4GH7B 1OARH 4L4TD 4C56E 3NP4A 2B9BA 2NW3A 2D2OA 1RUAH 4X9IA 5JMOC 4HPHA 3O3EA 3IXAB 1CXKA 1O5PA 2GG1A 1J0JA 3OKMB 2CIKA 4YHPB 4ELME 4FFVD 1YRKA 3FBKA 2IH1B 5L2KA 5CLZA 2BIOA 3KPOB 3QUMB 4HJIA 4JJ5B 4OT1H 5CP3H 4YPJA 1Z1WA 4Y4HD 1ZPUA 1NMBL 2FO4A 3DSFH 4MJHA 4QTHB 3MLYH 4AKOA 1V5JA 3V6BR 2EC8A 3T65B 5IVOA 2MQGA 2VUKA 2IAMC 4UT6H 3TV8A 1FAIH 4RDQG 3ZL1A 4PG9A 2JTDA 3A67H 3BFOA 1R3JB 4OF7A 1KXQA 5CD3A 4RX4D 3O2DH 4L3EB 1HZKA 2XQBL 4JHUA 2HT4C 1G4RA 4RSYA 5HD8C 2H3XC 2YAEA 2HG0A 1RLWA 1XIWD 4M6MH 3PABB 1QBLH 2HX9A 4ZXBB 4AZ8B 1PX3A 3DOSA 4PRHA 5JXED 1IGFL 1LO2L 3F85A 15C8L 4TOYL 2FNBA 5DJ2B 2CO3A 2A9MH 3R0MA 2XFXB 4HEME 4DP1X 1YEJL 2PYEB 1HDMB 1TFPA 3Q5YA 3U4BH 1OGTB 2QJDA 3NZHH 5I1IH 3NA4A 3A6OA 1S3KH 2CALA 2H7WA 4B5EA 2W88A 1LGVA 3RKDC 3O11A 3D51A 4K5MA 1FNEB 3OF6D 5AW1B 2XA8L 1L6ZA 3DSNA 3W81A 3WO4B 1NZRA 4KJYB 2R39A 3P77A 5HYSA 5J06A 5HGHA 3VG0H 2BFGA 4A7GF 1PD1A 1G6RA 2KT6A 2VL5A 2G9HA 4RETB 5JHDA 1QKZL 3ABMB 4Z78B 3MNDA 1SLWA 3ESVF 4KKBD 1FDLH 3N1PC 4ZX3A 3GSNA 5LAXA 2NY5C 3KNBA 3RDJA 2RAMA 1GC1C 2B15A 5FYJD 2XPYA 2IQ9L 2FB4H 1WBYA 1I9RL 5I1LA 1TO4A 5DQ9B 4E9TA 4MD0A 1VB9A 1A4KB 1KCRL 4FQ1H 1JXKA 1NC4D 4F27A 4PJXE 5HGGS 2XTJD 4XHJC 2ZX6A 2X05A 3CD4A 2DH2A 4X6FB 2BVOB 2BSDA 3MFFA 3G9VA 3SE4C 1TQBB 1KV3A 2DF3A 4HT1L 4ZPVB 5KBDA 1G9NC 4LCIH 3FTSA 3ZRFC 1JZFA 2EH7H 3FT1A 4FQHA 2VW7A 2Z7UA 1EGJH 2G75A 2Y06L 1TR7A 2IXQA 4JFOB 5TDNB 3MRLA 1N10A 4JFEE 3EBHA 5CGMA 4KK6C 3RVXD 32C2B 5AVYB 3AGVA 4P2QE 3VXUB 4KHTH 2AKRB 1CLZL 1LWJA 2GK0B 2JKJA 3CNKA 1WWWX 3H3KA 1HYRC 4CKQA 4X5WB 5F6IB 3TEYA 5EF1A 4BE6A 1DEEB 1S2EA 4FEMA 1A6TA 4YSDA 3LQAL 2IDFA 4HWNA 2B77A 4OTXL 1E7UA 4OCMC 3TA3A 3SDYL 4HJGB 2FWUA 5SWSE 1L0YA 1LEKB 5F9OL 3O8XB 5A7EA 4POZC 5I0ZA 3WTYA 1I7UB 3IGAA 1D9KC 2Y5QA 3MV7E 3D4YA 2E76C 4UTAA 3M88A 3EXJA 4NM8H 4JRXE 2J2ZB 5AB0A 4NLAA 5FS5A 2K4AA 1BQLL 3VD7A 4FLOA 2DMKA 4UAOC 4XGZA 4JR9H 2LFEA 2VLLB 4HKJB 4LSVH 1KB3A 1JP5A 4A2MA 2ED7A 2BOBB 2LLNA 3SOBL 3QIWC 3T3ME 5IK3B 1DL7H 3RU8H 4X4ZA 3AM8C 1U8IA 2HTKD 4IKIA 5L7XL 4PRIB 2B1OA 5I6KA 1HEHC 4G6FD 1DVQA 5B39B 3MUUA 3H55A 4QGTA 5IF0A 2NRDA 4BH8A 5EC1A 4JGNA 4HWEH 3TO4C 2I9LB 1FORL 2KZWA 1ZLEA 4HLZH 4IOSD 4LCCB 1KUMA 4I5BB 4M8RA 4OFYD 4R0LB 3MLRH 5HHME 4UQBA 5KYWA 4YDIL 1QLEL 1CD0A 2OSLB 4AVIA 3F8UB 4GKOA 4ZFZA 3UGEA 1C7SA 4PY7B 5HHPB 4H8WH 3V10A 3GXDA 1OTUD 1X6LA 4W70A 4YGVB 3B9KB 3CH8A 43C9A 4KTDL 1LO3H 1ZLUH 4KK5C 4N26A 1HKFA 2GCYA 3ZVVA 2EDRA 3EFDL 4KY1H 4FYTA 1GR7A 4ZO6A 2DI8A 2IH3A 3L9RA 4L37B 1XCTB 5CF3A 2JJTC 3FSVA 3UTTA 3V6OE 5K39B 1KBVA 4HD5A 3TU6A 1IEAB 1T22B 3K4DA 3TWYA 1SEQH 2B2XL 4NS0A 1O6VA 4ZMZA 1P7QA 3MR9A 2FIKA 2IAND 3L3OC 4GKZB 4DT2A 2Y07H 4XCNA 1MFDL 3BH9B 3RIKA 5DC4B 2X53A 4JRFA 5DZ9A 4QY8B 5C70A 1W2KT 1I1FA 3HI1B 1A6UL 4PWFA 3HE7C 1I4FB 2DM7A 4B9YA 1LO4H 3F3HA 4KROC 1N6QL 1KTLA 5I1HH 5DC9B 3VFTB 3VQMA 3UTSB 2P43B 5ICYA 1PNCA 4AEHH 1X5GA 4ZMLA 1D6EB 3AY4C 3P69A 1BG9A 3QUYA 4DZBB 2R1XB 2YWZA 3AAZA 2WAQA 2YD8A 3GUTA 4YN3A 4AENB 1QO3A 4GIOA 5C0AB 3RY4A 2GHZA 4OCSH 1NANI 5JOEA 3Q48A 4PWHA 4QRPB 1HN1A 5HVHC 4O02L 1OO2A 2XV2A 1JERA 2PNDA 4GFTB 5F9JB 3V4PB 4I1PA 3JZYA 2XBTA 4UQ2A 1R34A 4NGHL 1AGFB 1FE8L 2VZSA 3TGXA 2XG4A 5HJ3B 3P3RA 5AW4B 2YRBA 2VO8A 4QTIH 1EUTA 2ADGA 3ZIMA 2EDLA 5EF3A 2B0SL 1YNKL 2G5RA 3IFLL 4D0DB 1FJ1B 3CUPA 3II3A 3CN0A 3AT9A 4MBOA 3IDJB 4NFDA 3ZQXA 4B5ZA 5K93A 3TBYB 4FABH 3FT2A 4NQCA 3TH2T 3T0EB 4F8QA 4FQQB 4TVPL 1JFHA 4YFEA 1U6AH 5DVKA 2JELL 1EIBA 3P4OA 5ID1B 3QJRB 1BBJA 4YDVB 2ZUQC 5MERB 1JGLL 4ZMXA 4JUTA 5DO2D 5DWPA 5J89A 3RUGB 4K9EL 1RIHL 3UOAB 1GGUA 4KRLB 1AHWB 2P8MB 4RVBA 4NKDB 3CH1A 4BD4A 3HNTL 1R6VA 3ZL4L 3T3PB 1CL7L 2WXPA 4MAYA 3TZVB 4CSTA 4EQ2A 3E1F1 4GT0A 4LNRA 3ESNA 5IJCC 4PREB 5TK4A 3VD1A 4KDVA 2CM5A 4PW9A 3FQYA 4XXCA 5TQ0H 5EC2B 2IFFH 3T08A 5E2JA 3P30H 4ZXBD 1AG0A 1NEPA 4TNVK 1XEUA 4YLCA 1IBDA 1ZXQA 4F1ZA 2ORBL 3OWRA 4XNMB 3V0VA 2WBKA 3CV5A 4CVUA 3NPZB 2X4QA 1VJSA 4OZ4A 3R4RA 2YBRB 4G7VH 5B38A 1EVTC 2OZ4H 5CEXB 4W9FC 5C07D 2PXYA 5BRZA 1A1OA 2VXQH 3ATAA 1BLNB 5IQMA 3UZEC 2FJHB 3PJSA 4QHKJ 3UTZB 1IGCL 3NPSB 1W72B 4OZHF 3FB7A 1LYQA 2A9AA 1ML0A 1TEGA 3EBAA 3RWCB 5I1JH 5GGSB 4B60A 3PGDB 2FBRA 3X12A 1GJUA 3ILQC 3BZEB 1JZEA 1B0WA 5B3NA 1M7UA 1T5KA 4ZTEA 3MRDB 4I0KA 2QQLL 2AJ3A 4XODA 3FUHA 5CILH 3LY6A 1UD2A 5FCUH 3WTVA 1B4JH 1WHOA 3HZMB 4RBPH 3BUYB 4LRIA 4HZ1A 1CD1B 1ZHLA 4Y5YA 2FX9L 1WTLA 3NIDE 3G6JF 1I7ZB 3QH3B 2LE9A 3QARA 4HCIA 4H2AA 1BFVH 2WUCH 4HGWB 1A7NL 1PKQB 1BVZA 1ODUA 1NDMB 2NYYC 2OMTA 5E8DH 3V9EA 1S7QA 1CI3M 5DJDA 2HRPL 4OIIH 5I8KL 2ZONA 3LYRA 3VI4B 3OAUL 3L7FB 2B7DT 3O4LA 1FYTB 1OAZL 4UT7H 5C0CB 4D3CL 5E7BA 3FOLB 2P5EA 3LIZA 4M3KB 4U1IA 5FHBH 5EU4A 2MJWA 4M29A 3ECUA 1XCXA 1INEL 2HG5A 1KTDB 1OM9A 3ASWA 2H2PC 5CR1A 2EDYA 1U3HC 4P0DA 2SEBA 4P5TD 4B9FA 3UJTL 3MRKB 2JMRA 3RVVC 4WU7A 1LP9B 1TZHA 1BXUA 3GQFA 2B1AL 2VSCA 1DE4A 4K7PX 3BZ4B 5DD0L 4PHZA 3ZDXB 5DGRA 4C4KO 4GW5A 1KCLA 1E4KC 1HCZA 4FZ8L 5T3ZL 4JFFD 2O1AA 5DJZA 5FUCE 4AGLA 3K1KC 4ZMPA 4C4BA 2NTFB 4HAFA 4OLVL 5HDWA 2UZPA 1KSRA 3O8XD 1EAPA 1OTTC 1JVLA 1R9FA 1NPJA 4MJ6B 3MV11 2WSDA 3QDME 1U8LA 4ANKA 2BIMA 5FKPB 4MWFA 1J1OH 1HXKA 1UT9A 4QKXB 3SN6N 3SPVA 2Y69B 4PH8A 2CBMA 3G7TA 5AQ0A 3T4AA 2JLPA 3THMH 4P8QA 4PJAA 5D2LF 4F9PC 2PPCA 4JFHD 1ED3B 1TO5A 3BVNB 3F6IA 1WVZA 5E95B 5F0PB 5A2KH 5IMOA 3L5WB 5FLUA 3RGBA 3UEZA 1YECH 2VMJA 1KN4H 3WD5L 4FL4C 1JZGA 3UTQA 5EFIB 3ZGIA 1MFVA 4I3SL 3K46A 4WI4A 1BP3B 1QA9A 1ITBB 3KPPA 5DD3L 1ZRUA 1IT9L 2J8UA 3OKOB 2VZ3A 5CKGA 3VXSA 1HJBC 2N01B 5AAWA 3Q8AA 3P4NA 3II1A 2LV4A 4L8DB 3X1GA 4ZFGH 3NN8B 5ICZB 3STZB 1F4YH 1X6NA 2HJLB 3B34A 1WEJL 5BZWB 4KBPA 5FUCC 4OV5A 4H5SA 4KI5D 5E03A 4ES8A 1T89C 4L29A 5GJSH 2VLJE 3B8YA 4XMPH 2ERJC 3B9KD 4IEFA 5CS7A 1BWMA 5C7XH 2OL3A 2IC2A 2ESVB 4F58H 3BP4B 1S7VA 2V9QA 4XMXA 4JJOA 4E0RA 5CMAA 3WE1A 2E7MA 2LTQB 1THCA 4RMWA 3SD5A 3UAAA 3CZEA 1P6FA 1T6WA 4DEPB 5DLMH 5IJDC 4WFED 1GSMA 1MCCA 5KTEH 3L13A 4O58H 4EN3B 2KI6A 3CFBA 3L6FB 3I02B 4JFZL 2CNYA 4AH2B 4Z95H 1G9EA 3U7AA 2RR3A 4ZW5A 1TJGL 5B4MD 2R0LH 4HIJB 1SJHB 4KMLB 1W0YT 1PX8A 4HALA 1KBPA 1YSOA 4YBQD 1IAOA 1JZJA 3OXRB 2R29A 4TUJB 3HUJB 3S3DB 2WLMA 3L81A 5K1JA 3U0WH 1Z3RA 4G8IA 3SDCD 3VXMD 2ZIDA 4KZDH 4ZQTA 1CR9H 1MUJA 3US0A 4JPQA 3F6JA 3GSOB 4NAMA 5LG1A 1NCNA 1SHWA 2KZ1B 4XPGH 1KNOA 4F93B 3MKKA 1M9WA 1F3JA 4QHUB 1UD3A 5DVPA 2EIJB 5DHVH 5DEGA 3BP7B 1FFNA 4G2AA 4NPYB 2NY5L 3PGCB 4R7DA 3LZFL 2OMZB 2V33A 3L4ZA 3OX8A 3T1WA 4Q6IA 1E5CA 5IMKA 1KLFA 1UWEL 4Y5XB 2XG5A 4MCZA 1I8KB 3DX9B 4M61B 1EZSA 1ZV9A 4PG2C 2QEJA 3WEXA 3X3GL 3DVNA 4NRYA 4NO2B 3N04A 3CWGA 5DJ8B 2W9EH 3MMEA 5ESQA 2R69L 4OD3L 5C0DB 3T6WA 3F04A 3MROB 1V8HA 1C12B 4XNUH 4OUUB 3VDCA 1G9NL 1X4ZA 2F18A 4LKXA 4N2NA 2VL4A 1LNUA 3ABKB 3ZRCC 4RMRA 2O6CA 2HX7A 2XQ0A 2MKWA 4FN0A 5GSVA 1IFHH 3G08B 4I3RL 3T0ED 5AOJA 4M1DH 4PJCF 1ACCA 2XWBB 3ULVF 3ARBC 2E9JA 1OWWA 4G80B 1Z6JT 3PUUA 3AWGA 2C3XA 1HWHB 4ERSL 3NJJA 4L8BA 3OKYA 5BUAA 3GXNA 1KTCA 4M1GH 4BFOA 3WNOA 1QG3A 4RIRA 2JJVA 1UXWA 4QRAA 4AW4A 5HYFA 3IKCA 3FUFA 4Z0BL 1M6OB 1CFTB 1G0YR 4NJ9L 5GHWH 1XX9C 3FO0L 4B9PA 3TBTB 3DO3A 3DX6B 3L1EA 2NR6C 3QFJD 2G3MA 3TZVD 2D0FA 4JMNA 4OZIF 4GG6F 3LNDA 3VXOB 3SQOL 1T5WB 3B7RL 4R90H 1RUAL 2VRQA 4K8RD 3IMUA 4JE0A 3UMNA 2GSGB 2XU9A 1AY1H 4P3DA 1EHLH 1KACB 3PU7A 2BX5A 1JGEB 1SUHA 2AXHA 4LHUA 4Y1AE 5D6DC 3SGKC 1ZTXL 1N0LA 3J7HA 1Z5LB 1WWBX 1OALA 5JORB 3L1GA 1KJMB 5D55A 3MLYL 3X14A 5EZLB 2BY2A 5CBAB 4YHIA 5KVDH 1YPZF 3PHOA 3HR6A 1WV7T 2GTZA 2Y3AA 4GG8B 1OTSC 3V0HA 1N68A 3GMLA 4BK5A 4CVXA 4Q0XH 5EIQA 4MSWA 4U3HA 2YSTA 3A67L 1JXDA 1I7TA 1SYSB 3KBEA 3O2DL 4JRYE 1HHGB 1A3QA 4W9CC 1IM3A 1M7XA 1KGWA 5DK2B 2VZVA 5C7ZA 2B4CH 3NJMA 3MNMA 1KCSL 2ATPA 3E8UH 4AQEA 1U8HB 5ALCH 5D1XC 4E5XG 2WWMC 2A9ML 2WTPA 1F8TL 1N3NB 3A6CH 5ALBH 3UABA 1FH5L 5FYLE 4J3WA 4ZFFA 2IMMA 2WB1A 3FB6A 1CVRA 4IDJH 4KRPB 3NZHL 5AD0A 1HQ4A 4WIQA 4GQRA 1IC1A 5E6UB 1Y1DA 4XOCA 1R3KA 5K9QI 5KSAA 4JFQA 2BSSA 4WI0A 3G5YB 3NSDA 1QNIA 4HYTB 3IYLW 3X3FL 1TEFA 3TL5A 3WFHA 3VSQA 4HA1A 2HFFA 1MHEA 4BFIB 2A74A 2IO5A 1YNLH 3ULUF 2KUTA 5J6GB 4BSWB 4K3DL 2FYYB 5FYJH 4F2EA 1JNLL 5GZOC 2YUWA 2NY4D 2AF2A 3FS9A 1FYTD 1SRDA 4L4TE 4BZ1H 4Q4EA 1TIUA 5I26A 4AYSA 2YGVA 1D5IH 3QEQB 2OMWB 3F2LA 3FFOA 3IAQA 4Z7VB 2F54D 1OQOA 4MDRA 5IB5A 5E08H 4WGVB 3C6LC 3SQBA 5BZZA 1TQCC 1A65A 1M3IA 3QNZB 4KNUA 1IGJA 4QO1A 1HEZA 2P48B 2IGFL 4LOVA 3LH2L 4FQ1L 3U2SB 3QA3B 4LGRB 3IM1A 3VWJB 4YDKH 1SLVA 1BXXA 2IF7A 4ODXB 1X44A 3CFJA 4R4BA 5I73C 3PF2A 1KG0A 5BO1L 2BP5M 1CICB 1NCDL 2XACC 2Y6SC 2F8VA 3AT0A 3D25A 5BVJB 3I6GA 4P3CH 1J05B 1UXSA 1A7RL 5T1DH 5BO0D 2O30A 5HI3D 5K9KB 3INUH 3MGAA 6CGTA 1PJWA 4Y2DC 4RFOH 3FXIC 1A9EA 1CBJA 4U6HB 3EJPA 1FZKB 4XMKL 4M4RB 2UY6B 4KKLC 4YSRA 5DRXA 3IN2A 1UUSA 2UWEE 4ICXA 2DLEA 2Y5TA 5DXWA 4APXA 5AB9A 4BZ2A 1RIVL 4NLHA 3HE6C 1MCWM 2PCPB 5GRUH 5CIPB 2R1YA 3RWGA 3Q2NA 3GZQA 1QWNA 4Y4HC 3RNKA 5L88H 5I1DB 2BHZA 4GFXA 1EUUA 1E6OH 4KX8A 4ONHB 3F5WA 4F2ME 3MRCA 2B14A 1BVLB 3FCSA 4P2AA 1TYRA 1OB1B 2JQZA 2XN9B 3ISRA 4BCYA 2VLKA 2F6AA 3DX8A 3D07A 4OZGA 1N59B 4P46B 3NJHA 4LSVL 2UZXB 3V6FB 4B50A 1IILE 4DCQB 1RXLA 3WE6B 5KUKA 2VH5H 3NTCL 3RZCC 5JQIB 4CMHC 3RU8L 3W39A 1YEEH 5B7MA 3WN5B 4L8SA 3RHWK 5TH2A 3DGGB 4PRAB 5FYJE 1R3LB 2JI3A 2QBWA 3QUZC 1WZ1L 2JB6B 4CVZB 1IC7L 1CG9A 2JKIS 2VAAB 5AVXB 5ANMA 4F7CB 1AZCA 1RP8A 5FECB 1RL1A 1XR9B 2B4CC 2P7TA 3ZR6A 1WAAF 1PCXA 4R5XA 2YMXH 2JKWA 3Q2CA 2EYTA 3WCYA 2CDEB 3C5ZB 3PQYB 4UB0H 1K72A 3KPNA 3BW9A 5FB8A 3RPIB 2ZCKL 4G71B 3BHBB 1LO3L 3MLWL 1SEBB 4PJEB 3RWIA 1NCCH 1CWVA 4DPAX 5J6HB 3EGXA 4PB0H 2O5NA 3LQZA 4NBXB 3BDYH 5F44A 3KYNA 4KY1L 1E9PA 2XV0A 4LDEB 2VDNH 3QORD 3A24A 4TQIA 3VFRB 1PQZB 1AP2B 4UQ9A 3HG1A 4L1SA 1SEQL 2WCPA 3QJTB 2V8MA 1UT2A 2APFA 2BY3A 4ENEC 3BN9D 3LS4H 2NYKA 4ZPTA 4N0CC 3R18A 3CZLA 2OSXA 1DDTA 1W16A 4I1RA 4ORZC 1NA8A 1JCKA 4MZIA 2RACA 5CSGA 5A1AA 2XVLA 3HR5A 4V1DB 4G5ZH 1D7BA 5KJ4A 2CM6A 4ONFH 4W9ZA 3ZDYE 5L0QC 1RPKA 1IAMA 3QWRD 4YK4C 3EYUH 4AC4A 1LO4L 5TDOB 3SJVD 1HWGB 4LSTH 1C5DB 2BSRB 3QCVH 4I4WA 5I1HL 1IJ9A 4QHMA 3LN5B 2F53B 4AEHL 4S1RL 2X1WL 3CFDB 3LEXB 5C0BB 3D2UA 1JIBA 2VDLL 5AZEL 1A9VA 1AMXA 1TNMA 5LUMA 2A38A 1TZGH 1JYXA 1MLCB 3JT2A 3H3BC 1IGYB 2ZWZA 4UIKH 2ADIA 1FBIH 2MCAA 4NUPA 3TEXA 5DK3A 4R7XA 3WDIA 1QLRB 1WIOA 4C57C 4UQCA 3FT3A 4ZSOE 2BLFA 1T2XA 2SODB 3D39B 4PJ8A 3IXTB 4URTB 3MJ9H 1MVFA 1XSOA 2RTTA 2IWKA 2X4TA 2EDWA 5EUOE 2APTA 2W0FA 3AQXA 4PP2B 2V2WB 4QTIL 4ANWA 2ZYIA 2DLFH 3CFEB 1VCAA 5E1HB 1G5GA 1JNHA 3HC0B 3PFUA 4YUEL 2QVKA 4XP1H 5LBSA 3QUMH 3B9AA 4KGJA 4Z7UB 5HDQL 4Q56A 3KZ8A 2F5BL 3N0PB 1MRCH 3QIBB 4PJ9B 4QRQB 4IK7A 1CDGA 1VFOA 2BM3A 1HILA 5AOIA 3CBKB 5E8OA 1XBRA 3PL6A 4L3AA 5MP6H 1OW0C 3U0TB 1B2YA 4AM0Q 2OPCA 4GSXA 4OLWH 4X0KA 5F7MC 1RQ5A 3H9SB 5E0FA 4DW2L 4U33A 3SDXA 5E4OA 3UXFA 4LIQH 4PVBA 2A0LC 2FQGA 3ME0A 3MRQA 2HJKB 3RIAF 3V6ZB 4S1DC 3GGWA 1OWRM 1XCQA 1T0NA 2IEPA 3MJ7A 3PNWB 1QFWI 2QKIA 3SYCA 2Q3AA 4XTRD 2IANE 4IIQB 2FEEL 3KPSA 3MACH 5CGYD 1M7IA 3ECWA 4RMVA 1WWAX 5HXMA 3V8OA 3A4DA 1FLTX 4PSPA 1R24B 2ZOKB 1A4AA 1KPVA 2DL9A 1LDPH 3P3UA 3JWNH 1DLHA 3TEWA 1BVOA 3IGLA 2GUOA 5TQ0L 3OKLB 2JNZA 4NQEA 4UILH 4U1HB 3P30L 5IROD 1AAJA 5LBVA 5K9OA 4U7MA 1QFHA 2FSEB 3AMLA 1HHKA 3DIVA 3VU1A 2CGZA 2Z7YA 3MRJA 5KYNA 1TU2B 5ID0B 1ITCA 2OA9A 4KRPD 3LZRA 4HV8B 5GGTL 2JB5L 1BJ8A 1XGTB 2VW4A 3IU3B 4N9GB 1S7RB 5DJAB 1TQTA 2NXZB 3S0PA 2PWFA 1ZS8A 1NLDH 3JXAA 4OW6A 4DGVH 5KBPA 3BVUA 3DI2B 1CGWA 3H4HA 3UGUA 3T8XA 2X4PA 3D52A 5I1JL 4RESB 5F7KC 2J6EH 3LEVL 5M7QA 1GY1A 3KVDD 1OGAB 2WMPA 4FLQA 3S88H 2ZJSL 5FYJU 2J43A 1PBYA 1NFDA 1RZ8B 4HMEA 1X9UA 2GFBB 4JS7A 4XZ4A 5HJBA 4FQJH 1E50A 1DBBL 4OGZA 5T3XD 1CE6B 3QS3A 4JG9A 5CILL 1SXBA 2YMTA 2PP8A 3ARRA 3GHBH 3PXHA 4BQ8A 4GI8A 1BMZA 4RZCA 4H0IA 2WLLB 4IDLA 1B4LA 2Q2EB 4H1LB 2ADFH 3KLSA 1LEIA 2VR7A 1AXSA 4LKCB 1K8IB 4ISVB 4FQ2H 1A9BA 1BFVL 5FC9A 4GBXC 3KXFA 2ICES 2W9DH 1RUPH 3H3PH 3SB3A 3NK3A 3VWJD 3CK0H 3LKNA 2DAVA 1M2VB 1S6NA 2CKBB 5EU7C 1PG7W 4AKQA 1J9TA 2H26B 4JCLA 4Z7WA 5D5ME 4LIQE 2IPKB 3SKJL 3WJMB 1N5YH 2JKSA 1DJIA 4MS6A 5FWQA 1WBXA 2EDXA 4HS6B 4CAGA 4DVBB 4KRNA 1VPOH 1Y18A 3B6SB 1N26A 3D69B 3LNEA 5FWRA 3GTTA 5FHBL 2ED8A 1MZZA 2ITEA 2K1MA 2Q87A 3JV4A 1JPTH 1WAPA 4P5MB 4NZ8A 5IG7B 2DYPA 4PEEA 4MDIA 4I2XB 3ARFA 2CDFB 3W11D 3RYMA 3QAZB 3QJHB 1A47A 4JM2C 3QP3A 3O45A 3JWNE 2NX5B 5EORH 1OAJA 3G04B 1J5DA 5C07E 4XCCH 2XZAH 5LG6A 1LXMA 4XPBH 5DHDA 2HRHA 1OCZB 5DYOB 1XT5A 4K3HA 5BZDB 3S5LB 5FO7B 3DHMA 2J1XA 2WLKA 2WBXA 1HSAB 5IUSA 3Q6FA 5J11B 5HHOB 3BAXA 2FATH 5CU9A 2XN9D 5FA4A 4TTDC 1KIUA 3LKRB 1RIUH 4P46D 4PGDA 3BXNB 4FA6A 3Q8FA 5F71A 3THML 3EOAB 5IEHB 1GKOA 1R5VA 5DWUH 1FYHB 2GT9A 3ZZLA 1X5JA 3H9HA 3PXJA 2CHWA 4R2GC 5TF0A 4TS6A 1EXGA 1GGBH 1JVOA 4QHLB 5CJXA 1KN4L 1S5IH 2JXMB 2XSKA 1HKLL 4RGNB 1BF2A 3SE6A 3NCFB 5KS9A 2V7NA 3ARDD 4BA8A 4FX5A 1WCBB 4GQZA 1U42A 4E9QA 1LO5A 4MXWL 2XIDA 2Z35A 1Z66A 2QV4A 5FDWB 5I8OH 3VFVA 5J13B 3NFNB 2CK0L 1IGIH 4OLUH 4YDJA 4N28A 4KU1A 1GS7A 1X3DA 1FVCA 5FGCB 2JIXD 4BUGA 2X28A 3O3DB 2R4SH 3C5ZD 3K3QA 1DLFH 1FH2A 5C7XL 1DQQB 1MAJA 2BDNL 2BVQB 3U4EB 4F58L 4PJGB 3UCRA 1K4DB 1F02I 3PHSA 3B1TA 5C9JA 3RTQB 1TSRA 1F86A 4P2YA 4AV4A 2DLTA 1N4XH 2LAGB 4QXUH 5DLML 4F3FB 2KQNA 4B9KC 5IB4A 2FK9A 5KTEL 2E9IA 2NW2B 5E2TL 1YO4A 3LRMA 5KWYC 2VXSH 2ZAIA 3MUY1 4JFFE 4YHYC 3CXFA 2V37A 4UANA 2YPLA 1AHKA 1UM6L 4QRTB 2R0LL 3LD8B 2BCKA 1VCBC 1ZEAH 3PG2A 2WTOA 4P57A 3DVGB 5CWSA 5ESVA 1L9RA 4FQXC 1TQWA 4Z23A 4JZJB 1CE1L 4RH4A 4UI2A 3UBXI 4B3EA 4JFXA 4E9RA 1K4CB 1WZLA 3ZTDC 5JW4Q 3CX5K 4N0FA 4HJ0C 4M7JH 3N85H 4KZDL 1QFOA 2O6EA 4XWGH 4QOKA 2Z91A 5KYUA 1A7QH 2Z31B 1TKWA 3EUDA 3V4PH 3EHBB 4A6YB 5C0BD 2YSSA 5FM5O 1ZVYA 4RRPA 4S2SB 4GSDL 2WNXA 4IJ3C 3GSNB 5E8PA 1EA9C 1GW6A 2FH6A 3BGAA 4BRVA 4HUVB 3HS0A 2BIIA 2Y7LA 3HG4A 4IRZH 3LCYA 5GS1B 4P5TC 3JTTA 3BUTA 2W81C 4ABQA 2QPUA 1ZDQA 1H3GA 4LEEA 3D39D 4LVNB 2HT3D 3OSVA 5FYLL 4Y19A 4N90D 1TDQA 4HXAH 2W9EL 4O4YL 4FNLL 1KXTA 1CDJA 3U1QA 2X0WA 3FBQA 3MLUL 4HZAA 3T6XA 4XNUL 4Z3TA 4EVNB 4YEFA 4KI5E 4LCWA 3P9LB 3A6BL 3O6FB 3QIBD 4LE8A 4PJ9D 5I6MA 4WJ5A 4LASL 3IJHB 5D4QA 3VH8A 4D94A 1BJMA 3AM8A 1ZV2A 4H0GA 4LLMA 4YHLH 1PDKA 5LCVA 4M1DL 5L2JA 3H9SD 2K3HA 1WUNT 5SX4H 2FT6A 4FLSA 3VM5A 4F7EB 4YPGA 4MD4B 1XH0A 1XD0A 4UYQA 2BO0A 3WTUA 2CMRL 4WFEE 3WLBA 2Z9TA 4FD0A 3NCMA 2K7QA 3TO4A 4NXKA 4M1GL 5JR1L 4E41D 3BAKA 1VGKB 3TA3B 4PGCB 4GJTB 3APNA 4U1MA 3DI3B 1U8JA 5CLXA 4CSZA 2I7SA 1AGEA 3CX5J 4HS3B 5KOMC 5F89A 5F6HJ 4O2CA 5KSUB 1AY1L 1U8QB 3VXME 4APQC 3GS7A 5FK9B 3KDMA 3DLQR 3MRPB 3M1OA 3DNKA 3BWAB 4HHGA 4M03A 2VDRB 4KI5C 5AAMA 2Q6WA 4FHKA 4NRZB 3W0WB 2JJTA 4MMXA 5D7IF 3QWOB 1N8ZA 2ZX5A 4Y89A 1W72H 3ULSA 3GXPA 2MQ3A 4JY5H 1X5FA 1ASOA 2CGRH 5EF0A 4P06A 3WXWL 1G1CA 4DO5A 2H6PA 3OLEA 5DRZA 2JK5A 4JX0A 3AG3B 4JRLA 1ZS2A 1ZIAA 2NXZD 4KUZH 8PAZA 1JDCA 4ADIA 4HQQL 4CW1B 3QXTA 4CVWA 1HXYA 2WINB 4JGMA 1TZ8A 2B4CL 5KYWB 4M56A 2HT2C 3BRDA 4OZFA 1JF1A 2YD9A 3PWPD 2YPKB 4ZFZB 5KSBB 2PO6B 2E9GA 1LO0H 3VXRD 3EYVB 5LGJA 4CU8A 5DJ6A 1H8LA 3QJFB 2XVKA 4KTEH 3A6CL 1OVZA 5ALBL 2J7LA 1VLXA 1UG9A 1UATA 5CJQH 3OKDB 3ZTCC 3U4KA 2RHEA 5J1SC 2VSMB 4IDJL 4M9OA 3SDCC 4ORGB 4G43A 5IBTH 1BZ7A 3HMXL 3UTTB 1C8PA 1MH5A 4U1KA 5I30H 5JHLL 2NXYD 4WJKB 2A4ZA 3RRQA 4W9LC 2MNWA 1P7QB 4HP5A 1FZJB 4LLAA 3RUGE 1KFGA 4MMZA 5JIDA 5I5IA 4J4PD 1EZUA 1XGQA 4XCNB 2NY1C 4NKIL 5CZKA 4NZTH 3IDGA 2DRUA 5FYJL 2GIXA 4XHQA 3QG7L 1RZJH 4PP1D 3QFJE 3T3PE 3SGDH 3CDZB 4HEPG 2XWJB 5BXFB 4HUCA 4GAJH 4BDVA 3DJTA 1CBVL 3TBSA 4G7YL 1SDYA 2CJUH 2HB0A 2YZ8A 4LSRH 2C9UA 1M05B 2IBZY 5ICYB 1MQKL 2DICA 2NY7L 4X6CB 4DGYL 1DBJH 3O4OC 4OVVA 5EBWB 5GISL 5J3HD 4GB9A 1U33A 1QI4A 3LPPA 1EX0A 3DUHA 3DX3A 4QXTA 4PAZA 4B9ZA 3WIIL 2F7PA 1AGDA 1QSED 3TO2A 2NX5D 4WTWA 4KTGA 4QHPA 3DTXA 5IW6A 5EV7A 2OXGA 1P69B 1MAMH 4UINH 4K5PA 2B16A 2E27L 4JY4B 4WLCA 1BZDA 4D0CB 2B59A 5EIIA 4P3CL 3TT3H 3UP1A 1RVFL 3F00A 2AC0A 2VISA 2J5LB 3INUL 1BF5A 2J8UF 1LILA 4LSUH 4RFOL 2C7UA 2EE0A 1HXMA 5HHXH 1TVHB 5DO8A 1MJUL 1C5BH 2V4LA 4UWQB 1VKXA 3UC0H 4BFGA 5AW3B 3RNQA 5LGHL 4HJUA 3JZ7A 4B6ZA 1CL7I 4J1UA 1MPAL 1MCRA 3MQIA 4K8RC 1GTNA 2CLVB 3H2WA 3AZUA 1NEZB 2E56A 2M1KA 3X1BA 2BY1A 1MIMH 5GRUL 1WWCA 5E4IA 5SX5H 1NC2B 4NPKA 5L88L 3WTTA 3IMSA 4LCUA 1E6OL 4FXGB 4U1SB 1PKQE 2NZIA 1CU4H 1AZBA 3GFUA 3K0WA 4GRLA 1XF3A 5LN8A 4XO3A 1M42A 2O6FA 3D4ZA 1MXDA 4LESA 3VG9B 1CYXA 2AJYH 2OTUA 4O2FB 4X80H 4YDLC 3SE8L 2I9TA 4LF3A 1FYTE 2FX7H 3OC5A 1OGPA 3DHJA 3UYPA 3AREA 3PAZA 4RISL 4Y16B 5KVEE 1JV5B 1A2YA 1UH2A 3A5VA 5CBEB 1QBMH 1U3ZA 4GXUN 1M71A 2F54E 1QRKA 1Q94B 1D5MB 3VI3E 4CNIB 1XGUB 1LP9E 2X4NB 2ODIA 4WWKC 3EYQD 1QNZH 3BPOB 3ZDXE 3HBQA 3FH8A 4K94C 2N59A 1EBPA 2XNAB 4FMVA 4JQIA 1E4WL 3LQMA 5IVXA 4EKXA 5KN5A 1KT2A 4QRRB 4A1RA 3NABH 3QQDB 3LX9A 5DZJA 4NN5B 3SODB 1DDHA 2DKMA 3KL5A 4IRSB 1T2QH 3FB7B 3KGUA 3N42F 1DQTA 4LLUA 4XN4A 3OAZK 4JDTL 4N8VB 1IZKA 3VI4F 2CA4A 4J3UA 3S4SB 1NCCL 4CN4A 5IM7A 4GMSH 1UB5B 3L7EA 3BDYL 1FRGL 3OR7A 4FKEA 2HLAA 4N2MA 2NY4C 4XN5A 2Z31D 3AXHA 3LOWA 2VDNL 3EHBD 3GB7B 3LMJL 5JHDD 2V2XA 5IHZA 5DMKA 3MRMB 2B1HL 3I9AA 3QRLA 4QAMB 3BPNB 1SDDB 3GSUB 4JKNA 1E4KA 2FRGP 1FG2B 1T21A 3U36A 1OAUL 1ZHLB 2K9UA 1MCQA 1OAYH 4G6JH 4NENA 2DWTA 1X7SA 4YZWA 1WH0A 1UJ3C 1XGPB 3T5WA 1XL6A 3QFDA 4ONFL 2OW7A 4V2CB 1UTDA 3GSRB 2R9HD 4LSTL 3H1ZA 2JCCF 3OG4B 4KJQD 5GSRB 3IJYA 1QPKA 1GZHC 5FYKU 3MN8A 4DUXA 1D2OA 5HYSG 5ENWB 3B83A 4YR6B 1L7TL 4GQQA 5I16B 5EU4B 5HI3C 3O6FD 4QRUB 3V9CA 2VDPB 1LE9B 2HG5B 2AJSH 4J6IA 2OXHA 2AERT 2EQDA 1CUOA 2Y7QA 2R2HB 4D8OA 4TPRH 1E4HA 3QZPA 1SBBA 2H0FA 4HSQA 1DE4B 2KYIA 5GS0H 1WBZB 4NKMA 3MYZA 1G4MA 3MJ9L 4GW5B 5FFOA 5G4OA 1L9PA 3HAEB 3CU1A 4JG1H 4JDZB 3N43F 3RGHA 3MAWA 3UFIA 4JVPA 1AR2A 1ZE3H 5LQBL 3FTUA 3TA3D 3V0EA 2UZYA 4QF1B 3BP6B 3HZVA 2R2BB 2O4EA 5DYFA 5HSFA 1MRCL 1XO8A 5HHQA 3JYCA 5INDB 1I8MA 3IF1A 1G7PB 1U8LB 5MP6L 4KHXH 3QZLA 3HUJE 3S8FB 1VF5C 2C4FT 3S96A 4OLWL 1HAUA 4MX7B 3KS0J 3EJZC 4N2OA 4N2DA 4UCFA 4LIQL 3OR6B 3T2PA 3ZU8A 4J8QA 1OCOB 3NQIA 2P8PB 2YAQA 2AK4B 5D93B 3RY6A 3VFUB 3LZOA 3VO0A 4UM9B 5IMOB 1WC7B 5G55A 4X4XA 5G2NA 1OSPH 1IQDB 1A3ZA 3UTOA 4M4PA 2NCEA 4GXVL 3MACL 2EKJA 1CDBA 3KPPB 3A22A 3CJJA 4P4RA 3WMPA 2EDBA 2C9SA 3OSKA 4GSUA 3V4VL 2ATKB 1Q0YH 2E86A 1AACA 3P4NB 1HVXA 2GBVA 5JW3H 3FSZA 3SJVE 4JVUA 2CU9A 4WZ9A 2QGBA 1AQKH 1IARB 3MKGA 3B2UC 4Q2ZA 1OP3H 3QJZA 4H5SB 1BPVA 2PO6D 2R0KH 3EFFB 3HNVL 4L29B 4MNHB 1I9IH 2OCCB 2EE9A 4U3SA 3BC9A 4IEFB 1DVUA 2FBJL 2WXKA 3N1FC 2AV1A 1KMGA 2DQCH 2I60H 1J8SA 4DP2X 1S7VB 3X11A 2Y9RT 1FV1B 3WS3A 1N18A 3FJTA 4BWWA 2OJZL 4B9CA 4ADJA 2WY3B 5CMAB 3VX1A 1DBAH 1RK1B 2AQTA 5AZ2H 2N1TE 3QR2A 3UTTD 1S7XB 1BQHA 1IIKA 3GLAA 4DGVL 1BQ5A 4WKZB 4NT6A 1P7QD 2AVFA 3CSTA 4I9XA 3RGVA 2J6EL 2N7SA 3IJSB 2JI2A 1NCIA 4ALAC 4PTUB 2AJUH 2ZUTA 5F1IA 4Q8BA 1JXJA 3N44F 4G11A 4IGBB 2IBGA 2FEDC 3GEFA 3W2DL 3RX9A 2A9BA 1KDIA 2BMKB 4F15B 1OT1A 3HZ3A 3ZKND 1MUJB 2HTLD 5KOVC 2ADFL 2FJGA 3QUXA 1KNOB 3KM1A 1CF8H 1F3JB 4MDJB 4HCGA 4J6RH 3ZLQC 1FN4B 1CFSB 2W9DL 1RUPL 4HHAB 4QUOA 4X6DB 3VAEA 3ZHFA 4BGLA 4AW7A 3CK0L 5HYJE 1YYMH 3BN3B 5I76B 5ACLA 2EP6A 1TTRA 3FTGA 2QPDB 4E42A 1KY6A 4KKQA 2XG5B 4Q9RL 3EO9H 1E4XL 2W60B 4GS7C 2NR6A 3GXUB 3L1FA 1BQRA 1VPOL 1IBGL 5J9PA 3MREA 3H2PA 1B3JA 3DXAA 3C60B 2VQUA 2Y2TA 3LKSB 4HOMA 2P5WA 4U6YA 2ICCA 5D2LE 1WS8A 3QQ9C 3HN5A 5D6DA 2PWHA 3K2KA 5CIPH 3SGKA 3DBXB 2WSKA 1Y7VA 4ZTOL 4HGKC 4HX1A 4PJBA 4HIQA 2WPGA 5H2BA 4NQCD 4XVUD 4WTXA 1KCVH 3NJFA 4DKAA 4BJLA 1IL1A 3T77A 4L4VA 4NOFA 3FO9A 2J8HA 2FH8A 2VITB 4NQDB 3V5KB 2BNQB 4YDNA 5HY9A 2ZNWA 5KBKA 4U4BA 4JPSA 1DYZA 2UYLA 3IB4A 4NUJA 4MJ5A 3DV6A 2HWZH 3ZYZA 3QR1A 4ACTA 4X4MA 3NA9L 4XCFL 5I9QB 1DQMH 2XY2A 3CBRA 4LARH 5I8EA 3PLYA 4PGBA 3FSAA 5I1CL 5C3LD 3KYOA 4R7VA 2VXTH 4HS8L 2FATL 4X99B 4RGOH 2FYVA 4BGDA 2VDKH 1RIUL 1EO5A 3ZDZB 5D1XA 2CR6A 5CN3A 5TQ2L 4K2UH 5E1GA 5FAAA 2PWEA 2E7BA 4J2QA 4J3XA 5TGBA 1YEGH 5T3XE 1JWUA 4LRNL 1GGBL 5KSVB 2BOCB 2EC9T 4RLDA 3MNZA 4QAWA 4Z7VE 2GAZA 4P5KA 3HBPA 4QJ3B 5HDOA 3SBWC 3WAJA 4TL4A 1ZT4A 4WEBH 1UD4A 3GSVA 3ARTA 3VD4A 2GSIA 2HLFD 5D2NC 1OAKL 1EO8H 1MCSA 2DWXA 2YQ2A 3FO1B 1SFDA 4F8NA 4EIZC 4N2BA 5I8OL 3EJCA 5DR5L 2DDQH 4MLIA 5BRZD 3NSJA 4MD5A 3RBSA 1T66D 3HRZA 3F7QA 1D3CA 3CU7A 5F1NB 5D7LA 3IRPX 1S7WB 2JFCA 1DLFL 1Q9OB 4IRSD 4PJFB 1MVUB 2ATPB 2GB2A 3KCPA 5J8OA 5JQHC 3CZKA 4ANVA 4XN2A 1CTOA 2BIQA 4MXVF 1VFBA 5DURB 3KWVA 1SBSH 3BDBA 3C6LA 4QT5B 3HS8A 1G5AA 4WUUB 5MENA 1T4WA 4Q97A 3W38A 3U9UA 4QXUL 1OV8A 4KKRA 5MI0C 2BZDA 4QI3A 4FGMA 5AYQA 3P0YH 3Q2WA 1N2RB 2VXSL 4HUWA 3L2LA 3O9WB 1UC6A 5D96C 1YEWA 1WRFA 4WRLA 3IGFA 1CIUA 3WKNA 1XB3A 3FN0H 2X44D 2B20A 3DRQA 5B38G 3WFHB 1T4KA 2OP4L 1R3HA 5CEZD 2I24N 5HYEA 1BM7A 1A14L 1MHEB 5FO9B 2YAFA 4U1GC 2EDFA 2OI9C 2D8KA 3EJYD 2Y36H 3SHSA 1JNNL 2DQFA 3LN9A 3O4LD 4M7JL 4XMWA 4AVJA 4DGWC 1U91B 5G5DB 3O2WH 1RHHA 2LGNA 4HIEB 5FHAH 3T1FB 2P5ED 4NNYA 1CGTA 4HUUA 3KBPA 1MEXH 3GMMA 2MHAA 4I85A 2JJWA 3MJGX 3C6SA 5HDLA 1RUKH 2WQWA 1KGYE 3F7YA 4TLSA 4JZOB 1HZHL 2H5UA 2XWTA 1IGJB 4HK0A 1JF5A 1OLLA 1XBDA 1HEZB 4M7ZB 1OE1A 1AG6A 1E3ZA 2DMHA 3C8KB 4Q52A 2QHRL 1DCEA 3CLWA 3WHXA 2G0LA 4HXAL 1OIOA 3KR3H 4KZEH 2LLGA 1K8DA 4OF3A 3PAUA 4WW1A 3EDDA 5GJTH 1UXSB 1F4WH 2P3YA 5JPMC 2BP0A 4UQ3A 1FC2D 2PPFA 1BQUA 1O9VA 4AQAB 3DUSB 2VB5A 5IFJB 2F8OA 3IVKA 5DFTA 1S7TB 3WJJC 3IFOA 1JN6A 2A2QT 1A9EB 3KBHE 4YHLL 4YHNA 25C8L 3GJFK 4PV9A 5ANHA 3D5OF 1PVHA 1A6AA 1IC0A 1YPZE 3QUZA 1X9LA 1P53A 2NYZA 3GSWA 1OF2B 2AK4D 2P8LB 1HESA 4FTVB 4DO6A 4K8RL 4UM9D 2FT7A 1OHQA 3K8MA 1BEXA 5AALA 2XJLA 1HINH 1N6UA 1HHIA 2IQAA 2WXNA 3RWGB 1QLEB 3E0GA 1EVUA 4CMMA 4EXPX 3ARVA 3EJJX 1GPOL 3SCMB 2O61B 5T5FL 1PZ3A 4Q58C 3DOHA 5E8NB 5E6IC 3FCSB 3PAYA 1BAFL 3SD2A 3GBLA 5HBBA 1DVFA 2NT1A 3NIGF 3NACH 1C9SA 4PBDA 1RJZA 3L3JA 5IHLB 3SDAB 3HHMA 4WSKA 5C0BE 3CVIH 4DP0X 4WHYG 3CDGB 3GKWL 4HC1H 4DKFH 4L4JA 4MA3B 4BCXA 1AD9A 4PJEF 1NFDF 3HHSA 5ADPH 5ITBH 1AO7A 4F8LA 2RGSA 4PS3A 5A40E 5D1QC 3QQ3A 1KXVA 2QQNH 2WYTA 2V3FA 1UGNA 5C86A 2AAAA 4KUZL 1XR8B 2FAUA 5DZVA 1IB5A 3DO7A 2C3VB 5F7YC 3QUKA 1YZZA 3WFBL 3FU9A 3OVUB 2Z4TA 4LVHC 3MRGB 1PY9A 1C08A 4OQTH 1J11A 3GI9H 3V95A 2AJZB 4H1LH 5TTRA 2BC4B 2VR4A 3MV8B 3X1NA 4Z7WF 3KJ4C 5FUZH 4MZRA 5E1AA 3GMRB 4ODUA 5IQ9B 4NO3B 2D4FA 1KJ2A 4EDXA 5HDBB 5CJQL 4NBZB 4XBGB 4YSAA 3CHXA 1VENA 1XHHA 4QCIA 3H9SE 1S9XA 3KYNB 1T7ZA 1E9PB 4O02B 5IBTL 3RPKA 3UBXA 1BG1A 4N2KA 1ZHBB 3SE9H 3QQ4A 5A16A 1MW2A 1PMYA 2UV3A 5AW9B 1QATA 3DK2A 3BQUA 4JFSA 5KVEL 2UUDK 4E41E 3NIFF 1XWVA 1BOGB 3DPBB 1MI5B 3CFUA 4XPFL 4YFLI 2ZSVA 5BVPL 3F84A 1NM4A 3F58L 4LEOA 5DS8A 4YSCA 3HR5B 4MB4A 3AT8A 5ERWA 4UZUA 3ARWA 2QADD 3L9BA 2GIYA 5B3JF 1USZA 2HT3C 3ULUC 2CXGA 3CHPA 5AL8A 4DOHE 3C60D 2CJUL 2DLIA 3Q5TA 4AUJA 4Z7UF 2MEJB 1XSKA 5F21B 2GJZB 1DBJL 1YEFL 3PFQA 4M93B 2FCBA 4JKPL 2ICEB 4P05A 3KL0A 2F08A 1P5UA 1SN0A 3BZDA 4A63A 5CCKL 2GABA 1LEGB 1RZIA 3WIHL 2CDGA 4BKLA 4NQDD 3FT3B 4DF9A 2VE6A 2EADA 2BNQD 2L0DA 1Y6MR 3BP5B 5DUPL 4E68A 1K5NB 2PF6A 3DYPA 3BESR 4DP9X 4Y4FB 4F33A 3BKCL 4HPYL 1ZV5A 2OMXB 3PWPE 5HHXL 2Z34A 1T7YA 3QQXA 3VSTA 2XX1A 3DROA 3H42H 3VFNA 1JHKL 2FEEI 3VXRE 2EUVA 2EH8H 1TSHA 3UC0L 4RFNC 3U46A 5E8OB 5I1AA 3PL6B 3L54A 5LXVA 2ZX9A 5HP5A 5DA4A 3NJVA 3VVWA 4PJIE 3UEQA 1QPPA 5AVSB 2WNGA 2YPVA 4PJ5B 3EDFA 4OM0H 3SDXB 2IWFA 4LHUD 3U1SH 2UXTA 1EMTH 2FLMA 4F7PB 1J5OH 1JV2A 3FU3A 3ZR5A 3L16A 2NY6B 1T0NB 2ZXWB 1G7MB 3K5SA 1SFHA 4HSCX 3NSXA 1WAAE 1OCWH 3QJQB 1CU4L 4L9LC 1KGCD 1M7IB 4XX1E 1MNUH 2CAKA 2AJYL 3EGSB 5FCSH 4Z0XB 5BNXD 4GEJA 4ELKB 1DSFL 2FX7L 2H1PL 4Z7QF 2EXTA 1AZVA 5DTFA 1H6UA 1AR1C 1MWAL 5ABZA 2FL5B 2GUOB 3A0OA 3CSFA 3L2NA 1QBML 1Y6NR 4HCRL 2CLRA 5J1AA 3UROR 4LPYA 1F58L 3K8LA 4PJHA 3DURB 4NQXA 5E00A 3FSOA 2ZYRA 2YFOA 2E0PA 5IHBA 5K9OB 1NJ9B 5CJBA 3HBZA 2NUTB 3GSQB 2YA2A 2IG2H 4WUUD 4O51B 4LHUG 1JFQL 3HMWL 5H94A 5F7AA 3SO3C 1QNZL 4GBXA 3QO1B 2MOVA 4X98A 1J9RA 1QSEE 3GMPB 4UOW0 2ITDA 3Q1SH 4HIIA 4DKEH 1G6RH 2X4SA 3GI8H 1R5IA 1F18A 2VKWA 3NABL 5KSAD 4KC3B 4D0BB 4YJZL 4FKKA 2G5BA 3CMGA 1NGWA 3WEMA 2O5XL 2NXYC 1DVXA 1D5XA 3FQNB 4TSBH 5JUEH 4NZFA 2X4PB 1A6WH 3GSNH 4J4PC 2YA0A 3BMVA 4GINA 3GSXA 3IDYB 4G6KH 4Z5RA 3N1QC 2WMPB 4GMSL 4ALAL 1VGEH 3H54A 1OGSA 1JGUL 3RWEA 3VFWB 1ICTA 4X6BA 4PJDA 4PP1C 5EUKB 4OCYH 1YN6A 2XFGB 2FDBP 2QELA 3QIUB 5GGVH 3ZE2B 2V5MA 4JM2A 3V7AE 3EJUA 2DQMA 2ZOWA 3QDGB 1RJYA 4DIXA 3CVHA 3GBML 4Z3FA 4AK1A 4ZYKA 1P7HL 4Y1TA 3ZZ1A 1CS6A 4TQEH 1A9BB 4QKTA 5D70L 1Z3GH 3ERXA 1GCFA 5J3HC 5AG9A 1W6WA 1NWPA 3KXFB 4L9DA 2RCSH 2LT9A 3G9AB 2P24B 1AH1A 3U83A 3LKNB 1A3LL 1JI2A 1G0DA 4H8VA 1A8ZA 1YJDC 2WQUA 3OHXC 5L8JB 4QD2E 4JPVL 1H5BB 1N67A 3KW8A 1KXQE 3B2PA 3IU4L 5FUOL 2OTPA 4C83A 2JH2A 3MRFA 4CJ1A 3TYFA 4OD1H 1S3RA 3MNWA 4MS8D 5LB1A 3KGSA 2AJSL 2A9NH 3BAJA 2ZUYA 4IIZA 1KBKA 1MDAA 3LRKA 3QO0A 4LGPB 4NNXB 1KTKE 4AJWA 1A8JH 5DSCA 2A4CA 2A6KB 2GTWA 2YKLH 4FNRA 3O45B 1TETL 4H88H 4FTVD 2XTSA 1MF2H 2ZXDA 4JM0A 1QUNA 2IAMB 3C2AL 2FD6L 2CH8A 4TSAH 3T6QC 3EG9B 4FZEL 3UTPD 4NDMA 4TTGA 1J0HA 2VDRH 2VT0A 4F92B 1KIRA 1OM3H 4M8QA 1TF4A 3AB0C 4JY6B 4LOEA 4PLJD 2VERN 4LCYA 5IBLD 4BQ6A 3Q6FB 1NCAL 5EBLA 4EUPB 2VLKD 3TBVB 2OR9H 1R5VB 1V3MA 4GP5B 1BGXH 2GT9B 5JHDE 2DM4A 2GITA 8FABA 1KB5A 4WUKH 3AG2B 3TCLA 2AGJH 4H7VA 5GGRY 1L9QA 2DWDB 4ZUSB 5DMIH 2ARJB 2WNKA 1I3GH 5C3TA 3I6KA 4NQSB 1MVYA 1KULA 2ZXBA 4Z18A 5JW3L 1QFUH 1ZK9A 2KS0A 3AXLA 1JHLH 2ATAA 3RFZA 3T6VA 5E5MA 2GSMB 1NQBA 1KIPB 2R0KL 4GRMB 1I9IL 1WUZA 4HFUL 2HVJB 4OSUH 3IMVA 4LLQA 1YQ2A 4ODWA 1LWRA 2DQCL 2I60L 4LOUC 4MA8L 4NO5B 3V5DB 1F0LA 2OMUB 1G9HA 3RVWD 1IKNA 3P0GB 1CQYA 4N3TA 3WOVA 2XY1A 3FTXA 5D6CB 2F58L 2R56H 4B0MB 1T1ZB 3F12A 4G8EA 5KG9A 4QWWD 5BQ7B 1FVDB 5T3XL 4V33A 3DHUA 1FPTL 1RSYA 5C0ND 1X9QA 1U8PA 1A6VH 3ROOB 4DP5X 1F3RB 3JQOB 2BCKB 1YNTA 4AZUA 5CWSB 5ESVB 5HGAA 2AJUL 2WLHA 5CUSH 2OJ1A 4K23H 2X5PA 2CHDA 3L08A 2WWKT 5DRWA 1HNGA 3ILPB 3LZLA 2H32B 5DVOA 4XNYH 3L95B 2R9HC 3B8SA 1UM5H 1R1CA 2FWOB 4YO0A 2CIIA 4UUJA 1TKWB 4FMFA 3QZWA 2BHUA 1S9WA 4S1SH 1WD9A 1T0MB 3F7RA 4AUUA 3DMMA 2NOYA 2VQ1B 2ZKHH 1CF8L 2FSDA 3VQLA 5JNYB 4RAUB 4PJ7A 4J6RL 3EZ8A 3QWQB 2YD5A 3OKEA 2XWRA 1YYML 3GHEH 2QSQA 1CXEA 2EABA 2NSMA 3JTTB 3QG6A 4TUKH 3EO9L 5T1KB 2JV6A 1D9KB 4N68A 1IQWH 2A83B 4PJXB 4Y4FD 1QQDA 2GI0A 3BFWA 4J12A 2HZHA 5ECJE 5MHSD 2WIMA 2AQ3A 4UAOB 4WW2A 4JN2A 3MA9H 1H3XA 4LFHD 4WGKA 2X6MA 3QZMA 1LMIA 2L7EA 4IU2B 4QYAA 4P4KA 1MRFH 3LKQA 4YEEA 3QIWB 3P4LA 4QNPF 4ZTPH 3PL6D 1XH3A 1WPCA 4LLMB 4M3HA 3MCKA 3TFBA 1HNYA 5LKNA 4PJ5D 4JFEB 5C0JA 3NUKA 2IV9A 3KG5A 2BS9A 5HYQA 3UTTE 3W9EB 4P2QB 2ZOLB 1AI1H 2HWZL 1LMKA 2NY6D 4NQVB 1DQML 4FLRA 3WIFB 3ABLB 1YUKB 2VM3A 5E5LA 4K71C 2VRKA 2X4RB 5BRPA 3H53A 3KPSD 1PZSA 4NB7A 3M1BA 2UVFA 4RGOL 1R47A 1HHJA 4O2EA 3CPLA 5IVXF 2B3IA 2VDKL 4QIRA 5CKAA 1NBVL 3BRFA 3HLAA 1U8JB 1NCUA 2VR6A 3MV7B 4L1BA 2ZUSA 3MHZA 3NMEA 5F89B 4O2CB 3VGBA 1IAKB 1XF4B 1MHHA 4PRPA 1GZQA 3WJLA 3UYOD 3MUHL 2RFXA 4RSVA 5KSBF 1E8ZA 1HYSD 3SQRA 2W5PA 3K4ZA 4NQED 5CAYB 2A6DB 4YXKH 2Q6WB 2DIJA 2FE0A 4X6CE 2E6QA 3P73B 2DJSA 2Z8WC 4I7ZC 1QEWA 2BWIA 2GJ6A 4ELMA 3T3MB 5CEYB 2VR8A 5B1BB 3RAJH 2GC4C 3L3OB 3I75B 4XP9H 2DDQL 2H6PB 4FQIH 5DRZB 3D85A 2VM4A 4QRBA 2MCMA 3VXTB 3BSZA 1LJMA 2A77H 4JL1A 4X5XA 4KO6A 4OAWB 5D8JH 1KWKA 3HE7B 2WQXA 3J07A 4DHLA 1YUHA 1BLIA 4YL4A 2COQA 3DVIA 4Q4IA 3FT4B 4A7GA 4L5FH 1AYOA 4KXAA 4KROB 4RNRA 2KMWA 1ZLSL 2F5AH 3ZK0A 5DJ6B 3M8OH 5CEZH 5FPIA 4NQCE 1INQB 1QYGL 4RQQB 1UASA 2A9DA 3BOVA 4ZO7A 1E67A 1IKFH 3P0YL 3QEUA 3MUGB 5DJ0A 2VQ4A 3NCEB 2MCPH 4H0HB 4U2YA 3JWOH 4KMQA 5DVNA 1ZLWK 5CCGE 5T3ZD 4F91B 5HVHB 2Y23A 3MLSH 4HEMA 1MH5B 2HTLC 4NUGH 4IK6A 1JHTB 3QUYC 3SPCA 5IQ7H 2V7HA 3LIZH 4S0TD 3GZOA 3PWNB 2VDPH 3KXFD 3FFCA 1XGQB 2EEDA 3IPFA 4Q6YA 1VSCA 1AQDB 5F7DB 4WWPA 2Q8AL 3WS6A 4AL8C 2AV7A 4K0OA 4JAMA 5I15H 4F2FA 1DEDA 1QD0A 4NZUH 3O2WL 1UXLA 3NDZE 3KYKH 4F7MA 3MCLH 3WENA 1LD9B 2VABA 1FZOB 2IDSA 4JDEA 3TBSB 2DQEH 3HAEH 3QRFM 2X70B 5E99L 4IKNA 7FABH 4ZS7L 2PWDA 2ZUQB 4DH2A 3NH7L 3ARFD 3MDJA 4XAWH 5CHNA 2BNRA 1BMGA 1CQKA 2FIRT 1DJSA 1P4BL 3EOBA 2WLYA 5D7HA 1RD6A 1TJHH 1TZAA 4JRWA 1S9VA 4U1LB 5DJYA 3KPRB 5IW6B 3KR3L 5E4AA 1SZNA 5BRZE 1F3DJ 3U1PA 1M6UA 2VLRA 3AC0A 3LN4B 1IGMH 3HS9A 5IB2B 4KRMB 3WV0A 3U6RB 3OJVC 3HG3A 1E9QA 4FI6A 1TVDA 3FB5A 1MHCB 4WO0A 4XP5H 1Z2KA 4NC1E 2GQHA 3GT6A 2C7UB 1HXMB 3RA7H 5CP3A 2BJMH 2VQTA 2YGNA 2ZUUA 2VIRA 1WIUA 1A3RH 4LPWA 1H8OA 2E9BA 4MAYC 4YLBA 4K3EH 1RZFH 2CRZA 1P4LB 3IDNA 4HKBB 4UT6A 5CZVL 1LL1A 4WWKA 1HE8A 4XNQB 2HAZA 4OY9A 4XXCC 2WZ0A 4L5FE 3OQ3B 1PZ5A 3NEEA 3PJLA 2X6BA 4UTCA 4F9LC 1XGYL 1JWSB 3L3DA 3RKDD 5E94B 1S7UB 3WL9B 4LHJB 4LCUB 3ZE1B 3GMQA 5CEZE 2DMGA 4EN2A 3K7UA 4RFEB 5A2BA 3TEZA 2D0HA 5SWSA 4I18A 3MTXA 1U30A 5IY5B 2PXYC 4XPHL 3SPJA 3O4LE 5DUBA 3FOMA 3UYPB 4LHQB 2P5EE 4HC1L 4H25B 2YN3A 4ZAKA 3HZKA 4NC1C 3FRUB 1CYGA 3PWUB 4M6OL 1BD2A 1RKRA 4RRPM 4BSJA 5B7FA 3ETSA 2AEQL 5EBGA 1EEZA 2AEIT 3SIKA 5HYIA 5F9DC 5I5RA 2YC1A 3VE0A 5IT2H 1IX2A 1UJ3A 3MRNA 3C5JA 4N0UA 1DBKL 1DJGA 5GRWA 4YSTA 4O5LL 4XHJD 1G7IA 4DSYA 2BW4A 2YPLD 4Y5YC 3MBWA 4YDZA 5FO8A 1I8AA 1I8UA 3CFNA 5E56A 5IEKA 4UTBH 2VDLB 4NZRL 2FWLB 3F7PC 1KTJA 4X5RA 5FUZL 1AIFA 4MRBA 5GGRB 1X5LA 3NSYA 3QJVB 1MCLA 4F57L 2KZKA 5ISZA 1SY6H 3ECQA 1H6TA 2YAOA 3VFPA 3AACA 2HLAB 1U3HB 2H3NA 2X3BA 3NGBC 1ORSB 4PJAE 3SE9L 3F7LA 3KH4A 3GJEA 5DMKB 3CZFB 1JUFB 1LLAA 3GUFA 2XBDA 7PCYA 2FR4A 1E5ZA 3ARZA 4OLZH 2EE6A 3UO8B 5FR3A 2WO3B 3V6OA 5D1ZA 1C1EL 3LV3B 4HBCL 4BQBA 4ZDHB 5EU5A 3EFOB 3NIDB 3CFIC 3VA2C 3WTXA 3QFDB 1NGPL 5E1QA 1EGJA 3VW3L 4Y19D 1ETA1 1JGDA 1E28B 4YAQB 1NAML 3O41B 1P5VB 1YJDL 3P0VL 4XE5B 4NO0B 2D0GA 4JFVA 1U8NA 4P23A 2WBJC 4LCWD 4LSSL 2NMSA 4ZRGA 3SKOA 3S35L 2X6UA 4BKSC 4P2OA 5L4MA 2UVEA 5LO7A 2JWYA 4JBSA 2OXHB 3TPKA 3US1A 4FL4B 3WLWD 4HOZA 2Y7QB 4RRPG 1AOHA 1Q4NX 3T4AC 1QMUA 4TOYH 15C8H 3CVBA 3KJ6L 4NKMB 4P2QD 1UB6B 3TO4D 1FFOA 3TCXA 2EYSA 1YEJH 2WNWA 2VZOA 1J8KA 4A37A 1A6ZA 5CFAA 4K3GA 5T5NF 1MCEA 3HZVB 4KDWA 1K9TA 3H42L 4OKVA 4YXLH 4UQEA 1U8KA 2D73A 1I8MB 3IF1B 2ERJB 2XX0A 3MV7D 5AAWC 3S96B 2W94A 2BSTA 4WWID 5IW1B 3QNYB 3RWHB 5I1GH 1NGQH 1ZVNA 4ZQKA 3TTYA 2N7BA 1AYRA 4OM0L 2OV0A 2QGDA 4JLRB 4IRJA 3U1SL 4DETA 2H9GB 1EMTL 3VH8G 1AQMA 4OD2A 3WNNA 5C0GB 5KJ7E 1I1YB 4N25A 1PD0A 3TBWA 4ZOEA 4XNZC 5I75C 3LVTA 1JZIA 5HDRA 3S37H 2EKSA 3OKNA 1MNUL 4P4RB 3BGMA 4N2FA 5C0FA 1FFRA 2BERA 5ACMA 5SWZA 4AIEA 1J86A 3NRFA 1ZA3A 4OZHA 1WF5A 5AOMA 3L4VA 4P5RA 2ICWA 2DKUA 3BH8B 4ZW7A 3ZZSA 1R17A 3HE7D 1AVAA 4R8WH 3ZX1A 2R8SH 6TAAA 4Q2ZB 1Q9WB 2OQJA 1MG3C 2WYZA 3GRWA 4KROD 1AJ7H 2E9WA 4HFWA 4M62L 1CTMA 5IB1A 3KPLB 5G4NA 4QJ4B 4HT1H 5BOZG 3T9WA 3AG1B 2CO6B 2IG2L 4HJJH 4NKOB 5M95B 1JK8A 2ZXQA 1KFAL 3ZQWA 1PLCA 3Q1SL 2XLLA 4HOWA 3UBHA 2M2DA 3J27A 1G6RL 4N5UA 4NQDE 4F7TB 3G6JA 1EHNA 1ZT7A 2QR0A 3PREA 2CPCA 2EDDA 3L4TA 3DX0A 5D4HA 5C6PB 1CLZH 4ODTH 3HC3L 4P59H 3QXAB 4NT6B 3PE9A 4TSBL 5JUEL 1MCNA 2BP3A 2NNRA 3GSNL 5JOFA 5IQOA 5EBMB 2EZ0D 2DQJH 3LQAH 5E4EC 5HI5D 3T0XA 1YEDB 5I8CB 4Q6IC 3GLDA 3PDGA 1VGEL 1KF9B 3DTUB 1W0WA 5HHNA 1DUZA 1GXEA 5F9OH 1RI8A 4OZFG 3EGDB 3LNGA 5IJVB 5GGVL 4JANA 1E4XI 2VR9A 2PW1A 4JCMA 4PM1A 2ZG2A 2BVEA 3B9DA 2ZWNA 4AE1A 1BQLH 4M7KH 5LLIC 3ARBB 4EI6B 4I0PC 4EF3A 5IKCB 2ZICA 4AT6B 4TQEL 2LVEA 1Z3GL 3TJPA 2BOLA 5GRZA 3SOBH 3QUHA 2DWSA 2DQGH 1IJNA 1KGCE 5FA3B 3AUVA 2XBZA 3KPRD 4BBWA 1QI3A 4M6NL 4WTQA 4YFDB 4E42B 2C8NA 2GHWB 5DUML 4FXLA 1X5AA 2P44B 4BZYA 5J9PB 1P6AB 5JHMA 3RX5A 4UM8A 5A3IC 1JBJA 2P5WB 3MPCA 4U6YB 2A9NL 3EO1A 4XZUA 3ECBB 1QP1A 1OT4A 4PW3A 5KYYB 3U48A 2ENYA 4MAUH 4YDIH 1QLEH 3D0VA 4BKTC 4DPCX 1ADQA 3SBWA 4AQ8A 3WTWA 1IAIH 2WCSA 1Q9LA 4WUUE 3KWWB 2YKLL 4H88L 4UTAL 1F4XH 1WZMA 4OCWH 1SM3H 1VFAB 35C8H 4MTMA 2APXA 3DUUB 3QULB 3DIFA 4MQTB 4XO8A 1VZIA 5JPNA 3QXWA 2BP8A 3D06A 1ZLVK 1D5ZA 4OJYA 1F13A 3PGFL 4MJ5B 1ZANH 2CD0A 1DFBH 3TPUA 1LK3L 2YD4A 2WSPA 2V3EA 2XRAH 4GRLD 2BK8A 2J8OA 5BPPA 5EIIG 3FFDB 1X9RA 4LGSB 2EIZA 5HGDA 1EQWA 3QI9C 3WHE0 1MFDH 5GGUB 3ZKXC 4BK5C 1BZEA 1MFCL 3ILQD 5D1XB 5B8CA 1XZWA 2PMZA 1DQLL 1QZNA 1BGXL 3QDMA 4HKZA 4LAJH 4NN7C 3N2JA 5IMLA 5L4JA 1NUDA 2Z6FA 2D31B 3GBNH 3ARED 2DEWX 4PJFF 1XF2B 2DWEB 2OZ4A 4E9XA 1A6UH 3VB8A 2DYRB 1QWUA 3NP3A 2VXQA 3EYOA 1B2WH 5IVZA 1JZ2A 2W0LA 1U2HA 3QJUB 5DEFB 1Z0NA 4Y1AB 4JNXA 1I3GL 3I74A 2NLJA 2E5EA 2Z64C 4X7TA 1NPUA 4OJCA 4OIFA 5E2WH 1J87A 2X4UB 2EIBA 4WI7A 1X4XA 5D72H 5A2CA 2A6JA 4PRDA 4JK0D 2WWNA 3B3IA 3SE3C 4N1HB 4O02H 4R4FH 5KSAC 5C09B 3D09A 4YOKA 5JQ6L 2XPGA 3FNKA 2RBLA 4J3OF 3MUZ1 4JRYB 4EZJA 1ETZA 1FE8H 2OMYB 4OSUL 4Q9QL 3MXWL 4W4NA 2A74C 1H6FA 1IIIA 3HFFA 2O5ZL 1YNKH 2CLZB 3MRHB 3H6JA 4YNYA 3GD1C 3TYGH 3W5NA 3C6LB 3FPYA 1TQCB 3BUIA 4X8CA 4AQOA 4EPSA 3SEPA 3U9UB 3HPLA 3GZKA 4FFWD 3RIAK 4EBQL 5JW5B 3RVVD 2R56L 2VR3A 3S36H 3ZMEA 1B0GB 3TFKC 5HGBA 3BLBA 2ITCA 3BPCA 3QRGH 3ARQA 1DQJB 1JF6A 4R4ND 4TVPH 3SY0A 1SF3A 3U0PA 5SWQA 1A6VL 3ETBF 2WIIB 5I73B 2F1AA 2AW2A 2JELH 3GMNB 2DD8H 3UTPE 4XN9A 4PPTA 3GF8A 3MO1B 4FFTA 1MCJA 2FX8H 4XPTH 1Z9SB 5JPMA 3RFRA 1OTTD 3GIZH 4TSCL 1RERA 2VWEE 1UURA 3SBPA 4K9EH 4Y2DB 1RIHH 4XNYL 3FZUC 2R0WL 2DQFB 4AL8L 4BXVA 2Q86B 1MJJB 2VLKE 4TMPA 4X8GA 4OZGE 3BWSA 4LEXH 3ZL4H 2VDQH 4CC1A 4S1SL 3R06B 4O00A 1X5ZA 3MGTA 2ZKHL 2F61A 4HUUB 2JSFA 3IAGC 3SDDA 4A2GA 3IDXL 1I8IA 4PJCA 3L4XA 3C6SB 4LT7A 2J56A 2W07A 1S4IA 3HE6B 5GQBA 3F7YB 4MA1C 4BUQA 3LNIA 9PCYA 3GHEL 1AGCB 1KPRB 2XWTB 3OMAB 5CZRA 2X2IA 5GS3A 1U8CA 4Y4HB 1H3TA 4WNQA 5SX4I 4KITB 4AQ1C 1BZ9B 2VRAA 4WFFE 1UT1A 4P99A 5ANME 4MJIA 5E6IA 4U6TA 3CFKB 3VRIB 4WW1B 3UG3A 3G5VA 2DJUA 1FL5B 4OZIA 3OPZL 4GG6A 4ZTPL 3RZCB 1DR9A 4X4YB 4CMHB 2DPKA 3IVKB 2AEWA 3IFOB 1JN6B 4NN6C 2VWEC 4OR1A 1FL3A 4PRNB 5HDBE 3VDBA 1XIWB 1ZTMA 4I48A 5FKAB 2VUOA 4HZLA 1EXUA 1HH9A 4JREC 2Z4QA 3K81A 4JFDA 3QUZB 5D1QA 5E24E 4PWGA 1U4FA 43CAA 3GSWB 3QPQD 1AI1L 4AGOA 1QSFB 1X5KA 4OGXL 4LLDA 4L8SC 5BOPA 1J8HA 1HHIB 2C1OA 2H8PB 5IWLC 1FCCA 1MW3A 4CMMB 4HWBA 5IV2A 5D9SB 2X7LA 2Z3FA 4GRWB 2FX9H 3K6OA 1L5GB 1U92A 2CUAA 3VNYA 3FF7A 3DYOA 3BIKA 4A68A 4JUSA 3QZOA 5AVZB 4F2MB 1WFNA 2BCMA 4XVJH 2HRPH 4EZKA 5I8KH 5JTWA 4HIHB 4AJYV 4JO5A 3DWTA 3GIVA 3OAUH 4JHVA 5L6YL 5K9JH 1OAZH 3REWB 3QS2A 3B2MA 3VGEA 4WVRA 5EZOH 4D3CH 3T2NL 2DZEA 2IH8A 3F83A 4PJDF 5F0LB 1QLFA 3ZT7A 1INEH 4XP9L 2XHNA 3PHQA 2X88A 4W9EC 4FYSA 4DPRA 5F3HB 1FSKC 3K91A 5KJRL 3UZQB 2IOOA 2F7RA 3CHOA 2IIJA 2B1AH 1NC4B 5D8JL 3UERA 5L0QB 5DI8A 5C0NC 5MHSE 5H35A 4OB5L 4L5FL 4FZ8H 5T3ZH 1FO0A 5HPMB 3B2XA 1NGXA 1YVLA 4R3SA 2MNJB 2F5AL 4MNGA 3DJRA 2IBBA 1PKOA 3MUJA 2HSIA 2XYCA 2APWA 3M8OL 4NIKB 5E1AB 2DYSB 1S9KC 1PY0A 2VXVH 1KJ2B 5JYMA 1ZHNB 5ACZB 3BEVA 1IKFL 2CHNA 2EO9A 4PJ5E 4AY0A 2GY5A 3O6MH 4LEBA 1JPGB 5DQJA 2E74C 3SDXE 4IM8A 1DJYA 4FXTA 1FHGA 3ARBD 5BMFH 4XRCA 4YL9A 4N24A 3QUXD 4NUGL 2LOEA 3LIZL 2BRQA 2X12A 3CSGA 3Q8CA 2DEXX 1A64A 2EYRB 2VDPL 2C4FU 4U31A 2HH0L 2V5YA 4HHWA 3KPSE 1BQHG 3ZE0B 4IHBA 5I15L 1RU9L 2CNZA 5MEPA 2V2TB 4I3SH 3FQRB 5ERWB 4DKDC 1QFWM 1EFXA 2NR6D 1OCCB 4PJ8C 5B21A 1M7DA 1E9OA 3KYKL 3MCLL 3TN0C 4AUYA 3TEUA 3ZDYB 3DXAD 1CICC 3ZIYA 1P7KB 2DQEL 4NNPL 2P5WD 3S4SG 2X6CA 4U0RC 7FABL 3QB7C 1CDCA 4NQEE 1BVNP 2OMVA 1WEJH 4G1EA 2EDNA 4H20H 3IGKA 4CGUB 3TH3T 4WK4B 1CVSC 4KXBA 1MFAL 2V3DA 2NDGA 4W6WB 1TJHL 2R4RL 4L4VD 1IBYA 1RZIB 1ES0A 2CDGB 4NYLB 1JTOA 4BKLB 4EUPH 1AC0A 2XQYA 1OTSD 2XWCA 2WWKO 1MDTA 5E8EA 2YQBA 5IUCA 2LU7A 4ZSOB 3KL3A 4FQLH 4KDTC 1U8OB 1BW8A 2VKXA 4F33B 1HI6B 4XP5L 4OFVA 1K6QH 4HJTA 2QKIC 2VJ8A 5EUOB 5SV4A 4I77L 1ZGLP 1WA0X 4FXKC 1ZY9A 2BJML 1TJGH 2E46A 4HEPA 5CSZB 4D8PA 1KCWA 1RV6X 3TV3L 2DTML 2HKHH 5FW8A 5D1XD 3ES6A 2WWMD 1NFDE 3WSQH 3F7VA 2WOBA 1PLGH 1KIQA 1QR1A 3ZE2E 4D9RD 4ZUVA 4LVEA 2ALAA 4Z7NB 2RA1A 1J9CT 3OGCA 5T3ZE 3WI9A 4P2RA 1J0KA 1S5HB 1SJXA 2UWEA 4YWGL 1RZKC 1JPFA 1CTNA 4WU5A 2IDTA 1IVLA 2BSCA 1B4RA 4MQXD 1I8LA 2ZCZA 3KXFE 3ZKSD 2OL3L 3WMQA 3APCA 2NY5H 3EO0A 3C5XA 3LZFH 2QVTA 3OF6A 1H15A 3S34H 1FL6B 2HYMA 4FG6D 5F7WC 4Z7WE 1GC1H 2X1OA 2EXSA 4LLYA 5ES4B 1CB4A 2I07B 3OAYH 4I87A 1WD8A 4TUOB 5DTFB 4P07A 1UWEH 5C09D 5D7LD 5EZPA 1YNTF 3HG0A 2J1KA 2VDNB 5DVMA 4OJFH 2BS71 1VFMA 4JRYD 4GEIA 3X3GH 4M00A 5CLWA 4NWUH 3D05A 4PHXA 3D30A 4Y4KA 3O2VH 4OD3H 4NQXB 4UIMB 1PYWA 3HJEA 3P9MA 2PWGA 5AUMA 3G5WA 3C6LD 3CE1A 2ARJQ 3ZW3A 5MEND 1G9NH 4P9HC 5L8KB 5IT2L 2R29L 1H8NA 3LKOB 3LXBA 2YRZA 4GBXB 1PAMA 3L3HB 3OXSA 4X98B 2HFEA 3ZJAA 4AM0B 4G9DB 4Y5VC 5FYLD 2H32H 2ZF8A 3DGDA 3MXVH 4I3RH 2Y1VA 3MZGB 2X4SB 4MZ3A 2A6IA 2I32A 4G9FA 5GIRB 3ESOA 1PTZA 4M1CD 1HHHA 5T5NG 4AQZA 4BZ1A 5AG8A 5B3JE 5CJOH 1NSNH 5C8JA 2Y6SD 5DGQA 3M7OA 4R96B 2X2UA 2GBUA 1F2QA 4N2CA 1JG9A 3PP4H 3GSXB 4Y2DD 4J8RA 5C2BL 5I19L 1OSZA 3QYMA 1GYVA 3BVTA 5DFAA 3RWDB 4J3TA 4Z0BH 2BY0A 3RWEB 1UQSA 1NCGA 4HUXA 1PS3A 3FO0H 4M6AA 2FJUB 4MJ2A 1YN6B 2IPTH 3GXMA 1DQVA 3OV6A 3IDIB 3V5HB 1G94A 4JM2B