5GGVH

Ctla-4 in complex with tremelimumab fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
225
structure length
225
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords light chain
total genus 48
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH01
2DN7A 4HKBB 4I3RL 4BQ8A 3V4VH 1KC5H 3UO1L 3ZKNC 3GSUA 3VDAA 5H94A 1Q94B 2XICA 4BJLA 5DD5H 5C70A 4Z5RA 2WBJA 2ARJB 1EGJH 2F5BL 2NY0B 1JGUL 4ETQA 3VFGL 4U6YA 5B4MC 4U6XA 4U1LB 5AAWA 2AKRB 3TA3C 2GEEA 3MRCB 4PJBA 4XRCA 3QUZA 4LDOB 4ZUTA 3CZFB 3C9NA 5EZOL 5F7LB 1HOCB 4UU9A 5IMOA 4C83B 4XPGH 4AT6B 2V6HA 3C2AH 4DZ8A 4TVPE 1UVQB 1G7LA 1QKZH 5IMKA 3RDTC 4PRDA 4EUPH 4DW2L 1BFOB 5E5RB 4G8FB 3OKMB 1BM3H 1NSNL 3P9MB 1CGUA 3DX8A 5BXFB 3E6FB 2FHBA 5HHOA 4W6XB 4OZHE 3QDJE 4WI4A 1OVZA 3X17A 1QNZL 2R0WL 5DVNA 2AP2A 3FT4B 4GAFB 3SE3C 3PQYB 3FO9A 1I7ZA 4G6FB 3D0LB 1J8HD 4I0PB 2X4PB 4JVWA 2YPLB 3S7GA 5E8OB 2VLRA 2R4SH 8FABA 3RPIA 4PLOB 2YD8A 1NC2B 3EDJA 1RU9H 3FOLB 4G43A 1IMHC 2CK2A 4PP2A 4FQHB 3MROA 5CILL 3VXRD 5F72S 3GMLA 4PS4L 1CN4A 2W0KA 3SDCA 1WZLA 4MAYD 4U1LA 1CF8H 5L88H 4ZSOA 5IB3A 4K2UH 1I1AA 3K4AA 1IGFH 3SDYH 4MD0B 5F9JA 4PJGB 1P5UA 5CD3B 4M6NH 2ZKHL 4AYFA 2Q8BH 3C5ZD 5D7LD 4UDTB 5CP7B 1C5CL 3I6GA 4JZJB 1Y18B 2B1HH 3C08L 5KOMC 5EU6B 3CFCH 4NM8L 4HWZA 2EIBA 1T89C 3CVIL 4ODHH 1KGCE 5DJZA 3VFMB 2NNAB 1G7HA 2X4SB 2OTUA 2EIZB 3R0NA 3ZTNL 2OR8A 1JBJA 3PQYA 4U31A 1QFOA 3OKOB 4FXGB 5I8KL 1A6WH 1P2CB 3RTQD 3VI3E 3K4ZA 3RIFF 3H3PL 2CXKA 1C12B 5IBLC 4QHNB 3UJTL 1J1XL 1MIML 5K59F 4NZTH 1KJVA 4OTXH 2WSKA 4X6DA 1F4XL 43CAB 4QHMA 4TOYH 4IRZL 3QB7C 3NGBC 4C57C 1FYTA 1VGKA 3WDJA 4JPKL 4FFVC 1YMMD 3D3VD 4KV5F 1J1PL 5DURD 1R3HB 4ETYA 4U1HB 4HKJA 4QGYA 2CLVA 5IOPB 1F4WH 3CXHK 2V7NB 1N6UA 2A9NL 3HNVH 3RWFB 1RD6A 1UH3A 3ZSTA 4UINH 4F7PA 1ZLUK 1CFSA 3HC3L 4S10A 3U4AA 2XKSA 4NM8H 1T5WB 4LVOB 2HJKA 3LN9A 4WV1C 1MCPL 4OLVH 3LKPA 5T5NF 4P46B 2BXZA 2JCCB 5DHXB 2DQFA 5J57B 4DQOL 4QRRD 2AEQH 4XP1H 4J3TA 4FFZH 5AG9A 5SWZA 4Q2ZA 1D5IL 2NXYD 3QQ4A 4GRLD 3V52H 5I75C 4ELMA 3RVUD 4IRSC 4PP1D 4NC1E 3VXUE 4DTGH 1L7IL 3VRLF 1HHIB 1RUMH 4HAFA 3STBA 4H8WC 3SDDD 4H26B 1PZUB 3IDNB 2HKHH 3O9WA 5FKPA 3AGVA 4ZOCA 1DP0A 3ZDYE 1AO7B 1QLEH 4NPYB 5MEQA 2EDXA 1TVHA 2GSGB 4D3CH 2NY0D 2ZUSA 3IDYC 2QBWA 4NN7C 5F9OL 3VA6A 4MA3A 2J8UB 2FGWH 3O3BB 4PJIF 3RWDA 3VMOA 2I07A 3DXAB 1KJVB 1FIGH 2A6IB 4F7EB 4XWGH 2P43B 4QHNA 1N5AB 2GJ6B 4WU7A 4N0CD 3O11A 1WEJL 3FRUA 3HPJA 1BD2E 2GCYB 4IJ3C 5D1QC 5HPMB 3CLFH 2I26N 1Z5LA 2HLAA 2P8MA 4HEME 1MHCA 3CAFA 5GGQH 1X5XA 2VISA 2YMXL 4P2RE 4DZBB 3QHFH 2XTJC 4KVNL 4X7TB 5EUOA 5SWSD 1ZTXL 1EO7A 3S4SA 1PAMA 3T0ED 1RZ8B 1YQVL 3AS1A 4G9DB 1QEWB 4ZD3H 5CKGA 1JZ5A 4LVHC 4M62L 2NXZC 1S7RB 3MLZL 4MNQD 1I7RB 1BQHG 4RBPK 1CIUA 3ZE0F 3I3DA 3MRQB 1I1AB 1N2RB 1K8DA 1INDL 2CKBL 4KHTH 5EIQA 1QG3A 3F7PC 1MFAL 3S35X 3BQUD 4HJ0C 2R4RH 1EH9A 4NRXA 3DVGA 2DQGH 5CJXA 1AJ7H 3QI9C 3ARGD 5EOCJ 1NGYB 5HGBA 2CUIA 3DUUA 3ILQC 4Y16A 4XBPA 1C08B 3W9DA 5E9DB 3JVGA 3PL6B 3KPRA 4NDMA 1KB5L 4D9QE 4LPYA 5D1ZB 1OP3K 4ZYKA 3L3DA 4G80A 5C6WH 2FJGB 2VQ1A 2FZ3A 5CHNB 4APQD 1F6AA 2OP4L 1B4RA 3NTCL 3VXSA 4JY6B 4XP6H 1VENA 3C5JA 4TQEH 5GSVB 3MLVL 4UOW1 3DECA 5LKNA 1ZMYA 3IF1B 4JRYE 5C0FB 2YRZA 4DUXA 4P59H 1SYVA 3IAPA 3L3JB 1BZ9B 5D7JB 4F9PC 1CR9H 3P11H 4L4TE 4YR6A 3HZMA 4KZDH 1E27B 1EVTC 2Y07H 4GRWE 4MJ4A 2GTZB 4D0BB 3TJHD 2MNUA 5IHUH 1F58H 3G9AB 1EIBA 3G5YB 1UKSA 3ARZA 4M61A 3O2VH 5IVZB 5GRUL 1S9VA 5IW1B 1QFUL 5FYKE 3WSQL 4GXUM 4YC2C 3MXVL 4HWEL 4KKLC 4X4XB 3KPNA 2B4CH 1U8HB 5I73C 5J6HA 1CDIA 3DX6A 5C08D 4U6HB 5JIPA 5SX4I 4JY5H 5E08H 4NCC2 1C1EH 2ILLA 3A6BL 5GRYA 1NDMA 4WJ5A 5ETUA 5B39G 4NWUH 3QNYA 5GS1C 3FFCD 3C5ZB 4HKZB 3O45A 4JFYA 1FZKA 4EI6B 1EEZA 4DFHA 4R2GD 2VXSL 4PJIE 3S97C 3OKEA 4DCQB 1QSFB 3H9ZA 1IILE 1N64H 3S98A 4GQ9L 4KMTH 5DHYB 4LSPH 2ESVE 4CU7A 1IM9A 3AS2A 3N1MC 4M5ZH 4MLSA 1R24B 2OI9B 2FECI 1D9KD 2HH0L 2I60H 4Q58C 1A02N 3CSPA 4OIBA 1OL0A 1WITA 3TNMB 5D1QD 3UJJH 3FN0H 2NPLX 4FQLH 2GTWA 5EUKB 4OCNC 4LLWB 4ZUWB 3WFDL 5B39A 4N0UB 4X99A 2ADGB 1S7SA 1S8DB 2XN9E 2ID5A 1IZJA 1T7ZA 2NY7L 1WT5C 4LCWA 4H0HB 3MV11 2D3VA 1WBXA 4R3SA 2V5YA 3BWUC 3P4LA 4QRSB 1H0DB 3QG7H 4NQEE 3SDXE 3SQOL 3BX7C 4AIZB 4JQIL 3BDBA 1ZOXA 4WGWB 1GHFL 5TE7L 5E1AA 3P30H 3BSZH 1RIVH 3W2DL 1Q9LB 4NQXA 3O8XB 3ULUD 1CXIA 3QEUA 3ZDZE 4NDMB 2D9QB 3VXQA 5DO2C 2NY5C 5D1XD 3MJ9H 1KCLA 1CGSH 1YECH 1N26A 4ZPTA 4YXLL 3O45B 3UYRH 2EXYD 1NCWH 5E8DL 3PWVA 5EORL 3BZ4B 4G6JH 5HXMA 4ZXBB 4I18B 5GGRB 3NCJL 4YBLC 3K80A 3HE7C 3K8LA 3DI2B 1QUNA 4OKVA 5JDSB 2BY3A 4ODUB 3MOBL 1Q9OB 4XNQA 3E2HC 4R26H 3D85A 3C5SB 1KPRB 5KS9B 2DI8A 4EUPB 1KENL 4LVHB 5I8CA 1QD0A 5IB2B 1IGYB 2IBGA 2J3SA 3L9RA 2DQGL 2VL4A 1CGVA 3MCG1 2YA1A 3EYQD 2XZQH 1CT8A 5BOPA 5LGJB 5D9SB 5DI8A 4K9EH 1W0WA 4NC2B 1YMHA 3PJSA 1XF1A 3EYVB 3WLWD 2J1KA 3OHXA 2E7LC 4I0PC 4K94H 4ONHB 5MEPB 3EYFA 1NCNA 3KYOB 1HHHB 5D1ZC 5T3ZL 3RDTA 2H2PC 1EEYA 2WM0A 3VXME 3BIBX 3N0PB 2O5ZL 3GHEH 4N0FB 3ZTJH 5KZCB 2FL5B 4U0QB 2ADIB 1MIEH 4KU1A 1AGCA 4FNLH 4B7IA 4DKAA 2IC2A 3FQUB 2IBBA 1RJLB 4KC3B 1HYSD 1RULH 3MRRA 4TOYL 4IOFD 1N6VA 4CRPA 3ZKMC 4NGHH 4P2QA 5TE4H 3D39D 5ID0B 2W9DL 3QQ4B 1T0NB 1KFAH 4JZJC 1A9BA 1MLCA 3SE8L 5BVPL 3GSNA 5EO1B 5CLWA 1MPAH 4YNYA 5IT2H 5MERA 4ODUA 2ADGA 4P2QD 4PRIA 4YC2B 3QUXD 5J13C 4QHLB 4Z9KB 3U6RA 2FIKA 3D25B 3HMXA 1OARL 3EO1B 1IGJA 1T03H 1RAMA 3HMWL 4O00A 5I66A 4XWOD 1EBPA 5EO0A 3O3DA 2J88L 3WIFA 4MJ2A 5IW3A 4NP4L 2IAMD 5JA9A 4XI5D 2OR9L 5FDWA 3BKMH 3MV9B 3RY6A 3UPAA 4OGYL 3GBMH 1Z5LB 5EU3A 2BVPA 4Z7VE 1FZOB 4NKIL 1EHXA 4WTXA 4GSDL 4WI6A 5DJAA 4Z8FH 2W0LA 5D7KE 5TPWL 4R97B 5KG9B 3TEUA 4N9GB 1F90H 1U8MB 1RPQA 4QT5B 2OI9C 1U8LB 1QA9B 2VH5H 3GSOA 5D6DA 3WN5B 2MQCA 3L3OA 4PJ8B 5DWUL 2CKBB 1BP3B 5CBAB 4KKNA 1C5BH 4LSSH 1ND0A 1RK1B 3AM8A 4U33A 4YEFA 4EJ1C 4WWKC 3FN0L 2AXHA 3GEWB 5KAQG 1N2RA 5E2UH 3QNZA 5KOVC 5DT1L 3MO1A 2WUBL 3TBYA 5FUCE 1UWGH 3PWLB 1NFIB 4JFQB 5ANMA 2CDGB 5H35A 5IUSA 4LCUA 1KCVL 1F90L 4I5BA 4JFEB 4A6YB 4LGRB 4P0DA 4KTEL 3SCMA 1YN6A 4HIEA 1AY1L 1JPTL 3DTXA 3ZL4L 4FZ8L 1T4KB 2GITA 4UTAH 1FC1A 3FN9A 3PWNB 1BD2A 1NC4A 3KJ6L 4WI8A 4D9QD 3SGDI 4GW4B 2XWJB 4ZQKB 3G5VA 3JWDC 2WP3T 4UDUB 4F7MB 2JJVA 3DLQR 2J6EL 3OG4B 3E8UL 1CLYL 3QDJD 1CVSC 3UPRA 3VH8G 1KCUL 4PLKC 5SV3A 5DO2D 4O02L 1K2DA 5HHXH 2KUTA 5AYUH 4PJGA 3DNKA 1INEH 3TNNA 3K0WA 4G8IA 4KAQL 3IYLW 1IGFL 4KK5D 4CW1A 1X5HA 2UWEE 1A6AA 5E6IB 1V8HA 4NOFA 2BNRD 1SEBA 4CNIB 2ARWA 4S1QL 4M8VA 5D7JA 5FO9B 3KXFB 4HAGA 4LF3B 4OCMC 4PJIA 3F7VA 4IRZH 4RDQF 2AQ2A 4LKCA 5ESVA 4UB0H 3TPUB 2NY4C 1VEMA 5BRZA 1WF5A 4ZO7A 1PG7W 5SWZD 3SJVE 2APBA 1A2YA 3MNVA 3RY4A 4TUJB 1NC4D 1BD2D 1MJUL 3C60D 4NBZB 1J0ZA 4IRSD 4JFDA 2QKIB 4G80B 2E7MA 3ZKXB 4WNQB 4HIXL 1UWXK 5IVXA 4HFWA 2BNRB 3ZE2F 4EQ3A 1J1PH 3RA7H 2AJYH 3HFML 3SGEI 4MVBC 5BZWA 4NKQB 2QHRL 4LK4A 3T8XB 4LU5L 3VH8B 1JIBA 3O6MH 2W38A 3FQXA 4JHWH 7FABH 5B22A 4IMKC 4U1HA 1XZ0A 1MQ8A 4FP8L 2QSTA 3CH8A 3IETB 1QQDA 4MVBD 4JM2B 1IL1A 4WUUB 3VG9C 1TDQA 5JPMB 4L1DA 4FHBD 3G6JF 4S1DD 4TNVF 3HC0B 2RB8A 3VXUD 3TNNB 1A3QA 4K8RD 4POYA 3EZJB 4ZG1A 2FEDD 3L3GB 2ZPKL 4ZO8A 4J4PD 3QXWA 4E9LA 4XI5C 4JO3L 5CJ5A 4ZFOL 5J13B 2YKLL 5GJTL 3KJ6H 4MZ3A 1L4IA 1YYMH 1IKFH 2ESVD 4YXHH 4IHOA 5F7KC 1V3LA 3T4YB 1YY9D 1UYWL 3MRKA 3RNQB 2IANB 4JFZH 5EC1B 4GBXA 2X70B 4HV8A 5GRJL 1T4KA 4HC1A 4OBSA 5F7UA 4QEGA 1O0VA 2RGSA 3TH3T 2I9LB 4TVPL 2X7LA 2IPKB 3STLA 1LEGB 1TZHA 1JYVA 2IWGA 5HYQA 5DQJA 4MA3B 3ZT7A 4L3CB 1F5WA 1FJ1B 4TTDD 1KCSL 5HI3D 2CLRA 3ROLB 3VXTA 5T3ZE 1UVQA 1NBZB 2EYSA 2KQNA 3TCLB 5J11B 1U58B 2YPKB 4IDJL 1R5VB 2EDQA 2VLKB 3SQOH 3DARA 3VXPA 1PD6A 3KR3L 1JFQH 3RVXC 3QRFM 3CX5J 4PJ8C 5BV7L 4AQ1B 5GS1B 3T8XA 5JXAL 1T1ZA 3C5ZC 4NJAH 4D8PB 3NABL 2AXFB 5C0AB 2EEDA 5CWSA 2H45A 3D85B 2JCCE 1AD9B 3STZA 2R1XA 4JPWL 4OZIA 2UZYB 4LCCA 5ACMA 5DLMH 5F7EH 4YQXL 5JLZB 5C0IB 3TLRA 4JFFE 3U30C 4GUPA 4HS8L 4LARH 1QSFD 5E2TH 2YPLD 5DVLA 4OSUL 4JY4A 2GY7B 4KRMB 5C0CD 4EEEA 1HHHA 3IAGC 3L95B 4G42A 3QI9D 5CS7A 4PRAA 4QRTB 3QFJA 1T2XA 4O2CA 1YNLH 2QV2A 4GKZB 5CZXC 2ZG3A 4HUWA 4KWUA 4ZAKA 4OB5L 4S1SL 4Y89A 3QUYA 4WDIA 1Z0NA 3KPRD 3EDDA 2VKWA 4PRDB 4HGWA 1P4BH 4ZFFB 2ENSA 2EIEA 3HI5H 1PSKH 1IC7H 1VKXA 1T0MB 4WHYG 1NJ9B 3R0MA 5C0JB 5C07A 4BK4A 3SDDA 4OUUB 4JRXA 1OT1A 2KDGA 4X9HA 1U6AL 4PYHA 3QG6A 3QFJD 1CXFA 3F8UB 4P2QB 5IESL 1MFBH 1BEYL 3RU8H 4KGJA 3MREB 5HYSG 4OB5H 1GC1L 5HGHB 4FA8A 1A6VH 1A7NL 1EXUB 5I19H 2O5ZH 4PB9H 4KJWC 2VZVA 3GBLA 2VLJE 3AB0C 3O6FB 3E2HB 3QUMB 4U7MA 1JTTA 1OGAD 5BW7C 2ITDA 4LNRA 3O3DB 3ZKXC 1UZ6E 5I66B 1N8ZA 4ODVL 5FUZL 2D03L 1WT5A 4HJJL 5TH2B 1QRND 4H5SA 5JXED 4HMEA 2D0FA 5KANI 1FNHA 3DI3B 5B8CB 4WHDA 4EI5A 1EHLH 5DI8B 2C3VB 5GXBB 4OKDA 4ZFOB 5I8OL 4KTDH 1U3ZA 4JM2C 4K3GA 5L8LB 1VFBB 1IARB 2HJFB 1GL4B 2AKRA 4NQCD 4KHXL 1INDH 2HFFA 1J9CT 4GBXD 2B4CC 4HS6A 4PJHB 3FQTA 1S7WA 4FQJL 3D0VB 3KAAA 3RIAF 2R39A 5DK2A 1MHPH 1CTOA 1ZV5A 3MGTB 5HYSB 1F6FB 1KJMB 2E5EA 3DV4A 4MXWH 2GSIA 4ELMB 3WDIA 1Q0YL 4PR5B 3EYOB 2IPKA 5F1NA 2GK2A 5H35B 1ZT7A 3OG6B 3BW9A 4U2YA 5BJTA 4XNZB 5FXCH 1XF4B 4WJ5B 5ETUB 3SDAD 3NCMA 3HS0B 2UWEF 2GHWB 4HWNA 4OZFB 3VFRA 2FJGA 3RX5A 3E3QE 5JMOC 3GUTA 3GMOB 2OR7A 1MCCA 1JHKL 4JHZA 3MJ9A 1FFNB 3KXFE 4J3WA 2CIKB 1GGTA 1A3LH 4QY8B 1AQDB 5FYKD 5GHWH 5I18H 1MLCB 4PJFB 3NPSC 4PJ7E 3QNXA 4KRPD 3B9VA 4NQCE 5DD3H 1KG0A 1NUDA 3CDFA 3L7EA 1CLZH 3PWUB 3AREC 4MQXD 2DL2A 1EUTA 2EKSA 3GJEA 2X2YA 1OTSD 3VGGA 5DK0B 1I9RL 3NZHL 5HBBA 1T83A 2R1WB 4N0UA 4JFDE 1JZ3A 4W6YB 4XNXH 3TIDB 3MC0A 1JHKH 1ZHNB 4U6VL 3NCJH 5ITBL 1KFAL 1I1FB 2HVJB 2PR4H 3P73A 3VDCA 2ZJSL 1E4KC 3MRHA 4F33B 4OD3L 4KROB 1BQUA 4XP1L 4R97C 3I50H 3I9GL 4RCAA 3RJQB 4N0UE 1HKFA 1LQSR 3KPSB 3K46A 3C5SA 2ZCLH 5KSUB 3BD5A 2GAZA 3HPLB 1U93A 5AZEL 4OFKA 3PP3H 1XGQB 3M17A 4CN6A 3MR9A 1EZVX 1ZWIA 4K3EL 1MCRA 1HK6A 5LGJA 4UINL 2DQJL 1QFUH 1X5KA 2VE6A 2DQEL 5BOZG 4RGNB 4HG4K 1ONQA 2A6IA 3NIDE 4X9FA 3I85A 4JRXB 3BQUA 4NN5C 4QXGL 4U2ZA 3F6IA 1OF2B 2FCBA 3BKYH 3J8F7 4QY8A 5J7CC 4KKAC 4JFPA 5FDYA 2R0LH 3G5ZA 5FGRA 1QSEB 3BP6A 3FONA 1EHAA 5J0BA 1KPUA 3LPWA 4P59L 1AGBB 5LGHL 3SDCC 3QDGD 2R4RL 4U1JB 3VXNB 3CU1A 3GMNA 3S3JA 2B2XH 4NC1C 4KHTL 35C8L 1IGTB 3QUXC 4Z95H 3GMQA 5GRJH 3FTGB 1MEXH 1VERA 1FAIH 1V3JA 2QJDA 1GGIH 4EVNB 4XC1L 2JCCF 2V7HB 2MJWA 1YQVH 2FJFA 2ZUUA 2ZP0T 2XKNB 1OAQL 3RWJA 4NKDB 5IP4A 4CKVX 1TQBC 1SJVA 4OV6F 1XGTA 3AB0B 3O6FC 3SE3A 2VLKE 3HI1B 1MCNA 5FHAL 5IKCA 4OQTL 4NQUA 2NXZB 3CMGA 5ABDE 5FYLL 3WE6A 3FB7B 1Z0MA 3N9GH 2ZUQC 2RHEA 2NYYC 1BECA 4NFDA 1N3NA 3JWNC 4KMLB 3PHOA 1Z6JT 2BMKB 5HGBB 2C1PA 1JWUA 4HW6A 3WS3A 4IRSA 1F42A 4JFDD 5J89A 1DUYB 3EW3B 1IAKA 3QI9B 3V8CA 4GAYA 1E6OL 3ZT5A 5ACZA 4QXGH 5D7SH 4NHCH 2VOTA 2AK1L 4HF5L 2YPKA 1UB6A 1MCLA 5CEXA 4UQ2B 4XXCC 4RFEA 4JM2F 4NQDA 3TA3A 4IDJH 1MFEH 1FH5H 5I8OH 5T1MA 1QSFA 1YNLL 3KPMB 1YUHA 2F58L 4PJBB 4OUOA 4HGMA 5C8JA 3L3HA 4CVUA 5AZEH 2X1OA 5JA8B 3RWHA 2FLRT 3EOAB 4CADA 5A16B 3DHJA 3CFDB 3GGWA 3RWIA 4KK6C 2C26A 4U7KA 2NY2D 1FGVH 5ESQB 3ULVC 2JB5L 1Y6KR 5D7JC 1X3DA 2E27L 3RWJB 2UVFA 2XRAH 4XNZC 4EDXA 4Z7WF 4QCIA 3QPQC 5HHPB 4LLYA 5D7IE 2DQUH 5DUBB 3BH9A 5C2BH 2JJTA 1AJ7L 4KKBC 4RMUA 1GC1H 5CBEB 1IC1A 4UBDC 3RUGA 5BV7H 3X11B 3ZHDA 1FL5B 3U4EB 4ELMF 3LKRB 5ID1A 2PXYD 3G08B 4OJFL 4QRRB 4HULB 2R8SH 1P1ZB 1ORQA 1GCFA 1PG7X 3WJLA 4YHOL 1L0XA 5AAMA 5EOTB 3WJJA 2C7UA 4HD9A 2Y7QA 4Z7VB 1F4XH 3CXHJ 4G43B 4L3ED 4FP8H 1RUKH 4BK5A 1U3HB 3TGXA 3KYNA 4HUUB 4JHWL 7FABL 3LY6A 1TJHL 5LQBH 1NGZA 4QOKA 2PKDA 1JHLH 3A6CH 2P5EA 2EDKA 3UC0H 4WUKH 1YEKL 2X70A 1KNOA 5E2WH 2EO1A 2A83B 4JKMA 1OP9A 5MEOB 3GI8H 5C07D 2A9NH 2COQA 2V7HA 3RZWA 1ACYH 5HYQB 2Z0BA 5GJTH 4ONGH 3FQNA 4P9HL 2V2WA 1UM5L 2PO6A 2LVCA 1F02I 4AL8H 1BX2B 1C16B 3U4BH 1CXHA 1S78D 3CC5A 1SY6A 4NNPH 2XZZA 1ORSA 3MV8B 4AJ0A 1BAFL 1T89A 1YMME 3D3VE 4RGNC 4U1NB 3L3IA 1X4YA 1N0XH 4H1LB 4NN5B 4M6OH 3NIFF 3T0DA 1P69B 1YN7B 1XGRB 4ORGA 1GC1C 3DWTA 1RK0B 3TBTA 2ICEB 3QISA 5DRXB 5CGYD 4HK3N 4S1RL 3I02A 4WTWA 2DLGA 3HFMH 3ARFD 4F37K 1CFQA 3VXUB 3QXUA 2BNRA 3MJ7B 4LCWE 2JCCA 2OR9H 2PTUA 4NNPL 5DA4A 5F1OB 2BNQD 3RBSA 4PRHE 1C5DA 3I75B 4CVZB 5L2KD 4U3XA 1K4CB 3C8DA 1LO2L 3DRQA 4M48H 3CH1A 3FFCE 4I18C 3D39A 1BBDL 2HJLA 3MNWB 1WV7T 1YY8B 3QIBD 4XBEH 4WU5A 4K7PH 1R3LA 4LHUD 1ZLVH 3HC0A 2AJUH 3B8YA 4I77H 3BESR 5DFVD 5CIPH 4R4FH 1UXWB 1YNKL 5IJKA 4M7JL 1TVBA 1DBBL 1MWAL 1FLTX 4WEBL 4MNGB 3UTPE 2EDJA 1IFHL 1ED3A 1PLGL 4LNVA 2BNQB 3KLAA 4JN2A 4NHCL 3VH8A 3WFHB 4NO2A 2NXZD 3SY0B 3RUGB 3HC4L 1PVHA 3OMZA 2GKIA 1C12A 1E4XI 3ZKND 2HFGL 4CMMB 1U42A 1KPVB 4QOKE 2P49B 5B39B 3MMEA 2O61A 5H94B 2DJUA 4NYLB 4IOIB 5IB5A 4UV7L 3SO3B 4PBXA 1F4AA 1LK2B 3RI5K 5KSAC 3VXUA 4G7VH 4YHMH 5DVKA 5DZLA 4U1MB 4OLYL 4PY8J 3LOWA 5FGSA 5B8CC 3MV7D 4WU7B 1ZLWK 1X7QA 5BZDA 3B5TA 4GLRI 3SE9H 1EERB 1GIGH 3F5WA 1T3FB 2ARJQ 4UT7H 5HYJE 5C08A 5GGUB 4PJ8D 2BY2A 4XPGL 1G7JA 1RUPH 2BSRB 4PJBF 4OF8A 3MO1B 2DQIH 1FORH 1B2WH 3CD4A 2V17L 4ZOBA 4XVJL 35C8H 5GIRA 2WANA 4DZ8B 4GMSH 2ERJC 3VXRA 3AXLA 3UBXI 4UZGA 1U8JB 2JELH 1CICD 4IM8A 5BQ7B 2UY6A 5L2JB 1JUFB 1UXSB 3EJZD 4IS6A 4XMPL 1PEZA 1TLKA 4PJFA 3ULUL 3LQZA 3RVUC 3ZT6A 3VRIB 4RAUB 5ESAB 1F58L 2FRGP 3CSGA 1QYGH 4JPVH 2KQMA 4PRHD 2HRLA 1E4JA 3PE9A 5CIPA 2X4PA 3LS5L 4C56A 1CK0H 1GYAA 3D0LA 3B5HA 3SPVA 1JRHH 3QO1A 4PGDA 4NCC1 4YUEL 4MHHG 4NOBA 4Y2OA 4B5EA 1U8LA 3NPSB 1ZGLM 3S35H 1RZIA 3WYRA 1RJYB 2DBLH 4NRYB 4QTHA 4XP5L 3T3MF 3PDGA 5EO0B 1FBIL 1NSNH 3P40A 5A3IC 1OARH 1NUFA 4CNIA 4AM0B 1NGQH 3GM8A 5CHNA 4S0TD 5HDBF 1KYOJ 1W72A 5M7QA 4ZDHB 2ESVA 1ZGLA 4P23C 1CL7L 4JO4H 1G7MA 4MJ5A 4UUJA 4MQXC 4X7SL 2F15A 1DBMH 1F13A 5TE4L 2JK5B 2LVEA 4K3HA 4HIHB 3SGDH 4YR6B 5CMAA 4L8DA 1S7XA 5C0GB 3MLZH 3SCMD 1EFXB 1HCVA 3VI4F 3EJZC 5I18L 3IDGA 3PGDB 5CGMA 4D9RE 1ZVHA 1OSZB 5ICXB 3G6JA 4Z77B 3CZFA 4NWTH 3QP3A 4NQEA 1OAZH 1I1YB 2BRRH 2Z93A 2GK0B 2IFFL 1VESA 4QKXB 5IBTL 4N0RA 3TA3B 1AD0B 3L5JA 1BFVH 3A6BH 3MJ6A 1ZGLP 1FC2D 2X44D 4JJ5A 3IFNL 3RWIB 3SDXB 3WKMH 3BWAA 5I1AA 3ULUE 4XXCA 1JE6A 2N7BA 3VA2C 3QWOA 1MCQA 4CVXA 4GRWF 4P2QE 1XF2B 4HJGA 4H0GA 4HS6B 4PJHA 2CSPA 2CDEB 3QUXB 5GGTL 3PHSA 3GSVB 4ENEC 5ICYA 4U1KA 2OYPA 4JREB 1ZLSH 2ZG1A 3EHBD 4CU6A 1M4KA 4HKJB 1UKQA 2PYFB 4BYHA 4G9FA 4HH9A 3KLHD 4DGYH 2VN7A 4LIQL 4WDIB 4R0LC 4RIRA 1T20A 4QRRA 3OB8A 4KROD 2ADJA 5ID1B 2HKFL 1CFBA 2PW1B 2X4UB 2AJVL 3MLSH 5MP6L 3OAZH 4XX1E 5I9QC 3PWVB 4P23A 5HHNB 4DVRH 4N5UA 1PFCA 3TN0B 3CDGA 3TT3H 2ZUQB 4Z7UA 5DJ2A 2F5BH 2NY6D 3TO4D 1WIOA 1L0QA 3OAYK 4R7DA 3SO3C 1S7TB 1WFTA 4G6AD 4P46D 5DVOA 4HIIB 1GZPA 3P4MA 1RIVL 4K3JH 3L6FA 4K23L 1NDMB 5IIEA 1LHZA 1GOHA 1NBYA 3GHEL 3DETD 4QTHB 5LAXB 3DTXB 4N8CH 4UAOB 3EGSB 5JXEC 2M26A 4BUGA 2YUVA 1DUZB 3FAWA 1WCBA 3OZ9H 3VG9B 1CQKA 2QQKL 1UKTA 3JV0A 1CYGA 1ZHBB 4Z7WB 4RA3A 5HGAA 1WQVT 4PJXF 1DCLA 4CVWA 3B2VL 4IRJD 4YPJA 2ERJB 4F80A 1CFNA 3PP4H 5JIIA 2W65B 3F7QA 5D2NA 4HLZH 5CCKH 3MUJA 3TF7C 5DMKA 4GG6E 4E0RB 1A6AB 4F7CA 5F3HA 3X11A 1NCUA 1AXIB 1EZVY 3D39E 3V9FA 4KJWD 1WICA 2UUDK 2FL5A 1KEGL 4G8IB 1DVFA 4OI8A 2NY5L 2CO6B 3B4NA 4NZRH 3QZWG 3CLEL 3MRMA 4Y4KA 4YFLI 3V0WL 1L0YA 3CFEB 5E95B 1OSZA 3F7YB 4K71B 3NFPB 3QDGE 4KQ4H 4RSVA 4HJJH 1A21A 1U9KA 4IDLA 4MCZA 5J9PB 4FMKA 2VQTA 2F74A 1CFQB 2VERN 2PTVA 3HB3D 1PKQA 5HVHB 1SBSL 3NA9L 4NKMB 1IZKA 1YC8A 3HR5A 4Z95L 4RRPG 1E4KA 2MKWA 3DBXB 5CEZE 1HWHB 4KTDL 4P3DA 5IBUB 1V05A 1ZT4B 2V2XA 3GNML 3ZO0A 2JJSC 3LKQA 3GMMB 5DRNB 4NZRL 3OKMA 3S34L 2HMIC 1OAYL 5ADOH 1PKQE 4L29B 2R29H 4Q0XH 5EA0H 3V0VB 1R3IH 3Q3GA 4I18A 1T2JA 2VB5A 3PWJB 2EECA 2PXYA 5FUOH 5DRWA 3UJIL 3V5HA 2AJ3B 4FFZL 3KPPB 4WV1B 5SX5K 3OKLB 1ZHBA 1MH5A 2EXWC 4P2RA 4OCSL 3FJTA 4G3YL 3VE0A 1OW0A 2W60A 3CJJA 5DJYA 5T1LA 3VD5A 4X5XA 4QWWC 1HIML 2WBJC 4QF1B 5EB9A 3TBSB 3C5JB 3QH3B 1MIEL 5I75B 3FO1A 5ANME 4KK8D 4OCWH 1AC0A 5TQ0L 5F7DA 5F3BB 3UZQA 4EDWL 2WLZA 2EZ0D 1NKOA 3JWDH 1GGBL 1EJ6A 5JORB 4YHLH 4TNWF 3T2OA 4OI9A 1OCWH 1VB9A 3HZKB 5HGDB 4GBXC 3WLBA 5C1MB 5IMMA 4LHUG 5C07B 4FQXA 4LLUB 3RTQA 2DLTA 3MYZA 1Q1JH 3CH1B 1OPGH 3NFNA 3WXWL 1YEIL 4KXZI 1WEJH 1I9RH 3NZHH 1IEHA 5GPRA 1IBGL 4O2FB 4YDVA 4TNVK 1A4KA 4KAQH 5GS0D 5CUSL 1NMCB 1G7JB 4JRYB 2DQIL 4HUWB 3S96B 1U58A 4YBQC 1FE8H 2WNGA 5E70A 1U8JA 1DE4B 2I24N 3AXLB 2YSSB 4TULL 3BQUB 4GRWB 2P8LA 2CJUL 3RUGF 4KY1L 1E4WH 1FBIH 2OTUB 1QBML 1RMFL 3NCYP 4NNXB 1FNSL 2FEDC 1CE1L 2FLBT 3ARFB 4J12A 4MSWA 4ZS7H 5IGXH 3TBVA 1A7OL 4S2SA 4UMGA 5L2KA 4I1NB 1I1AC 5CD5D 5KSBE 3ALPA 1XR8B 2JB6B 2XZAH 1CGYA 3BKJL 3V2AR 5IHZB 3M8OL 3CDCA 3LQAH 4C56B 4HXAL 1MCFA 5DR5L 5EBWA 2DLFH 3THMH 3ORJA 2VWEE 3QG7L 4LSSL 2Y7QB 5FO8B 4YZFE 3PL6C 3SJVB 5C6PB 4PJIB 4OD2A 4KUCD 1ZHNA 3FONB 3KR3H 1NUGA 2PW2B 3W5MA 1VGKB 2PETA 1I7UA 1MHHB 2Y36H 4YE4L 5E9DD 3QUYC 2AV1A 1QA9A 5LG1A 5DYOB 4TYUA 4LSQL 4PJEE 2H26B 2UV3A 1NC2A 3BXNA 3BGAA 3VG0L 2GTZA 4MJIA 2DQTL 4E41E 5BS0E 4YHNB 5I6XC 5FHBH 2IG2L 1CVRA 2YUXA 3IU4H 2PCPB 2C3WA 2AAVA 4JR9L 1ETZB 1P7HL 2EIDA 1G9EA 3GMOA 4H25B 3E8UH 1NGWB 2J6EH 5AWNH 4PJAB 3NFSL 4NM4L 3NIGF 2H3NB 4OZ4A 3TFKC 1YN6B 3MLYH 1QZ1A 2EE9A 2YD1A 4AH2B 2IMNA 4I5BB 5F7HA 4PGDB 4KK5C 1E4XL 1NAMB 1MAMH 3MACH 4KTEH 4P2OD 5DZOA 5I73B 1KULA 5E2WL 4A2MA 5HVHC 5IW6A 1J0KA 4IRJA 5JHLL 3H42H 5CZVH 2B0SL 3UTSA 2NX5D 4JO1H 4WI7A 2BOBA 3FZUC 4LLVA 5HSFA 1PSKL 3SKMA 5L0QC 2GYSA 2XQYK 4K2UL 1YC7A 2C5DC 1CFTA 3RWFA 1YEIH 5C09B 2R1YB 5M94B 2R0LL 3ARSA 1FV1A 1X5GA 1P7KB 1EMTH 4ZFOA 1OAUH 1RIUL 4UUJB 5FECB 2X9WA 4RNRB 1A6WL 3OJDB 1QLEL 1WISA 4KDTA 4PRNA 2X05A 3D9AH 1SEBB 4PIRF 4FQ1L 3G08A 2P8MB 2GAZB 4JFHD 5IFJA 3IJSA 4EBQL 2X7LB 3MX0A 1YEDB 5FKAA 3RL2B 2VZ3A 3K7UA 3KXFD 1T7YA 3MFGB 1N4XH 3BKJH 5ENWA 4P23B 5HHNA 5D96C 2OP4H 2XRAL 3L3GA 2X4RB 5C0AE 2HT4D 4XHJC 2N56A 5DLML 5F7EL 3ZHLA 1MCWW 4L8SC 5IGXL 3IS0X 5I2IB 5I74B 4PJ7F 5T3XD 1J8HA 5HY9B 3MNZB 4OF5A 4YGAB 5FV2A 4JG0L 4FFYH 4CU8A 1FL5A 3U4EA 5GRXG 1AP2A 1DEEB 4GG6B 2QQNH 5JW4M 2NW3A 1E6JH 2ITCA 4JFFB 2QQQA 4PRIB 4L4VB 4J3UA 2BVQB 1FVDB 4HK0A 1LK3L 2XZCL 5EOTA 5HGGS 2H1PH 2YC1A 4FQHA 2R69L 4MJIE 2J8UF 1D6VH 1HN1A 1S5HB 3AY4A 4KQ3H 1IGML 4Z7OE 3MV8A 2ICWI 5CUSH 3WHXB 4KZEL 3MTRA 1XZ0B 2RFXB 2F54A 4H26A 2YRPA 4Y16C 3QEGH 4PFEA 1BBJA 1JGUH 4ZXBC 5I71C 1RIHL 2PF6A 3Q48A 5D6CA 3W0WE 1D5ZA 5GGUA 3JWOH 4GKZA 1J86A 1H3PH 3GJFK 3IKCB 4FNLL 4QT5A 3NZ8B 3F7RA 3DVNA 5BO1L 4BFBD 2NY5H 2LABA 2EYTB 5E99L 2EO9A 1JZ2A 3OR7B 3U7WH 3HZVA 1T21A 5LQBL 4YPGB 5DJXA 1OP5H 3NFSH 2R2EB 4BSJA 1KTDB 4IEFB 1KYOK 2P1YA 5D7SL 3F7YA 1GVIA 5T1MB 1TJGL 4C83A 1HDMA 2CMRH 4P5TC 4NQDB 1QR1A 5E4EC 3GSRB 2KPNA 3BXNB 3GI9L 5C3LD 3LN4A 2H2SD 4FQXD 5I1IL 2EKJA 2Z92B 2ITCB 2E9BA 3BT2L 3TN0C 1M6OB 2WUCH 5DEFA 1N7MH 4G8GA 4LRIA 4RWHA 3QUYB 4CAGA 1EHLL 3CU7A 4MNGA 2XWJA 1LGVA 3G6AA 3KYAA 4JPIB 5CP3H 5LWYH 2JJWA 3NPZB 2IH3A 3VW3H 1FPTH 5D7LA 4QCIB 1NANI 4LGPB 1F6LL 2WV3A 5I6XB 3UPRB 4LEOA 2YK1H 1CU4L 1MI5B 4LFHG 4UAOC 1WSST 4RMVA 5IQ9A 1NC2D 3VFOA 1INQA 2RBLA 3OB0K 4HUXB 2FIKB 12E8H 2DKUA 4PTUA 5E0QA 4OGZA 3RPKA 5F7DB 3VFSB 3UAJC 1FFQA 4I13B 3EOAA 1AXSB 4HLJA 4X7FC 4ZFZB 5H37G 3JBG7 4P5MA 1U8NB 5GGTA 5IK3A 3CNKA 3RGVB 1LP9E 4HKBA 4NO5B 3NCCB 2DB8A 5FYKL 1T22A 4Q6IB 5L7XH 2D7TL 4AIZA 2HFFB 4UT6L 3MODH 4R7NB 3I02B 3PWLA 3FKUS 1Q9WA 4ELME 5CEZH 1XEDA 2OLDA 1LP9F 1U6AH 1DQJA 1ERNA 2IQ9H 2FX9L 5L0QB 3FT3B 1MAKA 1U3HC 2BCKB 1Z9SA 1DUYA 2YPVH 3U79A 5ERWB 5T1DH 4MA8H 2V9QA 4YDVB 4E42A 3FFDB 3UJJL 1DN2A 5H2BB 2A77L 3BZ4A 4JRWA 3UROR 5J3HD 4OCXH 2VDLH 4JN1L 3LRHA 2NCMA 5C7XL 1JZ4A 4Q9QL 1QO3A 3IDJB 4OLUL 1BFSA 1BVLA 3WN5C 4NQSA 3CZJA 4M43H 1IEAB 1MCOH 1FNFA 1I85A 2XWBA 1TJIL 3RHWK 3VFUB 4M43L 3IJHB 3QUZD 3HAEB 3BUYA 5KSVA 5F3BA 2G9HA 4CADB 5MHSD 1UWGL 1CG9B 5KVFL 2ICEA 3AU1B 4ALAL 5HHVL 5BCAA 1DSFH 1JNHB 4X6EB 2B4CL 3V5HB 2WBJB 1NUNB 3BKYL 4JFXA 1FNGB 3MRPA 5AZ2H 2P5EE 4ZD3L 5E00A 4LGSB 3B9EA 1S9XA 3G9VA 1R3KA 2EE3A 3PXJA 2IQ9L 4QRPE 1Q0XL 3QUML 5L2KE 1Q9WB 3OL2A 3ZE1E 1CD1A 3ABZA 4V2BA 3QJFB 1P7QA 3QNXB 3SDDB 3JV6A 3LMJH 3S34H 1FGNH 1IQWL 4K23H 1RZJC 3LN5A 3B6SB 3O3AB 4G9FD 4G6KL 4GG6F 4GBXB 3EAKA 4FQLL 4MNHB 1XGQA 1MUJA 1FL3B 3FQUA 5DD1H 1R5IA 3GSWB 5HHVH 1SMAA 1MVUB 2GW5A 3G6AB 1CICA 5FF6A 3W11C 1G9MC 3CFBA 4O51A 4QRUA 1G9MH 2XTJE 3ARED 5GGVH 1KTDA 1KT2B 1J1OH 1UA6L 1QO3B 1NMCC 4XCEB 1MFDH 3PIQB 4XWGL 3FT4A 3HAEG 3DO7A 1LO3H 3MPCA 2ITDB 2X89D 5KVEL 1QACA 4Z7QE 1UEYA 3DXAD 1NMAH 3D2UD 5CWSB 4ERSL 4H8WH 3SDAC 1H9VA 1F3DH 2E7BA 2NY4B 1HWGB 4FN0A 3TIEA 3OX8B 4M6ML 4P57A 4XVJH 3T2QA 4Z7QF 3QZWB 4P5TB 3GUTB 4I0PD 1LO0H 2EH8H 4H1LH 5D1ZA 1QBLL 4P4RB 1OSPL 1QSZA 3EJYD 4MB3A 1ZA6B 2DI7A 2JIXD 3C2SA 1QSVA 2VWEC 3MRGA 1JHTA 4WFEE 3SBWC 4CJ1A 2BSED 3BP4B 3B9AA 1AIFB 2QHRH 2P5ED 2D7NA 2IAND 1B0GA 3FQRA 4MYWB 4KTYA 4NO0B 4KXZH 2N1KA 2YPLA 3MLTA 4J4PC 3TP4A 1JPGA 1BZ9A 5LCVL 3ZYJA 4FQ1H 4HWZB 3ARYA 4Q9CA 3NH7H 4LSVL 2L4OA 2Q86A 3BPOC 3LQAC 5DMGD 3U9UB 4MNHA 3DV6A 1UXSA 1VA9A 2X4RA 2DTSA 3CDGB 1VACB 2MFNA 2HAZA 3D39B 3G5YA 3HC4H 1RFDL 2APFA 4PJDB 4EXKA 4UB0L 5CEYA 4P49A 2GJ6E 2IH1B 4MA7H 4Q6IC 4I48A 4M7LT 1EVUA 3R06B 3MNZA 2VABB 2P24A 3MLXH 3T0WA 4UOW0 3RWCA 1PX4A 2Q76A 3U83A 4KI5E 5MENE 4GO6B 3CVHA 3QBTB 1JVKA 3CSYB 4F9LA 2A2QT 5JMRA 2QSCL 5F9DC 5JW3H 4UILH 4KUZH 5JORA 2J8UA 4F7MA 5E2JA 2HLFC 1D5IH 2X4SA 5E2TL 4Y5VA 5ISZE 1NCCH 4DAGL 5DHVB 3SGJC 3WFBL 2AEQL 3HAEA 4LPWA 3ARGB 1AXTL 4Y19E 4NNYA 3D18B 4B53A 3BP4A 4JLRB 3UDWC 1ODAA 3HA0A 1Q9KA 1U92B 1NPUA 1BQSA 1NEZA 2R2CA 5EZLB 1KCRL 1F45A 5DURB 4EVNA 4RX4D 2VDOL 1B0RA 5I19L 1FG9C 3W2DH 4KMQA 4LPXA 43C9B 1JGEB 4G7VL 1AY1H 1CCZA 3HI6L 2YS4A 1XF5B 3ULVH 4LKXA 3RKDD 3TZVD 2YN5A 4LLVB 4QXUH 4HX1A 5EH1A 3QUKA 2DM4A 2EC8A 4U1SA 1U8HA 5AZ2L 3X12A 4RMSA 5J6HB 5EU7C 4LBEB 5JQ6H 4D0DB 4YHPB 5E6ZA 1MHEA 2OM5A 5DRZA 1MVFA 4RDQG 3T08A 3EJYC 2ZUXA 5GRVL 3H9HB 4YHZH 1WAAA 2XOTA 3BPCA 4ONGL 2H41A 3H42L 2AJXL 1P84K 2DQCL 1AHWC 3H0TB 5I1CL 5BO1H 2AJSH 3WL9A 3VWKB 4CVXB 3GSQB 1T1WB 1GJIA 4NO3B 3ULVL 5EFIA 4ZXBA 4P5TD 2AS5M 4G7YL 3FRUB 1NGQL 3HPJB 3UTTE 2AJYL 3MRIB 3V6OC 4TUOB 5A1AA 1XGYL 5BZWB 3IDMA 2G5BB 2AXJA 4CGTA 3BD4A 5AWNL 3V5DB 4ZOAA 4LEOB 2KKQA 2Z93B 5D72L 2NX5B 3T65B 1G7PB 3P9LA 1DQMH 4JREC 2QEJA 4PREB 1RJCA 2NMSA 2NZ9C 1F4YL 3AAZA 3VGDA 4JZNA 4N5ED 3D0VA 3RVWD 2F54D 2H9GA 4UILL 1A6ZB 3HAEH 5KZCD 5IVXE 1DVFC 1H0DA 3V4PH 2EXWD 4OZGF 4OZHB 4R0LB 2VXQH 4G9DA 1PLGH 4UIKL 1WZKA 3HLAA 4HBCH 1CFVH 1NAKL 4R90L 3W0WD 1T22B 2C1PB 1AR1C 2A74A 3OTTA 4WEBH 4HJGB 2DBJA 1KSRA 1K8DB 4P3CH 4F57L 4M61B 1L9MA 5CFHA 3SKJH 4PJFE 5I9QB 5B8CA 2KL6A 3WO4C 1LE5B 3JVGC 2F53D 1II4E 1MIMH 4O4YL 4F58L 2R2BB 3SO5A 1F4YH 2B0SH 2MQ0A 1FL6A 1KB9J 5FM4A 2X4QB 5F96L 4P9HC 3VGAB 4P9HH 3OQ3B 1UC6A 4GXVH 4Q6YA 4EBQH 3OKDB 4LSVH 2FWOB 3WFCL 4JANA 2FDBP 5EC2B 1ETZA 2ZSWB 1FO0B 1I8MA 3I50L 2VDRH 3I9GH 4N0YL 3U0PB 2P5EB 4KVCL 3AS3A 5EU3B 2OZ4H 4NJ9H 1TTGA 4U1JA 5E8EB 2XG4A 1XCTA 1KPUB 4FABH 5INDB 4RNRA 1FZJB 2ZOKB 3SHSA 3D1MC 3I6LD 2D7OA 5IMOB 4WHTA 3LD8C 1FE8L 4M6NL 2LFGA 2BX5A 3DVIA 1NDGB 1K6QH 1CDUA 1XF2A 3W5NA 3LKRA 4Q9RH 1ZLUH 2C3GA 1WJ3A 2IFGA 4ZS6C 4DUVA 3T4AB 4RISH 1OGTA 4LLMA 1BZQK 2CD0A 4BSVA 2DKMA 3KJ4C 4Q97A 4YLQT 2QHLA 1DANT 3GSUB 3RGVC 4N1CA 3QXDA 4R8WL 3ILPB 2WIIB 4M5YL 4I77L 4G5ZL 1TZHB 4HUKB 3NN8A 4LCUB 4G42B 1NCWL 2D2OA 4N9GA 2IAMA 4F8QA 3WE6B 2OMBA 5I1CH 5TE6H 2NZIA 5C6TH 5KS9E 1FAIL 1U3YA 4U3CA 3AREB 2VLRB 4WO4C 1AKJA 2NLJA 5E94A 5GGSA 4AEHH 3LH2L 4GAYB 5IB5B 3RI5F 4MA1B 1MVUA 4DN3H 5T5NG 1IGMH 3LQZB 3TJEH 1A1OA 2NZ9D 2YSSA 1ZVSB 3OKLA 3TH4T 1IKFL 4YXHL 3PXHA 2DMCA 1WC7A 4N1EA 4XCYB 4KRPC 3S37X 1LE9B 3TZVB 3X14A 5T1KD 4KROC 3NAAH 2PYED 2LTQC 1KN2H 2ZPKH 4LQFL 3DUSB 3W9EA 5TDNA 1ZT4A 2V2XB 2X5PA 3QIWD 3I6LE 3HE7A 1T0PB 4WCYH 5HDBE 1MNUL 1IAIL 1SJHA 3QUMA 5SWSA 4UBDD 1XGPB 4ESKA 1CBVL 4PRIE 3SCMC 3VWKC 4OZFH 4LSPL 4LLDB 4NJ9L 1EGJA 1MWAB 4JFOB 4PJDE 1SJEA 2K3TA 3LEYL 5SWZE 4EOWH 1NFDA 3PG2A 5EU7E 3QO0A 5HPOA 1FL3A 3Q6FB 1OD7A 3H3KA 2K9UA 3SDCB 1MJUH 5CBAA 1KIQA 1FZMB 5CD5C 1JF1A 3P2TA 4HF5H 1NAML 3WFEH 3ULUC 1AQKL 5AYQA 5F9JB 1TJHH 4EN3D 3QEHA 5L6YH 1YJDL 1RZ7L 2A6DB 3HUJF 3LS4L 4WFED 2R9HC 1TVBB 1RFDH 3OKKA 3MRFB 3ARRA 3UCRA 3MRDA 3MRJB 5KVDH 2K1MA 3LS4H 3LKQB 4V1DB 3KYKL 1QOKA 1TQBB 1A9BB 3TYGL 1VFAB 5J1AB 3WKML 1FYTE 1DQQA 4UIKH 1A4JB 4KZDL 4OZFG 1XH3B 2XQBH 3HG1B 3H7BA 5ENWB 5JQHC 4QRRE 3C09B 5TDPB 5IHZA 5DUPH 1I9IL 3U7AA 4HUVB 4WVRA 1IGJB 2LQRA 2Z91B 3OKOA 4FXGA 3QCUH 2WIMA 3AROA 4MGXA 4NYLA 2NYYD 3WCYA 4PRBB 4POUB 4JR9H 3SKOA 3WFBH 2PN5A 3T77A 4N0FA 2ATKB 2UYLA 1MRCH 1MWAA 3TT3L 2DQHH 2FYYA 2OL3L 4KDWA 2H32H 1JGVH 4PRID 5IBUG 2YD3A 1IGYA 3WNMA 5DMIH 4BFEA 5IB4A 5F6HI 3QEQE 2R29L 4Q0XL 4X6CF 5DS8A 7CGTA 2AJSL 2NR6D 2W1NA 1CXLA 4OZGB 5F7WC 2UZIL 4QRQB 3RVVD 3T1FB 3BP5A 1KELL 4HX1B 4DGVL 1M7IA 3LD8B 4PV8A 4AG4L 1VHPA 4LKXB 1T0NA 4XRCB 5H8DA 4KH2A 2CDEA 4F9PA 2XACC 5C92A 1MF2H 3MNWA 5JQ6L 1KJ2L 2YD5A 4HV8B 3CX2A 3DRQB 2X42A 3ZKMD 2VIRA 3VWJB 2XZAL 3M17B 2ZUWA 3L6FB 4WUUD 2CGRL 4OCYL 4Y4KC 2MHAA 2Y06L 4AMKH 4HS3A 1DDHA 1NH6A 3HI6H 4XPTH 2G2RA 4TTDC 5JLZA 3QIUA 4HWBA 2FBOJ 5L8KB 2ZJSH 3H3BC 3CPLB 3O2WH 4M5YH 1RZIB 3KS0H 1YYML 2FATH 3H9SB 4OQTA 3MSPA 4L9DA 2GUOB 1IAII 4MA1C 2K7PA 5DDHA 1JNJA 2RJMA 5K59E 2HTLD 1C1EL 1QR4A 4L3AA 4MD5A 5FYKU 2BY1A 1QFWL 2O61B 3VXNA 2HKFH 4MS8C 2XY1A 1R5WB 1QRKA 3O4LE 3VFGH 3ARGC 1H5BC 4PG2C 3ZDYF 4JHAH 4F7TB 1EGJL 1S8DA 3BRFA 4NUJA 5K33A 3SE9L 3IGAA 2XFXB 3QHTC 1XR9B 3M1BA 4XCCH 3D18A 4MXQD 1T6VN 2OZ4L 3PWPA 3QHZH 1MY5A 2VDNH 2Z31A 1KB5A 4OSUH 2O5XL 1KTKE 3QCVL 2DQHL 3MLRL 4Y4HA 1HINL 3QXAA 3LPGA 5FK9B 3RWEA 1BJ1H 5IFAL 1YEFL 2RCSH 3UTSE 3SCMB 3X13B 5DQJB 5I74C 4HS3B 4ZNEE 2W0FA 3IFNH 4DFIA 3X3GH 2YA2A 5F96H 5DJ2B 3OKDA 2CDFA 4WUUE 5LCVH 1HQRA 3LVEA 1K4DA 5EU4A 4Y7MA 2YK1L 3RFZC 4P48A 4DOHB 4F7EA 1ZSDB 4LSUL 3OXSA 3QA3A 4Z7UF 2EE2A 2VDNL 3WIHH 1OLZA 3EKCA 2DKSA 4UNTA 3V4UL 5AD0A 1W0YT 2F53E 4AQOA 1TETL 3P3YA 4X4XA 5HHME 5D4QA 2BNUA 3BJLA 1K2DB 1CR9L 4A2LA 2A6JA 2FGZA 1AGFA 4H20H 3OAUL 2GI7A 5EUKA 4XCFH 4XPAH 3BPLB 5I1IH 4EZMA 1SM3L 3QDMB 5D7IF 2BDNH 3VD3A 2R9HD 1NCDH 1FZKB 3OXRB 5JIKA 5ESQA 4OGXL 4ZPVB 4YX2H 3DSFL 4H88L 4S11A 4UOJA 5C0FA 3BDYH 4NQVA 3FHQA 3JV4B 4GJTB 1NKRA 2DS4A 2I27N 1JN6B 1RSFA 5JW4Q 1YEDA 1DVFB 1MCBA 4F8TA 5D6CB 3QHFL 5FK9A 3KGRA 2YA0A 4F9LC 3RU8L 4X4MA 4GKOA 3C08H 3SKNA 2BDNL 2QKIA 2WUCL 1EDQA 1MRFL 1JRHL 1KTLB 4JFXB 1QLRA 5C0GA 3QFDA 3QCTH 1MCJA 2IADB 1S7WB 2VSCA 4ZUUB 2D0GA 5CJ8A 4Y0GA 2E9JA 3MA7A 4GW1A 4YAQB 4HBQA 3O6ML 4FQIH 4PTTB 4JPVL 2Q6WB 4R96B 1OHQA 3T04D 5INDA 3TZVA 1FG2B 1BQHA 2B20A 5JO5B 5KN5B 1AP2B 1ZVSA 4J2XA 2VR5A 2XPGA 1B4JH 4BA8A 5CSGA 1YYLL 5I15L 4PJEA 5DEZA 1AGDB 2UZXB 1JRHI 2VL5B 2VNCA 1FORL 1MCKA 5I1LB 3RIAK 4POZD 1JNNL 2Z31C 3MRMB 4Y4KB 2BRQA 2AABL 4WI3A 3GBML 1OQOA 4Q6IA 3KYOA 5FYJE 1L9NA 1BVZA 5L9DL 4IHOB 3RGHA 1OAKL 1NFKA 4Z0XB 3HC3H 1NCAH 4DAGH 4Y19D 3PV6B 2O5YH 2YR3A 2D7PA 4V1DE 2I5YL 2GFBB 5C9JA 2XA8L 5EPMA 3GGWB 1J8HE 5TJWK 4LSRH 4ZSOB 2JLLA 1DLHB 2NTSP 2BC4A 5IR1A 1PYWA 3MA9L 1KN2L 4LQFH 1ZANL 4TSCL 1HKLH 4U6YB 4JPKH 3DURB 3PGFL 4UQ3A 3GSOB 3HUJE 4KDTC 3CCHA 4JQVA 2A6KB 4BM7A 3Q3GB 3C6SB 4HIJB 4P9MH 2XWBB 1I8KB 3HZYB 4WO4B 1WTLA 1GGCH 4ZTOL 1ZTXH 2ZCHL 5I16A 3S3SA 5J12C 1OLLA 2HJLB 3RA7L 4JFZL 5T5FL 2BVEA 1A4JA 3W81A 4I3RH 1I3RB 3UZEA 5J06A 4KRPB 4NO3A 1U8IB 3SDAA 4L9LA 1VFOA 2JIXA 2OJEA 4Y5VB 2LTQB 4JY6A 4QNPE 1DBAH 5C2UB 2Z91A 5T3ZH 2WUBH 2X1XR 4YHIA 1XIWB 4G6AC 3FO9B 3U82B 2E7HA 3GJEB 1G6RB 2R2HA 4WRLA 3ES6B 1H8OA 4QHUB 3IDIB 5DJ8A 3MRGB 3DXAA 1RHHA 4W4OC 3VG0H 2XZCH 3QPXH 1EO8H 1WAAF 5E24E 3ET9F 1FVEA 3BN3B 1PYWB 4OAWA 2KH2B 2H9GB 1DLHA 3G6DL 5FO8A 2IJ0C 1A14L 25C8L 3I84A 1KJ2B 1ND0B 3TV3L 4ELKA 4I3GA 3MCLH 3MOBH 4D0CB 1QLFA 1AGCB 1CLOH 1UWXH 1KCUH 2MWCA 1KEMH 2GJJA 4NP4H 4QXWA 1GSMA 4XMLL 1KEML 4OZIF 3WHE1 2DICA 5T33L 3LPFA 2D7MA 2VYRE 4OGXH 4YX2L 1IC4H 1CK0L 5F8QC 1T03L 1IJ9A 1ACZA 3IXTB 4MB4A 2B2XL 1L7TH 5GSRA 4HIEB 4MXVF 3P4NB 2QADC 1NDGA 4XP4H 3V0WH 4RAUA 2W0PA 4IOSD 3RHWF 5GRVK 2BP3A 3CLFL 4M6OL 4WV1A 5BQ7A 1H3VA 1RUQH 4KY1H 4JQIH 5ELIA 2Q3AA 1GPOH 4MMXC 3DGGB 1OGAB 2VRAA 5IQ7L 1GGCL 2R56H 5J1AA 4Z7UE 2VN4A 3NA4A 5ADPL 3TFKD 2ICES 2FJHB 3G6JE 3KPSE 4JM2A 1FNGA 1QBBA 3MRPB 4ZNEA 4FFWC 1ZS8A 4JRXD 4NRYA 4UQ3B 1TZGH 1X7QB 5DD0H 4BZ2L 2E9IA 2YD7A 1TNMA 3IDMB 1Q1JL 4J8RB 3HE6A 5ECJE 4OLXH 3BPOB 4FMFA 2BK8A 2VAJA 2ATKA 1AI1H 1T80A 2HT2D 3JWOC 2Z8VC 1YPZF 2F54B 2Z31B 3V79C 4OLWL 3VFNA 5EBLB 3OJ2C 5HHMB 3RWGA 1BMGA 5HD8C 5BJTB 4ZPTB 1ZT7B 4GKNB 5IROC 4IS6B 4OCWL 3S3PA 4X9GA 1DBJH 3O6FD 4K7PX 4RZCA 4YBHA 3QNZB 3DSNA 4WEUD 4XXDB 5IEHB 3IVKA 4M7KH 4TVPD 3UPCA 5EOQL 5TFSH 3BZFB 2CRMA 3VWJC 3IDGB 3PGDA 3VWKA 4CBPA 4HKXB 4QXTB 3K1DA 3SKJL 1S7XB 5CILH 4K71C 3QDGA 5AD0B 5ALBL 4LLQB 3WBDA 1EMTL 4NPYA 5MEQB 3O9WB 5FKPB 4KDVA 3WJJC 3LIZL 1LP9B 4UTBL 3IT8D 2G5BA 4Z8FL 4KJQC 2E7CA 4LRNH 5T1KA 3AS0A 4L4TB 4ZOEA 3M8OH 4L1HA 2BNUB 3KS0J 5IMMB 1Q0YH 2WQRA 4X5LA 4XAKE 4PRPB 3FHAA 1FO0A 5DA0B 2EIZA 1A7RL 1QFHA 2V9TA 4O58L 5E2VL 3HMXH 1ADQA 5C0EA 4R8WH 3DO3A 3ME0A 4LLAA 4JDZA 3ZDXF 1CFSB 4LLDA 4ZUTB 1AIFA 4DKFL 3HE6B 2A74B 3AM8C 5DTFA 4RGOH 3PWUA 5EU5A 1MI5A 4F2MB 1FO0L 1JPTH 1XGRA 4XPFH 1G0XA 4MQTB 3TVMA 2E3VA 5IMKB 4JFQA 1OAYH 4X6BB 2R15A 4YDJB 5HTSA 5I76A 5KSBB 5IG7B 3B3IB 4RA0C 1SM3H 2D9CA 4C56E 1WBYA 3FQTB 4L3CA 2IH1A 2EDNA 5AEAA 1IAKB 3LKNA 3KDMA 5FUZH 1AHWB 4M5ZL 1RI8A 1YQ2A 4QO1A 3LN4B 1LE9A 2H3NA 1WFUA 4IIQA 4PJCF 1QR1B 15C8H 5D71H 2D4FA 3QQ3A 4JQVC 4QWWD 4GH7B 1OTSC 2IANA 3TT1H 4AENB 3S88L 3V4VL 3V95A 3HPLA 1K85A 4HIIA 1SQ2N 2ATPA 3FB8A 1VFMA 4MX7A 3OSKA 4O5LH 5JOEA 3CIQA 1S7QB 3ARBC 4I3SL 4PJEB 5D7IB 5FA4A 3U7WL 3OGCB 3Q0HA 4ZSOE 2APVA 4HUNB 1MJ7L 3MJ9L 1JWMB 4YZFF 3L3DB 2X1PA 2EDDA 5D7LB 1W0VA 4KJYB 3C8KB 2DM7A 2HA1A 4P5KB 3KPOB 3BQUC 4H1LA 3VXSB 1FNSH 4HDIB 4P3CL 4F57H 3NIGE 4F7CB 1E4WL 4N8VA 2W65A 4CUCA 2DMBA 2AK4E 5ITBH 3MLPA 3EBAA 2VQUA 3WFEL 3OJDA 5LBSL 1KXVC 3DROA 3ARFC 3QXTA 1QKZL 2VMFA 4N8CL 4XMPH 3GNMH 4R7NA 1I7TA 4X9BA 3SE8H 5BVPH 5IVZA 3HNTH 5IR1B 4HQQL 1A3RH 3GIVB 4PV8B 3S36H 3OBAA 4PB0H 3CPLA 1KOAA 2XTLA 4L4JA 4M00A 3NTCH 5JW4N 1OPGL 1QRNA 1UM4L 5HI5C 1U93B 2DQDL 3L1OH 3BI9X 2OK0L 2A73A 3PL6D 4RQQA 5C0BE 4ZO9A 3SPVB 3I6GB 2VC2L 1KXTB 4BUHA 3UDWA 5TDPA 1IT9L 4LPCA 2ZNWA 4TUOA 3ARXA 5HDQL 1L6XA 2X4QA 4M7LL 2Y5TB 4PJHE 4XT1C 3PWJA 3O4LA 4PUBH 2XA3A 1ZK9A 4NHUB 1F8TH 2XNAB 2IPTH 1YPZE 4LLQA 1CLZL 4LMQE 4V1DA 2QSVA 4MB5A 5C0CE 1XCQA 5EN2A 3L3JA 4K8RH 4BKLB 2A1WL 3TJEL 4Y4FD 3FB6B 4X98A 4YWGL 3IDIA 3PDOA 1NMBH 2R2HB 2HTKC 5C0DB 1XCTB 4LLWA 4ALAH 4CDHA 4N8VB 3E0GA 3UX9B 5JZ7D 4DUWA 3VWJD 4Y1AB 1JP5A 1Y6MR 2CKNA 3ECBB 5E00B 3BP5B 5FFLA 2D31B 4LHUB 2LAAA 2EYTA 2PO6D 5DJDB 3LQMA 1X5LA 1RV6X 3PP3K 1UCBH 2VXSH 2J8UE 5E6YA 3K1KC 5GSVA 1U8KB 5MENB 3O9WD 3LKSA 3QJHB 4NT6B 4XP6L 5F8RC 1PX3A 5I16B 5FGBA 1QRNB 1NCCL 1ITBB 5FO7A 5D7IA 5FA4B 3H9SD 5IFJB 5F44A 5C71A 5K9OB 4M93C 1TITA 3ARDA 1T5WA 4GRWH 5MI0B 2XI9A 2R69H 3OAUH 3QWRD 1RK1A 1WZMA 2ZNXA 3LS5H 4WIQA 2OL3B 4XPBL 3TESA 4Y1AD 3O41B 4S1RH 2NY3C 4LP4A 2D7QA 3TO2A 4RFOL 2EC9U 5SWSB 3QIWA 1G7IB 2DIJA 2VE6B 5TQ2L 2KBGA 3WJLC 2AXGA 5J4MA 2EDLA 2F8OA 5D96B 3BP7A 1WZ1L 1S7SB 5E4IA 2HWZH 4MCYA 3HNSH 4L8SB 3OJVC 4FXKB 1BVKB 1TVHB 2GSGA 4X6DB 4XZUB 1FAKT 3BYTA 3QO0B 1HEZB 4Y5XA 3M45A 3LQAL 1ROWA 3ARUA 1BFVL 4EI5C 4N90D 1XIWC 1JWMA 3LN5B 3O11B 2VDMH 3BRGC 3U48A 2GJ6A 4Y16D 3ARBB 3I2CL 2CH8A 1TTUA 2WIIA 2L7JA 2NQCA 1IEBA 1SY6L 5ITFB 4Y4HB 1PW3A 2DYPA 4PJCB 4JFEE 4UU9B 5JO5A 2VLKD 1EJOH 1LNUB 4Y16B 2IAMB 3B2UC 3VFPB 5DYOA 1HHJB 5I71B 2VR9A 1INEL 5EOCL 4LKCB 5ESVB 1KIQB 3VJ6A 5C9KA 1WC7B 4PRPE 4WWKD 1R5VA 1KIPB 4TSCH 1NBZA 4YGVA 3QUKB 3MLUH 5CLTA 3C09C 2QR0A 1FIEA 2AJZA 4I0PA 3QUYD 3MRBB 2Z92A 4BFGA 2XA8H 3KWWA 2BFVH 3KPSA 4KVNH 1DFBH 2O5YL 2JTDA 2WWMC 5IV2B 1MFCH 2UWEB 4L4TA 1OAKH 1OCWL 4UV7H 1HEZA 5E4EB 4TVPH 4XBEL 1FFOB 5GGSY 2CGRH 4OCYH 4XZUA 3LCYA 3K2MC 4J3OC 4GXVL 4PJFF 5A43C 1JWSA 3DX7B 4ODTH 5C0IA 4QHMB 5INCA 5E6IA 2YXMA 4X4ZA 1T5XB 4PPTA 1T2QH 4PGZA 4X6CE 4KQ3L 2IPUG 2F58H 3BHBB 4F3FB 5JOPD 4Y5XC 3F7VB 5ALBH 4NC0B 4E42B 3WHE0 2EDTA 5MHSE 1LMKA 3HRZA 5D71L 5T3XL 3EOTL 3QJFA 2ESVB 1ZGLB 5I1KH 4LCIH 5AUMA 3VXRB 3ALXA 5KTEL 5ADOL 1UZ8A 3T2PA 3V52L 3W0WA 4ODTL 2BHZA 3FQWB 5FM8A 1J87A 4W70A 5ESAA 1JYWA 3QXVA 5F88A 4TNWK 1LILA 4PV9B 4HHAB 3BKML 3QJHA 2ZSWA 4NT6A 4C58B 5K9JH 4AH2A 3BAEL 4Y4KD 3VFTB 3QIUD 5HJ3A 1CG9A 3CFJB 3Q1SL 3VFNB 2A38A 4ZUVA 3VMNA 5CD3A 3ZE0E 2FD6H 1HZHL 1YMMA 3D3VA 1BFTA 1X4XA 1D9KA 2FD6L 2GITB 5EFIB 1H3TA 1IKNC 4PGJA 4FZ8H 2DBLL 1F4HA 5A40E 5FA3B 5FDWB 5DJ0A 2HFEA 2Z31D 3LHPH 3P4OB 4E5XA 4HUVA 5F1IA 4F7TA 4M93B 5L2JA 3O9WC 4DN4H 2W9EL 1RVFL 1SBBA 1V7ML 1R3HA 4Q9BA 1J0JA 1JHLL 2AJ3A 2AXGB 4ZFGH 5MI0C 3AMLA 1KJ2A 2PXYB 2Q6WA 2W9DH 3WSQH 1TCMA 3A67L 1S7VB 3FFCA 2HT3C 5E2UL 1OWWA 4FFWD 5A2JH 2HG5A 3TNMA 1BVKA 5BMFL 4DEPC 4UI2A 4OM0L 3NIFE 1VSCA 2P8PA 3HRZB 3DMMD 1YNKH 5DD5L 1JMZA 5KSBF 4FQPA 1PGRB 4MHHI 4HMCA 4G9FB 4HH9B 3H8NA 1U91B 4YDIH 1G9NC 2NY2C 3WIFB 3U9UA 1L7TL 4PUBL 1FFPA 4OT1H 2AEIT 3S4SB 3HI1A 5IKCB 1CE6B 3TO4A 1CQYA 1ULVA 1GGYA 2NTFB 3N06B 1BQLL 5DJ6A 5DJXB 4B0MM 4GG8A 2IALB 4ELKB 4FQQB 4OD1L 4HS8H 4K94L 4WO4A 4OGYH 2VLMD 2JB5H 3RNKA 2ZCLL 1A6PA 1KNOB 3O6KH 4JJHA 3GJFB 1AD0A 2AGJH 4OIAA 3BGFB 1ZT1A 3ARWA 1PQZB 5HI4D 3EZ8A 3VXMB 1KLFA 2FX7L 3F62A 3SDDC 4HBCL 1OM3L 1EAPB 1WBYB 1G7LB 4LCIL 1OB1A 4O9HH 4UT9L 1B0WA 4YGVB 4JM4H 2IAMC 4K9EC 1IGIL 5DGRA 5DQDL 4NKOA 2NY4D 5EZOH 3ROOB 1QQDB 4IMLB 4CW1B 1LDPL 3FQXB 3QR2A 1FZJA 2ZOKA 4G8GE 3L7EB 4F15B 5I8CB 5DC0A 5AG8A 1CGSL 1GOGA 1YECL 3WXWH 4NO0D 3DV6B 4YIQA 1I8LA 3OGCA 1FDLL 1HXYA 1U8NA 1A5FL 3LHPL 3SDAB 2PCPA 1PG7H 5E56A 1A5FH 4PY8I 4PJXE 2BNQE 4Z7UB 3PNWB 1MQKH 1DFBL 2IALA 4C55A 5D1XB 2IFFH 4ZTOH 3ILPA 3TT1L 3S88H 2A73B 2EZ0C 2PUQT 4HGKC 3C8HA 3TWCH 5DVMA 1MHHA 3C2AL 3TC9A 5ERWA 4LMQI 3FRPG 1VADB 3P77A 4K8RL 1MEXL 5DJCB 2I25N 2NY6C 4N8PA 3D2UB 3SKUD 4Z7VF 4BELD 1G6RL 2M8XA 3EOBA 4GW5A 1DANU 3SKNB 4OV5A 1ZANH 5K9OA 2XZQL 3MV8D 1ES0A 1QEWA 4RZCB 5DFVC 4GKSA 1MI5D 1RZ8A 2F54E 4I0KA 3TO2B 5ID0A 1J5OL 2UZIH 4Y19A 5LJYH 1JF1B 1W2KT 4EUPA 2ZUYA 3SJVD 1NEZB 5EZLA 4MNQE 1HDMB 3WNPA 4LOUD 2B7DT 4PJAA 2DWEB 4B7LA 1E28B 4C56D 5DJAB 1G7PA 5C07E 4YHIB 5F7NC 3RGVD 4OZGE 1NAMA 2YRLA 1X9QA 4P2OC 4L8BB 5EULV 4O2EA 1KB9K 3DMMB 4J3SA 3X3GL 2R0KL 4OIIL 5C0RL 1XH3A 3CFEA 1X6LA 2IH3B 4Y8DC 3F12B 4ONFH 3Q6GH 1YYLH 5I15H 2G75A 3REVA 2AVGA 4JY4B 4UIMB 1FNEB 1H3UA 4M6AA 5HHQB 4MD0A 1JTOA 3CMOL 3TYGH 1HHGA 3V6OA 4PRNB 1JPSH 3CK0L 4FXLA 2NX5E 3B6SA 3O3AA 4IMKA 3WS3B 1NLDL 5FCSH 1B90A 2YN3A 3L3OB 4PJ8A 3GMRA 2YWZA 1T0MA 1REIA 1TNNA 3KG5A 4HZLB 5C0RH 5EOCH 5DD6B 1F8TL 4ZFFA 2HJKB 3WD5L 3SOBL 2OCFD 1XGUA 3PGCA 2HH0H 1JPST 2YPLE 1LEKA 3BUYB 3K74B 2F74B 3RZCD 1JJUA 1GZQB 1VGEL 3DPBA 4RGND 4HMDA 3QAZC 4G8GD 4Y5VC 1X5JA 4XCCL 1YUHB 1KV3A 1SY6H 2ORBL 1RZJL 1UQSB 3BDXA 15C8L 3V5KA 2EE6A 3FL7A 4YXLH 2DQCH 4O2EB 4EDWH 1NCDL 2IQAA 1T1YA 1ZHLB 1G9ML 3FB5A 4HG4J 3SOBH 4K55A 5CCKL 2M1KA 4NQSB 1JTPA 1AGBA 3BSZL 4NUJB 4AEEA 2CMRL 3WEXA 3NFNB 3TBWA 1C5BL 4Z18A 2FB4L 1Y6NR 4LASL 4Y2DA 4LDLB 4TN9A 1LWRA 4EI5B 3FTGA 3OAZK 1HHGB 3WIHL 4OFPA 1HHJA 4PJAE 3IJYB 2DQJH 5D2LE 4UV4L 3RWEB 2VDKL 1I4FB 5I1HL 4M7JH 1JPGB 4LCYB 4M7LH 3IAQA 3UTPD 3QDJA 4JDVB 5IG7A 4BSWB 2NLJB 1IT9H 3IDUA 5EBLA 3WFDH 4OCRH 5GGRA 4M3KB 3SGKA 4Y4HC 3BGMB 2Q8AH 1H15A 4JZOB 5HGDA 1IEBB 3TJHC 4ODVH 2XQYG 1V3MA 4Q2ZB 4HHAA 4YEEA 1CDCA 3C60A 4LRNL 1PEWA 4BQ9A 1DDHB 1CU4H 1K3ZA 1QHPA 4S2SB 3O8XA 1CLOL 1HCFX 3WS6C 3O4OC 3ZSSA 4DGIH 3WO4B 2VLJD 4MJ6B 4LIQH 1RY7B 3W9EB 1YMHB 2VLRE 1A14H 2CUMA 5IB4B 3LKNB 4ZAKC 3H9SA 1OY3B 4NQED 3FO0L 3MRNB 3DO7B 3VGAC 2YD6A 1IBGH 4TTGA 2D03H 4DQOH 1SVCP 4U1NA 1AE6H 2Z35B 3PF2A 1CD0A 1N64L 3BZEA 2ORBH 2R0ZH 3ZKSD 4PJ5B 4APQB 4MNQA 5JHDE 3AVEA 2Y25A 3LKOB 1BWWA 1A1NA 1MREH 5JPNA 2NXYB 5EBMB 3KLSA 5F7FA 3VGBA 1KTRL 5IBTH 3P0VL 2V5MA 4F33A 2F5AH 2CQVA 3HZKA 1NQBA 2HVJA 3P73B 1MCWM 3I75A 4LEXL 5EG6C 1Y0LA 1HXMA 2HFTA 3IFLL 1AO7E 3V7AG 4HC1H 5E8PB 3A6CL 3RX8A 1EEQA 4TUJA 4M9PA 4PBWD 3FQRB 3H7LA 1CXKA 1CBVH 1HH9B 4GG8B 2ZUVA 3H9HA 4OFYA 5ADPH 1ZAGA 2DJSA 2J4WL 3KJ4B 1DQQB 1U8PB 4PJ9D 4RMWA 4UTBH 4XB7A 1VDGA 3GK8L 3AU1A 4WCYL 1ZT1B 4JO1L 1Z9OA 4AEIH 4YHOH 3GJFA 4OBRA 5CZKA 5ICXA 2BOBB 3QT2A 3FQWA 2N4IA 4OJFH 1NAKH 4R90H 1OTTC 3GO1L 3O3EB 2F8XC 1O7SA 4ONOA 5L8JB 1BHGA 1WVZA 4PJXB 4C54A 2Q7YA 4EOWL 1MRCL 2AEWA 3AC0A 5IJVB 1WGOA 5A2IH 1JZ6A 1PZ5B 1RJZB 4KPHL 4G6ML 4X4YB 4XMLH 4X0KB 5HHPA 1U8MA 4AY0A 3DETC 4PJ5A 3QDHA 1LO4H 1C5CH 3QRGL 5FHBL 3TZVC 5DD1L 3BZEB 3IDXL 3QULB 4LVNC 1OQXA 4GUPB 1Z2KA 4OLXL 1KJ3L 3LDBC 1GHFH 2VQ1B 2AQ3A 4GT7A 3RQ3A 3BZDA 4NKDA 5EU6D 1I3GH 1QYGL 3UBXA 1IQDA 2DWDB 1A7PL 5DRZB 3CCHB 3QG6B 2X1QA 3RVWC 4PGBB 4ORGB 2YKLH 2A9ML 4IIQB 1P7KA 2NY2B 4OF0A 5CINL 5D1ZD 1NCBL 1TVDA 5KVDL 1XFPA 4UDTA 5CZXD 5ANMB 1BAFH 3C6LA 1CD1B 1JZ8A 1EXUA 2BSTB 1A7QL 2HT4C 3QWQB 3BH8B 5GS2D 3OF6D 4L4VA 5BMFH 3LZFH 4JFFA 4FTVE 5D7KD 3EOBB 2AI0H 4HXAH 3D2UA 4S0SD 2Y4SA 4YDJA 4Y4FA 3QI9A 5KSBA 5ICZB 2YC1B 4PJCE 2ZUTA 1JUFA 3HN3A 4ODXB 2VXUL 1NJ9A 1GIGL 1O7VA 3VFVB 3BOVA 4ZS7L 5I1DA 4RGOL 1EA9C 1FVCB 1WUNT 2B8OT 1UM4H 2Y5EA 4NNXA 1IC4L 1U36A 1LO2H 5I8EB 1MHCB 1AGDA 1D6EA 3L3HB 2AJVH 2R23A 5F9AC 1E28A 4JFEA 4RWYH 4ODSH 4JB9H 2NY3D 1JGDA 1WBZB 2HT2C 1RZKL 3DUHA 1UG9A 4LCWB 2MMXA 5DUPL 2H1PL 4WY7H 3MCLL 4PRHB 2WWKO 1EPFA 3MGOB 3ZHKA 2Z4QB 2R1YA 1ITCA 2EDYA 4F15C 4JRYD 4MAUH 4JM4L 1JV5B 3KYMB 1W72B 3D9AL 4IMLA 3GO1H 3OHXB 5IQ7H 1EJOL 5HVGB 3GMNB 1NANH 5C2BL 5TH2A 4DTGL 4ZAKB 5IHLB 1R24A 3WKNA 4J6RL 3HCVA 4JKKA 2MQ3A 3NACH 4PJ7B 4R96A 4X80H 4I9WE 1BIIA 4GMSL 5D1XC 5A2KH 4U1MA 2DLFL 4OZHA 4R0LA 1GGUA 1FGVL 4XNMA 1YY8A 4WY7L 4OIIH 2AABH 4ACPA 1I3UA 2Q20A 5GGSB 5LAXA 5F7MC 4Y4HD 1RZKH 3HZVB 2MSPA 1FFNA 1AKJB 1BFOA 1DBAL 3LKPB 4XAWH 5E8PA 1UB5B 3BD3A 2FX8H 4OLZL 4XPHH 4ZXBD 3WO3B 3DRTA 4G3YH 4L8CB 4WO4D 4WW1A 3HNSL 3SE4A 1BVLB 1FH5L 1S9YA 4M1CC 1MOEA 3VFOB 3B9KD 4I0CC 4D8PA 4PR5A 3MZTA 3N1GC 3U0TB 2MPAH 1FLRH 5L2KB 2VITB 2AEPL 4AIOA 1U91A 2I07B 5C9JB 1CD8A 1B6UA 1KIPA 5F89B 2D31A 4ZS6D 1G0YR 3HZMB 4OF7A 3OXRA 3S4SG 4HXBL 3PGFH 3LB6D 1A6TA 5EIIB 1CL7H 2P8LB 4CJ0A 1ORSB 3U0WH 9CGTA 3UAJD 4A6YH 2IGFL 1CF8L 2BZDA 4NJAL 4F3FA 3MJ8A 4RGNE 1WFNA 4KI5D 3ZTNH 1MHEB 4KVCH 3GRWA 3NAAL 1UZ6F 2AV1B 5EUOB 1NGXB 3KVQA 4RAHA 3TBWB 2N7AA 4PLJD 4DZBA 3VCLA 2Z8RA 3MCKA 5TF1L 4Q7DA 4RX4A 3D69A 3CVIH 3KHOA 2P7TB 1AXSA 3T0BA 1KC5L 2DD8H 3UO1H 3VXSD 1T21B 1ADQL 5GGRY 1D5XB 1J0YA 3JUZA 2YOCA 1XMWA 4PLNC 5C09E 2OTPA 1L6ZA 1MJJA 5DUMH 5FKAB 3RL2A 3CX5K 4F7PB 5GS0H 1G7IA 5GS0C 4LVNB 4ONHA 3VFTA 5MEPA 2PNDA 3OKEB 1H5BB 5HI5D 2JJSA 4OFIA 2GSIB 3MOAH 3QXDB 5LGHH 3OPZL 5TDOB 4WW1B 3LDBB 2UVEA 2IBZY 3KPPA 4WFFD 1P5VA 2DI9A 1YDPB 2Q3ZA 32C2A 4ODWA 1JPFB 1X44A 2HWZL 3O2DH 5F9OH 4N68A 3REWB 2HTLC 5C09D 2HMID 4ZPVA 4L8DB 4IIQC 4RAVB 4I9WD 1K5NA 3MUGA 3THML 4HUUA 5DEGB 3U36B 2XWTB 5SV4A 3SKMB 1HH6A 1PY4A 4HXBH 1T7WA 2GJZA 3PNWA 1YJDC 4HPOH 4XPBH 3HCVB 3BE1H 4YO0A 2YEZA 3SKOB 4NGHL 2EDBA 4OLWH 4ORZC 5F1KC 4AM0A 3RP1A 1JGEA 1OP5K 4XNMB 3QDMA 1SYVB 4R4ND 5MP6H 1KXQE 3FCTA 5T1KB 5EBMA 1ACYL 3MRHB 4APQA 4PGCA 1I9IH 3NOIA 4GLRH 4OLZH 1MFEL 2W59A 5F6IC 5DMYA 3DJ9A 3EYSH 3BPLC 4LPTA 2SEBB 5J9PA 5CEXB 5I1EL 1XF3A 5HHMD 2JK5A 4NIKB 3GM0A 3UTTA 1OD9A 3S5LA 3VD4A 4LPUA 5GISL 1NLBH 1LE5A 5GGTH 4MMZC 3MUZ1 4BQCA 2R56L 5LVEA 3VXOB 1NMBL 3DX6B 2Z9TA 3VXMA 4N8VG 4GKNA 1VFUA 3GMPA 2C3XA 3ESUF 3MOQA 5JHLH 5D2NC 5D70L 2BVQA 4HK0B 3B9KC 4EIZC 5TPWH 5GIRB 4XVTL 3OB0H 4UT6H 1OT2A 1UB5A 4GW4A 4FQQA 4GFTB 3T77B 5INCB 1T7XA 1WWWX 1A8JH 4RGMB 3V7AE 4N1HB 4DCQA 1I8MB 2GUOA 5T1LB 3MUHL 1LO3L 3T0EE 4BZ1H 3Q1SH 3LB6C 1MFDL 3BAEH 5ACLA 1D5ZB 3BJ91 4NNYB 2VZUA 4X4YA 1MF2L 1KN4H 3CFKB 4MLIA 2ZCKH 5I1LA 3ULUF 4Y5XB 2DQTH 3QZWA 1S7QA 5AUMB 3ZL4H 4X8XA 5LWYL 1BF2A 1A3RL 1KB5H 3C6SA 4HIJA 3K2UL 1U3HA 4RFOH 1WBXB 4Y2DD 1FN4A 2AW2A 4X8JB 3EDKA 4KRLB 4NRZA 3ZE2E 4YHKH 3UXFA 5H37H 1F00I 2NXYC 4LLYB 2DWDA 3RJDA 2FSEA 2NY1C 1P7QB 2AK1H 8FABB 2X41A 3UTTB 3PP4L 3KPRE 4U6XB 1T2QL 4YWGH 2PYEE 1LNUA 3SN6N 3G5XB 2LE9A 4K7FA 1UM5H 3WMSA 1YMMB 3D3VB 1HHKA 1HI6A 5CSBA 1HE7A 3QWRA 4OZGA 5CJBA 3LEVL 4NZUH 3DVNB 1R6VA 3NH7L 4KQ4L 5BZDB 3T0AA 1BX2A 2W0FB 1UCBL 3FRPA 2WBKA 4ODXA 2VDPL 2X1WL 3S9DB 4OFDA 2XIDA 2VAAB 3V6FB 2CPCA 3RL1A 2X4OA 3KLHC 1IQWH 2GK0A 2DLIA 1LEIB 3ARDC 3QHZL 4P2CG 2FZ3B 2ATPB 2VZSA 1KCRH 4PG9B 3ULVF 1A1MB 4X5WB 4D9LH 4FQXC 1NFDB 2H2SC 2PXYC 3L1OL 4JJ5B 4XNXL 4PTUB 4P9ML 1PKOA 2F19H 2X4NB 4HCRH 3EYVA 2CK0L 3U36A 1TZIA 3S36L 1P4LA 1AGFB 3GDBA 5J12B 2YD9A 4ETQB 3EYFB 5CEZD 5I1EH 1AFVH 1QRNE 5DQDH 2QQLL 3KNBA 4LBEA 1A3LL 5GHWL 4U1SB 2DF3A 4X6EA 1TIUA 5ILTL 3L3IB 5JHDD 2PW2A 4GQ9H 4KMTL 2FATL 4MCZB 3MLXL 1TETH 5EUOF 1RUML 5D2LF 1JV5A 1F3DJ 3V4UH 1DN0A 3FCTB 4NKMA 2GY5A 3ARQA 3EYUL 5BRZD 4D94A 43C9A 4YJZL