5GGVH

Ctla-4 in complex with tremelimumab fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
225
structure length
225
Chain Sequence
b'QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH01
3K4ZA 4LPTA 3QDHA 1ONQB 3GSUA 1QSVA 1MFBL 3KXFB 4W68A 5BJTA 4K3HA 3MUGB 3GMMA 3RUGB 3S34H 1NCDL 2X89A 4S1RL 1RMFH 5JMRA 4Z95H 3O6FC 3PV7A 1JIBA 2NW3B 3GSWB 4LLDA 1UM4H 1RZ7H 3GGWA 2F5AL 1RVFH 5K93A 1DN0A 1AKJA 5F71A 3GMOA 4G6JL 2IANE 4UT7L 1BQHG 1VFOA 3RWCB 4S2SA 3FQNA 3BQUA 5ANMB 1CFTB 3SO5A 5KN5B 4R97B 1D9KC 1X4XA 3WHE0 2BMKA 3AREB 1REIA 1S7WA 3MREA 4HKZB 5D1XB 5T1LD 1U2HA 1WWAX 1CWVA 2D0HA 2DKSA 1ORQA 4XBEL 1PYWA 5ABDE 4CW1A 1IC7L 2EDHA 4NO5B 1N5AA 3B2UC 1J0YA 2R29H 3EYVB 3U9PH 4YBLC 4O02L 5A3IC 4WY7L 4GAFB 5ID1B 3OB0K 3S97C 3P9WB 4R7DB 4PV8B 4X9IA 4AZ8A 4OV5B 4C4KT 5B4MC 3VFGH 5EU7C 5HHOB 3GMNB 4M5ZL 5INDB 2UYLB 4M62H 3MRQB 5IBLC 1KCSL 1JHKH 5E1HB 2VQ1B 5T5NG 4H20L 2ESVB 4NRXB 4X98A 3O8XA 3EJYC 4JFFD 1P9MA 3SO3B 2IPUK 1UACH 4WO4D 4JN2B 4C83B 1CLOH 1AP2A 5F96H 2WLYA 3HZVB 4JB9H 1A14H 3HNVH 4ZODA 4M9OA 2ZPKH 3VFRA 4ZUSB 4UT9H 5J13B 1M7XA 4PRHD 4TUOA 4YDVB 4OZGA 5FUOH 4UILL 1ZGLA 1KIPA 2GI7A 4Z18A 4U6YB 4LCYA 4B41A 4LSUH 1RIVL 3O4LD 3U48A 3FT2B 5IFHL 3SJVA 3MODL 4G8GA 2LTQB 5BV7L 1LE9A 2UUDK 1I75A 2D7NA 5BV7C 1KB5H 2BCKB 3ROOB 3V95A 5IGXH 2R8SH 5D4QA 2W92A 2EDKA 4LMQI 1YEGL 4LLWA 1RK1A 3CSGA 3BP5B 1FZOA 1F6FB 4N9OB 2ESVA 3NCEB 4HKBA 1RZJL 1S9VA 4MHHI 3OQ3B 1TPXC 4F2MB 3VXRB 2P46B 4M7JH 3BN9D 4HQQL 1RZJC 4PJ7F 1RJCA 4EDWL 5L0QB 4I4WB 1MI5E 1F4XL 1OT2A 1NEUA 4FFWC 3ULVE 3FQRA 4Y4KC 3WEXA 2CDFA 1LVEA 3SKJL 2GAZB 1OGAD 4KK5C 4D0DB 1G7JB 3NIDF 4Z77A 5E99H 3CLEL 5ESAA 4DVRL 2YD1A 2VL5A 2E7HA 4N0RA 4XPGL 4MJ4A 1F2QA 1OPGL 4LPWA 3MV9D 1LEGB 3MV8A 3WHXA 4GO6B 5ICXB 4HGMA 4PJXB 4XB7A 1J8HD 2R2EB 3OAZH 4XAWL 4YWGL 3FO2B 2E7LA 3MRFB 1S8DA 4LEOB 1YEDB 2ZUUA 4OLYH 3IKKA 4UV4H 3M17A 3A6OA 3BZFA 2DLIA 2FRGP 3RWIB 4A6YH 5IUSA 3DX6B 1F45A 2BC4B 5JA9A 3ZSTA 3ZE1F 4JG0L 3HLAA 4K23H 3OR7A 1YNKH 2XY2A 1JL8A 1A1OA 2R1WA 4X9BA 3EFDL 3BZ4A 4WI7A 4IIQC 1FNGA 1LD9A 3BKJL 5K9KB 1KENL 3CLFH 5EIIA 4W4OC 5CP3H 1DBAH 3TT3H 3ZHLA 1A6AB 2AKRA 5HHMD 1MLBA 5DHYB 3AC0A 2BX5A 1U8LB 4MJIB 4H1LA 2MCPH 2X4PA 1NDMB 4F37K 1YEIH 3ULSB 2EYSB 3MJ8B 4PJBB 2R2EA 3HMXH 5CJOH 1AH1A 2IH3A 1NC2D 1ORSB 4MNQD 5C8JB 1Y6NR 5D7SH 5CCKH 1EO7A 2ARJQ 5LGJA 3S3JA 1GGCL 3QI9C 3VFTB 2FHFA 1CE6B 2VLJE 1YEFL 4MA3B 4PD4J 3G9VA 4XCNB 3G6JE 3QIWA 4KMTL 4ZMAT 3S36H 5I1HL 5C07A 3QIBB 5GS1B 4KWUA 2DICA 5GGSY 1EUTA 4S1QH 4Z7VE 4U1IB 1AY1L 4GW4B 1H3WM 2I27N 3V7AE 3VGHA 3T0ED 5FO8B 2ORBL 4QYOB 3OKMB 1T1WA 2NYYD 3MBED 3V5KB 4X6CF 5E8DH 1H3PL 1L6XA 2CH8A 4HLZG 1MLCA 3QUZB 3UAJD 1V7NL 4AY0A 4AK1A 2Z8RA 3UBXA 5J3HC 2IQ9L 1KCKA 5HYQA 2VZUA 4XVJL 2NY0C 1ZXQA 5ILTL 1ZE3C 1NBQA 4XI5C 3ULUL 1U8OA 1F4WH 4YR6A 4M02A 3EZJB 4CMHC 4EN3D 4X6DA 1U58B 3VGFA 4PRPE 1T0MA 1URLA 1XH3A 5HY9B 4KKCC 3GMRB 5EOCH 4GG6B 2O61B 4RDQF 2AQ2A 3U7WL 3SE9H 1N64H 3MV8E 2ZSVB 1AQDA 1WWWX 1YEKH 1RZIB 1CD9B 1WGOA 1FJ1A 3WNNA 5FO8A 4NCDA 3OKMA 3EBAA 2A9NH 4QHUA 4ZFZB 3V5KA 4YDLB 4GLRI 1MY7A 3EZ8A 1RUPL 4LARL 3UBXG 2DI7A 1DLHB 1BPVA 3P0YL 3O6FA 3TJHC 5C3LD 4I48A 4Y2DA 1ZLWK 3ZHKA 4EI5B 3C8DA 4OSUH 1BD2A 1PKOA 4KPHH 4NN5B 4HHAA 5E8NA 4K55A 1KLGB 4PJDF 1PZ5B 4YPGA 3MRMB 1LO0L 2ERJB 4GAGH 2QQKH 4ZO8A 1EAPB 1P4LA 1U3HB 1I3RB 4IM8A 1FGVH 1OD7A 3BPNC 1QSFB 4DK6A 2PYED 4NQCD 3BKYH 4OF3A 2H6PB 5DGQA 1TJGL 5I17B 3RZCD 2ZSVA 1QNZL 3GJFA 4UBDC 4IDJH 3IYLW 4Y16C 2J88H 2PTTB 3PG2A 3QRGL 3BXNA 2K1MA 2R1YA 5MEQA 1DFBH 4H8WH 4I13B 4JGMA 4PJGE 1QHOA 4HIHA 4FXLA 4PGBB 3C8KB 5F6HI 1P7KA 3U0PB 1N7ML 1UWEL 3IDJB 4JO1H 4O00A 3MGAA 1FBIL 3IDXL 1WCBB 5DJAA 4YNYB 5T1KD 4ODVH 1ZHBA 3HZMB 3S88H 3LMJH 1K6QL 4KQ3H 5KSBE 5AWNH 4L8SB 1KF9B 5D7LB 1UVQB 1RULL 4WI5A 4LVOB 2AGJH 5AUMB 2PW2B 5IMMA 3ECBB 1DVFD 1MJJB 1VGEL 4P46D 3NACH 1H15B 4FQXD 4JHAH 3O6LH 3D3VB 3QFJA 1NFDF 2A73A 3BOVA 3MRPA 4ISVB 2FWOB 4OF7A 3QWRA 4WTZA 3WJLC 5CD5C 5DJZA 1WEJH 4XPFL 5C0CD 1CFBA 4GSDH 1PG7W 3KNBB 5CEZH 3JUYA 3BRFA 1OAUH 4OCWH 5EO0B 2NXZC 2IBZY 1YZZA 4KI5D 4RGND 1UADC 1NEZB 3MXWL 3QHTC 1FL5B 1U8IB 5JO5B 2W91A 4OFDA 1RZ8A 2J6EA 1HOCB 5F7DB 3QHZL 1J7VR 4HH8A 5GJSL 1A1NB 4PJCB 1EHLH 3VXPA 1ZLUK 3KPSE 3STLA 3CAFA 1WZMA 1U8NA 1EIBA 4Y4KA 4PTUB 4RGMB 3HPLA 4Z0BL 4WTZG 4I8DA 5A43C 2VSDA 1OY3B 5HHVH 2EDNA 4W6WB 1DBML 1I3VA 4N8VB 3GSOB 4DKAA 4WW2C 5IW6B 3I9GL 1QO3A 3DVFA 2ZCHL 3QUXC 2O93L 1MFEL 1SM3H 3HPJA 3QEGH 1BFSA 4M93C 1MHPL 1EERB 2FX9H 3VWKC 2AEWA 2ZUQB 4J7RA 1UKTA 3AS0A 4DVBA 3KHOA 1AJ7L 3QO0B 3RVWC 4OLWH 1IM9A 5EIVA 4U6TA 5FV1L 5I66A 3SGJC 1SJEB 3GIVA 4LPUA 3ZT5A 1KPRA 1N8ZB 5I15L 3BZEB 4JM2A 2CGRH 2DJSA 5HBBA 1A1NA 5E56A 3H3PH 1M7IB 1Q0YL 5FEBA 4I2XB 3BDYH 1R3KA 3S96A 4ONFL 4PB0H 4L4TE 3L1OH 4HUXB 5EC1A 5J6HB 5I76A 1TDQA 3BISA 1LK2B 3WFEH 4PJAF 4IIQA 1UA6L 1CFVH 1FQ9C 4W4OA 2BY0A 5DJ8B 4NT6B 1LDPL 2P5EE 4PGDB 1KJVA 1CICD 1QR1B 1DLFL 2FECL 4WWKC 4DCQA 5H37H 1K8DB 1SJHA 4JZJA 4J3SA 3BIKB 5I1LB 1E27B 3CVHB 3CGTA 2NY4C 1RZGB 3EYOB 5EU6A 1NEZG 3WL9A 3RPKA 3QUMH 4DGIL 4LCCA 3VGAB 3QXWA 1PSKL 4WEMB 1DQQB 3NPSC 4BKLA 2EO9A 3HE7D 1KCVH 2VXSL 4ERSL 4HKXA 1AGCB 1TCMA 4M7LT 4FQLH 1UM6H 3QI9A 4X9HA 3HG1A 4APQC 2ZG1A 5JTWA 4KK9D 2VQUA 3E2HC 2ITCB 3TYGL 4NGHL 1M7IA 1R3HA 5ITFA 3SDAC 5FYLD 4OCRL 3LD8C 4N8VG 5J6HA 2ZSWB 4YHZH 5AZEH 2DAVA 3RNQB 3U82B 1JNHB 3WFZA 4LNVA 3U6RA 2I07B 1T89A 5GJTL 5BO1H 4GMSL 4XNUH 4NDMB 5D7IA 1MFCL 1IBGH 2YK1H 4KY1H 1K8DA 1UFUA 4FQCL 4MLSA 1NBZB 3CVHA 1P7QD 1TQBB 1WICA 2EEDA 1ACYL 1HHJA 4ODXA 3FQXB 4U1KA 3MMEB 3G5XA 3CXDH 4FQ2L 3P0VH 5DD3L 3CC5A 4PJ7B 4KRPC 2VLRE 4F7CA 5GRJH 3JWDL 4E5XB 4ELKB 1WITA 4EBQL 2PR4L 3AB0C 4QRPD 4NPYB 3VXSA 1KIQB 4LIQH 5DD6B 3MA9H 3WYRA 2FEDC 5E9DA 4DW2L 2W0FB 4P2YA 3LIZL 3WIIH 3P4NB 2DI8A 4Y89A 4V1DE 5EU5A 2C1OA 2CUIA 2DQCH 3ES6A 4IOSD 4XCCH 2IFFH 2DQEL 3IJHB 3SQOH 5HI5D 4LKXB 3PJSB 3LKOB 3DV4B 2NY1D 1U3JA 5DS8B 3QXAB 2B4CH 2J8UF 5JPNA 1GAFH 1PW3A 4JRXE 3K46A 1KGCE 2DBLL 3GRWA 4QCIB 4QTHB 1CD8A 5BVPL 2AK1L 5DFTA 4MMXC 1UENA 1CXFA 5D6DC 3L3IB 3ARDC 2XQBH 5IJVA 2BJMH 2FCBA 1P1ZA 1S3KH 1MFAL 1SMAA 4JVWA 1HCFX 3FB5B 1OTSC 1WFUA 4G9FD 4OGAC 2CUHA 2G75B 1DQMH 3N85H 4M8VA 2H8PB 5DTFB 1DQLH 3UDWC 1CBVH 5C09D 4RMTA 4TUJA 4PV9A 2FHBA 4GQPH 5DJ2B 4HG4J 2CDGA 3V6OE 3SGEH 2Z8WC 1A7NH 4Y16A 3S3SA 4KTDL 5D8JH 5EU6E 1MCQA 4LSSL 1RPQA 3FFCD 1TIUA 3ZE2F 3R8BB 4OLVL 1LDSA 5BZDB 2HJFB 3THML 1IJ9A 4KI1A 3Q1SL 3D69B 5EWIH 1JPTL 3BP7B 4NZUH 4EOWH 2EKSB 3HG1E 4ETYA 1W72B 1N2RB 4NZRH 3PE9A 5L88L 2XN9E 5ACZA 3RKDC 32C2A 3QAZB 5J11B 2GFBB 5AD0B 5F8RC 1J1XH 5J12B 5E95B 2WUBL 5B3NA 5I9QB 1W0VB 3V0WH 4HIEB 4RFOL 4LSVH 4DKEH 3BD3A 2G9HB 4RAHA 5IHUH 4FXGA 1F8TL 3GNMH 4FMFA 5BMFH 4RWYL 1T20B 1BGXH 2A2QT 4KHXL 4X6CB 3WJLA 2BNQA 3VFWA 3DO7A 5FK9A 4FABL 3U30C 3MOBL 3PHOB 5C7XH 3AUVA 2ZJSL 1JTPA 3BPCB 4KHTL 4GFTB 4Z7VF 3MUY1 4UAOB 5DI8A 2HN7B 4NUJA 4ZUTA 4C59B 4I9WE 5E8PB 4EQ3A 4J3VA 5BRZB 3C2SA 1NMAL 4D9RE 3ULUE 1OSZB 1RHHA 3BHBB 3EYSL 1CFQA 5I71B 1RFDH 2PN5A 4YJZL 3KWWB 4MD0B 2F54A 2DIBA 2AEPL 5SX5K 1IAOB 1JZ5A 1KJ3L 2XTJC 4KKAC 3H9YA 4G6KH 4DTGH 3T4YA 3TIDB 2BY2A 2CJUH 2R0ZH 5HYFA 3UYRL 4WW2A 3IDMA 1AHWB 1OAYL 3QUXA 4TQEH 4YH6A 1I1AB 2Y06H 4P5MB 3LRSA 1T7ZA 5ADPH 3RGVB 3IDGB 5I1AA 5JHLL 1YYMH 3SDYH 4GBXD 3TNNB 2O5XH 5B8CA 2RCSL 1QFUH 3VWKA 4G42B 4YDJB 2WUCL 1H3UA 1KB9K 4PJDB 3BESR 1D5MA 3MR9A 4ONHA 2PW1B 3SGJA 1OM3H 3FOMA 3QG6B 3V52L 4H0GA 3VXTA 3FO1A 4UTAH 4P9HL 2V2TB 3BDXA 4OJFH 4MB5A 2BNRE 2BFVL 4P9HC 4JPKH 1NGYA 5JOPE 2FX8H 4MWFB 5E2UH 3GMPB 3VFOB 4CADA 2P8PA 1SHMA 1YPZA 1EGJH 4L9DA 2IALA 1R24B 4X0KA 2YD3A 2NTFB 3LVEA 2E5EA 1UCBH 1G9NH 1AXSB 4OCLC 3QNZA 4LSQL 1ZLUH 4WWKA 3MFFB 4AL8L 4XCYA 4YDKL 1IQDA 3QDME 3TH3T 3DROA 3BEVB 1BZ7A 3K7UA 1CR9H 1I7TB 3B9VA 5SV3A 3MLPA 1MIML 3B2VL 3L5WB 1P69B 1T2JA 3PUCA 4G42A 1FYTB 2BHZA 3VRJB 1IAMA 2RFXB 4YHOH 4N0YL 1QFOA 2BSTB 4LLAA 4YHIA 4PJGF 1NUFA 3PWUB 3RBSA 5I2IA 4D0BA 4RDQG 5E70A 3CZJA 4ODWA 4JQXC 1PX4A 4PJIE 1NGZA 2OLDA 3QDGA 3CIQA 5MEOA 3DMMD 5ITBH 4QRRD 3LKNB 1NBVL 4LAJH 1FRGH 3CD4A 4F7EA 5KSBF 1B2WL 4RMWA 1GGTA 2B1AH 3QDJB 1A1MA 4GXVL 2J5LB 4U1NB 2XPGB 2V5RA 4ZQKA 1GCFA 3CFEB 3FT4B 1NCWL 4HCRL 4UDTA 3F7VA 5MEND 4UUJB 4NN7C 3WIHL 2HH0L 1I7TA 2Y6SC 1K4CA 4NZJA 1MIEH 2DM3A 4KJQC 1P4IL 1A21A 3MGOB 3OKKB 2BSTA 4KDTA 1T3FB 3NFSL 3PWUA 4MNGE 2EE6A 3SGDH 3JTSB 4J6RH 4JVUA 2PTVA 4OFPA 4XP6H 4JGUA 1NFDA 4MXVE 3QRFM 5LBSH 4P2RA 4X9FA 3LRHA 1NCAL 1DUZA 4P57B 5HHNB 4Z7WA 2YWZA 1XGUA 2ZG3A 5IJKC 4OFKA 1MCNA 3KPQB 5D1ZD 2H2SC 2AJXL 3U1SL 4NSKA 1A6PA 4EKXA 1X5LA 5EUKA 3LKSA 2C3VB 5CUSH 4ZPTB 1KEGL 3O6KL 1RJLB 2JJWA 3ZO0A 5BCAA 1AO7D 2Q20A 3S35L 1Z9OA 4JFPA 3ARDA 3TZVB 2EYTA 4NO3A 2IANB 1LO3L 3D0VA 5C0AA 4F7MA 1QKZL 1R3JA 1BVKB 1JV5B 1Q72L 4PJAB 3RVXD 1MCSA 4JFYB 3VE0A 3VXUD 3UPRA 1QRNA 4B7LA 2NYYC 1C08A 4UIMA 3DUSB 3EKCA 4I18C 4OTXL 4XH2B 3UDWA 4IRSC 2EEAA 2FECI 3OGOE 3FMGH 3W11C 4WUUE 3KPNB 3ILPA 2PXYB 2IFGA 4ORGA 3U0TA 3C5ZB 4CU7A 2OR8A 4Z0XB 1U8PB 4MNHB 3RIAF 3RNKB 4AG4L 5FKPB 1XGQB 2OP4H 5BQ7A 4U6HA 1UJTA 3OJDB 3PIQA 5I74B 3QA3B 2IQAA 3DYMA 4HPOH 3IJYB 1DTUA 4DQOL 4M48H 3P77B 1ERNA 4UMGA 2Y36L 5IB5B 3QDGE 1QLRA 4WDIB 3ZKMC 1NUGA 4PLJC 2WINB 4NJAL 4PJ5E 4DN4L 2OR9L 4C57C 2B0SL 3DUUA 1QEWB 1TJHL 5CKAA 2VNCA 1ZTXL 4LPYA 4NOBA 1DL7H 1TVBB 3D2UD 5IMOB 2CIKB 4KH2A 1EUUA 3G5ZB 3G6DH 5FCUL 2IPKB 5DJCB 5C0IA 3PDGA 1PVHA 4HJGA 4HV8A 4IOIB 1A4KB 5TF0A 3QIUB 2YPLD 4J23A 4HT1H 4YXKL 1XGQA 3ZKSD 1FAIH 3RA7L 2FIKA 1AXTH 2YEZB 2VSCA 4GRWH 3U4BH 2WBJC 3RL2A 1HYSC 3HZYA 1OF2A 1QPXA 4MB4A 5D7KE 2EH8L 4LGSB 3RZCC 3CDGB 5CWSB 5IHZB 1FLRH 5J1AB 5EC2B 3E8UH 4Q9RL 1MI5B 5I8EB 4KGLA 4P9ML 3WXWL 3T08A 3GM8A 4U1HB 2GEEA 1VFAA 3NOIA 3PGFH 4YBQD 1TCRA 4WCYL 4BZ2H 3RTQB 2J8UB 2EDEA 1G1CA 2DQFA 2P7TB 2CIKA 3RWEA 1X5ZA 4JFXB 3DVNA 3LH2L 3WFHA 4PG2C 2BNUA 1OQXA 1Q9OB 5DT1L 3KPLA 3IS1X 4TUKH 4E9LA 4MJ5B 5BZWA 2JB5H 2H45A 3G04A 1EEQA 5CGTA 4CNIA 1AGFA 4G80B 5IF0A 4OD3H 4X7SH 2X44D 4ZTOH 4L4VE 2CMRH 4N0CC 25C8H 4I3RH 1T0NA 5DRNB 2X4RB 5EOQL 1HNGA 1CIDA 4NO0B 2HVJA 3O2VL 3VXMD 2DN7A 1R5VB 3ZYIA 5MP6L 3U4EA 4IRJC 1HXMA 1DR9A 3BFOA 3MXVL 2E6JA 3EDEA 2IG2L 3DHJA 4YO0A 1EAJA 5CILL 1AGDA 2CRYA 1TMCB 5IW3A 5D1QD 4GRMA 5FGBC 4KI5C 3PWPE 4G3YL 4NQXB 5SX5H 1RD6A 1S9KC 3UJJH 3IJSB 4FQQB 1MCHA 4S11A 2X1WL 3FB7A 2DQGL 3MNZB 4QRUA 4LP5A 3X11B 1A6WL 1FNFA 1BJMA 1YMMA 2GJ6E 5FYKU 1X4YA 1FZMB 1M05B 1XIWD 4H1LH 3QCUL 1QP1A 3CU1A 4H26A 1U95B 5FGCE 1QFWM 4NO0A 4XP5H 3VDAA 4Z76B 1P84K 3LB6C 3MRRA 4OGYL 5D2LE 4ZFFA 4WV1B 3P4LA 3O81A 4MHHG 4JQXA 2APVA 1KIUA 1U8HB 1HKFA 1PG7L 1OL0A 2VXQL 5EN2B 4HLZH 1BJ8A 2VLJB 3X12A 1U8JB 4LF3A 2VXVL 5GGUA 1L7IH 3CZFB 3LY6A 5B39A 4XPBL 4YHMH 3PABA 5T3XH 3G6JB 4Y5XC 3V6FB 4PY7A 5HVHC 1C5DA 1CQKA 4ESKA 4U1MA 5MHSD 1DUYB 4Q6YA 5ALBH 1YEJH 5FA4B 1FVDB 2CO6B 2NZ9D 3BKCH 4Z7VB 1KLUB 1N5YL 2P24A 5SWZA 1B4JH 4QXWA 2R23B 2X1PA 4QGTA 2AABH 5TDOB 1JNJA 1BFTA 1IARB 1U36A 2VIRA 2DKUA 2DQTH 4UV7L 3FO9B 5DUBB 5JHDA 2VZOA 3VDCA 4Y8AA 1G9ML 2Z35B 4O5LH 3NCJH 5F6IC 5IEKA 5EZIH 4EXPX 2DDQL 3EGSB 5IVXA 1YDPB 1G9MC 4MMZC 1IVLA 2X7LA 1G6RB 5FF6A 3SN6N 5HPOA 4J4PC 1JGUH 1MWAL 5EUOA 2XQYG 3HCVA 5F1IA 1U3YA 3ULUF 1OVZA 5F7FA 2ARJA 1F3DH 1EPFA 1LO5B 4PRPB 5IOPB 3B8SA 2UZIL 4HUUA 5IESL 3P30H 1ZSDB 5K9JL 1FNSL 4JFFE 1RZKL 3KDMA 5TE7L 5GHWH 2PO6B 1O7VA 3HFML 5IJKA 3O3UN 4X6FA 3FFDB 4NN6C 2AK4D 4HC1A 4NNXB 1MCIA 4K94L 4XP1L 5KVEL 5ESQA 3C6LC 2OI9B 4JO2L 5FYLL 4PRHE 3AROA 4KK9C 4I0PB 4K3JL 2H32B 5GRWA 1UT9A 2OM5A 5I8KL 1ZVSB 1W0YT 2BDNH 2X5PA 4OM0L 4OIAA 4H5SB 4L8CB 2AJYH 1VERA 2BVTA 3MLWL 3O4LE 4PJHF 1WZ1L 3MLXL 2D7TH 5HI3C 5SWSA 3NA4A 3D85A 2I5YH 3IFLH 1XGYH 3ARRA 4L3CB 1I3UA 2HFFB 4OLXL 3FO0L 4JANB 4LSDA 1OWRM 1NC4D 1LO2L 1OAXH 1T22A 3I2CL 4I18A 1GHFL 3QFDB 4IRSA 4ZXBA 4RX4D 2QADC 5DUML 2NX5A 5IOPA 4NHCH 4UZGA 5KVDL 3V7AG 4GKNB 1MREL 3TC9A 1CDHA 3LEYL 1SEQH 2CRZA 4R0LB 4M43L 5DQJA 1R3LB 1QFWL 2ZUSA 1IGYB 2ZKHL 1EFXA 1FFOB 3QEQD 4DUVA 4PJGB 2OZ4A 1OGAE 1A2YB 4L3ED 1BVZA 1Q9LA 3CH8A 1NAML 4PJEF 2QTEA 4JPWH 3LKQA 2P48B 1WTLA 3C5SB 5KBNC 3NAAL 5FB8A 3MV9E 2FNBA 4YE4H 5I1KL 3S8WA 5EBMB 4JANA 5DMKB 1J8HE 1U93B 1YNTA 4HSQA 3ZKNC 5KSBB 2YSSB 4NJ9L 1ZHNA 1A9EA 1II4E 1YJDH 1OARL 4R2GD 2Q3AA 1JNLH 4PJIF 5DEZA 4C56D 3Q48A 4M61A 2X4QA 5HHQB 3I6KB 1IGML 2FJGB 3CPLA 3FB6B 1CVSC 3GUTB 1T2QL 2PCPA 4QOKA 1IAIL 2W9DH 3TN0D 4DK3A 4M7LH 4XNYL 4FOMA 5F7MC 5TPWL 1FPTL 1EK3A 4FA8A 5IVXE 4U7KA 2FZ3A 4FP8L 1MUJB 2WBJA 4NZTH 2X70A 2Q76A 4HK0A 1L0XA 5HHME 1MH5A 2X42A 4PS4L 5EUOE 4UU9B 1T5WB 3WXVL 4M6MH 2HFEB 4P5TD 4K7PL 1H8SA 2VDOL 3KPSB 4Q0XH 4W6XB 3MLRH 2CLRB 3QH3A 1T03H 1TNNA 3OB8A 4MNQE 1EEZA 2CK2A 2V5TA 4PG2A 4MD5B 4OCSL 5IIEB 2VQTA 2GTZB 1IT9L 5GQBA 4HS6B 3GUTA 1CXIA 4ONGH 5B38B 3RKPA 2VH5H 3ZT6A 4TPRL 2F58L 2GTWB 4MDJA 3MO1A 4PRDB 5ADOH 3TF7C 5GRUL 5CJQL 1XF5A 4RGOH 3CU7A 4C54A 3QJFB 4NBZB 4W6YB 1UYWH 1B88A 1MHCB 3N0PB 4K9EH 3C60B 1FP5A 4N9GB 4EZMA 4IRJA 1CD1A 3RDTB 1AI1H 3T0EE 3UEZA 3QB7C 1EO8H 2XFXA 1D9KB 5IR1A 3ZL4H 4QGYA 2ADGA 5DLML 3ARFD 4QO1A 4YHYC 3MV7D 2HFEA 2D7OA 1IL1A 4MJ2A 2GT9A 4P2QD 5TFSH 1G0DA 2ITDA 4GKOA 2HMID 5I1DB 3HZKA 3IKCB 4KK8D 5KSVB 4L4TB 1GGBH 2NY2C 3L3GA 1KCRL 5FGBA 5EU3A 2R69L 4YBLB 3TA3C 2F8VA 3D39A 2OK0L 2P5EB 5CMAA 5HTSA 3HN3A 4NO2A 2P8MA 5LGHH 1VESA 3KPRD 3BAEL 3L7FA 1T21B 3W39B 1D6VL 4JPVL 5C0DB 2YD5A 1F58L 1UXWB 3ALWA 2DQJL 5D9SB 4ELMA 4YHNB 1AR1C 2AV1A 3NA9L 4FQHA 3OKNA 1D5XA 4U4BA 5TH2A 4CVZA 3HI1A 1X44A 7FABH 3WSQL 3N1QC 3B3IB 5DQ9A 4X4MA 3TYFB 4IJ3C 3RU8H 4DEPB 1ZHKB 1L9NA 2AW2A 4G7VL 4Y5XA 4DKDC 4NOFA 3U7YL 1NAKH 3MFGB 1CLYL 5ICZB 1FG2B 2BVPA 1UH2A 3MRNB 5B38G 4V2BA 1LO4L 4R6UA 1VFBA 1ZMYA 1F6AA 2R15A 2VDML 4G7YH 5KVGH 3C9NB 5IG7B 2LU4A 3FN9A 4P3DA 3OGCB 4POYA 5CEYA 5D5ME 4HWEH 1FDLL 1OT1A 2PYEE 2UWEE 4X5XA 3ARBD 4NQCE 3CVHH 2MPAL 3KPTA 1N6QL 3D0LA 4FHBD 1HZHH 3OJMB 2H1PL 4LGPB 4YIQB 2VLRB 3MGTA 4LGRB 4LEXL 5ISZD 5C0JB 4HH9B 4GOSA 3KR3L 4MX7B 5DRZA 4J4PA 4ZUWB 1IC5H 4DJMA 5IEHB 4F58L 1XZ0A 3F7QA 4XVSH 3TYFA 3MLSL 4KJPC 5EULV 2AS5M 2X4UA 3H0TB 1W0WB 4V1DB 4TSAL 4XWGH 5E08H 1AD9A 4L9LC 4WI6A 3F12A 5DD5H 1OSPH 1IGFL 5E6YA 1IEBB 4JJ5B 3MCLH 2Y07L 5F7EL 1BBJB 1KPVB 4P23C 5KSAB 2A6IA 3C6LA 4NFCA 1MCDA 1FCCA 3FT3B 2GJZB 1U92A 3BGAA 2HTLC 3RL1B 3BW9A 3C9NA 5IG7A 2AXFB 4JRXB 3OKLB 5D72H 5GPRA 2FD6L 1NKOA 2YBRB 4UNTA 3DMMC 1JWMB 3MBXL 4P99A 2JKXA 3F62A 5DJ6A 3WUWB 4NC1C 3L3JA 5C08D 4HK3J 5C0CE 2D31A 4QHNA 1OAZH 5T5FH 3QHFL 5HI4D 5IEHA 1NLDL 1O0VA 4KI5E 1S78D 4NHUB 3I02B 5BS0A 3PWNA 4RGNE 4KUCD 3EYUL 2EXYC 2QHLA 1IAKB 4NWTH 2AXGA 3HNTL 1M7DA 1XR8A 3NIGE 2X2YA 1KOAA 5CZKA 1TXKA 3BWAB 1BP3B 2LU7A 1MHEB 3F5WB 4TVPH 3RWHB 4IRZL 3RJDA 4XTRC 5IMLB 3VI3E 2K3TA 1IGIH 1BBJA 1IC4L 5KSAA 2CKBB 4BFGA 3U7AA 2YR3A 2VDRL 2NXYD 3QP3A 5B3JF 1D5ZB 4OUOA 1H0DA 2ICES 4ZFGL 3H9SA 3MLZH 1NANI 3WLBA 3AS1A 1HH6A 3OKDB 3O2DH 3DGGA 4LOUD 2WIIA 1G7PA 3VJ6A 2YA0A 1NAMA 3GSQB 1B0RA 5CJBA 5DQDL 5I1EH 3H7BB 3SCMA 2XN9B 4XAKD 5DGRA 4XMKH 5C0BA 1BWWA 1N6VA 3B9KB 3R06B 3CJJA 5DD1L 5D1ZC 4Q9CA 4D3CH 3S34L 1RMFL 1EXUA 4LSTL 3A67H 3LOWA 4N5ED 3REWB 3UCRA 4Z95L 1YN7B 4HUMB 5FM5O 2YKLH 1RVFL 4NNPH 1HILB 1ZT7A 2ZOKA 4O2FA 1DDHB 1L6ZA 4FFYH 1GGUA 1NGQH 5TDNA 3EYFA 3KYNA 4KKLD 1I4FA 3JVGC 1ND0A 3MNWA 3M8OH 4KTEH 5MI0C 4NQED 1KB9J 4HWNA 4LDEB 3RVXC 2XKNB 3DURB 3WUWG 2Z31C 3SDCB 4LCWD 2FB4L 4LKCA 4HGKC 5E4EC 3C87A 2NY0B 1E4XH 3DXAD 1DBBH 4GUPA 4PRBB 3PWLA 2NY3D 4FNLH 3TO2A 5EOTB 3TFKC 4AIOA 2N56A 5FUZH 1FGNH 2R29L 5DZOA 1T1XB 3U9PL 2I9TA 4CMHB 4ZSOE 3VFPA 4MQ7B 3MRCA 4X9GA 1HXYA 1HSAB 1W72H 1I8IA 3CSYB 4JM4H 4HD9A 3VFGL 4S10A 3TBSA 3QR2A 1BOGB 2XIDA 1CFNA 2DJUA 1JHKL 3R0MA 3VWJD 3U9UA 5C92A 3H3KA 4PP2A 2F53A 4D8PB 4LHUD 2JIXD 1UACL 2VJXA 5K9OA 4ZAKD 1CLOL 1K3IA 5FYLE 4X80L 3VFMA 4JB9L 1A14L 3HNVL 2DB8A 2ZPKL 2DMKA 1F3DJ 1OTTC 1Z2KA 4P0DA 5FUOL 4BFBD 2JJVA 3BN3B 1Z0MA 3HRZA 4CVXA 4LSUL 1S7UB 5HYJA 2JJSC 2NQCA 5DJDA 2BNRB 2Q7NA 1T5XA 3ETBF 4O58H 5EFIB 2XQYK 1A9BB 1ZVHA 3BPNB 2WW8A 1KB5L 3MA7B 4XNQB 4PRIA 3UTSA 5JW4N 1UM5H 5IGXL 5E94B 3TA3A 3RWJB 1CU4H 2MCG1 1SEBB 8FABB 4QRPE 5DFWH 1FO0A 5CIPA 4M7JL 2Y5TB 3QDMB 2C1PA 2NY6B 4XRCB 4TOYL 3VXOB 4LBEB 1U6AL 5DVNA 3MX0A 1WQVT 3CX5K 4PJHA 4IMLA 4EDXA 2XG5A 4OLZH 3NPZB 3GSRB 1I7RA 2X1OA 9CGTA 2X4NB 2EE2A 5JPMB 5E99L 4L3AA 4Y19A 4YBQC 3DSFH 3S37X 3X3GH 1RZFH 3WLWD 4PJ9A 4WGWB 4PJIB 2ATKB 4OAWB 4TTDC 3KLHD 3GI8H 3L3KB 3MYJB 1N3NA 1JGEA 2HTKD 5CGYC 2DYPB 3GMQB 4QTIH 1CI5A 4F7TA 4MDIB 2FGWH 1IAII 3ZKXB 3H8NA 2WBWB 3REVB 4HXBH 4UV4L 1BMGA 3TVMC 1UC6A 3KPPA 4HJ0C 3FQTA 3DRTA 2A6DB 4RRPG 4A6YL 1HDMB 3TJEL 4G9FE 4NQSB 4EEEA 1S7QA 1MQKH 4PJEA 3T77B 1T04B 5F9OH 5C09E 4UQ3A 1YNKL 4BFEA 2FLBT 4Z7UA 4HFWB 1DBAL 3TT3L 3TNMB 4F80A 3QEUB 4GAYA 2YPVH 2ARWA 5E4IA 1EHXA 3FFCE 4X8XA 4MNGB 1J88A 4AIXA 5DK3A 5C0FA 1A6UL 1KPUB 1WSST 1ETZA 4P4KD 2FR4A 1ODAA 1YEIL 5DMGD 2EDDA 4S0TD 4B50A 1I7UB 4L9LA 3HMXL 2QSVA 5CJOL 1G0XA 4L29B 1INQA 4XPHH 3MJ7A 5FYKD 2LQRA 5CCKL 5MERA 4P23A 2DIJA 4HLJA 4HIIA 2R0WH 5IB4B 1CYGA 1AR2A 4G6FB 4M93B 3QCTH 4IS6A 4EI6A 1JPFB 5EBWA 2VKWA 3JTTA 4MSWA 1MRDH 2FYYB 1XF2A 3S36L 3C6SB 1JRHI 2KKQA 3BYTA 4JFDA 2X89D 2GITB 3DX9A 1C5BH 3TCLB 4S1QL 1DBKH 4CVWA 2E9WA 4DZ8A 1AKJD 5DK0A 1JZ3A 5H2BA 2DIAA 4O2CB 4FTVA 1G1YA 3BQUD 5I1CH 4QRQA 3N1PC 3LKRB 3KAAA 4UIKL 1VADA 1UZ8A 2UZYB 1R6VA 4QRTB 5JOFA 1MJ8H 3OXSA 5GRVK 3WFDH 4F8QA 3DLQR 4WNQB 4GRLA 3IAQA 1F4WL 4Z7OE 3B4NA 3MRJB 1X3DA 4EJ1C 3CH1B 1ZK9A 2BRRH 3ZDZF 4OZIA 4Y4FB 2Z4QB 2BOBB 4F3FB 4JDZA 1GOFA 5AYUH 1TZGH 4LVNC 3UTOA 5CINH 4ZFOB 3IVKB 2CIIA 4KMLB 2X1XR 3WJJC 5IQ7H 3VFSA 5EOCL 1ZGLP 4APQB 1E6OH 4JO3H 3SE9L 1N64L 1CTNA 2QHRL 1Q38A 4BZ1H 1YEKL 5DEFB 3SDAB 5IW1A 4LSPH 2EC8A 5JMOC 1BWMA 2VLMD 3B43A 2HFGH 3O8XD 3U46B 1FSKC 4PJ5B 1NMBH 1MCBA 3NCYP 4OF6A 5CBAA 3WS3A 4XNMA 4ZS6C 4Y1AA 5SWQA 3QQ4B 1FC1A 5F7UA 1P4BL 4HS3B 3SDDC 3P4OA 1A7QH 4HPYH 5LAXB 4OSUL 4KPHL 5FFLA 2V17H 3QJHB 4OT1H 4J12A 3QCVH 1HQRB 2JJUA 4P4RA 3SDXA 3BO8A 3JVGA 3QNYB 2V9TA 4Y5VC 4GAGL 1XGTA 3ZDYE 1F13A 2AJUL 4M9PA 4LVHC 4BH7A 2Z31A 1RUMH 1N59B 3SJVD 1I8MB 4G8GD 1FGVL 1JWSB 3GSNB 1UGNA 4KRPB 3HRPA 4EXKA 4NWUH 3PDDA 3VA6A 5JXAH 3QXDB 2EDWA 2ENSA 3W9EB 5D5MF 4GKSB 3E6FA 1U91A 2UWEF 4P2OB 4IDJL 4OZHA 2J88L 5HHPA 2ESVD 3LCYA 1DFBL 4H8WL 4N68A 5F9JB 4EVNA 4HMEA 1IFHL 5GSRB 4H8WC 3O3BB 4NYLA 4Z8FH 4BSWB 2DM4A 4YXHH 4LCUA 4HUVA 4GS7B 3VXNA 4LPXA 4E41A 3QWOB 4ODVL 5I0DA 3MCKB 4G8FB 2YD9A 4PYHA 3S88L 2P47B 4OM1H 3LMJL 1MCEA 4KQ3L 4N0UA 4QRRE 1S5IH 5AWNL 1IZKA 2XG4A 2GCYB 4NC1E 4ZO6A 2AGJL 2ZOLA 1QVOA 1FIGH 3MV8D 5DURB 4IHOB 2F19H 4L4VB 3NACL 1ZA3B 3OR6A 3TO4C 1XMWA 3WE6A 1F4HA 4PP1D 1X7QB 3P9LA 4UDUB 4JY5L 1ZVYA 3HC3H 3QPQC 2JJSA 5FOBB 1FFQA 4PREA 2O5YH 4FTVE 4QRSB 5MENE 5L7XL 1NFIB 1LNUB 1DQJA 4JZNB 1OAUL 3BVNA 4OCWL 2JE8A 1VFUA 3RIAK 2OL3A 4ZUVB 1G7QA 5M7QA 4KKNA 3O3AB 5E6IB 4R3SB 3TBTA 1JP5A 5EPMB 5GSRA 4BQBA 4C4KO 4XCEB 1IZJA 4U3XA 2DTSA 3ZLQC 5CLWA 4M8QA 1EEYA 4ZTPL 4Y4HB 2W65A 4U6XA 3IFOB 3QWOA 3K4DA 4OUUB 1EHLL 3MCKA 3GSVA 4RAUB 1KCLA 3NIGF 1LMKA 1GC1L 3EO0B 4JRYA 2HJKB 5GGTH 3MROA 5EB9A 4XHJD 2NY5H 2GJ6B 5KJRH 5HHVL 1VPOL 4KJWD 4U1SB 4RFNB 3TGXA 2FL5B 4YFEA 5FGCB 3C08H 4OCXH 5DDHA 1A3QA 3L9RB 5D2LB 1JI2A 2HLFD 1HNFA 1SM3L 1QD0A 4RZCB 4HKJA 5D6CB 3SKNB 4M00A 3QEGL 1Z9MA 2DQDH 3FRUB 1VGKB 1AO7E 3HUJE 4Q2ZB 4KROD 5JUEH 4R3SA 4HJJL 4OLWL 3GIZH 3HAEB 2VMFA 3TVMA 3QIWD 1T7YA 3FAXA 5C07D 2JK5B 1IM3A 2CGRL 2F15A 3VXUE 3GMLA 2VERN 5GGVH 3AAZA 1T1ZB 1CXHA 3H3PL 1AE6H 4A6YA 3ARFC 3BDYL 5T1LB 4F7PA 3DVGB 3L1OL 4X7EC 1RIUH 3PWVB 3WFEL 2E6PA 4MS8D 2HMIC 5I75C 4MLIA 1JN6A 4M1CD 1CFVL 1ZWIB 3MV01 4RQQA 1WC7B 3I6LD 1TVHA 3K80A 1NKRA 2HT3C 1Q94A 2W60A 3HR5A 5GS0D 3MRHB 1HE7A 4MA7H 2MWCA 4OKVB 2Q6WB 1SY6H 1IRAY 1VEMA 2CKNA 1FFPA 1FFNB 2BVQA 4N0FB 4HBCH 1K8IB 3SKNA 3L7EA 3QUML 1IKFH 1WWCA 4O51B 4PLKD 2WWKO 1IGJB 3SE4C 3S4SA 2I9LA 1J10A 3HMXA 5EZOL 3EO1B 3T3PF 4JFFB 2FO4A 3CFKB 1JWUA 4JFZH 4FQLL 1UM6L 1XT5A 4WO4B 7CGTA 3BGFC 3QIBD 2ZCLH 4I77L 2F5BH 4NUGL 1ED3A 1YYLH 2K7PA 5DD0H 1PEWA 4CDHA 2G5BA 4K3DH 4PRHB 1WT5C 1RJZB 2QQLH 2VZTA 3H9HB 3PNWA 3MQIA 4YHZL 2HG5A 1CGUA 3MNVB 3X13A 4YUEH 1B9ZA 1BBDH 4YQXH 2RR3A 4HX1B 4YFLI 5BO1L 1MCRA 1KTRL 3O6FD 2X9YA 4PGEA 3O4OB 1BZQK 4FXKA 5E24E 4Y2DD 1LP9E 2WM0A 3HE6C 4RMVA 2YK1L 3RPIB 2YPLE 4KY1L 2P8LB 2XOTA 1BD2D 4GT7A 4GKZA 4OI9A 3VI4F 4U2ZA 2CO7B 3HI5H 4U2YA 1T7WA 2PNDA 1G6RH 4U05A 1GXEA 4FQIH 4WUKH 4LLYB 4WVRA 5GRXG 3G5VB 4TRPH 5DJYB 5DSCB 3SKMA 4KKBD 4XWOD 5GRJL 1IGTB 2YA1A 2XY1A 3B2UD 1G7HA 4M3JA 4LIQL 5KVMC 5A3ID 2EC9T 4MGXA 5C0GA 1SYSB 3BP4A 5IVZB 3WIIL 5DZNA 4JFEA 1Q9WA 1YEHL 1A0QH 3WJJA 2BY1A 3NGBC 2DQCL 4XCCL 5B4MD 1I1FB 1KNOB 2UVEA 5DVOA 2H32H 2OZ4H 3SQOL 3V5DA 3MV9B 1Y0LA 2EIEA 3QZWA 4GLRH 2BSRA 3DJ9A 1HKLL 3N1GC 1CDIA 3EJYD 3IETA 1GAFL 3WFBL 3ARQA 5FYJU 1MCCA 1J8HB 2B4CC 3O45B 3ALXA 4KXZI 2UVFA 3I75B 3SDDA 3VXME 2P43B 3PXHA 2QR0B 5TQ2H 5TQ0L 2AJVH 5I1GL 2VZ3A 1HHGA 2XQBL 4QXGH 4NFDA 3QFJD 4WI2A 2BJML 5CFHA 1P5UA 3UJTH 1S3KL 1BVLB 3W82A 3QWRD 1JVKA 2B7DT 1QPPA 3O9WC 3VFUB 3IGAB 3E3QC 2CK0H 1K85A 5T3ZH 1FZJA 1DQML 1G7MB 3VGBA 4U6VH 1YNLH 3IB4A 1DQLL 2D4DA 4PB9H 1OLLA 4PYGA 1CBVL 4HMCA 12E8H 1I1FA 1EMTH 3D18B 4QT5A 3VFNB 5HHMB 4JN1L 3HI6H 3KGRA 3BGMB 3F7YB 1A7NL 1ZA6A 4PJFA 5D8JL 4CMMB 5K59E 3GB7B 2R2BA 1PLGH 4U1LB 3GJEA 2DRUA 3T2NH 2Z91B 4Y5YC 5CBEA 2N7AA 1S7RA 5DK2A 1F00I 1NC2B 2VLLA 5EWIL 4DWHA 4FFWD 4MNQB 4GXUN 2FX7H 4MA1B 4NZUL 4EOWL 4Y4KD 5DJ0A 3DBXB 3EOBB 3PHQA 1NDGB 4NZRL 4PBWD 2EH7L 4KK5D 2BXYA 4LLQB 5ERWB 1H5BB 1J1XL 1FL6B 4CGTA 3MZGB 2EDRA 5E1AA 2GSIA 1BM3H 3UTTA 1Z9LA 3DYOA 4S1DC 2CDEB 1KG0B 4LSVL 4DKEL 2HFTA 3TO4A 4DKFL 5MHSE 2V2WA 2E8YA 1ES0A 2XWJB 3GNML 1XR9A 3DI3B 4KZEH 5BMFL 1BGXL 1R5IA 5D2NE 1VKXA 5AAWA 2VC2H 2Z93A 3IU3A 3T0EB 1Y18B 3QUYC 2A0LC 3MBEB 2VE6A 1IM9D 2XWBB 1RAMA 4YXLH 1LEIA 3ZZ1A 3DX8B 4WW1A 4JM2D 1KXTB 2DWDA 2R0KH 4MJ6A 5JW4Q 4WU7B 3P73B 5E2VH 5LJYH 1DE4B 3D25B 5BW7C 5J8OA 4OIIH 5F7LB 5FDWB 1IGCL 3IF1A 4NM4H 4UTBH 5KW9H 2XZAH 4GW1A 3W9DA 2M8XA 2NY3C 1TENA 1RFDL 1UH3A 1DP0A 3IDNA 1P5VA 4EN3B 1G7LA 4CN6A 1HI6A 1QBLH 4AMKH 1RU9H 4MXWH 2P49B 5DRXA 4G6KL 4DTGL 1ITBB 4R4BB 2HJLA 2ZG2A 1DJSA 2OSLB 5CP7B 2CJUL 2R0ZL 2AK4E 3UTQB 3MACH 2B2XH 4TQEL 1PAMA 5KTEH 2Y06L 4FQJH 3MRIA 4X7FC 1IEAA 1AD0B 5IB2B 1E28A 1YYML 4NZDA 5DRWA 3QI9D 4RMSA 2O5XL 2EIDA 1QFUL 3NN8A 2C4XA 2DS4A 2NW2B 1IKNC 3P73A 3OMZA 1MCKA 2V7HB 1J0JA 1MJUH 2WLZA 2XKUA 5AEAA 1OM3L 3U36B 5FECB 1QLFA 4UTAL 4X7TA 4OJFL 4NCC1 2W0LA 1QBAA 4L8DA 3KYMB 2V7NA 2B39A 2X10A 5GGSB 4X6BA 4XGZB 5C6PB 3FONB 1ZT1A 4ODSL 5ID0B 1UJ3C 1BJ1J 1EGJL 4GQ9H 5D5MB 5E00B 1CLZH 3NFPA 1Q0XH 2PYEB 2UWEB 4G43A 4NQCB 3BPLB 1UCBL 1G9NL 3ZDYF 4JE4B 1DEEB 2H9GA 2VXTH 2V2XB 4YGVB 1QQDA 3OKYA 5IMKA 4DZBA 3RZCB 1KCSH 3ROLA 2JCCE 1G9NC 1KELL 5J3HD 3IDYC 2EE3A 2YN3A 4H20H 3EYQC 3G08A 3IXTA 2X1QA 4XNZC 4YGAB 1GOHA 2UZXB 4XI5D 5IWLC 3BRGC 3P9MB 4L3EE 5GS3A 3VXSD 3SE4A 4JKPH 3QUMA 5IK3A 4UQ2B 5E9DD 1HEZA 4Z7NE 4OZ4B 4U31A 3V5HA 5DYOB 3VRIB 1I8KA 4X6EB 4YHOL 4HF5H 3HNSL 5T1KB 4KKCD 4KVCH 4MD4B 1Q1JH 1N0LA 2Z8SA 3KHQA 3UTTE 3FTGB 4RA0C 1E4KC 2Q3ZA 2X4SB 1RIVH 3BD5A 3RWGA 4ZOCA 4HDIA 3PL6A 4RIRB 3LN5A 3WLWC 1WT5A 1UKQA 1UZ6E 5ALCH 5IM7B 3MODH 5ITBL 1DVFB 4L8BB 4P46B 2WSKA 4FQXB 3LKPB 4C56E 3KLHC 1FNEA 2EXWD 1FRGL 2R1XB 3TJHD 5E8EA 2VO5A 5C0CB 3R4DA 1OP5K 5BVJB 3HE6A 3E6HA 2J3SA 4EUPA 1YEGH 3JV6B 4F9LC 3B5HA 3VCLB 5HGHB 4N8CH 1GGYA 5EU4B 4I0KA 4RGNB 1MIEL 1J1OL 1GVIA 5F7HA 4EDWH 5CSBA 3W2DH 3UP1A 4ETQB 3WKMH 1YA5A 1RJYB 4AENB 4MAYC 3MJ6A 3SKJH 1WBXB 1QSEA 5TE4L 5T1MB 4DVRH 4JZOB 2OTUA 4UBDD 1LQSR 3RX8A 4Y16D 4NKDA 5F88B 1ZHLB 1OAQH 1K4DA 5LBSL 4TSCH 4RFEB 4ZUUB 4EUPG 1A4JB 4X8JA 5FA3A 1FC2D 1HSBA 5FYKL 3RAJH 5CEXA 4XAWH 1HQ4A 4J8RA 2VISB 1S7TB 2X4OB 5A40E 2BOCA 4WFHD 3OKEB 4DAGH 1VACB 1F90H 5CUSL 4WI3A 1KXQE 2M2DA 2Y5EA 3GM0A 5BXFB 2NLJB 2AJ3B 2IAMC 1CL7L 3GSXA 4JG0H 2LABA 2ZUVA 2YUZA 2CLVB 4AIZB 3MV7E 3T1FB 1EHAA 4GG8B 2EDLA 4P2QE 5CD5D 3O9WA 1PY4A 2BNQD 4PJXF 3RWFA 2IGFH 5J6GB 35C8H 2BVUA 2CKBH 1JUFA 2C3XA 3PGCB 1HH9A 3FMGL 2NXZD 3BQUC 5H94A 3W0WA 5D7JC 5I16B 3STBA 3CDCA 1CICB 2YUWA 3KPRE 3DTXB 4LSRH 4ZSOB 1MWAB 3F6IA 1D6EA 1Z5LB 2DLFH 2KH2B 5E5UB 5F89B 1GGCH 4X7DC 1NMCC 4Y5YA 5HYSB 5K9QI 3OKEA 3NCCB 2OP4L 1SYVA 1CFSB 3L95A 2F54D 3HE7B 3HC0B 4BUGA 43C9A 5EO9A 1F3JB 4HPOL 1QG3A 4NQDA 4PRAB 4BELD 4M48L 3EDDA 4XP9H 1HHIB 2XRAH 1BF8A 5F3HA 3CX5J 4XXDB 1GZPB 3QUXD 4WHTA 3VGGA 4PJBF 5ETUB 1BQLL 1S7XB 4Z78B 1OAKH 3BPOB 3SOBL 3AU1B 4UOW1 3VGEA 1U8MB 2D03H 1HIMH 3VWKD 3BEWA 4R97C 1ACZA 3G6DL 3TBWA 2QKIA 3QUYA 3RVWD 1D5BA 1QUNA 4XVJH 1CGWA 2ADJB 1P7QB 3PWJA 2Y7QB 3ULUH 4HT1L 3LEXB 1LP9F 4R7NA 3UZVB 4QHMA 5BW7A 4Z9KB 3JWOH 4HG4K 4FZEH 4YFLF 1RK0A 4E0RB 1AXTL 1A3LH 4HZLB 3U4BL 4PRAA 4XNXH 5ISZE 4XB8A 1AFVH 5IT2L 4QRPB 2EDQA 1HHIA 2GK0A 4LIQE 5F3BB 1EJOH 5HGAA 3HR6A 1XCQA 1LEKB 4WWKD 3WNKA 1FLRL 2NNAB 3E8UL 3IXAA 1ZS8A 2VAAB 3EDFA 3S37L 4NKQB 2NY4D 3SO3C 4K7FB 2BVEA 1A6VH 1INDH 1EVUA 1BX2B 3HS0A 4BZ2L 3P0YH 1QBML 1V5JA 3VFVB 4XX1E 1BHGA 1CIUA 2FSEA 4PG9B 5HGDB 3MRBA 2NY1B 3PV6B 3GO1H 5J13C 4FFZH 1AQKH 2JB5L 2NR6D 4OD3L 4X7SL 1IKNA 5HGBB 2CMRL 1TTFA 4YHLH 4I3RL 5F7WC 5C08E 2A6JB 4G8EA 1UB5B 2LTQC 4RAVB 2DLHA 4L5FL 1KN4H 4YHPA 3H3BC 1MQ8A 1PQZB 4G9FB 3L6FB 4OCYH 5F21B 1UB6A 2HT4C 3B5TA 1UJ3A 4AJ0A 1QNZH 3QQ3A 2I24N 5C09B 5F1NB 3LEVH 1EGJA 4H0IA 4K7FA 4OD2A 3U2SB 3RGHA 2VLKA 2ATPA 4NQTA 5KVFH 4K71B 3FQWB 5L0QC 3G9AB 1UWEH 2EZ0D 4CRPA 5HGDA 3FFCB 4D94A 5DC4B 3UJJL 2IADA 1V3KA 3IDXH 5IWLA 2J12B 1SBSH 4RMQA 3SY0B 4RSVA 2AAVA 2ZUTA 5ELIA 2FEDD 3CFJB 5K59F 1K6QH 3NFNA 2AJSH 4FQPA 4ZOEA 4JQIL 4XBGA 4XP5L 2R56H 4P2RD 4NKIH 2DWEA 2BSSA 1PKQE 1DCLA 1E4KA 1GIGH 43CAB 3OG6B 1F11B 1KJMB 1P53A 3T8XB 4DN3H 5F6HJ 4PR5A 1QYGH 3DV6B 2NZIA 3V6ZA 4O4YH 3T0VA 3BP6A 4NRYA 5T3XL 4YHML 3L3DB 3HHRB 2NY7H 2JB6B 5ICYB 2VN4A 5L2KA 1YEJL 4LDLB 3BKCL 1LK3H 5HPMA 4NRZB 1ZEAL 3MRLA 3BSZH 3SE3A 2A83A 3QIWC 4F9LA 2L7JA 2EDTA 1B4JL 3DRQA 4NQEE 3O0RH 1M71B 2AABL 3ARDD 2SEBA 3BH9A 4RISH 4JFQA 5TJWK 5C0AD 4LCWE 4WHDA 4Q58C 5FO7A 1JTTA 3DXAE 5L2JB 5F44A 1OTSD 1QRND 3MRKB 2R4SH 4O5LL 1PJ9A 1S7SA 5EZIL 1NCBL 4MS8C 3TWCL 2HAZA 4MAYA 5I18H 1A7PL 1K5NB 5IV2A 1BLNB 3PDOA 1UWGH 3PXJA 1B0GA 1ZLSH 1JGUL 3DIFB 3MTRA 3PP4H 1FVCA 2ADIA 5IBTH 3RFZC 1CE1H 3G5YB 1EZVY 4QXTB 3LAFA 5C0RH 2AERT 1GZQB 3P30L 4PLKC 2CXKA 5ESVB 4JAMA 5FHBH 4JFOB 5GHWL 3QULA 3KLSA 4JREB 3D5OF 1EO5A 3NVQA 3QEHB 3ZDXE 3EHBC 1LGVA 4NQVB 4JLRB 4GBXB 1Z6JT 4TTGA 3ESUF 2OJEB 3QIBC 5DJXA 3MRGB 4WI9A 5GS1C 3RKDD 5F9WB 2M26A 1KBGH 1HWHB 3LZFH 4N1CA 4D0CB 3TBVA 2IAMA 1NGXB 3OAYK 2LAAA 1HHHB 1Q0YH 2Z9TA 2AJYL 4ONFH 4W70A 3PGDB 1U8KA 2D7TL 3L5JA 5J56B 1BFOB 1GGIH 1QLEH 2I5YL 3IFLL 1XGYL 8CGTA 1BLNA 4Y2DC 3CX2A 4LLVA 4L1HA 3QUZC 1INEH 1OAXL 3G6AA 3CK0L 1DLFH 1R3IL 1CGYA 5JW4M 2QSCL 5KS9E 3U4AA 2PYFB 4NHCL 4LRNH 5D7JA 5D93B 3S35X 1C7SA 2W9EH 3DX7A 1SEQL 1CGVA 4KKBC 4XWOC 4BSVA 3FOLA 4ERSH 5CAYB 4JLRA 4KJYB 4JKKA 1I9JL 1S9XB 1KTDA 2C7UA 2P5WA 1IQWH 5KG9A 3FN3A 2JCCF 5FDWA 5DA0B 1EDQA 2VDQL 1ONQA 5EORH 2DQUH 4JQVC 3KXFA 2XTJD 4KKAD 3MUGA 3QQ9D 1CG9B 3RUGA 4YDLC 3MOAL 3ZTNH 1KIRB 4OFYA 3RBGA 4YE4L 1NUDA 1BQUA 1Q8MA 2NW3A 4Z7NF 3GSWA 1TJIL 3DMMB 2D3VA 1FN4B 2L7UA 4QRRB 4X83A 4EI5C 2J2ZA 2ZP0T 1YJDL 4NN5C 3RWCA 1A6TB 5ANMA 1CFTA 1YJDC 5FYJD 3VG0H 5KN5A 3U79A 4BUHA 4AH2B 2AJZB 1UZ6F 3AREA 3TV3H 1XGPB 5JW3L 3GSNH 4HKZA 5D1XA 4BM7A 3ZE0F 1F4AA 5AAMA 3LHPL 1BZ9B 2W9DL 5MENB 4ZOAA 3X14B 3JWDH 4M7LL 5EZLB 4NO5A 4EBQH 2PR4H 1KUMA 3EYVA 2VRAA 4NP4H 3B6SB 2DBJA 1DSFH 5ID1A 4DW2H 4PGJA 3CFIC 3QISA 2ZCKH 4NZTL 4R7DA 4PV8A 4M6NH 2OL3H 2OQJB 4OV5A 4X4XB 5HHOA 3GMNA 5ACLA 5INDA 2UYLA 4F33B 1U42A 3T4AB 3MRQA 2J8HA 3EJZD 2J6EL 1X5IA 2VQ1A 3M1BB 4Q0XL 4NRXA 1S9WB 3MLRL 4G9DB 5IQ9B 3O3DB 1T03L 4PTTB 4JN2A 3RVTD 2XNAB 4C83A 5FYKE 2OXGA 3HZVA 1YMMD 2Y23A 5C0EB 4ZUSA 2LFGA 5D1ZB 4L8SC 4YDVA 5EBLB 1DZBA 4LVOC 1MAKA 3TBYB 1CL7I 4NO0D 3EOAB 4PJ8B 4U6YA 4R8WH 5ADOL 3DETC 3QWQB 2HVKB 3OZ9H 1TZHB 4RGOL 1MRCH 3FT2A 5E7FA 2WWKT 1AO7B 1M6OB 1UYWL 2ED7A 4K9EL 2R2HB 5MEPB 5A2FA 4Q6IB 4XCFH 1WAAA 4K9EC 1AI1L 1HHKB 2BCKA 1EO8L 3ROOA 3VXQB 3ZL4L 1QR4A 5E2JA 3VXUB 3O6ML 1W8NA 2A38A 3OKOB 3WIFB 1NSNL 5IB1B 3BP5A 4KTDH 5SWZD 3NZ8B 4H88L 4IOFC 4JM2C 1GGBL 5DEGB 4F2MA 3VXRA 1CXEA 2FATH 4OLVH 1IC1A 5C86A 1I8LC 2Y6SD 4U1GC 5HD8C 2VDLH 5JHDD 4I4WA 5CJ5A 2P5WE 1EBPA 1JPTH 4KJQD 5LGHL 2YXFA 4RGMC 2GQHA 2GAZA 5AZ2H 4BH8B 4D0DA 1G7JA 3EFFB 4PJ8A 5HYIA 5EO1B 3RIFF 2DD8H 2WNGA 4LCIH 4JZJC 2EDYA 3ARWA 1LEGA 4P48A 1M6OA 5ICXA 4K8RH 5JNYB 4R96B 5JZ7C 1F8TH 1Y6MR 4PJXA 4S1SH 2E8ZA 2VLME 4LCCC 3VD3A 3FO2A 3MRFA 2CLZB 4KHXH 2ZUQC 4LEOA 1YEDA 3VG9B 1RUKH 2YPKB 2H2SD 1QA9B 4KHTH 3RWIA 5L9DH 5LGKA 3D2UB 4Y2OA 3DX6A 2BC4A 3I50H 4IBLT 1U8QB 4OZGE 5DA4A 1B4RA 3BJ91 4XZUB 2XV6B 3OPZH 1SJVA 2EEBA 5E2WH 1LP9B 5DVLA 1I7ZB 4G7YL 3B9AA 1PG7X 2YPLB 5K9KA 5SWSD 4WFED 3SJVE 4G8GE 1T89C 3D85D 3LN4B 1A6AA 4HWEL 5EO1A 1GYAA 2D9CA 3SBWA 2AEPH 3BDBA 4GRWE 3C5JB 5DHYA 3CVHL 2PTUA 1U8LA 4MJIA 4IRSD 1HZHL 3W11D 4H0HB 4ZXBD 1NDMA 3P11L 3EOTH 3JWNC 2B20A 2NX5D 3ULSA 3CFDB 2EYSA 2VOTA 3MJ8A 4PJBA 2ESVE 2WK2A 3VGAC 3UYRH 1IC5L 2DQHH 1PZUB 1ORSA 3QXVA 3ZHDA 5C8JA 4XVSL 3CXHJ 3SKOB 3L3OB 1J05B 2BVOB 2A74B 1EFXD 3VFTA 3P4MB 4XWGL 5E08L 1CE6A 2YUXA 4MA3A 2ICEB 5DD5L 1OSPL 4XCNA 3T2OA 3QIBA 5GS1A 4OF0A 1KTLB 2BFVH 3Q3GB 4U1IA 3ZKMD 4GW4A 5D72L 4PLJD 4HIJB 1XF4B 4QYOA 3VXMB 3GRWL 3VD9A 2CXGA 2EXWC 2HRLA 4XMLH 1TQBC 1C1EH 4X99B 4HGWB 3QUZA 5INCB 1WJ3A 1UEYA 5T5FL 1T83A 4ZYKB 5T3ZD 4CBPA 2AI0H 1JF6A 4QOKD 3VDBA 5D1QB 5E5MB 4NWTL 1MIMH 3B2VH 4KUCF 4TVPL 4QF1B 1U58A 3LPFA 1S7VB 2WBJD 1IGIL 2HT2C 5HY9A 3ZTJG 2Q7YB 1HYSD 2CQVA 3GMRA 4GG6A 3ARSA 2O61A 1S9YB 3AFLA 1GPOL 3MLZL 4K3EL 1XIWB 4EQ2A 4JQVA 1BFVH 5JLZB 1RZIA 4OQTH 1JGVH 3BMVA 1FV1B 4ZFZA 1YY8B 2A1WH 1DLHA 5I1EL 5F7YC 3UTZB 3ZKQD 1B2WH 4EI5A 5ACMA 4AEIH 2EC9U 3A67L 1WBZB 1KLGA 1NCWH 4HCRH 3VMNA 1PZ5A 2GW5A 4X5WB 1E0OB 2APFA 3MRMA 3ZYOA 3VW3H 3V79C 5C07E 4NNPL 1W2KT 5E6ZA 4N0CD 1K9TA 5D70H 1EAPA 1U3HA 5D2NB 1I3RA 4OD1H 3Q0HA 4QNPE 1NGQL 3H6JA 1QSFA 3J8F7 4WJ5B 4IRJD 2VL4A 4KTEL 3CUPB 5C9JB 2H6PA 1NJ9B 3I6LE 4MJIE 4NKOB 4YEEA 5I17A 1LWRA 1OB1B 3UBXI 1FORH 1E4XL 2PTTA 1DBBL 3FCTB 4CL7A 4FNLL 1YQVH 4OF5A 4AEFA 1E4WL 1FGNL 2YC1B 5FUZL 5J7CC 1JF1B 1QFHA 4PGBA 3C8KA 3IDIB 2N4IA 3D39D 3U0PA 1W72L 3IDJA 3OB0H 4RNRB 3KJ6H 2WANA 1WCBA 3FHAA 4YNYA 2F74B 4X6DE 5IFJB 3W5MA 3HZMA 3QAZC 3F7RA 4XPTL 4P5KB 5J11C 2X09A 4U3CA 1P2CB 3O6KH 3I85A 5J12C 2AK4B 4L8SA 4R4FH 5D7LA 2YD4A 1UVQA 2AV7B 5AUMA 2PW2A 4MA8H 5HYEA 3ECBA 1MJJA 1H15A 1WLHA 3D3VA 4K7PX 3LB6D 4ISVA 2FH6A 3DPBA 2DLGA 2FWOA 3H42L 5GGRB 1QKZH 3ALPA 3ZDXF 3KPMB 1XF3B 2FIRT 5FDYA 5KSUB 3K2UH 1FNLA 3KNBA 3DUHA 4BYHA 4U0RB 3RY4A 4CJ0A 2FJHB 4OTXH 5EO0A 2HRPH 5B8CC 4UAOC 1BD2E 1NC4B 3UO1H 4ZS7H 3AY4C 2F8XC 1NEZA 4O58L 5DHVB 1FL5A 1U8IA 2UUDH 1FVEB 4RNRA 5FKAB 5JO5A 1CT8B 3BX7C 1HOCA 1UM5L 5F7DA 3ARYA 4PJCA 1I8LA 1F97A 5I71C 3GHEH 1T4KB 1L7TH 3KLDA 2XWTB 1CU4L 1SQ2N 3AXLB 4JG1H 4PTUA 3FRPG 2JCCB 1BF2A 3QEQB 2DJ4A 2DF3A 4N8VA 2OTWB 2VR5A 3GSOA 4ODBD 4XC3L 4J4PD 5IW6A 4JPIB 4JRWA 1AHWC 4L3EB 5EU7E 1I1AC 3RQ3A 3J7HA 4JY6B 4G8IB 3K8KA 1JHLH 2VAJA 3DSFL 4ENEC 1ZTXH 4CKVX 1CDCA 3X3GL 3MRDB 3O11B 3QO0A 4HMDA 1X6LA 1C16B 1SJEA 2UY6A 1MCJA 2HLAB 3C6LD 3GI8L 1N8ZA 3BZEA 4R2GB 2NR6C 4QTIL 4Q74A 4C56B 2XACC 2FGWL 3QPXH 4I2XA 1QSFE 3QFJE 1KJ2B 5IHLB 3RWDB 2OR7A 4HUXA 1F02I 1LK2A 1X5HA 5LG1A 3TN0B 1JYVA 5HI3D 5FM4A 5DJ8A 4NT6A 4RWHA 1MQKL 1X6NA 2E7MA 3A6BL 4PGDA 4EUPH 1JHTB 5F9OL 1QR1A 1GRWA 5CSZB 1RHFA 3S3PA 3LQZB 3BIKA 5I1LA 1E27A 1LILA 5BS0D 5C2BL 1RZGA 2QADD 3EYOA 1YUHB 2YPVL 5M94B 3O2WH 4K7PY 1A7RH 3WMSA 4P5TB 1ZLVK 4UT6L 1DQQA 1OTUC 2EZ0C 3VA2C 3H7LA 1MFNA 1AGCA 1CQYA 1WBYB 5KSAD 5CJ8A 4KDTC 5TE6H 1AC0A 4X4YB 4GXUM 5HVWA 2ITCA 2VDKH 3H9SD 4XPHL 4BFIB 5I1IL 4CAGA 2R0WL 2ZSWA 1Z3GL 3HMWH 1BIIB 2IH1B 3RNQA 1JNHA 2KZWA 3K4AA 5MP6H 3QCTL 5H35B 5DWUH 5LQBH 2G2RB 2I07A 3ULVF 5DC9B 3SCMD 3DSNA 3AS3A 1ROWA 1UCTA 4NDMA 1MRDL 5C0BD 2Q86B 1OWWA 2GK2A 3MXVH 4TNVK 2IG2H 3ZKND 5C70A 3PHSA 1C5BL 1NBZA 4NKMB 1DBKL 3KYOB 4Y0GA 3S5LB 1OP9A 3FQXA 1FL3B 3MV7B 3U0WL 3MMEA 1YN6B 1X9QA 5CD3B 1OD9A 4P2QB 4G3YH 2ED9A 5GIRB 4PJ7A 3ABZA 5C2UB 5I1CL 4E5XA 4ELKA 1ITCA 4NPYA 4FQ1H 3SPVB 1KIQA 2GKIA 5DD6A 3LSOB 2W0FA 3QCUH 2XTLA 3KPRB 3P4NA 2VDNL 3HB3C 3V8CA 2I60H 4J3UA 2BRRL 3QO1B 5TDPB 3IJHA 5HJ3B 5LCVH 3V4UH 1TZGL 3UTPD 2GSGB 4LKXA 5CINL 3PJSA 3LKOA 3DV4A 5IQ7L 5DS8A 3QXAA 3O2DA 1T1YB 5I8CB 2AXHA 4NKMA 3KYOA 4QCIA 3OF6A 4QTHA 4BZ1L 3QUKB 2HFGL 2YD7A 1NMBL 2F53D 4Z5RB 3L3IA 3TZVC 3M07A 4YK4B 3JV4B 3GDBA 2BHYA 3SPVA 4HPYL 1ZLWH 3FB5A 1VEPA 2G75A 3PF2A 2V17L 4OT1L 3V4PH 5JOEA 1LE5B 2H8PA 3QCVL 5DTFA 3WNMA 3S9DB 3NCBB 1YMHB 5D7IE 4OZGF 5GS2D 4MCZB 1EJ6A 4DGYH 5DJ2A 5F93C 3G6JF 1RUML 4KQ4L 2VZVA 5HYJD 2PXYC 5ENWB 1MWAH 3ARBB 1JPST 3UJIH 3BKMH 6FABH 3C5ZC 3S5LG 1OGTB 5JXAL 2HWZH 2NY2D 3O41B 3Q6GH 4PRID 3UTSD 5K33A 1MAMH 5BZDA 1AGEB 1B6UA 2HJFA 3TA3D 5IESH 4M6AA 3QBTB 1AIFB 1RZKH 3D69A 3FAWA 4Y8DC 5I74C 2L4OA 5GSVB 3BP7A 3EAKA 3QUKA 2EKSA 3NGBB 3VXSE 3C09B 5C9KA 2GUOB 1NCCL 1W72A 1G0YR 1N2RA 4K94H 4XP1H 5E9DE 5DC0A 5GRYA 4JO2H 2H3NB 3LDBB 3UMTA 5FYLH 2GFBA 3BE1H 5AD0A 4Z8FL 4MQXC 4YXHL 1AR1D 3MSPA 1W0VA 3PQYB 3STZB 3QQ9C 4HIEA 1J11A 3MLWH 1T7VA 2G9HA 4U1JB 4Y19D 2X9WA 1QBBA 3MLXH 3I6GB 4CUCA 4OM1L 1BAFH 4OCMC 1A47A 1TQCB 1T20A 2CR6A 4X6CA 4MCZA 4QWWC 4OLXH 4V2CB 3PHOA 5K9QG 1FIGL 4PJ9D 1WIPA 2F19L 1QSZA 1CCZA 5GZNC 5J9PB 2YHGA 1C12B 3BPCA 1R5WB 3DHMA 4G6AC 4P3WA 5FYJL 2C3HA 5LXGH 1CXLA 1BEYH 2A9MH 3QIUC 2HN7A 3HC4H 4NNYB 2O5YL 1WZLA 3AY4A 4YC2C 5E8PA 3N1FC 5BRZA 4M43H 1J1PH 4WIQA 1ADQH 1CXKA 4O2EB 1OSZA 4HAFA 3BHBA 2VB5A 2YMXH 3AMKA 4OGXL 5JW5B 3NIDE 3N9GH 4U3HA 4TVPE 3KWWA 4MD0A 1JZ8A 2MHAB 3VH8B 4F15B 1JBJA 4LLUB 1IAOA 3BH8B 1CTOA 3CFCH 3EIFA 3PQYA 3TIDA 3K1DA 2NXYB 4YDIL 3NAAH 3I6GA 3KJ4B 5JIPA 4AEHH 1QZ1A 3RTQC 3EJZC 5GGTL 1AHWA 1F6LL 1I1AA 2NY5L 3ARUA 2QQNH 5KJRL 2R2CA 2X4TB 2W0PA 4P5MA 4AM0B 3IFPB 3RGVA 3IDGA 4KJPD 4NJ9H 2NY5C 1EX0A 3TNNA 3RVTC 4LLMB 3C08L 1VDGA 2E9IA 3A6CL 5IROC 1AGBB 4YDJA 4PRNB 1PKQB 2EIZB 4WFHE 4PJDA 3ZE1E 4P23D 2PW1A 3T1WA 4MQTB 3QG6A 2DQDL 1IAIH 2V2TA 2HTLD 2A6KB 4XX1G 5JUEL 3GIZL 3N1MC 4MWFA 3GMPA 5C6WH 3ET9F 4HWZB 4OIBA 3VFOA 4DOHE 2BNQE 1R24A 4JFDD 5GGVL 2GYSA 3JV0A 1G7IB 2NTFA 2VDPH 4HEME 4NQEB 1AE6L 2APBA 1FCGA 5TGBB 1AXSA 2DLTA 3WXVH 2NPLX 4LCWB 3MFFA 1NGWB 1RIUL 4QNPF 3DXAB 4PY8J 2GHWB 2YRLA 4ZPVB 4FTVD 1DBJH 3TPUB 4D9LL 3BEVA 2EXYD 2VZ1A 1Q9KB 5JW4R 1A6ZB 4MA7L 3L5WA 5HDQL 1KLFA 1FYTA 4TVSa 2YRPA 4KRLB 2W0KA 4XTRD 4OCSH 3VRJA 2RFXA 2XZQH 2F54E 3N06B 4GRLD 5C0ND 3VH8G 3GKWH 1T6WA 2O5ZL 1CGXA 4WV1C 5HDBE 1XGRB 3VWJB 5SX4H 5CJQH 2X9XA 4GW5B 2KL6A 4LHUB 2JIXB 5BOZG 3I84A 4X6DF 2UV3A 3C8HA 1KT2B 2ZCLL 4ZAKB 2F5BL 2Z92B 3DECA 1MCOH 4AQ1B 5DD0L 3LKNA 3WBDA 4HC1L 1JRHH 4PGCB 3QDJA 2P4AB 4XP4L 2QQLL 5DFVC 4U1NA 4XVUC 3UZQA 2XPGA 2Y25A 4IEFB 2H26B 1BBDL 4YQXL 3CFEA 3KVQA 3FT4A 4UUJA 4JHZA 1WZKA 4Y1AD 5DR5H 4QXUH 4GMTH 3O3EB 1Z9SA 1K2DB 2OK0H 1I1YB 4KFZC 4BQ9A 4F8TA 1JK8B 4HBQA 4PUBL 2ED8A 3MGOA 4MCYB 3HI5L 3OKKA 5H8DA 1G6RL 1T3FA 4FQIL 4WUKL 5JXEC 5KS9B 4LNRB 3S36X 3V0AC 1YPZE 3GK8H 4TRPL 2Z31D 3JTSA 1ZLVH 3IDYB 3OX8B 3T65B 4YAQB 3QG7H 4FFVC 4ZXBC 1JPGB 4AT6B 3IAGC 2OX5A 3TFKD 1XCTB 4XHQA 4P57A 5E03A 5HHNA 2XZZA 5EZJB 3KPQA 3NH7H 3ZYJA 2QSTA 3OXRB 1UQSB 3OHXB 3WN5B 3FHQA 2OZ4L 2OI9C 2GIYA 4Q9QH 1F4YL 4I0PC 2C3VA 4ZPTA 3MLUL 3O3EA 1CDGA 1RJLA 3IRPX 3RY5A 3TIEB 4E41D 4U49A 3TZVA 2VITB 5L8KB 1UKSA 2IANA 4OZFB 2UY7A 4URTB 2AXJA 4I3SH 1BVKA 1JV5A 4LHUG 4HAGA 4PJAA 1WFOA 1OTTD 4JFYA 1IILE 5E8OB 2HA1A 2AJVL 1JGDB 3BUYB 4K3GA 4QXGL 3DUSA 4XH2A 2MPAH 1N6QH 3CFBB 3UJTL 4UB0H 5CLTA 1ZANH 4IMKC 3KPNA 3KLAB 3NABH 4OLUH 4WU5B 2CK0L 2PXYA 3KR3H 5T3ZL 4HUWB 4XBPB 4U6VL 1YNLL 1FE8H 4KAQH 4R0LC 2Q8BL 2B5IB 4PB9L 4F58H 3C5ZA 4KUZH 1UQSA 4Z0XA 1U8PA 4MNHA 12E8L 1EMTL 4JY4B 3RNKA 5FKPA 5J06A 1UXSB 1CF8H 1NGPL 3LQAH 3OJDA 2BRQA 3QA3A 3IJYA 1KACB 5FUCC 5F7EH 3TM6A 4P4KB 2BHUA 3TIEA 3P77A 3Q5OA 1WVZA 3T2NL 1BQHB 5IB5A 1J0IA 4JRYD 1NFDE 3FQUB 1HK6A 4WDIA 2EE9A 3IAPA 4QY8B 2WINA 4P2RE 4B5EA 1ZT4B 3K74B 4WENB 1QEWA 4WWID 3WS6C 1NPUA 1FZKB 4Z7WE 2X41A 1TVBA 5IMOA 3GSUB 1BM3L 4LU5L 1RURH 2Q8AL 3G5ZA 3UXFA 5BJTB 4GAJH 2IPKA 5DJCA 3GMMB 3CSBA 4TTDD 1MRFH 4IOIA 1A4KA 5CGYD 3EYUH 3QIUA 5KZCD 4LLDB 3OAUH 3GGWB 1DN0B 1AKJB 1RSFA 3TVMD 3ELAT 4IRZH 5C0AE 2YEZA 4OZFG 3RHWF 4YXLL 5GXBB 4HJ0D 5I19L 4S2SB 2VUYA 3FQNB 1IC4H 2R0KL 1QRNE 1C5CH 2BMKB 4OIIL 1S7WB 1MEXH 3MREB 5DMJB 4NM4L 4ZFGH 4BJLA 3CDGA 5CWSA 1ORQB 5IHZA 1JGLH 4B53A 5J1AA 5EC2A 2XZAL 4KVNH 1PYWB 4CW1B 1MI5A 1ZT4A 2GY5A 1V7MH 5I8EA 2ADFH 2FGZA 4U1HA 1N5AB 3GI9H 4R90L 1KEMH 5DQDH 2AEIT 4KRMB 3RTQA 2J8UA 1QBLL 4AMKL 1CDJA 2P7TA 1RU9L 4JFXA 2KBGA 4MXWL 3L5XH 5DD1H 5GGTA 1Q9OA 2R4RL 1KN2H 1RQ5A 4MJ5A 4ODTH 4LSTH 4K8RD 5IROA 4G80A 3MACL 2B2XL 5KTEL 4FQJL 4X98B 3O8XB 5DRNA 2X4RA 1NH6A 1FNHA 5GGRY 5EA0L 4JFHD 2AEQH 3C60C 3VGDA 1R5VA 2A77L 2H2PC 4PJAE 1AP2B 4CN1A 3RDTC 2ID5A 1TLKA 1JYXA 2L0DA 5FXCH 3VFRB 1J86A 4TUOB 4OZGB 1MJUL 2FB4H 1ZGLB 1KIPB 1KSRA 1MNUH 3RVVD 4LCYB 5D71H 3DARA 5I73C 5AG8A 2IPTH 3SJVB 4G8GB 1LE9B 5EBGA 1T2XA 1CGSH 4GQ9L 4NQXA 1CLZL 4OBRA 1Q0XL 3IJSA 4GRWB 1L4IA 4FQQA 5D7IF 3MNZA 4FS0A 2VXTL 3WV0A 3X11A 3IU4H 3AM8C 4LLWB 4OFVA 3INUL 1FZMA 1K3ZA 1M05A 3MLTB 1RK1B 5IVNA 1FZOB 4HKBB 3NBNA 3CMGA 1S9VB 1SY6A 1U95A 3MZTA 4OB5L 4Z76A 4OI8A 3T3ME 1MPAH 2XTJE 4WV1A 4X80H 3CSPA 2QQQA 4JKPL 1U8HA 3FQRB 2FBJH 5EN2A 1NCNA 2VLJA 1FAKT 3WEXB 1U8JA 4JFED 2CDFB 4HF5L 3CZFA 4KVCL 2ZUYA 4UNVA 4Z77B 4DEPC 1Q1JL 3G6JA 1MCPL 5ESAB 3F58H 1T66C 3V6FA 2KPNA 2VL5B 1DUYA 3WO4B 5FA4A 4MAUL 1FVDA 4R4NC 5ALCL 4Z7VA 3MV8B 3WHXB 3QXUA 1KLUA 4YX2H 5FYJE 2R23A 3VMPA 1KC5L 5TDOA 2APTA 4ORZC 4ZS6D 3ZTJH 2DTML 3GZKA 2JELH 1A02N 1S8DB 5D96B 3SDDD 3FO9A 5DUBA 3Q2CA 3M17B 2Z35A 3BZFB 3MLTA 2MSPA 3WUZA 1CZ8L 3EGSA 4N8CL 4LMQE 1YDPA 5JXEA 3RVUC 3ARGB 1G6RA 2D9QB 4TOYH 4FZ8H 2X40A 3HLAB 1MFDH 3OR7B 1U6AH 3MJ9H 1YECH 3RIFK 3W2DL 3WKML 1A1OB 2R1WB 3BZ4B 2ICCA 1FNGB 1LD9B 3N50A 5JDSB 5EIIB 1RUAH 1QRKA 4M6OH 1LO5A 4PRPA 2D0GA 2J8UE 5DHXB 3L5HA 2AKRB 1ZSDA 1MLBB 4X4ZA 5I6XB 3KS0J 2PO6A 3WFCH 3FFDA 2YUVA 1OAQL 4H1LB 4NNXA 3RI5F 4TSCL 5KSAC 5CZXD 1YMME 2X4PB 3RAJL 4I0PA 2H32A 4LAQH 2IH3B 2XZCH 4MYWB 1ZVSA 1T6VN 1P6FA 1NFKA 4H5SA 4L8CA 2DQIH 5LGJB 4KXZH 4U7SA 4DAGL 3FL7A 4K2UH 3TJEH 1F90L 3SCMC 5CHNB 3ARGA 4KROB 2HFFA 4L3CA 3UTTD 3BZDA 3QIWB 5C07B 4WFFD 1P6AB 3TO4D 1JMZA 3QFDA 5JDSA 1RV6X 4IMKA 3ZE2E 1I3GH 4PY8I 3QPQD 5SWZE 4A2MA 4QEGA 4R26H 4GKNA 2IGFL 2PUQT 1T1WB 35C8L 4R0LA 2CKBL 5GZOC 3V6OC 1R3LA 1A6UH 5CEZD 5JHDE 1IGYA 1H3TA 1MCWM 1FFOA 4B0MM 1T80A 1MLCB 1KFAH 3UBXB 4PJGA 4LSRL 5JR1H 1A2YA 5HYQB 2C4FT 3B8YA 2DLFL 4WEBH 1U8OB 4ZNCD 4YR6B 5CZVH 1JZ6A 3C5SA 2BY3A 3WD5H 1FNAA 4X6DB 2V5MA 5CHNA 1JMXA 1T0MB 1XH3B 5EBMA 3B9KC 4JKWA 5DMKA 1U93A 3WS6A 5KSBA 4XP9L 2YSSA 3BMWA 1I1CA 2XRAL 3WDJA 5HDBF 3GBNH 4H1LG 1AQDB 1EHNA 5HHQA 4MXVF 1QACA 3I6KA 2FJGA 1FJ1B 3FB6A 4WW2F 1OAKL 4QHUB 4M1GH 4XMPH 1OW0C 1A3RH 3AMLA 3O6FB 2D03L 1HIML 4FG6C 4I48B 4Y2DB 4UIKH 4HK3N 1L0QA 4LHQB 4QHKI 3SDCC 5SWSE 4WFEE 1BD2B 5E8NB 4HHAB 1MUJA 4RMUA 4G6MH 2FBOJ 4YPGB 4UU9A 3JWOL 4ZD3L 1T5WA 3ULUC 4FZEL 1IEHA 1P4LB 2J4WH 1A3LL 3JWOC 2NX5E 4XVTH 3KPSA 4HS8H 4XNXL 2LV4A 3KYKH 4J3TA 5FM8A 2IBZX 1AFVL 2RAMA 2CLRA 1CK0H 2HT3D 1VB9A 1YPZF 1V3JA 5A1AA 1EJOL 2HKFH 3EUUA 2QHRH 4ZG1A 3KYAA 3GJFB 4HFUL 1FO0L 4MD5A 5IIEA 3BXNB 3F7PC 2R1YB 2GTZA 5MEQB 2MOVA 4HS6A 1A6VL 1INDL 4HIHB 5B38A 1P7KB 2ZZUT 2GTWA 4PRDA 1P4BH 4NBYB 2KZ1B 3GO1L 3RZWA 4FFZL 3QJFA 1AQKL 5DJAB 1U9KA 1MHCA 3C60A 4N9GA 1ZHBB 3RDTA 1D9KA 1EEUA 1N0XH 3PL6D 5DHVH 5HVGB 4YHLL 2AJUH 5E2TL 4PJ9C 5IMMB 3IFNL 1PD6A 5I8OH 3PP3K 1KN4L 5I1DA 3IKCA 3QFJB 4YFDB 5KSVA 3TESA 2A73B 2VWEC 3MRPB 4L4TA 1KYOJ 1UWXK 3NTCL 5A2JH 2R0LH 1OHQA 4P59H 5DJZB 5KANI 1R0AH 5T3ZE 4OCYL 3BWUC 1FG9C 3HE6D 4QOKE 5IFAH 2P5EA 2FEEL 1JNNL 5BV7B 3MUHL 3LEVL 4BK4A 1T21A 1MCLA 3KPOB 3D9AH 4PLNC 3W39A 5C0DA 2NY6C 1E6JH 5KVFL 1RUQH 3AM8A 1I9IH 1WIUA 3KG5A 5FUCE 1IFHH 1UXWA 2P44B 5IHBA 5D9SA 1WIOA 4YHNA 1RZ8B 2YD2A 4M4PA 4H25B 1TPXB 5JIHA 3TCXA 5L6YH 1SBSL 3CCHB 3VXPB 1QSED 3STLB 4MVBC 1BECA 1U8NB 4Y4KB 3B3IA 4UNUA 2AJSL 3HPLB 4HUKB 4OLEA 3FN0H 2R56L 1JPSH 1L9MA 4NKIL 1ZHKA 3C2AH 4WHCA 4HXAL 1GIGL 5ICZA 3B83A 4JY5H 1QO3B 1FG2A 1KJ2H 1N4XH 2GY7B 3ZKXC 4DN3L 1QYGL 3MRNA 3ILQC 2ENYA 4O4YL 5L7XH 4Z7WF 3HPJB 2NY7L 2DMBA