5GGVH

Ctla-4 in complex with tremelimumab fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
225
structure length
225
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH01
2G5BB 1WAAA 3NABH 5E5RB 2ADFL 4JR9L 2R69L 1H0DA 3NFSL 2HKHL 4XPTH 4YHKL 3NBNA 4GLRI 5MHSE 5D1ZC 3DVIA 5K9JL 4O2EA 1A7NL 1JN6A 1T80A 1G1YA 4MJ2A 4D9LH 3SDAC 4YPGB 4ZO6A 4D0CA 5DJ8A 4K8RC 3GRWL 1U93A 4KRPD 4CVWA 1NPUA 2ITDB 4TSBL 3P9MB 2A6KB 1WT5C 2NXZC 1FG9C 5D6CA 5KVEH 3T4YA 3LHPH 1A21A 3MMEA 1NUNB 4XPHH 3LKOA 5DUPL 4M6OH 3KPNB 4MZ3A 1RZIA 2AEQL 2W59A 3VFRA 1E27A 4WJ5B 3VFSB 4NCDA 4FTVE 4F58L 2P45B 3DUUA 1Q9OB 4CL7A 3RAJH 1X7QA 4KDTA 3UTSE 3QCTH 4JPWL 2XACC 1I9JL 2HLFD 2XWBB 4NO0D 3V4UL 3H3BC 1SYVB 4G3YH 4Z7VE 5DYOA 4JANB 3TCLA 4U1IB 3UMTA 4KFZC 2QQLH 3RVUC 2GAZB 1CD9B 3OPZL 5BS0D 1OAQL 4WEBH 1JPTL 3HG1D 4DQOH 1IKFL 1CLZL 1FNSL 3S7GA 5D8JH 3U82B 1QKZH 3DMMB 1R3HA 5ID1B 2NZ9C 3DX6A 3O45A 4JY6A 1P4IL 1T0NB 3WN5A 4ORGB 4K07A 4U2ZA 3OKKA 3GO1L 3UXFA 4TPRH 1ZSDB 2YD1A 3IDXL 1JYWA 1U8OB 3X13B 1F4XL 1FGNL 5I30L 3GMRA 2DI7A 4FQ2H 5SWQB 5IHUH 5DHXB 4EKXA 5DDHB 1G7QA 3TNNA 1IM9A 4PLJC 5GGUB 1UC6A 5F9WB 3QDHA 1F97A 4IBLT 3STBA 4ZFOA 2PYFB 1S9VA 4JHWL 4X6CE 1T7VA 4KRPB 3QI9A 4U6VL 3W82A 3TZVC 1INQA 4NQDA 2OL3L 1QSEE 4C54A 1MVFA 2NY0D 3QUKB 1S7SA 4NO5B 1Z3GH 4ZS6D 4IRZL 2ATPA 5J56B 3QJFB 3QCVH 3F5WB 5C0BB 4JREB 1D3CA 3ARQA 2OSLA 3DXAB 4JY5H 4ERSH 2E27H 2HLAB 1CFVH 1FRGL 1TJGL 3DRTB 4NO0B 4U1NB 2BZDA 2JB6A 2GFBB 5ITFA 2YMXL 4PJ9C 4HPOH 2I27N 2R1YB 3GK8H 3CSGA 4HFWB 5GRZA 1U2CA 4OLUH 4H88L 3HG1B 1P9MC 3UJTH 3IS1X 4MQ7B 3MRPB 1XIWD 3O11B 2GCYB 1XF5B 2QJDA 3AMKA 4DGYL 2M1KA 3LV3B 3QH3A 2A6DA 4G8EA 7FABH 5F7KC 4AG4L 2DIAA 2EDEA 4Z7VF 3EGSB 2JCCA 3T0EB 5EORL 1XGQA 2J5LC 2ORBL 3SDXE 3KLAA 4HZAA 3VFOA 2X1OA 4X5XB 1YN6A 4H8WC 2H9GA 3DX7B 5JUEH 5CGYD 4ZNEA 2EDYA 5DK2B 4EN3D 3C6LD 4Q9RL 2YK1L 4MMXC 3DGGB 3DVGB 4QWWD 4MDIB 4IMLB 3T0DA 5FA3A 3QNZB 3MRCB 4Y1AE 4ISVA 4X6EB 3HE6C 1QRKA 1YY9D 1WAAE 3PWLA 3O2WL 4YUEL 3CPLA 2AXFA 2NY0B 1EZVY 2ATKA 1SJHB 4U33A 3ZHDA 2R2EA 4U1JB 3A6BL 3TESA 2HH0H 4DZBB 3MUHL 1AD9B 1G84A 3HAEH 3P4NB 3BPNC 2WBKA 5FV2A 1NUFA 5IBUB 4LHQB 2I9LA 1URLA 4X6CF 1IAMA 1BZQK 4OF8A 4HWEL 3FONA 3PGCB 2DKSA 3BZEA 1B4JL 2OS7A 4LLMB 3QUYC 1NJ9A 4ZPVB 3CFBA 5CEXA 4TUJB 1BVLB 3CVHH 2VE6B 4Z76A 3MRDB 4M6MH 4EEEA 3AU1A 1QLFB 3M17B 4OZFB 1RIVH 1ZLUK 5D7LD 1QP1A 4QOKA 4XC3H 1MRCH 3T2PA 5IFAL 2IBGA 3MJ8A 1KACB 1XIWB 2IPTL 2XQBH 3JWDH 5IHLB 3VFGH 5I74C 5DA0B 1H3VA 2DWDB 3BDXA 4HUVB 1Y0LA 3DURA 2H2SD 1C5CL 5I8KL 4LKXA 4KQ3L 1NL0L 4L3CB 1T7WA 3MZTA 4NRZB 2SEBB 5J1AB 4UAOB 1E6OH 1TLKA 4ZOAA 1CTOA 3GSOB 4F7TA 3BWAB 1MSPA 3QG6A 4EI5D 2B20A 2EH7L 4HEME 3PWUB 4ZUTB 4EN3B 6FABL 2X7LB 4YXHL 5KVDL 3V7AG 4Z7QF 1RJYB 2WAHA 2DAVA 3BT2H 1G6VK 3BO8B 3CSBA 3TO4A 4HK0B 5IK3A 1A0QH 3BYYA 3R1GL 3OGCB 1BVKA 2VDKH 3ROOA 1PSKL 3QA3A 1PKQA 3T3ME 2JELH 4WI4A 4ZPTB 5JTWA 1A3RH 3P2TA 2R4RH 1DL7L 1F00I 2Y7QA 3D39B 1ZGLP 1ORQA 1Z0MA 2GSIA 4M43L 4OD2B 4OSUL 4UBDD 1BECA 5H94A 3TT3H 2JTDA 2GK2A 4N1EA 1EJOH 2HFEA 2UZYB 4CUCA 3C9NA 4Y16C 4YQXL 1BQHB 4ZUWA 5TDNB 4XGZB 5FXCH 4P9HL 4OGZA 2BSRB 5F44A 3MACH 1RUPL 4DGVL 3VGDA 5D70L 4UU9B 1LMKA 5LBSL 3GB7B 1NMAH 1M7IB 2HKFH 2ZUQC 3BQUD 4WTZG 1RUML 3QR2A 1WAAF 1VFMA 2DD8H 4M5ZL 4NQDE 5CEZE 1NCBH 5J57B 2MNUA 4GRLA 4F7EA 1HCFX 4RFEB 4G9DA 1BIHA 2HVJA 1G9ML 4HJGB 3HI6H 5EBWA 2AI0H 1OT1A 4AENB 3NFNB 3P9WB 4NQSB 4YPGA 2AJXH 2Y5TB 4KPHH 3WJJA 2APTA 5IGXL 4XNUL 3K3QA 2AXJA 4LSVL 1BVZA 1PEWA 1FFPB 5BMFL 3FRUA 3P9MA 3D0LB 3VDAA 5C0AB 4NM8L 5FYJE 2GW5A 3K2MC 5IBLC 3OR6B 3K4ZA 1ZGLM 3AY4A 4Q7DA 2ITCB 5AAWA 4WO4C 2PR4L 5KJRH 1VFOA 4M02A 2CJUH 3S4SB 5I1JL 2XN9D 5CEZL 4KRMB 2Z8VC 4WJ5A 2DQDL 2H1PH 3VFSA 3WD5H 5C0NC 4XNYH 3FB5B 1HIML 3SGJC 3WNPA 5IB3B 1J87A 3HAEA 4GRWF 5ICZB 3K80A 3BMVA 4X99A 3V79C 1MFDH 2XWBA 1EEZB 1II4E 2BMKA 2QEJA 4O02H 3ULVH 1XEDA 4OFPA 2DF3A 3K4DA 4JANA 5FK9B 1F4YL 1KFAL 5JR1H 2GAZA 1FIGL 1FG2A 4Y4KC 2JCCE 3O9WC 1MEXH 3HA0A 4AH2B 2HWZH 2VUYA 2XTJD 3UCRA 3CVHA 3OJMB 5I16B 1T4KB 1UB5A 5D2NE 3VFPA 4BA8A 1BZ9B 4UTAH 5FYJL 4PV8B 3I9GH 3NABL 5ID1A 4EZMA 3BI9X 3MA9H 3FOLA 4XPTL 1LP9F 5EU7C 3KPLA 4YK4B 2Z9TA 5AG8A 3EBAA 3BQUB 3HPJB 4KJQD 4L1DA 3T3MF 3LDBC 2VDLH 2IPUK 3MLWL 4LF3A 2P1YA 3HMWL 3IETB 4GT7A 4D9LL 4YE4H 1MAJA 2CK2A 3X13A 5J6GA 3U7AA 5MERB 5CSGA 4X7FC 2Y6SC 4NFCA 5SWQA 4PLKD 2F15A 1SEBB 5DDHA 3ET9F 4JM2B 3PP4H 3OL2A 2EYRB 5GGUA 4FFVC 2PYFA 1MY7A 4L8DB 1BJ1H 3MV9D 3LHPL 4XPHL 5AEAA 2Z8WC 4WI8A 3RWCB 2E6QA 1TNNA 4M6OL 1FVCA 3T77A 4HAGA 4JO1L 4ELMB 3ARGD 2ZZUT 4JZJB 4KKNA 3BRDA 4OCRH 4NO5A 4G80A 5T5NG 4JB9H 4XXCA 2A74B 3RAJL 2P24B 3UBXG 3QCTL 4XX1E 4M6AA 2XN9B 3F5WA 5C0BA 5MHSD 1A7OL 3SDCD 2IFFH 4QOKE 4G3YL 5LJYH 3T08A 1OL0A 4UT9H 3DXAA 2QQLL 2Z93B 3OX8B 3OGOE 4WEBL 1XCQB 1KV3A 4DQOL 2C1OB 3VMPA 1LEIB 1MCSA 5B38G 2GFBA 1E28B 4XNXH 4A6YB 4KWUA 5D8JL 3O8XD 5D1QA 2NR6C 4HFWA 4QTHB 4WFHD 4MCYB 5J12C 5LGHH 1N2RA 1AXTH 3LRGA 4XNMA 4PRID 3D3VB 3MRPA 4S0TD 5ACMA 1ULVA 3T65B 4GW1B 2X4OB 3LCYA 4MQTB 3IKKA 4RMVA 4KXZI 4QXUH 4PJDA 3SPVA 4OI7A 2NY2D 3CK0H 1CFNB 4KK9D 5JOFB 3O3DB 3L3HB 4HS6B 1HINH 3MA7B 2C3HA 4N8VG 3UTSD 3W2DH 3T0EA 3JTSA 5DZNA 2JCCF 5E00B 2L4OA 4K9EC 4RMRA 3SGDI 2WWMC 4M8VA 4K2UH 3DX7A 1F3JB 2IQ9H 5DK2A 5BQ7A 4J23A 4PJEB 3WDJA 4FQLH 4U7MA 1X4YA 3DVGA 4MDIA 4PLNC 4IIQB 5C09B 3MRCA 3OKMB 4NBZB 2MFNA 3X12B 3MV9B 1Z3GL 4HXAH 3INUH 3F7YB 1N6VA 1KCUH 3QCVL 5I1DB 3ARGB 4OQ1A 2JJTC 4LQFH 2HTLC 5IMOA 1CK0L 3PIQA 3IYLW 4K7PL 4JY5L 3IRZA 2I07B 4WHTB 4ERSL 2E27L 1CFVL 1H9VA 3OXSB 1AD9A 5BRZE 5IFHH 2KUTA 3AREB 5DK3A 4LPTA 1NMCB 2E9WA 1LE9B 1FE8H 4HPOL 4PJIF 1Q9KB 3GK8L 3MLTB 1AO7B 1JTTA 2Z92B 4OLUL 2G5RA 4U7KA 3PGCA 4Y2DD 1ZS8A 3TN0A 3WV0A 4CU6A 4XVUC 3H2WA 5GS2H 4LLMA 3UJTL 3ZYOA 5HYQA 1IAIM 4JQIH 1A9BA 1QLFA 1CWVA 5EBGA 4WI3A 1JJUA 5F8RC 2P8PB 3MFGB 7FABL 5F96H 1S7WA 1AP2B 3DRQA 1P69B 3EJJX 3HE7D 4LPWA 1N0XH 5H37G 2DWDA 3RWDB 2VABB 1MHPH 1J1XH 1U3JA 4HIXH 5EA0H 2VYRE 5IWLA 5JUEL 4L3CA 2SEBA 3W9EB 4FQJH 2YD6A 2E3VA 3LIZH 2CLRB 4QHKI 3F12A 4FQ1H 1KTRL 3QIUC 4OJFH 1I3GH 4ZUTA 3UJIH 2LQRA 3BD5A 5JXEA 5IB5B 3GZKA 3DVNA 2HVKB 1N6QH 3BO8A 3B9KC 1I75A 2AJSH 4U4BA 3WCYA 4WY7H 5FUZH 5DVOA 2HH0L 3V95A 1F4HA 1KB5H 5E8EB 2E9IA 1QBBA 1RZKC 3D39A 1M7XA 5D2LB 4XNZC 4OD2A 3G04A 1WZLA 5IMMA 2HN7B 5KOMC 4LAJH 3HNVH 3RVXD 5FV1L 5TDNA 5J13C 4XGZA 2XZQH 3BP5B 2UZXB 2A9NL 2DS4A 4PJ8B 1K4CA 1TFHA 3TBVB 4JO3L 1S7XA 4UU9A 3CVHL 3GB7A 3L5JA 1XR9B 4M6ML 3G5ZB 1KLGB 4RAUB 1M7IA 4Y2DB 3O4OB 2PO6D 2YPVH 1RIVL 3QJHB 4XBPB 4XTRD 3BPLB 5I1EH 4XC3L 1MRCL 4UQ2B 3FO1B 3JWDL 4RFEA 3VFGL 1MI5B 1JV5B 3FKUS 2WIIB 2A83B 3CFKB 3HLAB 4AENA 3DROB 5C0BE 1CVRA 2Y5TA 1OQOA 1Q8MA 4NN7B 1E6OL 3DXAE 4Q0XH 1FFPA 1MOEA 1I9IH 1ZGLA 3D0LA 1JK8B 2DLEA 5C0AA 5T1KB 4D8PB 2I60H 1RJZB 5D7JA 4X7EC 5I8EB 4BH8B 1OGAD 2ZOKA 4OCYH 1ZVYA 1J10A 3BT2L 3TVMC 2XA3A 4DN3H 3S4SA 3M07A 1A0QL 4LPYA 3T0XA 2VDKL 4NIKB 4TTDC 4X6DB 4P2OB 4X5WB 5ICZA 2JELL 3ULUD 1EEZA 1A3RL 4PJDE 1T7XA 2R4RL 3PP3K 5HHME 3S35H 3TT3L 3MRRB 5FK9A 1EJOL 4YDKH 3T0EE 4PGBA 3PHOA 5JW3H 3NCMA 1JI1A 2B39A 3QIBC 4AH2A 1EHLL 3MACL 1BZ9A 5EDXA 3CC5A 2VDOH 4PV8A 5IEKA 2A1WH 4JJ5A 4JGMA 1NMAL 2HKFL 2GTZA 3QWOA 1I4FB 3HUJB 2DD8L 3C60D 5EPMB 4B0MM 2RAMA 1NCBL 1IAIH 4KH2A 3BUTA 1AY1L 1GRWA 4PG9B 1EK3A 3H9HA 4HBCH 3JVGA 3S96B 2PO6B 3BN9C 4Z9KB 2VXVH 1BOYA 4KGLA 3VGEA 3ZSSA 1DBBL 2BVYA 2HT4D 2AI0L 1I8IA 3ULVE 3IDYB 2C1PB 3G6AA 1HZHL 3RWGB 4G9FB 5MERA 4JPKH 4P4KC 1SEBA 3K2UL 4KPHL 1KYOJ 3E6HA 1NQBA 2YUZA 5IOPB 4JM2A 3BZ4B 4P46D 2EYRA 3FRPA 4GAGH 1GC1C 3QXAB 3LN9A 3LEYH 1ZLVH 4HIIA 2BHZA 2OJEB 1RUKH 1F5WA 2CJUL 4OTXH 2YC1A 4LCCB 1BX2B 2FLRT 2H1PL 3QIWD 5CSZB 3WD5L 5HD8C 4XNYL 2A74A 1F3DH 5CEZD 4MNQD 3K46A 4G8GD 1GGYA 1MFDL 1S7QB 4JFZH 4O02L 3ULVL 3RGVD 4MNGA 3MREB 2BVUA 3ZKXC 2D7MA 1GGUA 4M7KH 1NCDH 1MEXL 1XCQA 4K8RH 1A6TA 1WWWX 2C1OA 5MEND 2HWZL 5F89B 4GRWB 1FAIH 4IRSB 4UTAL 1I3VA 3FO9B 1MIMH 1KEGH 4A2MA 3I9GL 4M1CD 1FSKC 3L5WA 4RGND 3MA9L 1AE6H 5DJ6B 4QHMB 1MH5B 3D3VA 3AXLB 3DV4B 4GQPH 4GW1A 1LO0H 1GSMA 4D0DA 4AQOA 2CLVB 2VDLL 4MHHI 3S5LB 1CFNA 5JOFA 5CZVH 4PJDF 3ZYZA 4YE4L 1YUHB 3MA7A 4X9GA 4NKQB 2AJZB 5JHLH 4XCCH 4PYHA 3ETBF 3PP4L 3THMH 3H9SE 5L2JB 2C26A 4PJEA 3TEUA 3TO2A 2PETA 4P46B 5E9DA 4OGAC 5C09A 1K3IA 2VZSA 3IXAB 4PPTA 4WEMB 5A2FA 3OKMA 4KQ4H 3ARDD 2ESVD 4H20H 5FGRA 4OCRL 4XP6H 5EO0B 4J3XA 2UY6A 4JB9L 1LDPL 2AJ3B 5JMRA 3OR7B 5I1DA 4J4PC 3T0VA 4WGVB 4Z77B 1DUZA 3ULVF 2IFFL 3QIWB 2OTWA 4EUPB 3TNMB 4M9OA 4UT9L 2X1QA 4MNQB 4JG0H 4G8GB 1GZQB 1AXIB 3GIVB 3OXSA 1EA9C 4LOUD 1ZA6B 3RGVB 4F9PA 3AREA 4XNXL 4WHYH 4PV9B 4OLXL 4Z78A 4HKBB 3GSWB 4P3DB 4P2QD 1G7JB 1AO7A 1FYTB 1Y18B 2Z4QB 5MENB 3KYMB 1AXTL 1TVDA 3OMZA 3Q48A 2ICEB 1KLUA 4I3GA 4X98B 3KPSA 1OAXH 1C08B 3T0AA 4WW2C 2QADC 3LS5L 2PYEA 1NANI 3QEQB 4QXUL 2B7DT 5IHZA 4U6YB 3CK0L 3RNQB 2BHUA 1AP2A 1HINL 3W2DL 1ACYH 1P4LB 3O6LL 2VABA 3D18A 1NGPH 2AK4A 3ZTJG 1B0RB 3FN3A 4K2UL 5HYJB 2IQ9L 2X6MA 2LE9A 3EJZC 2QQNH 4FQLL 4UV4H 2CLRA 2FHCA 4BSVA 4L29B 4X8XA 1X5XA 5EZIH 2IAMC 2V17H 5D96B 1KB9J 2XI9A 4P23D 4HXAL 3ZKMC 2GSGB 3INUL 4ZFGH 5D1ZA 5FYLH 4LPUA 1AQDB 3ARDB 2ESVB 1G6RH 25C8H 4LQFL 3MRLB 5HYEA 5KVGH 2VXQH 1ROWA 2DQJL 4N0CC 1G7MB 3EYQD 1YYLH 3PQYB 5IFHL 3MRFA 4RFNB 5D2LA 3A67H 1UACH 4YGAB 3QQ3A 1X3DA 1J7VR 1WT5A 1E4KC 3MGOB 2HN7A 4N8PA 1A7RH 3DWTA 4MQSB 1NAMB 1S78D 5L6YH 3BP5A 4PJ8A 1CLCA 5DURD 1DDHB 4MB5A 3H3PH 2P5EA 2VDQL 4UINH 1V3JA 4JQIL 3G5ZA 1KLGA 1NEUA 2IPKB 3OAZK 2QSQA 4XBPA 1UKQA 3ARUA 5DRWB 5F96L 4UQ2A 3FO1A 3VFUA 1GAFH 2JB5H 3T1FB 2EKSB 2HP4A 5IB1B 4I48B 5EU6A 1MI5A 1S9YB 1N0XL 1QA9B 1JV5A 1YEDB 2VUOA 1N59B 4V1DB 4JFXB 3SKNB 2WIIA 3CFKA 3HLAA 1MHPL 1J1XL 1U92B 3DROA 2H6PA 3VXSD 1OQXA 2L7JA 5EA0L 1OAYH 4MNGE 5BRZD 3ZE2E 4FQJL 1EHXA 3LIZL 3EDFA 5LCVL 4FQ1L 4LU5H 3L3JB 4AIOA 5T1KA 4OJFL 1X5AA 4X9HA 1I3GL 3UJIL 1KCKA 2NZIA 2AJVH 3IFPA 1N6QL 3GI9H 2F54B 2FX9H 2XICA 4Q74A 5CFHA 3QZWG 3QPQC 4GOSA 2RR3A 4POZC 2XKSA 3LY6A 3O2DA 4JVUA 3RFZC 2AJSL 4EDXB 4IM8A 5FUZL 5ETUA 1GHFH 4P23B 2ADIA 4X6DA 2QHRH 4P2OA 1KB5L 2FDBP 1EEQA 4X5WA 4CNIA 1N7MH 4KZDL 5FHAH 5F6IB 1EV2E 5K9QI 2X4SA 4LCYA 1NDMA 4KUCF 2HT2D 3MRRA 4U1MB 1U36A 4JRXA 4KJYB 3HNVL 3ARRA 4TNVK 2XZQL 4MS8D 4JRYD 3X17A 1KNOB 3NTCL 4YBLB 3BP4B 5C08D 5ENWB 1WZMA 3B83A 3ARSA 4Y5YB 1WK0A 3PG2A 2ZCKH 2YPVL 4MX7B 2Z35B 4PD4K 4CN1A 3HUJA 5DURB 5EPMA 5I1EL 5E9DE 5C07D 3CX5K 4KV5E 4J3VA 2E7LC 3S96A 2BSTB 4WWKB 1UJ3C 2C1PA 4G9FA 2XKNA 4DWHA 3UPRB 2YS4A 3MNZB 5BV7C 2X4QB 4Q0XL 1D5MB 1VFAA 5IOPA 2EC9T 4XHQA 3PL6D 2D4DA 1LHZA 4OCMC 1AH1A 3VXSB 5BZWB 2BY1A 2I60L 4P5TB 1CXLA 1D5XB 5L9DH 3TBYA 4XAWL 4OCYL 2NXYC 1UCTA 4DN3L 3MRKB 4LCCA 4ACPA 3AC0A 2YUXA 4LIQH 3MCG1 4X7DC 5E94B 3KPSE 1CVSC 2I9TB 1NBZB 3O0RH 1RD6A 5FHBH 1QFWM 3VD9A 2PYEE 1S7QA 2FECI 3RUGB 4LKCB 4I0PC 3WNMA 4PJCF 3S35L 4LPVA 4LRNH 3PWNB 3PWJB 4YDKL 3ZE2F 3B6SB 3VG9C 1CQKA 1FJ1A 2I25N 5GGRY 2AK4E 2D31A 4IRSA 5DXWA 3FO9A 2VDOL 3VGGA 3IDJA 2A1WL 3M1BB 1WIPA 1DVFC 5HTSA 1TQCC 4JRYB 5DJ6A 2GUOB 5C08B 2YA0A 5J1TC 1IAIL 3DV4A 1GL4B 1PQZB 4HBCL 4EVNB 3W5NA 3DNKA 1A3LL 2WANA 1UWXK 4NHUB 2VXVL 3WNKA 5J3HD 8CGTA 1IBGH 1WBYB 1Z2KA 1MFAH 5C07B 3EFDH 4FQHA 2K7PA 3NOIA 1DUYB 3Q5TA 4JPKL 5CBAA 1DBAH 4ZOCA 4LASH 3CVIH 3KGRA 5D1XB 3C5ZB 3AB0C 4GAGL 2IMMA 3MBED 5L2JA 1QLRA 1TQBC 2Y06H 5D9SB 4YIQA 5C0RH 4OZHE 3PL6B 1IAKB 1RUKL 1FCGA 3ZE1E 5JA9A 4OTXL 5F21B 4BFIB 2WUBH 2HAZA 1X5FA 3NCYS 5H8DA 4XX1G 4APQC 2P5EE 4L4TD 4WI7A 4KI5D 3EAKA 4NNXA 3OR7A 1B0GB 4JFZL 2GJZB 4X8JB 1JMXA 3IGAA 4CDGC 4M7KL 5EU6E 3ULVD 1GZQA 1WUNT 1NCDL 3GIVA 3Q6FB 2G60L 4XCYB 4K8RL 1EDQA 5DVKA 1ZA6A 1AGFB 3QNXA 4LSRH 4PV9A 1FAIL 1B90A 4NNYB 1ITCA 1MIML 1KEGL 1GCFA 4OKVA 1FYTA 5I6XC 4P2CG 4FXGA 2ICEA 4PLOB 5FDYA 4Z0XB 2WP3O 1CDHA 4TUOA 5GGSY 1GGIL 1SBBA 3EYSH 1ND0A 4I2XB 4PJ7F 1LO0L 2Q87A 3VRIA 1GZPA 2FWOA 4NNPH 4U1LB 3QEQA 4JCMA 3RNQA 2C3GA 5CZVL 3VXRD 5TF1H 1T6VN 5JHLL 4XCCL 1U58A 3OQ3B 1QOKA 1B0RA 4FQCH 5HYJA 4U49A 3THML 1QHPA 2H2PD 4AZ8A 3O4LD 4JRXE 1RVFH 3EOBB 4OV5B 5E6ID 1I8LC 4OF0A 4ZFZA 4KQ4L 3KNBB 4H20L 4JKWA 4XP6L 3C08H 3BGMB 4ZTOH 1KJ3H 5JNYB 1OM3H 5DFVC 2P5WA 1MWAH 3FZUD 2DKUA 4GMTH 2Z31D 4YHYB 3HUJE 5FCSH 4AK1A 3BZFB 3O2DL 5TQ2H 3WHXA 1T1ZB 5JW5B 4PBXA 3JTTB 4L4TB 1QFWH 1BM3H 1G7MA 5ID0A 5FF6B 3TBSB 3PQYA 4P4RB 1K9TA 3NPSB 4K9EH 2ZKHH 1T66D 4G9FE 3MGOA 3B2UD 5KG9A 1D6EB 4OZHF 4L9LC 1XF1A 3H9SD 5F7DA 3ZE1F 5AG9A 3UDWC 1DDHA 1H15A 3FQXB 3HZKA 2RB8A 1UB6B 1OAXL 4MJ4A 3CDCA 5FYLE 3SGJA 4IDLA 5J4MA 4TQEH 4KZEL 5GGSB 1KLFA 3VRLE 3EOYG 5F70A 4FG6D 4MA1B 4EQ3A 1YN7B 4N9GB 4I48A 3B3IA 2GIYA 3HAEG 3LB6C 3X11B 3N1QC 3LPWA 4NSKA 1ACYL 1MCRA 1YEDA 4Y4KA 1N59A 4V1DA 3SKNA 1I85A 3RQ3A 1NGPL 5IT2H 5B8CB 3C8KB 1QPXA 1RK1A 3VXRB 1I1AC 1P7HL 5GISH 4E41D 5TDPA 4JQVC 4MD5A 4FFYH 2BNQB 2QQNL 3CFDB 1A14H 4UV4L 4YHIB 1H3XA 1OB1B 2V5RA 4Y88A 3L9RB 4O5LH 1BD2D 5EZIL 5JO5B 1AXSB 2V17L 1HNGA 2XFXB 1TVBB 2VDRH 4ZFGL 2F54A 5FYLL 5IEHB 3UO1H 5E6IB 1OTSD 4EDXA 25C8L 5IB2B 1F58H 4YGVB 3ZTNH 2R9HD 5KVGL 1PG7L 2VXQL 3BKYH 2XOTA 4X4XB 1YYLL 3B9DA 3KPMB 2FHFA 1CXIA 3A67L 1UACL 2WQ8A 3LSOA 4KJYA 1A7RL 5HHQB 2W0PA 2R39A 4KUCD 3EDJA 1EZVX 4XI5D 5L6YL 2N1KA 4Y4HC 3H3PL 5ENWA 1QPPA 5JOEA 2E5EA 4TOYH 3G08B 4UINL 4HV8B 2IQAB 4N0FA 2Z35A 1JNHB 2OR7A 4YBQC 2CLZB 1GAFL 3UEZA 2JB5L 2VLRD 3UYRH 3A6CH 5HY9B 4WWKA 1B6DA 5GSVA 4G8IB 5C0GA 1RZKH 1FORL 3RJDA 1C16B 5IP4A 3MNZA 1OAYL 5EIIB 2X4QA 2CXKA 3KYOB 1D5MA 4GS7C 4OUUB 4RQQB 4K55A 4LU5L 5IVXB 2H32H 4E41B 1JF6A 1L7TH 4G6AD 4P5TA 2X4RA 3N1GC 2AJVL 1D5XA 1MWAA 2BXYA 2MMXA 1KPVB 3GI9L 4HJ0D 2FX9L 1FYTE 4UUJA 3EJYD 1A5FH 3MRKA 4Q9QH 4LCIH 3VRLF 4PRAA 4IRJA 4KROC 1O7VA 1NGWB 4JZOB 2I9TA 1BQLH 4UZGA 2KZ1B 2QHRL 4MVBD 4GKZB 1N7ML 5FHAL 3QEQE 4HKJA 1I8KA 3G6DH 4LKCA 1CTNA 2NTFA 4PP2A 4WU7B 3NGBB 5C1MB 1CDYA 1VPOH 3PABA 5I76B 3B6SA 4QY8B 1P2CB 1O7SA 5D5MB 2FIKA 3WNOA 2VDMH 4GSDH 1R24A 5HYJE 4IOFD 3M1BA 3SY0A 1NEZB 4MAYC 2FO4A 2ZCKL 3BP6A 4PRHB 4DKAA 3F58H 3BPCB 5T1MB 5TGBA 3P73B 3GMOB 3B9AA 3SKOB 3IF1B 1J8HB 4LIQE 1PQZA 4MJIA 4EVNA 3DLQR 3OB0K 1HDMB 4NHUA 5B39A 2P5WE 2BRRH 3OAYH 4ZAKC 4NJ9H 2Y9RT 4HDIA 3CU1A 5DD3H 1A7QH 1CL7I 1M7DB 1OCWH 4JQXA 3ARVA 1DUYA 3BYTA 4RBPH 2VLRB 3PJSA 3GSQA 1V3MA 5EC1B 5IBUG 3BGFC 5CS7A 5D1XA 3C5ZA 4XVSH 4PJFB 1U2HA 3PQYE 4PRPB 3IJSB 1T83A 2P4AB 4KVCH 4L8CA 4WVRA 5GJTH 3VWJC 1PZ5A 5L9DL 4QRUB 1U8JB 3O6FB 1IAKA 1W0VA 4BFIA 3VD3A 1E6JH 4H0GA 3NIGE 1VGKA 2BOBB 4LIQL 3RNKB 2LU7A 5BVPH 1KJMB 2FEEL 3EO1A 2PW1B 4D94A 3HZVB 3O0RL 5FHBL 1R6VA 1IZJA 2WW8A 3DOSA 4LRNL 5ADOL 5EZLA 5E1AA 3FHAA 1U6AH 2C4XA 1H3PL 1OY3B 4V1DE 1AGFA 3RZCC 4LLDB 5CJQL 5CJOH 5I1LB 4I4WB 4EQ2A 1GC1H 5DMKA 4K3DH 5GGRA 1JZ8A 4PJCB 1T3FB 3QAZC 5DRNB 2UWEB 3B9KA 4Z0XA 1U8LB 4CU8A 1V8HA 5EU7E 3R8BB 1L7IH 5C0DB 4U1LA 4JDZA 3VXUE 4JHBA 2F54E 1HKLH 1IBGL 2F8OA 4WV1C 1NUDA 1MFAL 5IBTH 3EFDL 3ZSTA 2F53D 1QUNA 3DSFH 1IVLA 3LEXB 1DBAL 5I1KH 2WWKO 4AQ1B 4LASL 4UILH 3CVIL 4FFWC 3TGXA 3VXMB 3V6OA 1BQHG 1KPUB 4Z7UA 4UDUA 2V7NB 2E7MA 1H5BC 3VRJB 2Y06L 5C0RL 2EO9A 2Q76B 4XCEB 4OV5A 1K5NB 4S1DD 2WUBL 4PJGF 3SJVD 3R0NA 5DHYB 4BJLA 4ODUA 1VADA 5L88H 4P48A 2BVQB 3HI1B 4LEXH 5F1IA 2DJUA 4L4VB 1MVUA 1FL5A 5T3XH 5A2LH 5FECB 5HSFA 5JQHC 5DQJB 1T1ZA 3DJ9A 4S1RH 3MRJB 4X5LA 4U0QB 1AR2A 3DHJA 1HYSC 4AT6B 3P0VH 1FNGB 5FF6A 3REVA 4NKOB 4P4RA 5FUCC 3SDAD 3S3JA 4WRLA 4LSRL 3WLBB 3NIDE 4CADB 4K8RD 5HGHA 3S35X 1QNZH 1OW0A 5EN2B 1D6EA 3BFOA 1AHWB 4QRRA 4ELKA 4I77H 2QSVA 2JKXA 3TVMA 1IFHL 3HTLX 4FQXC 3NIGF 3DIFA 1UB6A 3EDKA 4HJJH 3RWHB 3OKOA 3EYSL 3S4SG 4NNPL 4XP5L 5DFTA 2IADB 5GGSA 3F7PC 3WUWB 2AKRB 3MR9A 1XGUA 2NY3C 5TF1L 4MLIA 4LNRB 3SDDD 4H25B 4OB5H 3NCYP 4M4PA 5CWSB 3S36H 1MRFH 2ADJB 2N7BA 1NGZA 3BDYH 4TN9A 3CUPB 3C2AH 2F53B 3C8KA 4FQCL 2V9QA 4JDVB 5HHOA 3RVUD 2DRUA 1F6AA 2NX5B 3BPOC 5BVJB 2BNQA 3LEVH 3CFDA 1BF8A 5HI3C 4YHIA 2W65B 5DMJB 1GGBH 1J0KA 1RVFL 3TBWA 5JO5A 3RVVD 3FFDB 2XFXA 1TVBA 2D03H 1YPZA 2G9HB 3C08L 2GT9A 3CCHA 4NOFA 4ZTOL 1KJ3L 1OM3L 1MWAL 2L7UA 2CRMA 5HGBB 4GMTL 1KGCE 2G2RA 1RZJH 5TQ2L 3SN6N 1ADQH 4LVOC 3TIDA 1C7SA 5EOTB 5ESQB 1U3HA 1U9KA 1QFWL 2X4NA 4MJIE 1QR4A 4HIHB 2J8UA 1IRAY 1W0WB 3QEUB 3CXDH 3VXPA 3DI3B 3BIKB 4K9EL 4Z0BL 2ZKHL 1MCCA 1RAMA 1BFTA 4LLWA 4OF6A 3FRPG 1U41A 4N0UB 1B9ZA 4H26B 3BW9B 4PLJD 1FFNB 1RV6X 3WXVL 4ZXBC 4NN5C 3ZKND 5E5MA 1RIUH 1S9XB 3G08A 1BLNB 4HV8A 4AM0B 4N0YH 3TZVD 1T1YB 4YWGH 3MUGA 4TQEL 3VFMA 1T7YA 2CLZA 2BNRB 1NFDF 1IGTA 5I8CB 4YDIH 4JFDD 3TYGH 3ARBC 5FO8B 5KSBF 3KPRA 5DVMA 5IT2L 4G8IA 2E6PA 4GBXC 1CICB 5JA8B 3H9ZA 5GISL 2X1XR 5SV3A 1C16A 3SDDB 3NIDF 3W9DA 5EIIA 4FFYL 1UKTA 1A14L 2PNDA 3HR5B 4PFEA 3UPAA 4LLYB 4RQQA 1FLRH 5IVXA 3U36B 4PJ9D 1EAPB 2Q3AA 2EXWC 1RUQH 2VDRL 1QVOB 5IW6A 4L8SB 3PDOB 1NC4D 1WBXB 5BO1L 4NHCH 3MJGX 5FYLD 2WK2A 2ZJSH 4JZOA 2IGFH 3O3BA 1AI1H 3BKYL 3UTPD 3T0WA 4GUPA 3MLXH 2ILLA 4PP1C 1VACA 3G5XA 4OIAA 1CDUA 4GG8B 5I76A 3MJ7B 5AYQA 4BH7B 1CDBA 5ILTH 1SJVA 1ZT4B 1P2CA 5C8JB 4TOYL 3V6OE 1ZK9A 4PGCB 4KK6C 4Z7UE 3RIAF 1NEZA 2M2DA 4U1GB 4PRHA 3BPCA 5T1MA 5C6WH 3P73A 1CIUA 5KSAC 3SKOA 4J4PA 5DD6B 3B8SA 3BEWB 1F4WH 3HE6D 3IF1A 1J8HA 2V5YA 4UT6H 1KJ2H 3UYRL 3A6CL 1HDMA 5F7WC 5CLTA 4Y7MA 2LAAA 2VNCA 3DYMA 4DVBB 2ARJA 4J1UB 4I18B 5L8KB 1M7DA 2IANA 3MUJA 1RZKL 3KPQA 2FEDC 1SVZA 3PXHA 4JFDB 3BJLA 2AXGA 5KSVB 4DOHB 5EC1A 1UKSA 3E3QE 4A2LA 5L0QB 1DBKH 4M93C 4W6WB 3MOBH 2ADGB 4PJFA 4PRPA 3C09B 1OGTA 1L7TL 3KYKH 2C3WA 1U8JA 4WW2A 3NA9H 3O6FA 5IVNA 4NC2B 2NY4C 4QRRE 2UUDK 3QUYD 1A5FL 1NDGB 4Q9QL 1RY7B 4LCIL 3Q6GH 3RNKA 1CG9B 1BQLL 1KJMA 2PW1A 3HZVA 5J11B 4ONHB 3RIFF 5DUBA 5F88B 3P4OB 3H0TB 4J3UA 1WCBA 3GGWB 4M5YL 1VPOL 1XZ0B 3QDGD 1P6AB 4ODTL 5IR1A 2MHAA 4MMZC 5BV7H 3IT8D 4G6FD 5K59E 4LLDA 2VDML 3PWVB 1ZLSH 4RDQF 3LKQA 1G7HB 4GSDL 4PRDB 4R96B 4KDTC 5HHOE 1SEQH 2BNQE 2BC4B 1C5DB 4RMUA 3VDBA 4OI8A 3F58L 5DRNA 3RVTC 1JPGA 1U8LA 3U30C 4E0RB 1YPZE 5C0DA 3U4EB 1J12A 2NNAA 3ZHLA 3D85A 3VD5A 1DP0A 2V5MA 4NJ9L 5HGDB 4UDTB 5DD3L 4JZNB 1A7QL 1OCWL 1FVDB 3LEXA 3S88H 3QFJD 1FBIH 3TPKA 2J8UE 1AJ7H 3WN5C 3VXMA 2R2CA 4MDJB 5K9QG 3MODH 4KVCL 1MCDA 5EBMB 4PJBF 4Y16D 4OFKA 4HUKB 3VD4A 1ACZA 4Z7UF 2H45A 1KEMH 4R6UA 2CKBB 3VRJA 3QXUA 1KBGL 5F7NC 3PWPA 4XCEA 1K5NA 2O5YH 2FRGP 3HMXH 5E08H 1FNHA 1ONQA 2BVQA 4MA3A 2OYPA 5BVPL 1FC1A 1PVHA 4L4VA 5FECA 1MELA 3QUYB 5C0IB 1PEZA 4L5FH 1OTTC 1XGYH 1LE5B 1ZHKA 4O4YL 4HKXA 3QI9C 3J8F7 1I1CA 5C0FB 4F3FB 4AT6A 1FNGA 1A6VH 1U6AL 4NKOA 2F19L 5A40E 3LZFH 2VKXA 3KPRE 4X6BB 1IZKA 5CJOL 3UROR 5IMKA 5SX4H 2ED7A 1GC1L 1UQSA 5EN2A 4K3DL 4CW1A 3JV4B 3NMEA 1JF1B 4G6FB 5HPMB 1MNUH 3L3IA 5IVXE 5JPMB 3CLEH 4CDHA 4HUMB 3FB6A 4F37F 3F7VA 5CJXA 2YR3A 4B50A 2EICA 1NCAH 1L7IL 2EIBA 2GHWB 4LMQE 4WO4D 5T3XE 4NKDB 1FL6B 2UZIH 2PXYD 3WJLA 1HKLL 3HPLA 3MRNB 5IBTL 5LAXA 3QUZC 2AKRA 3T4AB 4M7JH 2V2TA 4WDIA 5AAMA 3DSFL 3MC0A 1IC1A 5I1KL 4H25A 5EO9A 4UILL 5CWSA 1JPST 3CUPA 2Q7YB 5LXGH 2NY6C 1JGLH 5K59F 4QRTB 5TDOA 2NX5A 3QFJB 3EDDA 1IJ9A 2OR9H 3O9WD 3TLRA 3BZDA 1CGWA 2W65A 4GW4B 1T5XB 4FQIH 2B1HH 3CD4A 3MV01 1F2QA 2WLZA 3QXDB 3WKMH 5I0DA 1IC5H 1Q1JH 5L88L 4TUKH 1NLDH 2XV6B 1S8DA 2E7LA 1YPZF 4PD4J 1RQ5A 5T3XL 3I50H 1KJVA 1UJ3A 5JDJA 3CX5J 1SJEB 4E5XB 5GS1B 4KKBC 5IKCB 4XP4H 4OM1L 3QDJD 4S1RL 5EOTA 1J8HE 3VXUD 2V9TA 1W0WA 2DL2A 5CP3A 1IEBB 3QEUA 3QFDB 2J8UF 1IGFH 3BIKA 5GRXG 1DTUA 2BVPA 3CMOH 2IANE 2Y6SD 1QSVA 3MYJB 3QHTC 4Y19D 1I3RA 1QNZL 3G9VA 4YFDB 3RU8H 4G43A 4IJ3C 4N8CH 1RZFH 5J1SC 4I77L 1FFNA 2BDNH 1OD9A 2R23B 4PJFE 4UT7L 1S9XA 4HJJL 2Q6WB 4N90E 4ZMAT 5DSCB 1T1YA 4HC1H 3IDMB 3U0TA 3UTTD 4F2MB 2NMSA 5CJ5A 2BNRA 5C0CB 4X83A 5I8CA 1SQ2N 3V0AC 4OB5L 3U48A 2PXYB 2OQJA 3S36L 1MRFL 3BDYL 3NZHH 4PJXB 3C2AL 1CICA 1IC4H 1QSFB 1UXSA 5AZEH 1H8SA 4XHJC 2X70A 3LEVL 3HR5A 1AFVH 4J8RB 4M1DH 1DVFA 1GGBL 1EVUA 3MLYH 2D2OA 3U36A 3HMXA 4Z5RA 2D03L 3WFEH 1MHEA 3LKPB 1MCNA 4L8SA 5DJZB 2DQHL 1WBXA 4BK4A 4Z95H 1Q38A 2Q8BH 1RZJL 3WIHH 1ADQL 5DJXB 3S5LG 5F7MC 2YA1A 3UZQA 1YEIH 4QKXB 3V4PH 2EC9U 5F9OH 3CXDL 4NZUH 4UIMB 3QDJB 1TITA 4MJ5B 2MQ0A 2R0WH 4GXVH 4QXTA 4GG8A 4ETQB 3MJ7A 4BH7A 1A6UH 3TO4C 4MXQC 4ODSH 4RGOH 5C8JA 1QHOA 5EOQH 1HHIA 3BEVB 3VXME 5ALCL 1RIUL 4Y19B 3ARFB 4N0YL 3QO1A 4YWGL 3BH9A 1CGVA 2LVCA 4URTB 3S34H 1I8MB 1FQ9C 3PWPE 2B0SH 2D7PA 1U0QA 5DD6A 3G9AB 3BEWA 4NQTA 4QF1A 1Q72H 3K4AA 5KN5B 4YDIL 1E0OB 3TYGL 4C83B 3UTTB 4WI6A 2VLKE 3O3AB 4L4VE 3FQUB 4EUPG 3U0PB 4JFED 4I18A 3I75B 4XVJH 1A4KB 5GS0C 3RTQD 2IBBA 4KKLD 4NRYB 1YZZA 4Z7OE 3OHXB 1MJUH 4O58H 1LWRA 5EOCH 5EWIL 1FLRL 2ZSVB 4GRLC 3WEXB 3H3KA 4LP5A 5F7EH 3R0MA 3GSVB 1ZWIA 1U8MB 5I71C 1RUQL 5FM5M 4XVUD 1QBMH 2PTTA 4WW2F 3LH2H 3MV8D 2M8XA 4ZO7A 4NHCL 1WWBX 2OI9B 1NMBH 2ZJSL 2IGFL 1CG9A 12E8L 5CKGA 1AI1L 3AS1A 4Z7WF 1Q9LA 3UTQB 2WUCH 3RDTB 2PCPB 4LHUD 4ALAH 4GMSL 3AY4C 2YWZA 5HYIA 1KOAA 2VH5H 1QSZA 5JORB 4XPFH 5ILTL 5FOBB 2H8PA 3BESR 4X7CC 4BYHA 1CR9H 1I8LA 2BOCB 5DJCA 3PWVA 5D7IA 4OZIA 4LBEB 4R96A 4HC1A 4HIEB 2J3SA 4NKMA 5JIIA 1K8IA 3L3DA 1TCRB 2NX5E 4BQ6A 1C5DA 1JPSH 1RZGA 1HNFA 3QIUD 1F4WL 4UT6L 1NKRA 2CMRH 1KJ2L 5CJBA 2YPLB 4LK4A 4E0RA 3U4EA 5GHWH 5ALBH 3EZJB 2EYTA 5IQ9B 1ZHNB 3N1MC 4J7RA 4UDTA 3DMMC 4PUBH 3B8YA 2VB5A 4RRPA 2V2XB 1DBKL 4JFEB 5JIPA 3MOBL 4JDTH 5GRJH 3B5HA 3RTQB 1CE6B 4MCZB 4RGMC 3UDWA 4MDJA 4U6HB 5EBMA 5IG7A 2VN7A 3KYKL 2DIJA 3OKNB 4Y4FD 2CKBA 2GJ6B 5DRZB 3NA9L 1R3JB 4F15B 3CZFB 1Y6MR 3IDNB 5H37H 3WIHA 2DQGH 1L0QA 2FCBA 3AROA 4M6NH 3MGTB 3Q6GL 2XWJA 4NZRH 3ZYIA 4N5EC 1MAKA 5F9AC 2XZAH 3QRFM 2R4SH 1BBDH 3WHE1 1W2KT 1NBYB 3WYRA 2UVEA 3MV8B 3KXFB 4MLSA 4KMTH 1I1AA 4KRPC 4XBGA 3VFWB 1WFTA 1P4BH 2EEDA 4Z7OF 4JQVA 5C0FA 5MEOB 4F3FA 1MCQA 4LHUB 1DANT 5BV7L 4UTBH 1JHKH 3UBXA 1FC2D 4X6BA 2CRYA 1ZLSL 4XXCC 1GOFA 5E70A 1AKJD 1FNAA 5DZLA 3G6JF 5E2TH 1SEQL 3JV4A 4JREC 1A2YA 1RULH 4GXUM 4W6YB 3U0WH 3OJ2C 5GS3A 1G7LA 5JPMA 5B38A 1DBML 1X5JA 3MXWH 4NKDA 5EG6C 1A8JH 1I1YB 5ABDE 4ZUSA 1J9CT 3QIUB 3Q3GB 2AV1A 4JY4B 1SJXA 4RNRB 5GRVL 3S88L 1FBIL 1YECH 3RY5A 1MCEA 1HXMA 2Q7YA 2VKWA 3MRIB 3BUYA 1KXVC 1HILB 5HHXL 3QRGH 4Y4HA 3MODL 2QQQA 4QRTA 1KEML 1QD0A 5B3JF 3GJFH 5DD5H 3W0WD 4GW4A 1T5XA 3G5VB 3QIBD 3BKJL 3DYPA 4UQ3A 5IFJB 2DBLH 1QTYT 5E2VH 3WFDL 3HMXL 1EAJA 3U79A 3EHBC 5E08L 5DWUH 3T0EC 4Y4FB 5J7CC 5K9KB 1R5IA 2Y36H 4LCUB 5C6PB 1JBJA 5ISZA 4E5XA 4L5FL 5GS1A 1XGYL 3RWIB 3IU4H 3EW3B 1FDLH 3BN9D 3RI5F 4XPGH 2P48B 2YUWA 1Q94B 1YEHL 3LZFL 2BRQA 5KZCD 1N5AA 2VISA 1FNFA 4P4KD 1E4WL 5E5UB 1GYAA 1H8OA 2RFXB 2R1XA 4XP9H 5K9OB 4R7DA 2YBRB 2NY0C 1I3UA 3U7WH 3U4BH 3IB4A 3ROLA 3GUTA 1MNUL 4ZS6C 3CLEL 1LO2H 3FB8B 4BKLA 5DSCA 1NCAL 5SWZD 8FABA 3IDMA 1A22B 3MRBA 3U6RB 4FXKB 5EU4B 4MZ2A 4F2MA 2UZIL 3FOMB 5F1SA 4TSBH 3SKJL 3OZ9H 3BAEH 5C0CA 5JPNA 3U9UB 3QULA 5HBBA 5TE7H 2WV3A 4I8DA 1FZJB 5DUPH 4QGTA 4L3ED 3NIFF 4HXBH 4PJXA 4ESKA 5LXGL 5IQ7L 1JGLL 1QSFA 3VJ6B 5IB4A 5CZXC 1UGNA 1RZ8B 1DN0B 2J1KA 2OR9L 3LKSB 4JJHA 4J8RA 4D2NA 4FQIL 2B1HL 4YLQT 1XIWC 1OP3H 3FT2B 3AUVA 3IAPA 3HNTH 1J1PH 1QRNB 1M05A 1IC5L 1Q1JL 5D7IE 4TUKL 1NLDL 4OZIE 4GRMA 5I1IH 1OAQH 3PHQB 5DJZA 3CDFA 3I50L 4ZOBA 2C9AA 1KIRA 3TPUB 5IWLC 3VG0H 1IILE 4UAOC 5MI0B 5DJXA 3KJ6H 1JYXA 1CS6A 1BHGA 3HHRB 5B39G 1XF2B 1IGFL 4EN3C 4UIMA 5JXEC 2R1WA 5I73B 3CMOL 4MJ5A 3ZT7A 1ZEAH 4M9PA 3VWJA 1WJ3A 3RU8L 1TXKA 1KN4H 4N8CL 1RZFL 4TVSa 5T1DH 2BDNL 4O51B 4U6XB 3BEVA 4P49A 4ODWB 1YY9C 1HQ4B 4Q58C 3RPKA 3ARFA 2AJUH 3MLZH 2RCSH 4HC1L 4NZDA 4YO0B 1MRDH 3LKNB 1D9KA 1M4KA 3VGHA 4P2RA 1LK2B 5KN5A 5SWZB 4U6VH 4C83A 4DK3A 5CD3B 3O3AA 1FDLL 3FQUA 4PJAB 3U0PA 3CX2A 4LLVB 3NZHL 3TP4A 1A4KA 5GGQH 5EIQA 1JZ6A 1IC4L 4NRYA 5AZEL 1CZ8H 4RSVA 4LQ1A 3OHXA 2BCKB 3C87A 3GJFA 4PGDA 1EH9A 2D7OA 3MLVH 4L3EB 3BGAA 4M1DL 2ZSVA 3MLYL 1I7RB 3WEXA 3NH7H 4KUZH 3RP1A 3R8QA 4YHZH 3GSVA 4ZDHB 3IDIB 3TIEA 2BVOB 3WFEL 4JG1H 5A2KH 4YAQA 1FRGH 3V8OA 5E2JA 3NFPA 3QDME 1XF3B 5IW1B 3TM6A 5L2KD 4Z95L 2Q8BL 2CIKB 3WIHL 5I18L 5TQ0H 4NQEE 1F11B 2QADD 4H88H 2E8YA 5H35B 1EUUA 1HHJB 1V7NH 2V5TA 3RDTA 1YEIL 1A6PA 3V4PL 5F9OL 3F6IA 4NZUL 3FFCD 3HZMB 2DDQH 2FIRT 4GXVL 2R0WL 3EYVB 4WFGE 1NCTA 4XP1H 5IF0B 1TIUA 4OFVA 1ZT1B 1H5BA 1A6UL 5T1LB 1SYSB 3ILPB 2ED9A 4AG4H 5FOBA 2RGSA 1ITBB 4ODSL 4RGOL 4NP4H 1WIOA 1NC2D 4U05A 5DJ0A 1TZIB 2YXFA 4K94H 5D7IF 3S34L 4CVZA 1JWUB 4NT6A 4X4ME 4OZGB 2B0SL 2IAMD 1G9NC 2K9UA 5INDB 1Q72L 5J89A 2YPLA 1FVEA 5TE6H 3SGEI 3Q1SH 3B5GA 1XAUA 4WFFD 3QQ9C 5IQ9A 5KS9E 3IFOB 1T1WA 2Q7NA 4RA3A 5ISZE 2X42A 4DK6A 5GXBB 1AGCA 4M8QA 2BHYA 2ENSA 4HT1H 1MJUL 1MHHB 2V2XA 3TJEL 4O58L 5EOCL 4X4YB 2OTUA 4YK4C 2ZG3A 3V5KB 4MCZA 4M61A 4G42B 5F7EL 2X5PA 3DBXB 3BQUC 3JVGC 4RISH 3WLWC 4CRPA 1DQJA 3WIIH 3TF7C 2GJ6A 4DVRH 1QBML 3IRPX 1KPRB 3IDNA 4GW5A 3LH2L 1CFTB 5J06A 2X9WA 4R0LB 3MGTA 3DVFA 4TVPH 1NMBL 4JM2C 1UENA 2OXHA 2WUCL 1NBYA 5L2KB 1ZT7A 4QCIA 5DJDB 4CMHB 4ALAL 3KXFA 5BW7A 3VFWA 2VLKD 5C0CE 4OFYD 1KELH 2VH5L 4C56B 5MEOA 4XH2B 4XPFL 4F7PB 5DRXA 4DN4H 5CBEB 1HKFA 4IHOB 3FFCB 3PUCA 4JZJC 3I6LD 5T5NF 4Z7WB 4PJXE 2IPTH 5E8PB 1L4IA 2KH2B 5HPOA 3MV7A 1JPSL 5I2IA 2X2YA 4YJZL 1T0MA 5ANMB 4Z7NF 1A6WH 1NC2B 1SBSH 4KQ3H 2K7QA 4NO3B 1AGEA 3I6KA 1FZMB 5GHWL 4ZSOB 4POZD 5AUMB 3MFFB 1QFHA 1BP3B 1HI6A 2HFFA 1J0IA 3D1MC 3O41B 4PUBL 3ZDXE 32C2B 2IH3A 3AM8C 3MRIA 4JDTL 5GRJL 4OGXH 4P57A 1XGRB 1LNUB 3WSQH 2AGJL 1UVQB 1YNTB 2D7TH 3G5VA 5FGCB 2R8SH 4PJHA 5I1AB 5IFJA 1EFXD 2DQGL 1FH5H 4M6NL 3K74B 2CDEB 3MNWB 5K9KA 4YQXH 2DWEB 4NZRL 5JHDD 1CXFA 4CKVX 3MLPA 2XZAL 5KS9F 2R4SL 1BBDL 1DLFH 3TC9A 3RWIA 4PLKC 4KMTL 5LBSH 4YR6B 1KULA 1P4BL 4P2RE 1P7KB 3GSRB 4M1GL 5D7KD 4UTBL 1JHKL 3U2SA 3UJJL 2R56H 2JIXA 2XPGA 1WIUA 5GJSH 4XCNA 2X89D 4KHXH 1RPQA 2RFXA 4QHNA 5K9OA 2YBRA 5I17B 4LNVA 2VLMD 5FOJA 4OLEA 1FO0H 1RULL 3DPBA 3U0WL 3REWB 2DYPB 2VLJE 5SWSD 2XNAB 3I2CH 5IESL 4F7MB 2EO1A 1S7RB 4HCRH 3MXWL 2NXYD 5D93B 3U6RA 4FXKA 3VXQA 2IH1A 1J05A 2NW3B 1DN2A 3AREC 1NMCC 3OJDA 3U9UA 1CCZA 2YD5A 3T8XB 1FZJA 1YECL 3V5HB 1JFQH 3QXTA 1AC0A 2WINA 2A9MH 4FRWA 4I0PD 3BH8A 3GMPB 1VSCA 3QRGL 3VJ6A 1T2QH 3L7FB 3OSKA 1WBZA 2ZP0T 3VFVA 1RZ8A 2ZPKH 3QHFH 3LKSA 3BHBA 1S7UB 1DLHA 2YZ8A 5DD5L 1PJ9A 5F1NA 2DBLL 2IG2H 1U95B 4H1LH 5J6HA 1NEZG 1QRNA 5E2VL 5DWUL 1FIGH 3P4MB 1LO5B 2VQ1B 3BD4A 5C3LD 3KPOB 2AJYH 5J9PB 2VN4A 5K33A 2Y36L 1EFXB 3H7BA 1RZ7L 1U8PA 4HIJA 3ILQC 3IU4L 2V2WA 4LSUH 3MJ6A 2BVTA 2YPLE 5JHDB 4XPGL 3ZDXF 4LCWB 3QO0B 2GITB 4QHKJ 4F80A 4PB0H 1VEPA 2A0LC 5FUCE 1U3ZA 4LRIC 3OXRB 2YOCA 2FJFA 5HYFA 4XP9L 1G0YR 3MLWH 4NN6B 5TE4H 5C9JB 3TYFA 3U7WL 2BFVH 3U4BL 3HMWH 4O51A 5JXAH 4U6XA 3BD3A 2Y07H 5DR5L 1Z9SA 3P30H 4D3CL 2X9YA 4ODWA 3LKRB 1HQ4A 2XXCB 2BJMH 1LO2L 2WNGA 3I3DA 4YO0A 2GJ6E 3LKNA 1DQDH 3GJEA 3OZ9L 2ZUWA 3BAEL 4APQD 5SWSB 5TE7L 1X4XA 3FTGB 4O2FB 2R0LH 4PJ8C 5MEPA 4JO1H 1DEEA 3MGAA 2IALB 4HXBL 3ZDYE 1PW3A 3KXFE 4Y2DC 3P0GB 3O4OC 2BCKA 4ZYKB 4PR5B 1EXUA 3BPLC 4OBSA 1KSRA 1A7OH 1I7RA 2QLVB 3HNTL 1J1PL 4ZDHA 3RVWC 1I7ZB 1JTPA 2BVOA 3WS3B 5I1IL 1A9EA 5IJVB 3V0VA 3MV7E 4GKSB 5CEYB 4JFFA 3FHQA 3FT4B 3P9LB 3ZKQD 3VG0L 2CDFA 4NN7C 4OIBA 3WMSA 3KJ6L 4EJ1C 5FM5O 1F11A 3O6MH 2YN3A 4X7TB 2IPUG 3QWRA 1ZHBB 3I84A 3GMNB 2FJGA 3RWEB 3QZWA 2VIRB 3TBTB 1DE4A 1U8QB 1ZEAL 2B5IB 2ZOLB 5IF0A 1ZT1A 1FO0A 5FAAA 5T1LA 1KN4L 3KLHC 1SYSA 3ILPA 5I66A 3RWFA 1MLCB 5T1DL 2XKUA 3V7MA 3BP7B 1IT9H 1ORSB 4J3TA 4P2OC 4HCRA 2AJUL 3MLZL 4NWUH 2RCSL 4XWGH 1YMMD 4G6KH 1MRDL 3CSYB 2C7UB 2LAGB 4PJHE 3L7EB 1FIEA 5INDA 1CXHA 4HUWB 4RCAA 5CMAB 1P1ZB 5D4QA 5DFVD 2VXSH 3X14A 4DW2H 3IFOA 2ENYA 1CF8H 5DHVH 5GGQL 3C6SB 3RVXC 1CZ8L 3FO0H 1CFBA 3JWOC 2P46B 3MLVL 4H1LA 4R26H 2ZG1A 3NH7L 4KUZL 2HMID 4G42A 1MCOL 3R4DA 4XAKD 3S6CA 4YHZL 3DBXA 1CK0H 2PO6C 4K7PH 2R2BB 1W72B 4JG1L 1XR8B 4OZ4A 1YEJH 3NCFB 1KPRA 1WZKA 3IDYC 2FYYA 3QUZA 4LVEA 4R0LA 3KJ4B 5TQ0L 5BS0B 3WS6C 1XCTB 3WUWG 4LMQI 4XCFH 3D2UA 4PY7B 1V7NL 4PRNB 4Y5VB 5DJDA 3ZDYF 4PTUB 2DDQL 3LB6D 2F8XC 3ZDZE 5GS0H 5IW3A 4CJ1A 5IUSA 2XRAH 4C56A 4XP1L 1FGVH 4HGWA 3VA6A 4LCCC 4IHOA 5JDSB 1EIBA 1OLLA 4NP4L 1CDCA 5E8PA 4Z6AT 5GPRA 1EFQA 1YQ2A 4K94L 4WUUD 1JYVA 2CD0A 4W4NA 3MCKA 4YFLF 5DO2C 4WNQB 1ZVHA 2VAAA 5ANMA 2DQCH 4LVNB 1L0YA 4Y2OA 4TVPE 5TE6L 3QDMD 3Q1SL 3ULUC 1YMMB 1U91A 4ZSOA 5AUMA 3MFFA 4C4KO 4Q6YA 4R4BB 4NQED 4ZTPH 4IRSC 1BREA 1IMHC 3E2HB 3PGDB 4HT1L 1JGDB 1S9WB 5CLWA 3RPIB 4B53A 3MRHB 2HJFB 2ICWJ 1FZOA 3GSXB 4RISL 3WIIL 5T3ZH 1UVQA 3QXWA 1YNTA 3SCMD 1IGYB 4JN2B 4DVRL 4KK8C 1V5JA 1G7IB 1MCFA 4PJHF 4KKCD 3PV6B 2BSSB 2CDEA 3MNWA 2H26B 4TVPL 2DWEA 5JQ6H 5INCB 3STZA 1NCWH 2A9NH 4F9LA 3FT3A 4JO3H 4PGEB 5DJYA 1B3JA 4F57H 4YR6A 3CLFH 2AXHA 1R0AH 1KELL 5LG1A 2YKLH 4DN4L 1N5YH 3CXHK 2C3VB 2UYLB 1WTGT 4POUB 1HHGB 5FDWB 2OK0H 1XGTB 1B6UA 2BK8A 3DX9A 2YEZB 1P6FA 3U1SH 3QIWC 4JFQA 1JCKA 1A6WL 3GM8A 1SBSL 2CUMA 2JJUA 4LSQH 1AIFB 2WBWB 2DYPA 2EE3A 1PLGH 3F8UB 1IM3A 1IGCH 3OF6D 4F33B 3RGVC 2NW3A 1HSBA 5I0ZA 1A1MA 5DHVA 4JFFE 1D5ZA 1RFDH 2NYYD 5DJAA 1TMCB 2QL1A 3C6LB 1N3NA 3ZDZF 4OQTH 3T8XA 3SGDH 3QQNA 2PN5A 3V5HA 2G75A 2VZTA 5EU3B 4FMKA 4OGXL 4M1CC 4QRPD 1AGDB 5LGJB 3WSQL 5F9JB 1KTDB 3E6FB 1S7UA 3SDXF 2D7TL 2R8SL 4MD0B 4KJPC 5C7XH 3GMQB 2GTWA 5ERWA 1FH5L 5C9KA 3P4MA 4GG6A 3HB3C 4MAYD 3SCMB 1W72H 1ZKAA 4XMKH 1EHLH 1DLFL 1EERB 4R4NC 5E56A 2G5BA 3GMLB 2EDFA 3GSUB 4OCLC 3ZYJA 4LCWA 4NOBA 4ZAKD 3VGAB 4M7LT 2GITA 1AY1H 1X44A 5D96C 2R56L 3RKDC 4HUUB 3OG6B 5GJSL 3DARA 4KHXL 3JZ7A 3LQZB 2N56A 1A3QA 5D7LB 1DBBH 3ZO0A 3ARDC 1FO0L 1ZANH 3FQRB 1HZHH 5GRYA 4WU5B 3I2CL 3K2UH 2O5ZH 4HCRL 2ITDA 2APXA 4I9WE 4RFNC 5EUOB 4PJ5D 2BXZA 4ORZC 2A6KA 1GOGA 4ZFOL 1VB9A 5FO9B 3FTGA 3VMNA 5DUMH 5D6DC 3OKLB 3KPNA 2P8MB 1P84K 4EI5B 1JFQL 2IALA 2A9ML 4K3GA 5IV2B 1IQDB 1OLZA 1VKXB 4YDJB 1T2QL 3EOTH 1A6AB 1Q9OA 2BX5A 2ZPKL 2ICES 3QHFL 4PR5A 4C56E 4WIQA 4MNHB 3RZCD 1JHLH 1SYVA 2IG2L 1V3LA 4QRPB 4U1IA 3QB7C 3C5SB 1UWGH 2VDNL 5IJVA 4EIZC 2AJYL 1I85C 2DM4A 5CEYA 1UJTA 3FT4A 3KYAA 3P9LA 2MJWA 2VLJD 4PRBB 4IEFB 2VZ3A 5LWYH 4JFHD 5EC2B 5ANME 2N4IA 4LSUL 4ZNEE 3SE3C 4WENB 3DMMA 4X7TA 2DLHA 4ZSOE 1T0NA 3GMNA 3RWEA 4U31A 1KENH 4KAQH 4ORGA 2VIRA 4PB0L 5I1CH 4RRPG 2YSSB 1R3IH 3TV3H 4RX4D 1FYHB 3RBGA 2F8VA 2ZOLA 2ICWB 1RJCA 1ZSDA 4ZAKB 5TE4L 4OZFH 2BY0A 2BFVL 3BP7A 3AAZB 4LL9A 5JXAL 3GI8H 1U8OA 2Y07L 4P23C 4H5SB 3P30L 5JLZB 1QBAA 4NQCD 2BJML 3KS0J 3WO4B 5F6IC 5F97E 4B7IA 2FD6H 2C7UA 4KK5C 1DQDL 2VO5A 3L7EA 5FO7B 1C12B 4FA8A 2CIIB 4O9HH 4OQTA 1K8DB 4HWZB 3EYQC 4MGXA 4JHZA 2PTUA 3VXTB 1BEYH 1BMGA 2R0LL 2ZNWA 4NPYB 4YBLC 4PJ5B 3QUKA 2A6IB 1TDQA 3C6SA 5DMGC 4Y5YC 4B5EA 1S78C 2P7TB 3QJFA 4M00A 1LDPH 4I3RH 4OD1H 1HYSD 1CXKA 5K93A 1IGJB 1XT5A 4WWKC 2FX8H 2R2BA 1W72A 2HLAA 1P7QD 4NZJA 4PTTB 3DRTA 4NO0A 4U1NA 1LVEA 3K8KA 4JFPB 1VEMA 4FQXD 4OLXH 4CMMB 4YHMH 1GVIA 2R1YA 5BS0A 1XCTA 2XY2A 4ZNCD 3O6ML 2HRLA 3HG1A 5DTFB 1MF2H 2XTJB 3WUZA 1QEWB 4MQ7A 4P5TC 3O11A 5DQ9B 1PG7W 4PTUA 2NY3D 5JOPE 2GCYA 1XF5A 1QZ1A 4JHAH 1L9MA 3LS5H 3LV3A 1F3RB 4WV1B 1JRHI 3D48R 1ZE3C 1MQ8A 5L8JB 4FTVD 2WP3T 4IRJC 1IT9L 3EGSA 3V6FB 2YRPA 5HI3D 4NWUL 3O6LH 2D0FA 4XWGL 1PKQE 4G6KL 3UZVB 1HH6B 4X5XA 2XY1A 3IFNL 3KHQA 4YPJA 2MKLC 4NQCB 3ARYA 3AGVA 2PW2B 4GG6E 2VXSL 3DGGA 4DW2L 4IMLA 3QNZA 4R4BA 1CF8L 1TZHB 4X6EA 1U42A 3PGDA 4JFYB 1SY6H 4XT1C 3KPPB 1S9WA 3CSPA 3FO0L 5BJTB 2P8LB 4NYLB 3NCCB 3GFUA 3JUYA 4LCWE 1UZ6E 1ZLVK 4R26L 1SJHA 3MRHA 4U1JA 4Y89A 4DUXA 2DQJH 4Y5XB 3TA3D 4D9QE 4P59L 1HEZB 4DZBA 4BZ1H 1QR1B 1YEJL 4WW1B 4M7LH 3P4NA 1G7IA 1B2WH 4G8FB 5CJ8A 4ZXBD 3SDCB 4S1QH 4JQXC 1R5WB 3PV6A 2BSSA 4KKAD 2QSTA 1MLBB 1P7QB 1G9NH 3QNYB 1RJLB 5D1XC 4OLVH 4XCFL 5INCA 3C5ZC 2HYMA 5IM7B 4HQQH 4ZPVA 1T83C 4M03A 4RMWA 4TUJA 5FIEA 4DJMA 1BVLA 4FZEL 3O8XB 2VE6A 2VDQH 1NGXB 2AABH 3CJJA 3MRDA 5GGTA 1QSED 1XF4B 2Z8RA 5GS0L 3M17A 2XRAL 3PL6C 4FFZH 4OZFA 3ARBD 1FGVL 1DZBA 3VXOB 1S3KH 3W39B 3LRSB 4PRIB 5C2UB 2OTPA 1CGTA 4GBXD 2UYLA 1J18A 1XIWA 5LVEA 1WWAX 2DB8A 4BQ8A 5T3ZE 4LARH 1H3TA 15C8H 4JPVH 2YEZA 2NY2B 4HUVA 4FTVB 5F3HB 2DQCL 3UTSB 2X44D 2Z91B 4NRZA 5J1AA 4U1SB 2EXWD 3GSOA 3IU3B 4Z7VB 3BWAA 4G6MH 5LCVH 4F33A 1T0PB 1ZA3B 4ZTPL 3PWUA 5GRWA 4EN3A 1MCIA 1NCNA 2X7LA 1K85A 3C6LA 1S7TB 2JK5B 2V6HA 1RJYA 2D3VA 4K71B 3GMMB 4HK0A 1KN2H 1X5LA 4PP1D 2OL3B 1AGDA 3OGCA 2HJKB 3V6BR 5F9JA 1BPVA 5T3ZL 3MRQB 1CD1B 4KZDH 4U0RB 4ZPTA 1N6UA 5EUKB 5TH2B 3I02B 3AMLA 1WVZA 4XB8A 4DZ8B 4KK6D 5DGRA 4YEFA 5TJWK 1BQHA 3TA3B 2OX5A 5JQ6L 1I1RA 5HYSB 1NCWL 2BSRA 5KSAD 2HG5B 3NTCH 3V6OC 3FQNB 3IDUA 4OF3A 4XXDB 3HZYB 4F57L 4Q6IB 3CLFL 4A6YH 3L3OB 1MCHA 1PFCA 1R0AL 2IF7A 5C71A 3NN8B 1HHHB 3GSUA 2AQ2A 3MYZA 4X6CB 4Y1AD 3HCVB 2YKLL 1PY9A 1N5YL 4ENED 1WEJL 4HUUA 5HJ3B 1QSEB 1UCBH 2OK0L 1JGEB 4TSAH 3PNWB 4J3WA 4HJGA 2H3NB 4K3EH 1ZMYA 5D7LA 5CINH 4YHYC 5DEGB 3NFNA 4NQSA 1A4JB 4GBXB 3U1SL 2E7BA 4WU5A 4KI5C 2DQFB 3E3QC 4HX1B 4IS6B 4LSQL 1NANH 3HE7B 1KTLB 1PLGL 2FJHB 5E8NB 1IGCL 3RWJB 3NPSC 4LHJB 2HT3D 1RFDL 1SY6A 5B21A 3OR6A 2XG5A 4XBEH 3WFHB 5FO9A 1DEDA 1OW0C 2ITCA 4OQTL 5BS0E 5HI4D 4XAWH 3KDMB 1DBJH 2P8MA 3HG1E 4EI5A 4JKPL 3SKUD 3NPZB 1T89A 5IROC 4N9OB 3FB5A 5IB3A 4K7FB 1EBPA 3QQ4B 4MA1C 4I0CC 5C7XL 5HVHB 2CQVA 4YHPB 3C5SA 3J7HA 5HDBE 4AMKH 1Z9MA 1DR9A 3BKCH 1W72L 1EO8H 5B8CC 4XMKL 5I16A 3RVTD 1IKNC 1T4KA 3SDXB 3EO0B 4R97B 1LEGB 1EHNA 5A16B 2IBZX 4HWBH 3A6OA 4PYGA 5KSAB 1T20B 2QBWA 2H2PC 2MSPA 4U1HB 2YSSA 1QQDB 2J6EH 5M95B 3BQUA 1A3LH 2X4PB 1NFIB 2ICWA 1IAOB 3HPJA 4MWFB 4Y1AB 1ZANL 3IETA 2EECA 2P43B 2OXGA 1EMTH 4H5SA 3UAJD 4V2CB 1U3HC 3GSNB 3WFZA 2X05A 2B1AH 4BELD 5L8LB 5F3BB 3N06B 2O5ZL 4PGJA 5E4EB 1JZ4A 1ZV5A 2VL4A 1OP5H 5ELIA 2CIIA 1PYWB 1K8DA 4L8DA 4HWZA 1JN6B 1NAKH 3DUSB 5DUML 1HN1A 3RWCA 1IM9D 4ELMA 5DJ8B 4JZJA 1P5VA 3B2UC 1U93B 3QI9D 5F1OB 3EOTL 4LHUG 4G5ZH 2P7TA 4NQDD 5FYJU 4HAFA 1OGAB 2P24A 1BFSA 4LGRB 4Q2ZB 2XN9A 1CFQB 1F13A 4HULB 1QG3A 1IGJA 2FL5B 1JHLL 5D6CB 5ACZB 3MMEB 4JVWA 1OP9A 1UWGL 2Z93A 1RZIB 3BJ91 3OX8A 2G60H 3VFRB 1LEIA 4JFPA 1E28A 4A6YA 3DUUB 1UG9A 5LWYL 4CMMA 5KAQG 1HXYB 1X7QB 1SMAA 2R0ZH 1VDGA 4QTHA 4MCYA 1CFSB 1J88A 5DYOB 5FYJD 4OFIA 1OPGH 3C8DA 1KENL 4KAQL 3AM8A 4LDOB 3S98A 2ICWI 2XZZA 5DQ9A 3T65A 5I1CL 1GGIH 1R3IL 2X4OA 3TV3L 5GGTL 2GJJA 3C60B 4XRCB 4DAGH 2E7HA 3MV11 2NY6D 3O3DA 3L3HA 4HFUH 3GI8L 4M3JA 2XTLA 4HS6A 4NWTH 1YY8B 4YX2H 4ETYA 3O45B 4JY6B 2FB4H 4TRPH 4QNPE 1LP9B 3V6FA 3W5MA 2EH8H 5HDBF 1FP5A 1F2XK 5E00A 1OTSC 2LTQB 3D9AL 5LQBH 2J8HA 2FD6L 3VCLB 4BM7A 3OKKB 3D39E 1OARH 1F3JA 3NGBC 2DLIA 3G5YB 2FSEB 4O9HL 2WWKT 1MJ8H 2EDJA 1T2XA 2ZUTA 1BEYL 4JAMB 4IIQA 2BERA 4KKBD 3GMRB 4DKEH 3X12A 3MV9A 4JFYA 1BQSA 4KY1H 1I1FB 3F7YA 1G7QB 5GSRB 3KPPA 3TNNB 1IM9B 2ERJC 5BOPA 4I3RL 4OD1L 2P8LA 4KTDH 5SX5H 2ZNXA 2VERN 1S9VB 3L5XH 3ARGA 2YRLA 3O2DH 1YQVH 2BSED 1EO7A 1IE5A 1INQB 2QQKH 2FX8L 1JNLH 4WHTA 2I07A 4Y5XA 3EKCA 1QR1A 3SO3B 4WW1A 1S7SB 3SDCA 2W91A 4OCSH 5B22A 4KJWD 3HRZB 1LE9A 4YHML 1Q9KA 4HWBA 3MLTA 1RJLA 2Z92A 1MF2L 1E4XH 4MA7H 2YD7A 2ARJQ 2IC2A 5F6HJ 1JPFB 1TNMA 2J6EA 3O8XA 5C0AE 1XF4A 4XMPH 4JHAL 4RGNB 3O6FC 1QACA 1GXEA 3VXOA 3MLUH 2P8PA 4FZ8H 5ITFB 1RZJC 4KZEH 3W39A 4PRIA 3JWOH 3CNKA 1PZUB 3FAWA 2MWCA 4YHOH 4HJ0C 2APWA 3O81A 5F7YC 4QOKD 3FN9A 3RWDA 5F3HA 3UTSA 3CFIC 3FQTB 4I13B 4U1SA 3W9EA 4PGZA 5H2BB 2A6DB 4G8EB 3GSNH 4YH6A 3IU3A 3LN5B 5FKAB 1ZA3A 2JCCB 2HTKD 1X6LA 4PBWD 5IB5A 1S7TA 5KVMC 4LRIA 3VFOB 2HVKA 1SY6L 5C92A 1JWSB 1CDIA 4OUOA 1HQRB 1YN6B 5D2NB 4J12A 2H9GB 4QYOB 3GMMA 4TTGA 5JOPD 2VQUA 2WIMA 2OL3A 1A47A 2HJKA 4WI5A 1PG7H 4QNPF 5E8EA 3MRQA 3TO4D 5I9QB 1CXEA 4BZ1L 1OSPH 4ISVB 4M7LL 1B2WL 3ARXA 4BQBA 4S1QL 1AQKH 3RZWA 3GNMH 1G9NL 4OLVL 2LU4A 2HRPH 5DEFB 5C2BH 4Q97A 4TSCL 3ULUH 3TBVA 2HG5A 2R2EB 6CGTA 4HQQL 1UYWH 3FQNA 1NLBH 4LFHD 4XWOC 2AABL 3L3OA 4GRWH 1UFUA 1XR9A 4P2QB 2VSDA 4RAUA 4Y2DA 3CU7A 3NN8A 4FFZL 2YN5A 3QJHA 4X6CA 2I9LB 3HCVA 4PJIB 1S3KL 4L4JA 5GS0D 4ELME 3DGCR 3T2OA 4GQ9H 3FONB 1TJHH 1BF2A 1JGEA 1QFUH 1QLEL 3PNWA 4LARL 4XMLH 15C8L 2MCG1 1NJ9B 3BDBA 3CFBB 5CEXB 4JPVL 5DEGA 2A83A 4GRLD 4NCC1 5AD0B 2XN9E 1FORH 3AU1B 2DQFA 4HX1A 4IS6A 4D9QD 3SEPA 1Z5LB 1FN4B 3HE7A 5F9DC 2FJHA 4QOKB 1RIHH 5E8NA 4G6ML 3MJ8B 3V6ZB 7CGTA 4YDLB 5KBNC 2RQ8A 1JK8A 4D8PA 1NGQH 1RJZA 3WFHA 2ZCHH 5I8EA 1AHWC 4BH8A 4X80L 4NQUA 2DM3A 3DURB 4HBQA 4LKXB 4LSSH 1UZ8B 2XTJE 1KN2L 2XYCA 3D3VE 5CJXC 3JWNC 1EO5A 3QG6B 5EBLB 3WJLC 3PHSA 1Z9LA 1R3KB 3CGTA 5T3ZD 1WF5A 1V7MH 1P53A 2HFTA 3N1PC 4EUPH 4OI9A 1YYML 4K7PX 1Q9WB 5IK3B 3CAFA 5GRUH 3LVEA 1MJ7H 3QA3B 4A6YL 1TTFA 1QO3B 5A16A 3N85H 4PJEE 2VQTA 3QEHB 1I4FA 1T20A 4Y8DC 1YJDH 2Y4SA 5C09E 3TWCH 2HFEB 3C9NB 4U1HA 3DETD 4OLYH 3N50A 2VRAA 4PG9A 4NC0B 1UCBL 4KC3B 2XXMB 1AD0B 2PO6A 3MV9E 4H1LG 4TSAL 1NKOA 4DTGH 5FGBC 3I85A 3RIAK 4K3EL 1I7UB 5CINL 5IVOA 1WSST 3RWGA 1KB9K 4LAQH 3ALPA 5EO1B 3GSNA 3IAGC 1TZGH 2AK1L 5F3BA 3WS6A 2QSCH 2E6JA 3BZ4A 4GRLB 4NJAH 4F7EB 4JM2F 4HS3B 3KHOA 4G9DB 5I71B 2HVJB 1PYWA 1EEYB 5BRZB 2W38A 4XBEL 3QXAA 4N5ED 5EBWB 3DUSA 2OJEA 5D71H 1AO7E 1DBJL 4MA8H 1SHMA 3VWKD 1BX2A 3BSZH 4ELMF 5CSZA 2EDDA 2GKIA 1R3LB 1CD0A 1OGAA 4WFHE 3MLRH 3FRUB 1N0LA 4Q2ZA 1CFQA 3MSPA 3K8MA 2FL5A 4PRIE 5ACZA 2VAJA 4HD9A 3MREA 5ADOH 2DJ4A 4X0KB 4AMKL 4P3CL 3W11C 5C0BD 3LPGA 3BKCL 3IVKB 1EO8L 1H3PH 4JEGB 3RY4A 3MQIA 5F89A 1CICC 1IL1B 1F6LL 3RIFK 5CJQH 3DXAD 3SDDC 1CDGA 1HXYA 5DJ2B 1PX4A 3HAEB 4HS8H 4X99B 4PREB 4U3HA 2BMKB 3QHZH 4HWBL 1CFSA 3ARTA 1NAMH 4QHMA 1MH5A 3AXLA 2XIDA 5D1QD 5C3TA 1FG2B 2QTEA 1NBVL 2J6EL 3ZL4H 1XMWA 4L8SC 1BJ1J 2CLVA 2E8ZA 3CVHB 1UB5B 3C60A 4XRCA 3VFPB 4L3AA 3RVVC 3I3EA 3S5LA 1YUHA 1EMTL 1YY8A 2AJZA 2B1AL 1LP9A 2NY5C 1GH7A 1MIEL 1T6WA 3FOLB 2Y72A 3KPLB 5HHMD 2DLTA 4RGMB 3VCLA 4GJTB 5D2LE 3EHBD 3G5YA 3T0ED 2FSEA 4R4FH 2BNUB 2CUHA 1CD8A 1NAKL 4LF3B 4P2YA 4PJEF 3ARZA 4JAMA 4P46A 2EE9A 5J6GB 3IXAA 5EO0A 4KV5F 2P44B 3HC3H 5FCUH 2XQYG 1I1FA 5GSRA 4G5ZL 1R5VB 4U1GC 2AJ3A 2LFGA 1EGJA 3ZKNC 1ZHLB 3CXHJ 3U83A 3VWKB 2YD9A 4Z77A 4MXVE 3QIWA 4EUPA 2DJSA 3UX9B 3WDHA 3TNMA 1A1OB 5MEQB 3VW3H 1FVCB 4MNQA 3T77B 1MI5E 4G8GA 3MX0A 4ODXB 4I18C 3RGVA 4G80B 1C5BH 3GHBH 3HRZA 4HKBA 1MFNA 1ED3B 3GSWA 4P3DA 5L0QC 1G7JA 2R0ZL 1Y18A 2Z4QA 5MENA 2GK0B 3KYMA 1MCLA 1IFHH 1OPGL 3E8UH 3C09C 1JPFA 4X98A 1FPTH 3T3PE 1C08A 4UNTA 3TT1L 3TN0D 4XP5H 4LDEB 4M7ZB 4DAGL 4U6YA 5D1QB 4BFEA 3C8HA 4HFUL 1BFVH 1FLTX 4NKIH 4NWTL 5CZXD 4YX2L 1IEHA 4TRPL 2FB4L 1N2RB 3DYOA 2EH8L 5J11C 1P4LA 3BN3B 4XNMB 4X6DE 4F37K 5I19H 5LQBL 5DK0B 4Z7QE 3FQTA 3MNVB 1OARL 3OAYK 3HC4H 5H2BA 3D25B 4G7YH 1MJ8L 4PJDB 1IGMH 3SPVB 3LN5A 4RBPK 4L29A 5FKAA 1CL7H 5HHMB 4L1HA 2AW2A 1GOHA 2CK0H 4DKEL 2RBLA 3KLDA 3MBEB 5T5FH 3JTSB 4Q9BA 4KY1L 2GSGA 1JWSA 2FR4B 1HQRA 5D2NA 5GZNC 4QYOA 4KTDL 1ES0B 3W81A 3L5XL 3EZ8A 1AQDA 3ARDA 2ESVA 5BQ7B 5JXED 3PXJA 1YQVL 3CFEB 3MRLA 3QP3A 1BGXH 2QQKL 1JNLL 2IEPA 1WZ1H 4RA0C 3B9EA 3LD8B 4ZS7H 4OBRA 4OCSL 1Q0YH 3ESVF 4Z0BH 5E03A 2EC8A 1EEUA 5D2LF 4OCXH 2FO1A 2W92A 4CBPA 3U7YH 2FECL 1NAMA 4NC1C 5DEFA 5D6DA 3D39D 1E4XL 3WXVH 4MA7L 1OVZA 5IMOB 3PIQB 3LQAH 1V3KA 4P2QA 2W0FB 4AEIH 1GIGH 4XMPL 2IPKA 1P84J 4PJIA 1VFUA 3MLUL 4YC2B 1IARB 4FZ8L 5DRWA 1B0WA 3JWOL 4MXVF 4MYWB 3T1FA 3UTZB 2EKSA 1DQQB 3VH8B 5IB1A 3TN0B 1ZS8B 1S9YA 4YHOL 2WQRA 1QA9A 3IJHB 1T2JA 1TCMA 1VESA 1B88A 1OGAE 4OF5A 4JFXA 5DEZA 3SQOH 5F8QC 1U92A 1Z9OA 1OTUC 5AD0A 5HYQB 5B4MC 4FS0A 1A9BB 1UM6L 4TULH 1Z5LA 1FN4A 3VFNB 3GSNL 5A3IC 3SE3A 1S7WB 3V6ZA 3DRQB 3ULUE 3L3JA 3SBWA 2NCMA 5HHPB 4BFBD 3H42H 3O4LB 4GRWE 3T3PF 4GAJH 3WFBH 2DOCA 1JGVH 5DZOA 5C0AD 3V9FA 2EDBA 1UZ8A 5BO1H 4HLZH 5D7JD 2EIZB 4HZLB 4P23A 5JZ7C 3EOAB 5C70A 3F12B 5SV4A 5EBLA 4ZUUB 2Z31B 4X6DF 1OSPL 4FOMA 3JV6B 3VE0B 1R3KA 1IQWH 2WLYA 3DVNB 1AQKL 3LMJH 4U1MA 5TPWH 3GNML 1WFNA 1KCVH 1LP9E 4ONFH 1Q9WA 3BMWA 2HRPL 4JGJA 5C2BL 2WBJD 3ULUL 1KNOA 3BP4A 1UYWL 1NLBL 4GKNB 2E9BA 5GS2D 1QO3A 4EOWH 4Y5YA 4OCWH 2Y23A 3QEHA 3QQ9D 4U3CA 4MX7A 4J3OC 3H9SB 3G04B 4OM0H 2ZUVA 5IMMB 3HUJF 2PTVA 4GQ9L 4NUJB 1TJHL 1AD0A 1QFUL 2BSTA 2VR5A 2VTFA 1K4CB 4KMQA 4YHNB 4XMLL 1S7XB 1I7UA 4N5UA 5GS1C 3F6LA 4U6TA 3EIFA 4BK5A 5EO1A 3WLWD 3UPRA 5CZKA 5GZOC 1RIHL 4MNQE 4G8GE 4X9IA 5AZ2H 1T5WB 4HS3A 3VXSA 5BZWA 1JIBA 1NGQL 1LGVA 1EEYA 5BRZA 2ZCHL 2UY7A 4JM2D 4UB0H 2EXYC 1TTUA 4N0RA 1RMFH 5MENE 1BD2B 4LGSB 4LSSL 3DSNA 1T7ZA 1R3LA 5E94A 2HFGH 3EFFB 4TNWF 1NBZA 1ZGLB 5EB9A 1RHHB 4RGNE 3MZGB 3QUXD 1EGJL 3BISA 5D7JB 4X4ZA 1T03H 5E6ZA 3RUGA 4JVPA 1CLYH 1V7ML 2ZOKB 4X0KA 5C6TL 3PWNA 4M5YH 3PWJA 4ODTH 2PXYC 1V05A 4YNYB 3IVKA 5GRUL 3ULUF 3QUMB 1IL1A 3KG5A 1MJ7L 5FUOH 3S37H 4POYA 5DJ2A 4PREA 4P0DA 3N85L 3H6JA 4ZOEA 2W0LA 2WBJB 4JRYA 2GUOA 5C08A 1YJDL 3TWCL 4OLYL 2NTSP 1DFBH 4PGBB 3PHOB 4PS4L 3LS4H 5GQBA 4DTGL 2F9BT 1WBYA 3D3VD 5TF0A 5C07A 2ARWA 1G1CA 3CC5B 3CIQA 5IEKB 4JJ5B 4LAQL 1FFOB 2ESVE 3MRGB 2GTZB 5CUSH 3QWOB 1TZGL 2R29H 3T1WA 5TFSH 4YHLH 2QSCL 1F3DJ 3EO9H 3I3BA