5GGVH

Ctla-4 in complex with tremelimumab fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
225
structure length
225
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords light chain
total genus 48
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ggvH01
4FP8L 1REIA 3UZVB 1QFPA 3V5HA 3O11A 1YEDB 3NTCH 4ZXBB 4ZUTB 1WC7A 4LARL 2V5SA 4OZFH 1Q0XL 4G9FA 2F54E 5I71B 3LS4H 3HI5H 3DARA 3PGFH 4U6YB 5E4IA 3WFCL 4LVNB 3AXLB 1FNGA 3OAZH 1FZMB 3OJMB 3U36B 5KVGL 3L5HA 3FT4B 4UQ3A 5B3NA 4GAGL 5GZND 4O2EA 5GGUB 1NMAL 3ZKNC 4PJ7E 3CUPB 4KKLD 1I7ZA 2JK5A 1NBYB 5IK3B 1UXSA 2KDGA 5DC9B 1U8NA 5F7DA 1HYRC 2PYFA 4K9EC 4XP4H 2J2ZA 5I8CA 4NDMB 1U2CA 2HVKA 4UT7L 4MNGB 1YEHH 2FO1A 4C56E 1JPTL 1T0NB 3GM8A 4YHYC 5EIIA 2BC4A 1NL0H 3MGOA 3VXSA 3WDJA 1H3GA 1R0AL 1OGTB 4O02L 2WWMD 1KIPB 3ZYZA 3RVUD 4UOJA 4O2FA 5BRZB 1YMHA 3OKMA 5HJ3A 2MCG1 4LMQI 2BRQA 3VRJB 4M1DH 5IEHA 1JZ3A 3INUH 1XIWB 5E8PB 3BP5A 3T65B 3BN9D 5CP7B 1VGEL 4OIIL 3C9NA 4NPYB 3AS2A 3KPRB 5IHZB 5J4MA 3P11L 2HRLA 1SMOA 5EUOB 4G9FD 4HC1A 4QNPE 5JR1L 2BSTA 2PF6A 3CDYA 1EIBA 1UH3A 4WTZA 1L7IH 5B21A 5CUSL 1WFTA 5F3BB 4M7LH 2VDOL 1OGAD 4X6BA 4JO2L 3MZTA 5FGBC 2QADD 2FHFA 2PW2A 3HPLB 4P49A 3O3UN 4H20H 4YLQT 4YHIB 2CPCA 3MREA 4DGVH 4NKOB 3DYOA 1G6RA 4A2LA 3O81A 1CL7L 4GS7B 3W2DH 5D96B 2E3VA 3K74B 4Y1AA 1DVFD 2F5BH 5J1SC 5T3ZE 2QQQA 1OPGL 4Q97A 3VXUE 4Q2ZB 1WICA 4H1LB 4JGMA 3QCTH 3N85H 1IT9L 1F3DJ 2H2PD 4U2ZA 3T2NH 3VE0B 5F1NA 4XNMB 5IP4A 1HH6A 1BQLL 3IDIA 1D9KB 4BZ1H 4FTVE 5DC4B 1NL0L 2EE2A 2Z0BA 3KJ6L 3BT2L 5BJTB 3GJFK 2BJMH 4D94A 2DQHH 2FO4B 5TE6H 3UDWA 4RFNB 4L9LC 4NQEB 3NFSH 2R1WB 1UEMA 2F58H 1BZ7A 1GPOH 4KKCD 1JHLL 1Y6NR 5J12C 4NYLA 1U6AH 3QNZA 3WLBB 3P9MB 2D2OA 2F54B 4DUXA 5GS0C 3MV8D 3GSNA 1J5OL 4GW4A 1LO5A 3AFLA 2OMNA 5AUMB 1T2JA 4L4VE 4WHTA 1CDHA 2KZWA 1NGXB 3KPTA 4CVZA 5K33A 1INQB 1KIPA 1EEZA 1JWMB 2W60B 2FATL 4Z7OE 2DIBA 2IH3B 4JDZB 1IGIH 3P9LA 4Z0XA 2IC2A 3ZDYE 2VZ3A 3U0TB 5JPMA 2YEZB 4LRNL 4R7DA 5IFJA 3ILPB 3I6GA 4J4PA 4HDIA 5JOFB 5TQ0H 1BVLB 4GBXB 3LIZL 4JANB 2K7QA 3WHE1 1JJUA 2VAAA 3FN0L 4XB8A 3W2DL 1GZPB 3ZHDA 2D31A 5IMOA 4FQXD 1NH6A 3ARPA 1G6RB 4Q9QL 2HJFA 4LFHG 4QNPF 3VXUD 4PRIA 4W4OC 3VRIB 2EYTB 4JDTH 3WCYA 1ACYH 1F4XL 1YNTB 4JVUA 2ADIB 2R29L 1PG7X 4OGXH 4P57B 1MCFA 4MYWB 4FQ1L 4X7DC 5IGXH 3FONB 4PLJD 1GCFA 4P4RA 1S78C 2WUBL 3NA4A 1KT2B 5GSVA 1IGCH 4KJQC 2YD5A 1XGTB 2YD7A 3ULVC 2JIXB 2M2DA 5IQ7H 1FNEA 2V2WB 3QA3A 4K7PY 3VRJA 4ELMA 3T8XB 4YHMH 3L7FB 2WBJD 3X3GH 5F96L 1R3HB 3H3BC 4LSRL 3RY5A 4U1NA 1S9KC 2DICA 3K7UA 3BEVB 2C4XA 4AENA 3VXOB 5J89A 1O0VA 1J88A 1H5BA 1UM5L 5CSZB 2GHWB 1MVUA 3E3QE 5EPMB 5L7XH 3M1BA 1NC2B 3TZVB 4IIQA 1Q94A 1OT2A 3GMQB 1G6VK 3TBTA 3FOLA 5KVFL 5EU3B 1U8JA 4KGJA 1DLFL 4D9RD 3T1WA 5FUCE 2X4PB 5IROC 15C8H 1MCQA 2JJSA 4NC1C 5E24E 4ZO8A 2AGJL 3F5WB 1DBKL 2Y9RT 3VXMB 1T7YA 3DURB 3U9UB 1UWXH 1NCNA 2FBJH 5DWUH 5I76A 4DOHE 5C0AA 1CXFA 4A6YL 3BFOA 4XTRC 1BAFH 4JG0L 2V5YA 4P5TD 1AE6H 5EOTB 5ICZA 4KRLB 4BQCA 1HWHB 3MRPA 2EXYC 1TTGA 2VAAB 3T1FB 5EORH 5FA3B 4KI1A 3HAEH 2JELL 4XHJD 1D5ZB 4L1HA 5I8OH 1W0YT 3O3DA 3TH2T 4XHJC 3HC4L 4RMVA 2AEPH 3MLSL 2Z92A 2HYMA 2Z4QA 2WBJA 4FFYL 1KPRA 3PGDB 1NLBL 3O3BB 4LLWB 5DUPH 3BHBA 1L0XA 3QHFL 4PRPB 4ODTL 3UJJH 2CRMA 3SDCA 2X1OA 2JCCB 4LSUL 1HK6A 3VGAB 1DVFA 5J12B 4U49A 4PS4L 4RA0C 1AGEB 3HPJB 3L3JB 4U4BA 1G1YA 1MLBB 3B8SA 4R96A 4UIKL 2RBLA 3NAAH 1IQDA 4LK4A 1QSFE 1LO0H 3LS5H 1WITA 2BERA 3FAXA 1AP2A 1ZTXL 1AO7E 1J87A 5HHXH 1N7MH 5GRJL 1OWWA 3FQXB 4HBCH 3Q3GA 3OG6B 2NY0C 2OLDA 5T1KD 3JTSA 5IT2L 1HDMA 2YWYA 4HS6A 3VFTB 4U7MA 1SHMA 2OZ4H 1JGUL 1U3JA 1QRNB 2YSSA 3T0DA 1TXKA 5FCSH 3WFCH 2HFFA 3ZKXC 4I3SL 3NZ8A 4I8DA 1CDGA 1XGUB 3E6HB 3WIHA 3MZGB 4PJAA 1VB9A 4FQHB 5F1KC 3NPSB 4L8DA 3OAUL 4JQXA 4JPWH 1FN4A 1G7PA 1XIWD 2CRIA 4GXUM 2GY7B 4L1DA 5CZXD 5FAAA 2J8UE 3A67L 4ZO7A 4YPJA 4KTDL 4F2MB 5I17A 1QEWB 4XPTL 1WVZA 4NJ9L 5DRZA 3HZYA 2DOCA 1A4KA 4TVPE 3PQYA 3EYOB 2EDDA 3G5VB 1BQHG 3V6OE 4ORGB 4P2RD 1RZ8A 1UVQA 3RWJA 1DQDL 2DJSA 3QXWA 5HHNA 4YXHH 5B38A 4HMDA 4G6KH 2IMMA 4D8PA 2BY3A 2DDQL 4HUVB 5EN2B 2C3WA 2D03L 5I17B 4I3RL 2H32H 3KLSA 2HVKB 4ZQKB 4JZNB 4LCUA 4IOFD 4M3KB 5ESAA 3H9YA 5FHAH 4LHUB 4WDIA 1V7NL 1S9YA 1UB6B 1XF4A 1I9JH 1J0HA 1OTTC 4XI5C 1BX2B 1FV1A 1XF5B 5DMIL 2BY1A 1FJ1B 2NPLX 1T1ZB 3TT1H 5BS0A 4NO0B 4MJ4A 2P5ED 5TE4H 4UV4L 1Q0XH 3GIZH 4RRPA 4KKCC 1AQDA 4OCRL 2GSGB 4OM1H 3MV8B 1IKFH 3M8OL 1R3LA 1CLOL 4EXPX 3ZYOA 3BRGC 1JK8A 3S96B 4WO4A 4ESKA 2CJUH 4JG1H 1WIUA 4DGVL 1JUFA 4I0PA 3ORJA 2EDBA 4Z9KB 4JEGB 2FECI 4WVRA 1P1ZA 4ZAKA 5E8EB 4I13B 1ZTXH 1RZ7H 5KS9E 1HILB 3CZFB 3VRLF 2NX5D 4G8FA 2BVPA 2FWOA 4YDKH 1TJGH 2Q87A 4Z7UB 3IDYB 1D5XB 3U7WL 1TZHB 3CFEA 1NCDH 1U8LB 4P9HL 3L3OA 4UB0L 1FVCB 1RZGA 4AK1A 5TDNA 4XP9H 4QT5A 3KYMA 3MOQA 3OR6A 1RHFA 2X2YA 3QEUA 3ARGA 3MCG1 2AXJA 4LSVL 4ELMF 5IKCA 2I25N 2EECA 3RWJB 3OG4B 4ZTPL 2BOBB 1HYSD 4ZYKA 1FNAA 1MCJA 3RP1A 3QWOA 3SGJA 4HWZB 4EZMA 4PJBE 1AR2A 1I1FB 3MRFA 4U1LB 4PJ7A 1Q9WB 4I9WE 1OM3H 5EZIH 3FFCD 2BDNL 4UNTA 2IPUK 4GFTB 3AS3A 2YBRB 1JNHB 1KNOB 2IBZX 1QKZH 3SDAD 2VSDA 1HDMB 1IKNA 3KPRD 4OF8A 2X4SA 3V4PH 4YK4C 3UTSE 5SV4A 2UVEA 3L3HB 3FFDB 1AGDB 5I19L 2COQA 1INEL 1FRGH 2J3SA 3MLRL 4NQXB 3VXNA 4XNYL 2GCYB 3GBNH 4KJPD 3AS1A 1JWSB 3CVIH 5ERWB 1LK3L 1DN0B 4IMKC 2XWBA 1U3HC 3ALWA 4JKPL 3QO1A 3VGFA 2YEZA 3PE9A 5F7LB 5GGQH 3MV9D 2IQAB 4WCYH 2PTUA 4L4VB 5D6CB 3ZKQD 4KKAD 4MXWL 4PGDA 3BDBA 5DRNA 1EHXA 1I3GH 4G42B 3BP7B 4JRWA 1V05A 1QPPA 1XCTA 4G6FB 3W39A 3KPSE 2X9WA 4N0YH 2VRAA 3DXAE 2A6KA 3H9SB 1J8HE 4R2GD 3NIFE 4YO0A 2DLEA 1YMHB 3M45A 4QOKD 2H26A 4HLZH 3RX8A 4QWWC 2IBGA 3L9RB 1KJ3H 3GHEL 4TVPH 2DM3A 1MIEH 5GRZA 2Z93B 2H9GA 4LPVA 4PRBA 1KTLB 1HSAA 2QSCL 3BEWB 4O51B 1EFQA 3AS0A 1P53A 3NCCB 2HT3D 2VNCA 3ZKXB 1G7HB 1FG2A 1LK2A 4F33B 4HK3J 4OQTA 4GRLA 3IFLH 1OW0C 4DGIH 1U8IB 3C87A 2W59A 2YA1A 3O9WB 2N1KA 4Q0XH 2VDML 1BHGA 4E42A 3ROLA 1DDHB 3QEGL 3T4AA 1T4KA 3DMMD 3RBGA 1QACA 1RULH 3I84A 3TNMB 3GRWH 3U6RB 5DLMH 3EKCA 1NLDH 1IC7H 1S7QB 4NQCA 4LRIA 1WEJH 2XG5A 4Z0XB 4HIJA 2PUQT 3U0PB 1AGCA 4ZPTB 3NFNA 5BVJA 1FPTL 4G7YL 5A40E 4X9BA 3FOLB 3V8OA 2DQFA 1IC1A 2J4WL 4F9LA 8CGTA 4PJ8C 1K8DA 3E3QC 1FL3A 2GUOB 3C60D 3C9NB 4NPYA 3L3JA 4FQ1H 4HS3B 3N1PC 1PW3A 4P59L 4PB0L 5IHZA 1R0AH 4J3TA 1WT5C 3OZ9L 4RSVA 5K9JH 4PJ8A 5KANI 1FVCA 1OAYL 5D1ZB 4FOMA 4WUUA 1HI6A 4NQEA 3R0MA 5EU7E 4NRZA 4X5XA 1DBAL 4BKLB 3BH8A 1FFRA 1UGNA 4JKPH 5DTFA 5FGBA 3G5YA 3DNKA 3DROA 5FHBL 4D0DB 1FVDB 2ICWA 4G8GB 3RL1B 4OLUH 4RZCB 5KSBA 1Y0LA 1QFWH 3MLWL 1PD6A 4D9LH 3TJHC 5C0EB 1MWAH 1YEIL 5BOPA 3B2UC 4MDJA 2R2EA 1II4E 5FEBA 3H2WA 1MI5D 2MTPA 3PP3H 2ZCKL 4H25A 2VLME 3B9DA 4JZOB 4QF1B 3CAFA 4P2OB 4OF5A 5MP6H 4M7ZC 3BKCL 1B3JA 1KJ3L 3GJFH 1HHGA 3O3EA 4TYUA 2BSRB 1WFOA 5JXED 4KY1L 1ZLUH 1NDMA 4J3WA 1L0YA 3CX2A 5TH2A 1JMXA 5A16B 3IGAB 1SJHB 4ZXBA 4JFQB 2XPGB 3ZL4H 4PG9B 4M7LL 4N8VG 3MV8E 3WKML 4K55A 3PJSB 1FO0A 2EDHA 1PEWA 3FCTB 4PRHB 4LCYB 1S3KL 3RNQB 1ZGLB 1WBXA 3EYFA 3HMXH 4HIIB 4X6FB 4XC1H 3G6JB 4CJ1A 4Q0XL 5C0CE 4G80A 4M9OA 3UTSD 1RV6X 5T1MB 4NQDB 5IESH 5DJ2A 3GJEA 5LXGL 5T3XE 1QTYT 5ITFB 1JCKA 4WWKB 1OB1B 2A38A 5GZOC 5BV7H 4PJCF 4J2XA 4O4YH 4PJHE 1T83C 1OTUC 1V7ML 1FZJB 5E2WL 5JXAH 5LWYL 2YK1H 3RGHA 4KGLA 4UV7H 4NC0B 4HS8L 1SYSB 3MR9A 1KLGA 4MAYD 5E6IA 5D93C 4PJIE 3GZKA 1PQZA 3ARDC 3CFDB 5FHAL 1VESA 1A7NH 5JZ7C 1RUQL 4XBEL 1AI1H 1A1MA 1JF5A 5F1NB 5K93A 5JZ7D 1NEUA 1MY7A 3C6SA 2CKBB 2X42A 3HB3C 5TDOA 2ADJB 2YD3A 1YEEL 1DDHA 4L4JA 1MCCA 3U9UA 4TSAL 5JHDB 4OLZH 5C2BH 4TULL 1JGUH 1CDIA 1VFAA 4F80A 3MROB 3DMMB 1NGYA 3MJ7B 5I1DB 4ZFGH 4LHUA 4UT9H 4GRWE 1A2YB 2Q86A 3UZQA 2FX8L 5EBLA 1K8IB 4XAKD 1CICD 2AJVL 4NQVA 4C58B 2OSLB 1TZIB 3DXAA 4UAOB 2Q1EA 5LAXB 3RHWK 5CSBA 4XH2A 3ULVF 3VGDA 1HINL 5L88H 5C07E 2P5WE 4N0RA 3I6KA 2WV3A 5MERB 3TWCH 5ADPH 3QP3A 4DTGH 4LASH 4NQDA 4FFVC 1YYML 4P4KA 3WLBA 3DV4A 4S10A 3CCHA 1G7MB 3DVNA 4Z95L 4NQDD 3U7YH 3FO0L 4PJAF 4HLJA 4I0PD 2CGRH 3HMXA 4I0PC 4PTUA 4OZGA 2DWEB 1FNHA 3RWDA 4PBVC 1OLLA 4IMLB 1IQWH 4K2UL 2FWOB 2ED8A 3L5XH 4I3RH 3O6KH 3TN0B 3KPQA 3QQ3B 2B1HH 1KB5L 4P5TC 3U83A 2NZ9C 5C07A 4U1JB 1DN0A 5FO8A 5L6YL 3KXFE 2BVUA 2IJ0C 2ID5A 3VGBA 3BKYH 4UTAH 1TJHH 5I1EH 1KCUL 3TNNB 4MAUH 3VJ6B 3Q0HA 1CFVH 1RJLB 5FM5O 4L8SB 1MJ7L 3S35X 4WNQA 3CIQA 1MI5B 1NAMH 5EA0L 2R9HD 1JNLL 2HT2D 3X3GL 5E6IB 1VADA 5JQ6H 5EZJA 2R0WH 2VZTA 4GXVL 5SWQB 3ULUD 4NZRH 3C5JB 4KHTH 3QBTB 3WD5L 1S78D 2W9EL 1N5AB 4JFFA 4MD4B 3VXUA 4QHLA 4NRYB 4PLNC 1UM5H 1OAZL 3SDAB 4QY8B 2C3VA 4PJFA 5CAYB 2IH3A 5IB2B 3PGCA 3QR2A 5IIEA 3HTLX 1WIOA 1IKNC 3P4MB 3TYGH 4MQXD 1GGBH 4JHZA 1MFBH 4YH6A 5IVZA 2OM5A 3WSQH 4DJMA 2ZUWA 4YBHA 4OZGF 3QIUB 1Q9KB 4GQPH 2VWEC 5J11B 4K9EL 2X05A 4N0UE 3ZT6A 3F65A 4HLZG 3S4SB 5D6DC 4Y4HC 4DGYL 1DBKH 1OARH 2OR8A 2KPNA 2HKFL 35C8H 4R97B 3FRPG 4WY7L 1FCCA 5CINL 2VQ1A 1ADQH 3O2DL 4P4KB 4DKFL 2MKWA 3KXFB 5J0BA 3HI5L 5HJ3B 5DO2C 4AL8L 4P2QA 5ACZB 2DQUH 4KK9C 1AE6L 5DJCA 3JTTA 1XGPB 3U9PL 3S98A 5F6IB 2XKUA 4OGYH 3CU7A 1YQVL 4PGDB 2GITB 2GYSA 2A6IB 5CJXA 2VL4A 4XVTH 2ZPKL 3DUUB 5SX5H 3O6MH 4X0KB 4FQXA 3NBNA 2A1WH 1S7XB 2F53D 4ENEC 3CPLB 3MNZA 3SKNA 4YHKH 4G43A 2NY4B 1I7ZB 1KLUA 1IGTB 1NAML 3MRCB 1DL7L 1RUKL 3HZMA 4MNGE 1V5JA 3D0LB 3QUXD 4NSKB 5IG7B 4QEGA 1GSMA 4P2CG 2GSGA 5FYJU 3MO1A 1T66D 2C26A 12E8L 3QAZC 3BO8A 4Z18A 4PRBB 5C07B 1A8JH 5CZKA 2VDLL 5IM7A 1NKOA 2CLZB 1HXYB 2EH7H 4LU5L 1EGJL 2RIKA 1EX0A 2QJDA 3KDMB 3WEXB 5B4MC 5I1JL 2XY2A 3QWRD 4U3CA 5KS9F 4PRPA 1LK3H 4X7SL 3GK8L 4AH2B 3UMTA 5CWSA 5FDYA 1CFQA 2VLLB 5I8EA 2PYEB 1P5VA 3OKKA 2CQVA 4GRLD 4PJGE 3KPPB 4LCIH 2EDRA 5CS7A 3T65A 2ZSVB 4M61A 3FO9B 1Y18B 3WE6B 1SBSH 4NOFA 5TDNB 5ID1A 1RSFA 3OR6B 4IMKA 2OTUA 3FMGL 1VCAA 2BJML 4O2FB 4GG6A 1S7TB 3HE7A 4WHYH 3T3PF 5L9DL 4XNXL 4H0IA 1B0RB 3MFFB 3SGDH 5FECB 1N0LA 4GLRH 1BGXL 2DI8A 1RFDL 5M95B 1IAIH 1MJ8H 4BH8A 3MJ8B 4DCQB 5DURD 3GBMH 4QRRD 4JFDA 5C0FB 2X1QA 2XTJB 4X7FC 3VU2A 3I6LD 2I24N 3QFJA 3WUWA 4AIZB 2M1KA 4QHNA 2O61A 1MCHA 5IB1B 1S9XB 4YXKL 4Z5RB 3BIKB 4WHDA 4KK5D 4M7JH 3V4VH 4HEME 4I18C 1KNOA 1FNLA 5I1LB 5L2KD 3SKNB 4AG4L 1U2HA 3IDYC 4LCWA 2DKSA 1JNHA 1AGFB 1FQ9C 5T5FL 5JQHC 3HFML 5TFSL 1HN1A 3OZ9H 1FVDA 5L2KE 3U0TA 2Q76A 1EHNA 4NN7C 5FK9B 2C5DC 3IDJA 2R0KH 2NXYC 1KG0A 4XPTH 4L8SC 1S5HA 3H9SD 3GKZA 2ITDB 1RZ7L 4KUZL 4PIRF 2ATPB 3VD9A 1T21B 1Z0NA 5IKCB 3QEQB 1MAJA 4PBWD 4PR5B 4N8CL 5B39B 4U1IA 4OJFL 5DR5L 3O0RH 3JSSA 3K4ZA 1HQRA 5HHQA 3OKKB 2AJSL 2ZCLL 1CLYL 4CAGA 5I6XC 1R5WA 4JM2A 4PREA 2NW3A 3BP6B 2VZ1A 3SEPA 1GL4B 2Y25A 2DQJH 5EU6A 5EO0B 3QQNA 2EDNA 1AGCB 3TPUB 4NCC1 1IM3B 3SCMA 4GMSH 1V7NH 4PJAE 1M7DA 1MJ8L 5JXEA 2A2QT 1FO0B 5C0BE 4Y19E 2FNBA 1J05B 3PNWB 5CIPH 4LGPB 3MROA 3WJLA 3TYFA 3LH2H 4S1SH 2D31B 5IMOB 4MB5A 5EU4B 3ZT5A 4Q6IB 5CJOL 5BMFL 4DVBA 4N0CC 1RU9L 1KC5L 2ED9A 3TGXA 3ALXA 4UINL 5HHOE 1JRHL 2P7TA 1PG7L 4OLYL 1AQKL 2E6QA 5CBAB 4FG6D 3CD4A 3K3QA 3QRFM 4E42B 2CLVB 5TE7H 3MLRH 2QQLH 3OQ3B 3MRDA 2R2BA 3BQUA 2GSIA 3AMLA 3GSWA 3U2SA 3RNKA 1NANI 5DJAA 2BK8A 3QIUC 5IVOA 1XGYL 2J7LA 2HN7B 1WLHA 4WI5A 4HW6A 5KZCD 4M8QB 4LKXA 5DD0H 3ETBF 1FFQA 3DYPA 1RIVL 2MJWA 1E4WL 1ZKAA 2AJSH 2F53E 3F62A 4L9LA 1CLYH 3ILQD 4AM0B 3KJ4B 3M17A 2AJYH 2NY1B 1BP3B 4NWUL 4LSQL 5IFHL 5FKPB 2W0PA 3C8HA 4K94H 4N90E 5MENA 3JWNC 3V7AG 2Z92B 4P2RB 2HFEA 3DV6A 1TMCB 2VC2H 2WBJB 4GMSL 2R0ZL 2BHYA 2V9QA 4YUEH 1D5ZA 3MOBL 3CC5A 1GAFH 2A6JA 4NP4L 3PJSA 5K9KB 3WNNA 3S8WA 2R1XA 1P2CB 1GGCL 3GEWB 2OTPA 2KH2B 1D5IH 4S1DD 1WWCA 1NBYA 5KG9A 2I60L 3IJHA 4F9LC 1LP9B 2E9WA 1JWSA 5GS2D 3LZFH 3LEVL 3HE7C 4U1GC 1O7SA 1E27B 1AQKH 2Y4SA 5BRZE 5TE7L 3VXPB 4PY8J 4WCYL 5ADPL 3L6FB 4U6XB 3MTRA 1FIEA 3CMOL 2G60H 3QZWB 2FJFB 1LD9B 4OIIH 4JB9L 4LDOB 5DJ0B 4PJGA 5JDSA 3RJQB 1UYWL 3KPNB 2Z8VC 3P2TA 4OLXL 5KVDL 4HUWA 4U1LA 4GXUN 1HHJA 2XA8H 4RAVB 3LPFA 2ICWI 1ZLWH 4HJGB 1DUYB 4JFED 2DKMA 1FP5A 5F88A 4PJIA 2GKIA 2IALA 1F97A 2B20A 4YDJA 4J3XA 2KQNA 3VH8A 3WFBH 2VAJA 4HIIA 3QDGB 4KDWA 5L2KA 2F54D 3WUWG 4JKLA 1LO2L 2B0SL 2GTZA 4MQ7A 3MOAL 5DJZA 5C0AD 2HH0H 3G6AB 3O8XD 5CBEB 3QCVL 4DKFH 2OZ4L 2EKSB 3P4MA 1YUHA 2Q20A 5MEQB 3C5SA 2OTWA 5EZOH 3CVHL 3GRWA 2QHLA 3MYJA 3Q5OA 4B5EA 4LKCB 4H20L 4PJCE 4XAKE 3S34L 4HH8A 1DANT 4XBGA 1J1PL 5I76B 3RIFK 4RWYL 3HNTH 5JDJA 4JPVH 4FFWC 3T4AB 3H3PH 3STZB 4D0BB 3AREA 1EAJA 3STLB 4Y4HA 3WO4C 3RUGB 3IXAB 5DMIH 3UX9B 1J8HA 4HGMA 1P7KB 2R4SL 5C70A 2G60L 5ICYB 4PJXE 1Q72L 3GUTA 1S9WB 2B39A 4OM1L 4I2XE 1JRHI 3GMPA 3PDOB 1EEZB 3SGDI 2AXFA 3GMNA 1VHPA 4RFEB 1LHZA 2CJUL 3FQRA 3RVXC 2YUZA 1ED3A 1NANH 4MXQC 1MCEA 2XY1A 4G6KL 1CE1H 1QHOA 4YC2C 5CGYD 5KZCB 4TNVF 1WCBA 2AEQL 2GIYA 1JYWA 1A6TB 2I5YH 2WINB 4LFHD 2DB8A 2NMSA 3LD8B 2XNAA 4U6VL 1NGQL 1RURH 4MNHA 1RZJH 3PXHA 2B0SH 4YX2L 3C5ZC 2BMKB 4QRUA 2YPVL 1BZ9A 4M3JA 4R0LA 5E70A 1YC8A 3RWFA 1X4XA 3NIFF 5BV7C 1SJVA 5BRZD 1JVKA 3O6LH 2WBJC 4X4ZA 3FQNA 2EYTA 5C08A 3FO2A 3VG9C 2X4RA 4CADA 3GBML 1PJ9A 5GZOD 4TNWF 3UYRL 4A6YB 4GMTH 1XAUA 2FZ3B 4LVOB 4X5WA 4QXTA 3O6FB 1D7FA 3TNNA 1K4CA 2VB5A 1RUML 1WZLA 5C0JA 3B5HA 5DJXB 1YMMA 3SO3B 1JZ8A 1VACB 4NBYB 3FQNB 4NQEE 3MLVH 5C08B 4LPCA 1EHAA 4KV5E 3LQAC 4UV4H 4PTTA 3ZKMD 1CGTA 2VLKA 2QSTA 4DW2H 1OP9A 1WAAE 5DEGA 5LG1A 1I8MA 3E2HC 2CD0A 4M7LT 3V6FA 3OF6D 1QNZL 2O5YL 3QDJB 1OB1A 1UH2A 3KLHC 5JUEL 3LDBB 1YEDA 5FYKD 2G5BB 3IETB 5DJYA 5FA4A 5KSAD 3RAJL 5CP7A 2EC8A 3J7HA 5C0RH 4YBQD 2IALB 5DRXA 2X4NB 4PGEA 2DMBA 1PG7W 2R4SH 1XCTB 1QYGL 4XP6H 4Z0BL 4JRXE 3BH9A 1KT2A 4LCIL 2AGJH 4PBXA 1RQ5A 4U1KB 3ULVH 3QNYB 4QRQA 5KSVA 5HDQL 2CIIA 3KDMA 3QH3B 5EOTA 4Y5XA 1LVEA 4AIXA 4EUPB 2VWEE 4JKKA 1F2QA 4YDIL 2AK1H 4L5FH 1SM3L 5T33L 2AV7B 5FUOL 3RDTD 1QLEH 3LN4A 1X5HA 1OOAA 3IFPB 1S7SA 1RJZA 2P4AB 5DZOA 1BOYA 1MI5A 1PKQB 4LQ1A 3MRPB 5FGCB 1VGEH 4Y1AB 3OJ2C 1E4KC 2VLRE 1LEKA 1ND0B 2PYED 5EFIB 3OHXB 4JKMA 3F6IA 2X4UA 4ZNEE 1BWWA 2RB8A 2PYEE 3SDCD 4W4OA 3IJSB 3ULUL 1FSKC 3OXSA 1I7TA 4GRLC 3F12A 2XWTB 1UA6L 5EORL 4G3YL 3TM6A 1A6UL 4KI5D 4OI9A 4ZS7H 5EUOA 4BELD 3O4LD 5CCKH 5GRXG 2BSTB 5KS9B 3L5XL 1F11B 1CXLA 2YA0A 3BJLA 3W0WA 1G7MA 2B1HL 3NAAL 1P9MC 3L5WA 4XGZA 4PGBA 1XFPA 2APTA 4O58H 1QFUH 1YECH 1J7VR 4ZSOA 4Z95H 1UZ6F 3EYSH 2FLRT 4TUKH 1CD8A 4WFEE 1XZ0B 2EXWC 2IG2L 4YHPB 1T0MA 3BP4B 2CGRL 2XWTA 3FB5B 1BQHB 3QUXC 4S0SD 1BQLH 4YHLH 5EZLB 4UT7H 3SDCC 3G08B 4OAWA 4JFEE 4PS4H 43CAA 1CL7I 4OGAD 1KBGL 5E08L 3SDDD 3LKOB 1U95A 1FNSH 1QFHA 1NPUA 4ELKB 3N1QC 4CU7A 2X9YA 4ODUA 1I8LA 1TVDA 1D6VH 4L8DB 4NUJA 5HPMA 2QQKL 4NT6A 1RUAL 5DJDA 4XCNA 4HIHA 4BK5A 5B3JE 1MCNA 1RZFL 1WZ1H 1DQMH 2OL3L 1CQYA 2XIDA 4OD1H 4CVXA 4I5BA 2J12B 4PJXA 2JB6A 3IAPA 3SQBA 5F9DC 4U6TA 4YHYB 4G8IB 5EO1A 5FDWB 4MDJB 3O45A 5AAWA 5BMFH 1PY4A 1ZLSH 3SOBH 5LQBL 2XXMB 2R56L 4EN3B 3NIGE 4MJ6B 2VKXA 5E8DL 3GM0A 5ESQA 3NACH 3V0WH 3HUJB 4K94L 2RJMA 4NOBA 2F9BT 5BXFB 4OZGB 4LCUB 1JV5A 3MYZA 3S4SG 1C16B 2X10A 3REVB 1MRCL 3L3KA 4ODSH 5EN2A 5H2BB 1H8NA 4XBPB 2HLAA 1G7LB 5FFLA 1FAIL 4GKOA 4JQVA 3MLTB 2A1WL 4MQTB 3EIFA 4M9PA 2XKSA 1MAKA 4PJDA 3TVMB 5D1XD 2XA8L 1KIRA 2IANA 1Q0YL 3N9GH 4JE4B 1H8SA 4RFOL 3WFZA 4C4KO 5E9DA 1T0NA 4JR9L 1F11A 3MGTB 2YXMA 4Q74A 4PJGB 2NY6C 4TTDD 4ONHA 1LP9F 1ZWIA 1JHTB 3AAZB 1BZQK 4Y4HB 3R06A 3SE4A 1AD0A 1HYSC 2PW1B 4Y4FD 1T1WA 1KXTB 2E6PA 4I2XA 1KENL 1RZFH 2IPTH 4XC3H 1MF2L 2OL3H 4K71B 3K0WA 3RKPA 4JZOA 3TN0D 1NJ9B 3GNML 1UJ3A 3KYKL 2OI9C 4V2BA 3IB4A 1T1XB 2MKLC 4F58H 2J8UB 2AKRA 4YQXH 1EJOL 1IVLA 3UJIH 4Q9RH 3HZMB 1PQZB 3CFDA 4U31A 4DVBB 2OK0H 2AK4A 4AEIH 3MLWH 4D9LL 4KK8D 5I75B 1J0YA 2VDLH 3EYQC 3Q1SH 1FCGA 3QISA 2P5WB 3O2DA 4RMWA 4R96B 4ZUTA 2PXYA 4FQIH 3CFCL 3O8XA 1JYNA 4HJJL 5DHYA 3W9EA 3VGHA 1QBLH 1QSFD 5C0IB 1NUNB 3CZJA 3TBVB 4S11A 1DQQB 5HGHA 5E6YA 1ACZA 1ERNA 4GKNB 4MWFB 4PJ9D 1IAIM 5MI0B 4MA3B 5EO0A 4GAJL 3QWOB 3MXVL 4WW2C 4H5SA 4MLSA 4UIMB 4OLXH 1EERB 1K3IA 4OV5A 4LLVB 5I1KH 3C8KB 5KJRL 1ZGLA 2C9AA 4IRJA 3TCLA 5CD3A 3LN5A 2YD9A 2X7LB 4PGCB 3OF6A 4YZFF 4S0TD 1LD9A 3QUMB 1KCRL 4GBXC 3ARFC 1SVCP 1OT1A 3ZYIA 1EFXD 1N59A 3WS3A 1HIML 3CFIC 1A22B 2JJSC 2HRPL 4OZHF 3CVIL 1A7QL 5DSCA 2E9BA 3RWCB 1KENH 5DRWB 1N8ZB 4CNIB 2VERN 2PTVA 1L7TH 1IM9A 2B1AL 3C6SB 1ONQA 1Q38A 1QO3B 1S7WB 3FFCA 4V1DB 4YQXL 4YHNA 1CGWA 1UWEL 2QSQA 1NEZG 2OXGA 5B38G 4XRCA 2Y07H 5KVGH 3RGVC 5D7LA 1B9ZA 1ZANL 4GW1A 2NTFB 3WS3B 5JMOC 2WLYA 1JPFA 5K9QI 2VXUL 3W9DA 3ILPA 2G2RA 5EBMA 1A9BA 3QDJD 5E6ID 3CNKA 4R7DB 5JNYA 4UT6H 2OJEA 3QDGE 1OGAA 4E41A 4EI5D 3MUJA 3VFMB 1CFVL 4U1NB 4HG4J 1WWBX 2GW5A 5IEKA 3ARZA 3MCKB 4PRNA 5IQ9A 4JM2C 4RDQG 1OP5H 2ZCLH 1FZOB 4X98A 1EMTL 3WNMA 1U58A 3FB7B 3V5DB 1V3LA 1NC4B 3TC9A 5CJOH 4AEIL 3HHRB 2VITB 1EH9A 4NKMA 3EDKA 1X5KA 1T03L 4JAMB 2NY0D 1CG9B 1DCLA 3SE3C 3SDXB 4I1NB 2H2PC 2D7TH 5ETUB 3NFPA 5FK9A 3PWPB 5HY9A 2D3VA 3RVVD 1IM9D 3C08L 1G9NH 4KQ3L 3D9AL 1MCWM 1R3JB 2ERJC 5D7IF 4RGNC 4ZS6D 2FSEA 3HRZB 4UILL 4EUPH 2VR9A 5HVFB 4P2RE 3V6BR 4NO3A 4P2OC 5KW9L 2PTTA 1CDCA 5DK0B 3DRQA 3I02A 5DUPL 3MRQB 2A0LD 2VXSL 3RFZC 2AABL 1QSFB 4JFXB 3ARBA 4OGYL 3OPZL 3MA9H 4JZJB 3SDDA 4X0KA 1FLRH 2OI9B 4W70A 1JN6B 5K59F 4ZODA 1NC2A 5DSCB 3HNVH 1HZHL 5T1DL 1OCWH 2XZAL 4JDZA 2VLJE 3MRFB 2A9ML 4MDIA 1I9RH 4L29B 2NY1C 4JRYB 4NQSB 3VWKC 1RIVH 4JB9H 3BUYB 5FKPA 3MLVL 5EC1A 5HHOD 4CW1B 3K2MC 4OCRH 3OKEA 4IIQC 4MMZC 5CINH 5AYUL 1MHCB 3EYUL 3MV7A 3VFUB 1GOHA 2EKJA 3MRBA 3MODH 5KTEH 4I4WB 4NUGH 4GH7B 2OBGA 2HT4C 1U58B 2H8PB 3FB7A 4QRPB 4P46C 1OP3H 2FEDC 3QJHB 3WLWD 1RZGB 4MDIB 2X4QB 1JGDA 3ZDXF 4NQSA 2EDOA 4G6FD 1TJIL 2VO5A 3TF7C 2VLKB 2CLVA 3F7VB 3QO1B 2IH1B 5F89B 3HR5B 3IXTA 3K8KA 1I1CA 3WS6A 4MX7B 2FIKA 1UJ3C 4FTVD 4HC1L 4WFGE 2A83A 1IGIL 1DEEA 4R2GB 1U92B 3VXPA 2CKBL 4IRZH 1N26A 1FVEA 3B9EA 1ZHBA 4LAJH 2X4RB 4D3CH 1KJ2L 5GS3A 4N1CA 1IGML 1UCBL 5F6HI 1Z5LA 3EOBB 4LSTL 4EN3D 1MCSA 3PDGA 3G5ZA 5GHWH 4EUPA 2Y06L 4M5ZH 5I18H 3RGVA 5IWLA 1A4JB 2QSVA 4AEHL 4HT1H 3TO4D 2AP2A 2GI7A 4X6EB 5F8QC 2R8SL 2V9TA 2Y36L 4RBPK 5K9KA 1EUUA 3HE6D 1Q94B 3JWDL 4GRMA 4LP4A 5D5ME 4OGXL 4JZNA 5BVPL 4F7MA 4XNZB 3T0BA 1DZBA 4KTEH 4NBXB 4LSRH 1XEDA 2XWJA 4M61B 4Z7WE 3WBDA 3EHBD 3AM8C 5GRVL 1CI5A 2VDRH 4PJIB 3IFOA 4M00A 4HG4K 5HGDA 1EUTA 4NN6B 4G5ZH 2VL5A 4FQQA 1SQ2N 3FRUB 2VDQL 5I1JH 4ETQA 2AEQH 5LBSH 1NMBL 4XVSL 3HNVL 4YPGB 3VI3F 4F15C 4GOSA 4LBEA 1WBXB 1F3DH 3EYFB 5GGRA 2GJ6A 2HKHH 4KQ4H 5DA4A 1QEWA 3VWJB 1T21A 3ZHLA 1YDPB 1J11A 1F90H 5DT1L 1FH5L 1P84K 3S34H 1E4XI 4GRWF 4HKXB 4NKDA 3BWAA 1RK1B 3B6SA 3MLXL 4QXTB 1F4YL 1BAFL 5D8JH 1BD2D 1WJ3A 3B9KD 5DHXB 3S96A 1YPZA 2NY2D 4C56B 3ES6B 2AEIT 1Q9LA 4HGKC 4KDTA 4XCYB 4Z7NF 1MCOL 4EEEA 4PRDB 1MHPH 1DR9A 1GOFA 5FF6B 3HR5A 2GK0B 5I0ZA 5EU4A 1MNUL 1XCQB 1S9YB 2C4FT 4JFHD 5I18L 2ZOLB 5I1AB 1DEDA 4R4FL 1MCRA 1FYTB 3PNWA 2GTZB 3J8F7 4ELKA 4JG0H 3I6LE 1IQDB 2MMXA 3BYYA 1DSFL 5IUSA 2APFA 4JDVB 4X4MA 3CCHB 3UJJL 1VEOA 1P6AB 4JHWH 1CGVA 2IAMB 2NY2C 5JIKA 2C1OA 5JHLL 3ALPA 5F1OB 5TFSH 1IQWL 4K2UH 2J5LC 2CDFA 4U1KA 2APWA 3F58H 2NW3B 3AY4C 3D39B 3NOIA 4GW4B 3SJVB 2MCPL 4JKWA 4G9FE 2FBOJ 4H26B 4NO0D 3R4DA 2BNRD 1MH5A 1AJ7H 1KEMH 4U1IB 5F9JA 5GRJH 5GS0D 1WBYB 4JDVA 4R9HA 2P49B 1D9KA 5F7FA 3LEYL 2E7LA 3ULSB 1CF8H 2HN7A 3QYCA 4NWTH 1FH5H 4NFDA 4YEEA 3DHMA 1MJ7H 4FXKB 1LE9B 3D25B 4ALAL 1B0GB 1N6QH 3VFWA 4AT6A 4TUJA 5DD1L 3BPCA 5GGTA 3VFRA 3OL2A 5TPWH 3PG2A 3IFNL 3AU1A 1ZK9A 1YMMB 4L3ED 4GKZA 2W0KA 3VFOA 1J0KA 1UB5A 1A7QH 4LEXH 4BZYA 4HIHB 3ABZA 4I9WD 3AXLA 4L3EB 3D1MC 3SCMD 2IPTL 1WFUA 1U8JB 2XQBH 4KRNA 1J5OH 4JHAL 1MIMH 1LE5B 4JFDD 5GGTH 1IEHA 5ACLA 3QIUD 1SYSA 3MR9B 2FATH 2HJKA 4ZUVB 2D7PA 2PW2B 2Q6WB 1BFOB 5HVWA 4QTHA 1RIUL 5ICXB 5C0DB 2LTQB 3WIFB 3G5YB 3LKNB 4EDWH 2DDQH 5CCKL 5EWIH 5B8CA 5DJ8A 4P2QB 1LQSR 1MCOH 4M6ML 1DQTA 2DTSA 3EYOA 2HLAB 1QBLL 4OLVL 4NQUA 3G6JA 4Y5YC 1HHJB 1YNKL 2VQTA 4LKXB 3TFKC 4PJFB 5EUOF 2WW8A 3FZUD 5GSRB 4QXGH 1F8TL 5DJ0A 3B2VH 4G7YH 3EUUA 4GAYB 4F7PA 1M6OB 5GZNC 2J4WH 2NCMA 5DURB 2YD4A 3IDJB 3VGEA 2X1WL 4I18B 1AKJB 2FB4H 2Z8SA 4E0RA 3GIVA 3IFNH 3PV6B 2P8MA 4Y16D 3BPNC 5T1KB 1KIQB 4YUEL 4MD0A 3S3SA 4I2XB 4KWUA 4DN4L 5L2JB 1ND0A 2X70B 1LNUB 4NP4H 1I8KA 1WZ1L 4FTVB 4OZHA 5FYLL 1G9NC 2VZUA 2XKNA 2AW2A 5TGBA 1B0GA 4XX1G 4NKOA 4QRRB 3MRRB 5E4EB 3BSZH 3FT4A 1CLCA 1ZVSA 4LLMA 3WIHH 4LKCA 5IFJB 2MSPA 1M7DB 3FMGH 4AENB 43C9B 1PYWB 3VWJD 6FABH 3HB3D 5IJKA 4J8RA 4DUWA 3UAJD 1PEZA 5DFTA 3GSVA 1WAAA 5MERA 3CLEH 3SPVA 1QSZA 3QWRA 1FSKB 3C08H 4Z7WF 3O4LE 3TBVA 2D7NA 3B9KA 2NY0B 4LLYA 4P5KB 4F2MA 1QOKA 4OT1H 2BOCA 3UYPA 4F9PC 3JV5A 2VZOA 3PWUA 4K3JL 5KW9H 4H88H 4NHUB 4FMFA 4KY1H 5KVDH 5D9SB 2SEBA 4KMLB 5EZIL 3CFEB 4P46A 3GO1H 4LARH 5CLWA 1FO0L 4K8RH 3FONA 4NO2A 2YD1A 5IB2A 5F71A 2IQAA 3DX7B 2F53A 4X4ME 3O41A 1PBYA 5A2IH 1R5VB 4KJQD 1AY1H 4JPIB 4UQ2B 5CEZL 4JFEB 2ZWLT 1LP9A 1A2YA 2Q86B 4H0GA 4JPKL 2VDPL 2XN9E 1M05B 5SWZA 3BIAX 5IK3A 3MMEB 4ONGL 1NMAH 3EO0A 4FFYH 4KV5F 1YNKH 4CU6A 1MLCB 4MAYC 3RVVC 4AG4H 1BVLA 4GBXA 2F19L 4RQQA 4JLRB 3S3JA 3BE1L 3QNXB 3ESVF 2UY7A 1Y0LB 3OAYK 4XP4L 2BVQB 5M7QA 4NO0A 3VA2C 1LO3L 4GBXD 1B2WL 4PY7B 4ZFZB 4DK6A 4OCXH 3VA6A 1JI2A 1GYAA 2XN9A 4P4KD 4M93C 1FAIH 1QA9A 3MLYL 3EDDA 3QJFA 5JLZB 1EEYA 1IZKA 3G5XA 4WU7A 4PLJC 3DI2B 2BY0A 3N9GL 4JRXD 2DLIA 3QDGA 1FZJA 5C71A 4TSAH 3SKOA 4YGAB 3SE3A 1G6RL 4XCFL 5EULV 5C3TA 2XN9B 3BP7A 4Z7UA 1JF1B 1QSEE 5JUEH 3ARDB 5IM7B 5LGJB 4HIJB 1NCBL 4JRYD 4X6FA 5LCVH 4RX4A 4ZUWB 2WANA 1RHHB 4HIEB 1KN4L 1MREH 4HUNB 2AVGA 1KEGH 4PG2C 5I1DA 3T1FA 2PCPB 3D18A 4GW1B 3CVHA 1FYTA 4W4NA 1CFSA 1K6QL 4ONGH 4Q2ZA 3R1GH 1H15A 1KJMA 3D2UA 5DYOB 1JZ5A 1L7IL 1CDBA 3MMEA 2AKRB 4TPRL 3MRQA 4XPHH 1S7UB 3IFPA 4L5FL 2X41A 4LCCA 5FUZL 4YAQA 1KJVA 4OKDA 5DK2A 3U9PH 4NZDA 3D87B 4HUUB 1QQDB 2GJ6B 5E99L 1FL6A 2CK0L 5I16B 5I1IL 3KR3L 1I7RA 3LSOB 4WDIB 3ARVA 4PJBF 3B3IB 4K71C 4OTXH 4Z77A 4HKXA 3SGJC 4LSTH 3D0VA 3UTZB 5DJZB 1UG9A 3VI4F 5K9JL 3VGGA 4ZQKA 2FX9L 4CMHB 1KN2L 2FL5A 2HT2C 5B3JF 4NKMB 4IRJB 3TCLB 1BFVL 5JW5A 3MNVA 2WIIA 4ZFFA 3DV4B 3I9GH 3CLFL 3ESUF 4HS3A 4K3GA 5DUML 3SPVB 3TO4C 4EOWL 1D5IL 4OV5B 5JTWA 1D6EB 5ID0B 1ZSDB 1J18A 5AD0A 2WP3O 1IGJA 3RY4A 5T33H 3KPOB 1B90A 3QIBD 4NZRL 4OZFB 1TZIA 1I3RA 2R0ZH 2APVA 1UKTA 4HPYL 3U4BL 5HYJE 3CZFA 4LP5A 4MAYB 4MA7H 5IBUG 3BDYH 4NQVB 2VDQH 1I4FA 1H3TA 5FYKE 3GUTB 4N5UA 5H8DA 3STBA 3A67H 4TSCL 1U8NB 5F7DB 4J6RL 1VADB 5H37H 1N4XL 3TH3T 1I1RA 1ZGLP 4XRCB 5FHBH 4LQFH 1MJJB 4IRSC 4A6YA 2UWEA 4PJFE 3GMMA 3D18B 1EZVY 2Q8BH 2YPLE 1XF2B 3HCVB 4Y4FB 4NNXB 4QOKB 1FGVH 1H3VA 4LCWB 5CZVH 4HGWA 4XMPH 3H42L 1NDGA 2ZUYA 1ACYL 1NAKL 3FJTA 4OZFG 5JXEC 1KPUA 4OZIA 2X09A 5HYQB 3ZE1F 2IFGA 4G9FB 1JE6A 3RWDB 5KG9B 1LDPH 3ET9F 3VMPA 3QUMA 4DOHB 2BMKA 3HNSH 3IDNB 4XX1E 4OQTL 5C08E 1KEML 3PHSA 1OCWL 1YY8B 2XZAH 3HG1B 1EVUA 1QLRB 3QUYC 3V5KB 2VUYA 4PGZA 4HZLB 3G9AB 3RWHA 2DQIH 1A6WL 1JGDB 1BLNA 3K2UH 4ODHL 2DM7A 3QIBA 4ALAH 4UTBL 5DEFA 4KUCF 4KTYA 4HS8H 3BMVA 3HMXL 1WGOA 4G6AD 2IGFH 1YMME 5H2BA 3QULB 4KPHL 3EDFA 4XZUA 1G7LA 2OX5A 3X14A 3EDEA 3QQ4B 5D1ZD 4DKDC 1DQLL 4DQOH 2FL5B 3H7LA 4OLVH 4R4BB 4HXBL 2ZG1A 1CK0L 1YPZE 3RWIB 1A9BB 1HH9B 3B83A 5HGBB 5EBLB 5I73B 3WL9B 3GMLA 3PWLA 2XKNB 5ADOH 3SDYL 2NY7L 4PUBL 3D69A 3O4LB 2W65A 2A0LC 5L8LB 5DMKB 1EHLH 1D5BB 4YHLL 3NCYS 2JB6B 5BZWB 3LRGA 4MNQE 2ARWA 1YYLL 5CD5D 1OP5K 1MQ8A 5FB8B 3VXMA 3TIDB 4PJ9B 1QLFB 2P1YA 4URTB 5KTEL 1JP5A 1CR9H 4NUGL 4K8RC 3TA3A 5J13B 1T1WB 1NCTA 4KRPC 3B9AA 4NJAL 2GITA 4NUJB 4D3CL 2Y5EA 3O9WC 2IADB 3ARBC 3FQXA 5FGRA 3RZWA 1M6OA 4HSQA 3ARBD 1A7OH 1CG9A 4OM0H 1N6UA 3QXAB 3K8MA 4WI9A 4D9RE 1AO7D 2BOCB 5IF0B 5C09D 3JVGC 1ZHLB 2QLVB 3BSZL 3IJYB 4Z7VB 1INQA 1IM3A 1I1FA 2A77H 1CXKA 4WHTB 1G7QB 4QRUB 5DS8B 4AM0A 2HFGL 3SE9L 5IVXA 2HLFC 3LHPH 2BXZA 4P5TA 3PGDA 3DSNA 4EI5C 3T8XA 4YJZL 5F9AC 3B2UD 3CLEL 3MACH 4OFPA 3QHZL 4MNGA 1BZ7B 2JJUA 4QT5B 5DJ6B 2AEPL 2LVCA 4Z8FL 2KL6A 4GMTL 5L6YH 3KXFD 2DYPB 3MRJA 1WEJL 1GXEA 3P11H 4NNPH 5DQJA 1A1OA 4R4NC 3OX8A 4JCLA 1MEXH 2EE3A 4HEPG 3RWEB 5CBAA 3P30L 4PTTB 4P99A 1YNTA 2EIZB 3B2VL 1T5XB 4PRDA 3S88L 4RFOH 3Q6FB 1CS6A 5CILL 2FX7L 3OSKA 3UCRA 4MQSB 4DW2L 5K9OB 4PJXB 3KPLB 4YDLC 5D8JL 2UWEB 3QPQC 5AYQA 5C08D 2JK5B 1E28B 5IROA 4YNYB 5E5MB 5IR1A 1RVFH 2Y06H 4M5ZL 2CR3A 4O9HL 1UC6A 1YEGL 3BPOC 1AXSA 1GAFL 1UXWA 5DMJB 1KTDA 1ONQB 1S7WA 2N7AA 2EXYD 3GI9H 2VOTA 4P2QD 1TCMA 1HSAB 3BEWA 4MHHG 3W5NA 3F7VA 2HTLD 1L9MA 4JHBA 3JBG7 3VGAC 1KELL 3C5SB 4P2RA 5EU6B 1QBMH 4PD4J 1A7PH 4DVRL 4LHJB 3S36X 3B43A 5F7KC 1FIGH 2KKQA 3FKUS 5GRYA 3SE8L 4B7IA 4OZ4B 1SEQH 1BQSA 1KOAA 3LKNA 4NKIL 1KCRH 1PG7H 4OLYH 3MLYH 5SWSB 2F58L 2X40A 1K2DB 4KKLC 2IWGA 5HHNB 4U33A 4QCIB 1JHLH 4PJ5A 3W39B 4HJ0D 4Z8FH 4DZ8A 3BZFA 1R5IB 3AREC 1LMKA 3I6KB 5A16A 4HUXA 3BDXA 5TQ2H 43C9A 4OT1L 3MXVH 3OKYA 3PIQB 1TENA 2OS7A 4JDTL 2EEAA 1U3YA 3VCLA 1A3RL 1SBBA 2R9HC 5AEAA 2NX5B 3JUZA 1U8MA 4JFOA 4NHCH 1A1MB 1B2WH 2C3GA 3ARRA 2AJYL 2OL3B 4LLDA 2AJZB 1HSBB 4NWUH 2D9CA 1JUFB 5JORA 1CLOH 1IAMA 3Q5TA 4HWEH 5AZEH 4FFZH 1TQBC 4QHUB 3WXVH 1FFPA 1S9VB 4GO6B 2VISB 5CEZH 3MSPA 3SCMC 3TIDA 5BV7L 2BY2A 1JNNH 3LN4B 1M7XA 2W91A 4PJEA 5MENE 4Y4KD 4I0CC 4JHAH 2YC1A 3DX7A 1KYOJ 2IAMD 4KRPB 5JPNB 3RZCA 1X5IA 3GMOB 1TETH 1F6AB 5ISZD 3L1OH 3RKDD 1T0MB 1ZWIB 3SE8H 1J1PH 4X99A 1ORQA 5DVNA 3U7AA 3M17B 4YBLB 5D7JB 4X4XA 5T3XD 5J3HC 3UP1A 1WISA 2ARJB 3HPJA 1FYTD 4WO4D 1CGUA 2E7CA 1ZHKA 3EYVA 5KOMC 5ABDE 5IB4B 3KPPA 2R1WA 4P5TB 5D2LF 1BFVH 8FABA 2ADFH 1F4WL 4X98B 3GSWB 2ENSA 3N0PB 5EOQH 1R24B 4C56D 3QQ9C 2KBGA 2OYPA 2I07A 1QBML 3MODL 5AG9A 1IMHC 2HFTA 3IRPX 4HPOH 2HG5A 4RNRB 3KLAA 2CMRL 2A73B 2R2HB 3DRTA 5ALCL 1FNSL 1NFDE 1P7QA 5E99H 2OJZL 3OKDA 3IGAA 2FJGB 4ZTPH 2IEPA 4HKZA 3L3IA 2ORBH 4HWEL 4JFXA 5D2NE 1O7VA 1U9KA 5FV1L 3U4EA 2X4SB 3JXAA 5C0EA 5SWZB 4CN6A 2YD8A 3HRZA 5CEXA 5GGTL 1YN7A 1BJ1H 1ZAGA 3DUUA 3VFTA 4TRPL 5TQ2L 1BJMA 3UBXG 1IEAA 2CIIB 4TTGA 4JY4B 4LPTA 2YUWA 2H3NB 1JBJA 2XZQL 3LD8C 5H35B 2XNAB 1K3ZA 4RMRA 3P4LA 2EYRB 2E7HA 5EU5A 5I1HL 3KPRA 2RCSH 4XPFH 4N9OB 5J57B 5KANG 2EIDA 4TN9A 5E2VH 3V5DA 1OHQA 2ARJA 2N56A 4P0DA 3KYMB 3V6ZA 3BQUC 2BHZA 1MPAH 1I7UB 2ITDA 5HYSA 4U0QB 5DD6A 2W9DH 3PABA 2VLRD 4P2QE 1IAII 5FYLH 5ESVB 1YEHL 1JYXA 2QKIB 2C3XA 4L3AA 1T22A 1QP1A 3T2QA 5B39A 4NRYA 4XP1L 3BD5A 3UC0H 3KPNA 4OFDA 3WNPA 1MRFL 3RQ3A 3GFUA 2DQJL 4E5XB 4J23A 5EZJB 3H9SE 1J8HB 1LNUA 3P3YA 1NGPH 4GAGH 1DP0A 5ITBL 5CJXC 1IL1B 3U30C 1JZ6A 4OKVB 4F7TA 2OL3A 1YNLH 3CX5K 3EJYC 1PGRB 4MCYA 2AJ3B 5J06A 1R3IH 1T4KB 4XAWL 1WUNT 4MJIE 2ZCHH 2P8LA 4POZD 2VTFA 3PP4L 3Q1SL 5IB1A 2XI9A 2EKSA 4FQLL 3L95A 2XICA 3O6FC 5ILTL 1OAXL 5GGSB 3SKMA 3LRSB 4GAYA 3EGSA 2WK2A 2UWEE 2GJZA 2QQLL 3QDMD 1OWRM 1G1CA 3LN5B 3MV9E 3MRBB 5E8OA 4W6WB 3TZVD 4KTDH 4FQ2H 4CVZB 3HI6L 5IOPB 1VFUA 3BHBB 3NZHL 5HYJA 2VL5B 1BBJB 4UTAL 5F1SA 3QCTL 1U8QA 2Z4QB 5IB4A 1DSFH 1KPRB 1YZZA 4ZFFB 4KMQA 4ZD3L 4M1CC 4L8BB 4CUCA 3PDOA 4LCYA 1F5WA 1YN6B 2ERJB 3EDJA 1IKFL 2G5RA 3JUYA 4QHLB 4ZSOE 5GS1C 5C8JA 3IDNA 5F7YC 1RJYB 4NSKA 4ETYA 3QZWA 2R2CA 3VXNB 1K4CB 1MWAA 3QEQD 5C9KA 4NJAH 1DN2A 2QADB 3MV9A 4MSWA 5D7LB 4JRXB 3IJSA 1I1AA 2CLZA 1ZLVH 4JZJC 1T04A 3HI1A 3D3VB 3MBED 2MFNA 5HHVL 3QG6A 1KCLA 2HFFB 2YMXH 1OAQL 1FNGB 3U36A 3AM8A 2CDGA 5DJDB 4UBDD 3RWFB 3I3EA 4TPRH 5SWZD 5JA8B 2JJTA 1RZIB 1GJIA 5LGHL 1KF9B 3ZZ1A 4EVNB 3ROOA 1HH9A 5FM4A 5D9SA 1A9EA 3ZLQC 4YXHL 3KXFA 4JFDB 5C0FA 1OSPH 2YXFA 2VKWA 3S5LA 1LEGB 4UT6L 4KZEH 5HY9B 1RUAH 2D4FA 4NO5A 1DBBL 3OR7A 3KYAA 1CXIA 5AD0B 4KUCD 2BFVL 3QO0A 3KLDA 3S36L 1MHHA 4HWNA 1QFWI 1MIML 3MV11 3N06B 3VFPA 1RJCA 3ZE0F 4U1SA 5FM8A 4PJ8B 2E8YA 2HH0L 4M7JL 4NGHH 1ZLUK 4JO3H 4ONFL 5IVNA 4XBPA 2IAMA 3RZCD 5EBGA 1UENA 4FQLH 3SBWC 4Z78B 4JHWL 3QDHA 4FXGA 4OLWL 1S5HB 2A9NL 1I1AD 1W0VB 3MLZL 5JOPE 2HMID 5L7XL 1K6QH 3AGVA 2WAHA 5DC0A 4Q6YA 5TDOB 4LCCB 4X6DA 1S7QA 4KRPD 3VFOB 5DK2B 1BFTA 2OR9L 5HYFA 4M6AA 1MEXL 3LEYH 5SX4I 3D3VA 1G7IB 2AABH 3H9ZA 5T5NF 3T08A 5C7XH 4CL7A 3ARTA 2LAAA 4K23L 5DDHA 1AIFB 4ZNCD 5IMMB 1X5AA 4MCZB 5CEYA 1FHGA 3KYNA 3C6LA 3MNWA 4MVBC 4X9IA 4JPVL 1X9QA 2P45B 2VLRA 4DCQA 1YEKL 5AG8A 4UU9A 4G8EA 4QGYA 5JW4N 5I0DA 1F00I 3AC0A 1AH1A 4ZO9A 1OLZA 1D9KD 4NRZB 4OUOA 4X5XB 4XVJL 4CVUA 5I6XB 4BKLA 5JHDE 5D4QA 3BW9B 2Y7QB 4KKBC 3EOAB 2GFBB 3LV3B 4G6JH 2V2XA 4N0FB 5DJ2B 1J0ZA 1I9EA 1ZHLA 1MCWW 1AGBA 1CTOA 4LHUD 4GSDL 5C2UB 1MY5A 1NUFA 3BZEA 5I8EB 3GSXB 4PJDF 3NCBB 3ARWA 4WFFE 2OXHA 3GGWB 3NIGF 32C2A 3R8BB 4P57A 1B4JL 3PWVA 2ZOLA 1UCBH 5CMAB 1I7RB 5J13C 2A6DB 5HYSG 1VFOA 4KH2A 2EH8H 1ZLWK 1YYMH 1H9VA 3WDIA 2FRGP 4WEUD 3IAGC 4LOUC 1OSZB 1DBML 1OPGH 2E27L 3BZ4A 2PYFB 5L0QC 1G7PB 3GMMB 1W72B 2P5EA 4NC1E 3L3HA 1HXMB 1I8KB 5BW7A 1A21A 2DQCL 3RTQA 3RI5F 1KJ2H 4S1RH 4WI4A 3MREB 3TO2B 5K9OA 4AEEA 1INDH 1NGZA 1U95B 1KTLA 1MCLA 2I07B 5HVGB 1UWGL 5F9JB 4OFYA 4QWWD 1X6NA 3NA9L 1WWAX 3E1F1 4MNQB 4PJCA 2AV1B 3IDXH 3VD7A 3FRUA 5IB5A 3PF2A 3P0GB 4LAQL 2A6JB 2BX5A 1PZ5A 5EA0H 3BXNB 4HZLA 4K3JH 1YQ2A 1XF3A 1TLKA 1J86A 5JIHA 5HDQH 5GGVH 1ADQL 3S4SA 5EU7C 4LRIC 1FZOA 3PL6D 2G75A 2OJZH 2NX5E 5T3ZD 1WWWX 2E8ZA 4BFBD 2XTJD 5TH2B 5ESQB 2VDKL 1ED3B 3MRDB 1T3FB 1NUDA 2YC1B 5E2JA 3DVGB 4KMTH 2DBLL 2NY7H 4PUBH 3U46B 5FCUH 1S7RA 5TDPB 1NFKA 4N0CD 5D7IE 4Y89A 4U6XA 4FMKA 3MUZ1 3U2SB 3UC0L 3NCJH 3QI9A 5JO5A 3C2SA 1KXQE 3SDAC 2Y6SD 5DD0L 1MLCA 5EG6C 3ARBB 4PJGF 2AJUH 4YXLL 5CILH 5HGAB 3TBTB 1S3KH 3HUJE 4JANA 3QEHA 1MUJA 2PTTB 5KSBF 4TSBH 4KI5E 3QIWC 4DK3A 5D5MB 4OBSA 3ZDYF 4KROD 3LIZH 3T0EA 3FQTB 3MRKB 3RPKA 1LGVA 3LQAH 4J7RA 2EIEA 3D9AH 1PKOA 4CN4A 1P2CA 3TA3D 1WC7B 3WO4B 3I50L 4F7PB 3CK0H 3MCLH 5F1IA 2X7LA 4MQ7B 4HUVA 4E9LA 3LKQB 4J12A 3O3AA 4NZUH 5DGRA 2NY5C 5GRUH 2CK0H 1ZT7A 4YHOH 3BXNA 3EOAA 3UO1H 2ESVD 4EDXA 3T0EC 3ZE0E 5K9QG 3SHSA 4J3VA 1CGSH 2VXUH 1CDJA 4JN2B 4NC2B 2F5AH 3WNOA 3L5IA 3NCMA 2Y72A 3W9EB 3IU3B 4KMTL 5MEPA 2FIRT 2DBLH 5C0IA 1G0YR 1HQ4B 4O4YL 4UZGA 3FCTA 5DHYB 1K85A 3O2VH 4HK0A 2AJXH 3OJVC 5F44A 4FQXC 2YS4A 3W9DB 3L6FA 1ZXQA 3UTTD 2FYYA 2VXVH 3DXAD 3DO3A 3MRMB 3G04A 2JF1A 3QI9B 5FO7B 4WV1B 3ULVE 2APBA 3MLUH 3PUCA 5GJSH 4C83B 2GJ6E 2Q3ZA 5E00B 3WKMH 3JV0A 2VLKE 5CJ8A 1LO4L 3CSBA 4NNYA 1T03H 2QQKH 4JQVC 3U82B 5FYJH 3LQAL 2FGWH 3MLPA 1HE7A 3SN6N 1IGCL 3BPCB 3TYFB 5CBEA 1KLGB 1NKRA 1UEYA 5LKNA 4P46B 4ONHB 1KCSL 1WT5A 1TPXB 5SWSA 3LOWA 4GG8B 1RAMA 1B4RA 1X5XA 3K1KC 5D2NC 3VD3A 3QQ9D 5EWIL 1D6EA 3REWB 5HGDB 3K4AA 1MRCH 2DL2A 4ODSL 3SBWA 1CCZA 3SKJH 3QXVA 4RAVA 3V5KA 3GJEB 2WP3T 1A7NL 3MNVB 3L3KB 1QFOA 4PFEA 3RY6C 4NN5C 1LILA 4PRID 1HEZB 3GMRB 3EGSB 4U2YA 5DR5H 4RGNE 4ZAKB 2YD2A 1VSCA 1TVBB 4RGMB 1G9ML 4XXDA 2V5MA 3IKCA 3DUSB 4MLIA 1QKZL 3PGFL 3QCUH 4I77L 3G5ZB 4PRPE 4N0YL 4J3UA 2XFXB 3WXVL 5A2JH 4YR6B 4K3DL 1AHWC 1ZT4A 2IQ9H 3O6KL 4D9QD 4HF5L 1S7UA 4RIRB 4OCNC 3MUY1 3TYGL 1JNNL 4KK8C 5BS0B 3BQUD 5L88L 1L6XA 3R06B 3PWPA 1F02I 1A0QL 1EBAA 5ETUA 1VEMA 4BUGA 1HCVA 3LH2L 5C8JB 6CGTA 4PV9A 3HG1E 4CGTA 3QUML 3S37X 4IJ3C 4O2CB 2A74A 3RKDC 4HC1H 2EO1A 3P9LB 5LGJA 4KZDL 4PJ7B 4YPGA 2H1PH 4P3DB 5FECA 3VDBA 5MENB 4JY5L 2YN3A 5DD6B 3GGWA 3BH8B 5DD5L 1YQVH 4ZOAA 4TVSa 1XZ0A 2I9TB 4GKNA 3F7RA 2BVPB 2X4TB 2VLJD 3VG0H 2XQYG 3HG1A 2OP4L 1SMAA 1Y6KR 5E8OB 3QDAA 3ZSTA 3GHEH 1FNFA 2H2SD 4YIQA 4AEFA 4JFFB 5KAQF 3ARFD 3SO5A 1A9EB 1S7VA 4GQ9H 3ZKMC 4ZUSA 3MA7A 3O2DH 4K7PX 3OKNB 3NFNB 4XWOD 5H94B 1UA6H 3WFHA 1XCQA 1A6UH 3TP4A 3TNMA 4CVXB 3NCYP 4HD9A 3TZVC 1OAZH 1OAYH 2D4DA 1Z5LB 3EOBA 3CU1A 3FHAA 4DQOL 3HI1B 4NM8H 5FO7A 1FV1B 4OM0L 1TPXC 4WNQB 3V0VB 2NXZD 3FTGA 3T4YB 1XT5A 5FV2A 5HVHB 4YHNB 2XTJC 3U30B 2DYPA 3MRJB 2NW2A 5D2NB 2HKHL 4LCWE 4KXZI 2X6MA 3G6JE 1RY7B 3IXTB 3UTSA 3V0AC 3C2AH 1TVHA 2F15A 4YE4H 2EIZA 5E7FA 1C5CH 4XP9L 4OCXL 3EJJX 2RCSL 4XPFL 5DXWA 1MH5B 2I27N 2EDLA 1VKXB 1Q1JL 2EE9A 2AK1L 3QNYA 4QRQB 5KSVB 3CXHK 3M07A 3CH1B 3BWUC 4P2OD 4XPAL 5HHPA 4L3EE 3VXSD 1B4JH 4XMKL 3OR7B 2PNDA 1AC6A 2N7BA 5HD8D 1T89A 2FJHA 5C0DA 2XA3A 4CKVX 1EPFA 4DN3L 1CFNB 2ATPA 2X4TA 3AB0C 2EZ0D 5FYKU 2WQ8A 3KJ4C 3MCKA 1NSNL 5CGMA 4WWKC 4MWFA 3HUJA 4TQEL 3T77A 4YHZL 2C1PA 1K5NA 5F8RC 1T0PB 5E8NA 2K3TA 1NCBH 5FUZH 4L3EA 2VIRB 3O45B 5IGXL 5CJQH 4XWGL 2DIAA 4R0LC 2I9LB 2AJ3A 5D71L 3B5TA 3CSGA 4CMMB 4NFCA 3QHZH 4WENB 5GIRB 2EICA 3F58L 5FOBA 1RZKH 1AO7A 3JVGA 1AGDA 4FQPA 3V6OC 4YNYA 5IR1B 5INDA 1IGTA 1NCCL 2X70A 5F97E 1X5FA 5I74B 5TF1H 3VW3L 3QXDA 4Q9QH 2EXWD 1LK2B 3BJ91 1NFDF 3HN3A 2FSEB 3CDFA 4GT7A 2Z91A 1LEIA 4HDIB 1N8ZA 3KPSD 1I3GL 1TJGL 5EUKB 3D3VE 5B4MD 4OCSL 4KK5C 5LVEA 3QI9C 4LDEB 2FH6A 4FFZL 2CUHA 1U8PB 1MFAL 2DF3A 2VSCA 4HK3N 4FQ2L 5HGBA 5IBTL 3R0NA 3CC5B 1DUZA 2G9HA 3GBNL 1EO8L 4P5MA 1DBJH 4G6MH 3QEUB 4MXVE 2CUMA 3C8KA 1MHCA 4Y4HD 1KULA 4X99B 3BW9A 4GUPA 5D7JA 4JRYA 2GFBA 3LV3A 5C1MB 1NSNH 4HXAL 4KROB 2VN7A 4HHAB 1AKJD 5D7KD 1URLA 1HNFA 2BSRA 4MNQA 4WEMB 3FO0H 1P4IH 5HYQA 1MOEA 3RGVD 4KRMB 4R8WL 2OQJB 5EO1B 1NCAL 2M26A 5D1XB 1K8IA 3W11C 3L3DB 5BQ7A 4OCMC 2P47B 2VABB 3HAEB 3AY4A 4M6NH 1C08A 1IBGL 4AMKH 4X6CE 5AWNL 3NH7H 5IMMA 1DBBH 2WMPA 1J8KA 1A6VH 5F72S 3EHBC 4QHNB 4JFEA 4P48A 4DWHA 1FG2B 4MAUL 1MCIA 4RAUB 3UAJC 2FX8H 5CZXC 4MXWH 1CGYA 5HHME 3JTSB 1U8HB 3HR6A 5IVXE 3ARGD 4KZEL 1XGRB 4KTEL 1VGKA 1MCPL 1A7RH 4KVNL 1JHTA 1CVSC 1OTTD 4XI5D 2EZ0C 4RCAA 4JFYB 1WQVT 3BKML 5DO2D 3VH8G 4HKBA 2F74B 4F8TA 3MGTA 4X6CA 4RA3A 3HC4H 3GSOB 4QRRE 2D7OA 4LGRB 1UM6H 5CGYC 4KJYA 3UTTA 4QRTB 2D0FA 3GDBA 4F7MB 5C0RL 5DQDL 1JGLH 5FUCC 2OR9H 3QIWA 3MJ9L 1R3HA 4QYOB 4RISH 5JLZA 5IB5B 1NBVH 2DWDB 1FDLL 1KB9J 1KACB 1IZJA 1N64L 4L29A 4LSUH 1KB5A 2NZ9D 4FNLH 1HQRB 2Y5TA 4LNRB 4HPOL 1ORSB 4YDVA 5HHQB 2BNQE 5C0AE 3PQYB 2H6PA 1FL6B 4HJ0C 3W0WB 3WNKA 4PP2A 3T0WA 1CGSL 1P1ZB 2H32A 5DMGC 3DBXA 4KC3B 1H3XA 3OMZA 1TFHA 3T0VA 2P5WA 3CFCH 3QUZC 3C60A 5E03A 1B88A 3AREB 1KYOK 4QRRA 5A3IC 1YJDC 4L8SA 4P9ML 2AXGB 3CMOH 5GS2H 2IADA 1F4WH 3BPOB 1PSKL 1ES0B 4XNUH 1OTSC 4P2OA 2ZUTA 3Q5YA 4XCFH 4OBRA 4LVHB 3CFKB 3DRTB 5ALBH 3VFVA 4C56A 4YBLC 4PYHA 5HGAA 4Q6IA 2J6EA 1DTUA 1A02N 2R2EB 5I1KL 1SY6A 2HTKD 3ULUH 3BZDA 4MB3A 3QFDA 3LEVH 5GJSL 1J12A 3D69B 3O4LA 1U92A 3G6DL 1TDQA 2R1XB 4LCCC 4MXVF 5DJCB 2UV3A 3GSNB 2YPLA 1I4FB 4BZ2H 5CP3A 1YNLL 3K4DA 1YPZF 1A6AB 3S37L 4CRPA 2FGWL 3WE6A 4KROC 4YIQB 4M62H 3BVNA 4KHXH 1FLTX 3MOAH 2ZCHL 3DTXB 4HCRL 5IW3A 3IETA 1BQHA 4UI2A 2V2XB 1CE6B 1ETZA 5INCB 2DLFH 4OZGE 1U42A 4K3EL 4FZ8L 5I15L 1JPGB 1TQCB 2NXZC 3SQOL 3ZE2F 4RX4D 1UFUA 3R8QA 5HPOA 1G84A 3OPZH 2AXHA 2DQTH 3V7AE 5T1MA 3HC0B 3C09B 1U3HD 4OZHE 2BSSB 3KNBB 3UPCA 4BH7A 1FLRL 4O2CA 4X6CB 5JDSB 5ERWA 3VDCA 1E4XH 4QTIH 3TBSA 3UPRB 1U8KB 3FFCE 1L0QA 3SY0A 3EO1B 4J1UB 3EOTH 3BD3A 2YRPA 3RZCB 5JPNA 2KZ1B 4LVOC 5MHSE 1WZMA 3ZTJG 3QWQB 1C12A 3VWKD 5IMKA 3KPRE 3OB0H 3QCVH 3WHE0 4FQJL 2ICWJ 1DL7H 1RUKH 3HMWL 1WBZB 1KUMA 1XF2A 1QRNA 3AMKA 4NNXA 1DLHB 1ES0A 1EXUB 1JGVH 1FIGL 1VENA 2EEBA 2HTLC 3GSNH 3MRMA 1RK1A 5D70H 4KJWC 4R0LB 1AD0B 2ZP0T 2QR0B 2FDBP 5DMYA 3DX9A 3EFDH 5DD3L 5FKAB 4DZBB 1J1XL 5T5FH 1SYVB 2LVEA 1ZE3C 3MXWH 4Y2DA 3D48R 2BHUA 2LE9A 4MA8H 4BFIB 5D1QA 4KHXL 4YXKH 5CSZA 3ZE2E 3MJ6A 4HCRH 4B53A 4YE4L 1FL5A 4PD4K 1S7TA 3WKNA 2QEJA 4HMCA 5DEFB 4FQQB 2R56H 1AD9B 3MLTA 3SQOH 4ZSOB 4JQXC 3V4PL 1HHIB 4XPGH 4YHOL 3BD4A 4PJEF 5IWLC 1I85A 1VA9A 3G6DH 1ZOXA 1S9WA 2PXYC 5CLTA 1F13A 5F3HA 3TO4B 2HVJB 4X8JB 3MGAA 1LO0L 3LS5L 1U8LA 1VERA 3S37H 3UBXI 5CIPB 4N90D 3UTPD 3MUGA 3P73A 5ICZB 3FL7A 4HUUA 4O00A 5C0BD 3VFNA 3OGCB 1QBBA 5CUSH 4KJWD 3V4VL 3MV8A 3TT3H 4F57L 3ULUE 2BVOB 3OB8A 3QHFH 3A0OA 5CKGA 4A2MA 3X3FH 2O93L 4O02H 3GJFA 3CSYA 4EKXA 3X11B 5I19H 3VXMD 3CUPA 4TUJB 4CDGC 2VLJB 3SY0B 4JY6A 4U6HA 3ILQC 2F5BL 3P4NB 4U7SA 4DN4H 2NX5A 3A6CH 4YGVA 4CNIA 2P44B 4LHQB 1RHHA 1TJIH 4HIEA 4BJLA 4MA8L 5H94A 4D0DA 4DKEL 4QOKE 3W11D 3MJ8A 3QULA 5CSGA 4L4TE 2HJLA 4MS8D 1CICB 3BP6A 1XGYH 4UDTA 2ITCA 1MHHB 7FABH 4LL9A 5D7IA 2NYYC 3QDMB 1KJ2A 3V5HB 3O3AB 4RGMC 4LSPL 4Y8DC 2IF7A 3PL6A 3H0TB 3HE6A 5IBTH 1NAKH 4QRSA 2QADC 4FQIL 5F7NC 3RWGB 4NQTA 4XCCH 2Q6WA 5KS9A 1A7BA 4Y2DB 5T1LD 4MQXC 3D0VB 3UTZA 5FA3A 5IEKB 3MXWL 4FFVD 4X6EA 1BBDL 1I1AC 4M4PA 4DN3H 4LNVA 1I9JL 3BKJH 5I1CL 1IEAB 1J9CT 2DMKA 3BIBX 3OAZK 5JMRA 1BJ8A 4OQ1A 5MEOB 4OIAA 5EOCJ 1N3NB 1YN7B 1QR1B 3SE9H 2NNAB 2YPKA 4YDIH 2P46B 5DQ9B 4UTBH 1KLUB 4U3XA 5IMKB 1WTLA 2UUDH 3FFDA 2APXA 1GZPA 4PRAA 1H5BC 1RIHL 3QFJB 3JWOH 4ODUB 4FQXB 3I6GB 1G7JA 1NEZB 1S7XA 2EH8L 4G5ZL 3GRWL 4M03A 3PV6A 3RAJH 2M8XA 5E8NB 4L8BA 3ARDA 2W92A 4JJHA 2K9UA 3QUYA 4KQ4L 3S88H 1F4XH 4XP6L 4Z0BH 5DHVB 5EBWB 4Y4FC 4M48L 4OFVA 2VMFA 4POZC 3LB6D 4I3GA 2ATKB 4H1LG 5F7UA 1MCPH 4R4BA 1GGIL 5L2KB 1KV3A 3BPLC 1KTKE 4P23C 3G5XB 4LSVH 1N5YH 4XCCL 4NM4L 1C16A 1EGJH 4AH2A 5DJYB 4APQC 1F42A 3KGRA 5HXMA 1MFDL 2Y7QA 2ZJSH 3GSVB 4TOYL 1A6VL 1CICA 4FP8H 2BC4B 1U91A 3TCXA 5T5NG 3NN8B 4R4FH 3REVA 2BNRA 3IVKB 1MRDL 1OY3B 3MRNA 3D0LA 3FT3B 3H7BA 3MO1B 3ARFB 2NY3B 3LPWA 5I2IA 1Z6JT 3P4OA 4H1LA 3STLA 2UZIH 5E08H 2VXSH 3T4YA 2JCCE 3CVHH 3RUGA 2E7BA 4Y8AA 5I71C 4EDWL 2X4OA 5ANMA 4QHUA 4FTVA 4OZHB 4DEPB 3LQZB 4M43L 2NY6B 4H0HB 4RIRA 1U8MB 4JFOB 2CDEB 3HS0B 1OSZA 4RWYH 4S2SB 5B22A 5I66A 4KI5F 1LO2H 3O41B 4WGWB 4DKAA 2V5TA 4MA1C 2LU3A 3PP4H 2JB5L 4C57C 3SGKA 3RDTC 2EO9A 3CDGB 4ISVB 3EYSL 4TUKL 1IAKB 5C07D 3G6AA 4M02A 5EZOL 3C60B 4PTUB 3DGGB 5EB9A 4Y4KA 2ARJQ 2WWKT 3JV4B 5B8CC 3LS4L 1WZKA 5GS1A 4WW2A 5I1IH 3NACL 3EYUH 4QRPA 1CVRA 1CFNA 2LV4A 4WFHD 4LEOA 1P84J 3V7MA 3EYVB 1RIHH 4LLQB 4RGOH 1S8DA 5E2TH 1I8LC 3BGMA 4PJBB 5LXGH 2I9TA 2LU7A 5F1IB 3OAYH 3NA9H 4B7LA 2FLBT 1PY9A 2ZUUA 4ZNEA 1NLBH 4WEBH 2P42B 1WCQA 4KK9D 3B9KC 4YHML 5JW5B 3HZKB 4TUOA 4UOW1 1S5IH 4L4TD 4XB7A 4HZAA 3C6LB 4ZUVA 2F74A 4WI3A 4FNLL 4HWBH 1JPFB 4PRIB 4JR9H 5L8KB 1UXWB 4QRPE 1ZHBB 2UZIL 3O6FA 3RRQA 3H42H 3HNTL 5J6GA 3MRHA 1RMFH 4E41E 1E28A 4NKIH 1DEEB 1OP3K 1PX3A 4PJHF 5DQ9A 4ZTOL 5I8OL 4H25B 5EO9B 3FN9A 4ZUWA 4TOYH 1YEEH 4FS0A 4W68A 4XCNB 3N1MC 2YPVH 4YK4B 2JB5H 1JWMA 2W60A 4HH9A 1JIBA 3I3DA 1CFSB 5HI4C 3P4OB 4K3EH 3S35L 4PJXF 4XMPL 5KJRH 5DZNA 2F8OA 3E6FA 4PB9H 5GSRA 4QCIA 2HAZA 1XIWC 4OI8A 3KJ6H 4G7VL 4LDLB 4ZXBD 1DFBH 4WW1B 5F9OL 4U05A 3TPUA 1W2KT 2IPKB 3Q2CA 1QNZH 2EYSB 2O5YH 3RTQD 4DAGH 4XP5L 3G5VA 5DA0B 5ITFA 1Z3GH 1X7QB 5E7BA 3QPXL 3IFOB 4PJBA 4LLWA 3WIFA 2W9LA 3HZYB 3VRLE 2E6JA 4KJYB 4R2GC 1I75A 2OSLA 3PWPE 3CK0L 3MCLL 1NFIB 4IEFB 4NYLB 3K2UL 4ODHH 4RMUA 2WWMC 3HA0A 1DQDH 5GISH 1GC1H 5LGKA 4XCEB 5JA9A 1QD0A 1XH3B 2CXKA 4Q9RL 1WTGT 3LRSA 4H1LH 2W9EH 5DHVH 2VXQH 2EIBA 3MBEA 1X5LA 4Z7VF 2FZ3A 3WEXA 5C0CA 3HAEG 3LKSB 4Y5VB 4Y0GA 4FQHA 3GHBH 5TF1L 1JYVA 1W8NA 4YFEA 2GK0A 2HWZL 4P9HC 5D1XC 1VACA 4DFHA 2YRZA 1T1XA 1KGCD 2FHBA 5FYJL 4FQCL 4ERSL 1FZKA 4CMHC 2PW1A 1Q9LB 3BKCH 5BV7B 2A6IA 2XRAL 4F7EB 1BX2A 1XF5A 4MJ5A 3WXWH 4PJ5E 3VFWB 4AT6B 2FYYB 1EMTH 1C5BH 4HUXB 1TVBA 1X3DA 4OLUL 1N59B 3DRQB 3I02B 4Y1AD 1J0JA 3LDBC 3OTTA 5HI3D 4IIQB 4NZTL 2VXVL 2DTMH 3GMQA 3PWUB 1N6VA 4WJ5A 2NY4C 3WV0A 3BPLB 3C8DA 1AGBB 4XNQA 4XC1L 2NY4D 4Z7OF 3SDCB 1T89C 3RDTB 5IESL 3W5MA 3VXSE 5IOPA 3FN0H 1HIMH 1KCVH 1ZSDA 3QPQD 3WO3B 2CDFB 4RFEA 3BGMB 2R1YA 2QV2A 2WNGA 4P3DA 4RWHA 1NUGA 5DQDH 4X9HA 2DM2A 4R26H 2JIXA 1YY8A 3ULVD 5JW4M 2F19H 5M94B 2A74B 3VXRD 5HHOA 3DLQR 5CWSB 1QHPA 7CGTA 5DVMA 2DQFB 4APQA 3RIFF 2GAZB 1NCWH 1MFEL 4N9GA 1VFBB 4FA8A 1KIUA 1LO3H 5J1AA 1I7TB 3D39E 3NH7L 3LZFL 4Q9BA 2D7TL 3E6HA 4KK6C 4QGTA 1NGZB 1X5GA 4C83A 4Y4FA 1OTSD 1D6VL 3OXRB 3NIDF 4LOUD 4YDKL 4BUHA 1PLGH 4Y5XC 3GIZL 1C5BL 4EI6A 4HUKB 4CADB 3MA7B 3O4OB 2YBRA 1CD1A 2A73A 4M8VA 4QO1A 5DFWH 4X8XA 2DKUA 3M1BB 4P3CL 4ZS7L 3IU4L 4MX7A 1RVFL 3P0YH 3QH3A 3P73B 2YD6A 3ME0A 3DVGA 4JN1H 4WTWA 2DLGA 2CXGA 4O58L 1JPGA 2DWDA 1HHKB 2EE6A 4B0MM 3GK8H 1BECA 1XR9A 1JGLL 1HKFA 3QO0B 4YWGH 3QIBB 1TZGL 1T7ZA 2BOBA 3UBXA 4M62L 2UZXB 3BMWA 3O6FD 4QRTA 5KSAB 2WINA 4F15B 3NTCL 1IFHH 3VXRA 1JI1A 4KU1A 3TJHD 1WSST 2EDYA 4LLUA 3FB6B 1FGNH 5BZDA 2G5BA 2NR6C 4KZDH 4IRJD 4MGXA 4JFQA 1NCWL 3T3PE 4XNZC 1G7QA 4IRJC 2H3NA 2F8XC 1VKXA 4EN3A 1F58H 1ZEAH 4UUJB 3TBWB 3HE7D 2KUTA 2UUDK 2BCKB 1BFSA 2R0LH 5C9JB 2ESVE 1DLHA 5J6HB 3EO9H 5SWQA 4XNUL 3DVIA 2DQEH 4IDLA 3UTOA 5MEND 3NCJL 3K1DA 1R6VA 2Q7NA 2VQUA 1U8IA 3MRCA 4HMEA 4G43B 4YHZH 1MF2H 3LMJL 3NCFB 1S7SB 4NHCL 5BO1L 5C3LD 2VJXA 4NBZB 2HMIC 4N5EC 1R5VA 2IBBA 2BVEA 2DQTL 3VWJA 4JPIA 4PRIE 3UO1L 2KQMA 5FYKL 1BOGB 2H6PB 4JPWL 5FGCE 5CMAA 2ZUQB 2VR5A 3KPOA 2CRYA 4QXUL 3SJVA 3U4AA 3H9HA 3VFSB 3TVMA 4QKXB 3WSQL 5ADOL 3RWIA 1BIIB 1UQSB 2XN9D 2D9QB 5KVMC 4N8CH 3WNLA 2RR3A 2BSSA 1Y18A 3IRZA 4JJ5A 4U3HA 4UAOC 3QNZB 35C8L 3O3DB 1KJ2B 4R90H 5BCAA 1AXIB 1YYLH 1A3LL 1F4YH 5F9WB 2Z8RA 5FGSA 1MFAH 3SKMB 1KC5H 5CFHA 3WUZA 3JV6A 3U1SH 1ITCA 4U1HB 4GKSA 2VDMH 3T04D 3P0YL 1I85C 3NGBB 1QVOB 3QFDB 1OSPL 5GGVY 1U6AL 4NDMA 1ZHNA 4XVSH 1AHWB 4UNUA 5IW1A 2Q7YA 1MCBA 2VUOA 2ZJSL 2AJXL 1FBIH 2YPLB 1C5DA 4N8VB 1LE5A 3MNWB 4EVNA 4LVEA 1IC5L 4YFDB 3NABH 4I3SH 1P4BH 5D1QC 5IHLB 2DD8H 3ULVL 2RHEA 1M05A 3UEZA 3CGTA 3QUZA 4WUKH 3V0VA 5ALCH 3S9DB 3EO0B 3WLWC 4BZ1L