2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
molecule keywords O-GlcNAcase nagJ
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
4IU2A 3UL4A 3GHPA 1QZNA 3L8QA 2VN5A 4DH2A 3KCPB 2CCLA 4WI0A 3KCPA 4WKZB 1ZV9A 2B59A 1TYJA 1G1KA 2BM3A 3FNKA 5G5DA 3F2LA 2ZF9A 4U3SA 4IU3A 2Y3NA 4FL4C 2W1NA 2VN6A 4FL4B 4UMSA 4N2OA 2XDHA 2JH2A 2O4EA 4UYQA 1AOHA 5LXVA 2OZNA 3BWZA 4UYPA 5AOZA 1OHZA 1ANUA 2VO8A 5K39A
chains in the Genus database with same CATH superfamily
5I0VA 1B2WH 3BOVA 4BHUA 4IBQA 3NG5A 5G5DB 1FYTB 4OBRA 1T83A 3T04D 3VDBA 3BPOC 3TNNB 4WEBL 2QBWA 2H45A 1WYJA 2P80A 4OKVB 2QFRA 4OUUA 5DRZA 1ZK5A 2ZOLB 3FQUB 3VTAA 2Z4QB 4C57C 2DQCH 5A6MA 3IF1A 1GH7A 3PDOA 1ODUA 3HC3H 4LVOB 1ET8A 1SMDA 2HWZL 2AQ3A 4AG4H 3IDYC 5J11C 5CD5C 1N6QL 1BV8A 2EUZA 3U9PH 1EXGA 1FV1A 2BVTA 2XN9D 2XIIA 2ZSVB 3P0VH 3QQNA 1RUAL 4UWQB 4MZIA 4OF8A 1KEML 1IL1A 1JHTB 4B3VA 1NKGA 2UUDK 1BYNA 4JY4A 3KYNB 5FGBA 2BNQE 1JFQH 3P9LA 2N0MA 2LE9A 4W6YB 2PW1A 2V9RA 3B9KC 5DK0A 5BVPH 4YDIH 3PGDA 1KIRB 1DLHA 3B5TA 3GRWL 3KLHD 2CJUH 3AABA 3O2DL 1QQDA 2CALA 4WU5A 4XBEL 3GI9H 5C0NC 1MPAH 5D93C 4DFHA 1PNCA 3V0FA 3MA9L 1WQVT 2GSGA 4NQDA 3Q1EA 7CGTA 4WUUE 1AXSB 1I1RA 2X6AA 2F61A 3AM8C 4H0HB 4ZUUB 2F19H 4MA1C 5I1EL 5HHXL 3GMRA 3FTWA 1G1CA 4P46A 2ZJSL 2XTJC 1N0XH 3DX7B 3ZKXB 2FNBA 1MQKL 4JQIH 4YAQB 2P26A 2Y5TB 4X4XA 5HPMA 2GJPA 5GS0D 2JQZA 3T3MF 5HDRA 2N1TE 2Y24A 3WKYA 2BO0A 3LXUX 3EOBB 1KCSH 3GSVB 4K8RC 4PUBH 5J9PB 1JWMB 3JV5A 3X11B 2ZKXA 2ICWI 2EE0A 4OTXL 2IXQA 1JF1B 4XVTL 5F7FA 4PHZA 4NOBA 3HCVA 1FE8L 3EH2A 1QUNB 3FQXA 3LSOA 1YN7B 3T1WA 3UTSA 5F0JB 2E7MA 5EWIH 1KPUB 2FK9A 3WEAA 3QUYA 4S1DD 1TLKA 3SBRA 4PJDA 3EYQD 4UTBH 5LCVH 3CDZA 3IDMB 2BY0A 3B7UX 2E9JA 1R5VA 2XN9E 2LR4A 2GW5A 2XWRA 5E51A 3RFRA 1NCJA 3L48A 1NUNB 4QO1B 5D2NE 3CFCL 5A2FA 4JHBA 4KZDL 1E28B 3LZRA 3ZZ1A 3BVUA 1BVKA 5AVRB 3AREB 3HHSB 3VNZA 1KXTB 1QKZH 2RCSH 4ZUWB 3EHBC 4G43A 3K2UH 4RSYA 5FGSA 2DH3A 4GSUA 3OKDA 2BDNH 1MVUB 5I1HH 1LWJA 4PGCB 1AO7B 1BQSA 2YFOA 2AKRA 2EEDA 3FONB 4PJ9B 4UYQA 3JBG7 3CZUB 3V10A 1S7SB 1JK8B 3SY0B 1I3VA 1NTDA 2F53B 4NJ9H 4DEUA 1ZWIB 2JKRM 1F56A 3X1EA 3QRFM 1N2RA 4EQ3A 5G55A 3WS6A 1YMME 5H37A 4OB5L 1EZSA 3NK4A 4HH9A 1OWWA 1N8OE 3BPNC 4EN3A 2QEJA 1NSNH 2VR5A 1CXLA 5I6OA 1U92B 4NZRH 1KN4H 5CZVL 4L3CA 3QC5X 4U3HA 4FI7A 5D7SH 2WSPA 3HRZA 4TSAL 5FHAL 2HTLD 4NZDA 4ODXB 4PJAB 4OJEH 3DJZA 5HGHA 2XWBA 3ZPDA 5INDB 4XZ4A 2WTPA 2VMCA 3BGMB 25C8H 1CF8H 3WENA 4ZTOL 4K94L 5AW1B 4M5ZH 5BCAA 3EFOB 1RFDH 4NO2A 2FQFA 5DVOA 4M6OH 3TEUA 5DFVC 1KFAH 3KPNB 4Q7DA 5GGTH 2EC9T 5EO1B 3QJRB 4ZMNA 1FDLH 3SE4A 3VX1A 3TA4D 3S96B 2PN5A 2VUYA 1NCCL 2O6CA 3N2JA 4AEIL 5DEZA 3ZRSA 4TPRL 4B0MB 1ES0B 3NH7L 2DD8L 4X8GA 4DO4A 2DWEA 2B39A 4P5KA 4L9LA 1TNMA 3U6RA 1S5HB 2DIJA 5EEVA 1S3KH 3NRFA 4HWNA 4HW6A 4Z7NF 4JHVA 5C0BB 1XCQB 1JXDA 2NY4D 3VG0L 4LL1A 1SYVA 1HL5A 4AXWA 2WXKA 4E42B 2OR7A 4P23C 2JELL 2VDPB 4UANA 3UZVA 4MJ4A 4N3UA 5FC9A 5KSAD 5F0LB 3EOYG 4ZX4A 5GRUL 2FBRA 3RUGA 4APXA 3FUHA 1BOGB 4GAJL 5CN1A 1TXKA 3QUYC 4KZDH 3O2VH 5FOJA 1C5BL 4GAGL 2AEQH 2WLHA 2GIMA 3GBNH 3WKMH 4N8VG 3T77B 2A9MH 4RIRA 3U4EA 4MAYD 2XXFA 3SO3C 3ZZQA 1LLAA 4J12A 4JFHE 1IGIH 2WO2B 2RR3A 4EOWL 4OJDH 2BY1A 5IFHH 4JDTL 2LAAA 4KMQA 2EUVA 4BZ2A 1HH9B 2YA1A 4JKPH 3VXMD 5JHDB 2C3WA 2NQDA 3BEVA 1TQBB 3PPSA 1K4CA 3EUUA 5E8DL 4QR7A 4OLUL 2H3XC 2YZ8A 4QXGH 5A2JH 5E4IA 5D5MB 1ZANH 4Y5YB 4TXVB 4YK4B 4AZ8A 2F2HA 4JVUA 3PQYB 1Q0YH 5IB2B 2OXGA 5I18L 3ZRCC 4XVUD 1KBGL 4B9GA 2VWEE 1MW0A 4MSWB 1A6PA 2R29A 4JDVA 1U4FA 2CGZA 2J8HA 2O5ZL 5GJSH 1JHLH 2L3BA 4ZOAA 5IFHL 2FGWL 5JA9A 5B1KA 4IBUA 5DDHB 1UB6B 4JO1H 3FMGL 3DXAB 3K6SB 3JWDL 4ZG1A 2OJZH 3VSUA 5E6RB 3QIUC 1TT6A 2X4UB 2CZNA 4FDWA 2FT6A 4JO2H 4APQC 3GUTB 1Y6MR 4F7MA 5L9DL 4AOFA 1U2YA 4KX7A 4Z3IA 2J25A 2LT9A 2WJ7A 4AIEA 1WC7A 3I6LE 3DETC 1F2QA 4WUKH 2V3EA 3VFUB 3BAYA 3KEDA 4F8OA 5LNDA 2YD0A 1BVKB 4POUB 4JZOA 1TVBA 1DEEB 3I84A 4ZPVA 1BSIA 4CADA 3RY5A 2QLVB 1AMXA 2FX9L 4PREA 3K46A 4ZX5A 3VI4B 3MBED 1E40A 2MTAA 1WK0A 4BFEA 5HHMD 1N4XH 5M95B 3GEFA 1UENA 3MLUL 4XOBA 1CYGA 4MXQD 4EJ1C 3JTSB 2X9WA 1AP2A 3S35X 3O4LB 3LHPH 5AYQA 5HPOA 4P2QB 4N0FA 4U6TA 3QDGD 1HNGA 1N8ZB 2WXJA 4WTZG 1LDPL 4QHUB 1H3VA 4KVCL 1WTGT 2Q7NA 3FO1B 4HPOH 4OJCA 2Y7QB 1M4KA 2HT4C 1VRSA 5E2UL 2IWGA 1P6FA 4NFDA 4FCHA 4I0PA 5HGDB 1U8MB 2NXYC 4K15A 1RZIB 5INDA 4EDWL 4ZTPH 4R4NC 4ELMF 2WBJC 1V7NL 2YLHA 1MIMH 4G70B 4YJZL 4Z7WB 1CD1B 1CD0A 4QTFA 3UP1A 4CVUA 4Z78B 4AYGA 2W80C 2XN0A 3ZDYF 5I1IL 3GIZL 3Q8FA 4ZBJA 1A22B 4NQEE 3S37L 3ARBA 4HIXH 4OVVA 4PAZA 2PP7A 1JF6A 2YAFA 5JPMA 2Z93A 1MCHA 4YHYB 5CIPH 4XH2B 3ARPA 3DOIA 1QRNE 2C9UA 3SDDB 3UPCA 2R1YA 4JCMA 3NIDE 5CJQH 2VQTA 2GSMB 4XMPH 1NGQL 4J4PA 3V5DB 5DURB 4JO1L 2HLFD 5GRYA 2G3XA 1VACA 4JRWA 5CEYA 4PP1D 3WD5L 1CGSL 1VKXB 4OM1H 4M5TA 3MX0A 2Y7LA 3CE1A 5C92A 3ZUCA 2J55A 1JZEA 1L6PA 1P4LB 5DO2D 3TV3H 5DEJA 4A68A 3SBWC 1G5AA 1IBGH 1ZGLB 4GBXC 1CDYA 3T0XA 1ZEAH 2CDEB 2VC2H 4UI2A 1OAUH 4JZNA 2AK4B 3M17B 3PGCA 1WFNA 5EB9A 2IIJA 4GOSA 4PJEE 3L3JB 4DGIL 3GHBL 2BC4B 2HT2D 4J3OF 2EO9A 4HWBH 5KVDL 3FULA 4JL2A 4L4TA 4N8VB 4YHZH 2V2XB 3T0VA 4U49A 3H1ZA 4RISL 3SDCA 4DZ8A 3NK3A 5ESAB 3EYSL 4KMLB 1CT8B 4JKPL 4XVJL 4K4KA 3G5YB 3ATBA 3LH8A 3S3BB 3U1QA 3B6SB 4HU8A 3CHXA 5DXWA 1S9WB 5CEZE 3IJEB 4LCCA 4X5RA 1XGPB 1N4XL 4MCZA 3MA7B 1BLNA 1RK1B 2AXGB 1UACL 2ITCA 2Y9RT 2YD7A 2MHAA 1E9QA 4NWTL 4P2QE 1QLFB 2IAMA 3BT2H 5D5MF 1MG2C 1IZJA 2QPDB 3LOWA 3MV8B 3WXVL 3H56A 3Q6FB 3IGUA 5DZPA 4LKXA 1GYWA 4TTDD 1XZ0A 2OS7A 5D7EA 3ECVA 4OR1A 4WUUD 3RI5K 3ZTNH 3V6ZA 2I85A 4HV8A 1EGJA 5KBPA 3LKOA 4L0ZA 3WIHL 3DX9A 5GJTH 1P5VA 5B3SB 5ADPH 3QNYB 3ZYIA 3T0BA 1X4ZA 3TIEA 2FJSA 1JHKH 2Y2YA 3BRGC 4FXGB 3F5WA 4PJXF 3SGEH 2WQRA 1PKQB 2GFBA 3DMMC 4HCGA 1IJ9A 1VGEL 4OJFH 2CDFA 1A4JB 1KPRB 2X2UA 4JRYA 1BBDH 4QT5B 2BWDA 4LRNL 4Y4KB 1OM3L 5CP3H 3RUGF 1XF2B 4IGBD 3T8MA 1UXWB 4XNDA 3GK8H 4OZHE 4LT7A 3JWDH 3VSTA 2XICA 3MC0A 2PYEE 3DUSB 3DK0A 2QDWA 1BQ5A 1UHVA 5ICUA 3T4AA 2RACA 1CI5A 4F20A 2W9DL 5ERWA 3VSQA 4BFKA 1M05B 2M83A 5LO7A 1XSOA 1VFBA 4K9EH 4MA3B 4A6YB 3HRZB 4TLTA 1NEPA 4JFFE 2RTTA 3U6XS 5T1JA 3HHRB 1EAPA 2J6EH 5EDXA 1XD0A 5I74B 3KPQB 4UILH 3ZR6A 1HIML 4X6EA 1NCWH 4BFGA 3KWWA 2HFTA 2WXRA 1B0RB 3O6FA 5DJXA 4ZTOH 3ETTA 1M57B 3QDAA 2NSMA 4LOUD 3J2PA 4PJCE 1ADQA 5EOQH 1KF9B 2ZYIA 3GSNB 4XB8A 4Z3GA 4DW2H 3KVDD 1A4KA 3SBWA 2BP8A 3S97C 1TUPA 1OW0C 3I75B 4NQUA 2YUWA 1RHFA 3N41F 2NNFA 3BQUB 3TL5A 3TONA 4XVJH 1E4KC 4OJYA 2HRHA 3TIDA 3QIUD 5KZCB 1S78C 1CFQA 1K5NA 2DQFB 4HMCA 5C0GA 3KWTA 3LN4A 3QNXA 2Q76A 2JELH 2RQEA 4Z76A 4B41A 1ESOA 5DZOA 3ZUNC 3GIZH 3L5JA 3JZYA 4G71B 5JHMA 2V7HA 4I3SH 1CU4H 2XJKA 3S2AA 1DDHB 5DR5L 4H8HA 4PJIB 2J88L 2R1WA 3UC0L 3X13A 3OZKA 4W1TA 4PYGA 2Z93B 5JIHA 4QRRD 2HKFL 4N0YL 4KPHH 1NIFA 4KU1A 4LNRB 3QAZC 2H0FA 3P73B 5ESQA 1A7NL 3HZMA 5AFAA 3MRIB 4ZFZB 4AKOA 4GNKB 4AE1A 2WP3T 4B7IA 5I15L 3CHOA 1BZ9A 4X9GA 3QH3A 4H1LB 1A9EB 3PXHA 4G8GD 4AH2A 4AQ1A 4B60A 1N5YL 1R0AH 1IC7H 3R0MA 4GRMA 4IMKC 4N8CL 1U8JA 4GSRA 4UNIA 4P2RD 3QWOA 3FT4B 4ODVL 5CD3B 3AG4B 5A16B 3W1ZA 1PQZB 4Q52A 4IMLB 3V95A 1T21B 4APQB 3OB8A 4PRHE 2XACC 1U3ZA 4E9YA 2QKIC 2F08A 2DWDA 4WFFE 1AO7D 3G5XA 3RBSA 1RURL 2W0FA 5DD3L 3H4HA 1U21A 1VDGA 4GSQA 4B50A 1LK2A 3VI4F 4YSQA 1U91A 1RHHB 3LV3A 3T4YA 5FGBC 2IV8A 2J12B 3IN2A 5EG6C 1M1SA 2PWHA 3NEOA 4QOKE 4CSSA 2NT0A 4K3EL 4NQED 4X42A 4OLYH 1KYOK 1TQBC 2ZOKB 4OCWL 4K7PL 4AW7A 5BRZB 5FGCE 3FCTB 3HC4L 4HZLA 3D25A 3MV11 1AS7A 2X7LA 4CVZB 2EYRA 1P84K 1ES0A 3BE1H 2CCWA 4WI3A 1CB4A 4XNXH 2AF2A 2BVOB 2X6BA 3GMQA 1RUAH 4QHLA 5H35B 3UJJL 2XWJA 1QEWB 1E3FA 1ZA3B 2F53E 4LAQL 2PKDA 1DJSA 5JR1H 4HGWA 5D4QA 5HYJB 3P4OB 2ZXDA 3EOBA 3OTTA 1QLEH 3OAUL 4X5XB 5DI8B 1MFNA 5HY9B 5C0FB 1S7VA 2PPAA 3BJ91 2XWXA 2TRYA 4XPFH 4XI5C 3IFLL 3O0RL 4UOW0 3LQZB 1E5AA 2DIEA 4L5FL 3B9VA 4X8CA 1NUFA 4ONHB 1UWGH 3VI3F 4N5UA 3STZB 3CFEA 2HFFA 3RX5A 4DP9X 3T6QC 2PCFB 4HS8H 5IM7A 5FO8B 2OZ4H 2ZCHH 4AKPA 4F33A 1KPVA 1OSZB 3H9SE 4YWGH 3VWKB 1D7DA 5AENA 1Z32X 3QRGL 4OU3A 2DM2A 3E3QE 4KJPD 1QLRA 2FATL 2GJZB 4YE4H 1AANA 3LXCA 2KI6A 4M3JA 2F15A 3JTSA 1EEQA 5KJRH 2P24B 2P5EB 3TT3L 4PRPB 3TF4A 3IU3A 3UACA 1HSAA 2MPVA 5FS5A 3MNVA 3NIFE 1QI4A 4FXKA 5JW4M 1CGUA 1QSFA 1S7WA 3HC3L 5JXEC 1OB1A 3SDAD 1KXHA 1XR9B 3G6AA 3V6OA 4IBVA 1RJYB 1QRKA 4GMTH 4Y8AA 4KROB 2MCG1 1N2RB 2VDKL 2JLLA 2Y7OA 3DKHA 4GP8B 4HH8A 4NQSA 3FB7A 2ZXBA 2AI0L 4JBSA 1UH3A 2CO6B 4P9HL 4W4OC 3IDXH 5B7EA 3TCTA 4WZ9A 2BSRB 1KENL 3PWLA 1Q0XL 1S7RB 3KNBB 3MUZ1 4M8QA 4F7PB 2DB8A 2D2CC 1AKJB 1X5YA 3CIAA 4KK5C 3WBDA 6PAZA 1IB5A 2HG5A 2F74A 1MI5B 3QNFA 4LEXL 2DI8A 3OZLA 4TUKH 4A7GA 4PYHA 1VPOL 1G7QA 5IB4A 4KV5E 4L8SA 1UQSA 5K39A 4UQ2B 4UV4L 1D5ZB 4WW1B 3ULUL 2CA4A 5HHOE 3UAJA 3QUKA 4OFKA 3P4MA 1D6EA 1MCKA 3RZCD 4XBGA 2MKLC 4HBCL 4WWOA 5T1KD 4Z0BL 1DN2A 2OMUB 3NA9H 2D9QB 1F18A 3UTZB 4BKLA 4JRYD 3H55A 5F9WC 4G83A 3ZE1E 2R51A 3EFOA 4DZ8B 1RULH 5DHYB 4FQXC 4NPKA 3JWNH 1RK0A 3BLBA 2OR9H 4UQ3A 4WEMB 4YR6A 1OWRM 1JXFA 4Z7NE 1ID5I 3GDBA 3O4OB 3QQXA 4NQDD 4BA0A 1ZSDA 1CDUA 4GG6F 3LEVL 1CCZA 3AU1B 4AXWB 4R96A 4P05A 2WGNB 2G0KA 2VZUA 3GBMH 2QVFB 4WHTA 1J8HE 3OD3A 3PJSB 4ODWA 1IGFH 3QI9A 2EIMB 5JUEL 1MJJB 2J2ZA 2XNAA 5KTEH 4JFWA 2NPLX 2PMZA 2XVLA 3PCYA 4U6XB 3DVNA 5F89B 3RFZB 3KJ6H 3LN5B 4JG1H 4PCSA 4ADGA 1MLBB 1T5WA 3T77A 3U4EB 4LP8A 4DK6A 4XPBH 4NBXB 5EIIA 3VD1A 3IMUA 3SOTA 2WLNA 4TYUA 5CUSL 4LO9A 2KERA 1G9ML 1LK2B 4R4BA 4MA1B 3WFDL 2ZOOA 3WO4C 2L4OA 3MROB 1NC4D 5ICXA 1NGYA 1QMUA 5E03A 1FCGA 4MX7A 3FMGH 1PLGL 3RU8H 1A7OH 2WZPD 5FYJE 1E5ZA 1JV5A 2R56H 3T6ZA 1OCZB 1DBBH 4HQQL 5DC9B 4HGKC 2YMTA 3D2UB 4NUGH 2VMJA 2DPKA 1UXWA 5KAQG 3TU6A 2YQBA 4M3HA 4KKAD 1PY9A 4D3CH 1G9HA 4KGLA 4FC3E 4MSWA 1JYWA 4A04A 4JFPA 1ASQA 3IFOB 2XRAL 1JYVA 2XZCH 4HD5A 1U8OB 1RU9L 4ALAC 2CRYA 1OAYH 5E6SB 2EDTA 2QADB 2ZWLT 4Y5YA 1CI3M 4A6YA 1Z9MA 4XXDB 4TLKA 3TN0C 1PZSA 3VJ6A 5JPNA 4R84A 3IXTA 2IQ9H 3KBFA 1EHLL 4Z7WF 5B39B 1GGBL 3OWRA 2QQKH 3TJHC 3VU2A 2JVUA 1C16A 5AVSB 2YD1A 3D0VA 1QQDB 4QD2E 3VH8A 2B2XH 1JGVL 4RGMB 5DS1A 2BNRA 1FNAA 1ACZA 4LLUA 5MEPB 2YD3A 3GHBH 1PVHA 1EBAA 1RPKA 1ZHKB 2AQPA 4Y2OA 1TEGA 2AJUH 3V6BR 1ZT4B 3EHBD 4D8PA 1CICB 5HHPB 1U42A 4P2RA 4QWWC 4S0TD 4B9JA 1XH3A 2WO4A 5HHMB 1AAJA 1J0HA 3NJLA 3V9CA 2ATKB 3RE0A 5JIMA 1OCCB 5CP3A 1P1ZB 3L08A 1HE7A 4APQD 1DQLH 3LKOB 3O2WL 3U7AA 2DKMA 2H2SC 3KLSA 1BQHA 1HKLH 4IRSB 4AKQA 2FJUB 5KYWA 5EBLB 2ROYA 1P5UC 5FO9B 1AHWB 4S1DC 4ZJ9A 1ZV9A 4WKXA 3HJ0A 5F3HB 4U6VL 5D7JA 4YNYB 4I88A 1YN7A 5B4MC 4P59H 1V3KA 4U7SA 4J27A 1J0IA 2BOBB 4FFVD 5B4MD 4HKXB 4KJWD 5E8NB 3ECUA 4C56A 1MI5A 5GSVB 1T20A 2XY2A 3KYAA 2CBMA 4KFMA 1VCAA 1FZOA 3QUGA 3QHFL 2VABA 4P2OB 4HCRA 5IOKA 3NN8B 3U0TB 3BWUF 4N5EC 2OMVB 4A2FA 1SOSA 2K1MA 1WF5A 2FEJA 4OGAD 1J9TA 1H3PL 1AFVH 3F2LA 4P5SA 2PR4L 1VEOA 3WTYA 1BOGA 5F9OH 4PGCA 1FSKC 2YKLH 4FFWC 1NKOA 5IW3A 2X4OB 3KWXA 4H5SB 2EIDA 4M5YL 1C5CH 3DGGB 4PGDA 4UIMA 4X6EB 3SGDH 2P4AB 3CU7A 4HIIA 3AT9A 3F7LA 1IAKB 2P8MB 1NBZB 5IMOB 3DOSB 1JVOA 2BHFA 2G75B 3LZPA 4JO3H 3VXRE 3WDHA 3GHEH 5DYOA 2CXGA 5JW3L 3EYUH 5IT2L 3BSZH 4XO5A 2VDMH 2ZOKA 4K3HA 3D3VE 1LQBC 3RGVD 4LU5L 1A7RH 1LNUB 3I50L 2X7LB 1RP9A 3UGXA 3KJ6L 4JG1L 4GKZA 1KBPA 2R2HB 3J8F7 4GRLA 2VDKB 1KOAA 1EBPA 4HK3N 1XAKA 4RDBA 2ADFL 2D7MA 4DKFH 4JREC 3OKMB 3KS0J 1IFHH 4G8AC 4O2CB 4H8VA 3RWGA 5C0AE 1S7XA 2EE3A 3SCMD 4PHXA 2QQLL 4X7TA 3GZQA 5CWSB 4GG8B 4PJFE 2LGNA 1N6UA 3KPTA 3CMOH 2WN2A 4XHQA 1MAKA 1NWPA 4NLHA 5LUMA 1YY9C 3LQZA 4JKMA 4YLCA 4YWGL 5I26A 1CG9B 1G7HA 1MN4A 2J6EL 3QCVH 1QNIA 1A6ZA 1I3RB 1NCBH 5J6GA 3OMNB 3FSOA 1SYSB 2H1LM 3QR1A 1HINL 3TEWA 1J7VR 2NY5C 3D39A 4MNQD 3QGVA 1XEDA 2X4PA 2XG5B 1F3DH 2XQ0A 5E9DA 5AAMA 3K1KC 2YXVA 1JVLA 4ACPA 3JWOC 3QRGH 5TE6L 1FGVH 1ROCA 4QHKI 5FUOH 1RU9H 3AWEA 4JREB 4ZSOE 2MHAB 1KLGA 2A6DA 3R7QA 1I7TB 5B38G 4AMKH 5T1MA 1P7QA 5IHBA 1JZ6A 1B3JA 3GS7A 3KYKL 1R4XA 2ZPKH 3LYRA 5FYJU 1TETL 1X6LA 4OCLC 1FNFA 1BVLB 3O2DH 2HFEB 4MGXA 2ZOTA 3U48A 2IDTA 3D3VD 5HI4D 1SN5A 4ZMPA 3QYNA 4X0KB 1HAWA 4KX9A 4X98A 5I8OH 5B1AB 5I6LA 2Y36L 3F58H 4RSVA 5ADOL 3VI3E 3Q3GB 3MLTB 4ZW7A 1HNYA 1WIOA 3FRUB 2QTVA 2ZNWA 3U7WL 5CJBA 5D7IE 5HXMA 2EO1A 3V4PB 4PIRF 5DMGD 1JERA 3VDCA 1JI1A 3G9AB 3ZHFA 3SQOL 2YR3A 1UYWL 3TZVC 1B2YA 4O9HL 1NPUA 2NSXA 4BE5A 2AEWA 2JNZA 3SZ6A 2EDJA 1Q0EA 2VSCA 4U0RB 1X9UA 2HAZA 2CO4A 2X4SB 3C5ZD 1OHZA 3RPIA 2FSEB 4X83A 1S8DA 2CD0A 3D51A 4WW1A 1HL8A 3AAZA 2Z8WC 4D0DB 3GGWA 4K94C 1MJ7H 3ZL2A 3GKWL 4DZBB 1PYWB 4PWFA 2UY7B 4Q74A 5GZOD 2NTSP 3DYPA 2WOBA 1LDPH 1B4JL 4OZGA 2H1PH 3THMH 2DS4A 2R8SH 2GTZB 4MNQE 4XCYB 1RURH 2DJSA 3QG7H 1NAMB 1XGUA 4MD4B 3RFZC 5BW7C 5F93C 1G7LB 3BP7A 1YYMH 4Q6IC 5I16A 2C3VB 4ZXBC 3IFLH 3HB3B 3NEXA 1HHJA 1UD6A 3SKMB 2CO1A 4I77H 4ZMAT 2IALA 8FABB 5FW6A 2LU4A 4F24A 2OTPA 35C8L 4XVSL 2AQRA 4F5CE 2HFGH 3VMNA 3ZO0A 4GMSL 1AS8A 1E3XA 4Y2DA 2IPUK 5ICYB 5IG7A 3C87A 3OG6B 4D9LH 3ZE2F 1MHPH 3DO7A 4XB3A 4AQOA 3WFDH 2E6PA 2IFFL 1MWAA 4FQJH 4OB5H 2WWMC 2BK8A 4MDRA 4Q6YA 4PS7A 4R2GC 5K9QI 1VJSA 1R6VA 2NY1C 4ELDA 2FO1A 2QJDA 2VDML 3VYOA 1BM3L 3I6GB 3LKRB 2CJSA 1YYLH 2H0JA 4L18A 4MJJA 1XGPA 1H5BA 5DSCB 4Q9QL 1DQIA 4UV7L 1QD0A 3ROOB 1INEH 2R4RH 5IHLB 4NPJA 4JFXB 3UYOD 3S3DB 4P46D 2DWDB 3PYCA 3PWJB 5I2IA 4DEWA 4BRVA 3D0AA 2V9UA 3MBWB 3MRGB 7PAZA 1M7DA 3U0WH 4ABWA 2FJHA 2LLGA 2VQ1B 3PGFL 4M1GH 5DD0H 4TNGA 5FR3A 1F6LL 5FFLA 3WTWA 3P11L 1Q4NX 3U36B 3H8NA 1RJZA 4G8GA 2HG0A 2J72A 5I15H 4EI5B 4IDJH 1IEHA 2GFBB 4H8QA 2EIEA 3HG5A 4IU3A 2CDFB 3Q06A 4IEFB 1SDDA 2FEDC 5LCVA 4J3OG 4CVZA 3DV4B 1T2QL 2TSAA 1SN2A 4PMEA 4EOWH 5EUKA 3C5XA 2VR9A 3TJHD 3WFCL 1GYVA 5J5EA 1IX2A 4UINH 3SSGA 2Q1EA 1I9IL 3TBYB 1MWAL 4RX4D 5E6UB 4J3WA 2Y5QA 4XNQA 3UIZA 3RVTD 2W9EL 1I7TA 1D5IL 3FO9A 5HD8D 1F00I 5FECB 3KL0A 3VXNA 1OGPA 5T1DH 4X8XA 3KLLA 4XN9A 4W9CC 2OXGB 4QRQA 3MA9H 3S98A 2WINA 1GGCH 1O5PA 3OLDA 2RJMA 4RWYH 1JV2A 2CUHA 2VXQL 4F2ME 2CKBA 3I3BA 5ADOH 1CT8A 4LPUA 4CC4C 5H37H 5BJTA 3G5YA 3ASWA 2Y06H 2WTOA 2FCBA 5C3LD 5GJSL 5TH2A 2OTWB 4QGYA 3ILQC 2LTQB 3CX5J 4KWUA 1ZTMA 4N90D 3M7FB 4LLDA 4KC3B 4X80H 5EV7A 4LK4A 2XPGB 5L2KD 1PZBA 3HIZA 1KXVC 3ARQA 3ZKNC 1TITA 5IHZB 3ZDXE 3UEQA 4HFWA 4JR9H 3QFDB 1PKOA 1SDAB 1OTSC 4JZJB 1D5RA 1A6VH 4NKIH 5ALBH 5FCUH 3EYSH 5I6XB 1CMOA 1SOXA 3HKZA 4TL4A 3RPIB 2ZCHL 2P24A 2ZKHH 1H0DB 2YQGA 4RMQA 4I87A 1FF5A 2MEJB 2WIIB 4ANVA 4WNJA 1A3RH 4MQXC 1D7FA 2DQIH 3T3MB 3VG9C 4TS6A 3C9NA 1T1XB 2UWEB 4LHQB 3TESA 1U8NA 3MGTA 1NLBH 4Y0GA 4EPSA 4JG0H 4X6CA 3E3QC 3RUGE 3ZOAA 3UTQB 1X5HA 1UJ3B 3ARSA 2BVYA 4HUNB 1KSRA 3S37X 4KNTA 4Q97A 2NY2D 4Z77B 1BAGA 5FLVA 4FFWD 5FO7B 4YSAA 5CCKL 3L7FA 4Y5VB 1NFIB 1Q1JL 2J1ZA 5KW9H 3OMAB 5MHSD 1R9FA 4GKLA 2BZDA 3SE3A 3VTMA 4EN3C 4JN1H 2NY3C 5K9KB 1HZKA 5KOMC 5CCJA 1JCKA 4XMTA 4NQTA 5H8DA 4EKXA 3IDJA 3KPSD 3WTUA 4PB9L 1YPZB 3IPFA 1J10A 5JR1L 4QRPA 3RWHA 4OZFB 1K8DA 4K7FB 4W9HC 4ETQA 1MCCA 4KH9A 5C9KA 5I1CL 3ZMEA 3TBWA 2PTTA 3ESVF 2WKOF 3GF8A 3FQRA 1B0RA 3FS9A 5DJXB 5FYKE 3WUWA 4PJ5D 1OARL 2H5UA 5KYWB 4NJAH 5TJWK 5CGMA 1A1OA 2E47A 2E9WA 3QBTB 4ENZA 4KVNH 1G7PA 4NRZA 3CUPA 3V7AG 4HCRH 3VXUE 3HG1A 4B0MM 2P5WB 1ZHLA 25C8L 2VYRE 5IESH 1QFWI 4Q8BA 2UUDH 4Y9GA 5LN4A 4UT9A 2A7BA 4FFZH 3UADA 3ULVE 1AD0A 1DUYB 4ANXA 4E68A 2DBJA 4DEPC 1RZJH 2ZP8A 3BQUD 5EZIL 2V2TA 3M8OH 3T2QA 2N7AA 5ENWA 2X87A 3OAYK 3W9DA 2H6PA 1A14H 2D7PA 2CBOA 3TN0A 5JPNC 4AM0A 3IJYA 3UJIL 2MJWA 4X9HA 4UDTB 5IBTL 4CUCA 1KXQE 3MRMB 1ZLVK 2LOEA 1KLGB 3CBRA 2Z91B 4TLSA 2WYIA 4WI9A 4CSZA 3CG8A 1IAIL 1I1AD 4L29A 4U6XA 1X5LA 3ARGC 2EXSA 3KYNA 5FDWB 4BFNA 2F5BL 5ESQB 1QTYT 1WA0X 3AC0A 4X6CF 2G5UA 3WNIA 4ZMQA 5T1KB 3ZE0F 3S5LG 4G6ML 4N0RA 1A9BA 1PY4A 3PQYA 1PZUB 1EZVY 1GR7A 1IAKA 2P8MA 3OPZL 4N6QA 4I13B 4NO5B 5E6IB 1LO2L 1HQRB 1VA9A 3SGKA 5GGQL 1A6TB 1K72A 3NFPA 1RZQA 4JHZA 4J3VA 2FL5B 1MW3A 4M7JL 2VWEC 3QRLA 5FA4A 3M6DA 2A9NH 4OLVL 1MCIA 3CN2A 3B9KA 2NXZB 2N7SA 3MV9D 3WFBL 2A73A 2AEPH 2ENSA 1JK9A 4Y2DD 3H7BB 1PMYA 1PLAA 2X1OA 1EJOH 1OGTB 1JYNA 3IMRA 3MFFA 5EO9A 2XQYG 2VSDA 5C0DA 3KPOB 1DYZA 1OPGH 2NDGA 1IKNA 1L9PA 1MCLA 3COOA 4X6FB 4F9LA 4GRLC 5CGYD 1BAFL 3V4PL 3QHZL 4RGMC 2A77L 5KJRL 2VXQH 2ZCKH 3FO0L 4PTUB 5F6HI 3RDTD 3N9GL 1AIFB 1EEYB 1TPXB 3MR9B 4W9IC 5AKVA 3V5HB 4S1SH 2YO3A 1XF3B 4E41B 1I9JH 1E65A 3OR6B 3WS6C 3ABLB 3MUHL 3V2AR 4H8WC 1FSKB 4Z7OB 2LU5A 1MFCH 2X12A 3CLWA 1EJOL 2HRPL 1A5FH 3WXWH 5CZXD 3T3PF 4A39A 3U30B 3P4OA 2R0WH 2DYPA 4KOCA 3UX9B 4P5RA 2BNRB 2BS8A 2IALB 8FABA 3K7UA 2IH9A 4M29A 1P4IH 4NUJB 1DVQA 1F1GA 2RHEA 3AY2A 3QJFA 3KG5A 4R0LA 1YMHA 2ESVA 4G43B 2VDPL 2E3VA 1JZDC 1P7KB 1RZ8A 2E75C 3EG9A 2GYSA 1ZVSB 3O4LD 4X7EC 3LKPA 4IDLA 3K6DA 1KN2H 3BAWA 2ZONA 3ABZA 2EINB 3WE6B 2QZ5A 1X6NA 2ZG2A 3KVPA 5ECGA 4WWKB 3MU3A 3TEXA 3ARYA 1IKNC 3WIIH 3IM1A 5KJ4A 4C55A 2NMSA 1A8JH 1SHSA 4WSKA 1IAIH 1XHHA 5JOFA 3L4ZA 1FZMB 3EXJA 1U3HC 4PWIA 4X4YB 3NN8A 3U0TA 4TSBL 4QRBA 1DQVA 1M71B 1UC6A 3IFPA 3MBEB 4KY2A 3TH2T 4JHWL 2CUAA 1J9CT 1JPGB 1YPZF 3NABL 1R5WA 3STLB 5K1JA 4CN1A 1FL3A 5GXBB 3MLWL 3QI9C 1S7UA 4JPVH 1IGCL 3II3A 4OCXL 4QRPB 1EA9C 2YK1H 4ACTA 2ORBL 1NAKH 4XPHH 3EZJB 3SDDC 3WNNA 4EI6B 4RZCB 1IBDA 3BQVA 5FYLH 2DD8H 3K6FA 4PVMA 4U1HA 2CRZA 2NNCA 3IGAB 4DGVL 5E1AA 1TVDA 1MJ8H 4LESA 3AB0C 1FNSH 4JRFA 5JW5B 1OSYA 1INDL 1QHPA 1NGWB 5ID1B 4ZUTB 1E6OH 4TRPL 4IRZH 1LEGB 4PJHF 3T0EE 4NZTH 4J3UA 5E1GA 1D9KA 2IAMC 2RMNA 3QPQD 5DJDA 5ITBH 1RZFL 2CIIB 2Q2LA 4BFFA 1AZUA 1IE4A 4I9XA 1D7BA 4M8UA 3HS0A 2BIQA 1HYRC 1U8KB 5I8EB 4LBEB 3WNMA 3VGEA 1AQHA 4UYPA 4UMGA 4XVOA 3QCTL 1KYOJ 1CFNB 2VAAB 2ZWZA 3MTRA 4O2CA 4V2CB 3SQRA 1C08B 4B9CA 1ZLUK 2DKUA 2XG4B 1GGIL 1U8CA 5I73B 3VA6A 3V6FB 3V79C 1MH5A 4WI5A 3KMDA 5CF3A 5LBSA 4ZNEA 1KB5H 2X0UA 1C7SA 1E4JA 1RUQL 1IQDA 1YMMA 1LNUA 3M8OL 3D05A 3G08A 2M2DA 3BMWA 3O9WB 3JUZA 3OGCB 2IH3B 3PV6A 4UTBL 4HDIA 4BQBA 5DURD 3QIBA 4K23L 3DDGA 2DIAA 5JHDE 4NB7A 1R3HB 4Y1AD 4URKA 2WINB 3HC0B 3Q6GH 3LS5H 4LPTA 3UG4A 1S5IH 3P3SA 3CSBA 1BW8A 2VXSL 3IJSB 5AOIA 3SN6N 3TO2B 3K5SA 2GT9A 4QXWA 4AYBA 4WK0B 1F90H 5IOPB 5K9QG 3GM8A 4AJ0A 2X44D 3GXFA 2E8YA 3FCTA 1P5VB 4HZLB 3RL2B 4XNUL 4WEUD 2YAEA 1K6QL 1WCBA 2AMGA 1GOHA 3B9KB 4ZUSA 5LLIC 4ZMTA 2P46B 3AY4A 4XODA 5H35A 4Z7OE 1A4JA 5MERB 4TL5A 3BI9X 5CCHE 3H53A 3DK2A 2IANE 2VLRD 3N5AA 1BYOA 3EFFB 4YL9A 4DTGL 1VLXA 4WV1C 3RZCB 5AOJA 1KJ2H 3Q8BA 1J18A 4ZUWA 2ZUWA 3DXAD 3FTUA 4NKMB 1HXYB 4WO4D 3UYPB 2ADIA 4H2CA 3VQ1C 2C7UB 1I4FB 3L4UA 1T0NA 4PRBB 1FFTB 1I1CA 3DV4A 3FU3A 4L1BA 4I1RA 3MODH 4FQIL 3WY4A 3SY0A 3QUXB 4UTAH 4PY8I 3PNRB 4GW5A 4EBQL 4J8QA 1R19A 5CZRA 1WC7B 2DI7A 5E6ID 2NUTA 2DN7A 4RZKA 5INCA 5LJYH 1YY9D 5H37G 4WWKD 1F58L 4AVKA 4BEIA 2FSEA 5L0QC 4P2OA 4KNQA 4JHAL 3ABMB 3CC5B 2B59A 3KDMB 1BF2A 2WSDA 5LAXA 4HOZA 3OR7A 4HJGA 3S8WA 1U8IB 3VXME 2Z0UA 4BKSC 5GIRB 3H9HB 3IKCA 5ACMA 2R0WL 4F7TB 4IGBB 4FFVC 5A2IH 4DW2L 1CXKA 5B39A 1MFDH 4YBQD 3ZL4L 3WSQH 2R27A 4K7FA 3SO3B 4H0IA 3FUIA 2NOYA 1C16B 4QRTA 2GITA 2XXMB 4OIAA 4UF7C 4BFOA 1G0DA 4EUPH 5HYFA 4NO2B 5CBEA 1RKRA 1QACA 3ULVD 3HZKA 4Q56A 4RWHA 4HSQA 2CO6A 2UYLB 1AXTH 1T4KA 4ZUVB 1KZYA 3UTTA 1DSYA 5JOPE 4Y1SA 3WMPA 2IFGA 4AX3A 1BZEA 1UKTA 2F54E 4GAGH 3RWJA 1Z9SA 4KO5A 3DO7B 2DEXX 3D4ZA 5I1EH 5D2NC 3MV9A 5EC2A 5FDYA 2WLIA 4K2UH 3V4VH 4CU6A 3C2AH 3C6LA 1S78D 3OKEB 4ES8A 1LO3H 4M7LH 1IBYA 3P77A 4RMVA 4X5PA 1HWHB 1JDDA 1X9RA 4GEIA 3VFNA 4ODBD 4TNWF 4L37A 4J3XA 4X7FC 1N18A 2AEQL 3MSPA 1O0VA 4KAQH 3RAJL 2JXMB 1E3ZA 2NXZC 3RUGB 5D2LA 3GLAA 5KSVA 1VENA 1HHGB 3CZLA 1EJFA 1PD6A 3BP6A 4PRIE 3V0WL 4FQHB 1VFMA 4IMLA 1Z3RA 4IRJC 3LNFA 1EAQA 2M8XA 4FNPA 1SBBA 1YEGL 4KJYB 4C58B 5IMLB 5DT1L 4MJIB 3LNEA 3ZSSA 4R5VA 3TOPA 1Z1WA 3P3TA 3FUEA 1H8LA 3VB8A 1KYUA 1OAXL 4B53A 1H6UA 5FYLE 2OMVA 3S5YA 2EILB 5DUBA 2FHBA 5TE7H 1PEZA 4FNTA 1U3HD 1UD8A 4DQOH 3QIWA 1QEXA 3ISYA 43C9B 2F5AL 4QRAA 3QEGL 4XN4A 1YEEL 4FD0A 3H7BA 1H3XA 1ADWA 2IQAA 3RWHB 2JB5L 1UTDA 4L5FE 5JOEA 3QUZB 1JNLL 3L9EA 2O6PA 4UV7H 4M7KH 4AGNA 2VXSH 1V3LA 4KXAA 4PG9B 5KOVC 1NIAA 4K3GA 4AL8C 3MOBH 1CICC 4OZFG 2YKLL 3ARED 2E6JA 2RB8A 1MSPA 1QI5A 5EU7C 5IVXA 3N1QC 2VRQA 4JFHD 3IGKA 3O8XA 1KC5H 3MA7A 1WH0A 2LHAA 4NFCA 5D4HA 1ACCA 3MAWA 4UT7H 4XC3L 5FKPB 5FOBB 5B8CB 3CPUA 3MMEA 2Y22A 1WZLA 5FKAA 4BSVA 1QFUH 5GGRB 4WI7A 4PJFF 2H6PB 4AM0B 3TT1L 1KTLA 1HWGB 2V8LA 1YZZA 3PABB 4JN1L 3QJTB 4AIOA 4OZIB 3CZJA 2OTWA 1A6AA 4RNRA 3SDXA 3VXOB 2VJ8A 1KGYE 3S4SA 4M7LL 1JGEB 3HLAB 2UXFA 5HHQB 1KIQA 3VWJA 3U4AA 4UT6A 3MRFB 1BXAA 2Y5EA 1QRNA 2P5ED 4QHPA 5J6GB 1SJMA 5JHBA 3Q43A 2VLJE 1KTCA 5DGQA 2XV2A 3UJIH 4KKCC 5AVWB 4WTQA 1FPTL 4ZMOA 4MAYA 3CFKB 4K9JA 5LVEA 2GUOB 5CJXA 4IIZA 2G60L 2VKWA 5A2LH 5KVFH 3W11C 1MCSA 1CL7I 5DUJA 2BXZA 3E2HB 1AOZA 4A7GF 3BXNB 3CZGA 4B97A 2BX5A 4FQPA 2VL5A 4K55A 1EHLH 3BAIA 3L9YA 2QR0A 4NKOA 3GB7A 2DICA 3UZQA 3UBXI 3VG9B 4Z0XA 2XWCA 1JPGA 1R5IA 2XZQL 2GUYA 4OZ4A 1GPOL 2DMCA 1O75A 1BVLA 1YA5A 2FYYB 3BAKA 1MWAB 5E5RB 5KBNC 3DYMA 4ODHH 1GAFL 5HI3D 1CDHA 4OV5A 2D8KA 3SD2A 5KUKA 2O6FA 3GXTA 5FO7A 1G7IB 1LO5B 3RTQD 4PPTA 3L7FB 3IGLA 3GHPA 2R59A 4DO5A 4YSEA 3SJVB 4EIBA 5IB3A 4ADIA 4MJ2A 1INQA 4X6CB 1RIVH 4M48L 3BQUA 3GSQA 1RK7A 3OF6D 1JTPA 4JN2A 2HP4A 1BXUA 4Y89A 3WN5A 2O4EA 3A67L 1IBGL 4HIPA 4EZMA 2VLMD 1BX2B 1LO2H 2YZ1A 5HTSA 3WLWC 4R7NA 4Y16B 3IMVA 4R97B 3R8QA 2ZXQA 5F1SA 3HMXH 3OHXA 1O9VA 1SY6A 2JKNA 2V17H 4N9OB 3UAJC 2Y6SD 1P4LA 3S35H 2CM6A 2BVUA 3TO4B 3O3DB 1IGJA 3NCCB 3VI4A 3TX4A 3MNZB 2JE8A 3WY3A 2BC4A 4OT1H 1CBVL 1GIGL 2H7WA 4U1IA 3N6YA 1YLBB 5IB1B 4R7DB 3HZYB 1XH1A 4LHUA 5DD5H 2JIXD 1M2VA 3BGFC 3V7AE 4LBAA 4XTRD 3FTVA 4CSTA 1DVFB 3PREA 4AH2B 2G2RA 3RWFA 4HA1A 3GXPA 1KN4L 3NSDA 1CFBA 5AW3B 5D4IA 1H8OA 1DP0A 3L5IA 3QDJA 4MJ6A 3H6JA 5F1OB 3VRIB 4JFEE 1ND0B 1XD1A 2NY2C 1Y07A 5AVVB 3ZZSA 4PJ9C 1NCOA 2K4AA 3EJUA 3U2JA 2R39A 2YHGA 3E1F1 3G7TA 2FUTA 3F8UB 2BNQA 4LSVH 4W9LC 5EZJA 4ENEC 3BUBA 4LKXB 2EADA 4FLSA 5IT2H 2XETA 1PZ5B 1UD2A 2NY1B 1ZLSH 2IFFH 3ARGA 1Z9LA 3LEXA 3LV3B 1TFHA 2DDQH 5L2KA 4G42A 1KT2B 5KSUB 2K70A 2VLKE 1YQVH 4GMSH 4KXBA 3TC9A 4JPIB 2A38A 1CDCA 1LK3H 1YHPA 3S3CB 2R15A 1IKFH 4POZC 1W2KT 4XOEA 4XP6H 4K5LA 4MB1A 4QRSB 1QFPA 5CHNB 1UH4A 4P2CG 2OYLA 5BOPA 3SYPA 4GIPD 2DJMA 3VJ6B 3LKSB 4JUTA 1E4XI 1TTCA 4K8RD 2KPWA 4Q6KA 1J5HA 2ID5A 4LSVL 3OG4B 2GBTA 3RA7L 5HYEA 3CC5A 4JGUA 3JWNE 4GH7B 4FHJA 2ZAGA 1F4XL 1WUNT 3BIKB 2WMPA 3QG6A 5AOLA 4AGLA 4CJ0A 4F92B 4IGBA 1PY0A 4XMZA 3S3SA 1EAPB 2YPKA 4PJ9A 4BZYA 4Z23A 1QRNB 2X9XA 4MQSB 3C08L 1HT6A 2AK1H 1ETJA 1ZY9A 3U2SB 1ORQA 3GRGA 4NDMB 4L9LC 3ET9F 3IETA 2W5PA 2WP3O 5C0AB 3P2BA 3ULUC 5JQIB 1WFMA 3QNZA 3NTCL 2AVGA 1I8LA 4UDUA 4DN3L 5IQ7L 3EGXB 5I6KA 1R24A 3N43F 1JPFB 4U1JA 4XC1L 3MR9A 3SE3C 1LE5A 5GSRB 5ICZA 1XQ4A 5JIPA 1ZANL 2WW8A 3NP3A 2WXGA 4Z7OF 4YDLC 4JB9L 4N87A 1CURA 1YJDL 4LEBA 3MV9B 4J8RB 1UKQA 1UGKA 2IBZY 2OP4L 5EC2B 3O6LL 3GRWH 5DZ9A 2A83A 3BUDA 3ECBB 3B7RL 3O3BA 3PHOB 3MRLB 2DYRB 4WWKA 5B21A 3SKNB 5KG9B 2OSXA 1F3RB 5B3JE 2YUVA 4L8BA 5TE4L 1RZKL 2DBLH 2V0AA 3Q5YA 1RCYA 1O7VA 2O5NA 3EG9B 1ROWA 2F8IA 4I1NB 4BE6A 2EDRA 2BIMA 4LVOC 4QHNA 2NZ9D 1LILA 3P1VA 1ZVNA 3E6FA 1HKLL 1OGAD 2BIIA 4PJ5E 5IHZA 4GRWB 1XGUB 1WGVA 5J0BA 1J0YA 1S7UB 1U8MA 3T09A 4WNSA 5EN2B 1VEMA 1KBVA 5ADPL 1Q9OB 3PHSA 1YVLA 2EDXA 4KJWC 4AY0A 2EAEA 4BK4A 1EO8H 1BBJA 1FFRA 2VR7A 3EH3B 1L4IA 1LE9A 4XP4L 3ZKQD 3T0DA 4U1GC 5TF0A 1FVCA 4R97C 4AMXA 3L3OB 4A2MA 5DYOB 2E6QA 1FNGB 1U41A 2X3AA 4FA8A 5AZUA 3IKCB 4IBYA 4LLAA 1RIUL 1TZGL 2H6OA 3MRDA 5FDWA 4RQQA 3U9WA 4UMSA 1E9OA 1GGTA 3RA7H 4ELKB 1T21A 4APQA 1HOCB 1RZGA 1QFWH 3GLEA 1IUZA 4LBEA 4P04A 5KZCD 1QRND 3CZEA 1SY6L 3V0VA 1JAEA 3G5XB 1U91B 3AY4C 4XNYH 5DS2A 4PJGA 3UCQA 4Z3JA 2JJVA 3OBAA 3BUPA 3SGKC 1MCOL 2B1AL 2OW6A 3AROA 2PXYD 4N28A 3KPPA 3HCVB 4YPGA 1ZA6A 4PWGA 5T5FH 2WQSA 3G5ZB 3RX9A 2F1AA 4FNSA 4M62L 3L45A 5F88A 2NQ3A 4JM2B 3BDYL 1BM3H 3IDMA 1M1XA 3SDXF 3WI9A 4TOYH 4JUSA 1PZ5A 5BO1H 1ANUA 1J8RA 1EWHA 5L2KE 4MNHA 1DDHA 3ARGB 3FAXA 1KJ2L 2BIOA 2LVCA 4HISA 5E9DB 3RGVB 4C83B 4HLZH 3K5RA 4AEIH 4Z8FH 2VITA 4N90E 4HEME 2VMDA 2VLKD 3GSUB 4AK2A 5I75B 4MHHI 2VDOH 3QPXL 3A6CL 1BD2A 1SXBA 4HG4J 5HDBE 1SDDB 3JTTB 4R90L 3CHSA 4ZS6D 4Y4FD 4LNRA 1CE1H 4HJTA 3APCA 4CA4A 1S9YB 3L3GB 5CBAB 1AY1L 5E2UH 1NMBH 5JW4Q 4FFZA 4NQVA 2O6EA 4HT1L 3FO2B 4IBZA 2EECA 1NKRA 5HD8C 1T0PB 2GT9B 4GRWE 4O2EB 1RUPH 4P23B 4IJTA 3RJDA 3WJLA 3D50A 5DK0B 4L4VD 3IJ8A 3MLRH 4LFHG 3V52L 1BD2D 4PB0L 2HVKA 4BSWB 1FVDA 4YOKA 3E8VA 4EI5D 4QXUL 1A6UL 3IYLW 1TQSA 5CN2A 1JBJA 1IGCH 1MEXH 3DC0A 2X42A 4LMQI 1DL7L 1E5CA 3RDTC 3IU3B 2F68X 2UZYA 1H8SA 3S36X 1ZXKA 3RWCA 3GSXA 1T0NB 4RIRB 2IANA 4Y9FA 1FE8H 4N0YH 2WZ5A 2WXLA 3CK0H 3UMTA 5FYKH 5CLZA 1WEJH 2FIKA 4NDMA 1ZHBB 3R06B 4WNQB 4DPBX 5J7CC 3IETB 4QRUA 4TNWK 4WHYH 1KCSL 5BZXA 1CE6A 2JI3A 5HI3C 3PP4H 2BP5M 3SE8L 2MQ0A 3NT0A 5EZLB 5CEXB 3SKOB 2X4RA 1JF1A 3FTGB 2XPGA 4HJEA 2P80D 1QUPA 4KDWA 5EO1A 2Z31A 2AABH 4WENB 1AG0A 3GSQB 5E2WL 1XGRB 1NEUA 3CC1A 5EU6B 5T1LD 3WXVH 5HGDA 2VW4A 2QKIB 3HUJA 4OZGB 5DT1H 3LQAH 2JJSC 3BESR 3VGFA 5IB4B 4U3CA 2IEPA 3HG3A 4Z78A 1D5BA 1RZKH 1AKPA 2ZXGA 1D5ZA 1IM9D 1YG9A 3HC4H 5DHVB 5K1VA 1XIWA 2O5XL 2RA1A 5C3TA 1KUMA 4CKVX 3QUKB 2ZKHL 3D0LA 1CD8A 2EDMA 3GD1C 1JHKL 3TP4A 1FFNA 1PJWA 3FT0A 3RVVC 2C4XA 2FQDA 3TH4T 3EYFA 1WV7T 1ACYH 3ULUE 2MOVA 4PLJC 4GT7A 1SXNA 1X7QA 2P43B 3EBHA 4TM9A 4ELME 4CMMA 4S2SB 1CVSC 5AZ2L 1BFSA 2QDVA 2I32A 2AXHA 3CFNA 1I31A 1KJ3H 4BBWA 1QO3A 1YPZE 3HS0C 3DGDA 3U1SL 3O0RH 1MDAA 1YEFH 1JZ7A 3MRQB 1FO0H 1KIPA 2H8PB 1NBQA 3P2TA 4G1EA 3U4BH 1I1YA 2V5MA 3VRJB 4WFGE 5C70A 3VACA 4CN4A 1ZGLA 2HZHA 3VXUA 2XA8L 1TQCC 3LMJL 2O5XH 5TK2A 3RWEA 4PY8J 1A3LL 3QDHA 1OPOA 4M03A 1Y6KR 3TFKD 4YSPA 1JZJA 2WO3B 4HJIA 5DRNB 3ABKB 3UTSE 2X28A 1AXTL 5CZVH 1QSFB 5C08B 3DVNB 4Q14A 3TFKC 5DHXB 2HJLB 1RJYA 2YN3A 2FBJL 2FT7A 2AMUA 4OUUB 2HJFB 1KTBA 2Q6WB 5ESAA 4XNZC 1PZCA 3A22A 4HIEA 4MJIA 1I3GL 5I2IB 5DQJA 5L2JA 5CKAA 3QDMB 3VD3A 3CUPB 1AYRA 5FM8A 5D70H 1KELH 5FYKD 3FRPB 4WTZA 5C0BD 1KB5L 4JPIA 2J5LC 5ISZA 3EOAB 2BSED 3L9RA 5TTRA 2JK5A 3DUHA 3HBPA 3NCBB 5LBSL 1CFSB 2QPFA 3HN3A 1AGBB 4FNLH 3CJJA 4PTTB 3H3KA 1RZIA 3MRBA 4RESB 2F74B 4ZQTA 2D0GA 5IVOA 2GY7B 5BV7H 4LSRH 3OM3B 5E94B 3EDJA 2HLAB 3BEWA 4X6CE 5EUOF 4HCRL 2JQAA 3ZE2B 5ISZD 2DQJL 5E6ZA 1DQKA 1LHZA 1J9SA 3H9YA 1CDBA 3NSJA 2AXWA 1X5KA 4BXVA 4NQDB 2L7UA 5BRZA 1NOAA 4CNIA 4YHZL 1MJ8L 3QIWD 4IRZA 5DLML 5C0ND 3GTVA 2VRAA 3T3ME 2W38A 1MFVA 1SXSA 1GC1L 3FH8A 5T1KA 4H8PA 3DJSA 3VXNB 3H9ZA 4OTXH 5LB1A 3MRRB 4Y1AA 4LHUB 2ED8A 1J1PL 2QL1A 4P4KA 1UOVA 4O2EA 2DL2A 2EXYD 2CBTA 5I1AB 2YWZA 2GJ6E 2YIHA 1DZBA 1UVQB 4X50A 2O5YL 5K9OA 2XC8A 3QCTH 4WHTB 1ZTXL 2PO6A 1E2ZA 1PZ2A 3CNKA 1KB5A 4AYEC 5GIRA 3EDKA 1NC4B 3VFTA 5CR1A 1MLCA 1NDMA 4DN4L 3BZ4B 4ZO7A 5D2LE 4KJPC 1U3HB 1RUQH 3CHRA 1H3TA 1MLBA 1R3HA 5C0DB 2OSYA 4NNPL 3SGEI 5FAAA 3T3PE 1GXEA 2P7TA 3FB5A 1L9QA 3T6WA 3QDGE 1DCLA 3BKCL 5L8LB 5ALCH 4K5PA 4PRHD 3O11A 4JMNA 2AVFA 1HHIA 4P2AA 2I07A 2O5ZH 1OD9A 4IOIB 4BFIA 4NN7C 5K5YA 3LZFL 4PGZA 5CFAA 4PJ8D 4YMPA 5FO9A 4Y2DC 1MF2H 3L81A 5G5DA 2FE0A 3VFMA 1QSEB 4XCNB 3HE6C 2HTLC 3HUJE 3CDGA 1PG7L 2DQIL 3QCUH 5EN2A 4QXVA 3THML 1F13A 3QK0A 2FNWA 4HOMA 4L4VB 4FTDA 5KSAC 3CVHB 1TVHA 3QR0A 4E36A 3GXIA 4P57B 4HF5H 2FR4B 2WXPA 5PCYA 4WO0A 4H8WL 5JMOC 3I9GH 3QZWB 5D1ZB 2F54D 4DUWA 4MWFB 4XVTH 2KYIA 4PJIA 3BH9A 4PM1A 2UXGA 1CGVA 1Z9OA 2E0PA 4NKMA 2PO6C 3N1MC 3D12B 4I48A 5DGRA 3A4FA 3GFUA 3FL7A 5FIEA 1I7UA 5DJZB 1AQ8A 4F7PA 1X7QB 5EWIL 5BOZG 4XPAL 3ARDB 4HOXA 4TNFA 1BMZA 3QJXA 1HOCA 4LGPB 4PLKC 3ZE2E 4PJXE 5BUGA 4YHMH 2QHRL 4M1DL 4Y4HD 2K9FB 2D3LA 3FBQA 5GJTL 3VWKD 1JNNL 4FQIH 2D4FA 4ECNA 4K9EL 4MYPA 4XR8C 5E0QA 4P46C 4K3DL 4PI0A 1N67A 2WQXA 4DKFL 2B9BA 3C8HA 4XPFL 5KYXB 6TAAA 2LU3A 1ILSA 1VFBB 3ZDWA 2WXIA 1GL4B 4AV0A 2W0LA 3H3PH 1CICA 4LOUC 4NXKA 3L54A 1F11B 4UQDA 2LW3A 5J1AA 5HHPA 1VGKA 4AUYA 3SJVD 1YEIL 2X4QA 4JG9A 2H47C 1VIWA 2CPUA 2X70A 4TLUA 1QWHA 3TPKA 1FG9C 4UOW1 3FU5A 4XC1H 1JZFA 1I8KA 1KY7A 1CQKA 2FQGA 4PD4J 4F58L 3L8QA 5EU4B 3I6GA 4KBPA 3P40A 2ENQA 4B5EA 2ZUXA 1EQWA 1PKQE 2DOCA 2UV3A 2VDRB 1I9IH 3FHQA 5DJDB 5DJ8A 2NNAB 5FUCC 1KULA 1ZGLP 4IHBA 5BQ7A 2ZX7A 4Z7UE 1KEGH 4AEHH 2IOOA 4F91B 4NO0B 5DJ0A 4W6WB 4GXUN 4TSAH 5DMJB 5DRZB 4BWTA 5EF1A 2QSTA 5EU6D 4XRCA 5KVFL 4PJ7F 4JAMA 4XH2A 4XAKE 1WEJL 1Z0MA 1GOFA 2PNDA 2FLRT 3KR3L 4Y4KA 2XQYA 3V4VA 3TJEH 1J8KA 3W9EB 4ODVH 4LHUD 3D4CA 1G1OA 1DQDL 2DEWX 5FV1L 5FB8B 5H2BA 1BF5A 4HWBL 1G9EA 2YRLA 2AFNA 4AVIA 4K71C 2JXMA 3DSFH 3OJ2C 1KT2A 3L1OH 1W6LA 1HQRA 5J4MA 2ZAHA 4HDIB 3Q2LA 4MAYC 5DJAA 1QSFE 3WYRA 4XMUA 3GPSA 4JGNA 1GOGA 5BS0E 3LB6D 1ZV2A 5DC2A 3I9GL 1DBMH 4AVHA 1CC3A 2HFEA 4P4RB 4U1NB 5T5FA 3OMIB 3G6JF 1GGIH 1FZKB 4ZX6A 2YGVA 1Z5HA 2B3RA 1DBJH 3ULSB 4ONGL 4HD9A 5MENE 2A2QT 3WTVA 1U4EA 3ERXA 4FA7B 2O5YH 1CR9L 3MLXL 2J6WA 4JE0A 1FUNA 2YEZA 1F3DJ 2PLTA 2C7FA 3REVA 2EDKA 5EOCL 2V37A 4DN4H 4URTB 43CAA 1NM9A 2R69H 5CCGE 1IGYB 1P84J 1URLA 2PYEB 3L2MA 4YPGB 3UBHA 1R5IB 3ENEA 1BVOA 4Y1AE 2R2BB 4I0PD 1FIGL 2D2OA 4IIQC 1MRFH 4OCNC 5DMGC 3TYFA 2K78A 2YPKB 4YE0A 4ADJA 5IY5B 3FFCA 3H6AA 4YK4C 3UO1H 1WAAA 3EO9H 4OD3H 1HVXA 5DS8B 3L3HB 5JORB 4WFEE 1WJ3A 1NGXB 3X12A 4GAAA 3IU4L 4FXGC 2YPLD 4Z3FA 1HHIB 3VW3L 1OLZA 3B34A 4FI6A 5C0RH 5E6IC 3LPPA 3UROR 4IKJA 2KPNA 2N1KA 4NUJA 1GTFA 4NRXB 4CAGA 3HR6A 2Z0BA 4U3SA 3B5HA 4ZSOB 2VLRB 3HKFA 2ZXCA 3TJPA 2JJTC 3G6DH 4UT9L 4F58H 1HJBC 1XH0A 3CN3A 4YHKL 3QUMA 5K1NA 2WZPA 3QUYB 5FX3A 1PIFA 1J5IA 1P1VA 2R83A 4P23A 4M8VA 5D9SB 2AQSA 1EO8L 1M6UA 1QZ1A 2RFXA 2VDOL 4UU9B 5E23A 1BGXH 4G7QB 4OCYL 3AQXA 2W65A 2X3CA 4RGNC 3Q2WA 5IK3A 5CCKH 3B7SA 1Q9WB 3HRZC 5DFAA 2PYFB 5HYQB 3H9HA 1T1XA 2UWEA 3BD4A 3ORJA 2OA9A 4BGDA 2A6KB 2ERJC 2R56L 3HI6L 2P52A 4RA0C 3A23A 4UM9D 4DF9A 2WNWA 5FWQA 4GO6B 4EXKA 1F6FB 2ZNXA 3UTQA 5F9WB 4ETYA 5EBMA 5EFIA 2HXAA 4F9PA 2QGEA 5J56B 5CLYA 3OAUH 2VUKA 2ZG1A 5JXED 4XPBL 4FNLL 4AGMA 3KD4A 1I9EA 1QZNA 4N68A 4XMLL 5FHBH 4J28A 2A1WL 2JCCA 4ZW6A 4NENA 3ZHDA 4C4BA 4GKNB 3EJQA 1QSED 3DX3A 3EOAA 3DVGB 4LLQB 4Z7AA 2WXHA 3D85B 3QZNA 5DU7A 3HVDA 3I6KA 4PTTA 5BZWB 3LN9A 4G9FD 3T08A 1INDH 3B4NA 1XTMA 3ZKMD 3PV7A 3GINA 1LP9F 1DSFH 3SDDA 1CLCA 4I2XB 2FATH 1HL9A 4HXBH 1J0ZA 3O45B 4KDTA 3FSWA 4O51A 2ZCLH 12E8L 4G7VL 2FECL 4JDEB 1A1NB 5LGYA 2G0LA 4PJHE 1NLBL 3F7RA 4NKQB 4QY8A 4MAZA 4OF3A 4YFLF 1XCTA 4ZFOB 4KHXH 4FNUA 2ESVD 2WYZA 3SJVA 2VUOA 1I7ZA 1IGTA 1MH5B 4AUUA 3ZDYE 4CNIB 4EI5C 2IC2A 1KEGL 4FZEH 4CDGC 4DGYL 5CZKA 4R6UA 4Q6IB 4I85A 3S96A 5IREA 4RISH 2DWEB 1JZ3A 1EANA 3D3VB 1LDSA 3TASA 4DOHE 2KS0A 3CMOL 3CN0A 3FB8A 3I2CL 2V5YA 4LGSB 4UOQA 2DQDH 2UY6A 4ZFZA 3PQYE 3RKDC 1KJ2A 4J3TA 4NO3B 1IZKA 3HR5A 2IDCA 1S5IL 1P9MA 5ESVA 5AWNL 1J11A 1XF5B 1JZ4A 3V0WH 1A65A 1ET5A 4WJG3 1OTTC 1S9WA 1YEHL 1G9NH 2VDMB 2AAAA 4ERSL 3ARFD 4P5MB 2Y06L 4Y88A 5E4OA 4CRPA 4N2FA 1QWNA 2IAMB 4AEEA 4QRQB 2BMKB 4OCYH 1QX1A 4JM2A 1PQZA 4AQEA 2GBVA 1KXQA 3WIHH 1BIIB 4Z7VA 4MDJB 5E8OB 5GS2D 1E2WA 4HIEB 3W11D 1SF5A 1QI3A 1PLBA 3GMOA 5IVXE 5SV3A 4MQ7A 3MLXH 3NSFA 4DVBA 4E5XG 1T7YA 3WFZA 2WVVB 3IJHA 3MCG1 4KO6A 3CFQA 4ZW8A 3PJSA 1H3UA 2KKQA 5DD1L 4XO4A 4DAGL 4D8PB 1A4CA 5IKCB 3A21A 1QVOB 4EDXB 3KPLB 4KDVA 3OKLA 3SPVB 4HGMA 1GIGH 4PBDA 1S7RA 2EDQA 2C7UA 2F53D 2XTJB 1ZHNB 1XEUA 1X3DA 4PRBA 4UB0H 5E1QA 5EN3A 4QHKJ 1TCRA 4EUPB 3Q8CA 3I9PA 1BQHB 1ZHBA 5E2VL 1FC1A 4JKNA 3KEHA 3CXHK 1A7BA 1T0MA 2EDYA 2EIZB 1CE6B 3MROA 5CU9A 3GMNA 5FUZL 1MFEL 1E6JL 4XMXA 2X1QA 3WN6A 5C1MB 5CEXA 3BYTA 3CD4A 5EA0H 3WMQA 3U46B 1KFGA 2DQHL 1FHNA 5TDNA 5KN5B 2CNZA 2DLFH 2WXMA 3GSXB 4FLRA 2O72A 3GUTA 3VGDA 2RBLA 5DJCB 4TTDC 2DY2A 3GKZA 5FYJH 2YPLA 4G72B 5E00B 4KRPB 1IV8A 4GQQA 1FL5A 3UTZA 3LNHA 3QJZA 1E4XL 1KPVB 5C0BE 1W8OA 3VFUA 1FG2B 1WFTA 1S2EA 5EZOH 4PLJD 3RGBA 2DDQL 5IHUH 3TZVB 3MNMA 3BGFB 3FO9B 3MLYH 2E7HA 2B4CH 3ZDXF 1ZK9A 2BW4A 4XT1C 2A6KA 1HYSD 4OJFL 5F9DC 1TPXC 4J1UB 5EU3B 3WLBB 4KROC 3PL6C 5F7DB 1M53A 4K5NA 1DTUA 1JV2B 3OXSB 4ODXA 3F3HA 4PJAA 1P4BL 1JGVH 5HGHB 4N0CC 3QWQB 3BGMA 4EAEA 1XF4A 1CJYA 4XP4H 1URZA 2DYSB 3P30H 1GYAA 1K5WA 4ZNCD 5I8CA 1R24B 5I75C 4JJHA 4CJ1A 3MRNA 5MEOB 2ZWNA 3A4DA 2VJXA 4KV5F 5DJ8B 1T1ZB 3HG4A 2WB1A 1GMEA 3ALWA 3DV6B 3HFFA 1YMMD 5BV7B 3KH3A 2G4GA 2EP6A 2YEQA 2X5PA 4GRLB 4ZX3A 3WY1A 3QB7C 2JH2A 1U93A 1QFWL 3R4DA 4P5TB 5HGBB 3Q6FA 2BJML 4P57A 4XXWA 1SMAA 3Q8EA 3FOLA 3IGAA 5I17A 5HJGA 3F85A 3SPHA 3PWUA 2Y1VA 3WDJA 5HHOD 3K2MC 2V9TA 3VXUB 3KAAA 3VSVA 1OCOB 1QBAA 3CFJA 3FHAA 1U6AH 2N4IA 3NACL 1KN2L 2DM3A 3AMLA 3ILEA 5JW5A 2TRHA 5SX5K 5IUCA 4LEOA 1HESA 4ZNEE 4BV1A 4Q89A 2ITDA 4BQCA 4GRMB 3TNNA 3DI3B 1ET7A 5IVNA 5CBAA 1D6EB 3FTYA 4OKVA 1YJDH 2AZUA 5DJ2B 1TENA 2CLZA 15C8H 2C3HA 2W88A 5KVEE 4RMSA 4Y7MA 4YC2C 4IKNA 4OF0A 5JW4R 1VKXA 2OZNA 3UTTD 5IF0A 3H85A 4XN5A 4FMFA 4ZMYA 5HI5C 4X5LA 4AJVA 3U4KA 1TZOA 3B2DC 1N26A 2OR9L 3MTXA 4KK8D 4BIKA 2UZIL 2ADYA 4G6JL 1W0VB 5ABAA 4XMVA 4IS6B 4P49A 4YSDA 1KBKA 5DF0A 3SE9H 1AGEA 4IU3B 4LMQE 1SEQH 5FYKU 2XX0A 5EO9B 2V2WB 4J3OH 3MJ7A 3M17A 4MDIA 1TJHL 4HF5L 5JHLL 2F5AH 4ZT1A 2BWQA 4RBPK 4WU5B 5EF0A 2ESVE 2YGPA 5ITFB 2VW6A 1WAEA 3NJFA 2EZ0C 5FHAH 4P3DA 5JDSB 1KGUA 3K72A 2CR0A 2XWDA 4JW3A 4RX4A 2JWYA 4XN2A 5J3HC 3PAUA 4FP8L 2ZYSA 5AW4B 3QDME 4NRXA 1MF2L 1NSNL 3IGFA 1DFXA 3AZUA 2IWEA 5BQ7B 2BP8B 4JY5L 3K74B 4K71B 2ZZUT 4HJ0D 3JV4A 5HI4C 4XRCB 3OR6A 5DMKB 5ES4B 3VVVA 2CHWA 4BZ1L 1SJHA 2XVKA 2X4SA 5DVPA 4OAWA 4WI6A 3RJQB 2E27H 4ZAKB 5D7LA 1RZPA 2Y1AA 3RZCA 1FN4B 2B8OT 5DEFB 5BVJA 3FT3A 3BVNA 3UG5A 4LLVA 5EU7E 5H4YA 3TVMA 1JFHA 4HUVA 3BXNA 3X14A 2WGXA 3NJKA 4R7LA 2HMID 5HDWA 1KENH 1UGNA 4NGHH 1YQ2A 2QQQA 5H94A 4JM4H 1XF2A 3U2SA 4JY5H 4XXDA 4OUOA 5IQLA 4A2LA 1IFHL 4M62H 3KPMA 3HZVA 3INOA 3DUSA 1UJ3C 2DQHH 3HI5L 3D8MA 1QSEE 1E7VA 2R29L 4OW6A 4G8IA 2DLTA 3ZQ9A 2X6MA 5LGKA 3BVDB 4N85A 4HJJH 2MWCA 2B16A 4J3BA 4IDJL 5ANMB 1JK9B 1SGKA 1KTKE 1UACH 4KHTH 3D2TA 4QHUA 4FL4C 3CLFH 2Y1ZA 3ROLA 1A6UH 3SPIA 5I1DB 2A83B 3PHOA 2BZ7A 1JXGA 4OZGE 3DX4A 1E8WA 2AZAA 2VCOA 5L4JA 2D03L 1DJXA 4LNVA 3BSHA 4JDEA 4CGUB 4UIKL 4BZ2L 2F8VA 2XZQH 4RZCA 1SOKA 2W0FB 1KGCE 1FJ1B 5F7LB 1OAXH 2DLGA 1QOKA 3K2IA 4JFQB 3IDYB 4ABVA 3KM2A 5EORH 4L3AA 3HHMA 4LSQL 4K3JL 4Y4KC 3GSNA 2MMXA 4U3SB 4NAQA 4BH8A 2ICES 4MHHG 4NEHB 4FABL 1NH6A 1OXYA 4PV9A 5C2UB 5GS2H 3GI9L 4IBSA 4JS7A 3ZTJG 1IEAB 5EEXA 2J21A 4K7PH 2BFGA 4HS6A 3QIWC 1D5BB 4JM2F 1YEHH 4CGTA 1OY3B 4LARL 2F19L 1JMZA 3TM6A 4M6NH 4JFED 5AB1A 4QXTB 5DUPH 7FABH 4NRZB 4KK8C 4OLZH 5IEHA 3DROB 1NCDH 2OPCA 2WXNA 5F9AC 3RB5A 4LIQL 4JJOA 4JFVA 3SKJL 4R8WH 5LAPA 3P73A 2E56A 4S0HA 2W9EH 1EDYA 2GIYA 3IDGB 3AUVA 1WAPA 3I9AA 1A6VL 4DTGH 2EXWD 3HZMB 3ARBD 2AQTA 4GI6A 2N3JA 5C0IB 1JPST 5LCVL 2CCLA 3TBYA 1WBYB 3ZTNL 4AVJA 3ZMRA 5EA0L 4BK5A 1M7IB 3OZ9H 5L2KB 4YE4L 5IG7B 5ICYA 4HIJB 1UT1A 3IJEA 2DZEA 1OT1A 1NWOA 5DJAB 3BT2L 1JWSB 4Z7IA 1FAIL 4ENED 2J6EA 3LZOA 5MERA 2WPGA 3BKJH 1K8IB 5I76A 3KLHC 4PWEA 3LHPL 3EH4B 5C2BL 5IGXH 2WKGA 4NJAL 1CLOL 3QCVL 4PJ7B 1FNEA 2HT3D 4FKKA 4ZXBA 1BFVL 2EDNA 2WQWA 1FZJB 2CCVA 4BKTC 2QSCL 4G3YH 3UTSD 3AQZA 4MMYB 2Z64C 2IH8A 1I7ZB 3RZWA 5D6CA 1FH5H 1B2WL 5IP4A 5KSAA 1GA2A 5G4NA 4DZBA 3GSOA 5HDQH 2WMPB 3QG6B 3ZDYB 1CIDA 1WBZA 4N5ED 3SD5A 4LGRB 2YAHA 1OSPH 1BCIA 4JRYE 3SDYL 5INCB 3WCYA 3GXUB 4TRPH 2IO5A 3UP6A 4X9YA 3US9A 3NVQA 4OD1H 2ZYHA 3QT2A 4FX5A 4B9IA 5MI0C 3NUKA 4IBTA 1KTDA 3U36A 3T4AB 1DBJL 1SJEB 3MACH 5F96H 3OR7B 4HJGB 5B1JA 2X1PA 3RVWD 1IGYA 3CXDL 2KL6A 5HY9A 5C0EB 4JEGB 4U1KA 1JGEA 1MEXL 2NCMA 4BQ8A 3C12A 2F5BH 3L4YA 3U9PL 4ZYKB 1L6XA 2P1YA 4H25B 4KITB 1JNHB 4XBGB 3ARDA 3KPRD 1EXHA 4QF1A 1T6WA 1UXSA 5F1NA 5DS8A 3CFEB 3NA4A 3W0WE 3KXFD 3RTLA 3EUDA 2ATKA 4WLCA 1C1EH 4K5OA 3WDIA 5JW4N 5CP7B 1OO2A 4HWZB 4AV5A 3CFCH 3L3DA 1T4KB 3X3GH 4TUJB 1BIHA 2FB4H 3P0YH 1VEPA 3HZKB 4DHLA 4QJ4B 1RSYA 2PYFA 1D2PA 2APWA 4ZUVA 3UPAA 4KHTL 3FQTB 3RWJB 1CFVL 4KQ3L 4KRLB 1LO4H 3C6EA 4PLNC 4XBPB 3KWVA 5ETUB 1Z9SB 3WE6A 2I69A 2XIDA 4ZMXA 1TCRB 3WUWB 2E74C 4GXFA 5DHVA 2MCPH 3IDXL 4A7VA 1A6WH 5C7XL 1FFNB 1IKOP 4HIQA 2OMBA 4P2YA 3HG1B 4UAHA 4Y2LA 3GBNL 4FOMA 2SODB 3K4AA 2QGDA 4NQSB 2B1OA 3GGWB 2AK4E 3MV8E 3HI1A 3AM8A 4FQXA 4JO5A 1R75A 5CAYB 2WSKA 2QV4A 2D7QA 3APMA 1NCUA 5D1XD 1T5XB 1U8LB 3W5MA 1F4WL 3MO1B 2HG5B 3B7TA 4M43L 5IIEA 2WANA 4JAMB 4F7EB 2JKSA 4B95C 1ZS8B 4HALA 4UBDC 3VGHA 4AQAA 2V5SA 2WQ8A 4NZUH 1FL6B 3BHBB 3EJPA 4PVBA 1A1NA 2KLRA 4ZPTA 4DP1X 4H1LA 3HBZA 2VDPH 4R2GD 5I0XA 2FO4A 1T2XA 2HLEB 2Q7AA 2YJQA 1U8NB 2AGJH 3OKYA 3QFJE 2ED6A 3MNZA 2NCEA 5GHWL 4E42A 1MNNA 1QTPA 4NQEB 1PG7H 2FH6A 3NCEB 4EVNA 2HH0H 5EUOB 1YAZA 2FGWH 5I8EA 1VACB 5CEYB 4HUCA 3VU1A 1GY2A 2XA8H 4TVSa 1EXUB 2YMOA 1UASA 4XHJD 3V4LA 3D08A 2ARJB 3BO8A 1B4LA 5AL8A 4F1ZA 1DSFL 2VLKB 4N2DA 3NAAH 4J39A 2GJJA 2IF7A 2ZQKA 4JFSA 1RVFH 3JWDC 4RGNE 5LG1A 3OJVC 2J4WL 3SYQA 4BELD 2WUCL 5JDJA 3V4PH 5SWSD 4NNXA 1YRKA 5JZ7C 4ATTA 1K4CB 1INEL 1XB8A 4ZFFA 5E2JA 5J3HD 5BXFB 3BE1L 3QA3B 5GGSA 1E5YA 2JLPA 3HC0A 5ANHA 1OAKH 2DM4A 3B2VH 2ZOLA 2YPVL 1ODAA 4GSDL 3MV8D 3PHQA 2F8OA 1HN1A 5E2TH 5KJ7E 3GMOB 1VFAB 2BOCA 4H13C 4I3RH 1AD9A 4JDTH 3QORB 4HS3A 1TZIA 3W3BA 5I23A 3QQ9C 1WS8A 1L0YA 1I8LC 3QR2A 5KBDA 1NMAH 2ZPKL 4LCCB 3QI9D 5EBLA 3EJYC 4HUVB 4XXWC 1Q72L 1E9QB 2MH4A 1RZJL 4YNYA 1GZQA 4PU2A 3L7EB 4TUOA 4FQ2L 4U1MB 1W0WA 3F7VA 3MRFA 1AO7A 2X4NB 3PL6B 4XXCC 5FUCE 2X38A 4C4UA 2XI9A 5D5ME 2X2IA 3BN9C 2AJXH 5MEQA 2BHYA 2KT6A 3CCHB 3B2UD 2R23A 1UA6H 4QRFA 1DJIA 2Z92A 2EIZA 2YSSA 3VW3H 3RX8A 2WLYA 3TIEB 2DEYX 3MLTA 3GS0A 3RX7A 3JT0A 4LASH 4R0LC 5IKCA 3WTXA 2HX7A 1OPGL 1UWXH 1M2OA 1Z66A 3HLKA 3G6JE 2CLRB 4OFYD 2OZ4A 4ZPVB 3L4WA 2HPOA 4GJTB 3MJ7B 4AI7A 2P7TB 3FB5B 1SHMA 1I1AB 5FECA 3QUXA 1E30A 2KZBA 4XCCL 1HFUA 1MY5A 1D6VL 2WZAA 3L3KB 3UGEA 3F00A 1VCBC 1JS4A 4ATWA 1PFOA 3DSNA 3ULUD 4YFLI 1O7DE 3BX7C 3RGHA 2RALA 4OM0L 1WFJA 3D69A 1F4AA 3QFJA 3TBWB 1UJTA 3L3DB 4HSCX 3IDNA 1IE5A 4LLUB 1BOYA 5D72L 2OXHA 2VE6A 5IW6A 4N4YB 4XNUH 4KUCF 3UTPD 1IC7L 3QISA 4KTYA 3DVIA 3TLRA 5CGYC 1A7OL 2YQ2A 5C6TH 2DQ6A 3SKJH 5L4FA 3UBFA 4FG6D 4YFEA 5JW3H 3D07A 3VH8G 1VB9A 5D1XC 1AKJA 4N2AA 3QIBC 5CFHA 4L4VA 4D7BA 2IPUG 4OLZL 2M26A 1BXVA 1JI2A 4MXWL 4HK0A 1BBDL 4R7NB 5EMYA 4I0PB 5SWZE 4K5MA 3UH8A 5JQ6L 1K9TA 5HHNA 4XVSH 1UZ8B 5DEFA 5BVJB 3OKKB 4ABQA 5D7JB 3KHQA 1CK0L 5M94B 4OGZA 4GG8A 4X7SH 3LRSA 1H0DA 1AKJD 1ZPLA 1OAZH 5K59E 1T80A 2YD8A 4R2GB 3LNIA 4ZDHB 4HKXA 5C0CD 3H42H 2DQFA 3O0LA 4J3SA 2ZICA 2J73A 5EOQL 3FB8B 1ZRUA 4K7PY 4BHUI 3D18B 3K8KA 3ZVVA 1KY6A 4L1DA 2DYPB 2HJFA 3N1GC 2HA1A 2ZD0A 4HIHA 5FWRA 4LFHD 3ZKSD 4HXAL 4ONFH 1A2YB 1IQDB 4F37K 2ZX5A 3S48A 1U0QA 4NRYB 2I27N 5D2LB 1KJVA 1A64A 2H4EA 3B43A 4GINA 4R96B 1IAII 4XAWL 4AM0Q 3BUTA 5I73C 3RIKA 1WD8A 1JWSA 1B4JH 5T5NG 1N0LA 1WZAA 2W1NA 3SIKA 3ZQXA 3CH1A 1BYPA 3PIQA 4WTXA 4E9XA 4IKLA 4S10A 2BNUB 5F89A 3H9SD 5F7AA 4AYID 4PBWD 1QNZH 3PDOB 4H26B 3NIDF 5IMOA 1AG6A 2HLAA 1NM4A 2VXTH 4ETQB 1A66A 4M1CC 1J5OH 4DNLA 3LQMA 1ORSA 3MCYA 4R4ND 4W9KC 4PJBE 5I5IA 4IJ3B 2DLEA 4RGOH 1YEIH 2YSTA 3QIWB 1G7PB 3N44B 4WW2B 4YDIL 1FFQA 1J48A 3K6SA 1N64H 4DKTA 1D5IH 2BCKA 2D3NA 2DTMH 3IRZA 4MCZB 3LKSA 2QMJA 3TBSB 1HJCA 4RFNB 1ZCRA 1BG1A 2DYPD 3RIAK 1DQJB 1L5GA 2R2EB 4Z5RA 3CVDA 2Z9TA 3VG0H 4HHGA 4W9GC 5AYUL 4LSQH 2WC7A 3IAQA 3SBQA 5IVZA 1W0VA 2QELA 4C8XA 3RGVA 3HE7C 4LKCB 3MLRL 4JFPB 2R0LH 5DUML 1RI8A 3V52H 3ZHNA 1SEBB 4NXSA 4O2FB 3QQ4A 2QSQA 4QOKD 2QFPA 1W72H 5KSBA 1J5DA 2I60H 4Q6IA 5D7JD 2ESVB 2PR4H 1AGFB 4KXCA 1UXSB 3TTYA 4FL4B 1F42A 3ZKXC 4PREB 3A6BH 4WSGA 3TWCL 5CMAB 1G5GA 2NUTB 5HHVL 5DC0A 4G6AD 1AR1C 4WAFA 12E8H 4G7VH 5KS9F 1ORQB 2Z31C 4DP6X 3U0WL 3ALXA 5DLMH 4G1MB 3ZYJA 1PCSA 4DPCX 4CBZA 1BM7A 5LBVA 3RWFB 3O6KL 2NY2B 1RZ7H 2QTEA 4ZMLA 1CO1A 4QLWA 3QDJB 3QJHB 1X5XA 2PYEA 2KZ1B 2MTPA 4K0OA 3V5KA 3FTZA 1ZT7A 3GPEA 1AO7E 5KVGE 2B08A 5SX5H 1KXTA 4NP4H 2JB5H 3UTSB 2CE6A 3WEMA 5C9JB 3SPGA 3CLFL 1ZT4A 1QHOA 5BMFH 2EABA 1FRGL 4F33B 3DUUB 3CDZB 2OMYB 1IILE 1CR9H 4M7LT 4FADA 4MB4A 4UZUA 3UO1L 3QFDA 2C9SA 3ALPA 5LG6A 1QKZL 2RCSL 1H5BC 3HUJF 3IMWA 1UWEL 4P9ML 2KLSA 3VXRA 5I9QC 1CD1A 1MDTA 3QVAA 3FZUD 4WV1A 2W8CA 1CZ8H 4EN3D 1A6WL 3T0WA 4YX2H 3OAWA 1CF1A 2VOTA 5F3HA 3RTQB 4ELMB 4EDWH 3GBML 5FEBA 2IOIA 3GSOB 3HE6A 4FN0A 4DETA 3FQWA 3RIFK 3K2UL 3PL6D 2EE6A 3T65B 1NOLA 3HZVB 4QPEA 5KYNA 2HN7B 4PP2A 1JGUH 3QE5A 3TIDB 4JKKA 2V4LA 3M45A 5CLWA 5I17B 4Y5XA 3GKWH 2JB6A 3SOBH 3GI8L 3GMNB 3TXAA 4F2MB 1AZVA 1IT9H 2ADGB 5F9JA 5B7MA 1PYWA 4NNYB 1U8CB 4HH9B 2VN7A 4NQQA 1GHFL 5C07D 3VGAC 2JMRA 4JFZL 5EOCJ 4DAGH 4AIZB 4X2UA 2VL4A 4DQOL 5JHLH 4R3SA 5HYJE 4DPRA 4XNYL 4PP1C 1G0YR 4X9IA 2QQNH 3NCYS 3ZYOA 5BS0D 1NJ9B 1NIBA 4LB8A 2X4OA 3V0VB 3D18A 4FFYA 4HWZA 1RZGB 1VERA 2DWTA 5A40E 3EGXA 3QORC 3R1GH 4OSUH 1JRHH 2P5WD 4NENB 3L2LA 3MLSH 1HZLA 1Q38A 2KMWA 1JNJA 3UJTL 4TULL 1UZ6E 4LHJB 1A9EA 4FQXD 1FNLA 1HHKB 3GMMA 2HKHH 3A4EA 3D85A 2W9DH 3MXVL 3O3DA 3U6XA