2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords O-GlcNAcase nagJ
publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
4FL4C 2JH2A 2CCLA 2VO8A 2VN6A 3BWZA 2B59A 3KCPB 4UMSA 5LXVA 2O4EA 1TYJA 1G1KA 4WI0A 2W1NA 4FL4B 3GHPA 1QZNA 3F2LA 3FNKA 3L8QA 4UYPA 1AOHA 4IU2A 5AOZA 3UL4A 1ANUA 4WKZB 2OZNA 2VN5A 1OHZA 2ZF9A 2Y3NA 1ZV9A 4N2OA 2XDHA 3KCPA 5K39A 4U3SA 5G5DA 4IU3A 4UYQA 4DH2A 2BM3A
chains in the Genus database with same CATH superfamily
1T5XB 2FX9L 1FRGH 4Z7WE 3NACH 4CU8A 2YBRA 3UTOA 5AOMA 4QTFA 2ZXCA 4H26A 4P2OA 1CFMA 3EOBB 4RFEB 4FKEA 2MPAL 2A99A 2HH0L 4NM4H 3DBXA 4IKLA 2BJMH 3BSHA 4PHXA 3CHSA 1EHXA 3Q43A 5D1XA 4W4OC 5L0QC 3OKMA 4NHCH 1R6VA 3IE4A 4EIGB 3HVDA 2NDGA 1E4KC 3HMWL 4HSCX 3LPGA 5CLZA 4Z5RB 4ZSOE 4GQ9H 1XT5A 4GKSB 5CP3H 3GBNH 3R0NA 1ZVYA 4M43L 2WKOF 5DURB 3V0DA 1F45A 1IAMA 4CC4C 4ZX6A 3BP4A 1CI3M 5CSZB 4AV5A 4F7TA 5KANI 1IM9D 2NY4D 5CF3A 3C5JB 3FU8A 4ZS6D 5DEGA 2OMYA 1ZSDB 1IJNA 3KL5A 1T5WA 3WEMA 4AK1A 5AD0B 3C08H 4YDLC 2CALA 3HB3C 4TNGA 5JLZB 2AJXH 3H53A 5C0EB 3VI3B 5FYKH 2KI6A 3PAZA 5FUCC 3RUGE 1LO2H 1YNTF 5D4HA 2IAND 4BFIB 4KK5C 3LKSA 3C6LC 2GB2A 4GMTL 2NZIA 3MXVL 3QZWG 4IQHA 1KXQE 2X1OA 5FHAL 3ZN6A 2OW7A 4NO3A 4OF3A 1E27B 5T1KA 3X12B 3L3IA 1NOLA 4XO3A 3UX9B 5ICYA 2WXMA 4FKHA 4LLMA 4G80A 2QKSA 4LRIA 5HPMB 1CWVA 5IMLA 3QDMD 3VFNA 2QDVA 1QFUH 3RGVD 3OKOA 2OLDA 3NABL 4G1EB 4WEBL 5HVHB 4UZUA 4R83A 2AJVL 2YUXA 5INDA 2PN5A 3NH7H 1FORH 5AB0A 4V1DD 2W91A 3EF4A 4X8JB 1XH0A 5D8JL 1VPOL 2VR8A 4J6RL 1USQA 2QSCH 5DEFB 5JIHA 3ARWA 1NCAL 4NFDA 4AJ0A 3WGUB 4Z7QB 4OCXL 4I4WA 4LLDB 4JFEB 1PZ3A 1Y07A 2D0FA 1T1XB 2VSCA 1OQOA 3LN4B 5ISZB 1U2YA 3T4YB 1ED3B 3D06A 3Q05A 2O5XL 4CC0A 3KAAA 4YHPB 2OMVB 1KY7A 4BKLA 4BSVB 1K6QH 2OI9B 3VXNA 2ZP0T 4XWGL 2FWOA 1KFAH 3QNYA 4G6ML 4JHBA 1KC5H 2O5NA 1FFOB 4JE4B 2BVOA 3ILQC 1E5CA 1RY7B 1WFJA 5E99L 1GOGA 3FCBA 2DRUA 5B1JC 4M4PA 2VQ1A 2VH5L 3GMMA 2NY0B 4M1DL 1I8MB 3HAEG 3PQYB 2MFNA 1F4YL 3BH9B 2HTKC 3PU7A 4LHUG 4A38A 1IJ9A 1DLFH 3MOBL 4ONHA 4XN2A 2JIXD 1YYMH 2A3TA 1N68A 5DK2A 5AOJA 5BS0E 2KQNA 1MRFH 2HKFL 3A67L 4ODUA 5K9OB 1VZHA 2OYPA 1UZ6F 5D9SA 3CVHA 5HDWA 1JFQH 4I5BB 2VMDA 1MCFA 3ZZSA 1D2OA 2LVEA 3BGMA 5FX3A 3QHFL 4B60A 4DZ8B 2AGJL 3BUTA 4HCRH 4LPTA 4Z95H 4YX2L 2NY6B 1Q9LA 4JFDD 2F7OA 1HC1A 1XEUA 3IFNH 2J1YA 1HIML 4PIRF 1ACZA 4Y4KA 2QQKL 3KJ4C 5A2AA 2Q76A 3V9EA 3WKPA 4EPSA 1V7ML 1ZEAL 1Y1UA 4PJGE 4KVCL 1I1YA 2IANE 5CUSL 3X1GA 3AQDA 5DZLA 1NDMA 1E8WA 2E9WA 1CBVL 5I0VA 5D7LA 4X7CC 4L9LC 1MVUA 4OZGB 5T1LB 6PCYA 2YEZB 3QEQB 5BOPA 5HPOA 4RFNC 4NJ9L 5FC9A 4QXTB 4DGYH 4F7PA 2P5PA 4LLUA 4TL4A 3LOWA 4R7LA 3THMH 3KYOA 4LL4A 2IDCA 3CN0A 3WTVA 2J3SA 3QDME 3QHZL 4KROB 1QVOA 1U41A 3LSOB 4S1SH 2RACA 4HC1A 1RUQL 1QG3A 3VFGH 3QG7H 25C8H 1T04B 4V1DE 1PIGA 1SQMA 2V5MA 3T0BA 3TFBA 4NDMB 3SDDC 2HPOA 2QVFB 5EEVA 2VDMB 4W9ZA 1KTRL 3B3IA 1ICTA 4ENZA 3D4ZA 4P2AA 2YPLD 3QXDA 3WHXA 3MREB 5F7EL 3H8NA 4F7EA 5GRWA 1U8PB 5F3HB 2H32A 2FIRT 1X6LA 4JFOB 4P2RA 2L7UA 4ZSOA 3B9VA 3RLSA 1NLBL 1HSBB 5EU6A 3LNDA 1EGJA 1DTUA 4S11A 1MW0A 3TEZA 1TENA 4HJ1A 4K3HA 4KZCA 8CGTA 3CX5K 2JJSA 2MKLC 2YPVL 4DGVH 2XG4B 4IRZH 1I85C 1NH6A 5DRZB 4M9PA 3KBPA 1X5HA 2CUHA 4MVBC 3TBSA 3TLRA 5HBBA 4Y2DA 3DV6A 2F7QA 1V7NL 2Q0ZX 4YHKL 3RNQA 4WFFE 4ORZC 3ECUA 3MRMB 2YMXH 3M1CA 3RUGA 3D0VA 2YUZA 1Q0XH 1KJ2A 3G08B 5HTSA 5AW2B 1UD6A 4ZMPA 2BP3A 2MNWA 4ZOBA 4FP8H 1MPAH 2NYYC 4QHPA 3EGSB 2Q5BA 1MCPH 4UMSA 5J12C 3P4LA 3T6ZA 4WUUB 1GA2A 4K7PL 3KW7A 5TQ0H 5EFIA 4CJ1A 1AO7A 3L5HA 4GRLA 4EUPH 5DTFB 3EJZD 3T0EB 3SDYH 3UYRL 5BQ7B 1LK3L 3QRGH 4JFDE 3HR5B 4YSEA 1OTUC 3V55A 4NZFA 1J1XH 1IAOA 2AFNA 5TJWK 2OXGA 3QUYB 4L2LA 5CP7B 4HV8B 2ZKWA 3ARQA 3W9DA 4A6YB 3TYFB 5KUKA 4LL9A 3RKPA 4X6CA 3WTSA 4TTDD 4K23H 4D3CL 1JWMA 3D51A 5E7BA 2XETA 4HDIB 2CAKA 2IBZY 1SVBA 3GRGA 3LVTA 4O58L 5TPWH 5ACMA 2JKTM 1TF4A 2VW4A 3LVEA 3O9WA 3PXJA 3MV01 4KO5A 4AWJC 1TQTA 3D0LB 2XBTA 3TCLB 4BK4A 1F5WA 4QJ5B 5IZ7A 3AY4A 4OB5H 4PR5A 2YEVB 2J25A 3TBVA 3SPCA 3ZE1E 2JXMB 2X6CA 3INUL 5EO0A 5A6IA 4HH8A 4FXGA 1KIRB 4JX0A 4O4YL 2OM5A 3DETD 3LD8B 4JFHE 5FO9A 1VDGA 3JV6A 5KAQG 4LCWB 4MDRA 1KYDA 3DX6B 1A25A 1R5IA 4HVBA 4WIQA 1WT5A 3GC3A 1MUJA 1PNDA 3ZYZA 3V4VB 3BLKA 1A47A 1KY6A 4H13C 4D0CA 1BFSA 3L1OH 2YPLE 3MV8B 4PFEA 5J6GB 2EXSA 2W60B 1HSAB 3MFFA 5KSVA 2M2DA 3T9WA 3VI4B 4P23D 2UWEF 4AQEB 5ICZA 5JPMB 3DC0A 3I85A 4J3OH 4NNPH 2Y72A 1U8MA 3BT2H 1HQRA 3D33A 3D85D 3G5VA 5J13C 3AFLA 3KH4A 4BRVA 4PJ5B 5EIVA 3IU3A 4H8QA 3NZSA 2LFGA 4PGBB 3FH8A 3LYRA 3JUYA 4LSQH 3RWJA 5B22A 3MJ7B 1SHSA 4QJ4B 2J88L 1GY1A 5D2NC 5EOQL 1IT9H 3Q01A 4XOBA 2WLLA 2Y2YA 2ZG3A 3VXSD 1IM9A 5DEJA 1DQKA 2H5UA 4ODVL 2C4FT 3BIAX 5KW9H 5K39B 2H0JA 1EZUA 5C0JB 1BBJB 3SYPA 5AWNH 1AFVL 4EI5A 2QMKA 1ONQA 1LWHA 3D50A 2HMID 2IANA 4F7MA 5T1MA 2NOYA 3WXVL 5DJXB 1AY1H 1UXWB 4Y5XA 2C9QA 4YBLC 4PHZA 3KLLA 4MGXA 2IAMA 3I6SA 3G6JF 3P77B 3MCLL 1UA3A 1YEFL 3CPLA 1Q1JH 2DJUA 1JL8A 4U49A 4A04A 2G60H 4W68A 4ACTA 1VKXB 4ABWA 1OGSA 4NUGH 4DP5X 4LVNC 3TO2A 1MWAL 5KVDE 5C0AB 1S7RA 3RIAF 5DJ2B 2YKLL 4K3JH 2YSSB 5EO1B 3RGVA 4ORGA 3T1WA 3RKDD 2P8PB 4HSAC 1E6JL 1LMIA 3RY6A 2OV0A 2CMRH 4KX9A 2CGRL 2NSXA 4XN5A 1G7QA 2YARA 5AZEL 3UG4A 1MJ8H 4TVSa 2HRLA 3WMSA 1KTBA 5FDWB 3NBNA 1FZMA 3BEWA 2IGTA 2WVVB 1ZMYA 4Q9QH 1VERA 3UIYA 4WK4B 4XRCA 2VLLB 1DQVA 1G7PB 1F4AA 2DIJA 3EYSL 4KXBA 3VH8A 2DTML 3L2MA 4KI1A 3QFJD 1HH9B 1D6VL 1NC4B 2BOCB 2JCCE 3DGDA 1U91B 4NWTL 3NFPB 3EDEA 4G8GA 4P5KA 1W8OA 4PJ8D 2YMTA 1IL1A 1BSIA 1N6VA 1WS7A 2PO6B 1I1FB 4KXZI 3NJFA 5AW5B 5LGJA 2PW1A 4W9JC 1F6AB 1CE1L 2R0WL 2MKWA 4PJXE 1WBYA 1W72L 4OGQC 2LOEA 5KYXA 4UT7L 3X1FA 4YXLH 4GXVL 1Q0EA 2B20A 1SJVA 1YQVL 4XAWH 3FU9A 3G5ZA 3CMOL 4YL4A 2DWDA 1GR7A 1KCBA 4FNPA 3MLPA 1NCHA 2J6EL 1VB9A 3F62A 4ZBJA 5DFVD 2JIXA 2F58L 3T3MF 3U83A 4QTIH 2BPBA 3KLHC 2CJUL 3BD4A 5SWQA 3UROR 2QGCA 2FJSA 2VXUL 2CQVA 3VXSE 1DUYB 4KITB 5DO2D 1U92B 4N5ED 5KN5A 1PG7L 1A6PA 1QAWA 1DBKH 3AADB 1VGKA 2DH2A 4PGCB 1FCGA 4NRXB 4JFDA 4EBQL 3P73B 2Y5TB 4MXVE 5MI0C 1IGIL 5IGXL 3OKKA 2I07B 4PB0L 3E1ZA 4AMWA 4WJ5B 5LHDA 4Y16A 3DIFB 1NFDE 5BXFA 3BAWA 3EOTL 2EH7L 2HT3C 2J20A 1PEWA 4LDLB 3EW3B 2AQSA 5DF0A 3C60D 1UXSA 1MXGA 3L16A 3CXHJ 4JFTA 4XP4H 2D2CC 1OSPL 4XPGH 2NXYD 4U1SB 5T5FH 5B8CB 1OALA 4KTEL 1KLGB 1GPOL 3GSWB 3MR9A 3QEGH 1J9TA 4NBZB 4I0PD 5GSVA 4DP6X 3KPRE 2ITDA 1RVFH 2E9GA 5A16A 3MRIB 4XZ4A 4TULH 4JDEB 4NZUL 3BSGA 1QZNA 4D0BB 5BVJB 3D2UD 1R5WB 1BZ7B 2R69A 4OVVA 1MHCB 3K5SA 3BCFA 4LEBA 2B2XH 1G9NL 3WLBB 4X0NA 4IM8A 3TCTA 3LZQA 2W65B 3SBWA 4ZW7A 3FTZA 3QFJE 5D93B 3F3HA 1U3NA 3VD0A 1VADB 1DLHB 2DMCA 4PVBA 5I15H 5HHNB 3R4RA 3KWVA 4EOWL 2OMXA 1SN2A 3HJ0A 5DGQA 1ESOA 3EJRA 4LCYA 12E8H 2FJFA 2OMUA 5DFWH 2CKBB 4ODTH 4X7TA 1ZLUH 3U4BL 4HFWB 4TQEL 4UIMA 4QCIB 1HEZA 2JKIS 3ZDZF 1UZ8A 5I0YA 4LOUC 2OA9A 3BUQA 3S0PA 4HPOH 5JA9A 3FAWA 3SPVB 3PGCA 3ZZLA 3QARA 5KANG 2VLKB 4F7CA 1WA2X 2I85A 3PJSB 4MB5A 1RZ7H 4C58B 3QJRB 1XR8B 1E6OH 3WKML 3IN0A 3MRNA 5E6IC 1G5GA 2Y1YA 4AOFA 4PV8B 3K46A 4G8AC 1RP8A 1FNEB 4L05A 2X12A 1PD6A 1QHPA 1PPIA 3A4EA 3MGOA 1ASPA 3UYOD 1AKJA 1A8JH 4GKNB 3S96B 1E5AA 4P4KD 1MIMH 5HVWA 5AYUH 1DJIA 3LKQA 4N22A 4ALAH 2VISA 2ZUUA 3ZDXF 5FGSA 4YQXL 2CD0A 2E8ZA 1AZUA 1TZHA 2AQ3A 3IFPA 3HPJA 5IEHA 5KYYB 5EUOA 1YEIL 1A1OA 3FN0L 5GGUA 3BAEH 4Q9RL 4GIOA 4AQ8A 2ICWI 4P59H 2OK0L 2C3GA 5TE6L 4P3CH 2AQ2A 3AUWB 5K5YA 5DD6B 3GDBA 5CEZL 2JKRM 3S2AA 3AREB 4AC2A 2AKRA 5CU5A 4WWKC 5DURD 5TQ2H 1JK8B 2AQRA 4LF3B 1G7JB 1P5VB 3GM8A 4Y1AB 1U3YA 4MHHG 2XACC 5JHLA 4LLYB 3WL9A 3CC5B 5J6SA 4NRZA 4MCNA 4ZNEE 2OMWA 3CUPB 1GKOA 4G8IB 1KCKA 1JF1B 3VG9C 2GY7B 1UZGA 4JDVA 2EUVA 3MLYL 2WWKO 4OIIL 2X2HA 3B3BA 5DJ0A 1E9OA 3MVSA 4U6HA 3K6SB 2CDGA 1V55B 3OAUL 1PD0A 3O45A 2ZUSA 3GS7A 1FLRL 4TUJB 3TOPA 3BVUA 3QAZC 4P23A 1N4XH 4DEPB 1RZIB 2QADB 1L9SA 3IDJA 3D85A 5DUMH 2EVFA 3FOLA 5IQLA 4AGLA 4P05A 3A0OA 3DURA 1T2JA 2X5PA 3ASNB 4MJ2A 2J44A 3ZDYB 2GJZB 3FSVA 4LSSL 2DD8L 1ZA6B 4ODWA 1MCWM 3LZFH 3NK3A 1CICC 1S8DA 4NZ8A 3VXSA 4AGPA 4F57L 3VMOA 5EIQA 2BCKA 1YPZB 5LGHH 3V0IA 4IDJL 4JFUA 3L2NA 3IK2A 5FYLH 3NCXA 1MFNA 1W8NA 1D7FA 2LTQB 5D7HA 2MTPA 3AM8C 2EXWD 5TDPA 3VD1A 1XZ0B 4OTXL 1DSFL 3TV3H 1ROWA 4DZBB 3O11B 4LHQB 5AVYB 1A7RL 1E50A 3S3DB 1L0QA 2PCPA 3PNRB 2Z65C 4NKIH 3MLXH 4OCWH 3KWWA 1QO3A 4RAVB 1GC1C 4KX7A 5EBWB 4Z7UF 5CZXC 1C12A 4TNEA 5KVEH 3VSQA 3WUWB 2K3TA 1IAKA 3FQTA 4NKOA 1BYOA 4MRCA 4N85A 5I8EB 2CO3A 2Y07H 2XPGA 4V2BA 5CNHA 4MJ5A 4XVTH 1ASOA 3KR3L 3S5YA 3KDMB 3L4ZA 4MDIA 1CBJA 2VE6B 3ULSB 1B90A 1PY9A 1KPUA 1D5BB 5T3XL 2X1XR 2NZ9D 3ABMB 3IETB 2YAEA 4IU2A 4U1LA 1IKNC 1WUNT 3VVVA 4JS7A 2ESVB 4NQXA 4F9LC 4G8FA 1YNLH 1ZHNB 3W2DH 1N7ML 2Z31A 3JVFC 4HHAB 1ZLVK 3EGDB 4J3TA 5I26A 3PQYD 4ANKA 4JRYB 4NHUB 5DYOB 1RUPH 4K8RL 2XX1A 2XWJB 5FO8A 1RIHL 5D4JA 4ZMYA 4O51B 3V6BR 4NC1C 4ZUTB 1AQDB 3TFKC 5A2BA 1N59B 5GIRA 1LWRA 1ZANL 2OZNA 2NYZA 2DYSB 4UDTA 2NY6D 1UB5A 3HR6A 1NAKL 3VI3E 1T1YA 1TNNA 3N42F 3O0RH 1WZKA 4GT7A 4HIXL 2B4CC 4ZMOA 1JF6A 3DUHA 2E4FA 4C59B 5K69A 4QAMB 3BSZA 4DFIA 1F4XL 2YD4A 4G43A 5ESAB 5AUMA 3RI5K 4EZKA 4Y4HB 1ZV5A 4LOVA 1AHWC 2FGZA 3A23A 3EGXB 3HAEA 5T1LD 5GGQH 3KYAA 4LHUA 1B0RB 5IREA 3DSFL 4BCYA 2C8NA 1DO6A 2ZKMX 5KJRH 1RUKH 5C7XL 4KI5D 3U36B 4HOZA 1WYJA 3B5GA 3CVHH 2JI1A 3VFVA 3REWA 4M00A 3ZQWA 5IG7B 2ZCLL 3B9KB 3LY6A 3GPEA 1NANH 1AXSA 2OQJA 4ZUUB 5F88B 1E3ZA 4WV1A 5KVGE 1ZT4B 3VDCA 4XNXH 3K72A 4QHNB 4U1JA 4OKVB 2OKMA 1MAMH 2IG2L 1DL7H 2KDYA 2JELL 3P02A 4QJ3B 3NEOA 5JHDB 1TYRA 4FL4B 3OAYH 3GK8H 4RISH 3SDCB 2X4UA 2NNFA 3JV4A 4Z7QE 3NRFA 3IDUA 5I0ZA 5CR1A 3EDJA 2O6DA 4JG5A 1RSYA 4CGTA 4C57C 2GTQA 3W5MA 3C60A 3EJYC 3PWPB 5EN2B 5E03A 3V6OC 1AYOA 4H25B 1MI5B 3LRSB 5D6DC 4KGLA 4PLJD 3N1PC 3TBYB 3COOA 5L0QB 2EIJB 2XIBA 4Y4FA 4X9BA 3NZHH 5KG9A 1DANT 4Q4IA 1B6UA 1XH3B 3HBQA 2VR4A 2EDRA 3QR0A 4YDVA 4HC1H 3QIWA 2W95A 5E5MA 1HL4A 1QOKA 2E3VA 2EC9U 2UUDH 1ZWIA 2HT4C 4ZYKB 3MRCB 1SLWA 3ARYA 1VFOA 1HZHL 5JOFA 3GDCA 4HIQA 2ETWA 3QQ9C 2CU9A 3J27A 2X9ZA 3IXAA 4OFDA 4PJCF 3ZGIA 3FUFA 1OHZA 4FQQA 4KHXL 1AQHA 4LSVH 3QCUL 5T3ZL 4OLXH 3OWEA 4GW4A 3AT9A 4OFPA 3WI9A 5DMYA 2H32H 1MREH 4FS0A 5L9DH 4TVUA 5TDNB 4Z7VF 5JZ7D 1EGJH 1QW8A 4B7LA 4E9TA 3UTZB 2KZKA 5CIPB 4Y7MA 2ICWB 3T0ED 5C09E 3C6LB 3I02A 2YWZA 4OV5A 4N0FB 1A5FH 5IVZB 1QLEH 1JPGB 3KWXA 2VERN 1OAUL 1AR2A 2VWEE 1JNHB 3CQPA 4MD0A 4WKZB 3RTQC 4DP8X 3LEYH 2OULB 5IIEA 4Z76B 1D9KC 2IFFH 1SFHA 1D5ZB 2HFFA 1KJ2H 4R90L 5DUBA 4ZFOA 1DBBL 3X3GH 4KI5E 3C8KA 4G9DB 3FB6B 3L4VA 1ZHKB 5GZND 2GHWB 1EEZA 1G9EA 1HX0A 3CZFB 4S2SB 5E2TH 3SKMB 3BN9C 4P4KA 1JOIA 4JE0A 1OWWA 1T5XA 2DKUA 2D31B 1I3GH 2CG9X 3U25A 2Y69B 1FIEA 3K1DA 2GIXA 4DP1X 1NBZB 3EOBA 4RFEA 2JQZA 2G2PA 4KZ0A 4G6KL 4KMQA 2VN6A 3QI9B 2ZXGA 1SOKA 3HG2A 4JO3L 3CN1A 3BD3A 3CWGA 3ZQXA 4Z5RA 1YRKA 1NGPL 2IJ0C 4IJTA 4PJ5D 4B3EA 4GKSA 3AMLA 4P5MB 4RZCB 4X5WB 5DS2A 4WY7L 5I74B 2WOBA 2GIMA 2CUIA 5CSZA 3R1GL 2DM4A 3A6BH 4L3EA 3RZCC 3C5JA 1N12A 4RGNC 4JJOA 1IC5L 1ZSDA 4NIYE 3WJLC 5E8EB 5AD0A 3NSFA 4MJJA 4WO4C 5JLZA 3QUML 1Q72H 1KGIA 5C0EA 1T3FB 3VI3A 4BFJA 3QFDB 4ODSH 5EZJB 2B7DT 1NCBH 3TBWB 1XB8A 4OCSL 2WN3A 4YC2C 4AG4H 2AK4B 2RBLA 3ZYJA 4BFIA 1BZQK 3GSQB 1R46A 1RH8A 5AL8A 1SMAA 3QJQB 5CJOL 3KJ4B 4JL1A 4DGIH 1IBZA 1E27A 2CRMA 3IF1B 3MUGB 2EXYC 3P3YA 3X12A 3MA7B 4LDCA 3E6HB 3T0EE 3A6CL 4Y7OC 3WN5C 3CXHK 1I9RL 4L9LB 3SYCA 4YL9A 5HPMA 5D1ZC 1EXUB 1KGUA 5C0AD 3ZKXC 5GRXG 1NLDL 5LWYH 3LNIA 2H7WA 4G1EA 4HXBH 1UCBH 1FYTB 5SWZB 3CLEH 2TSAA 1G7IB 1KBGH 4FZ8H 4B5ZA 5FUZH 2XKNB 1TZGH 1SXBA 2DI7A 2YN5A 4QO1B 3MXWH 2W59A 2VM9A 4X8JA 3BVNB 4GG6B 1D7CA 2BRRL 5DEFA 3LS4H 5FYJD 2B1HL 1TXKA 2R2BB 1VFMA 4YDKL 4LLDA 1MIEH 1CDHA 1MEXL 1YAIA 4JFEA 1H0DB 1OSZB 3SDDB 5HGGS 1T1XA 2DQEH 3LN4A 5ISZA 1LL1A 1AE6L 3T4YA 1ED3A 1OXYA 3QUKB 2VR3A 2QQLH 4GAGL 4F80A 1I9IL 4YHPA 2OMVA 3QVAA 4BSVA 2PO6D 2B08A 5D6CB 3N06B 1KNOA 4KK9C 1P1ZB 5CZRA 2ICWJ 3CFMA 4YFLF 1FFOA 2EIZB 4BUHA 4FRWA 2HCZX 3EDDA 3X1EA 5IJKA 1RZFH 4DEPC 3FHEA 5D55A 1QR1B 3QJSB 1J0YA 1I8MA 3PQYA 1HNYA 4JQIL 1AGFB 3BH9A 3KGTA 4PJ5E 3U7WL 3D0AA 1EPFA 2DZEA 1RMFL 1A9BB 4TF4A 3S9DB 4NGHH 3QO1A 5B39B 1WC7B 4M6OH 5K9OA 4LVHC 1FA4A 4NQVB 2XI9A 1X5ZA 4I5BA 5K59E 1JNNH 2FQEA 4AC4A 4OFYD 1GZHA 1B6DA 1SY6A 4DZ8A 3UDWA 4EF3A 4JPWH 2X4OB 4OGYL 4ZUSB 5H35B 4ZODA 1PD1A 5E1HB 3S36X 4R5VA 5FR3A 2GJPA 5J12B 3VFUB 2N7BA 4FI8A 3MPCA 2R29L 4KJYB 4E2OA 3IGUA 5TDOB 1JPFB 3ZTNH 2BHFA 3DECA 3NJKA 4NOBA 1FZOB 4OZGA 3MODH 3D4YA 2YEZA 5J56B 3UTSA 3QEQA 5JHAA 4G6FD 4AIXA 1IO4C 3IU4H 3ARVA 5JIPA 3T6VA 4QXTA 2WLKA 4JHVA 3TA3D 3RFZC 1ACCA 1A7OH 4LAJH 4PYGA 3LQZA 3EXLA 2CNYA 1XGYL 3LSOA 3NCEB 1BLIA 1QBLH 1QACA 2APWA 3CZJA 1T04A 5LN4A 2DKMA 4NDMA 1YCSA 5HHXL 5H4YA 1K5WA 3MRBB 3NOIA 4DKDC 5FYJE 3SQOH 4GBXA 3BPCB 3HUJB 1DEEA 3LXAA 1MFCH 1J1OH 5FGCB 4ANWA 4QWWD 2RALA 3WXWL 3MREA 4ZI8A 3KJ6L 1XX9C 4JHZA 1U8PA 1PZBA 5F3HA 2KQMA 1MF2L 5IVXF 5KVFE 4Z7WF 4HZAA 4JFOA 4DN3H 4FX5A 1IGCL 1HSBA 2CZNA 3WEXB 1BEYH 5LUMA 3IAQA 1S7SB 3UFIA 5F9DC 1RZKH 4DKTA 1ACYL 2D4DA 2H6PB 5J13B 1BDYA 2XG4A 5EWIL 1A2YB 5BZZA 4JJ5B 5DRZA 3ZRFC 1QFOA 2YAMA 4NT6B 2PWDA 1PLCA 3VB8A 4QMEA 4TNFA 4XX5A 4JREC 2IQ9L 3O2DL 4A7TA 2R69H 4BQ6A 1X9UA 1IBHA 2VLKD 3FT3B 2QSQA 3MRMA 4Y9FA 2AV1B 2CWRA 4ZDHB 1JMZA 3G08A 2A2QT 4LSUH 3ZVVA 3CFQA 5GS0H 1P4BH 3EGSA 4CW1A 1BVNP 3OLEA 3LZLA 4WUUA 4MJ4A 3F7QA 3CFNA 3T6WA 1FGNL 2RIKA 3RWHB 1KGXA 4M5TA 4PUBH 3MNDA 5DTFA 3SYQA 3RUGF 3VA2C 3T0EA 4GRWH 5CU9A 5BQ7A 4WHDA 4YBLB 3ZIYA 3T0XA 3HR5A 4HS8L 5FFGA 4IHOB 4S1DD 1LEKB 3KYKH 2LE9A 1M3IA 4I77L 3QUYA 5CP7A 1RUAL 5CBEB 2FEEI 4HV8A 4RSYA 1BQLL 4A6YA 3TYFA 1XMWA 5AYQA 1GS6X 4LVNB 3BAJA 2LGNA 4M1CD 4HDIA 1ET8A 4WW2C 3ZR5A 3GINA 4AUUA 2O5YL 4HH9B 4RAHA 2WVTA 3EBAA 3K6SA 2HRGA 1UWEH 4WTZA 3D0LA 1JZ5A 3ARED 5E7FA 3ZYOA 1S78D 1GL4B 3RB5A 4AYMC 1YJDC 4IKKA 2FT8A 3PAYA 3HCVB 4Y1AD 3UZVB 3RIFK 3D8MA 1KIRA 2WB1A 2LU7A 2ARJQ 1XGUB 1PGRB 4LCWA 1KJMB 3DX6A 1I7TB 5KVDH 2TRYA 2WXHA 3V4VA 3F8UB 3M7OA 4ZUWB 3CZUB 4B9PA 3MV8A 2VB5A 5J6GA 1I4FB 3CE1A 2W60A 1HSAA 3VI4A 5JPMA 4W9FC 2QADD 5IVOA 5EHFA 4K3DL 2CJ3A 3DMMC 3GZKA 5PAZA 1OANA 4XPFL 1U8NB 1HCZA 4JO1H 5E9DB 2X41A 4PJ5A 3CPUA 1KSRA 3TO4C 2HFEB 4JHUA 3QWQB 1WFOA 4PGBA 1A7PL 3DPBB 2K7QA 3ETSA 4AUYA 4WK2B 3MJ7A 2Y5EA 2YD1A 1RHFA 3EJUA 3S3BB 5JHLH 5CKGA 2AJUL 3ZT6A 4WI5A 4F2MA 4WF7A 3F58H 1BQHG 5K39A 3EJJX 4XCEB 3SSGA 2IBZX 3I2CH 2DQCH 3UMNA 2ZX8A 3DKHA 5C0JA 1XBRA 5DXWA 1ZLSH 1J48A 3GEFA 1B2YA 1BBJA 2VLKE 2WHVA 1G9NC 1U2CA 3AU0A 3ETBJ 5I6PA 3LEVH 4M56A 4HPYL 2XXFA 3ULUF 3GUFA 4G7QB 1WS8A 4HLEA 4J5VA 2HUEA 1COBA 4P46D 2VLRB 5DJXA 5J5EA 1UXWA 3B34A 5I17B 4BD4A 5MI0B 2APXA 4JCWA 2ZCHL 2Y2WA 4MXWL 2XZQH 1I8IB 3P77A 3V0HA 4LEXH 4K5OA 1IGML 4U1KB 5LCVA 1Z0NA 4UQIM 3SBPA 3VG0H 4PJGF 5JDJA 3EF7A 4LU5L 4NQUA 1VKXA 1AGDA 4LIQH 2KZWA 2K9UA 3DJRA 5C0AA 1HQ4B 2NNXA 3I6LE 4OT1H 4PJEB 1TQBC 2YSSA 5DJ2A 5EO1A 1JXJA 4M8RA 5FWRA 3IRCA 2P8PA 4P9HL 1FH5H 4LZKA 4OLWH 2F54D 5IB3B 2XVBA 3FONB 1NGXB 2YUVA 2X4QB 2DBLH 5F7MC 5FDWA 4N8VB 2WVVA 4K7PY 5HYSB 4GP5B 2WXFA 2H2PD 4JRYD 4K3GA 4BUQA 1FJ1B 2VLLA 3Q3GB 4XCNB 3MSPA 5IHZB 3FO1B 3LH2L 3EDKA 2A6KB 1HH9A 3JWNE 1NC4A 1OD7A 2BOCA 2ZP8A 3HNTH 4Y1AE 3NFPA 5GXBB 4PJBE 1HN1A 3I9IA 1TTFA 3ILPB 2GVYA 2Y1ZA 2PO6A 3ZX1A 1LEIB 1I1FA 1EUUA 1NCCL 2XC8A 4OQTA 5DJCB 2GUOB 4BFBD 1F6AA 1TCMA 1NEUA 2RCSL 5TF1L 3ABLB 1LO4H 3H85A 4JANB 5LJYH 4L3CB 4APXB 2Y2TA 3CMGA 2JB6B 3D4CA 2VDQB 3P0YL 3FOMB 1JYXA 2DW5A 1CR9L 3ELAT 5AW4B 1UWGL 2WUBL 1MFAH 5F7KC 4BCZA 4J3VA 1ZDSA 4DOHE 1B4LA 1WZ1H 5AW3B 1GGYA 1DUYA 4ZFQA 1U92A 5LGKA 4OFYA 2X4NB 3B9KD 1YPZE 3MRPB 2WD0A 2NTFB 5E6IB 2F6AA 2JB5L 4NRXA 1EZLA 5DMIL 1N18A 3P73A 2Y5TA 3K8KA 3D08A 3NCJH 3WYRA 4JPKL 4UT6L 3T2OA 2I07A 4PSPA 5FOBB 2NNAB 4WJ5A 3BSZH 3DIFA 2QPUA 1MFDH 5IHLB 3SDCD 2BZDA 2C1PB 2F53E 4WKXA 4CKQA 4FYTA 3JVGA 2VXTH 3B37A 3HS8A 1OCZB 5I18H 3PWPD 1GJUA 3RBSA 3UPRB 2VLME 5B8CA 1EEYB 2GJ6B 4U1SA 4ZX3A 1TJXA 4DTGH 2XBDA 1BVOA 2N0KA 1KLGA 3GSWA 1RURH 3KXFB 1T89C 2BCMA 4LCIH 4WGWB 5FIEA 4Y2LA 1L9QA 4AL8L 3LQAH 2P80D 3MRIA 2F54E 3N40P 4GO6B 2R0ZH 4HUUB 3RAJL 4OZIB 4WWKB 4JDEA 1HEJC 5DUPL 1YN6B 4D0BA 5BVJA 1R5WA 2FIKA 4LMQI 1BZ7A 1QMUA 2OL3L 1HI6A 1MHCA 2WLMA 4X0KB 2BNRB 3WLBA 1UM4H 3ZE1F 4JRYE 4PRBB 3X17A 4HJ0D 4NZJA 4QF1B 2NY1D 1JVLA 4YSPA 1BPVA 3EOAB 3VG9B 3G04B 1L6PA 3BWUC 1HU8A 2YK1H 1VADA 3IBOA 4J3XA 1DLHA 3UYPB 5HHNA 5E51A 3NJJA 1HYSC 3SGDH 3QAZB 3K1KC 3ESMA 2DTSA 4KK5D 4P2QB 7PAZA 3C6LD 4WVRA 4OSUL 5I5JA 1TJHH 2CKBA 3VSVA 4F1SA 3FTYA 2IDUA 4HFWA 1BQKA 3ZW3A 2BSBA 4GO9A 3UP1A 1H3TA 1O6TA 1FO0H 4JG0H 3NYKA 4RVBA 2DWTA 4XMWA 3PWVB 1XGQB 2O72A 3GFUA 3OBAA 3SPVA 4FTDA 5FM4A 1W8EA 1YY9C 2ATKB 2H26B 3AT0A 2VLKA 3QQDB 3F2LA 5AOZA 4YSOA 4K8RC 3RVVC 3VQ2C 3PGFH 5DJ6B 4RX4D 1UD2A 1IQWH 1EH9A 2CIIB 1XR8A 1G5AA 5F96H 4JUTA 1XO8A 4PV8A 4XP6H 2HT2C 1RIVL 1FNEA 4Q6IB 2XBZA 4B9FA 1L9TA 4U1MB 3ULVE 1PF3A 1YECL 4NCC2 4GKNA 3V4UL 3S96A 3X3FL 5I19H 5BZXA 1LDSA 3GXMA 5ADPL 4TXVB 1KB5B 2P3YA 2F5AH 4LBEB 4K71C 4PWIA 1JZDC 1CFSB 3LZRA 1EK3A 1BJ1J 2FH8A 5KYYA 1E4XL 3AQYA 3P11L 4JZNB 4PWKA 1IV8A 4U1IA 1CK0H 4S1RL 4S0HA 4FG2A 2GTWB 4CVZB 1WCBB 3QI9D 4H8WL 4M93C 1ZXKA 4UYQA 5IK3B 3VD9A 5DD6A 2J71A 3PWPE 4EN3B 2XKUA 3GMOB 4XVSL 1CXLA 3ILQD 4KQ4L 4OCRH 2WXPA 3PWUA 4EXPX 4HAKA 1F3DJ 3ZBMA 4TLKA 4GXUN 3RWGB 3AREA 1XBDA 2ATPB 1KUMA 1VHPA 4O2FB 1JK8A 5D1ZI 4LF3A 4W6XB 1G7JA 1P5VA 4H20H 2EE6A 4Y1AA 3B4NA 4LLYA 3CC5A 4UYPA 5EZOH 3JTSB 3D07A 1JV5B 3CUPA 3MRLB 3UC2A 3TC9A 3UJIL 4G8IA 5BVPH 1NM4A 1IMHC 1EZVX 1JF1A 1NC2B 1WGOA 2H9GB 2WJ7A 1UHVA 4M7ZC 3PDDA 1BM7A 4LGSB 4N6RB 2VDNL 2ICEC 3BD5A 4QRFA 4TYUA 5CLXA 4DVRL 5A3IC 5IMMB 4TUJA 2JCCF 2AK4D 3UTPD 5I1AB 5L2KB 4OAWB 3VDBA 1T03H 1RZIA 1MRCH 3GWJA 4XVJH 4AIEA 4DN4H 4HIEA 2F19H 2FLBT 3HI6L 1IFHL 1U8OB 1YY8B 4X5RA 5ID0B 2EDNA 4X80L 3T1FB 4LSRH 4JRXB 3L6FA 4Z3JA 3VWJC 2GJZA 2XA8H 4MZ2A 4PJXF 1ZA6A 3ZL4L 4BGLA 1AHWB 1J8RA 2ZXEB 3QRLA 4ELKB 3FU0A 1BBDH 2F18A 4TPRH 2APVA 5IHUL 1YPZA 4ZMQA 5SWZD 1FYTD 1I53A 1SJHB 2V0AA 3B2VL 3NZ8B 4FFZA 4X9HA 3VO0A 1XZ0A 1RZQA 1ETZB 3B7RL 1WLHA 2EUWA 4DZBA 3O11A 3RBGA 2ARJB 5BOZG 5A40E 4GEJA 1MHHB 3GXFA 2JJUA 1LK2A 5K1VA 2K6ZA 5HYSG 3QUHA 3ZJAA 4RAVA 2J72A 3W38A 5EBWA 3BW9B 3V0WL 4OF5A 4YPJA 1SXAA 3SDDD 3WUWA 5L4JA 2B0SL 4MXVF 5I8EA 4F93B 1YDPB 1ZS8B 5DJ8B 4JKPH 2J55A 3SPIA 4L2YA 4HF5L 3KDMA 1YMHB 1CU4H 1MFBH 1NFDF 2VE6A 3N41F 4OD3L 3ULSA 1XVSA 1ZLVH 3V0JA 4W9CC 2FB4H 4RAUB 4G83A 1D5BA 3IETA 2Q3AA 2J1KA 2OMTB 3BZ4B 1A6VH 4UBDC 5F9JB 4UAHA 3BVVA 5KVGH 5JTWA 2ESVA 5AKTA 5AOIA 5HHMD 3U6RB 1ZHNA 2Z7WA 3B1UA 5AG8A 1UH4A 2F61A 4QLRA 1SDDB 3BYTA 4HHAA 1HT6A 2X1QA 4FFYA 3EGDA 1KDJA 5EEZA 2IIJA 2VKXA 2WIIB 2AEIT 2V6HA 4U7KA 5B7EA 2H4EA 1EWHA 4JRYA 1FRGL 4NHUA 5DYOA 5EA0H 2P5WD 3NACL 4XX1G 2XWJA 5K93A 2AJSH 4DWHA 2E7DA 4O51A 5C9JB 3BAKA 1KTDB 2BJML 4ZUTA 1TYEB 1AQDA 4UTCA 1N59A 4EE2A 1WUZA 3BRGC 1QWUA 4J27A 4NHCL 1AS8A 5DT1H 2QFPA 4B9GA 4GQ9L 5C0CB 2Y6SC 2P1YA 1EHLH 5IJCC 1SMOA 3X2QB 4IRSD 4CBZA 4NBXB 3UTPE 8PAZA 2NUPB 4JQXA 5ESAA 3LRLA 4L1BA 1OTUD 1JGVH 1K2DB 4Y4HA 3D52A 5GGSY 5DVOA 2P48B 3EGXA 3W9EB 1B0RA 2OTUB 2XVKA 4GAYB 3C08L 5F44A 4OLVH 1CIUA 4Y0GA 3RTQB 2DOCA 2AJXL 3U36A 1TJGH 4FABH 1UD4A 1LO2L 2UVFA 1D9KB 3PF2A 5E8OB 4G8EB 3HC3H 3QDJB 2L7JA 1SY6H 5IG7A 3B9KA 4AYEC 5KBPA 2FBRA 3BWAB 1RULL 3LIZA 4YHMH 4FQLL 1FYTE 5SWZE 3L9EA 3US0A 4ZUUA 5F88A 4C55A 5C6PB 1EFQA 3U4EB 1ZT4A 4S1QH 1AZCA 4QHNA 4GG6E 3AS0A 2VKWA 4OKVA 4KRMB 3L9RB 1MCJA 3Q1SH 1U3HB 4PWGA 3QUZD 2ROXA 3NGBC 3KHOA 5JHDA 2R0KH 2WSPA 5EPMB 5JIMA 2DIAA 1QFUL 3F84A 3O3AB 3RWFB 3TT3L 3IJEB 2GEQA 4FFWC 3DDGA 4LQFH 2XRAH 3PWPA 4OF0A 5EN2A 1TLKA 4H25A 1MI5A 3LRSA 3NH7L 1RU9H 3TBYA 5C1MB 4W4OA 2QSCL 5IB5B 1XH3A 1AZVA 3EBHA 4PJAB 2EDMA 3HG5A 2P80A 5AALA 4ERSH 4BZYA 3D3VB 5IOPB 1T7XA 2FBJH 3SE3C 4X4ZA 5HHME 2X2UA 5C3LD 4OI8A 4XMKH 4CC4A 3MRCA 4ZYKA 3M17B 2YOAA 2FNWA 2VDMH 1AZBA 2ZOLA 4HWBA 5BMFL 3HN8A 2FUQA 2WKGA 3RZCB 5CWSB 2ITEA 4RGNB 1DQTA 1K6QL 2A74B 2P5WE 4RSVA 2XKSA 4WO4B 4WI6A 2JMRA 1TTAA 4PG2C 4XBGB 3KPOB 4DO4A 1MRDH 5TDNA 3L4YA 4YBHA 1M1XB 1A65A 2PLTA 5JYLA 5BRZD 4OFKA 4YC2B 3UTZA 4GAAA 2YEQA 5CIPA 3V52H 3U4KA 2ICWA 3HC0A 3C6LA 3RVTD 4I1RA 4Q58C 4QXGH 3SO3C 4AVJA 1IAIL 2VYRE 1N3NB 4OM0L 1CDUA 4N0FA 3RJOA 1BAGA 5IVZA 1DLFL 2Z3FA 3Q2LA 4I87A 1W0VB 1YYML 3S3JA 2LLLA 1JNHA 4WKZA 1SM3L 1JGLH 1Z7JA 3MROB 3CSYB 4X4ME 3WFHB 1JFQL 5CKAA 5D1ZB 1RZJC 3BPNC 4EDXB 4Z76A 2ATAA 1PJ9A 3SCMC 1D5ZA 4ZO8A 4RX4A 4GQQA 2W9DH 4HCRL 2ENSA 2GQHA 4G9DA 4O00A 4YNYB 3FB6A 5ANMB 3UZEC 1ZHKA 5FGBC 1G4MA 3CZFA 4S2SA 3SKMA 3ZKQD 4LLWB 2AJ3B 3V7MA 3HN5A 4GSQA 3TIEB 4B6ZA 5L4IA 3A4DA 2D31A 3AY2A 2WQUA 4HMCA 2F08A 2YOCA 3QW9A 3VNYA 3PY9A 4DGWC 2KPNA 1NBZA 2QELA 2QEJA 4A6YH 4DGYL 2EUZA 3NSYA 5IQOA 2DJ4A 4UOZA 5I1GH 4KNQA 3UABA 3N85H 3QI9A 5I1KH 4KQ0A 4S1SL 4PY8I 3VFOB 5I1CL 4TQ8A 3QG7L 25C8L 3VVWA 2D0GA 3MLTB 2XZZA 2WO2B 4P5MA 2A1WH 1UWXK 3CN2A 3LX9A 4OGZA 4RZCA 4X5WA 5B1JA 1O7DE 3HVNA 2JI2A 2OCCB 1ADQA 3T8MA 2BP8B 4AKOA 1GIGL 2EECA 4OY9A 3UG5A 3QEHB 5E8EA 4NQCD 1C7SA 4LVHB 3V4VH 3S8FB 3HTLX 4LO9A 1T3FA 1YLBB 3VCLB 1DEDA 3QFDA 1YN7B 5EZJA 2UXGA 2YJLA 1AP2B 4UQEA 2AK4A 4NCC1 3GSQA 2VLRD 1X5FA 4IRZL 5AVSB 3GMPA 4F1ZA 5HD8C 4TLUA 1FF5A 3MUGA 5BRZE 2UZXB 1QHQA 2BSTB 2FTAA 3BFWA 3MA7A 4C56B 3P3TA 3VI3F 4ZFZA 5TFSL 3N1GC 5CLWA 3E6HA 1V10A 3GHPA 1KLUB 1N19A 2FT7A 2HT3D 2VUKA 2AEPL 3IDNB 3OV6A 4L9LA 1E2VA 3QS3A 3CXDL 2EDBA 3NPSC 1EXUA 1KGWA 1UOVA 2WQXA 1JZGA 1ZT7B 4R97C 1MPAL 5KJ4A 1FYTA 5SWZA 3BIKB 1G7IA 1MCPL 2LLGA 1TQVA 2XKNA 3JYBA 4XC3L 3DK2A 1ZAGA 3BUBA 1OAYH 3PPEA 4QO1A 5TQ0L 3ZKND 4XN1A 3BVNA 4GG6A 3ESPA 3ABZA 4PEEA 5HGDB 3WD5H 3SDYL 3NN8B 2R2BA 3QRGL 3QZBA 5INCB 1ZD6A 2BY2A 1WAPA 2ZE0A 1J1XL 4XVOA 1OSZA 1RP9A 3SDDA 2MNJB 3QORB 3OSKA 2FQFA 3AGVA 2BY3A 3WY4A 3QUKA 5LCVH 1CXIA 4ZX5A 3KPNB 2IPTL 3U2IA 1PZSA 1JTPA 4AEIH 4UCFA 5D6CA 1EX0A 4UZSA 4K5MA 2IH1B 4Z7QF 1BF2A 3PDGA 1C5DB 1P1ZA 4GUCA 1DE4B 3RDJA 3QIBD 4KWUA 4JDTH 2EIZA 1H3PH 4A2DA 3W39B 4W6WB 5KS9B 4OB5L 2KERA 1M9WA 4EAEA 4F8QA 1XMEB 1I85A 3BP6B 1QR1A 5FYJH 2YLHA 1AGFA 1CGXA 4LOUD 3RI5F 7TAAA 4N90D 2MQGA 2XUWA 3PWNB 4JREB 2FX8H 4X6EB 1A9BA 1E30A 3SZKC 4J2XA 2Y1VA 3DRTB 3H0TB 4WSGA 1WC7A 2CRIA 5KVFH 4BUGA 3BFOA 4K3EL 4P5TC 4XB3A 4NQVA 5T5NF 3FJTA 3GNMH 4JFYB 3EFFB 3RX5A 4NNPL 4DKEH 1B88A 5GS3A 3DROB 5E6ID 3BT2L 1R3LB 2B59A 4NQCE 2X4OA 3IMTA 4OQTH 4ZUSA 5H35A 1LVEA 4LAQL 4HD5A 3VFUA 4H40A 3GRBA 2QZQA 4KJYA 1GS7A 2FEJA 5TDOA 4NQQA 1IT9L 1PFOA 1EJOL 2M26A 3NSCA 2VLRE 4EMZA 3NIFB 5T1JA 2DDQH 1NMCC 1FZOA 2VIRA 5KW9L 2NQ3A 2EDKA 1OE3A 1HL9A 3WLWC 4UANA 1X9QA 1CDYA 4P48A 2ZUTA 3E3QC 2D73A 3BJLA 3N2JA 3PIQB 1EMTH 3BQUD 5M7QA 4PJ9C 4KC3B 4WW2B 4W70A 5IESL 3K5RA 2JKLA 4UQ2B 4UOJA 3KXFD 3ZE0E 2WBKA 2X9YA 1T0PB 5DQDH 1Q90A 2DM2A 1CMOA 4HJUA 1AY1L 2ZG1A 5EU3B 1NCDH 2MCAA 1XL4A 3GXDA 5ALCH 4N9OB 1A7NH 2WQWA 3MNZB 3ZR6A 2EC9T 2NSQA 3DBSA 4KI5F 4F9PA 3BESR 3REVB 1Q1JL 1A3ZA 3MRBA 4YSCA 3BPCA 1LLAA 3HUJA 2BNRD 3H2PA 2XQYG 2G60L 3EG9B 4PJIE 3HE7D 1OQXA 1PJWA 3U48A 1ODAA 1TVHB 5F3FA 2QVTA 4K3JL 3O81A 4EDWL 4XODA 3GI8H 4OLUH 4QDGA 1BZ9B 4L1DA 4AYDC 4JFFB 2CMRL 3FPYA 3PL6D 1L9RA 1KIQB 3WEXA 4UNIA 1P4IL 1S7SA 3NG5A 3IGFA 1MJ8L 4HYTB 4P2QD 3N9GH 4Y19B 1Q94B 1QLRB 1WJ3A 2H6PA 2J1WA 2ZPKL 1KMGA 1A2YA 4LSTH 5K1NA 2R2HB 4JJ5A 4WHTB 4NT6A 3TO4B 5LG1A 2VABB 5KUMA 2F7RA 3BVXA 4JPQA 3PHSA 1FUNA 5D2NA 1YZZA 3QA3B 5EEXA 2APBA 4XE0A 3FT3A 4G59C 4JKNA 1KYFA 4Z7AA 2AV1A 3E8UH 3GSNL 4N90E 4L1SA 1J0IA 4KXAA 4Y5YC 3M1BB 4Q4EA 4BHUI 2BOBB 4MS6A 4NP9A 5BNXD 4WI9A 5SV4A 2EEBA 1EO8H 4F3FB 3FB7B 4LBAA 3OMAB 3RWHA 1ZLEA 4CILA 3V79C 3JWOH 4YXLL 2PPCA 1NWPA 2YFOA 3H3PH 3S34H 2YXFA 2CKBH 4BQCA 2VDOB 2BS71 2BIHA 5CJQL 3QGVA 4IHOA 4FG6D 4YVNA 4U6XB 1HOCB 5FKAB 1LEKA 4XB8A 3Q1EA 4HZ1A 3MRFB 5EO9B 3FMGH 3HHMA 4XOAA 4XVUD 5CBEA 3SE8H 2P42B 1M56B 3GTNA 4QTIL 1MW3A 4PRHB 2D03L 1WVZA 1DBKL 1AGEB 5BJTB 1BFOB 3WOVA 4NZTL 4MAYD 5I66A 4HH9A 3DTUB 4EN3D 1DVZA 1E8XA 3FSAA 4OR1A 3S35X 2ZOOA 1BOYA 4KMTL 1MLBB 5G2NA 1HVXA 4OF7A 1NCUA 3L2LA 3PPSA 2ZKHH 1R0AL 5G4OA 3HCVA 3FN3A 4K7FB 2J8HA 2P9RA 3S36H 3CFDB 3UZVA 4GFTB 1XGUA 5GRZA 1KJMA 5DR5H 1I7TA 4HJGB 3WTXA 3BCDA 4I2XB 1MCKA 1KXTB 2XTJC 1NC2D 4ZUWA 2BNRE 2I25N 1I9JH 1OGPA 2Q9OA 1I4FA 5T5FL 4NI6A 2VRKA 2KZ1B 3VD2A 1O9WA 3CDGB 4QOKB 1CF8H 5L2KD 2HRPH 2V7NA 1U42A 3QEGL 3LIUA 2A4CA 3FCGA 1U8NA 4NUMA 3TP4A 1E5BA 2HFTA 1H6EA 5E9DA 1RVFL 2HFEA 3VDAA 4JRXD 1MCBA 3DPBA 4P2QE 4XOCA 1QFPA 3JT0A 5C3TA 4AL8C 1NICA 3JWNH 1RHHB 2B2XL 3TM6A 1R4XA 3SPGA 2ENQA 4J1UA 4YVUA 1VIWA 2EDOA 1TETH 3L3HB 5I15L 3U30C 4EO5A 1Q8MA 3H55A 3MCKB 4PJFB 12E8L 2BFVH 4QLWA 1OCWH 5K59F 2BVUA 4ODTL 2VLRA 4RWHA 5I17A 2L7QA 3D12B 3SYAA 1YMME 3MRQB 3VGFA 3BKMH 1FG2B 2GJRA 1I8IA 3C09C 4U1KA 1M53A 4YWGL 3BUIA 4Q97A 5B1AB 1RZ7L 1HQ4A 1E6OL 4PJEA 3CZEA 3CVIH 3ZZQA 4FFZH 4RDQF 3UTTB 3C87A 4JY6B 4P4RB 4BFEA 4Z1PA 5IB3A 5J1TC 1J1PL 2BH0A 3VD4A 2CA3A 4ZW8A 1NGXA 3QDAA 3ZTEA 2X4QA 2DKSA 4A68A 5AYUL 5KSUA 3DX3A 1G7MB 4N8VA 4UZGA 5C2BH 4QT5B 4ALAL 5HYSA 5C0ND 1YVLA 4KXZH 4JRWA 4W9DC 1FJ1A 1M42A 3Q3GA 4XCNA 1OTSD 5IHZA 3AWEA 3IB4A 3FO1A 3P1VA 1LM8V 1SUHA 4KFMA 2A6KA 3CK0H 5T1DL 1U3ZA 1WQVT 4P59L 4YDIH 3SZ6A 1X5KA 3LQMA 4P3CL 3ILPA 1YNKH 5FWQA 1LEIA 3ZE2B 2ZAGA 2GUOA 2XN1A 3X13B 5TK4A 4PSRA 1KCRH 4ABVA 4BZ2A 1PAZA 4KKAD 5C0CD 2HYMA 3F05A 1PVHA 4JANA 3CFBB 1HE7A 4L3CA 4APXA 1CQKA 5EBMB 2WWMC 4RMSA 1L0PA 4H44C 5L2KE 2JB6A 4PY8J 4FFYH 1YQ2A 3FOMA 1SVZA 3VXMB 1UGKA 2ZAHA 4IK7A 5FK9B 5LKNA 4JK0D 2Q20A 4OD1H 5LDUA 1D9KD 1FC2D 4C4KT 2OP4H 2YRLA 1B0WA 3QDJD 1UM6H 2P28B 2X4NA 3MRPA 2BOLA 3U0WL 2NTFA 5E6IA 5EU7C 4IOFC 1UURA 5DUML 1ZLDA 3C6SB 3IE9A 5I8KH 1GMEA 2YQ2A 3GM0A 3TBBA 3HW7A 4K7PX 4ZOAA 3ZT7A 1N70A 5FOBA 1U3HD 2NNAA 1XCWA 3FTGB 1BAFH 1WAAE 2C1PA 1AKPA 3PS6A 3F7LA 4C83B 4K71B 5JHMA 2RA1A 3V8CA 4Y5VC 5F1OB 3U1SH 4CMMB 3CHQA 5FYLL 2ZX7A 5HDBE 1J9SA 3EADA 4LXFA 1OAKH 1EEYA 4YEFA 3TV3L 2GJ6A 2XT1B 1PNCA 4M48H 4KK8D 1R3KB 3S37X 3FAXA 4NKIL 3KXFA 4PRDB 3MV7D 5ES4B 3LIZH 1IEAB 5D2LB 5MP6L 2WZ0A 2NCMA 1JHLH 1TQCC 3D3VD 4GQPH 4DW2H 5IFHH 3RL2B 35C8H 2ZICA 4BKSC 4HUUA 5D7IB 4Y9EA 4OZIA 4WWKA 1YN6A 2CIKB 4YOKA 1IX2A 2WWOA 1MNNA 4X0KA 3RZCD 2BNRA 3H9YA 4RGND 4PRBA 1SBBA 4QF1A 4NLAA 5ESVB 4WO4D 3EOAA 2O6FA 5FO2A 3CJJA 4HX1B 1CGVA 4MB3A 4I3GA 3UYPA 4M7ZB 2ICEB 1JERA 1T80A 5GJSH 5C8JA 5FB8B 1YNLL 4JM4H 3F7KA 4UT9A 2GSMB 4P2QA 4EXKA 3TF7C 4PLOB 3MOAH 4NN5B 4PJHB 1PY0A 5C0CE 3SO5A 4XNZC 1P7QB 2EXYD 1EAJA 1RUPL 3VWJB 3RHWK 3PWVA 1HZLA 4NZRH 1XGQA 4G6JH 3MQIA 4YK4C 5KWYC 4PREB 2ATKA 2H26A 3QQDA 1AR1B 1CICA 3HI5H 4OVUA 2GEEA 5LQBL 4G9FB 1F0LA 5T33H 2KLRA 5DJ6A 2CIIA 1HKLH 3EYQC 3AM8A 4M9OA 4Q6IA 2AQ1A 1I9EA 3IMVA 4U1MA 1ZJBA 3LZOA 4HMDA 3QDJE 1NL0H 2XQYK 4Y9BA 1BV8A 5CIPH 5MENB 3PNWB 4WK0B 4UB0L 5KSAB 1MW1A 4LE8A 1KB5A 2LFEA 4LBEA 4LK4A 1VACB 5D5ME 1GJIA 3OHMB 1CLOH 1B4JH 1Z9PA 4K5LA 5F9WC 3C8HA 4NKMB 5KJRL 2V7HB 4JUSA 2G5UA 1RUKL 4JZNA 3GBEA 5C6WH 3AXLB 3C6EA 4JPVL 5LAXB 5DVPA 3CVHL 2EE9A 2JJTC 4ES9A 2GTWA 4CVZA 1WCBA 4KK9D 1J11A 4LFHG 4POZD 2KMWA 5IK3A 2IH8A 4P3DB 2ADIB 4EN3A 1IKNA 4X6DA 3GMOA 3OMZA 1MNUL 1TVDA 4HUKB 4F9LA 4MA8H 3RWGA 5IB1B 5IF0B 5I0WA 4MMYB 2ATPA 3BLBA 1DL7L 3MV7E 4O2FA 3HLAB 5JXEC 4RISL 3ZOAA 3GK8L 4ZQKB 1CLZH 3WKNA 4Z3TA 2BDNL 5CLTA 2EAEA 3JTSA 4K15A 1OPGL 1JV5A 3MRLA 2QVIA 1ML0A 3WMPA 1EBPA 3GBML 1I1CA 2H9GA 1NBQA 3NPZB 4N2MA 5DC0A 2JVUA 1AHKA 1JZJA 4N6RA 4RGNE 5IMMA 1NSNH 3G3LA 5LNDA 4ZO6A 3P30H 2VMFA 3NZHL 5I1AA 5L2KA 4E0RB 4OAWA 3BAYA 4PJBF 1I1AC 2BVQB 3M07A 5E23A 4PP1C 1NCNA 1A7QH 1X5IA 2A9ML 1U8OA 4Z7NB 1DBAH 1YY8A 4XP1H 5CINH 5ID0A 1PLGH 1BEXA 3T1FA 1XF4B 3TBTB 4C56D 3PWJB 4JRXA 5KZCB 5DC4B 1ADQH 1IZJA 4HZLB 3OGOE 2BWDA 3EZ8A 4I48B 5AL0A 3KGUA 1H5BC 2PYFB 4AQAB 4AT6B 1AHWA 2BW4A 4HISA 4LSVL 4ELKA 4OLXL 1SBSH 3ML8A 1CL7L 1LQBC 4ZTPL 3B7UX 2UXFA 4H26B 4NQSB 1SJHA 1MREL 3NZ8A 4H4NA 3FUIA 5L9DL 3MLRL 5FYKD 2B16A 2BSSB 1ETZA 1EGJL 1P53A 3Q8CA 2ARJA 3DV4B 1MHHA 4KDTC 3B1TA 5CJ8A 1ZIBA 1FDLL 3GLZA 1CZ8L 2PP9A 1Z1WA 1U93B 1SZNA 1YPZF 3BW9A 1R3JB 4KXDA 1A5FL 2PXYC 3GXUB 5HJDA 4JZJC 3I3DA 2Z0BA 4LLQB 4FDWA 3QORD 4KO7A 4YBQC 3NGBB 1NCIA 1YDPA 3LEYL 2A9NH 1ZS8A 3C2AH 5EC2A 5DJ8A 1FVCB 4CRPA 3S48A 3F5WB 2APSA 4N2DA 2IFFL 1FSKC 1YMHA 4RAUA 3X3GL 4U1NB 5D6DA 2VDPB 2CM5A 2OMTA 3BZ4A 4UV7L 5J1AB 3K2MC 4NB7A 2X6AA 5F9JA 4FQ2H 3VW3H 3BH4A 1UFGA 4OZHE 3DARA 1YYLL 4R26H 4KUZL 4W9HC 5E2TL 3U6RA 1JXKA 2C3HA 1SDDA 2Z64C 3ZMNA 2UXVA 2DQTH 2WIIA 2DWEB 1KOAA 2ZWYA 4YAQB 2IF7A 1FFPB 1DCEA 4E41B 1G1KA 1I3GL 2X87A 1G94A 4B53A 2HJKB 1NKGA 3BDYH 5I6NA 1A3QA 4K2UH 5C9JA 5E1AB 1KTDA 3L3OC 1AVAA 2ALWA 1XGRB 2EEAA 3N91A 4XI5C 4M7JH 2Q86B 1P2CB 4L48A 1DQDH 2Q8BH 3EJQA 1FL5B 2C9AA 1HL5A 5TE4H 4N24A 5TD4A 2MCPH 1JI1A 5C0CA 4ZX4A 1FNSH 3W81A 3LTVA 4BFGA 3WNKA 2ODHA 1E8YA 3RE0A 1YEHH 3E0GA 3U2SB 2PPEA 3SO3B 4FCAA 4N6QA 1TG8A 2NUPA 3O2VL 3PCYA 5CFAA 2X6UA 2AC0A 4TUKH 5B38B 1K2DA 3K3QA 3A6BL 3V6ZB 1A6TB 4R7XA 4AV0A 3W9EA 4C56E 2OTUA 1LO0L 4GAYA 4E68A 3RTQA 4J39A 5IW1B 1NUDA 1GGIH 3VQMA 5J06A 4XN7A 2EABA 5E8OA 1D9KA 1KGJA 3SCMB 4G8EA 5DC2A 3OC8A 1TMCB 2XWBB 4RESB 3H1ZA 3BWAA 2V3DA 1SLUA 1WH0A 4ELMB 5FYKE 3U4EA 1AC6A 2Q87A 2MH4A 4QTHA 5B1BB 2PABA 3CSTA 5C6TH 3L9RA 1OL0A 5G55A 3EIFA 2G0LA 3NFSH 4F33B 3JV0A 3ULVF 4P0DA 3SY6A 4M5ZH 1S7QB 4ADIA 2C3XA 2C9UA 4X50A 5AW8B 3HLKA 4H1LG 3AS3A 5G4NA 4TVPD 5EPMA 5K1JA 4MNQB 2WNWA 1YUKB 3O3AA 3RWFA 1KCSH 4HXBL 4LKXB 5LWYL 3IJEA 2DEYX 3DVGB 3WUZA 2DYPD 4WWID 5FUZL 4JFFD 5J1SC 1TZGL 3QPQC 1KWKA 4LEOB 1PQZB 3C5XA 3WAKA 4GW1B 2VMEA 1XF3B 4TSAH 3LS4L 5IB5A 4M1GH 2F1BA 4JB9H 4BWUA 2GI7A 1A4CA 2W1NA 3B8SA 1JJUA 4FMKA 4PJAA 2WBJC 5IOPA 3D3VA 1WSST 4UTBA 4WTQA 5KS9E 4MNHB 2EYRA 4P9MH 5DJAB 2WV3A 1AS6A 4PY7B 1FN4B 5L4FA 3M17A 1CDCA 1NDMB 5T8IA 2QQLL 5E2UH 3RZCA 5CWSA 2G3ZA 4IKIA 3QJFB 2XQYA 2A74A 2D7PA 2X70B 5IR1B 3OSVA 4WO4A 1CYWA 2H8PB 5EEYA 2B77A 3CFCH 3KPOA 3MV9B 2IXQB 4YDNA 3U6XA 4PJDB 1M1XA 2UZIH 3MLSL 4UNTA 3FUMA 3WY2A 1KN4L 2BS9A 2UYLB 4YSRA 4F8NA 2GAZB 2J57A 2HLEB 1BG9A 2YD2A 1N3NA 4GUPB 3UJTH 3UBXI 2AK1H 3ARFC 4XCCH 2DMBA 4JY5H 3F7PC 1W0VA 4L0YA 3II1A 2YPVA 4HOXA 1ET7A 4NGHL 4YEEA 4M6OL 2YR3A 3MCYA 3MROA 4P5RA 4PRHD 3CSYA 4OJCA 3WFHA 4WI3A 4DIXA 5D1ZA 3NPSB 4EDXA 2CBTA 1AQKL 3RJDA 3MYZA 3M86A 4F7EB 4JPWL 4R97B 3GXNA 1BVKB 1OK8A 1HWGB 4AEHL 2Z1KA 1T6BX 3NCMA 5ETUB 4YNYA 2ITCB 5ANMA 1WRFA 3D48R 4ZTEA 4KK6C 5D7EA 2OX5B 3MRHB 1DVFC 1FFNA 4Q74A 1REIA 3Q6GL 4LCVA 4IRJD 2AJ3A 5CHNB 2NPLX 2FQGA 3TIEA 2GC4C 2MPVA 3PYCA 2WCSA 3MODL 5HI4C 3V4PB 4PJ7B 3AJ7A 3MA9H 3IU4L 2RH0A 2XG5B 2NW3B 3VGBA 1TDQA 4ICXA 5I0DA 4JW3A 4WWOA 4QOKD 1UWXH 4TVPE 5CMAB 1A7OL 4HS6B 2IEPA 4B9JA 3VD5A 1BQRA 3VXQB 1MCOH 3MN8A 4QKTA 1KLFB 4LNVA 4L4VB 3DGGB 1E9QB 3PJNA 3QUGA 3VFOA 4QHUB 4NO2B 3NSJA 1MY7A 3MLTA 1AO7B 2FGWH 4GRLB 1EAOA 2WTRB 3R8QA 3UC0H 2BP8A 3SQOL 1L0XA 2BWIA 4PW9A 1SUJA 1Q9OB 5K9KB 3M88A 1J1OL 2VR6A 4PW4A 5J57B 2H0PA 5I1LB 1XIWD 3QEHA 2PTUA 3OZLA 1S3RA 1FC1A 3NSDA 4P5TB 5EC1B 1TPXC 2ZYIA 3VCLA 5F1SA 1BEYL 1UT1A 1YN7A 3NJHA 4F58H 1P1VA 1AP2A 4J3OD 1RZKL 1G7LB 1EERB 3NDZE 3C5ZC 2ZKXA 3MBXH 3T0DA 3GMRB 3K6FA 3IJ9A 2PYEB 1ZHLA 4RFOH 1MCSA 1DYZA 3WJJC 2UZXA 2BSTA 3V7AE 4C56A 1ROCA 1FPTH 2AABH 3ZUNC 3IVKB 2E76C 1KLUA 5AG9A 1HHIB 3IDNA 1KF9B 1NMCB 1E4XI 4H88L 4LQ1A 3T71A 4DCQB 4LKCB 4RMTA 3T77B 1OTTC 4LSUL 3TESA 1FQ9C 2DMKA 5JYMA 1ZT7A 1F97A 1P4BL 1QASA 3BIKA 4Z78B 3L4WA 2X44D 3AAZB 5I73C 3WIFB 1PG7W 3NESA 4KKNA 4PJ9B 2EILB 5KSVB 5D4IA 3BRDA 4OLZL 3NFNB 4PUBL 2XN9D 1ERNA 3BH8B 3FQUB 1B9ZA 3I75B 3QUXC 2NY7H 3NN8A 4WJKB 5HGDA 3RDTC 3GPSA 2V9TA 5INCA 3OLDA 4YHLL 5I0XA 3FU3A 3IN2A 4MJIB 3KYKL 1A1NA 4U05A 5I1IL 5IP4A 2X3AA 3QORA 4QYOB 1L7TH 4FA7B 3KPNA 4GG6F 2VXSL 2FECL 3JT2A 3UAJC 2VDKL 1X5XA 3KL3A 1JE6A 3TASA 2GW5A 2IH1A 1QFWL 3LEXB 5GRJL 4A2GA 1C5DA 3LZNA 1DE4A 3TGXA 4TS6A 1HYSD 3BKYL 4NQTA 1CTOA 3W39A 5KS9A 4EI5B 1WV7T 4KPHH 2CK0H 2MCG1 3D6GA 3UEZA 2D9CA 3ZL2A 1RPQA 4ZXBC 3BP6A 2VO5A 3VXMD 4KKRA 3FCTB 4LHJB 2EDHA 1BD2B 4NI3A 4AX3A 1UXLA 5KVDL 3PWNA 3VXOB 4X6EA 1D6EA 1XL6A 1U8LB 4ZFGH 3DRTA 1FIGH 3H0TA 1ULVA 1YY9D 5EDXA 2AERT 4GSXA 3KM1A 3BE1H 3RY5A 1RUMH 4ZG1A 5C2UB 3Q5OA 1AHMA 1RV6X 2CBQA 4U6YB 5ENWB 2P49B 3FQNB 4JFYA 4GAJH 1WWWX 3EFFA 1BJ1H 3O8XC 4P2YA 3DROA 4QHLB 4Y5YB 4Q52A 2DIEA 1ZXQA 3MNMA 1KXHA 4BZ2H 4JO1L 4R7NB 2WZ5A 1GTNA 1AACA 4RA0C 3D34A 4IS6B 1G7QB 3JUZA 3K80A 4TKWA 4DFHA 5HDQH 2WJ5A 1KCVH 4RMRA 2VDQH 1KN2H 4F8OA 5DD5L 4D94A 3FUJA 3F58L 3VH8B 3BMWA 3VRIB 4MMXC 3I2CL 2DQCL 3OWRA 1QD0A 4G7RB 4PBWD 5DWPA 1ZLSL 1LP9B 2Q1EA 2XXMB 4M8QB 4U6VH 3LEVL 3PIQA 5EOCJ 2J6EA 4WW2A 2OZ4L 2DQJL 2VUYA 4UQ2A 1N6UA 2FWSA 2XJKA 2BW5A 4RH4A 3MTXA 3VFPB 5EU3A 2YD8A 5HYEA 5B21A 3MNZA 2XZQL 3DXAE 1Z3GH 3WG7B 5FS5A 4DQAA 1DQMH 2IQAB 2FYYB 3REVA 1BP3B 2XN9E 1TSRA 3ML9A 4UNUA 3VG0L 3SY0B 1T7VA 3EG9A 1CYXA 3G6DH 1T21A 3KG5A 4TNVK 3WTTA 1IC4H 1MHPH 5A43C 1TVHA 3UBXB 2NX5B 4OT1L 2XTJB 3K91A 1BZ9A 1FH2A 1LWJA 2D7OA 5FLVA 2IGFH 1FH5L 3O6LH 3WHE0 1XSOA 4JFFA 1HINH 4OLWL 5IWLC 4HOMA 5A3ID 1KIQA 2OYLA 4X7DC 2Y7SA 4FFTA 3BHBB 5F1KC 1TZIB 3RP1A 1UT2A 3NAAH 4HBQA 1OAZH 4J4PD 4M29A 2NYKA 4Y19A 1Q94A 1QLRA 4KH9A 3KPQB 5A7BA 1BM3L 3DVNB 5CD5C 1D5IL 3TO4A 1P7QD 1X6NA 1RXLA 1Y18B 5FF6B 2VABA 2XZCH 5DQ9B 3VWJD 5IBUB 3NCWA 3E6FB 3QA3A 4Y16B 2WCGA 3HNTL 3WIIH 1AR1D 3LHPH 3VXME 2W0FB 4U1GC 3NCYP 5A2IH 2DQ6A 1AI1H 2KT6A 3KL0A 4WFGD 1JGEA 4F27A 4FFVD 1U3JA 1J8HB 4ONOA 4ENED 2VSDA 2OL3B 2X10A 3M1BA 1BX2B 3HNVH 1XH2A 3MJ8B 2BOBA 4AYGA 3UO1H 5IHBA 2HKAA 5E00B 2J5WA 4YIQB 4F3FA 4XMXA 1J8KA 3EFDL 1ZK5A 4UT9H 4A7SA 5KSAD 2VL4A 1C9SA 3ES6B 4N5UA 1O75A 5G4MA 1DQIA 3LPFA 5FKAA 5A16B 4A39A 4U6XA 1HOCA 1JXFA 3C09B 5EO9A 3MRFA 4KTDH 1S46A 5CCJA 5KYNA 1A4AA 4WO0A 2A83B 1E42A 1WZ1L 4MJ6B 1QPPA 4PRHA 1F2QA 4KNTA 3RB7A 1M7IB 5FM8A 4XGZB 2FT6A 3BX7C 3C5SA 2PR4H 4NX0A 2K78A 5CO1A 5ABAA 1AGEA 1K3ZA 5BJTA 1BFOA 2LAAA 3OAZK 3P3UA 4NKQB 3NTCL 4PV9B 4P2OC 3RG1C 5MEOB 3R7RA 2OMNA 1TYJA 1ZTMA 4PMFA 4TNWK 1JZ4A 1G9MC 1MLBA 4JHWL 5L7XH 1NMAH 1FGVH 5C08D 1U8JB 3BGFC 5F7LB 5D2LE 1MFDL 4K7FA 2J6WA 4BQ9A 4HU8A 3CFDA 3LKPB 1KB5H 1ZTXE 1YO4A 1MAKA 3BXNB 4KZEH 2H45A 2IMNA 5E4EB 1FP5A 1KELH 2Y06H 4HJGA 2NXZD 4I2XA 2J8OA 3SOBL 1KXTA 4WFED 3TJPA 4E9VA 1GW0A 1S7WB 3KEHA 4G2AA 4BE5A 4RBPH 2ERJC 3VXRD 2ILLA 3CDGA 4MJHA 4NN6C 4QOKA 4DTGL 4J12A 4I7ZC 2ORBH 2OJ1A 2VDRL 3HIZA 3PXLA 3O6FD 2XV0A 2X28A 3FNKA 3DJSA 4FADA 1IAII 2R0ZL 1J7VR 1JAEA 3OMIB 1CGWA 5EIIB 2WANA 2QHRH 4W81A 3TNNB 3WNIA 1OOAA 1A6AB 5ABDE 1RHHA 1UM4L 2MHAB 2VZVA 3EH4B 2G3MA 2XICA 3H2QA 2QHLA 2EACA 3DX4A 3QCTH 1HK6A 2H3KA 1SHXA 1JRHL 3HPJB 3MHZA 5I5MA 5IEHB 3L3HA 3MZTA 5KEZA 3HRPA 1S7VB 2GIYA 4WFGE 5D1XD 5BCAA 2JQAA 4HUVB 3QYNA 3MCKA 4PJFA 4YS4A 2ENYA 1TJHL 3HS9A 2MPAH 3BUPA 1XF5B 2XZAL 3MRQA 4OIAA 1MQ8A 1BMZA 2B4CH 2ZX6A 1FO0L 1NCJA 3MYJB 4JG0L 1FG2A 2NMSA 4DEWA 4L1HA 4FQXC 4Z0BL 1PZCA 4JFSA 3CVDA 1QR4A 4W4NA 4CU7A 3F85A 3QQ3B 4Y5VB 1CPUA 1F1DA 1ORSB 4M43H 1JNLH 2AJYL 4F15C 4HLJA 4KKPA 3RY4A 3VU2A 3UTTA 4BXSV 3B9EA 1P7HL 4JY6A 4P4RA 3TH4T 1EJ8A 3OVUB 4GKOA 1T89A 5I19L 3TJHD 4BFKA 3B43A 4RQQB 1G7MA 1ZDQA 4GS7C 1A4JB 2F5AL 1L4IA 1XSIA 3QH3B 4QT5A 3ZE0F 1TQCB 4GSDL 2JF1A 5ALBH 5T1KD 2OTWA 2YXVA 4E41D 4F91B 4OU3A 1NEZB 1C5BH 1XGZA 5C08E 4WEEA 5E2JA 3B83A 4GMTH 3K2UL 2BP5M 2EVHA 1CK0L 5F9AC 4JDZB 1CCZA 2D7QA 1R5VB 4PG9B 2GITB 4PJIF 3WO4C 4KO6A 3X13A 1EJ6A 4WFEE 2VQ4A 4ZFOL 4FOMA 3LN5B 1AIFB 3CFBA 1NUNB 3SEPA 4X83A 5EBMA 3GQFA 3VXRE 3VM5A 4HETA 1KIPB 2MNUA 1B2WH 3NABH 3BKCH 2HLAB 2YXWA 4CGUB 3VXMA 4FQ1H 4BEIA 3FQ1A 3S35H 2X2IA 3QZWB 5EZOL 2AAVA 5FK9A 4BELD 2PCYA 3CVCA 3JXAA 1JI2A 5D8JH 5BVPL 2R23B 4G42B 5HYJB 4KUCD 4PM1A 1NCAH 2AVFA 3MV11 3APDA 1HJCA 3SCMD 3TZVC 3OG6B 5IFJB 1YEEH 1VFUA 1BREA 1YEKH 5AVZB 1T03L 3DSNB 1MRCL 4X7SH 5D1QC 5F71A 4DN4L 4G1MB 4QI3A 4LSRL 1Y1DA 3SE9H 5D1XE 5ITFA 4P04A 4RWYH 2XA8L 1PKOA 1F4WL 4G6MH 4K5NA 3FTGA 3DPDA 2COVD 1OGAB 4U4BA 4C83A 5A2FA 3II2A 1J5CA 3G9AB 3UBXG 1BBDL 4MNQD 3QZNA 1MVFA 4TPRL 5F9WB 2JK5B 3U0TA 4CMMA 1P6WA 1OLZA 5F7DB 4QRQB 2VH5H 4M1DH 4JY4A 2WBXA 4PD4J 1NCGA 4BFOA 1P5UC 2A4EA 4XXDB 2BY0A 5IROC 1DVUA 4GUQA 1R3KA 4GI8A 1IBGH 5HI5D 4Q89A 3SYOA 5FYKU 3GZQA 5D2LA 1IEAA 1OAXH 2SEBA 4TOYH 3E7JA 3SDXB 3MUZ1 2HWZH 5IBUG 3GJEA 3RL2A 3STLB 4BHUA 5D7IA 2VRAA 3QHFH 2AGJH 2CIKA 2JJSC 2X1PA 1QX1A 1MLCB 2QGBA 3VYOA 1P6FA 4IIZA 3DX2A 4JKPL 2CDEB 5EZIH 1HIMH 5KVEE 4FQHB 1OEZW 1TTBA 3FQWB 3HAEB 1G43A 2WYIA 1F3JB 5BZDB 5ESVA 4KVCH 1V27A 1S5IH 2FB4L 4IBWA 4NLHA 3MV9D 4HX1A 4UINH 1CBVH 2WC7A 5AVWB 1ZJAA 2ICEA 3HKZA 5KVGL 5FB8A 4B27A 1NIDA 3DHMA 4F8LA 1I1AB 3RPIB 4RGMC 4NJ9H 3G6JB 4PJHA 1AXSB 2V2XB 4LLVB 1TJIH 1P7QA 4NS0A 4UTBH 4O2EB 1DR9A 4YE4L 1OP3K 2KKQA 3VWJA 5SX5K 2AJSL 1HHHB 1JPTH 3RRQA 3T4AC 4MD5B 4YHOH 5E2VL 3S6CA 4GXFA 4PREA 1H5BB 5JR1H 1IAIM 5DYFA 1LHZA 4U7SA 1RUQH 2ED7A 3BZDA 4XPHH 2BC4B 4G9FA 1HHJB 5HDRA 3H7LA 1CURA 3NA9L 5EBLB 3CU7A 1IU1A 2VSMB 5EU6D 3JZYA 5EORH 4G7VL 4EIUA 4F20A 1EHLL 1J5IA 5F7EH 4HUCA 3L5XH 1FAIH 1M05B 1IM3B 5HGHB 2HP4A 3NRPA 5MENA 4WWPA 5A2KH 5JO5B 1JGVL 3OJVC 1VACA 1G1OA 4AIOA 1KV3A 1NLBH 2PXYB 5I8OL 4R4ND 3CTTA 4JZJB 5E5MB 4FZEH 2F2HA 3VSTA 4Y2DD 4GP8B 4NKMA 2V7HA 2YPVH 1IRAY 4TMPA 3L4XA 5ESQB 4LGRB 5TGBB 1DVYA 3AXLA 5LAXA 5MHSE 2ZT9C 2FATH 3C9NB 4K94C 1FSKB 5F89B 3HC3L 1UQSB 3OPUA 4MNQE 3QHTC 1SY6L 4XNQB 4YHML 4P3DA 2ADIA 4YHKH 2PWFA 4HD9A 2AANA 2XWZA 4S1QL 5EIIG 5AAMC 1AO7D 2AV7B 5IB1A 5IF0A 4GRLD 4N0UB 2YZ8A 4MMYA 4YO0B 3Q1SL 3WFDH 3ZO9A 5B3JE 3HLAA 1GZPB 3ARGB 5SX4H 1NPUA 2R0KL 4ZQKA 4O02L 5CSBA 2YXMA 1FHGA 4QRBA 2DIBA 5F6IC 4N2CA 4LQFL 2XRAL 3UYRH 1FNHA 3ULUC 2DJMA 1RU9L 4V2CB 4A7GF 4ZUVB 2NY4C 1G1YA 2GSIB 1FWXA 3WEAA 1NEPA 3O9WD 2BVQA 2OSLB 4MKTA 4I13B 4YHNB 3NJNA 3MV9E 4HAGA 3C8KB 1AD9B 2GI0A 1BMWA 1N2RB 4M03A 2FBJL 1WA1X 1XF4A 3TBTA 2H3XC 3PWJA 3GMQB 4IOSD 4XMKL 5SWSB 1Y6MR 2VDML 5CJXC 3IMUA 4HZLA 4UM9B 4BCXA 3M45A 4I48A 2PYFA 4AQAA 4AT6A 3L5WB 2APTA 3F6LA 3B7SA 1SJEB 1BOGB 1U36A 2WNKA 2YC1B 3SD5A 5F7HA 4NQSA 3INUH 5IKCB 2DYRB 1OIOA 2O30A 1MRDL 5E56A 1H3XA 1EHAA 2BSSA 3HA0A 1J0KA 5GRUL 2MCMA 4EI6B 2JLPA 5EV7A 3DV4A 4NM8L 3V52L 2EO7A 3ZRSA 4QXGL 1QSFB 3EBIA 3ALXA 1DJGA 4P2RE 1U93A 3UBGA 3WEOA 1R3JA 4NEHB 5EU6E 4BV1A 1KBWA 1NEZG 4MJID 2B9AA 4LLQA 1NGZB 2Y22A 4AI7A 1L5GB 1C5CH 1UEMA 1FVCA 3IJYB 3F5WA 3GRWL 4L3EB 5EH1A 1TQWA 4NPKA 1L9NA 5E1QA 1IIKA 3N43F 1S9WA 1WAAF 5D72H 5DHVB 2W9DL 5EOQH 5M95B 4XOEA 3PV7A 4U1NA 2HLFD 3EJPA 4KKCD 5J1AA 2FH6A 1ZKAA 1J05B 1TEGA 2C3WA 4R4FH 5HDBF 2D0HA 4BKTC 4DNLA 4EI5D 4B7IA 1VFAB 3ZDZB 2D8KA 2HX7A 3EYOB 3PUUA 4G3YH 2WBJB 2VQUA 2DWEA 5F70A 2XX0A 1EVTC 3CSFA 4YAQA 1FFPA 2IAMD 3SE3A 1AFVH 1P4UA 2BM3A 4FNRA 4E41A 1AO7E 3L08A 2IH3B 4XTRD 2HJKA 1A14H 3MUJA 1XD1A 2H6UA 5H2BB 4R5XA 5E1AA 5IQ9B 1NWOA 4GG8B 4M7LH 1XGRA 5I1GL 2Q86A 2XYCA 5GS1C 5IW3A 3N85L 1P2CA 2YRPA 4F37F 3GI9H 3ARBB 3MCLH 5I1KL 1YEFH 4PG2A 1FL5A 1N8OE 5H37H 1ETA1 4CN1A 4TSCH 4X6CE 2X0WA 3N44F 4LNRB 4UNVA 3CX2A 2DI8A 1A3LH 3U2SA 2YKLH 3ZDXB 1JTTA 5SV3A 3RWDA 3H6JA 3WNOA 4MHHI 4EKXA 3L48A 4JR9H 5B38A 3ARFB 2QQNL 3IGLA 3I84A 3V6ZA 1A6TA 2TAAA 2J5LC 1HL8A 3Q8BA 2N7SA 1JPSH 2M8XA 4WCYH 4M4RB 5IW1A 5I1HH 5B1CA 4NN7B 2YD5A 1S9XA 1VEMA 4G8GD 3QG6B 3CZKA 5CILH 3SCMA 1RPKA 4S0SD 2XWBA 3S37L 1KNOB 2Y3NA 1E4HA 2FDBP 4WDIB 1SXNA 3UZEA 4ELMA 5I6XC 5FGBA 4L4TB 5F0JB 1OAQL 1DVFB 1G1CA 1YYCA 4XO8A 2HSIA 4UOW1 2Y4SA 5D7KD 1RZKC 1V3KA 2C9VA 4HJTA 4UTAH 4C4KO 4QRSB 4F33A 5E6ZA 2A38A 2GY5A 1QBMH 2V17H 3L4TA 1S7QA 2FJHB 4P3WA 1FVDB 3K0YA 5D5MF 4MNQA 1WCQA 2NX5D 4Y88A 4ANUA 4LKXA 1GCYA 2A0LC 3QO1B 5C0DB 1P7KB 3DVGA 1YQVH 3CMOH 3IKCB 4N0CC 4LEOA 1ZT1A 2EZ0D 2QTVA 4GKZB 1PQZA 2J6EH 1HHKB 2CH8A 3GXPA 4GW1A 4FQJH 4FLHA 1XF3A 1R9FA 3WD5L 3A24A 3QCVH 2CJUH 2VW7A 1RQ5A 1X7TA 4P5SA 2JSFA 4G6AD 4MNHA 1NUGA 5DJAA 5BO1L 2C9PA 5HGBB 3AZUA 1FN4A 1FNAA 1Z9SB 1YJDH 4PY7A 4EZLA 5LCVL 4Y16D 3RHWF 4OUUB 3IFLL 4HFUL 1Z5LB 3Q8FA 4MA7L 4PBXA 5ADOH 2CK2A 3I3BA 2AI0L 3QJFA 5FHBH 2PP7A 3DUUB 4AYSA 4TVPH 2X70A 4FCHA 4WSKA 5IGXH 5IR1A 3QISA 3UTSB 4PB0H 4C4UA 2H8PA 1QA9B 2YD9A 5BV7C 1TPXB 4XMLH 5FFOA 3MV9A 3TTSA 2IXQA 4KVNL 1KJ3H 2EH7H 3L7EB 4PJDA 3ALPA 3LQZB 2A6JB 2JCWA 1V3JA 2UYLA 3DO3A 3IFOB 3C5ZB 2VZUA 2GAZA 5FYJL 3RNKA 4GUPA 1GHFH 2ZUWA 1U8CB 3GHBH 5DD0L 4KTEH 1CFQB 2FX8L 1OSEA 2G9HB 3OKEB 4PP2B 5KVFL 3EJZC 2VXQA 4GBXB 2UZYB 4FC3E 2YD0A 1VCAA 1DEEB 3I9GH 2OR9H 2K9FB 3BIBX 3GNML 1S2EA 4HMEA 1W6LA 5IBLC 1BWWA 5GS0D 2BVPB 3UAEA 1BVKA 3O2DA 1MJUH 4BK5C 1GCFA 5I73B 1LP9E 5FECB 5ETUA 2ITCA 5JIDA 1G9NH 4G8GE 3TN0C 3WJMB 2OX5A 3GSNB 3MRHA 4XB7A 3QUXB 2K1MA 3HC4H 5CHNA 2SODB 1OO2A 2C9SA 5E4OA 3RDTB 3CZSA 1F11B 4CKVX 2VTFA 3CBRA 2VDOH 1QZ1A 1UYWL 1GGTA 1A4KB 3ESNA