2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
b'EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords O-GlcNAcase nagJ
publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
2VN5A 2ZF9A 2VO8A 2OZNA 3BWZA 4UYQA 4FL4B 1ZV9A 4U3SA 4UYPA 5G5DA 3GHPA 3L8QA 3F2LA 2B59A 2BM3A 2W1NA 4UMSA 3UL4A 2O4EA 2VN6A 3FNKA 4WI0A 5AOZA 5LXVA 1G1KA 1ANUA 4IU2A 1OHZA 3KCPA 5K39A 4DH2A 4WKZB 2CCLA 3KCPB 2Y3NA 4N2OA 4FL4C 1AOHA 4IU3A 2XDHA 1TYJA 1QZNA 2JH2A
chains in the Genus database with same CATH superfamily
1N6UA 1F3RB 1F00I 3IWVA 3FTUA 4X6EB 3B1TA 4I2XA 3ZK0A 2WYTA 4WTXA 5LVEA 5BQDA 3QUZD 4PJ9B 4LVEA 3HG0A 3B37A 2EYTA 1JHLL 4HUVB 3ESUF 2DWEA 3CFKA 3LKRA 4ONFL 1J12A 3OQ3B 3QUKA 4MDJB 1I8KB 1AXSB 3WU1A 5ICZB 5JXEA 2C9RA 1TCRA 4JFZL 4LPYA 3CSPA 3E38A 3IFLL 4UQCA 5C2UB 3GSXB 5J1TC 3MR9A 5LJYH 2LTQC 1KCKA 3CZNA 4WY7L 1KBWA 3ZL4L 2YC1B 3GINA 3WYRA 2WXMA 4UIKH 1KSRA 5EU6A 2CUHA 3GIVA 5FGCE 1UXWB 4OM1L 3IU3A 1RZGA 3EO0B 3LS5H 1INQA 4O02L 1AZVA 1YYCA 3CFUA 1BECA 1U93B 3DOHA 4ANUA 4KTDL 2DLGA 1CE6B 5AB1A 3FO0H 4FQ2L 3Q8EA 3WDHA 4EN3B 3OZLA 5GISH 3V9FA 1I1FB 2RTTA 3BQUB 4GYBA 4FXGA 1Z5HA 3D2TA 4JX0A 3D39B 1HL9A 3AQDA 1NMAL 3FB6B 3KGSA 4XPHH 2R0ZH 2EQDA 1ZGLM 4JM2D 4RESB 2V3FA 3P0GB 4XB8A 2G0KA 4LDLB 1L3WA 4F8PA 1WTLA 4N2LA 1G7LA 4AH2A 5IHUH 1G9NL 1R47A 3QUML 4NNPH 3BRDA 5MEPA 1TZIB 5DVOA 4G9FA 4C83B 1BLNB 4AVIA 4PVLA 1IIKA 2ZX9A 3CDGB 1JYVA 3UIZA 4OLEA 1ASOA 2ZXWB 4L2LA 1XAKA 5E2UH 5D7KE 4OZHE 5F9DC 1OGPA 1UADC 5L9DL 3D2UA 2EH8L 2GT9B 2JCWA 4JFPA 1NIAA 3VXOB 2PP9A 1NMBH 4QT5B 1KXVC 3JWNH 3U30C 2DQEH 1QWNA 3LSOA 2NUPA 5E2WL 5DHVB 5GGTA 3WV0A 1XGQA 4FNQA 3O3UN 4ZMLA 5HGDB 4I1RA 2H2PD 5IMMB 4K3EL 4POZC 4QEGA 4CJ1A 5AW9B 3V4PA 3PQYE 5KS9A 3NABH 1CWVA 4PVBA 3HNSH 1KIRA 4MS8C 1D5MB 2ZOLB 1DANT 25C8H 1PZCA 3H9HA 1E27B 5HHMD 1DQJB 3ZDYF 1AIZA 2HG5A 2VDPH 2Z8SA 2E75C 4LVNB 2GJZA 2LFGA 2B5IC 2AJZB 4CVUA 5GRJL 1XSJA 4WFEE 5DQ9B 1BFTA 4GG6E 5KBKA 4B7LA 5DJ0A 2UWEE 4EI0A 5ADOH 1UT2A 3F7KA 2PW1B 2NY5L 1IE4A 3OVUB 5EIIA 2H6PA 3CZJA 3D4YA 1H15B 2HTKD 1E2WA 3UTTB 1J5CA 1XQ4A 1BW8A 1T1ZB 4RZKA 4WWKA 2EDFA 1F4XL 2QELA 3O4LB 4N0YL 1Z9SA 4Q14A 4YDNA 2DWDA 1QUNA 3E9UA 3HZVB 4TNFA 2VDOL 3QG6A 4TRPL 5C0CE 4AE1A 3D85B 3DXAE 4HSAC 2CJ3A 1MLBB 2BNQA 4AOFA 5DRNA 4DWHA 4CAGA 3L4VA 4HIIA 5CFAA 4X0KB 1UD8A 3GLZA 2Y7OA 3MJGX 1QI4A 2OK0L 3DBXB 4YFDB 5B8CC 3WS3B 3OR7B 4A2DA 2ICES 1NANH 3NG5A 4IBVA 4PJEF 2AQNA 3HS0B 4E2OA 4R8WL 1YC8A 1QSED 2C8NA 4HPYL 3QJFA 3QORA 3S36L 4PJ5A 2C7UB 4J8QA 2NNAB 4UOQA 4I18B 4NO2A 4PWIA 3KCWA 4IK7A 4GUOA 1I1AA 1FPTH 4KPHH 4JFFB 4G71B 4OKVB 5B3NA 4C59B 1ZLSL 3WDIA 3QIWC 4GO6B 3MO1B 3KLQA 2CLRB 3QHZH 4PV8A 3MV7A 5EZJB 3VSQA 5FUZL 5C8JA 3EJPA 2Y2TA 2W5PA 4Z3JA 2K9UA 4JFWA 4D0DA 4JRXD 4L0ZA 3P73A 3V6OE 1Y0LA 3DVGA 5I23A 5DZOA 5J12C 1YEDB 2NQCA 1SQ2N 2MTPA 5FUCE 3X13A 4F7MA 1H5BC 5KANG 3W57A 2X87A 2QGCA 2UUDH 1RK0B 1VPOH 2FQDA 2JB5L 2CQVA 2XVKA 4K94H 5IB5A 4X4ME 3E9TA 4G7VL 3KLHD 3N43B 4HKZB 4W9FC 1BXVA 3DIVA 2Y7NA 3I6SA 3HB3C 4R96A 3CGTA 2G60L 5C08E 3QS3A 1KTDA 32C2A 1B6UA 3L3IA 1NGWB 3BT0A 5F93C 3HMXA 2E7DA 3NN8A 5D1XE 2EDHA 3IDNB 4XVOA 1BVKA 5C0IB 2E7MA 1PKOA 2Z35A 1FNFA 1QVOA 4QY8B 4APQA 5I1CL 4Q56A 1TZGL 2F53E 4K0OA 2OXGA 4GAJH 2HPTA 3KEHA 1A8ZA 1IBZA 2F0CA 2I7OA 2OULB 2VITA 3AC0A 4FERA 4PYHA 4WJ5A 4PV9B 3UJTH 1RP9A 1HHIB 1RJZA 1Z6JT 5I0ZA 5BUGA 3TF4A 3MNVA 4IGBA 4M5YH 4FQXC 4HS3B 1YPZF 2VOTA 1TLKA 1J48A 4TLKA 3OJVC 4LU5L 4LP5A 2YPVA 2VL5B 4WJKB 4H1LG 2UZYA 2A9ML 4NZRL 4YXLH 3CVDA 1I9RH 1UOLA 5HGHA 3E80A 2Q0ZX 3MLUL 3WNJA 4UUJB 4UTBA 3HN8A 1A3QA 3G6AB 3TBYA 2XTJE 4ODHL 4XH2B 3P4OB 3N3EA 5HJDA 2VR6A 5TJWK 1JGLH 5CD5C 2VMDA 1UXSB 2OJZL 3V7AE 3ZMRA 3NFPA 4U1IB 2P4AB 1YUHA 2VO8A 1V3LA 2ESVB 4KTYA 1Z32X 5IMOB 1FZMB 1ZE3C 3BD4A 3S35L 3A21A 5LQBH 5HI5C 5AOKA 3GD1C 4OZIB 1F4YL 3FQ2A 3QUYB 1JPSL 4JKPH 3UGXA 2A1WL 4KKPA 1SMOA 2PKDA 1EVTC 4L8DA 5CSBA 2XX1A 4W70A 3IXTB 5SWZB 4FZ8H 1NEZG 1NZRA 3MRNA 4S11A 3T4AB 1XR8B 1RU9H 4O2EA 1EUTA 4QXUL 1OT2A 4M48L 4WCYL 5BOZG 4KXZI 1N6QL 4BHUA 5J6HA 1KNOB 5CS7A 3ILPA 1IM9A 5E0FA 3TL5A 2QSCL 2V0AA 4MA8H 2VXQL 2VH5L 3WY4A 1IL1B 2ICWJ 3HUJB 4ONGH 2NUTA 2WGNB 3BYYA 2P44B 1ZT7B 4Y2DC 4IJ3B 4N2EA 3VU1A 2BVPA 3CZFA 1ES0A 4XBGA 4DOHB 3RWDB 3DBSA 5IJCC 3VXQB 1DVUA 2NTFA 3DURB 2CDFA 2J8UB 1MFAL 1TYEB 3M8OL 3W11C 4NWUL 5FYLE 1SOKA 4IOFD 1AFVL 2WZ5A 3ETBJ 4J4PD 1WG3A 3CVHH 4E0RB 1G9NC 5C07A 5JXED 4XBEH 3WMQA 2HJLB 3WEOA 3V2AR 4ZAKC 2DOCA 1FIGH 2J2ZA 4AJVA 2JJWA 4P05A 3CH1B 4CGUB 5GS0L 2CDGA 4DKAA 2J1XA 2NDFA 3NBNA 1Q9OA 1P0SE 1PL3A 1UQSA 3HPJA 3HKZA 4MA3B 5D96C 4ZDHB 1RHFA 4N26A 3PIQA 2A0LD 3VW3L 1JZ6A 2ZCHH 1OSZB 1CD1A 4UDUB 3VFUA 1YECH 3NIFB 4NUQA 4BKLB 4I0PD 2ADYA 1AANA 3NJGA 4N8CL 1GW0A 4TUKL 1IFGA 1XH1A 5AZEL 1GMEA 1YUKB 4YSUA 4P46A 5ITBL 5B1CA 1NKOA 2J7LA 1FGVL 1UUSA 4PYGA 2VAAA 3FB5B 5DUBA 1OW0A 1AZZC 4GW5A 2FLRT 4LCWD 3C8KA 2CGRL 4BM7A 4EO5A 4ATTA 1YYLL 2EDBA 5AEAA 2FQGA 1OM9A 3R0MA 3SOBL 1KTRL 4XXDA 3UTQA 4HWEL 4YBQC 2WNXA 5F6HJ 3TV8A 3Q5TA 2DQ6A 3FYEB 4H8WL 1DYZA 5F9WB 3HLKA 3K4AA 3RDTB 3BSGA 1QMUA 3HC4L 2X4UB 2K6WA 4HSCX 4G9FD 2XBTA 1UKSA 1KCSH 2VSCA 3CD4A 3OG6B 3VM5A 3TBVB 3ULUD 3DUHA 2GIMA 3E2HC 1IZKA 1OP9A 4KWUA 5TTRA 4AJYV 3U2JA 1IGTA 2G4EA 3K80A 4EXKA 4XO8A 2MTAA 5KJ4A 3D2UD 4PLKC 1KCWA 5EF0A 3VGEA 1SHMA 2ZCLL 5JNYB 1OCWL 3D07A 4KJQC 3TASA 4AYBA 4FLHA 5DR5L 3TYFB 1JGUL 2VZ3A 5AAWC 2AQ2A 1XGYL 1DBJL 2BZDA 3SE4A 3S97C 3GEFA 1FCGA 3F6LA 5I75B 4Y5XA 1WIPA 2D31B 2FZ3B 2ITDA 5CZRA 3LXCA 3ILEA 1BBDL 2X3AA 4PJCE 3MRHA 3PHQB 3UJJH 5GGSA 2NDGA 3O9WA 3NIDE 4NP9A 5FGBC 1FG2A 1OGTA 2MHAA 2NCMA 4OLZH 4HALA 1JXKA 4UU9B 4XVSH 5C0FA 4RGNB 3TBWB 4OR1A 3VDAA 3EH4B 2HA1A 2UVEA 3R8QA 5D2NE 1XBDA 2XQYK 4PJBB 2V2TB 5J1AB 1JNJA 5BV7L 2WPGA 4FJYA 4ZXBB 1QNZL 2FBOJ 3KG5A 3BAKA 4JBSA 3FC8A 3MUGA 1E5UI 4MNHA 4QHNA 4Y5VB 4WWKD 1NLDL 4OB5H 4YNYB 3DX0A 3ASNB 4YHIB 3L2LA 5KJRL 2ORBH 5D93B 1CDGA 4HZ1A 1M2VA 3QDME 3G6DL 3TTSA 1TTRA 3GEWB 3VFNA 3N40F 3II2A 3LV3B 4LPUA 4NZUH 3IFNL 2CO6A 4M6OL 5L4JA 2BHFA 2BNQD 4ONHB 4F8QA 2DAVA 2VC2L 3BDBA 1O6VA 2NY1B 4BRVA 1MI5B 4JANB 2WO2B 1MVUB 3T6ZA 1W72H 4JFVA 4QMEA 2XWJB 4Z7NE 4KJWD 4Y1AD 3O2VL 4U6VH 2BVTA 3QORD 5HDQH 4XCCH 2VN3A 4N6RB 3JV5A 2GEEA 4P2CG 5A3IC 3N55A 1I1AD 1KJ3H 4AUUA 3FRPA 3QRGL 4U3HA 4NNXB 4LAQL 5H37H 5CJ8A 3SE6A 4LGRB 5H94B 1GS8A 4P8QA 5LBGA 5DFVC 3LXBA 3KPRE 2J12B 4D0BA 4ZBJA 3IJSA 1RCYA 1RUPL 1C1EL 1M4KA 3D18A 5J11B 3EGSB 2QHRH 2WV3A 3V6FB 2OAAA 2CK0L 3RNQB 3FPXA 1KGCD 3VYOA 4BKSC 3LDBC 1I9IL 4P3DA 4F91B 2Y4SA 4XVUD 5HHVL 2Z7ZA 1ETB1 1TO5A 5K9JH 1ZIAA 1TITA 2JJSA 4XHJC 1HT6A 2YMXL 5FV1L 3CE1A 2VLJE 1OM3L 1DE4A 5J0BA 5C0NC 1IGJA 1OPGH 1AKPA 5PCYA 4ALAH 4U7MA 2F58H 2VLLB 1G4MA 4QF1A 3RP1A 4AIZB 3K6OA 3VFGH 4CU6A 3SPVB 2NQDA 3K5SA 4Z7WE 1KB5L 5BRZB 3BGMB 4N1EA 2KH2B 3C5SB 3GXIA 3EG9B 4UT7H 2FQEA 4Y4FA 1CT8B 2ENQA 1EAQA 4IGBD 2OMZA 3TO4B 5GRVL 5DD3L 3KPMB 2MPAL 3GM8A 1M6UA 2OZ4L 1KYOK 3AUWB 2YAOA 4GAGL 4AGLA 4HXAL 5HY9A 5DEFA 5TE6L 2FSEA 4F7TB 2NT0A 2YGOA 1DL7L 3RE0A 4EBQH 4MMYB 1EDQA 3AROA 3GUFA 1N0LB 2UZIH 4JHUA 4U7SA 4AM0B 3KPNA 3D3VB 5E8OB 4DZBA 1PLGL 4GINA 1G5AA 4OD3L 1U3NA 1NA8A 3Q2WA 4XC1H 5JXAH 1CDBA 5AAMC 3ZE0E 3LMJH 2IGFH 4H5SB 3K6DA 1K4DB 3HFMH 3T6VA 4JB9H 1WH0A 1SUJA 4M1DH 2Y07H 5DJAB 4PJGF 4Z0XA 3TT3L 3TTYA 1H6EA 1AE6H 2X4TB 5E1AA 1VESA 4UNUA 4K07A 3RHWF 2BP5M 3RFRA 3VI4E 5DRXA 1ZJBA 3NACL 5GS0C 4G83A 2R2HB 1ZTXE 5IQLA 1QTSA 3GRGA 3T71A 3A47A 3TBCA 3C2SA 3N2JA 3VWKA 3AG2B 2WD0A 2MOVA 3MXVH 2CKBB 3GK8L 2GI0A 1GS6X 3LKPB 3MN8A 4L8SA 4X7TA 1TYRA 3QULA 5F9OH 1U58B 4APXA 3ZE1E 5IHLB 5CEZL 3B34A 2FH6A 3I75A 3U7WH 3MA7A 1U4FA 4ZOBA 1PG7H 1A64A 1T89C 3Q48A 4YHML 2LVCA 1S78D 2ENPA 2HLAB 4OLYH 3QK0A 4WEMB 2XVLA 2PO6A 5HXMA 1YEWA 4WI4A 4ELMA 4PRIA 1XMEB 3MZGB 3NJXA 5DEGA 2YPKA 5FK9A 4NQEB 4H8WC 3RX7A 4LSSL 5FO9B 3SDXB 4NCC2 1VRSA 3PLYA 3QBTB 5B39A 2ILLA 2XFXB 4D3CH 5C07D 1CQKA 2BDNH 4ODVH 5DLML 3WL9B 1MHHA 1NCDH 3LEVL 3LHAA 1A6TB 4OGZA 4OIFA 2ZG1A 1HI6B 1NDGB 3FTSA 4EQ2A 2VDQH 1IUZA 2FK9A 3SZKC 1JPFB 1WVZA 1DQVA 3OKDA 5EN2A 4R5VA 4AEEA 3LEXB 4LP4A 3WLBA 2W95A 4FA7B 1KCVL 4ZPVB 5SV3A 2NNFA 1B6DA 1I3UA 5K5YA 4F1SA 1EAPA 5DJ8B 2VKWA 4CNIB 3T8XA 3FFOA 4OF5A 1GKEA 1TETH 4ZS6D 3FU0A 5H4ZA 4DF9A 2DEWX 4KZDL 4K8RD 3O3EB 4DNLA 3PV6B 3QISA 3MXWL 3B56A 1M05B 1NC4D 2FD6L 2Z8VC 3TV3L 3UERA 4OD1H 3ZDXB 4Z6AT 3SYOA 1XF2A 4OLVL 2G2RB 3QJTB 2TRYA 3O2DH 4OCRL 1M7IA 4ZW7A 3LJ3A 3PL6A 2FX7H 2ZOUA 4N24A 2HKFL 2W92A 4QHUA 3ML9A 4LKXA 2J6EH 4RMBA 3HLAB 4JHVA 2VUYA 2R51A 4HWBH 2A2QT 4HX1A 3TPUA 3PG2A 4AM0Q 2NY4B 2H1PL 4GXVH 5BV7C 2DI9A 4XZUB 5E9DA 1J5HA 2JK5B 4DAGL 2VLKD 5BZDB 5I8KH 2PWDA 1WF5A 4AQAB 5D2LA 2X53A 3GS7A 4AEHL 5D7LA 4OCXL 4XMLH 3RJQB 2ENJA 2ZUYA 4LSDA 4C4BA 5HVHC 2P42B 1SGKA 3QUHA 5HYJA 3WFEL 4X6DB 3ZTDC 5FGRA 2D4FA 2F7IA 2WTOA 2WXGA 2XWDA 2CGYA 4QHMA 5CZVH 4X7FC 1SHXA 2Z0BA 4YDZA 5F7EH 1KB9K 3A4FA 3O9WD 8FABB 4M5ZL 3M88A 4JPVL 2YFNA 5IESH 1AYOA 2P28B 3MV11 1TQUA 3H9SA 4J3OD 4FE9A 1XF5B 4FFZH 4PW9A 1LQSR 1OTUD 2EE9A 4GAYA 4RIRB 5C6PB 1ZTXH 2F68X 4FLRA 4Z7VA 2JVUA 4XMUA 1AGCB 1JZGA 4HH9B 2V9TA 5EDXA 2NY6D 4ODWB 3SPGA 3O6MH 4DN3H 3RU8L 4ADIA 2FX8H 3QFJB 1MJJA 4PI0A 5IUSA 3QDHA 3RHWK 1PPIA 1V05A 2AXHA 3LOWA 4CC4C 3EFDL 1D3CA 3PDDA 2VZUA 3I3BA 1GS7A 3R7QA 4JHWL 3ZTEA 3O6FC 4N0CD 3P1VA 3VH8B 1C9SA 1NMCC 2VQ1A 1R3IH 3NDYE 4WKXA 4YL4A 2O30A 4M6NH 4BKTC 5J89A 4P5MA 5KSBE 2OL3H 3VM7A 5LGKA 1RZ8B 3EH5B 4KC3B 4ZNCD 1VACB 3LTVA 3D0VB 4OFPA 2W9DH 5DA0B 3UXFA 3BO8A 4TTDC 4YDJA 3MJ8B 4RAHA 3RJDA 2VMCA 4PD4J 2C5DC 5JUEH 4FG6C 5FYKD 3REWA 4AL8C 1HEHC 5E94A 1QFWM 1L9NA 3CLEH 2OSYA 4PJAB 3RL1B 4I1PA 2DKMA 3D1MC 1BFVH 2RCSL 3A22A 5AG8A 2AGJH 1NFDF 2CHDA 5D1ZB 5E7FA 3UTSA 1JWMB 4KV5E 4M1GH 4PJIB 3QNFA 2DIJA 1TJGL 1WBYA 5EU4A 4YMPA 2LQRA 2KI6A 3L17A 1NIBA 4Y2NA 5LBSL 3CH8A 2VSKB 1ZGLP 3K0YA 1FDLL 1S9VB 1CFNB 1W2KT 4RGOL 4HC1H 4EUPH 8PAZA 4JG0H 4XAWH 1D9KC 2IPTL 4G80A 1HJCA 3LEYH 4WU5A 2IG2L 2DQJL 2Z91B 3BW9A 5J6GA 1X5AA 1JG9A 5TGBA 4LVHC 1MCIA 3DK2A 5AKSA 4MDIA 2OSXA 5HDLA 1MRCL 4OV5B 4I48B 3V52L 4B0MB 4CC1A 4KTGA 3CK0L 4B50A 2C9VA 4S1RH 2FWUA 2VDMB 2YRZA 1RUAH 3BEVA 1K5NA 4B9PA 1DBKH 3KBEA 4N2HA 1EDHA 4XO9A 3CX5K 3U4BH 2KL6A 1DJWA 3VFRB 5HJGA 4OZGF 1KPRB 1BZ9B 1YEFL 1RFDL 4N0FA 2OMYB 2VMFA 1TPXC 3BWSA 2VXSL 2N1TE 2XU9A 2QMKA 2APSA 2Z31C 1FCCA 1IIIA 3MYJB 3S96B 3ISWA 4DKTA 4TVPD 4YLBA 1LE9A 3KZ8A 1MCWW 2XZQL 3QIWA 3X14B 2XPYA 1DEEA 1QP1A 5FA4B 1KEMH 2YEZA 2H45A 5FV2A 4Z7QB 2CGZA 2DD8H 1XCQA 1XV8A 4JDEA 4P57A 3U9PL 2XPGA 1RI8A 4IRJB 1TJHH 3FHAA 4I0CC 3A4AA 1S4IA 5HHME 3SY0A 5K1VA 4WTZG 2VRKA 3FUHA 3RTQD 1JGVH 2HJFB 3ATEA 3RVWD 2XZAH 1H5BA 2PXYC 3VRIA 4F57H 2PYFA 3QXUA 5D70L 1BHGA 3VRLE 3IGAB 3UX9B 1MAMH 1UWXK 2WCGA 2OYPA 1XR9A 2ZG3A 4EF3A 4H8HA 3WS6C 1CLOH 5KYUB 1FSKC 3VSVA 4JKKA 2CR0A 1CLYH 3Q2LA 2A4CA 3F7VA 1OB0A 2DQCH 4TL4A 1V3MA 1HDMA 2CR6A 2NOYA 4HAGA 4P2OC 2DQGL 4LEOA 3TEUA 4OZFA 5KTEH 3OLEA 3VG9C 2E56A 4AENB 4RWYH 4X6CA 4HGKC 1ADQL 4K7FA 5D1QC 4N6QA 2MOGA 3LXAA 4CSPA 4GEJA 3BLKA 3QA3B 1B0GA 5DJZA 4EIUA 4DW2H 5GGSY 4E5XA 1BYNA 1FVCA 4MXVE 5F7FA 5CIPH 3QP3A 5AYUL 5J13B 2OYLA 2ADIA 3H7BA 2CDEA 3ZTJG 5KJ7E 2XN0A 2OLDA 4FQXA 1RMFH 4WAFA 2ZUTA 2YGVA 1JN6A 4AIOA 3ARWA 4GH7B 4ANKA 4LLMA 4NO5B 2C7FA 2PO6D 2H3NA 1BGXL 5GS1B 1GYAA 1BBJB 3DX9A 4CJ0A 1SYVB 4MHHI 4KRPC 4NQDB 1KC5H 4PN6A 5D7IA 1MNUH 2H2SC 2OYMA 3II1A 3O4LE 4N8PA 4X8JB 2EECA 5CLXA 2DS4A 1Z0MA 3B9AA 1IGCH 3IDXH 4AXWA 1SJHB 4Y16D 2DQHL 4ZUTB 5AW1B 1JZ2A 5DC2A 3DX7A 3TGXA 3CN4A 3PWNB 3VXRA 4LNVA 1VKXA 4Y19D 2D7QA 1IGIL 4ETQA 4JS7A 4LQFL 5DK0B 4UM8A 1K6QL 3TT1L 3W37A 1NUDA 4NAQA 1SHSA 4R2GD 1NGPH 1CTNA 3WNOA 1ETZB 4LSVL 2ZUWA 4GBXC 1J1OH 4PGDB 1I31A 1BQ5A 1T66D 1TSHA 4J3TA 1FV1B 1LYQA 5LGJA 1WFOA 2AVFA 4G7SB 3GBEA 2GG1A 1Q38A 2ZXGA 4O02A 4PGEB 4G8IB 3H0TB 3ULAB 3CMOH 3QEQE 3NCFB 1WAAE 3RPIA 4LLDA 3SD2A 5EBMA 3MJ9H 4UDTB 1CD8A 2W60B 3PL6D 1SMAA 4V1DB 1NEUA 1GOHA 2IH8A 4M93C 1QAWA 4Y2DA 1FH2A 3RG1C 5DQJB 2RAMA 2Y25A 3RA7L 4PGBA 2HXAA 2IDSA 5INCA 2O61B 5AL8A 3IKCB 4IHOA 3L5HA 3PYCA 3BWAA 3S3JA 5E9DD 5IV2A 2CPCA 1ZLVK 3JWOC 1N8ZA 1NWPA 1ZT1B 1VZIA 3QUMA 5D7LD 4Q2ZB 1BJ8A 4M62H 2BX5A 3KBFA 4RFEA 3U6XS 3PWLB 3ECVA 2VABA 4LPWA 2JQZA 1BREA 4KXDA 2PWGA 4PTTA 4WJG3 2WLJA 3STBA 4HCRH 1WD9A 2AK4E 2EXTA 1FYTB 4KTEH 2W80C 4UIKL 4XP4H 2ADFH 4JFQB 2EEBA 4Z7AA 5C2BH 4N8VG 1E4KC 4GKNB 5D8JL 3H9SD 3BISA 3LS5L 4PRHB 2VWEE 1VLXA 3RY6A 4QRUA 3BDYL 5CLYA 4Y2LA 3GMMA 4HUWA 3FO0L 5GISL 2HX8A 3VB9A 2P8PB 1R3JB 2QPFA 1A5FH 5EA0L 2BNRE 2IOMA 2RIKA 5I74B 5SX4H 4F20A 2JELL 1A6VH 1UEMA 1WHPA 1XH0A 3UPRA 1KGWA 4XPHL 5C09A 2R0ZL 2XXFA 3OC5A 4UAOC 3ZDYB 5B3JE 3UCQA 1KFGA 3HBPA 4YPGA 2BOCB 1KB3A 3L7EB 1HILB 3M86A 4M5SA 1A6PA 3D05A 12E8H 3FQWB 5F3BA 3GMRB 4P2AA 3LNFA 2FECL 4U1MB 3QEHA 5AALA 1KMGA 1HAWA 4J3UA 1SN5A 5IHUL 2A99A 4NNPL 1E3XA 2EIZB 1VFBB 2ESVE 1T5WA 4NUMA 3VGAC 5E2UL 2APXA 4OZIE 3RVXD 4H26A 5GIRB 4UANA 5AAWA 3P3SA 5C0JB 5I76A 4U1HA 4L48A 5FKAB 4F7EB 1QR1B 1HWHB 5SWZE 2DQEL 3QZBA 1KJ2H 1QZNA 2EEFA 1U8IB 1C12A 3O8XB 3QXDB 4PMEA 2V7NA 3Q06A 4XNXH 1JHTA 3CIAA 3EJRA 2HLEB 4G59C 2WQWA 2JF1A 4MS8D 3TVMC 4NDMA 2FDBP 4H1LH 5GRYA 3UTSD 2AV7A 3W38A 3NABL 1KXTB 3L4UA 5CUSH 1M9SA 3FJTA 3RIFF 5JOEA 1KIPB 1N3NB 3DLQR 4PEEA 3RWFA 3AG4B 3TZVC 2FT7A 25C8L 1IX2A 3OR6B 1F2XK 2VDPL 5EHFA 1MEXH 1MW3A 2I9LA 4Y7MA 2OCFD 3IPFA 4YHYC 1AD0B 2NXYD 3CQQA 2X44D 3QNZA 4OFVA 3RWGA 5F7BA 1I85C 1U21A 4LCWE 2J8UE 2C9PA 1NOAA 3L4CA 4F92B 3CQFA 2R7EA 5AG9A 3V4VB 1BIIB 1I7ZB 3CFJA 3NIGF 3KPPB 3RGVC 4NZDA 3BZ4A 5ACLA 3D69B 4I9WD 1AZUA 4ERSL 2H5UA 4LOFA 4FJZA 2ZAHA 1P4BH 4M8VA 4NC2B 3V95A 2R69A 4OGAD 5HYFA 3ULUE 1M57B 1ZHKA 4RDQF 4PJXE 3R7RA 1JNHA 7CGTA 1N4XH 1GYWA 4JY6B 2R0WH 4WEUD 2WLHA 5FF6A 4MNQB 3ZE2F 3NIFE 4QRTB 4KI5D 4FQQA 3ZQWA 1CGVA 3X1FA 4D9QD 3F7YA 4LNRA 2QKIC 3L1FA 4NI6A 4Z1PA 1ORQA 2EXYD 2HVKA 2YA1A 3NZUA 3Q6FB 4WDIB 3HBZA 3F7QA 4X99A 3QIWD 1GGIH 1EERB 2V17H 1FPTL 3IEAA 4KPHL 1J87A 1HHHA 1R24B 1GAFH 1G6RH 5DRZB 1BQHB 2N1KA 2ADGB 3QHZL 3QQDA 3ESNA 2J5WA 3TWCH 2X89A 1BPVA 1A6ZB 1MAKA 3NPZB 4FI8A 5KYXA 3ZN6A 4F8LA 4X0NA 1VF5C 1ZVSA 2WN3A 1DDHB 2X7LB 3BI9X 3DX4A 4Y4KD 1FBIL 2I5YH 3IN2A 1VPOL 3C2AH 2KDYA 4YO0B 3GPSA 1XF4B 4GI6A 2XX0A 2YUZA 1BJMA 2UXVA 2NTSP 5F9JB 4AC2A 3QUZB 4C56A 2HLFD 3NA4A 1TIUA 4HCFA 4E9RA 3NESA 1N2RA 2VJXA 1F1DA 3OB0K 1F3JB 1OWWA 4GXUN 3KVPA 3SKMB 4X4YB 3KVDD 3ZL2A 1NPUA 5L4FA 2AQ3A 3FQNB 3CVCA 4DP7X 1ZGLB 4U1SB 3Q1EA 5EC1B 5DVLA 2FSDA 3FH7A 3MRFB 2BNUA 4XHQA 1P7KA 2NY0C 5MENA 3ECBB 1O75A 1BVLA 4FQXD 1JWSA 4EIBA 2Q7YB 1WDAA 1LWJA 2HB0A 1FORH 4M8QB 3UJTL 3K91A 3R06B 2VERN 1UZ8B 4M5YL 5DHXB 1AOHA 3JYCA 1H19A 4L1LA 1OARH 3FUJA 2W9LA 5A7EA 1JI1A 4WSJA 5MHSE 5JORA 3U48A 4N68A 2N4IA 4AGNA 4ENZA 4UMGA 4YXLL 2RACA 3EYFB 4OZFG 1I9RL 4RQQA 1GRWA 1UD6A 4X4KA 5DZLA 4W81A 5AAMA 3H9ZA 2HFEA 1EZUA 5CD5D 4JQXC 1EXGA 2V5SA 5I2IA 3IVKB 2J88L 3SGDI 3AADB 1ZRUA 3K1KC 4JM2B 4LPVA 3FO9A 4FHBD 1HC1A 4P9HH 4LHUG 1KGCE 2VSDA 2F54E 1O6SA 5D6DC 2QGDA 1JGLL 3HBQA 1GGTA 4QHPA 5GZNC 3QQ4A 3VXRD 4WO4C 5AVWB 2YAEA 3L3KA 5HI5D 3TNMA 3O3AA 4A2MA 5I8EB 3EGXA 1P6FA 2WXHA 3RIFK 4PM1A 2AFNA 5DGQA 5K9QI 1AZCA 3S88H 5LQBL 1DSFH 1CXKA 2HMIC 3QZWG 1GOGA 4JKPL 2P52A 3TJHD 5K69A 1XGRB 3DUUA 3ULUH 4Q8BA 2I07B 2ZG2A 3KXFA 2DBJA 4FZ8L 2I9TA 3V0GA 4BJLA 3ARED 1RU9L 2CMRH 3P2DA 1CFBA 3TFKC 2ADJA 3PJNA 5DDHB 1T89A 3KYMB 3V5DB 2BHYA 2IANE 3PWUA 5IVXA 1QSZA 2KZKA 1I4FA 1SYSA 2OMTB 3BGAA 5DHMC 3P4LA 1TVHA 4Y2DD 2XQYG 2Q6WA 1CFVH 5LGHH 4CN4A 3WGVB 4MA8L 1KXQA 5E99H 2CKBL 3WKMH 4JRYA 4GKZB 3N9GH 4ONGL 4Z23A 1NIFA 5I1IH 1KV3A 3V4PH 3W11D 4D8PA 5MERA 2P49B 3D12B 1FL6A 5I30H 3RVTC 5AD0A 2K3TA 5ERWA 1NCNA 3BWUF 1KTLB 1JF1A 3S4SB 4BEIA 3T77B 4OSUH 2ROXA 4BSVA 3HI6H 5J57B 3T65B 1LO4H 1ADWA 3CVHL 4XT1C 4WHYG 3C5JB 1TFPA 4PP2A 1NCAH 4XBEL 4PJFA 4WI9A 1FIGL 4LCIH 2X88A 4GSDL 3JTTB 2VLRD 1NAMB 2K8QA 1W0YT 2YFOA 3G04A 3FU8A 1TEGA 4ONOA 3BIBX 5JIHA 5CBEB 1TTUA 4JE4B 2B20A 3UYPB 2EE0A 2ZCHL 3AW5A 2AC0A 1UJ3B 3MUY1 3F3HA 2FL5B 4LCUA 3JWNC 1YECL 1UT1A 2A4ZA 4L5FH 1UGNA 3T0EB 4AUYA 4AYMC 5A2BA 4OF6A 5C9KA 2XQ0A 4TUUA 4GRLB 5KVDH 1QSEB 1K2DA 1PNCA 1RUQH 2CUMA 2EDXA 3IS1X 3GHEH 5I5JA 3VFOA 4NO0A 5C09D 4DPBX 3BPNC 3EOBA 2X4NB 2ROYA 3QWRA 3BUYA 2B4CH 2W65B 1FC1A 3AS3A 4U1NA 3TFBA 4WF7A 1T1WA 3Q3GA 1W8NA 1CFMA 3PUUA 3N91A 2WTRB 1XAUA 1HQRB 2BXYA 1E43A 1WUZA 4MBOA 4G5ZH 2VMJA 3DOSB 3BIKA 1FNGA 1E3ZA 4PLKD 4UQ3A 1KCSL 43C9A 1WICA 2NCEA 3QEUB 4DGYH 1MCFA 3OXSA 2WKGA 3J7HA 3F64A 4KJQD 2HT4D 1S7QB 3QIUD 5JHMA 2B08A 2BS9A 3BVNB 3DNKA 1G7PB 3IKKA 2UY6A 2EADA 4GMTH 4Z78B 5D7EA 3LZRA 4WFFD 5C0BD 4TUOA 4PRPA 1TZOA 2NY3D 4A2FA 3OGCB 4JO3H 4Q74A 2EYSB 3GB7A 5JO5B 1HH6B 4AJWA 3ULVE 5CAYB 1OT1A 2XNAA 4I77H 3DVNB 4TNGA 1I3RA 4NCDA 3VFMB 3HIZA 2H9GB 3UJIH 3BPCA 2P8MA 3N50A 4MZ3A 5IB4B 3UJJL 1V7MH 1DO6A 3VD9A 2IADB 1BEYH 5FDYA 5BZWB 3ZHLA 4CMMA 5JW3H 5A16A 3L9EA 1JIBA 4JO5A 4OLZL 5I5RA 4XVSL 2W1NA 4QXVA 5KSAD 1E30A 1CS6A 1XHHA 1IRAY 2DQDH 4X9BA 1RUMH 1K8IB 2ZXDA 5K93A 3NTCH 5D5MB 1QR4A 1LEKB 3CTTA 5DD6B 4CC4A 1UH2A 3SDXE 5EUOE 4QD2E 3CSYB 4HKJB 3O6FA 2M8XA 4A2EA 4OB5L 2RH0A 3L6FA 2H41A 4XMKH 4OCWH 3VVWA 3OMIB 1BX2B 5IVZA 3H3BC 3IJHA 5KVMC 2IPUK 2KZWA 1DN0B 2YN5A 4I4WA 3UH8A 2YUVA 2A73A 2XXCB 4IMLB 4NZUL 2WBKA 4K94C 1E40A 1U8CB 1QPKA 1AIFB 2F7RA 1P7QB 2VLKE 3LY6A 4I3SH 4LDOB 3VE0A 1ZDQA 3HE7B 1OOAA 1OAYH 3R4DA 4X6CF 2IO5A 4JDVA 2YBRB 5A3ID 4TQPA 1CZ8H 1W72L 3ESPA 1HXMB 2BRRH 3EBGA 1KDIA 5JQ6H 1S5HB 2B1AH 4QRRA 1JP5A 3FFDB 4ZTPH 5K33A 5IHBA 1PKQB 3K71B 3WNMA 2AP2A 1TNMA 1KJ3L 4XOCA 4G6JH 1GW6A 2Y7QB 5I66B 3K8LA 4U3SB 1GZPA 1L9RA 2WBJB 4MJ4A 5I1LB 1TTBA 3DIDA 2XG5B 2R9HC 1XDTT 3L13A 3QB7C 4NOBA 5C0AE 1PF3A 1UZ6F 4RAUA 2OZ4A 1FL3B 3F05A 3K72A 4Q9QH 1ZSDB 1JCKA 2ZSWA 1KYFA 2OI9B 2JCCF 2X12A 5GZOD 1D9KA 2ED8A 3BAIA 4DHLA 2QHRL 4JFHD 4ZD3H 3IDIA 5AUMA 4P9MH 2VN7A 1X7QB 2BIMA 1JVKA 4M7KH 5IMKB 1OCCB 4NQXA 4BFJA 4OTXH 4XHJD 3TO2A 5BVJB 4WO0A 2C3VA 3BD3A 4ZMQA 3MRRA 1TEFA 3KPTA 2ITEA 5HDWA 2CU9A 1MFMA 1RZQA 4ZOEA 4YEFA 3G3LA 4LEBA 2NLJA 5K9JL 4RRPM 1E8YA 2BIQA 4HMCA 2QL1A 3RWEB 3UP1A 2FJUB 2DWEB 3CFKB 4A1RA 3ZDZF 4CVXA 1H3PH 5DWUL 4ISVA 3RUGF 1L7IL 1OPGL 1UJTA 1TCRB 2IAMC 2IH1B 1JD7A 4ALAL 4Y9BA 3AVEA 1KT2A 3IJYB 2F58L 2WINB 3RIAF 3ZHKA 3B1UA 4X5XA 2WZAA 3MR9B 3DJRA 4H20H 3VFGL 4JFTA 1FG9C 2Z31A 3CFTA 2CRZA 5DF0A 5EU6B 3GIVB 4U7KA 2CD0A 4UV7H 4BIKA 4UT7L 3I9GH 4LE8A 5KSVA 1RZGB 4FYSA 5FYKE 3S37X 4K15A 4Y5YC 2WCPA 4I7ZC 1DBAL 1SDAB 2IBBA 4WUUD 4JZOA 3QFJE 2WVTA 2P7TA 3QPXH 1A4AA 1LK3H 3M46A 4U1KA 1PYWA 3KPLA 1CR9H 4FXGB 4G7YL 4I1NB 4XPBH 1MCOH 1E4XI 5B1JC 5IEKA 5B3SB 4EBQL 2PXYA 3ETSA 4ZPTA 1BD2E 2UZIL 3FQ1A 2F8VA 4B97A 2EUWA 4XC1L 1CFSA 4G6KH 3WS6A 5ESQA 2V5YA 3EIFA 4AY0A 2IGFL 3NJVA 4HBCH 4AH2B 3BN3B 4NC1E 3D9AH 1UYWH 3HFML 4JB9L 5MEPB 4NQVA 4P2OA 1J5OH 4M1DL 2Y07L 3NSJA 4MQTB 4YAQA 4LPCA 3WN6A 4U6YA 1L9OA 2JV6A 3UGEA 4PUBL 3D2UB 1JJUA 2VR3A 5D1QA 9PCYA 4JFPB 2XIBA 3HZKA 4PJAE 5FUCC 2EZ0C 3F8UB 4H13C 2Z1PA 1RSYA 2AZAA 3LSOB 4J39A 2Q86A 3FPYA 2NUPB 1FL5A 1RK1A 2TSAA 1ZTMA 4KO7A 4X50A 1N64H 1ND0A 2KQNA 1XGQB 3MXVL 4FYTA 5E51A 3VACA 1FJ1A 5F9OL 2YQBA 1B4JH 3GZPA 1GHFH 3B2MA 5ADPH 3KPQA 4B9ZA 3CC1A 5BNXD 1A1OA 3U7WL 1KIRB 2YR3A 1PG7L 1Q0YH 2APWA 3HMWH 3H9HB 4JRYD 5IJKC 2JIXB 4HS6A 4OLYL 2HG5B 3U7YH 5AVSB 4JREC 2GJZB 1RULL 1MPAH 3GJFA 5KWYC 3NCCB 4ZTOH 2GJJA 1G7IA 4NHCH 5IOPB 1A3LH 4MMXC 5DJ0B 3MPCA 2BCKA 1L5GA 4YJZL 1BYOA 1SN0A 3MRKA 4N2BA 1X9QA 3AB0C 5EIIB 4TS6A 3ALPA 1OIOA 3CXHK 2NNRA 4QOKA 2F74A 4D3CL 2BDNL 2WBWB 4ODVL 1DVSA 4WI0A 2EIKB 4WWKB 4AWJC 1T7YA 1BVNT 1FZJA 1NCDL 1Z9SB 4NRXA 4N90D 2DWDB 1TZ8A 1QUNB 2NZ9D 2VDQL 3QG6B 1WO2A 2V6HA 1QRND 1J0YA 2CUAA 4JMNA 4EPSA 4MHHG 1OB1A 2BNQB 4XP5L 5DRNB 4GW1A 3IFOA 4GBXA 4HIIB 4DKFH 1S7RA 1F56A 5JZ7C 5G5DA 1Q90A 1DVYA 3K46A 4K7PY 4MJIA 1TETL 1FNEA 5D9SB 3THMH 1YQVL 1BG1A 3NJIA 1YEEH 1FZKB 3QJFB 1OOWA 1ZK5A 2ZONA 4PJ5B 4FHKA 4NO2B 1MQKH 4EIGB 3WJJC 1KWGA 3BYTA 1X5MA 4WI6A 4OD1L 4MTMA 5A43C 3QRBA 2D9QB 3QWRD 1JXJA 1UM4H 3O2DL 3JWDH 5DHYA 1NOFA 3UDWC 3MV7B 5EU3A 5C8JB 5I71B 5FYKH 4AC4A 5GS2D 4NB7A 1C5BL 3L5JA 2FX7L 4PVNA 2DL9A 3WXVH 4HK3N 1FVEA 4D0DB 2J6EL 4IBYA 1CD9B 1CGSH 3LZOA 3RIAK 4HWBL 1Y0LB 3DVGB 3GSNH 4F7MB 3X13B 5EFIA 1PIGA 3CFQA 5I8KL 2EVIA 2X1PA 2ZKYA 1H6TA 4XMLL 4PRPD 4R90H 4R96B 1U33A 3C60A 2DQIH 4B9FA 3P02A 5EF1A 1KTDB 32C2B 3L3IB 1NCCH 5D4HA 4XC3L 4ZODA 3SO5A 5FYKU 2W0KA 4LDEB 2G4GA 4NM8H 3TH2T 4Y19E 2HX7A 2ZOTA 3NN8B 4ZSOA 1E4KA 3FT4A 4ZQKB 4DKEH 4E41A 5CZVL 3PP3H 5BS0A 1BVKB 4AEIH 4C8XA 5F7EL 4JGUA 4DUWA 2Z35B 4APQB 1BZQK 1QVOB 3O2WH 4Z18A 4JQIH 1SF5A 3Q5YA 5IESL 1RL1A 1SDDA 4IU2A 2FVNA 2Z65C 1VJSA 2JXMA 2VITB 4FFZL 4OBSA 5JPMC 1KPUA 3MLXH 4WJ5B 1ZTXL 2ZCZA 1RJZB 1PZBA 1FH5H 2G9KA 2J6WA 3Q8CA 3HRZA 4FG4A 1TG8A 2BVQA 2OCJA 1USZA 3OJDA 4IGBB 2VDKB 3OV6A 1E28A 2CIKA 2F5AH 3MNDA 4P5SA 3UG5A 3WIFA 1RHHA 3O6ML 5A40E 2FX8L 4OBRA 3RQ3A 1ZS8A 2J5LC 3VB8A 1M6OA 5L2KE 3QPQD 1DJYA 2UZYB 3O6FD 1YEKL 2CRMA 1O7VA 3T0XA 5B7EA 3FKUS 5HGHB 3W0WB 1S7WA 3NVQA 1NSNH 1S3RA 1FN4B 2P24A 2APBA 5FM8A 1OK8A 1SBSH 1W80A 3TBYB 1JCVA 5GGUA 1R3IL 2VAJA 2CCLA 4M6NL 1JPST 4HAFA 4XO5A 4TTDD 2CO1A 2OL3L 3QO1A 1R0AH 3ENEA 4BCXA 1ITBB 5DYOA 1AVAA 4L8BA 3BPOC 4NN5C 1YUHB 2W9DL 1T5XA 1OP5K 3ZTJH 4BGDA 2CHZA 2DMBA 1OZTG 4CA4A 2J56A 3BQVA 3MBEA 1GGUA 5JUEL 1ESOA 3TVMA 4ALAC 1SUHA 4B9CA 3APFA 5E70A 4XB3A 4K71C 5CF3A 1MDAA 4UF7C 2Q9OA 1ODAA 2CXKA 4L8DB 3PWJA 3TZVA 1T04A 1F45A 5DURB 1BFVL 1ZEAH 3MRNB 4AYEC 2AGJL 1ROWA 4O2EB 5ABZA 4P07A 4EI5C 2WOBA 1NOLA 4LESA 5AOIA 4M1GL 2BS71 2XVBA 3FULA 4IW4C 5BJTA 4KUZH 4Q6IC 5J6HB 4Z7UF 1D9KD 2HVJA 2HUEA 2GC7C 4MNGE 5I16A 3ILPB 2E7LA 1IM9B 1I85A 3EDEA 4MLSA 5MP6H 1AOZA 3MLZL 3G5YA 4HC1L 2Y2WA 4JG0L 3L9YA 2NUTB 1UOWA 4XAWL 3LEYL 4LLAA 3RGVA 4L1BA 2BVPB 3CZFB 1ES0B 4XBGB 2C9SA 3NIDF 1BZDA 4Y1SA 1T0MA 1TVBA 1D5ZA 2NTFB 4PRNB 2CDFB 3FL7A 1XSOA 2Q20A 4BZ2H 2CJTA 4S1RL 3MHZA 4RAVA 1E9PA 4ZQTA 4KQ0A 2K4AA 3ATFA 1RUAL 2VRAA 1O7DC 5D2NC 3UYRH 2FLBT 4E9SA 3FDWA 2J2ZB 2KBGA 2QKIA 3V4VL 3U4BL 2BERA 1DUYA 2B8OT 1UB5A 5IK3B 3O6KH 4L3CA 1Q9OB 3EFOA 5C3IA 2Z31D 2I7SA 1UQSB 3DGCR 3HPJB 3WTXA 4YQXH 1L0XA 3PIQB 1Y18A 3SB3A 1CD1B 4HUUB 4IIQC 4OGQC 1J8HD 3VFUB 3SDDC 2H0JA 1BZ7B 4HZLA 4L0PB 5ABAA 3AU0A 3LZFH 1QYGH 3CZUB 3VXMD 2J1KA 1OV8A 1CFTB 4P46B 2YPLD 2WIMA 1DSWA 1FA4A 2ZTBA 3OAZK 3X12A 3ZDYE 2VAAB 2XTSA 1OAXH 4GW5B 1VZHA 2DD8L 2GFBA 5KVGH 2C9AA 1JVLA 2N01B 3C8KB 3GKZA 5CJXC 2PXYD 2ZWZA 1TJHL 5EU5A 2WTPA 4XXDB 3WNPA 3NJFA 3UTQB 3FSWA 5BO1H 4KXZH 4NQCA 4O9HH 1JGVL 5EV7A 2XZAL 3QDJD 3N44F 4F57L 2QADD 5L88H 1GA2A 1S7UA 4OQTH 5KVEE 4NKMA 3KH3A 4WWID 1XD0A 3V4LA 3SQOH 4AT6A 3WY3A 3QZPA 1HEJC 4HJ0C 3M1BA 1CLYL 3CFDB 3CX5J 1IGTB 1N8OE 2GY7B 3NCYP 1IBDA 3KBPA 4OLWH 2FUTA 4YHZH 1LE5B 3I6LE 4NWTH 2R56H 5KTEL 4GQRA 5JIPA 4UV4H 4RWYL 2R1XA 4D94A 3HG1A 1W0WA 3Q8FA 1I8IB 4PJEE 4DW2L 2IWEA 4Y5XB 1T1XA 2OYKA 2ITDB 1XGPA 1BJ1H 4P59H 1XIWD 4FN0A 1CDUA 3MRHB 1SY6A 3IMTA 5GGSB 5HHOB 2WLLA 4P99A 3TH4T 3V0EA 2VTFA 4L18A 4YGAB 3P2TA 1M71A 4XBPA 5KBMA 3M45A 2AQPA 2MHAB 1OGTB 2H2SD 3NGBB 5J3HD 4HV8A 5C0FB 2XJKA 2COVD 3CZGA 4QKXB 1QG3A 5D7HA 4L1TA 3PUCA 4MJ5A 1NPNA 1KC5L 2W38A 1MNUL 5K59F 3DUSB 5SWSA 4M6AA 1D5IH 1UCTA 2CHXA 2EDLA 2E7BA 1AGDB 3HG4A 3LNDA 1KLFB 4QHNB 4QOKD 3RZCC 3MUGB 4MNHB 5D6DA 1PD1A 3L2MA 1VADA 2N7BA 3WO3B 4AZ8B 4B6ZA 5IB3B 1W9XA 3IDXL 5GZNA 3VJ6A 3U4KA 1LP9F 4WO4A 3ABKB 1M2VB 5F6IB 1NGXA 4HP5A 1SFHA 1PJWA 1GZQA 3VFNB 5I6NA 3TNNA 1MRFH 2CO6B 3H8NA 1MCBA 1BM7A 4YSOA 1I1RA 1XMWA 3WUWA 1A7PH 5F8QC 2DKSA 2NY2C 4XN2A 1NGPL 1WA1X 3SDCB 1TZHA 1HXYA 3QHFH 2JJUA 1J1OL 3ARGD 3AXLA 2OQJA 4FS0A 1GYVA 1GPOH 5L8KB 1C08A 2QBWA 5CZKA 2LU4A 3N85H 2R2BA 3CMOL 3DRTB 1YPZE 2WWNA 4R5TA 5JYMA 3SBRA 1WWCA 3MJ9L 1G9MH 1A66A 4D0BB 3P77A 3LQMA 4YBLC 3IJSB 4KK5D 3K2KA 3P3UA 5DD0H 3DGGB 1QQDB 2JKIS 5IROD 2OMXA 3CVIH 3D18B 3UG4A 2G30A 5I6XB 4KZCA 2NX5A 4ZUWA 1I9JH 1RJCA 3CAFA 1YCSA 4LDCA 1VFOA 4JO8A 1A7QH 1LTXA 4P3DB 3NCMA 3TA3C 3IN0A 3QUXA 3GMOA 1II4E 4WU7A 1OE1A 3S34H 4M62L 1RH8A 1E8WA 3C60D 5I1GH 1L9MA 3QIBD 2CJSA 2OMBA 4N2IA 1OAQH 2PPEA 3GMPA 3EGDA 4KJYA 4JPWH 5I8CA 1DE4B 5FLVA 5KVEH 4F9LC 3ME0A 1U8NA 1IGJB 3S2CA 2AAAA 3SE9H 4Y1TA 4E41D 3GXFA 3LPFA 4HCRL 5BS0D 4E9TA 4KTEL 2Y36H 4QF1B 2ADFL 1BWMA 3PXJA 5B22A 5J5EA 4QRPA 2BHUA 2A6DA 2YGPA 4WW2C 4FG0A 4HA1A 4QRQA 2GUYA 4QHLA 1NAML 5CILL 4PB0H 4Y4FB 3CPUA 3SE3A 3GUTA 3PNRB 4M00A 2IFGA 1SXSA 4DZ8A 1MHPH 1DANU 5ID1A 1R3KA 2IALA 1C8PA 1CICD 3S35X 3U1PA 1A5FL 2VQUA 3E6HA 1FQ9C 5CLWA 5FGSA 1A6VL 1ZOXA 4HEPA 3BIAX 5DEFB 1TR7A 5HY9B 1X9UA 1WZ1H 2EVFA 1NPJA 1JTTA 3ZR5A 3PF2A 3UPCA 3ASWA 2YRPA 12E8L 1OGAA 4RISH 1K85A 3KPNB 3CQPA 1I53A 2GPZA 5FO2A 4DZBB 2XV6B 4PJDF 2X28A 1DZBA 2RD0A 3MX0A 1HQ4A 1SOQA 3BN9C 3ZIMA 1CDHA 4HAKA 4NO3B 4P4KD 2MQ0A 4MMZC 3M17A 3SPCA 2XZCL 2ODHA 1XGTA 4XCNB 3ROOA 1MH5A 3Q1SH 3ZY7A 3F62A 1GSMA 2G9HA 4GQQA 2VM3A 2J1WA 1Q4NX 1OLLA 3FMGH 5E1AB 3KS0H 2VM9A 4C4UA 3MBED 4QNPF 1U8QA 1V8HA 5KYWA 4JUTA 1DEDA 1MOEA 1KJ2L 3OD3A 2VLRE 2YWYA 3AT8A 3ZE2B 1KCUH 1NICA 3DETC 3FCUB 3CLWA 3CDFA 4XNXL 3B8YA 1SEQH 4X5WA 5DJCA 3TZVD 3F58H 5ABDE 2Z93A 3VWKB 5TQ0H 1EFQA 2ALWA 1AZNA 2OMVA 2EO1A 5I1DA 3V79C 4X7TB 4AX3A 3EJSA 5CUSL 4APXB 3OKNA 4OZFH 3FT1A 4P06A 3DC0A 4ZNEA 4G3YH 1A1MB 1TQBC 2J71A 3I75B 5EBLA 4XX5A 3ZYOA 3MA7B 1JD9A 2FE0A 1MEXL 3BZFA 1D7BA 2VB5A 4UI2A 5J9PA 2JKNA 3ISYA 3RGVD 3I6GA 1G7HA 3CUPA 3F04A 4ELMB 4PRIB 2FR4A 3PY9A 4CW1A 1QO3A 4EZJA 1W6WA 4CN6A 5DEGB 1MXGA 5FK9B 4BH8A 2DJ4A 1QHPA 5GPRA 4YHNA 1MCKA 2VM4A 1CF1A 3I50L 2L04A 5B39B 5E4EB 3W9DA 4QXWA 3W81A 4BDVA 2OTWA 4DVBA 1P4BL 4R83A 1MHHB 1OT4A 4HFUH 1PLBA 5CGMA 2WKOF 3O45B 2NQ3A 1N4XL 2R0WL 1NEPA 2F2HA 4PBXA 3A3YB 2ZX6A 3JVFC 3OX8A 4X6FA 5EN2B 2TSBA 5E2VH 4IOIA 1ROCA 2RQ8A 4GO8A 4P2QD 2KPWA 4FX5A 3WLBB 3OKYA 2E3VA 5T1DL 3P3RA 5IM7A 3QXVA 2K70A 3T3MB 4P2RE 2XXMB 2Q3XA 1UXMA 3IPEA 4GO9A 4OZHA 3L08A 1JFQL 1GGIL 1T4KA 1QW8A 4WFGE 1VZGA 4N2GA 3CJJA 2V17L 1VIWA 2BCMA 5ISZD 3MMEA 5E6RB 1G1YA 1GAFL 1G6RL 1YDPA 2EILB 2FRGP 2E4TA 1PEZA 4H4NA 5DWPA 1NDTA 2WIIA 5EF3A 1XF2B 7FABH 4RDQG 1F6LL 5FYJD 4C55A 1D7CA 1YY8A 4HIHB 3CBJB 1JL8A 3IDGA 1M7IB 3ARZA 4NQCD 3P11L 5I0XA 3I85A 3F6IA 3BAWA 3PL6B 3NFSL 3PQYA 2EE3A 4WHYH 1F90H 4YSEA 5JTWA 4JR9L 4QHUB 3MKGA 3UEQA 1CE1H 2ALAA 3P40A 2LLNA 4LKXB 2LU3A 4OD2A 3RWIA 2E0PA 5IQ9B 4XCEA 1KTCA 1QFHA 3FH5A 5E6UB 4GUQA 3TPUB 2QKSA 2FJGA 4LVOB 3C2AL 3U9WA 1V5JA 4GG6A 3LRMA 1J0JA 5E9DB 1Y07A 2VCOA 4H8PA 4FXTA 5LBVA 2DYPA 3MLPA 2R0LH 5D2LB 4EMZA 2UWEA 1JDCA 5D7LB 5T3ZD 3UACA 2MCPH 2IAMA 4GEIA 4BSJA 3FU6A 1AS8A 5DQDH 4JKWA 4L37B 2XJLA 4Y8DC 2NY0D 2LTQB 4FQ1H 5DMYA 5HYJB 3H1ZA 4I89A 2HT3D 3D52A 4HJSA 3L3HA 4WNJA 3ZYZA 1XH3A 2FO8A 1XSIA 3SE8L 4OLUH 5AB9A 2A83A 4Y5YA 3U82B 3TIDA 1UG9A 3DXAA 5T3XE 3WMPA 1D5BA 4H7VA 4ZFQA 1FORL 1NKGA 3PFQA 5DD1H 3H9SB 2JKJA 4GAYB 4OJYA 4ZUSB 3VGHA 5HYSA 1MCJA 4Z7VB 4AUJA 2A74C 3QAZC 2WXFA 2F9BT 1ZV2A 2J55A 2HRHA 5SWSD 4OKDA 2AANA 5HI4D 2Z8RA 3WFCH 1ACYH 1MJJB 5FDWA 2ZUQC 5L0QC 2D3VA 1RPQA 3WNNA 3ETBF 2F6AA 3JZYA 2H2PC 3E8UH 2AEQH 1JBJA 2A9NL 4P9HL 3Q5OA 3EH2A 4F9PC 1U8KA 2E4FA 3RPKA 3S3PA 1LNUA 1Z66A 2A6IB 3CVHA 4J6IA 3O6LH 4JHZA 4P5MB 4S0HA 5DTFA 3KLKA 3V6OA 2AQQA 5JHLH 1CK0H 4LLYB 3TCLA 1MRDL 1RZIA 3S88L 3U30B 1EHAA 4BQCA 1IBHA 1DSFL 1PKQE 3BO8B 4YDJB 2HKAA 4OAWA 3GXUB 4X4MA 3B4NA 3N41B 4MJ6A 3SGKA 3S5LA 3NJJA 5C08A 2X6VA 2AZUA 5FOJA 3ULUL 2A9BA 3MCKA 2EXSA 4WI5A 2CMRL 3M6DA 4CC0A 1JK9A 4Y7OC 3HC0A 4YK4C 1F3DJ 4BK4A 2IWKA 4OV6F 4AMXA 1U8HA 3VD5A 1JZJA 5IJKA 3V6ZA 1A4JA 1BA9A 4PRDA 1U8LA 2W07B 5J8OA 1I3VA 3Q8AA 1FAIH 4NHUA 4UQ2A 2B5IB 3SJVE 2NYKA 1KBGH 1CFVL 2EDMA 5EU4B 1DFXA 3RVTD 4WUUE 1QEWA 5LGHL 4GG8A 3WLWD 3WKML 4MMXA 3N9GL 4HXBH 2G5BB 2EDTA 1TU2B 2Z7UA 3BZEA 1OSPH 2AEPH 4O00A 1WP6A 3V4PL 3FUNA 2BSTA 1BWWA 4G80B 3K2UL 2X4SA 4KRLB 3LN4A 1HFUA 3QUXD 3BW9B 5ANME 5J6GB 4KJPC 3VSTA 2W88A 3HI1A 3PJLA 3KYNA 3LHPH 4MAZA 2MNWA 5TGBB 3ZO0A 1G4RA 2DTMH 3QZNA 1VERA 3MGTB 4OSUL 3HI6L 3FTWA 1LO4L 4QGYA 4PJGE 1SJEA 4LQ1A 5E1HB 4MCYB 5BVPH 5DHEA 4WV1A 3A0OA 4LCIL 3O0RH 4QRAA 1BQRA 2DYSB 4PLJD 1K5NB 5DO2D 3WG7B 1MFCH 5AOMA 3RVVC 5C70A 1ZXQA 2XLLA 1UD2A 1PVHA 2AJXH 3HC2A 3GJFK 3ILDA 3KLSA 4N0FB 5B8CB 2A9DA 5A2AA 1PAMA 3Q9PA 5F1SA 2ZWKA 1IQDA 4UNVA 5JHDD 1P5VA 2BIHA 4BFRA 3HAEG 1GR7A 2JJTC 1OHZA 2L0DA 2PYEE 4L5FL 5CGBA 3SKOA 4DH2A 4ZW8A 4JO1L 4YUEH 1F1GA 3KLHC 5KVDL 2PLTA 5F1IA 4NKOA 1E5ZA 5EEVA 1DP0A 3TN0C 3FFCD 4DSYA 4MVBD 1G7MA 3GHEL 3UDWA 1DEEB 4LPXA 3KWWA 5C0DA 2YEZB 1RZFL 4F27A 4ZMXA 2ZOKA 1ZVYA 1YRKA 1XCQB 3QH3A 4JDEB 1P1VA 2YZ8A 2GQHA 3LB6D 4LRIA 3GSUA 4RX4A 1AQKH 5T3XH 1PCSA 2B4CL 1W0VA 4J12A 3WNIA 4PHZA 4YXHH 1OGAD 3CCHA 1DQMH 3EO1A 5AKRA 5E00B 2VDRH 4ANXA 5J12B 1CBVH 1RIHH 1SQMA 1ZHLA 1WFMA 1H5BB 1MF2H 3IGFA 3VRIB 5I73C 2F15A 4U1JA 1ZVNA 3KWXA 4WK0B 1NGQH 1M3IA 1XR9B 3HB3B 1MJUH 2CO4A 3P9MA 3LZLA 2UZXB 3CN3A 3L5XH 3MRBA 1AACA 3N1MC 4U05A 3SYCA 4BFIB 3F7VB 4GMTL 1HDMB 5CNHA 5EZLA 4ODUA 3KR3H 1B2YA 5AOLA 3ZYIA 3FU7A 2YN3A 4W6XB 3L9BA 4BCYA 4Z3IA 4LEOB 1NFKA 1GCYA 2DM7A 4N90E 3BKCH 4JO3L 2IMMA 1W72A 3HW7A 3EDJA 5DJYB 3C6LD 1I3GH 2RGSA 2J3SA 4I77L 4X6CB 1R46A 1RSFA 4XX1G 2C1OB 3W5MA 5DJZB 1B0GB 3UJIL 4G9DA 4E5XB 3GRBA 2DI8A 1J0ZA 1FVCB 1V7ML 5JPMA 3BUQA 4UOW0 1BEYL 1NBVL 2ADIB 2CDEB 3H7BB 5AOJA 5H37A 5A6MA 4FQXB 3EZ8A 4LOUC 1XCWA 3OAYK 5C0RL 4GUCA 3FCSA 1JN6B 5ECGA 5ICYA 3HMXL 4IRSD 1MW0A 4LLMB 4G1EA 4DETA 1HHGA 4TLSA 1N26A 2O4EA 2H3NB 4GIPD 3NTCL 3IMRA 1X4YA 3BMWA 3WI9A 2E47A 4JFEA 1FVDA 1ITCA 5D7IB 2H8PA 1P2CA 4FP8H 2BSEA 4NT6A 4PS8A 2G3NA 4XWGH 4HKXB 4YHKH 3QR1A 3VWJD 2QSTA 3CFNA 1M42A 5E6IC 4JRLA 1ED3A 3APCA 4XMKL 3OXRB 2D4DA 4AXWB 3GSWB 5FS5A 3EFFB 1E7UA 1L6PA 2V9QA 4UQ9A 2XWBA 3WKYA 3DX7B 1OGSA 4NIKB 2ZNXA 4HIJA 3BPLC 4I3SL 3VXRB 1VKXB 1UH4A 1IU1A 3G6JA 1CZ8L 3UC0L 1YMHA 4RMVA 3RUGB 5JQ6L 1X6NA 1YY9C 2B1AL 2FCBA 4PJ5E 4W9IC 5D7KD 4ZTPL 4BXVA 2PTTA 4X42A 5HP5A 5DJDA 1ZT4A 3T2OA 2IQ9H 3AS2A 4EI5A 5LGJB 4G6JL 3Q0HA 3U1QA 1JYWA 4H2CA 2B0SH 4JZJB 4O02B 5E08H 2HZHA 1KACB 4IOFC 2UXFA 4J4PC 4Q6IA 1MNNA 5FA3A 4AK2A 3QQNA 3RPIB 4LLDB 1JZ5A 1MCSA 5EBMB 4Q9QL 4MD5A 2WN2A 2XWCA 4ZG1A 3F85A 5F3FA 2X2HA 3PQYD 1YN6A 4PJCA 3JV0A 4FFYH 4RA0C 4Y2DB 4QJ5B 2JLLA 5IMLA 1PTZA 4P9ML 5CZXC 4UM9D 4M7KL 4PGBB 2X9WA 2DBLL 4JO2L 2ED6A 4Y89A 4HUXA 3BX7C 5INCB 4IHOB 3W1ZA 4F33A 4YDLC 3BWAB 4I0PC 1NC2A 4PJ8C 4WFED 4W1TA 3CNKA 3EDDA 3HUJF 1N8ZB 2R29H 3OHXC 4OUOA 3T3PF 3IGUA 1DFBL 3QUMB 3TWYA 5JW3L 1RZPA 5D2NA 5TDPA 2IAMD 4P9HC 3NSXA 4ZAKB 4J8RA 2Z1KA 5BXFA 4DVRH 3DSFL 4LT7A 3GNMH 3QFDA 1XB3A 4RFEB 4UINL 5D96B 5E8NA 2VABB 3IXAA 3OKMA 1CD0A 4PTTB 1DLHB 4H20L 5GJSH 4MWFA 1XB6A 4FKKA 3STLB 5C0CD 3SDDA 4UV7L 1CXFA 4P5TB 1HEZA 4PGCA 3I9GL 4GUPA 4CADB 1NFDE 1D7DA 2FJHA 3ULUC 2OXHA 1KIUB 2JMRA 5CU5A 5AENA 2BVUA 3EO9H 4QRUB 3BESR 3GXDA 1X5YA 4JFXB 4AGQA 2E6QA 1C5DA 4L3FA 3GMMB 4HUWB 2NZIA 5CJXA 1GSKA 1LK3L 1CR9L 1P4IH 4G8GD 3W0WE 2DDQH 3LNIA 4FYRA 4U4BA 2CM5A 4BINA 4XPBL 3UPRB 1MCOL 5IB1B 1QBBA 3FO2B 4KNTA 1ACCA 4LHJB 4YPGB 4DEWA 3QWNA 4TN9A 2F08A 3KPRA 5EO1A 3RZWA 4G6KL 3ULSA 3G5ZA 3Q9QA 1OE3A 2XRAH 3E2HB 3QEHB 1MWAH 3M7FB 4HBCL 1CYWA 3D9AL 1UYWL 4IKKA 2QVMA 3NCWA 2XWRA 1T5WB 5F9WC 1CG9A 3VG0H 4O4YH 2YWZA 1VGKA 4YBHA 3DVIA 1H0DA 2VDOB 1YNTA 6PAZA 5GS2H 5ECJE 4H26B 4OZGE 1ZPUA 4KY2A 5I76B 4XE0A 3EBAA 4U1HB 5DJ2A 5E9AA 4BFGA 5EC2A 1ZDSA 5C08D 2VT0A 5CCKH 5IFJA 1C12B 2ZX8A 1AXIB 2LV4A 4FD0A 2IXQA 4MAYC 1N64L 1JHTB 2Q1EA 2VLJA 1RIVH 3G5WA 3UTZA 3W39A 4Q9RH 1KTJA 2AF2A 2EIMB 1K5WA 1GHFL 2IBZY 5D1XD 4ABVA 3DTDA 2AV7B 2P47B 3LVTA 1J8HE 1J88A 1BP3B 1UWXH 5ACZA 5F0PB 3JV6B 2F53D 3TJPA 1Y7VA 3WJLC 5F6HI 4XODA 1Q0YL 3HMWL 4Z7WA 5M94B 3MRMB 2YPLE 3U7YL 4JPKH 4ZRGA 4ENED 2V33A 4V33A 5DFTA 1MPAL 3FUEA 4TSBH 4MDRA 4ZTOL 3ZHDA 2BFVH 3QNZB 3RWGB 4NHCL 3RZCA 4QTIH 1URLA 2P8LA 3NSDA 1KULA 2B4CC 2SEBA 1DJSA 1DJIA 3WJMB 3QORC 2ISDA 4X4XA 3EDKA 3PDOA 4HWBA 3CFJB 3C87A 3OKLB 3QDJE 1FI8C 3CDYA 1A7BA 5BVPL 4PJBF 3WTWA 1E2VA 4D8OA 2OP4H 3HE6D 4HEME 1OL0A 2W8CA 4F58L 2XTJD 4IM8A 3D4CA 5I0DA 4Q97A 5JZ7D 1ZHKB 3MBWA 5D93C 1JNHB 4LASH 2ICEC 4XTRD 1AHMA 5FF6B 1UASA 4FQQB 4AGOA 2V2XB 4DKFL 4LLUA 3F7YB 1OVZA 5I19L 4WSGA 3VI3F 3MCLH 3CFMA 1AO7E 1A21A 2HJKA 1ORQB 1BOGA 2BZ7A 2HVKB 3THML 3PNWB 3GMNA 2AJSH 4DP6X 5EBWA 5AVRB 3V0VB 1MHCA 2BIPA 4X99B 3VI4A 5BZXA 3WEXA 1MQKL 4HDIA 4FFZA 4AZ8A 1G7QA 2AEOA 3LRLA 4OU3A 1L0PA 2AITA 1HHHB 2O26U 5FKPA 2BW4A 5D7SH 5EEXA 3BUTA 2A77H 4L4TE 3R19A 4RX4D 1UM4L 4EI6A 3JWDL 4FMFA 3QQDB 2HSIA 5FYKL 5TE4H 1WITA 3PJSA 3SCMA 1EAJA 4QWWD 3U46A 4ZMPA 3CHOA 3QEGH 3RBSA 1FFPB 3WXVL 1A2YA 4QYOA 4DN4H 3N42F 2EJ1A 3LDBB 4UILL 4BFNA 2ATKB 4LAJH 3CXHJ 5KYXB 5JQHC 4MD4A 1IFHL 3TA3A 1ZVSB 5I1JH 5CSZA 3GSNL 5B38G 1B0IA 3ZXAC 5KBLA 2CLZA 3V7AG 3VA6A 3MUZ1 4WHTB 2HN7A 2WO4A 1JMZA 5ANHA 2AXGA 2X4OA 1DVFC 4R90L 2OL3A 2DMKA 3Q43A 1FIEA 2DQIL 1AQ8A 4OUUA 4F9LA 4C56B 3T2QA 1IGFH 1QTPA 3ETTA 5F1OB 1UOVA 5IF0B 2LLGA 5KBDA 1N2RB 1NCCL 3HPLA 5FYLD 4B5EA 2BP8A 2XV0A 2I32A 3ATDA 1HJBC 3T5WA 4DKEL 4YFLF 4JLRA 2DF3A 4IBQA 4WW2A 4AEIL 1IKNC 5HHOE 3HC3H 3O2WL 2BNUB 2C26A 1P7KB 3LPGA 4JQIL 5MENB 3MGOA 4JFDE 4DP1X 1BVLB 2IV9A 2F1AA 2IPKA 4TSCH 1SF3A 1JWSB 4HJUA 1TXKA 1KYUA 1YAZA 3AUVA 1M3JA 3X3GL 1CO1A 3WCYA 3ZT6A 3MLXL 1ZLVH 2H3KA 1R5IB 2PNDA 3GSVA 1AJ7H 4KXBA 4QYAA 1QEXA 4XN8A 4KXCA 3GHBH 5M7QA 3UBXA 1BV8A 3WENA 2GSIA 2BSED 3X3FH 2PCPB 4HC1A 4EUPA 3TU6A 2UYLA 4N4YB 2K6ZA 4LFHG 4RQQB 5CHNB 1NSNL 3REVA 2HFEB 3IPBA 4MX7A 1SBSL 2W9EH 5F88A 1PBYA 4RRPG 1J05B 5HDBB 3RI5F 3H9YA 1N0XH 1PY9A 3S2AA 1HCYA 2PETA 2H47C 1PNDA 1O6SB 2A6KA 4UOW1 3RY4A 3B43A 1JRHI 3QQ4B 1R0AL 4D2NA 3AS0A 3L3KB 1PMYA 4X7SH 3TNMB 3EGXB 1KTKE 5EBGA 1ZCRA 5D72H 4AITA 3QYNA 5T5FH 3PAVA 3T2NH 5IFHL 2XN9E 1HZKA 2DLEA 3BAJA 4E42A 3TESA 5GSVA 2XWZA 4BFKA 3DUUB 1WGVA 3KXFB 3AAZA 1BPLB 1ZEAL 3B3BA 4JG9A 4HUMB 5CCHE 2ADJB 3CN1A 3D4ZA 3EBHA 2E9WA 3V9EA 1HTYA 4KNQA 5DJXA 3S48A 5BO0D 3PWUB 5IVXB 4X8CA 5E4OA 4NP4L 1I4FB 1SYSB 3OAWA 2H6UA 4LLWA 4XRCA 3TCXA 1TVHB 2O6CA 2B1HH 2QPUA 1HYSC 3NCEB 2QHLA 5MP6L 2IWGA 3L3GA 4JRYB 4PV1C 1ETJA 3D48R 1KWKA 1UD4A 4D8PB 1LEIA 5MERB 1FL6B 4ZS6C 5AD0B 1WUNT 5ERWB 2UZPA 1QW9A 5T1KA 4J3SA 4F2EA 2DLTA 4MXQD 4BZ2L 3OLIA 4NRZA 3NJNA 3FT0A 4BSVB 1X4ZA 1WFIA 4PJFB 3UYRL 1LILA 4J27A 4TQEH 3SGDH 4A2HA 4GRWB 3PWPB 1QASA 3QDMD 4G6MH 3T0AA 4ABQA 5LN8A 2VW4A 3O6KL 4HISA 4DQOH 4FNLH 2WUBH 3PREA 2CBOA 4YQXL 2ZYHA 3VQ1C 1I8MA 2BWIA 3WY2A 4ABUA 1LO3L 4K9EH 1INEH 5CIPA 1HHKA 4OJEH 2FX9H 4PCKA 2O5NA 3E7JA 3LZFL 1QYGL 4N1CA 3ELQA 5J6SA 4NBZB 1T7XA 2KC0A 5JLZA 5E56A 4AI7A 3QQXA 4X98A 1K2DB 3B7RL 2ATPB 1O9ZA 5B1KA 3SBPA 1OAXL 1S5IL 1NM9A 3VFOB 1IC5H 5KVGL 3I9AA 1EBPA 4LO9A 1E90A 4NO0B 1E42A 4XOAA 2FJFB 3B9KD 4PD4K 3EOBB 1FFTB 4PREA 3BUYB 3R0NA 2Y5TB 5BO1L 3MA9L 2DI7A 3KPRD 4O9HL 1Z5LB 3IMUA 4G70B 2X3CA 3ZDXF 4K3DH 3NIGE 1S9WA 2ZNWA 5BV7B 5L88L 5FECA 3RWHA 3WTVA 1KLUA 1B0WA 4KO9A 3O9WC 2C3XA 2EDJA 3BIKB 1FNGB 4UQ3B 3SQOL 3K3QA 1YNKH 43C9B 1JV2A 1T03H 3FH8A 5FHAH 4MGXA 2WZPA 5DSCB 3GO1H 5HVHB 2JWYA 4KGJA 4ODSL 3ARRA 4FXKC 4OLWL 3WGUB 1T5KA 2UY6B 4P4RB 2NY6C 3ZE2E 2YRLA 4YHZL 4KHTH 4NWTL 4K23H 3H2WA 2VC2B 2P48B 3JWOH 2PR9A 3C08L 3DX8B 2OMWA 1I8KA 1V55B 4N5ED 4LKCA 4UV4L 1ACZA 1F5WA 5F7KC 1X4XA 2JKWA 2Z8WC 3GB7B 2VLJD 4BZYA 4MXWL 1PFCA 5JMOC 1I3RB 2BY3A 2J73A 4N0CC 4X6DF 2P8MB 1E65A 2XVGA 4UB0L 2Y7MA 1EGJA 5EZOH 1QLRA 2A74A 3AQYA 3RI5K 2BFGA 3ZIYA 4CMMB 4JPQA 4LIQL 2PN5A 3VGDA 3MJ9A 4PS4H 1BXXA 2HFTA 2XXGA 1U93A 3FS9A 4B3VA 4K73A 4PRIE 1CE6A 3RZCD 4AQOA 3WKPA 4DP2X 4EN3A 4YSSA 4ES8A 5TK2A 3JWDC 5E1QA 2FNWA 3OB0H 1D5IL 3QCUL 4IBZA 5GS3A 3O6FB 4F9PA 1QRKA 1QLFA 4NQUA 1NMCB 3WE6A 1QSFE 3L6FB 5CBAA 2WK2A 3BWZA 4UYQA 3S3SA 5C7ZA 1JYXA 2G2NA 1JMXA 5F0MB 3WTYA 1RLWA 1U3ZA 4I4WB 2PCFA 2EIBA 2A73B 1YEHH 3BJ91 3SOTA 2EEDA 4C83A 2WSDA 4CMHC 2WYZA 4JKLA 4BWUA 3KJ6H 4FFVD 3VE0B 3H2PA 4KZEH 1UM5H 2XIIA 3GBDA 3DKHA 1RPKA 2YAFA 2XKSA 3F00A 4QRRB 2Q3AA 1GPOL 4NC1C 3LS4H 4V11A 1KB5B 2PABA 1QBMH 4AQ8C 1BFOA 2X1XR 3N85L 3BJLA 4OH2A 3DV4B 1UURA 4ZI8A 1NCHA 1LD9B 1OCOB 1MIMH 4ZFZA 4DPRA 5T1LD 3WD5H 2X4QB 1G9ML 1U91A 3CDZB 3SCMD 4RAUB 3OB8A 5DD0L 3NMEA 2ZSWB 5HSFA 1B9ZA 1WEJH 1D9KB 1DVTA 2BP0A 3BMVA 3F12B 3TA3D 3D6GA 2AJZA 3IDIB 4PJIF 1I9JL 2P5EB 5AUMB 3TXAA 4NQXB 2QPEB 2KS0A 4LVHB 5AW4B 5I0WA 1DUZA 2C3VB 1VFAA 1ORSB 3MRRB 3SSGA 2DICA 3MDJA 3H85A 3S34L 1H15A 2WJ7A 4LP8A 2NLJB 5HYJE 2PPCA 3DVFA 1WC7B 3TC9A 1CTOA 1EEZA 4XMZA 3DOIA 1H8OA 3O4LA 1OAQL 5JOFA 2PW2B 3BH9A 3G6JF 4JPWL 4CVXB 3MNZA 1MG2C 1WWWX 5TF1L 3TH3T 5AZ2H 4JE0A 4JRXA 1TPXB 5CWSB 1KT2B 3D85A 2BC4A 4P5KB 4PR5A 4X5XB 3GKWH 2JJTA 2CCVA 3OWRA 2YARA 4YFLI 3RTQC 3X11A 2Z31B 1W6LA 2OZNA 5A1AA 1GZHA 5DZAA 1NDMA 4H1LA 5KSVB 3UG3A 2HWZH 3TN0A 1IC7H 3UYOD 3VXPA 1HXKA 1V7NL 4LCYA 2YD2A 3D7PA 1SXZA 4B96A 1MHPL 1U6AL 4JZOB 2YS4A 2P7TB 1KV7A 4ODTH 1AKJA 5DVNA 2QVFB 1WWBX 4U1KB 1PYWB 3KPLB 5I6PA 5KG9A 2OW6A 4GP8B 5HJ3A 1NBYA 4W4OC 3GI8H 5CN2A 1WZ1L 2BSBA 3SZ6A 3MO1A 3PPEA 5IEKB 1S6NA 1YJDC 2VIRA 2PXYB 4FMVA 1Z9PA 3QEQA 4RISL 1WAAA 2D3NA 4Z7QF 1G43A 3TCTA 4L8SC 1MFEL 1E3FA 1MREH 5EUKA 1PZAA 4QPEA 3B5GA 5LDSA 2XYBA 4JFUA 3G9AB 3NZHH 4D0CA 5AVVB 5FYJH 4NQVB 3Q2VA 4P2OB 4E9LA 5FO8A 3JTSA 4U6YB 2PO6C 3FMGL 3VG9B 1NEZA 4EN2A 4WFHE 4F8NA 4QKTA 5D1QB 3BXNA 3FT3A 3HZKB 4EDWH 1KCUL 1T4WA 5E6YA 3UABA 3VSUA 2WVSA 2WMPA 3UBXG 1SEQL 2Q86B 1FL5B 3F58L 4FABH 2WANA 1UGKA 2N3JA 3FO1B 1ND0B 3QQ3A 4FDWA 5TQ0L 2BH0A 3RTLA 1EJFA 5C0IA 1FJ1B 1JXFA 2OJEA 2NNXA 5LCVH 4MCNA 1ZHNB 2BPBA 5HHNA 3KPQB 2VRQA 1SXNA 4N9GA 4Y16C 4G3YL 4Z8FH 3GZOA 2AK4A 1A1OB 1G6RA 3D87B 4YDMA 3TEWA 4N2AA 2FQFA 4HH8A 4BSWA 4A2GA 2Q8AH 2GSGA 3FFCE 1EANA 4KRPB 3L1OH 5FLUA 4FCHA 4HS6B 4WI2A 3T04D 3GJFB 4R2GC 3O3DA 4XX1E 3U36A 2XA3A 5EH1A 3ZZ1A 1EZLA 1G7IB 5E6IA 5T1KD 2BCKB 3K74B 1EEQA 1L9PA 5D55A 1L5GB 3A6CH 3MRKB 3IU4H 1IJNA 3ZKXC 2BNRA 5ID0A 2X6CA 3WAJA 1FLTX 1E4XH 3D25A 1P5UC 4PCYA 4TVUA 4QOKB 1AGEA 2NRDA 4X6BA 1YNTF 4HFUL 4NRXB 4CKVX 4PBWD 1GH7A 2Y3AA 1R33A 2WQ8A 1OCRB 3VXSD 1QWUA 4ZS7H 4HULB 1G84A 4JDZB 3P54A 4S1DD 1NL0H 2OTUA 3FQUA 4YE4H 1W91A 3S37H 3VD1A 1AYRA 2D0FA 5E2VL 1OB1B 2J8HA 1KG0A 4GW1B 3IFOB 4GBXB 4Y2OA 2ESVA 4RA3A 2X05A 3OG4B 5IMOA 4F2ME 3FSVA 5G5DB 2EE6A 1H8NA 4MJIB 4YGVA 1C7SA 4M7JH 4AVKA 3RY5A 4J4PA 3B2VL 5MI0C 1WIUA 4PCSA 5SWZA 5EOCJ 1EQWA 3LZPA 1D2PA 3MSPA 1PCXA 4M93B 3AY2A 4C4KT 2ICWB 3NCJH 4P57B 4Z7OB 1KNOA 2XHNA 1F90L 1NIEA 3ES6A 4I0PA 1AS6A 3QWOA 4PJ8A 3CBRA 1CE1L 1LK2A 1ERNA 2FLMA 2XSKA 3VFSB 2ZSVA 3OHXA 2YKKA 3KDPB 4KY1H 5FW6A 5KAQG 1NGZA 3DV6A 2LGNA 3SPIA 2AAVA 2WZPD 4U1GC 4OJFL 5EFIB 1URIA 2R0LL 4LCWA 2YAPA 1O6TA 4PJ9D 5MEOB 2J8UA 1FZOA 6FABH 2E9IA 3UROR 3HAEH 4MD0A 5DQDL 4E0RA 5JQIB 4X6CE 4FQ1L 3AG3B 3U2IA 5DRWA 5EOQH 5ESAA 4HIEA 3AM8A 2HFFA 3CH1A 3ZTNH 2EABA 4DT2A 4ZSOB 2FYVA 3FT4B 2KYIA 4OLUL 4QJ3B 1JPTH 4Z0BH 1EO5A 4MA3A 2IGLA 4PJXA 1OSZA 5LXVA 2ICCA 3DIFA 4XP1H 5EEZA 1SDDB 5DD1L 2UXTA 4IU2B 1DBBH 2JXMB 1A3RH 5HBBA 1KPUB 1UZ6E 3GPEA 2WLIA 2FWOB 3C9NB 4P48A 2RR3A 3OJDB 3RVXC 4EN3D 2JCCE 1I1YA 1E28B 2CIKB 3TLRA 4KO5A 4UAOB 3WIFB 2HKHL 4A63A 1G9MC 1RHHB 2QVKA 5JW5B 2FJSA 3MREA 1ZLWK 4E9WA 4MBRA 3FNKA 5DMJB 2AEQL 2MNUA 5GGUB 3VGAB 5AAPA 4OJDH 4NC0B 4R84A 1YMMB 3O6LL 3ZDZE 4HS8H 3TBVA 3QO1B 2RALA 4OGXH 3RUGE 2VZ1A 5DYOB 1CK0L 4CSZA 4PWEA 4L8BB 5E5MB 4NN6C 3RLSA 4U2YA 2NXYC 4KMQA 4HLZG 4WI3A 1LWRA 5ICXA 4JG5A 5JA8B 4MAYA 3MJ7A 1OAJA 3K6IA 3TVMB 2H0EA 1J1XH 4HMDA 5LWYH 4WEBH 1U8MA 5I6LA 1U9KA 3ARBC 3OKKA 3PWJB 4WGWB 1YQ2A 3TZVB 1T04B 2AXJA 3D33A 3NA9H 3WJLA 3FQXA 5CLZA 2F8XC 1RIUH 1OD9A 4ORGA 4BRJA 4OGAC 4IRZH 4L0YA 1WBXA 3GXPA 1FAIL 5BJTB 4HG4J 3H53A 3X2QB 4YHYB 1KBGL 3NFNA 2HVJB 1VFUA 4NM4H 5AW2B 4BFFA 3MKKA 5I16B 3QO0B 3O81A 1QFOA 1IGYB 4KI5C 4Y1AA 1ZLUH 3B2DC 4KJPD 5D1ZI 3WTUA 3DYOA 1OSPL 2AEPL 3RKDC 3G5YB 4G8GE 2WQUA 4WNQA 3CMGA 4U0QB 2EXYC 3RGVB 1BQLH 4POUB 2V2TA 1VENA 1T0MB 1TVBB 1K72A 2DTML 1D5ZB 2F19H 3L5WB 1IKFH 1B4TA 4G42A 1U95A 3B6SA 2CBPA 4GFXA 4YHIA 3KHOA 4IS6B 3O4LD 1CPUA 5AB0A 2BMKA 4N25A 3RVVD 4RAVB 1E9PB 5TPWH 2XA8H 1YVLA 2ICEA 3O0RL 3VQ2C 4CVZA 2KLRA 3BOVA 3MLTB 1MFCL 1ZY9A 1UH3A 2NMSA 3QUGA 3D85D 2QKIB 1ZK9A 1DUYB 4JG1H 1UB5B 1MELA 4UAHA 4ONHA 4HJ1A 2AJXL 4L3CB 3EFOB 4ZOAA 1SMDA 2F54A 1AI1L 4KI1A 1Y18B 4NERA 3ZHNA 4F5CA 1HU8A 1ANUA 4Y4KC 3TN0D 3IJ7A 4E9QA 4LCVA 4M3JA 3IF1B 1RUKL 4FMKA 2R69L 4R97C 5ELIA 4PHXA 4M03A 1G1OA 4NPJA 1QZ1A 1OALA 4YUEL 1E50A 1EO7A 1A6AA 1QBAA 4HZLB 1IBFA 1A1NA 1TENA 1IV8A 1FNLA 2KMWA 1AKJD 4QO1A 1IAKA 2HLFC 3X12B 1CTMA 5AVQB 2GFBB 5AVZB 3QQ9D 1HNGA 4ORZC 1AQKL 1YYMH 3LH2H 4YXHL 1J0HA 3QEQD 5EU5B 1NBZA 4K7PL 4KK9D 3SN6N 4Y9GA 2IANA 2YA2A 1DQML