2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
molecule keywords O-GlcNAcase nagJ
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
4UMSA 1ZV9A 2VN6A 5K39A 3UL4A 4UYQA 4U3SA 4FL4C 4IU3A 4DH2A 4IU2A 4N2OA 1QZNA 3GHPA 3FNKA 4WI0A 3L8QA 4FL4B 4WKZB 1G1KA 5LXVA 3F2LA 2Y3NA 3BWZA 2BM3A 2VN5A 2W1NA 1AOHA 5AOZA 3KCPA 1ANUA 3KCPB 2XDHA 2JH2A 5G5DA 2CCLA 2ZF9A 1OHZA 2OZNA 2O4EA 4UYPA 1TYJA 2B59A 2VO8A
chains in the Genus database with same CATH superfamily
4AVIA 5GIRB 4JPVH 5IMLB 3WHXB 3QC6X 4NC0B 4TM9A 4M5TA 2O6CA 4YIQB 3DVGB 4N25A 3T04D 1W72A 4BXSV 2G5RA 1GW6A 2OMUA 4PGJA 4KRPD 1L7IH 3D3VB 3NACL 4G7YL 4NRZB 5B22A 3BPLC 2MCG1 2A6DB 4H40A 4UV4L 2NY3C 1XZ0A 4DW2H 5KWYC 4N22A 5D2LF 4FOMA 2X6AA 5K93A 4HUWA 4KBPA 4ALAH 4IBQA 4HISA 5IR1A 4M6NL 4J4PC 1MLBA 3VCLA 4KHXH 3D85A 2RQEA 4U0QB 4DFHA 5F3BA 2XG4A 1XF4A 2W80C 1P5UB 3QEQB 1GAFL 3K91A 5FM5M 4ZXBB 5C09E 4MD0A 3HIZA 4NZDA 3WY4A 1DJWA 2BNRA 5DJ6B 1A2YB 3HFML 4HFWB 1M6OA 2BW4A 3HPLB 3VXRA 1TSHA 4AQAA 1PCXA 1RD6A 3APCA 1XB3A 5IZ7A 3D18B 2RA1A 3OSVA 3ERXA 2EH7H 4HJJH 4R96B 4XCYB 2O26U 5FFOA 4XPFH 4OZGB 2ADGA 5L8KB 1XR9B 3GKWH 5FLVA 3QUXD 1SMOA 1M05A 2OMWA 3CXFA 2P8MA 4MKTA 1O75A 1I8IB 2CUAA 5DJ2B 4YSAA 3K6NA 5IT2L 2AJXH 1RUAH 3IDXL 4N90E 4OD1L 3P3UA 4PRDB 3EDKA 2ADFH 1BJ8A 4WZ9A 3SCMA 4KDWA 4XNQA 3ZTDC 1QTYT 4OQ1A 4IRJA 2WNWA 3ESVF 5HHOA 2X2HA 3Q48A 3IJYB 5A7BA 5LQBH 4HH9A 3HB3D 2YAOA 1A9BA 1FNGB 4Q2ZB 1SXZA 1I7UB 4OLYH 3WN5A 1XMEB 3X12A 2PYFB 4TQIA 4ZS7L 3BIKA 2ODIA 3CUPB 4OGYL 4D7PA 2V7NB 3PFQA 5BZDB 4HIPA 3S8GB 2VO5A 4PJCE 4EZLA 2R56H 2WXRA 5DK0B 1IE4A 3FUIA 4AZ8B 1WAAF 4ILDA 1KTKE 2WIIA 2RCSH 4PGBB 4ONGL 5FUZL 2DQFA 3AM8A 5J3HD 1ZLVH 3ZL1A 3CDZB 5A6MA 4Y2DD 5E8NB 2D7MA 4B0MM 3BWSA 4CKQA 3PQYB 1CIDA 3A21A 1VZHA 4QRUA 5I1HL 3D09A 1BM7A 2VO8A 3UG5A 1JI1A 1ULVA 1Z3GH 4HJUA 2YUZA 3OPZL 4IRZA 4JFPB 4HWBL 3TIDA 4Z7OE 2F6AA 3WNPA 2XVBA 3QUMH 3HB3C 3BZEA 2WB1A 1MJUL 5DWUL 3D34A 1A4BA 3GJFB 1GR7A 4QMEA 3EH2A 5AEAA 3G9VA 4JFDD 3CFTA 4XXWA 1ITBB 1VFAB 4FYQA 3WGUB 5D1QE 4YOKA 3DIDA 2QSQA 1ASOA 1AJ7L 2FBRA 2A4CA 2VR9A 3KMDA 5IW6B 2NY7H 4NENB 3T2NH 2NX5D 5GRXG 1TFPA 2X3CA 1AR2A 2JCCE 3QPXL 3RUGF 3AZUA 5FK9B 2VM4A 5DJ2A 1GYVA 3SE4C 2DICA 3TT1H 2ZSVB 4MS8D 4BSWA 3O11A 1AZNA 5FO8A 1NWOA 4QTIH 2ERJC 5DS2A 3VXQB 3WTSA 3GNML 1HEZB 4LP8A 1UA3A 2R2HB 1FUNA 2HRHA 2FLBT 3IFOA 1A14L 2WV3A 4KDTA 4NNPH 3RX5A 3ZDWA 1A1MB 4QEGA 3DWTA 4UQIM 4V33A 4X6DA 4AEEA 5IMMB 4H1LB 4M6ML 5IJCC 5EPMA 1B2WH 4H7VA 5KVMC 5KBLA 2IOMA 2IAMC 2H5UA 4MAUL 3WEBA 4FYSA 2WB7A 4K8RL 3P11L 2OMVB 3O2DL 2DQFB 2OPCA 2R4SL 4J1UA 4LPXA 3M1BA 3ZGHA 4KVNL 1MFEH 4AYBA 1ZGLB 3FT3B 3R7QA 4N5UA 3UFIA 3IMWA 1S7RA 1NFIB 3UAAA 1CK0H 1CLCA 3VXOA 5H94B 4P57A 5DMJB 4G8IA 4M48L 1UGKA 1HZLA 4WU5B 2WO3B 1LEKB 2WXOA 4GINA 1X3DA 5C08A 2PCFB 4WFFE 1CFNA 3ZYOA 4PLJC 2ZUWA 2KLSA 4N2DA 4NO2A 1VGKB 3U46A 4GMTL 1MCOH 4LVOC 1O6SB 1RV6X 1G1OA 4BUHA 2ZF8A 3SGJC 1SFDA 3GO1L 3WS6A 4DOHB 1KIUB 1JNHA 2NY2B 1UOVA 5IQ9B 1L9MA 3ULUF 5AALA 1HYSD 5E08L 1WZ1H 3J2PA 5B1JC 4LVHB 2BY2A 1KSRA 1G0XA 5IWLA 4KO5A 4AYSA 4QY8B 3FO2B 3ETBF 1UT2A 1CLZH 4AV4A 1ZD6A 1H5BB 1TQBB 2B2XL 2C26A 5DU7A 2VDML 4XCFL 4NENA 2YRBA 4PIRF 3B9VA 3BGFB 3MV8D 4RAVA 3FUKA 1KB3A 5D7IE 3SCMB 1SLXA 2H32H 2JV6A 9PCYA 2J5LC 3EFFB 2ZOOA 3ILEA 5IOKA 3KVPA 2BP8B 1HH9A 1PD6A 2JELL 3O3EB 3B2MA 4G8EA 1XBDA 3L9BA 2H0EA 4PJ5E 2EZ0D 4I9WD 4KMQA 2R2BB 4LDEB 3DHUA 5EORL 3O3AA 2BHUA 2DEYX 3H0TB 5EZJB 2AGJH 3FTGB 1PZ3A 3AY4C 3CN1A 1QFOA 2TRHA 4H4NA 2OXHB 5CEYA 3JBG7 4K3DH 2WLIA 1IUZA 3R8QA 1D5MA 4MYWB 1MFCH 5LBSL 4F58L 5AZEH 4Y5VC 3PDDA 3MRRB 2WLLB 3QQ3B 5DI8A 2WKOA 3PJNA 5DUMH 3GBNH 4LCCB 3EADA 4OH2A 2WBJD 2BVPB 5IMKA 3B9EA 3PV6B 1JERA 4HKZA 1S7TA 4UUJB 2FL5B 4JFED 1R4XA 4HF5L 4TLSA 3LNDA 1XGPB 1NCUA 4RIRB 3DTXA 3VNYA 1IAII 1TTCA 2E76C 5AVSB 3PL6C 3I2CL 3GSUA 4JO2H 4BBWA 3FT2B 3ECVA 1YYML 4J27A 5JW4R 1E2WA 2EECA 1T0NB 2H1XA 2AEWA 3DV4B 1OM3L 1BWMA 4Z3IA 4S0HA 2F1BA 1QZ1A 4HEPA 4O00A 3TX4A 2HFEB 1WAAE 2IGFH 5IQ9A 4M7KH 3WOVA 1AXSA 1N8OE 4JGNA 3KWTA 4JFZL 3ZBMA 3LV3B 2IPUG 1IGCH 3CZNA 3LQAH 4UNIA 3GMOA 1IIKA 3CXDL 5IROA 1TJHL 3BRGC 4AKPA 2LFEA 2NMSA 3DBSA 5I2IA 1U33A 4ZUSA 3LKNA 1RZJC 4GRWH 3H55A 2E27H 3LMJL 3GWJA 4XBGA 1YEKH 3RWIA 1W16A 2EIJB 5KJRL 2D7QA 2ATPA 4XP6H 2IGFL 4G9FE 4L4TD 5I1CL 1KIPA 3GLDA 4MCYB 3SDXF 3RWEB 4QLWA 5IV2B 2QADB 1UATA 1JHLL 1XF1A 6TAAA 5C6TH 4DKFH 3OHXC 3R06B 4X8GA 3AG4B 3NIFF 4Y9CA 4ETYA 1RHFA 1OGTB 3P3RA 3W5MA 2UVEA 1FPTH 1MFAH 2OMVA 3CIQA 3X1FA 3EG9A 2PTTA 1CVSC 1I8AA 4LT7A 8FABA 3BCDA 3QDGB 4F58H 1ROWA 4GRWE 3VGDA 5DO2C 5C0RL 3GBNL 3FYEB 1M7DA 3CVHH 3FTVA 3KEDA 2C34A 2NTFA 4QT5B 1KBGL 3LOWA 3VXOB 1DDHB 2ZCLH 3E9UA 4PBDA 3GQFA 2FL5A 3KM1A 3RX9A 4ACPA 3LZRA 4KPHH 4PJIA 2JKIS 5KVEE 1SDAB 2BO0A 2Z8RA 4RFNC 3UIYA 2CUHA 3BO8A 4NJAH 1UKQA 2Z8WC 2EUWA 1U91A 3MLPA 1FFPA 5SWSE 2NY5H 1TKWA 4NM8L 2VC2B 5DEJA 1S8DA 5EG6C 3AB0B 5IP4A 4U2ZA 1XH3B 2DWDB 3C6SB 3NRPA 1GZPA 5SWZB 5JOFA 2Z1KA 3EO1A 3QZWG 1F3DJ 5HDBF 3VGHA 1QEWA 4PWGA 5EUKA 3W0WA 4EUPG 5E9DD 3O8XA 3VM7A 4F7TA 4OFDA 5HD8D 5INDB 3EXLA 1OY3B 4L4VB 1NCGA 3CFJA 4QRQA 5HGAB 4G8GB 1BVLB 1LDPL 4RQQA 2XWJA 5D1QC 5DRZB 4I0PD 3STLA 4J3OC 3REWA 3V9FA 5C6PB 3FN3A 1Q9OA 4HGWA 1KZYA 1HL9A 2CDEB 3T77A 2MH4A 2R8SH 3GMNB 3ZSSA 2YN5A 4KROD 1I8KA 4X8JA 3D4YA 3UBXB 4KXCA 4PJBA 2HZHA 4KDVA 4L4VD 3WV0A 5IFHL 4XZUA 1XF3A 1JV5B 1UWXH 1MCOL 4UQ2A 2ZOWA 2FT7A 4QRRA 4F93B 1KEMH 1BXUA 4O02B 3NSXA 3C08L 3SYOA 4KRNA 1NJ9A 2E9GA 4F8NA 4LCIH 1KXTA 3BP4A 4PG9B 1R5WA 3DPBB 2JKXA 4P23D 1QG3A 3MOAL 5C7XH 1JZEA 2VLLA 2NZ1A 1XXDC 3VI3A 1YPZB 3KYOA 4UMGA 4WI3A 5D93B 1O6TA 1PQZA 4WV1C 4PJHF 4L8BA 4ZW5A 3DIVA 3QWQB 4HUNB 5EBLA 4LKXA 1LTXA 3PWJA 1FYTA 2OMYA 3L45A 5E4AA 3JWOC 4G1EB 5T5NF 3TO4C 3AXHA 1R3LA 4JM2D 1WFJA 5T1JA 4LIQL 4D94A 1E5UI 3FF7A 3O0RL 5BVPL 4BK5C 3S88H 3WFCH 3QYNA 1S7XA 1A6WL 4QD2E 1XGUB 2AK4A 4H20H 1KYDA 3UG4A 3CG8A 3FCUB 3L4VA 3G6AA 4ZNEE 5HHXL 2DLFL 2J8UF 3POHA 1WSST 3S36L 1GYWA 1MCEA 3LB6C 3P1VA 1J7VR 4YFLF 3GMOB 4JRYD 4FQXB 5CP3H 3IVKA 1OTUC 4CVUA 2DIAA 1INQA 4GY4A 5E9AA 5BZWB 4YXHH 1JPEA 3L1GA 1A6ZB 1FZJA 1U8LB 1FFRA 1XXFC 1PLGL 4X7TA 3S48A 4P5KA 3HBQA 3LEYL 1Z7JA 2A74B 3PREA 4Y4FD 4JRYB 4NO3B 3VFOB 2VJXA 3WHE1 2HWZL 2OLDA 4K5NA 4ZFFA 3EGSB 4JM2C 4HUVB 5CLWA 3PHQA 1F1GA 1AR1B 1AOZA 1GGBL 4S1QL 4XX1G 3L3OA 4Y2NA 4L18A 1A3RH 2BP3A 3OGCB 3MOBH 4WWPA 5I1IH 5HDWA 2OQJB 2EADA 4HK0B 2IPTH 4MQTB 3FPYA 4NXKA 4ANVA 5GRVL 1FGNH 1U21A 1OE1A 2WQAA 5ID0A 1Z1WA 5E4IA 4P2QD 1ANUA 2BDNL 3GD1C 5BOJA 2X4PA 5KG9B 3GRWH 3HE7A 4RSYA 2IO5A 4ZFOA 4ZW7A 3MSPA 1I1YA 2BIIA 3HE6B 2AK1H 4R97C 4X98B 1U58A 4LLDB 2P24A 5E6IB 3UC0H 3UZQB 3BW9A 1FH5L 4HG4J 4IRSA 4MAYA 2FQGA 4IIQA 3ABMB 3X11B 5L9DH 1SMDA 2XQYA 4KKAD 1KIQA 2DWEA 1VPOL 2C4XA 2X4NB 4QIRA 4WO4D 4X8XA 5IB1B 1B0GB 4X5RA 3N3EA 2KHAA 2VT0A 4DO4A 3ORJA 4FFZA 2ADFL 4QRSA 1V55B 2NZ9C 2HRGA 3RDTD 1NCWH 1F3JA 1MI5B 5E94A 5HHNB 4F7CB 4AMKH 4MQ7A 4BKSC 3FRUA 1Y6NR 4P07A 1NOAA 4MDJB 4L3CB 1IGYB 1L7TL 1XMWA 3QXUA 3L5JA 3L3KA 3GSNB 4EQ2A 2H4EA 2CE6A 5K9JL 1SBSL 1UXWA 5I75B 1D5IH 5H37H 1IM9A 2E7MA 3UTTE 2GSIB 4NJAL 4ODXA 5FA4A 1IARB 2J8UA 3KDMB 1O6SA 4HC1H 2QMJA 3S3SA 1H9DA 1F4WL 2A38A 4PJDB 2Z65C 1X9UA 3AQZA 1CD8A 3F65A 2Z9TA 2R1XB 4HPOH 1OE3A 1BYOA 4Z76B 5BRZE 4QRRB 3GBMH 3OAZK 2DJ4A 2VR7A 1UWFA 3KVDD 3L3OB 2A83B 3CC5A 4N2IA 3RVWC 4FJYA 5IHUH 3T0EB 4KUCD 5CEZL 1JFQL 2BOCB 3KW7A 5DJXB 3GK8L 3MLUL 5F89A 2WLYA 4HYTB 3KS0H 2WJ7A 4LLDA 3U7YL 3UGEA 5I8CB 4J3OG 4TUOA 1KC5H 1MIMH 2OA9A 3ZKND 2WXKA 1YN7B 3J8F7 1KUMA 5D7JB 1HDMB 4JHAH 2VW7A 1JV2B 2LV4A 5GSVA 4F1ZA 1XGYH 1RZFL 1PF3A 5JZ7D 5LGKA 1KB5B 4HDIA 2ZXBA 3OPUA 4NNYB 4NC2B 2P26A 1ACCA 2AF2A 3EGDB 5DRXA 1KBKA 4JFXB 1U8IA 5M95B 2G60H 4YLQT 3MGOB 4NN5B 3NJNA 3DGGA 1A6UL 3MRFA 2VLKB 3SYAA 5I71C 3K4AA 5CEXA 4JZJA 4GKNA 1QSFA 5EO9B 4WENB 3DYMA 4JRWA 1K2DA 2NXYC 1BQHG 2AJYL 1FFOB 1Y07A 3RVTD 4UF7C 1IBGL 1UXWB 4OZGF 3V4VA 4G7VH 4KI5E 2E5EA 3BISA 1HT6A 2VR3A 4F57H 4MNGA 3IU4H 1S9XA 2EDBA 2R29A 5CIPH 4XP9L 2MPVA 3PS6A 3SEPA 3V4PL 5EC1B 5AW7B 4OLUH 2AQ3A 6FABL 2HKAA 1N9PA 4P5MB 3S3DB 5PAZA 2D7TL 4F37F 2VLJA 1NM9A 3ISRA 2EDFA 2ICWJ 1U8NB 5EZOL 3MJ7A 1KXVC 2ITDA 3QS3A 2YAFA 1QPPA 2KKQA 3BUIA 4KFZC 3RTQB 1BXVA 5HDBE 1T66D 3VWKC 3X3GH 5BCAA 3II3A 2FHBA 4KUCF 4Z8FH 3QEUB 3WL9A 3O4LA 1J48A 3TJPA 4G80B 2RB8A 4JN1L 4BCXA 3EAKA 2ODHA 4KY1L 4MMYA 4GSDH 3H9HA 5JUEL 3QNZA 3VDCA 1CDYA 5IHZB 2DLHA 1UM4H 4Y2DB 3QULB 4O4YL 3WSQH 3KCWA 2NUPA 3UMTA 2PYEA 4F9PC 1L9NA 5EUOA 4NWTH 4GBXA 4MJ6A 1RHHA 5ICUA 4G7SB 1YPZF 5CZXC 3TFKD 2ZKHL 4Z9KB 3CUPA 5TQ2L 3QPKA 5DEFB 4HH9B 3L5IA 1MWAB 5DC0A 4YZWA 3SGKA 1UTDA 2LTQB 3KPNB 4R4NC 3EYQC 3KL3A 1AHWB 3HMXA 1MCJA 1ZHKA 1MUJA 1N0XL 1SYSB 1KCKA 1G6RH 2HVJB 5K9KB 1UZGA 3IPFA 1GW0A 4TSAL 4Y4HD 1QQDB 1E9OB 2JJVA 1JK9B 5E9DE 2DQEL 5DD0H 4LSVL 1KPVA 1GGCL 43CAA 2FHFA 1Y18B 6PCYA 2FTAA 3SKJL 1AS7A 4KNUA 5BV7H 2B59A 5AW1B 3U9UB 2A4EA 3C5ZC 2FD6L 4OCSL 4QO1B 1HXMB 3TIEA 4BHUA 2MPAL 3IK2A 1BQLH 3KPOB 4K3JL 3NJMA 2ED7A 4KU1A 1FJ1A 4FQCH 3AU1B 5DJ8A 4PUBH 2I5YH 3BESR 2AFNA 4N2KA 1CXFA 2PO6B 5IROC 1KMGA 5F9WB 43C9B 2LLNA 2YXFA 3TN0C 2GY7B 1AKJB 2ZG1A 3S7GA 1MREH 2FYVA 2FYYA 5E5UB 1T03L 1A5FL 1JK8A 2NSQA 4PY7B 2F58L 1RJZA 2OSLB 5C71A 2JVUA 3N9GH 1J8SA 4JO4L 2Z3FA 3VTMA 2CIKB 2JSFA 3FFCA 4PGEB 2OMTA 1YQVL 4GH7B 4UTBH 5IHZA 2D2OA 2FX7L 3HMWH 1DYZA 1QACA 3BAWA 3PABB 5IK3A 3MRGB 4JFFA 2BSSB 3G5XA 5D8JH 4YHIA 2APVA 3SDDA 1GL4B 4GG6A 4LVEA 3RDTA 5DT1L 4BM7A 3ARGC 2HMID 2QQKH 1ILSA 3B4NA 4GRMB 4Z7VA 1PFCA 3B3BA 1JWUB 4K23L 3FCSB 4PJIF 1N6QL 3ARYA 4PYGA 1CXIA 1LP9B 4JGMA 4UV7H 4XPHL 4N0UA 1JV2A 1TZHB 2OZNA 3BSGA 3TM6A 3VXMB 3QDAA 1YQVH 4FDWA 4L0YA 1T83C 2ZCHL 1LD9B 5I1JL 2F5BH 4MXVE 2EH8H 3KLQA 4LOEA 4BCYA 4P9HL 2DQHH 3LKOB 3U0TB 3T1WA 1FDLH 1Y1DA 1IBBA 4JY5H 4XOCA 1FNFA 5FPIA 4RWYH 1QTSA 1T03H 3IPBA 5EIVA 1TQUA 3WFEL 5A2KH 4AW4A 1GIGL 5IFJB 1E7VA 2DMKA 4Y2LA 4B0MB 4B5ZA 4R4FL 3QDJB 5EO0A 1MZZA 4YFLI 4KKLC 5HI3C 4FQIL 1EEZB 2CLZB 3DC0A 4R84A 2D31A 3VX0A 1MFUA 4PV1C 1PG7L 3FQRA 2RMNA 4GAFB 4PJ8B 1PZ2A 2JQAA 3V5HA 5JXEA 2YGVA 3DVNA 3L5XL 3V4VL 5J6GA 1TJMA 3VWJA 5DS1A 1EFXA 1KENH 1UHVA 4Z3GA 3D8MA 5GGQL 2D03L 2W8CA 4XCEA 1ML0A 3H54A 3VFRB 2HFEA 3SPHA 1LP9F 3ZHDA 3R4DA 1SQMA 3AMKA 5EIIB 4PBXA 5IG7A 1JRHH 3VQ2C 1BAFH 3P4NB 1AMYA 3S37L 4KTYA 1JPGB 4PU2A 5EF2A 3O3DB 1OAJA 4X0KA 1S7WA 2X4QA 2BSRB 1PLCA 2R39A 2EKSB 1ADQA 2PP8A 3DV4A 4NQEB 1ET7A 1TOXA 1DEEA 1RK1A 2X38A 2WIMA 3ZK0A 2XRAL 4OY9A 2AZAA 4Z7VB 4JO3L 3TN0D 2DQCH 4JQXC 1BBDH 5IK3B 2A6DA 2VKXA 3WMPA 3JV4A 4PJHA 4NKIL 4UOW0 5I66A 5F7YC 2O1AA 3KPPA 4JLRA 4FS0A 5F6IB 3PJLA 3KLHC 3X14A 1SOQA 1NDMB 4HUCA 2Q8BL 4FZ8H 3HZYB 2DWSA 3HC0A 4BZ1H 4WNJA 1OGTA 1JZGA 3DOSB 3QWRD 4TLTA 4IM8A 4Z7OF 2XSKA 4JRLA 4YHYC 3GDCA 2RAMA 4HIEA 3LEVH 5HHQA 3OMNB 4LHUA 4R5XA 1DBJH 2FGWL 2ESVE 4XMKH 1XSJA 1GGIL 1J9CT 1RZGB 4ZAKC 1VENA 3C8KA 1T66C 3AWFA 2CPUA 3VWKD 1NINA 2YGNA 1I1AC 2D4DA 3QCVL 4HH8A 4PJ7B 1EEZA 2CLZA 1FFQA 2IF7A 3PNWA 4E41B 3MV9B 3X1BA 2VN4A 1FWXA 4LCYA 3ABZA 4MCMA 2AHIA 3BPCA 1ZK5A 3CLEH 3NFPB 4P0DA 1YSOA 4NEHB 1LK3H 4ICXA 2WWOA 1HSAA 4M6AA 1Q0XH 1Q9LA 1FFTB 3OKLB 4OTXH 4BUGA 4ZMZA 2CHDA 3V4PA 4IOIA 5FF6A 3TCTA 3EOYG 1T20A 1ADWA 2IANB 4FQ2L 4W93A 1CT8A 1C16B 1OXYA 2HTKD 2PR4L 3VFNA 4R26L 5D6CB 3TBVB 3UDWA 4ZPTB 3D4CA 1J0IA 1OHZA 1KFAH 3MRKA 4OLXL 5FHBL 1P5VB 4Z7WF 4M56A 1XTMA 3MNVB 3VXQA 1F00I 3CLFL 2B8OT 3UC2A 3WTYA 1QSFE 4UTBA 1L5GB 5BS0D 5IHHA 1RUPH 4EPSA 3GJFK 3NBNA 1EEQA 1J8HA 4K71C 1NIAA 1VAHA 2UXTA 2VITB 5KUKA 4G5ZL 1HQRA 4YFDB 3FHQA 1P7QD 1JD9A 2MCPL 3GGWB 4PIBA 1KFGA 2AKRA 4M6OH 2TSBA 2AEIT 4JQVA 4AM0A 5D9SA 1TPXC 4X6DB 2PABA 1L7TH 1COBA 4AV5A 2GJ6A 5ESVA 4P9ML 4R4BA 1OALA 3TC9A 4OJFL 3BLPX 4ZMXA 1Q0XL 1FZKA 3MMEB 3SDXB 5H8DA 4QHLA 4CL7A 3CE1A 1JN6A 1Y0LB 2O5YL 5SV4A 5DHYB 4WO0A 3FT4B 1OLLA 5EC2B 2DQIL 3KL0A 2OTPA 5CR1A 4KI5D 2Y3AA 4XWGH 1UCTA 2HH0H 4I48B 4LCWD 5F93C 3EOTL 4H5SB 2TAAA 1QLEL 3P9MB 2WTRA 1TTFA 2H47C 1S7QA 3IFLL 1NEZB 5HDQH 4F20A 3CSFA 3I9GL 5DJCA 4D9LH 3O9WA 5JQ6H 1ACZA 3VGEA 4GW5B 1HCYA 3GRGA 5FKAB 1AD9B 5GS0H 1ZLWH 5DD1H 3SDDD 2XQBL 4U1SB 3V6OE 3ARGD 4HIXH 3DX2A 4PJEE 4BA0A 2HMIC 4Z7NF 4YDJB 4FNTA 2P49B 1ZWIB 1JUFB 4HCRA 2P9RA 1NZRA 2CDFB 2EABA 3UTPD 3MLSH 3U30C 1CICB 4WO4B 1S5HB 4M3JA 5GGTL 4RISH 3EZJB 5BW7A 3TU6A 4AG4H 3L81A 3AW5A 4RGOH 3FBKA 2VN5A 5F9OL 3I3EA 4K9EL 4U3CA 1RJLB 4L29A 5E1IA 1KV3A 4NOBA 2W92A 2DQUH 2WWMD 3NSYA 4G82A 1FNSH 3TL5A 4WW2C 4X6CB 1I1FB 1N0LB 5DMIL 1WWAX 4AL8L 4WVRA 4IIZA 2EXWC 5KW9H 4H88L 1XF3B 4ZODA 1X7QA 3SY0B 3QFJD 5E1HB 3UP1A 4HG4K 1U42A 1FC2D 1B4TA 3O3AB 4X8JB 3TESA 1I8IA 3BGFC 3L48A 3C60D 1NIBA 4N0RA 4N2MA 4YZFF 5GJTL 2QPUA 1T7VA 2O61B 4RGMC 4KC3B 4WTZA 1P4BL 3MRMA 5I74C 4YSQA 5CBAA 2C9RA 1L0XA 4XWGL 2IWFA 1F0LA 1VFMA 3U25A 1FN4B 1JSYA 3RL1B 3GIVB 4J3OD 2CO6A 2LE9A 4L1DA 2LT9A 3OVUB 2WZPA 1BQHA 5HHPA 5DS8A 1NKGA 5F3HB 4H8WH 4JE4B 4PG9A 3S3BB 2C3GA 1TNMA 1EDHA 2QHLA 3FSWA 1OF2B 4OZFA 1HSBA 4D8PA 4GSXA 4QRPA 2AW2A 1T0NA 4FERA 1AD9A 1MFVA 1B9ZA 2X6BA 5IB5B 3VJ6A 2PWGA 3GMMA 2WW8A 3UXFA 4MQSB 5JHLA 4N0YH 3GSWA 3ILPA 4LCYB 5T1DL 3UTQB 5D7JD 5CO1A 1AO7A 5E8OB 4JZNA 3RB7A 1OIOA 1X5IA 3CVIL 3CBKB 4U6VH 3BAEH 4F7PA 3WFCL 3ULUL 2FE0A 4ODUA 3G3LA 4YXLL 3Q43A 2ESVD 1AHKA 3ATAA 2AXFA 5H2BB 1OAKL 1P1ZA 5IQNA 5AYUL 3IMTA 2UY6B 2Y36H 1DN0A 2XXCB 3MRJA 5DRNA 3Q8BA 5CD3B 4WU7B 4PREA 4TSCH 4U4BA 3HEIB 3GMQA 3LH8A 3MNWB 2YIHA 4EN3A 4O9HL 1BBJA 2BSCA 6PAZA 2VB5A 1DUYA 1QASA 2DIJA 2A6JA 1G43A 4ZTOH 3HN5A 5DFVD 3N0AA 3T3PB 5KYNA 2VE6A 3PQYD 1CLOL 4U6HB 1IQWH 5JW5B 4OLYL 3QJQB 1EV2E 4XNYL 4I5BA 1KLFB 2VXVL 2YQ2A 2X0UA 3ABGA 4KOBA 4L1HA 4MMZA 4Z3TA 3QR0A 1FVEA 4LPVA 3T0EA 1EPFA 1MFBL 2X0WA 1I8LC 4O9HH 3T6XA 4JPKH 4JB9L 1M7DB 3RWCA 3RA7L 4E2OA 3NSCA 1KXQA 3BQUB 3EUUA 4P4RA 4E9RA 5A3IC 4BFIB 1ZVSA 1V54B 5E5MA 2GG1A 4DP4X 1R5VA 4UYQA 1EXUB 3RVUD 1G7PB 4G2AA 4F2MA 4R2GC 4XO5A 2W9LA 3V0WH 1FO0L 4HZLA 4L8CB 4P5RA 5CKAA 5HI5D 1D2PA 4DPBX 2EINB 2R1YA 3QQXA 5JMRA 3HUJB 5KSBF 4KK6C 5JPMA 3QJRB 1J8HD 3RIAK 3OZLA 2IADB 1LK2B 4CILA 3FSZA 5ABDE 2ZOLA 5E8OA 5C09A 4XP5H 5I8KH 3QCUL 4YSOA 1DL7H 4HKXA 2NCMA 4PW4A 5KEZA 2BVTA 5TQ2H 4GKZA 2Y2TA 3FL7A 4OZFH 2EDXA 3QFJB 4HUUB 1D6EA 1TCMA 4RX4D 3PWLA 4ZZFA 4Y0GA 3K71B 2B14A 1LO2H 3NPSC 3NIDB 4P46D 2G3NA 2H2SD 2IQ9L 1SJHB 1NCAH 1T3FB 4P3WA 4XVSL 4AE1A 4FL4B 1VFBA 5I1HH 1KB9K 3AAZA 3ZTCC 1JNHB 5SWSD 4W81A 1I1FA 5TH2A 1TVBB 4XAKE 1NCDL 3AY2A 1FCGA 1DCLA 2R59A 4HXAL 2IQ9H 5EU7C 1RL1A 4DGUA 1UVQB 3BIAX 4HUKB 4DO5A 4FKEA 1JNLL 2A3TA 3BAIA 2IWEA 4APQA 4ODBD 2WCGA 3ZTEA 3VI3E 2CCWA 5GS3A 4CN1A 1I9EA 1NAMB 2J1WA 3GLAA 4UT7L 1RJYB 3D85D 5CUSH 3K4ZA 3UTPE 1EDQA 1E4XH 4HAKA 4MMZB 4R8WH 2XIDA 1EZSA 3GSOA 3Q6FB 1J0KA 1RZJH 4NAJA 4GKSA 1BD2A 2W65B 3M86A 1TYEB 3K2IA 4J3VA 1GZQB 1ZEAL 3TO4A 3FO0L 3KAAA 3OB8A 3GS7A 4X4ZA 1M7IB 1HJBC 1AQKL 3NIDF 2VXQH 4I77H 3ZDYE 2CKBL 1HSBB 4ALAC 3QO1A 1J5OH 5KSVB 3N41B 2OCCB 3LXUX 3DTUB 4PPTA 1EHAA 5LBSA 3V6ZB 3IFOB 4G8GA 3VI4B 4A7SA 1BA9A 3N5AA 4ZMQA 4QXGH 1PAMA 4XNUH 4P5TD 1MJJB 1SHWA 4OAWB 5C0AE 3UADA 3G6AB 1YYCA 1E43A 1WBYB 1E50A 1FIEA 1DVTA 2BPBA 5FO8B 1NGWA 1S7XB 5F7HA 1BVNT 1U92A 2VIRB 4IYKA 4U05A 4M7LH 4J8RA 5HHOD 3SBRA 2PCPB 3TONA 4AYID 5HYQA 1HIML 1ZA6A 3KYAA 4PJ9C 1ZJBA 3ILDA 3C60A 43CAB 2WUBH 4XPGH 1DP0A 4X5QA 3I3DA 1HILB 4NRYB 5C2BL 1ZXKA 3LRMA 1E7UA 5CHNA 3BYTA 2VL4A 5AG8A 3M8OH 3GBLA 1ZDSA 3JUZA 3C8DA 3LZOA 3RL2B 4XP1H 2XWTA 5IHUL 3OV6A 4Y16B 3OKNB 2WXJA 4HS3A 3IGAB 3CGTA 3KBFA 4G3YH 1C5CH 2PW2B 1YEDA 4MJIB 3U9WA 4WI7A 5KYXA 3UIZA 4FQXC 2A9MH 4QRPD 4WI0B 4EOWH 5HVHB 5BXFB 4I2XA 2V33A 2WYHA 1MDTA 4KQ3L 3HC4H 2RR3A 4AVJA 2SEBB 3E6FA 2AXJA 4KHTL 5EWIL 2QVMA 2CA3A 3DX8B 4Q9RH 4WHTA 4N2CA 2FX9H 3N40P 4U7KA 4L4TA 5KBNC 4TUJA 2XN1A 5IVXF 2V2TA 4UQ9A 4D9QD 1KIPB 2PO6D 1SXCA 5ADPH 4QYAA 2FSEA 4M7ZB 1DE4B 1XDTT 3CX5K 3FN9A 1J0YA 1ILUA 1AR1C 1IBZA 4AIEA 2OMWB 3EYOA 4LCWE 2OYMA 5FKPB 1T5XB 4FQPA 1XEUA 4OAWA 4AYGA 4DK3A 1H3TA 2FUTA 4F8OA 3JV0A 5GS2H 1FE8H 2N0MA 3FSVA 3KPSD 2R1YB 1TZIA 3EYQD 1NGXB 1J0JA 4M48H 4PD4J 4UI2A 3BWUC 3ABKB 4G11A 1R47A 4JBSA 3PWNB 5DMKA 3GSRA 1UZ6E 2XBTA 1RSYA 1P69B 4XNMB 4FXKB 3S36X 1JMXA 5C0BD 3WSQL 1MG3C 1BLNB 3MC0A 4GO9A 3NESA 3TCXA 1HI6B 4PJ5A 1NM4A 1H15A 2EIZA 3MA7A 1HIMH 3T2PA 4PGCB 2V9UA 4I7ZC 3DX9B 5TF1H 4AEIL 2YFNA 1FAIL 2MHAB 2BXYA 2ENSA 3ROOB 4HETA 1HHGB 2VXTL 1JS4A 3RZCC 1SY6H 2E74C 2CO7A 4X80H 4QKTA 4AQAB 5F1NB 1E2VA 4IKKA 4RETB 1Y6KR 4KKCD 4MD0B 4ELMB 1T21A 2J8UB 4OT1H 1U8OA 2FX8L 1SF5A 4NN7C 5FYJH 4MLIA 4B6ZA 4E41D 3NZHL 3MRPA 5T8IA 3P11H 1VEOA 2AXGB 4B7LA 2F8XC 3OZKA 3WFZA 4D3CH 4LK4A 5BO1H 2CCVA 1ORQB 1DBML 3KXFE 4CBPA 5AB9A 4QF1A 4APXB 4NNPL 3LH9A 4GI6A 1H6FA 5LAPA 1OAUH 1XO8A 4P5TB 3W1ZA 1FFNB 1ZTMA 4YHML 5AVVB 2EILB 1U6AL 2B4CH 2QJDA 4HMDA 4PTTA 3T8VA 2PXYA 1HNGA 3TPUB 2HLFD 3TNNB 3IETB 1CU4L 2DD8H 1KTJA 1WD9A 5D1ZB 1ZPUA 1OHQA 2XZCH 2EDEA 3RY4A 1NGQH 2MEJB 5FO7A 2V7NA 3GMPA 2FIKA 2V8MA 1CVRA 2IIJA 4FNLH 2F8OA 2J1ZA 3HKZA 4AVKA 3IM1A 4N6QA 3EFOA 4H20L 2QSCH 4HSQA 1XCTA 5J5EA 2DD8L 1TJGL 5DGQA 2VC2L 1MAML 3LPFA 1BF5A 1OD9A 1LD9A 5C0IB 3BZ4A 3WJJC 5C0NC 4YVUA 4ANKA 2R0WL 5B39B 4PBWD 3E2HC 3Q7JA 4OJAA 4PGZA 3KJ4C 3BP6B 5AUMA 1BQHB 3VE0B 1E8ZA 5AQ0A 1ZT4A 4QTHA 1C8PA 4BFOA 4G8IB 1KN4H 2CO7B 3HI1A 3VXNB 4N2EA 5C08B 2V17H 1RKRA 4EI6A 4QHNA 2IG2L 3P02A 2NY5C 1XGQA 3UBHA 2LABA 3SD2A 4OIFA 1C5DA 3MLWL 2BNQB 1ODAA 4CNIA 4JR9H 4AGOA 1A1NA 4IDLA 4Y5XB 2YEQA 2AXGA 2PR4H 4JDZB 1IFHL 2WBJA 3VFMB 5C0AD 4N2AA 1RIHL 1YUHA 4B27A 3OHXA 2OMZB 1JPGA 1A7PL 2NQ3A 1Z6JT 3QZPA 2Y1YA 1GZHC 1N5YL 4AEIH 4U6YA 1TTBA 2P5ED 2YD6A 3AABA 4KWUA 4NAQA 1OCZB 1OCOB 2A99A 1R1CA 5D7LA 3QRLA 1JPST 1LEIB 2AXFB 3RVXD 3HG0A 4N2LA 4GUQA 4HGMA 3K3QA 4JB9H 3H7LA 3HW7A 4MSWA 3D0VB 4Y4FA 4JJ5B 1MFDH 5ITFB 5LB1A 1QLEH 4XI5C 5J0BA 4A2LA 1VCAA 1J11A 4HS6A 1A6AA 3VYOA 5EA0H 5ILTH 3OXRB 5HYJD 1TU2B 2EEXA 2FQDA 5D2NA 2ZICA 3QG6A 3VWKB 1PIGA 4Y9GA 4BINA 4N2BA 3ZT5A 3HG4A 2H0FA 3OG4B 3ECWA 4OF6A 3TFKC 5K9KA 1KWKA 4PRAA 4LCUA 4W4NA 3Q2VA 5MENE 1UKSA 3QZWB 4ZO8A 2F9BT 3B37A 2NR6C 2NY5L 1H8LA 1JK9A 1AHWA 5FX3A 1Q0EA 2QV4A 3HG2A 5ADOH 1S7VA 3O9WD 4F8PA 2K3HA 2C7UA 4HIHA 2VLJE 1M7UA 4KDTC 5MENA 5CLYA 2CXKA 2VDRH 4HD5A 1IILE 5CP3A 5KVGH 4N24A 4PJBE 2IG2H 2X4UA 3F3HA 1B6DA 5EEWA 2W95A 4X9FA 4BFGA 1IAOA 1XR8B 2GJ6B 3MV7D 4YR6A 4MDIB 3CSPA 4UMSA 2X4NA 3MA9H 1Q9KB 1PCSA 2IDCA 2FJFA 5IB1A 1OAZL 3SQBB 3RFZA 5EO1A 3OZ9L 4WU5A 2F61A 3BH8B 4RFEA 3PY9A 4EIZC 2ALAA 5K9OA 4M29A 5FB8B 3VMOA 3C09C 1QFUL 5CZRA 3DO7B 3RPIA 2QR0A 4F7EB 1DQQA 3DX1A 3TYGL 5E8DH 1E9QB 4DTGH 3ZGIA 2QQNL 3ZR5A 3C5ZB 5ITBH 1BVKA 3EJJX 3WTTA 5IJKC 1NDGA 2JWYA 5F88B 5DVOA 5ISZB 5H4YA 3ZYZA 3H3BC 3NCXA 2YAEA 3MYJB 1KXHA 1E5ZA 1V5JA 3UBGA 4DAGH 1UA6H 3NCCB 4OD3H 2O6DA 1D5ZA 1UADC 2XZQH 4YSCA 3SDDB 4U1HA 4WW1A 3NEEA 3QJHB 4JDVB 1KPVB 3G9AB 3ESNA 4M93C 2UZPA 5JW3L 2FWUA 2PTUA 2J73A 4H8VA 1MN4A 4Y19E 2FEDD 3SKOB 5BV7B 1QW8A 3U0WH 1JZ8A 1KF9B 2PW1B 1CI3M 2XOTA 2HRLA 3ESMA 5F8RC 1QRND 1U8KB 2ITCB 1O9WA 5L0QB 1KTDA 3DMMB 3VRJB 4GMSH 4EDXA 3QH3B 4YQXH 4E5XB 3MV8E 5LG1A 1X4YA 3QR2A 4FNSA 4PCYA 1A7QH 4I18C 1JYNA 4ZXBD 2I9TA 3MUUA 2NQDA 2XKSA 3D05A 5D7JA 5JYMA 1UM6L 2A6IA 2GSGA 1EMTL 2VDLL 1MCQA 2NYZA 4QHLB 4ZUUA 2VAAB 1CBVH 3KR3H 4YHNB 1I1YB 4KK5D 4YPGA 4LOVA 2H2PC 4DETA 1UT9A 1GGYA 3NZSA 1JXGA 1TQBC 3R19A 4MXQD 2PPEA 4O51A 1F4HA 3CDYA 3RAJL 3SCMC 1KG0A 2WM0A 1EK3A 2HLEB 5IVOA 3JWNC 4Y5XA 4WWID 3NEXA 3AJ7A 3AS1A 3C8HA 4XNZB 3O3EA 3R7RA 3PE9A 3OR6B 4IBSA 2XBZA 4P23B 1F4YH 3QI9A 1JGIA 3WIIL 5BS0B 4NQTA 3S35L 15C8L 4PSRA 4OKVB 4JX0A 5EEXA 2WMPA 3IU3B 4XXCC 1UJ3C 2CQVA 3WD5L 4FTDA 1YAIA 3ZYIA 4AEHH 3OAUH 4C4UA 1IMHC 5A7EA 2OAAA 3D39A 1FYTD 2WSKA 3N0PB 1LEIA 3DSFL 5DD3H 1KENL 1LHZA 1NMCC 5FYKU 5LBGA 1DJXA 3X13A 3PWUB 3QWOA 1JL8A 1IGJA 3F58H 4L9LC 1RUML 4NBZB 5CGTA 2EVIA 3KDPB 5EIQA 1A21A 1TCRA 3VXUA 2FVNA 1SRDA 2RHEA 3SYCA 1KJVB 3S3CB 1H6TA 3A4DA 1UXSB 2D7OA 1R0AL 2AQPA 4HIJA 4L3CA 4MXQC 3K6SB 3IDUA 5EH1A 5AG9A 3LSOB 1JBJA 4A6YB 5IJBC 1IO4C 1UFGA 2Q76A 3D2UD 3DVNB 3PL6D 1QUNA 1F56A 4AEFA 1KPUA 4F15B 5I16A 3NQKA 1S3KL 4MBRA 4ZTEA 4JHVA 1MXGA 3I75A 1QFWH 1MVUB 3RBSA 3ZW3A 1M1XA 1OTUD 5EFIA 4YLCA 5FR3A 3NCYS 4N4YB 1T6WA 3TLRA 3MNDA 2ARJQ 3BGMB 5CN2A 5LXGH 4KZEH 3TYFA 3LKPA 4RZCA 4TVPH 2CO2A 1S7UA 2ZCKH 4PJIE 3RVVC 3ZTJH 4LSDA 1BZDA 2E59A 2Z31D 1B4JL 2FECL 1MWAL 3GZKA 4S2SA 3AM8C 4YDVB 5BRZA 5ABAA 1RU9L 3L95A 2OZ4L 2B1OA 2AEQH 2H3NB 3N04A 1W72H 5KBPA 4YQXL 4G42A 4MB3A 3BRFA 5TQ0H 3OB0K 4P2OB 4DN4L 2RD0A 3FCBA 3QIBA 1KPRA 4PJCF 4UTBL 2Y22A 4A2FA 3ULSB 4U1KA 3IDYC 4TNVF 4R7LA 1JGLL 1GKEA 2NCEA 3JV4B 3MLVH 4ZAKB 35C8L 2BIQA 4FTVD 1HK6A 2J6EL 2EXWD 3DNKA 5ANMB 2NXZB 4K3EL 4M5ZL 2FO4B 4F2ME 5F7EL 1BMGA 2Y36L 4PWJA 3C5SA 5DVNA 5FYJU 2EE2A 1BJ1J 3GRWA 4DESA 2EYTA 3DO4A 4LQ1A 5EOQH 3NJJA 3U79A 3M6DA 3GMNA 2WKOF 2XV3A 4D0BB 3N43F 32C2A 4E9XA 1P84K 1WO2A 5I5RA 3GB7B 4HXAH 3PCYA 1AGDA 3BFOA 5TGBB 3S3PA 2NUTB 4JKNA 1BOGB 4DGYL 4BZYA 4ADJA 1LE9A 5KOVC 1YQ2A 3ISWA 3D33A 3LIZH 2AJYH 2OV0A 2E46A 3OAZH 3D4ZA 4RRPM 1WDAA 5EULV 1X5AA 2Q8AH 2PCFA 5BW7C 3BI9X 4G59C 5ITBL 1MVUA 5MEQB 5F7DB 2R4RH 3RGHA 3QUHA 1RZJL 5EF3A 2P7TB 4GRWB 3L13A 1WBXA 1I4FA 1QSED 1YDPA 2CK2A 1N2RB 4P5TA 1I7ZA 4XT1C 4FFWC 1UM5H 5HD8C 1EANA 2I60L 3O6LH 1SM3L 4HUMB 4N8PA 2VMDA 4L0ZA 5JW4N 5D6DA 1Q94B 2HT3C 1IL1B 1TVHA 1ONQA 4YHZL 5E5MB 5KANI 3RURA 3QJFB 1UWGH 4A7TA 3L1FA 4TLKA 5SWSB 2VSKB 3BZ5A 2D03H 5SWQB 1RUQL 2J25A 2Q1EA 5L2KA 1SM3H 3ZHFA 2J57A 1HKFA 4JN1H 3QO0B 1DFBL 2AQRA 4Y19D 2FJHB 3CU1A 3MKKA 3E6HA 2M8XA 4ONGH 4X6FA 5K9JH 3ATBA 1S5HA 4ZOBA 2RH0A 3TA3A 5A40E 1PX8A 2GBUA 2NUPB 4IU2B 3GFUA 1T0OA 3LKSB 4PLKD 1E27B 3PP4L 4G8GE 1S9YB 2P5EE 3LPWA 4XI5D 1G87A 4PJ7F 3D2UB 3PL6B 1O7DE 1B3IA 2B1AH 2WLZA 3NIFE 4XC3H 4Q6KA 4HC1L 1F11A 4DP6X 5TGBA 3D52A 1RJLA 1EJOL 1UA7A 4GRLA 4QWWC 3R4RA 5I76A 3IDMB 4NDMB 5BO0D 1CFSA 4ZMLA 3OKNA 2WXMA 2YA1A 3AU1A 2BLFA 1EHLL 5F7UA 2PO6A 5FDWB 3LS5H 3IN2A 2XQ0A 4FI6A 4Y1AE 3L2NA 4XMUA 1A7RH 2W88A 2JJSA 5JHLL 1YEEH 4NQDB 2AQTA 4C83B 5EEVA 4JQVC 3ARDD 3O11B 3T09A 1QA9B 2YPKB 1QUPA 3C6EA 2H26B 4K94C 4OCYH 4Q74A 1AS8A 4BQBA 1MFEL 4AIOA 2AZUA 3ZDXE 4GXUN 3KJ6L 3IJ9A 4YE4L 2HRPH 2Z93B 3M46A 3OR7A 1E28A 1U95B 2FBJH 4QXTB 5DF0A 5EOCJ 3WIHA 1MREL 4OJEH 4A2GA 3MLXH 3WBDA 5IQOA 3TH2T 3IXAA 8CGTA 5KAQF 3P0GB 4NKOB 3GEFA 4PJXF 1I7RA 4XRCA 3QP3A 4LDOB 4HDIB 1ID2A 2OXGB 3BPOB 4OLEA 1A6TA 1DE4A 4U6XA 4TUUA 4CC0A 4KMLB 4JFQA 4L8DA 2MPAH 4H8WL 4BFFA 5T33L 5JDSA 1MKFA 3OKYA 3S35X 4HS8L 1AQMA 2BZDA 5EU4B 5HPMA 5ALCH 4WSGA 5HP5A 4O2CA 4JAMA 1F11B 4C4BA 4YUEH 1IC5H 1K8DA 4J3OH 2X7LB 4XOBA 1MCWM 3D2UA 3PL6A 1HCZA 1ZA6B 4E41A 3UJIH 1PG7H 5JTWA 1OAXL 2VUYA 1ZOXA 1YEIL 2XWTB 3GXDA 2BNRE 4MNHA 1WAEA 3DRTB 2HVKA 1DBMH 3WAJA 1F4AA 4D3CL 4ORZC 5CP7A 5KVDL 1D7BA 2X5PA 3ZL4L 5CS7A 5CSBA 4L3FA 3P9LB 5EUKB 2KERA 1F8TL 1RULH 2AXHA 2Z31A 3NGBB 2F7QA 1QRNE 2VGLM 2WYTA 2X2IA 5KSBA 2EYSB 2QLYA 2GAZB 4O4YH 3CFKB 4LL1A 4PV8A 1CU4H 2FJGA 1E4KA 3QHTC 3DUHA 4JFVA 1YDPB 3RGBA 4K9EC 5ETUB 1R5VB 2YA0A 1ZVYA 5DZAA 2C9AA 4U1GC 1L9QA 3O81A 3BQUA 1P4IH 4P4RB 3LQAL 1ZE3C 3H6JA 4ODHH 5AB2A 1IQDA 3RGVB 2QKSA 5D1ZA 4LOUC 5GS0L 4PJHB 4Q9QL 2BH0A 1JZDC 3KHQA 5JXEC 2HRPL 3ARFB 4O58H 4DP9X 4LF3B 3C5XA 4WRLA 4FLOA 4QHKJ 3MCKA 3WNOA 1MW2A 3LKRA 4X42A 2YOAA 3UDWC 3WY2A 2XWJB 5DRZA 3I6LE 5AWNL 4W6WB 3EGDA 5DRXB 4B9PA 4FHJA 2RQ8A 3Q1SH 4Z78B 5JMOC 1TVDA 1NL0L 3BP5B 3GC3A 3HA0A 5EU3A 3CVHB 1YYMH 4G9DA 3SDAD 1VCBC 3KYMB 5CZXD 2YMOA 5FV1L 3RWJA 3M17A 4L2YA 5IM7A 1DVFC 3VRJA 4PP1C 3RTQD 4CADB 4I1PA 4XBMA 4PWEA 4AT6A 1KJ2L 3A6OA 4ODHL 5GQBA 3L1OL 3BIBX 5I30L 3PHOB 3S5LA 2AQ2A 4QRTA 5I24A 4GKNB 1FHNA 5EO9A 1L9OA 2AJ3A 4IK6A 1FP5A 2WBKA 4TRPL 2AERT 1BAFL 1XD0A 3QRBA 2MQ0A 3ECUA 3HR5A 7FABL 2Q87A 3HPJA 3QHFH 1JWMA 3QXAB 2LR4A 2CRIA 1A7PH 2G3XA 4PJDE 3WO3B 3R8BB 5C0CA 2OFQA 3MUJA 4FP8L 5AW5B 1AAJA 1IU1A 1UEYA 2ENYA 3C5JA 4L2LA 1BW8A 1U8PB 3O8XC 1Q8MA 1NC2A 3CHPA 2J6WA 5EZIL 2UYLB 4TUOB 5FHBH 1K8IB 5ICYB 3VFSB 4IU3A 3DOIA 4XBPB 2XFXA 1WA2X 4DO6A 3IMVA 4KO6A 1CG9A 1GIGH 3WXVH 1OE2A 3S8FB 1J05A 4EN2A 2A74C 3G5VA 4G5ZH 4Z3HA 5LN4A 1T5WA 1LK2A 2UWEF 2ZAHA 2B2XH 2PYEB 3RFRA 3D69B 1J18A 1HTYA 1LEGA 1WUNT 1CDGA 4XPGL 4JQXA 5H35A 2IOOA 3QULA 5EZIH 1B0RB 5ELIA 3VSUA 4NFCA 5D5MB 2P47B 2X1OA 5C07B 2VWEE 3PXLA 1MLCA 1GGTA 3BAJA 1M3JA 1UXSA 1XCQA 1F3DH 1J88A 4GRLD 1KFAL 1RMFH 5C0IA 3EW3B 3IJSA 5JPNA 4GXVL 1B9KA 3TN0A 2WBJC 4FTVE 4TSBH 1T89C 4WGVB 5K9QG 2ADIA 3C2AL 5FYLE 4B9YA 3ZDZF 4KJYA 2CUMA 3CHQA 1J5OL 1W8EA 3M1CA 2OM5A 5CAYB 2JIXD 4ORGA 3KBEA 4NCC2 3H85A 3ARDC 3NQIA 4QJ5B 1JGDA 4O5LL 1FVCB 3OG6B 5CEZE 5FM8A 4PRHA 5A2LH 4RIRA 5C3IA 1GOFA 1AO7D 2X4SB 3IBOA 4NQCD 3NZHH 4ACTA 3FUEA 3NCJL 3U9UA 4JQIA 4H44C 4M5YL 4YNYA 4BZ2H 2P5WE 4ZUWB 5SX5K 3U0WL 4GT7A 4G42B 3P77B 5DFTA 1WIPA 4MYPA 5JW3H 3VACA 1BBDL 3ARFD 5E8PA 3VSTA 2J20A 2Z91B 4S1RL 2JXMA 2J2ZA 5DJZA 2XRAH 3RGVD 2ZUQB 1DN0B 3GSVA 1NGYA 3CFNA 5B8CC 3L3IA 4CW1A 4EN3D 1DBJL 3MJ9A 1QSEE 1LNUB 4L23A 3U4BL 3MODL 4WI4A 4UIKL 1IFHH 4X8CA 4CKVX 1PS3A 1NGZA 4NZRL 3NH7L 3ZE1E 3N6YA 4FZ8L 1JGEB 2VUKA 2EC8A 2C4FU 4GSUA 3V0IA 1AJ7H 1N7MH 3VFVB 5JHDB 1NSNL 2E7LC 1MCWW 1MRFL 3EYOB 1FBIH 1BMWA 4YHPB 5DHXB 4MJHA 4P2YA 3OXSB 1WFIA 1PNCA 4RMWA 5J6HB 1A4JA 4K3GA 4FNUA 3MX0B 3QUYB 4XNMA 3WY1A 3GZQA 4LSSH 3G5ZB 1BIIB 2WTPA 5A2AA 3BAXA 3NZ8A 4K3DL 2QV2A 4AKQA 2BVYA 2Y6SD 3HTLX 3FT1A 4NP4L 5FOBA 4DKFL 3DURA 5K59E 3AY4A 3EO9L 1YC8A 2IMNA 3QR1A 2VDMH 4EZMA 2ZUVA 4C4KT 5D1XC 1XSKA 4ZW6A 5KYXB 4OCRH 3U6RB 4I4WA 3W9EA 1CFVH 1KXTB 2WAHA 3BCFA 4H1LH 1QP1A 3NOIA 4JG0L 3KPQA 3FOMB 1I7TB 4IDJH 4WUUA 4YDIL 1F02I 4N90D 1MRDL 3CFDB 4PCTA 5CCJA 3G6DL 3QE5A 1GJWA 3M7OA 4UV7L 2DLIA 4U1IA 1KB5H 4G6FD 5F44A 1DVQA 3MV8A 5CCKL 1FSKC 2ZYRA 3SQBA 2EIEA 3O45B 3RB5A 2IQAB 5CM1A 3PAVA 1FZMA 2OW6A 1BZOA 3OAUL 3IDIA 5C0BE 2D0FA 1BVZA 4F9LA 5DFVC 5CN3A 1FDLL 4Y1AD 5G5DA 5JNYB 1OGAB 1ZIAA 1CFQB 2C9SA 1UOKA 3PNWB 1BF2A 1NGZB 1MIEL 4P5SA 5MEPB 2LU5A 4C56A 3J7HA 4ZPTA 2WHVA 3VXRB 3JT0A 3RZCB 4OB5H 3MROB 2BSEA 2OBGA 3PYCA 3UC0L 3O6MH 1CL7L 3MRHA 5IGXL 4MDRA 3EO0B 3N40F 4N8UA 4BK8A 1AXTL 2Y4SA 4HMEA 5IIEA 4I0CC 2EICA 4YZFE 1FA4A 2QDWA 3GJFH 4APQD 3WLBA 4Z1PA 1LP9E 3ILQD 1CD9B 4EMZA 1OP5H 4TS6A 1NIEA 4G9FA 1H3VA 1OPGH 4CGTA 1NDMA 1A4JB 3EZ8A 5CKGA 1DHKA 2AKRB 1AGEA 1S7SB 1WK0A 4YBLB 1J9QA 1T2JA 3KXFD 3ZU8A 4JCWA 3HMXL 5C9JB 3QZNA 5JIKA 4Y2DC 5E2TL 3AQXA 4WY7H 3F7LA 1Q0YH 3BEWA 2F7PA 1Z32X 2N59A 4M62L 1WFOA 4AXWA 4Y8AA 5C86A 1WV7T 5FW7A 2X9ZA 2VERA 4I88A 5IF0A 2VSMB 5I15H 1L9RA 4CAGA 3CHOA 1LO3L 3BIKB 4KJYB 4NQXB 3KGSA 5M94B 4QXWA 4OCLC 4M8UA 2DBLH 3BP6A 3MRDA 3B7YA 4GIPD 4Y4KC 2VOTA 3QQ4A 2LTQC 1QLFA 1ZHLA 4AK2A 5MERB 5EUOF 1TEGA 5HYFA 2V0AA 4R4BB 4IEFA 1KDIA 3SPJA 5FWQA 1GGUA 3MRIA 1RSFA 2BX5A 4HZAA 5D5MF 1JDCA 2XETA 1CWVA 2AQ1A 4OJYA 1G84A 3EO9H 3IBEA 1ZS8A 2WQUA 1CZ8L 3CPLA 15C8H 1SBSH 2BSDA 2M1KA 4G1MB 5FC9A 1P84J 4Y7MA 4LHJB 1BZ9B 4MA8H 3UPRB 3JWDH 2XNAA 3O0RH 1R34A 5BVPH 1TQTA 5JORA 3S88L 5HVGB 3GS0A 1FAKT 2Z4QA 3RAJH 2GK2A 3EDFA 1IT9L 2QKIB 1LO2L 4MZRA 3ESPA 2Y7LA 3AGVA 4GEJA 1G7QA 4PJGE 4OM0H 5EU6B 5LDSA 4P46C 1OL0A 2E9WA 2C3VB 3EOAA 1JHTB 2BSTB 2NY4C 4D9LL 2VM3A 3CXHK 5DMIH 3H42H 4AL8H 5CEZD 3BD5A 3CZUB 4TQHA 4R7VA 1PBYA 2H1LM 2JQZA 1C08A 1BX2A 1MQ8A 2BNUB 1NOLA 3BWAB 1UM6H 4YVNA 5KSAD 2EIBA 5IV2A 4ZS7H 2P5WD 3WKNA 5D7JC 2FLMA 3MBEA 2XWZA 4HUUA 2R69H 3UTSB 1SUJA 4NO0B 2HKFL 1G94A 5E51A 3IKCB 4FXTA 4RFOL 4ANWA 4GIOA 1ASPA 3C08H 4KK5C 1NBZB 1I1AB 1FO0H 3HAEH 1KY6A 4M03A 3UTTA 3T1FA 1NMAL 1OZTG 1FAIH 3RI5K 3WEOA 4KTDL 1LE9B 3QJZA 3IJ7A 1HCFX 1VJSA 2RJMA 4X4ME 3RYMA 1QWHA 4OGYH 4XN8A 4I87A 3T4AB 4OLUL 4PJ7E 3RVXC 1QYGL 1YEWA 3OL2A 3SOTA 3RPBA 3T0BA 1RJZB 2OSLA 3P0YL 4NIYE 4O2FB 3MRIB 3FXIC 3ZKXC 1NCOA 4ZOAA 3RY6C 5LGHH 4TVPE 3ZE2B 1FL3B 5DYOA 4Z3JA 4G7VL 1KV7A 5MERA 1Q72H 2MOQA 4JFUA 5BJTB 5TQ0L 2R2EB 4DN4H 4JPIB 5IJVA 1HOEA 2CD0A 5HGGS 1UQSA 2K45A 1FNHA 5C0BA 3LEYH 1OARL 5IJKA 2XN2A 5GGVL 1IX2A 1X5MA 5L7XL 5JOFB 4QRFA 4IU2A 1PD1A 1CICA 1YECH 4RGNC 3TVMC 4P9MH 4IOSA 1B88A 3FQ1A 1IAIL 2V5RA 4PGCA 4XN9A 2X05A 1Z5LB 1Z9PA 4ES8A 4HULB 4NKQB 5FYJE 1MHEA 4NRXA 3V9EA 5KYWB 1N6UA 1AFVH 5HYEA 2ZG2A 3C09B 4KQ4H 1CXHA 5DVKA 5I5MA 5HDOA 2BNUA 3QZMA 3EGXB 5DA0B 5T33H 5IIEB 3BAEL 1EH9A 3CVCA 4HFUH 2RFXA 1G7IA 4DTGL 2R51A 1TITA 4M6NH 4N2NA 5A43C 4FFZL 2OMBA 5EN2A 5A16B 3LHPL 5I9QB 3P4MB 4ANUA 3IGAA 4CDHA 4BH7B 5CEZH 4U1NB 3N44B 3Q5TA 3FQRB 4P2RD 3LRKA 4FQHA 5CNHA 4D0CB 2O93L 3HHRB 4LQFH 3FQ2A 2D3VA 3GBML 3KWVA 5A3ID 3IDMA 3KJ6H 1FNEB 2H32A 3QCUH 5CHNB 4MZIA 4HPOL 3WNNA 3CZJA 4J3UA 1MCNA 1LVEA 4LEOB 4JFHE 5TDPB 5D7KD 4K0OA 3MGAA 4YPJA 1JV5A 4AJWA 4MNQE 4TUJB 2KI6A 1HHIA 2EDNA 2DYPD 3FQNB 4XPAL 5E00A 4NT6A 2ZUTA 3GXIA 3LAFA 3S5LG 2FHCA 4K5OA 3TBWB 3Q2CA 4J3TA 4QKXB 2E7HA 4WI0A 3U2JA 5HHMD 2WSDA 1U41A 3F2LA 1EIBA 1AD0B 4PWFA 5IB2A 4DPCX 3U30B 1QR4A 3QJUB 5EBWA 4YHYB 1IAIH 4IEFB 3BVNA 3L3GA 3MFGB 2VZOA 4MMXC 1TETH 1DQJA 3UPAA 2NY1B 5JLZB 1IGCL 3IDNB 3KGUA 4GP4B 4L29B 2DQGH 5GRVK 4E9WA 3OM3B 3TO4D 1RCYA 3FB7B 3MDJA 3I74A 1U4FA 4PJAF 4G9FD 3CSYB 3QRGH 4JG1L 4F3FA 5IFAH 2KYIA 1RZKC 1UB6A 1VEPA 2VDLH 2GFBB 1ASQA 1NFIA 3KNBA 4YSSA 3DGCR 3LB6D 2ZXWB 2NX5B 3PGFL 1GC1L 3OMZA 3V4VB 4GFTB 1SEBA 1YNLH 3AREB 4DKEL 2DTML 2J5WA 2Y72A 4JKLA 1A3LL 5I74B 3QIUC 5I0WA 3MZTA 2YSSA 4I8DA 2DTSA 2H1PH 3BLBA 5FGBA 3UYRH 1EAPA 2VLRE 2BS8A 4OVVA 3JSSA 2ZP0T 5I17B 5KTEH 2HN7A 1NAMH 1XL4A 3ZN6A 4LASL 5AOLA 1TLKA 4HAFA 4UQ3B 2VABB 2BNQD 1D5BB 5T3ZE 2PR9A 1CR9H 1WFTA 4ZX3A 2XA8H 3CBJB 5IEHA 2YOCA 4GXUM 2VERN 4JFYB 4K71B 2H3KA 2X6CA 3QDMB 3L5XH 1QX1A 3QNZB 3ILPB 5H4ZA 3HNVL 5K5YA 1Z66A 1QA9A 2FATH 4LBEA 4YWGH 2FWSA 2E9JA 3X3FL 3VW3L 5KJ4A 3ISYA 4KXZI 1RJYA 4D0DB 3CCHB 3RTQA 3LNEA 2F74B 2IH1B 5CSZA 3FBQA 4DN3L 4KX7A 1UOWA 4J2QA 2Q0ZX 4RAVB 2PTTB 3GF8A 2DQ6A 4F15C 4M1GH 2YKLH 3GUTA 3JWNE 5IMLA 4MZ2A 2EXTA 1TQSA 4OCXL 1RERA 3ATFA 3VTTA 2C3XA 2C7UB 3KLLA 4G43B 5KOMC 3RUGB 3GI9H 3G5YA 4AWJC 5F71A 2IXQB 1G7MA 1DQDH 2CGYA 2GVYA 4YH6A 3T8XB 3WELA 3FQTB 4BKTC 9CGTA 2KDYA 4L4VE 3REVB 1TO4A 4HLEA 4Q58C 5JIIA 5CMAB 2DL9A 3JVGC 3MBED 25C8H 3PWLB 2MQGA 3SGEI 4X9HA 3S2AA 1AANA 3CVBA 4G3YL 4KH2A 2CHWA 3KLDA 5DURB 4V1DD 1U2YA 4P2RB 2DLEA 3HNTL 1QWNA 4ENZA 1Y1UA 2H3XC 5GRUH 2FGZA 1QHOA 3OB0H 1W8OA 1PZUB 3I6KA 4JO5A 3IDYB 3ZIMA 1MHCA 1XCXA 3BLKA 1P1VA 5T5FH 3VNZA 4YS4A 5IKCA 1J1XL 3T0XA 1LO0L 3LNIA 3B6SB 4WO4C 1QATA 5AUMB 3ZQWA 1GPOL 3TBYA 2WYIA 3UTZA 3DETC 1BVOA 4M61A 3SE3A 3FJTA 5D93C 3X11A 5CZKA 3IF1A 3HZMA 4R2GB 2VXTH 5J13B 1JZ3A 3CZSA 1YPZE 5GZND 4GW4A 5C0CB 3TO4B 2BC4B 4OZIF 5JHBA 3NFNB 3H3PH 2X2YA 2YD0A 4NLAA 4LLVB 2ZWYA 4NP9A 4IKJA 1HEZA 1HZKA 3T6ZA 1X44A 2XJKA 5CGYD 1T6BX 3DHJA 1T04A 2VDQL 4DKTA 3LEVL 4K2UL 2JTYA 4K9JA 1NFKA 4UBDC 4Q6IC 3CWGA 5FCUH 3B8SA 2EH7L 2FD6H 1ZTXH 3F7VA 1FVDB 4JO4H 5DZLA 1E5BA 4PJGA 1URIA 4W9ZA 4HHAA 4TQPA 5KUMA 4ZYKA 4HC1A 1IGML 4Q0XH 3SOBL 3AU0A 4ELMF 2GIXA 2X2UA 5L4JA 3RWFB 1DANU 3O2VH 4ZXBA 1GHFH 1NBCA 3E0GA 3M17B 4LCVA 4K7PX 5JA9A 4ODTL 4PJFF 5KYUA 3QFGA 2NYYC 2B4CC 3GIZL 3QFJE 1P0SE 3W81A 5CSGA 5EZLA 1OWWA 1OP4A 4OZFG 1DLHB 1SYVA 1UEMA 3HC0B 3NIDE 3GMRB 4FZEH 1VIWA 4HJ0D 4JFHD 1EAOA 3OX8B 3NCYP 4NN6C 3LKQA 4XXDA 3CC5B 2A5UA 4NQXA 3UZVB 4MNQD 1Q1JL 5CU5A 4FQQB 4IGBC 2VUOA 1I31A 3L8QA 1BZ7A 1HEJC 4JGJA 1HHGA 5CINH 1XGUA 3WUWA 3H2PA 5HHME 4OQTL 2Q2EB 3MHZA 2BIMA 1MAJA 2DDQL 4IGBA 4WWKD 4P4KA 1GSMA 3R18A 3DGDA 4JREC 2O4EA 4M4PA 2V7HA 4N5EC 5GGQH 4I3SH 3QBTB 5IBTH 3MODH 3N85L 1ND0A 1G9NH 2VWEC 2X4OA 3HUJF 4X4KA 3MRQA 5HHOE 1F2QA 4UTAH 4NZTH 1ECZA 2G5UA 5J7CC 2ICWB 5I19L 5KVGE 1YCSA 1WS7A 1GCFA 1AVAA 5C6TL 2KBGA 4NQUA 3FQXA 3DVFA 3IJ8A 5C6WH 1HSAB 2YD7A 3RWHA 5LUMA 3DDFA 5D55A 5AVXB 3WNMA 2YZ8A 3QHZL 3WFEH 3FN0H 2AAAA 2DEWX 4UDTA 1NANI 4ONHA 5IQLA 4J2XA 1ED3B 3BAYA 4NHUA 4GBXB 5C0AA 3V0WL 4B95C 2ZWNA 1D6VH 5F9AC 2VLRD 4LVNC 2WQWA 2YQBA 1MFNA 2P5EA 3C60B 4V2CB 3E38A 5J89A 1H8OA 5D7LD 5EEUA 3TWCH 4YFEA 2XWEA 2JCWA 3T77B 3SPCA 3LQZA 4BFNA 2O6FA 3D5OF 4OF7A 5LBVA 4J3SA 5ACZA 5J56B 1D6VL 3PAYA 1NIFA 4U6XB 1NMBL 4ZX5A 1F58H 1NA8A 3CFBA 1LYQA 1G9NL 3D06A 3O4OC 5DDHA 5AVQB 2A4ZA 2V9QA 3ZKMD 5AZEL 1CCZA 4J7RA 4WF7A 1URLA 4Y16A 2EE3A 1SVCP 1KCUH 1JFHA 3VI3F 5I1AB 5BRZD 3KPRD 1DVYA 2NNAB 5CZVL 3VXPB 3SIKA 4EIUA 1AG6A 1RVFL 1NCIA 1NJ9B 3BN9C 5KSAB 3BN3B 3WN5C 3DKHA 4HF5H 1YEJH 5KYYB 2K8MA 4Z7WB 5KZCB 2Z7UA 4F33A 3RDTC 1MRCH 1FE8L 4NS0A 4P3CL 5AAWA 5FM5O 4O51B 4LEXH 4PJXA 2XQYK 1LILA 4OSUL 4LU5H 3JVGA 2ZXEB 2WZ5A 3MR9B 4JFSA 5IROD 3O2DA 3PWJB 2QADC 4M00A 5GS0C 1P9MC 4K3JH 1MCCA 4TTDD 4YHNA 1CFTA 4RGMB 2V4LA 4YHOH 3WJMA 2EYSA 3LN5A 2WLHA 4YC2B 4DEPC 1UWXK 1YMMB 1OZUA 4PRNB 1D2OA 2BRRH 3Q2NA 4PJEA 4PVMA 4MCZA 3PUCA 3QIWB 4QTFA 2WN2A 4OF3A 4YJZL 4CSTA 4M4RB 3GO1H 3X2QB 1OANA 4NERA 2ZG3A 4ONOA 1YECL 5I71B 3G6JB 3BXNA 4UDUA 3L3DB 4PB9L 5E99H 3F58L 1NC4B 2WLNA 4XCFH 3SE4A 3MX0A 4HV8B 2EYRB 1I3RA 1RZ7H 4HIJB 4ERSH 3VQMA 1PEZA 1U36A 1WA1X 4Z95H 4F2FA 5EA0L 2ZSWB 1GOHA 2E9BA 3JYCA 4KH9A 5ILTL 3RWEA 3QUZC 4XXWC 3VWJD 1I75A 4BELD 2R0ZH 1XGRA 4XNYH 5EIIG 5F3FA 1JHKL 2DQDH 3S35H 1J5CA 2FT6A 5JDJA 3JTSB 2DI7A 2XN9A 3BP7B 5DHVH 2ZCHH 5CN1A 4Q4IA 4LSTH 1OTSC 3H3PL 4HFWA 3KVQA 2WKLA 3DOHA 3VDAA 3W5NA 3ARVA 1U3ZA 4CC4C 1AD0A 3D48R 1FRGH 1E3FA 2XBDA 2ZWKA 1S7VB 1SDDB 4F9PA 4ELME 2MTPA 2LVCA 1NC2B 2YD8A 3RQ3A 1BLIA 2KLTA 3JZYA 3RPIB 3NG5A 4R3SB 3RY5A 1EJ8A 1EHNA 4OGAC 1CYGA 1UZ6F 2ED8A 3GLEA 3U7WL 1VGEH 1EMTH 4BYHA 4WDIA 3JXAA 4BWUA 2KZKA 5JIDA 2JI3A 3FU8A 3KXFB 3NK3A 5BVJA 5IVNA 3DHPA 1THCA 3ARPA 1F1AA 3NDYE 1HHHA 3OKOA 1PW3A 2IPTL 1QFHA 4FF9A 4L5FH 4JPSA 1VADA 2GFBA 3UL4A 4F91B 5HVFB 2YUXA 2XVGA 3TA3C 1W6LA 4HQQH 3SSGA 2QBWA 3LN4B 1XX9C 1KCSL 3TGXA 2BVUA 3MRHB 3LH2H 5C0ND 1KIQB 2DWEB 3TBTB 5AOKA 3BZEB 1TQVA 2GTZA 3GMLA 4LRIC 4OZIB 4J5VA 4N86A 3B3IB 4ESKA 1D5MB 1G7LA 3GNMH 1UD3A 5A6IA 2IH3B 4P2QB 2XWDA 2HT2D 2X9WA 3S34H 4AGNA 4DT2A 1L7IL 2UZXA 3ZE0F 3MCLH 3G6DH 4K7PL 1KJ3L 2APSA 3E8UH 3F6JA 4JHWL 3TCLA 1X7TA 4CC4A 3P0VL 3OLEA 3QI9D 2LLGA 3VXSB 5J1SC 1LDSA 2AMUA 3MXWH 3BUBA 3T2LA 3ROLA 3ULVC 3SKOA 2AEOA 3B9AA 5AAPA 3VWKA 1UENA 2ZYIA 1M56B 3E6FB 1NCNA 2CWRA 2HG5A 1GY1A 3LXBA 4HX1B 4UT9L 5DC2A 1P4BH 5F1KC 4U1HB 1D7FA 4WW1B 4PJFB 2OP4L 1C5DB 1VFOA 3C5ZD 5CWSB 3P4OB 2BS71 3MLUH 1A6PA 1KJ3H 3E8UL 1X6LA 3LZLA 3FPXA 3WTVA 1JGDB 2G2RB 2LVEA 3UERA 1F3RB 3O3DA 3P54A 4UQEA 1X5GA 4JFDB 2F19H 3IKCA 1HDMA 1VHPA 3STBA 2IMMA 3R06A 4IOSD 3ZE0B 4D8PB 5DYOB 5LNEA 1FNLA 1EXGA 1TQCB 3KPLA 4UIMA 5DRWA 4K7PY 3V7MA 3FF8A 3V5DA 4CVZB 1VGEL 4PJXE 5DQ9B 5E0QA 4GKLA 4Z0BL 3T4AA 2QR0B 2XX0A 4F7EA 3DI2B 1UUSA 2KPNA 5D7LE 2Z6FA 5AVRB 5D4QA 5ADOL 3ULVD 2GK0B 3QUYD 5B7EA 2B0SH 4Z77B 4MCYA 5BZZA 3O2WH 5LKNA 3D30A 1ZS2A 1IC4L 4P57B 4HUXB 2QQKL 4UM8B 4PMFA 1GYCA 1FF5A 1KWGA 3KPSE 3F83A 4XVTL 2NNFA 1KY7A 4ZUVB 3D9AH 2HT2C 2NY0C 3OGOE 5EUOE 1X9QA 3ARBC 4RMUA 5E2WH 1WLHA 4KGJA 1UZ8B 4TN9A 4PRBB 4U6TA 1I3VA 3MV7E 4P2RA 1FHGA 1NTDA 2L3BA 1DO6A 4NQCE 4QOKB 1PPIA 1NCWL 1IGJB 4XPFL 4E36A 3R1GH 1C08B 1HN1A 2HH0L 5F72S 1KZQA 3JTTA 2C3VA 1E6JH 2YKKA 3HZVA 3K6DA 3QZOA 3FO9B 5AZ2H 4TUKL 4N87A 4YSTA 1B4RA 2VDKB 2YQGA 3BZFB 5ENWA 5T3XH 4CC1A 1MW1A 4I18A 3U4EA 1FH5H 4PJFA 3SKNB 5DQDH 2J88L 4AX3A 1KLFA 3GKWL 4YHIB 2X4SA 4HPYL 4PJ8C 2XXFA 3ASOB 4AYDC 3BQUD 4G8EB 4Y5YA 4B41A 1QZNA 3FRPB 1MHPL 3U6XA 3GSNH 3QUXB 4OBRA 3EJSA 2MCPH 2OI9B 2UY7A 1EO8H 1GGCH 5AB1A 4Z3EA 4MXWL 5LLIC 1W6WA 4XZUB 1MEXL 4WK4B 1NCCL 3DA0A 3ETSA 1FORL 4GO6B 1C1EH 1KYUA 1H5BA 1R3JA 4H8WC 4IRSD 4MAYD 3ZHKA 4OJDH 2BRRL 3DJZA 3UO8B 5BJTA 5AYTA 4JPVL 2O30A 4YN3A 4IBWA 4X99A 5CEYB 2FNWA 2G75B 1G6RA 3OAYK 3IJEA 7CGTA 4MD4B 5BQ7B 5B1AB 2Z92B 2XKNB 3DLQR 4FQJL 3D6GA 1EVTC 5DD6A 4H25A 1YNTA 3TZVD 2Y24A 1ZCRA 2IFGA 5MEOA 2VM9A 4QRUB 3F62A 1RHHB 2CJUL 3T0VA 1QO3A 2ZOTA 4AM0B 4UV4H 5KSUB 3D39E 4XMWA 1RJCA 4FNLL 3L3OC 4Z7VE 3FFDB 4WI9A 3B9KC 3EJCA 5B1CA 4HGKC 1Q72L 3SO3C 4JZOB 3GUFA 5E8NA 2K4WA 3P9WB 4Z0XB 5G55A 4DPRA 4ZMWA 5CCGE 3L3JB 4RMQA 5EOCL 4N8CL 4QGYA 5B39A 3T65A 1XVSA 5T3XE 2J7LA 2JKRM 5HYSG 2WINA 2DZEA 4ZUTB 1E8WA 2GUOA 2VMFA 1ES0A 2R4RL 3GSXA 4ZQKA 4HWEH 5GS1B 1GGIH 1KCRL 1PQZB 1X5FA 2AJVL 1Q9WB 3F00A 3OWEA 5DZOA 2OCJA 4J3XA 3MUY1 3NCFB 5GPRA 3ATEA 5ENWB 1DLFH 2XV2A 1N3NB 1YMHB 4FYTA 3VGFA 2Y23A 4A63A 1R3KA 5I1KH 3ZRFC 1OO2A 4BSVB 1T0MB 4JRXB 4TXVB 5HJDA 2A9CA 1DQIA 4PAZA 2XCMC 2Y9RT 2WVVA 2IQAA 3AXLA 4HVBA 2WVSA 4HWZA 4OV6F 5IVZA 1TT6A 3WTUA 1YHPA 4WCYL 3P3YA 1OF0A 1R24A 4YBLC 4J6IA 2NYKA 1FL6B 3L6FB 1IFGA 3TEYA 4NZTL 4Q6IA 2OSYA 4Y4FC 1A25A 3L4CA 4FG6C 5L4MA 4L4TE 4HLZG 4C56E 1EGJH 1QSFD 2PF6A 2XTSA 5BS0E 5HYJE 3HNSL 1YEGL 3MLRL 1O5DT 5BMFL 2DWXA 4AQ1B 3O0LA 4W4OA 2BW5A 5C0GA 4HXBL 1JYXA 1ZDQA 4JKPL 4CMHB 2XYBA 3PQYA 1MCBA 5ECGA 4Z0XA 1E0OB 3I50H 4NQCA 4S0TD 1G6VK 3A3YB 5TF0A 3DGGB 4HA1A 2UZIL 5DZNA 1T22A 1A7OH 2QHRH 4RMSA 4F7MA 3SDYL 3GSQB 1OSZA 2XN9E 3HR6A 1SN0A 1HE7A 4WWNA 3U4KA 1NKOA 2EEDA 2X89D 4NAMA 3CFJB 3U2IA 4W9JC 5LGJB 3HB3B 4XO8A 3VG9C 4DHLA 5EC2A 4DP7X 2NUTA 3VD3A 3O8XD 5J1AB 4IHOB 4RLDA 3U4EB 3TIDB 1H3XA 1XH0A 2NY2D 4FLSA 1M53A 1BMZA 1AHWC 3VFWB 4OZHB 2NR6A 2C9PA 1S8DB 1U3HA 2IV8A 4HWBA 2F5BL 5EWIH 4RMTA 3OJDA 5BMFH 3BVXA 2CBPA 5GZOD 1BD2E 2VR5A 2PYED 3IWUA 3SJVB 3L6FA 2MNWA 4HU8A 5DJXA 2I9LB 2I07A 4M93B 4PJIB 1JZ6A 4HALA 7PAZA 3OLIA 5I66B 3INUL 4YHPA 1F3JB 4Z76A 1RIUH 1QHPA 3EBAA 5HDRA 2P43B 2OMNA 4WEUD 1PYWB 4GQZA 2F2HA 2AEPL 4KVNH 3Q1EA 1MJ8L 5INCB 3TO2A 2Q2LA 4M1CD 4UM9A 1J8RA 2R0LL 3QJFA 1CMOA 4WWKC 2VQ4A 3WMQA 2IH8A 3IWVA 4F1SA 3WDJA 4NUJA 3NSFA 1I8UA 2GSIA 3D3VE 4CRPA 1N6QH 2K78A 4JVPA 3QCVH 4NI6A 4OF5A 5FIEA 4F2MB 1TSRA 2B7DT 3TN0B 3EDEA 3U1PA 3HOGA 5B1KA 5AB0A 1YN6A 5D1ZD 3EH4B 3VCLB 4GJTB 3PWPD 4ZFZB 4OM1H 2ENQA 3A67H 4XMKL 2WXPA 4GW5A 4N6RB 1DR9A 1L0YA 1CK0L 1KTRL 4U1MA 3FQUB 4YAQA 4XB3A 1PZCA 3MV9A 5C09B 3UJJL 4BZ1A 4OCSH 1T5KA 2CKBA 3SDAA 4MNHB 4ELKA 1E42A 3N9GL 2OL3B 4ZFGH 1F8TH 1RULL 1VERA 4HSAC 1GGBH 1HH6A 2E9IA 3GJEA 1A4KA 4S1QH 2CU9A 3LKQB 3WFDL 5DSCB 5FDWA 1DQDL 5KVDH 3A5VA 3B7SA 3UMNA 2F5AL 2DJSA 3LHAA 3RIFF 1M6OB 3SPGA 1O5PA 3MRPB 3DUSA 2KZ1B 4P48A 1AIFB 1UD5A 2BIOA 1HC1A 4M1GL 1IZJA 4JCMA 3DBXB 1VA9A 3L3IB 1WIOA 1A6ZA 3Q44A 4JFEB 4JPIA 4UAHA 4L9LB 1CDUA 3BKCL 2VDKH 1YUHB 4RDQG 3VFWA 3O6FA 3X13B 3HZMB 3M7FB 1TYJA 2TRYA 3IGKA 3LXCA 2IPUK 1ACYL 2HX7A 3EFDL 5B4MD 5EF0A 1FFPB 4AYFB 5I18L 1Z9LA 1JE6A 2D8KA 1QLEB 4R7NA 2IH3A 2YD5A 3OGCA 4N1EA 4HWBH 4Y9BA 1BFVH 3HLAA 5F6HJ 1NUNB 1S9KC 3DX4A 5T3XD 4NGHH 2R0KL 2OS7A 1HL5A 3MRGA 3B5GA 3LNHA 4JFFB 4QXTA 4E42B 3DRQB 4U2YA 3LSOA 2ZX7A 2VDRL 5DQJB 2BP8A 3TYGH 3VFTB 3IS1X 5GGVY 3L1EA 5L4IA 2LU4A 3O6KL 2W9DL 2DYSB 1K5WA 1Q38A 2X4TA 4GRWF 4NWTL 3VFPB 4X5WA 1JZ7A 3H9YA 1EJ6A 4Y5VB 5F6HI 4AC4A 4N68A 2GTWB 5F2FA 3L54A 3K2UH 1EFXD 1RZIB 4M1DH 4FA8A 3LXAA 2FCBA 1RUKH 5D2LB 3ZZSA 2V8LA 4BA8A 5LCVH 3P30H 4I3RH 3VAEA 3U1QA 3R1GL 5BPPA 1SXAA 4CN4A 3V4UH 2PWEA 3HI5H 4KXDA 4C47A 3QG7H 1V7ML 2I27N 4R90H 4DF9A 3W38A 3BQUC 3C9NB 5AVUB 4GSQA 4S1SH 5EO1B 3KYNB 2Q3ZA 2G4GA 4JZJC 4KFMA 1R19A 3CFKA 1UB5A 1BYPA 3FOMA 5AVYB 2FEJA 2SEBA 2PCYA 1N5YH 3FULA 1G9MC 5DHVA 1D9KB 3CFDA 3DI3B 3IDGB 2DIEA 3F04A 1PZAA 3SB3A 2YD3A 4G8FA 2VDPL 3KPSA 4XMXA 4PS4L 4QRQB 1OM3H 3EF7A 1IM9D 2ZYHA 2JE8A 2OKMA 3L7EB 3QA3B 1CIUA 4WAFA 2NTSP 1A5FH 2C4FT 2C9UA 4NOFA 3WKQA 1E90A 3HUJE 2V17L 2VMJA 3MCYA 3TZVC 5ICZA 2XWCA 1S9VA 2ZIDA 3LN5B 2B59B 5IVXB 5IBLD 2EP6A 2ZUUA 3UBXA 3UOAB 2JJWA 3UTTD 4DVBA 1QWUA 3D51A 2Y1ZA 2QVIA 4YDNA 3W3BA 3AREA 2PP9A 2QVTA 4IKIA 5DR5L 5L6YL 2F54D 5DQJA 2QFRA 1QBMH 4PN6A 2VW4A 4JDVA 2XC8A 5HHVL 3OQRA 2GITB 4KV5F 5GSRA 4KJPD 4P05A 1M7XA 5I1IL 3BD3A 3MLWH 3FFOA 5IW6A 2BINA 1Z9SB 1A0QL 3JWNG 4LSUH 3RWJB 1KNOA 4LIQE 1CYWA 1OK8A 4GG8B 2J4WH 3U0PB 2HWZH 5GSVB 1EEYB 2L7EA 4TNWK 1IEBB 4QI3A 1ZA3A 1DBAL 2BNRB 2YHGA 2E75C 5DHMC 1UWEL 1RK7A 2CGZA 4HCRH 3U83A 3ARSA 3RIKA 3VU1A 5DC9B 1PVHA 1N64L 1L6ZA 1OT1A 4X50A 4LNRB 3RNKA 4ETQB 3FONB 2BZCA 5PCYA 2YRLA 1YEJL 4JZNB 1OAYL 1JHLH 5BVJB 3ARBA 3ML9A 3H4FA 5ICXA 3ETBJ 4C54A 3ML8A 3A6BH 1KCUL 1YY9D 2WXLA 3H9SE 3HHSA 4JCLA 3IE4A 4R0LA 5ESAA 1YLBB 1UM4L 5KN5B 1FG2B 2FO8A 5F9JB 1PZDA 1ORSB 4HCFA 4RRPG 4JHWH 2E27L 3LMJH 5D7IB 3QO0A 1J0ZA 4UT6A 5I1GL 5L9DL 2G0LA 1U8NA 3IAPA 4KKLD 3A67L 1R46A 4EZJA 3PPSA 1CLYH 1LO5A 2NT0A 3DJSA 3QG7L 3CQQA 4LLVA 4WFEE 5GZNC 3Q3GA 5EN2B 5A16A 1T1YA 4U4IA 1J9RA 3G08A 3DK0A 1T6VN 3VI4E 5T3ZL 5D2NE 3C5ZA 1SOSA 3BSZL 4NO0D 1MPAL 1ES0B 1PJWA 4Z7UE 3LRHA 2FUQA 2WXHA 3TH3T 2B0SL 3V0DA 2QKIA 4C56D 4M8QA 4EUPA 1CDCA 2HKFH 3MLSL 3LIZA 4M1CC 2DPKA 4YDMA 4ABUA 3B2XA 4BSVA 4B9JA 2P8LB 1BQSA 1E65A 4BQ8A 3ME0A 5GRZA