2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords O-GlcNAcase nagJ
publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
2OZNA 3GHPA 3UL4A 3KCPA 2XDHA 5K39A 2CCLA 1ANUA 5G5DA 2BM3A 4U3SA 2ZF9A 1ZV9A 2VN5A 4UYQA 4IU3A 4WKZB 3KCPB 1OHZA 2VN6A 2W1NA 4FL4B 2JH2A 4IU2A 3L8QA 4N2OA 4DH2A 5LXVA 5AOZA 4WI0A 1AOHA 3F2LA 1G1KA 3FNKA 4UMSA 2Y3NA 4FL4C 4UYPA 1QZNA 2VO8A 1TYJA 3BWZA 2B59A 2O4EA
chains in the Genus database with same CATH superfamily
1FFPA 3GPSA 3FU8A 2YZ1A 2WCGA 5C0CB 3V5DB 1PLBA 2QQNH 2D4DA 4P3WA 1WFUA 4X6BB 1SJHB 1T7ZA 4UT9L 2LT9A 1TLMA 4BCZA 2OYPA 5EIIG 3SE9H 3VXRE 4Y1AD 2CO2A 2P5WA 3GSVB 1KEMH 3OXSB 2Y1ZA 5D9SB 1TCMA 4Z5RA 1ETB1 3L3JB 5ICZB 1WYJA 2AJXL 4W9DC 3J07A 3QO1A 4MCZA 2PCXA 1NCWH 2X7LB 3DNKA 5HTSA 3T8XA 1LMKA 4U1JA 3WS3A 4W9EC 4XWOC 2CGRL 2XQBH 4HG4J 5E99L 4L0ZA 1RJLA 1T04B 1LE5B 2DLIA 4TQPA 5E8OB 4TS6A 3EJCA 3JWNE 3II3A 3ISWA 3KPOB 2FEEI 3FU9A 2Z31D 1P7QA 1QSFD 3VTMA 1N5AB 3GZQA 2N1KA 1JDAA 2B5IC 3FO0L 3O45A 4P46B 4WI0A 5F21B 4CADB 1KGJA 5BV7B 3EYVA 5DJCB 5F9AC 2QQLH 3WTYA 3ARPA 5DJAA 3RTQA 1BMWA 2XKNA 3UBFA 2Q8BL 4EMZA 2P5WB 2WMPA 4MLSA 1QBBA 1XD0A 2VXTH 4FQHA 2WIIA 5GGUA 1OM9A 3MZGB 3PDGA 1C7TA 1AI1H 4ZSOE 4RH4A 1DVZA 1QR1A 4QXUL 2ESVE 3MLSL 5MHSD 3D87B 3PAUA 2EDHA 1IGJA 1RJLB 2LOEA 2CZNA 2PCPB 4FNLH 2ITDA 4G8IA 4NZRH 1B4JL 3CFKA 3F7PC 2O61A 3ABKB 4XNMB 3DRTB 4D0CB 2FT7A 1GJWA 2VWEE 5GGQH 1FNHA 3KGSA 1SDYA 5C0BB 2AEIT 1BZ9A 3F7YA 5D4HA 5HGBA 2OMXB 1JF5A 4B6ZA 4L18A 1UZ6E 5DD6B 2CDGA 3BAIA 3G5YA 5HD8C 1X3DA 1UWXH 3LZQA 2XNAA 2OJEB 1DQJB 3REVA 5EBMB 4CSTA 3CFCH 1DBMH 2O72A 4GBXC 3LNIA 4OCMC 3EYVB 3E38A 4BWUA 2VZSA 3CUPA 3VGAC 4G70B 4NQEB 4XHJD 2V8MA 5TDPB 2DBLL 1JGLH 2WMPB 1T5XB 4X80H 4BZ1L 3QORD 3GF8A 3RPKA 3MR9B 4P99A 1E8WA 2A9DA 3GSNH 4IRZH 5EN2B 4RDBA 4MDRA 2G30A 3US9A 3ZDWA 2EUWA 1QR1B 4LHJB 2BW4A 3B3IB 4XP4H 5DFTA 2V5YA 3MCG1 2WXIA 3HAEH 3MRLB 4JFUA 4DOHB 4ZOAA 3O4OC 4JKPH 1HT6A 4HIQA 5G2NA 4BK5C 5HHMD 4L1BA 5HGBB 3IGKA 2XWEA 1MRDL 2EE6A 1KTKE 2GCYA 3G5YB 1ORQB 1S9XA 1YEHH 2CBTA 4NUQA 4UAOC 1RZPA 3MROA 3REVB 2ZX7A 3GSUA 1A0QH 4XPFL 1BF5A 5IQMA 5MEND 5A2IH 4S10A 4YHIB 2KZBA 2NY6D 4K23H 4DP1X 1CDYA 3GSQA 2CLZA 4PJDB 3EG9B 4QRSB 1AGDA 4MJ5A 4L8SA 4Z95L 4OUUB 1L9MA 4U3HA 3UGXA 5F7HA 2G2RA 3IJEA 5D8JL 5TDNA 1JE6A 1JGEA 3NT0A 3PWUB 4O2EB 3SZKC 1RUKL 3CXHK 1J88A 1OQOA 4Y2OA 4PJAA 2CHDA 3MRNA 1IAOB 2WLMA 1NBZA 3L4CA 1FL3B 5IHBA 5BVPL 1A6ZA 2QGEA 1U8MA 3C12A 2X3BA 2ZXDA 4PJFA 2F53D 3M17A 2IGTA 2WQRA 2NY2D 2ICWA 3CSFA 4XRCB 1HXMA 1M3JA 1QRKA 4WI4A 3PQYA 2WINB 2XWJB 4ZD3H 1SY6A 2AV7A 2IVFC 4G1MA 4P2OD 4XN8A 3MROB 2VZUA 3C08H 5K9OB 5C0AA 1IM3D 2V7HA 1FFNA 5GRXG 4B5ZA 1U95A 3UYPB 3CK0L 3L2LA 4FQXA 1OO2A 3ARDB 3K5SA 1MLCA 4NJ9L 4NFBA 3RDTB 1MWAH 1ZY9A 3HC0A 4KKAD 4G5ZH 3VWKD 3WXWL 4ETYA 3G9VA 1R19A 2HJKA 4ELME 3ARSA 4QRPB 1NCUA 1HNFA 3N50A 1J1OH 3MV01 3PP3H 5ALBL 2HFGL 3ZHFA 1NBZB 4EI0A 4PV9A 2DQDH 2WBWB 1UJ3C 3QDJE 3QWQB 2Z0BA 3DO3A 4Q6IB 1QWHA 1U8MB 1HAWA 3VRLE 1YMHB 5I1CL 4AJYV 1LM8V 4GI8A 1AC6A 1YHPA 3QR0A 2F61A 1RURL 3MQIA 4K94C 4P2RD 5AYUH 2VC2L 3OLGA 3EH1A 3FFDB 4FCAA 1YY8A 3BAJA 5IM7B 3WFZA 2B59B 3QEQA 4ZX5A 3L54A 4CU8A 4FNPA 5D5MB 1U95B 4FKEA 3U7WL 3VXTA 3QIUA 3SQBB 4ZTPL 1XGPB 4MNQD 3RVUD 3TT1L 2LTQB 1U8NA 3W5MA 3CSGA 2KLSA 4GS7B 4HFWB 4MMYA 3JVGC 1LGVA 1BOYA 3B8YA 3QO0B 5IVXE 1PEWA 2HJKB 3IFPB 1OPOA 3FQ1A 2GFBB 3MCLL 3NESA 4GQZA 1BQHB 4JPIB 2BHFA 4YZFF 2X4QA 1C12A 1EGJH 4N22A 5EDSA 1A9EB 1P5UA 3BAYA 2PETA 3F64A 4PV9B 3SE3A 5JTWA 1MJ8L 5FYKE 4HC1L 1FBIH 1V3LA 3GM0A 3TFKC 1OE2A 5JDSA 4PTUA 1QLEH 4MYPA 2JJSC 3VXUB 2ODIA 1NMBL 3WGVB 5IQNA 2EKJA 4C4BA 1JK9B 1ZV2A 2VDNB 3ILEA 1KLUA 2NY5L 4BFFA 3KWWB 4J27A 1SM3H 4BZ2A 2EDBA 2B16A 3IGFA 2J25A 2JKJA 3N1FC 3WSQH 2O6FA 3LMJL 9PCYA 5L7XL 1DUZB 3CDZA 3SD2A 3I75B 4A6YL 4IBTA 1U8NB 4KXBA 2VLKD 4EZLA 5EN3A 1EAOA 3C5SB 3KYNA 3H55A 4HIHA 1NOLA 3U46A 1F4XH 5I1IL 2AJVH 2BP0A 2BIHA 4L4JA 4WKZB 2X4QB 5D7JB 1UXMA 2Z31A 1FZJB 4GT7A 3HB3D 1GCYA 1WSST 4ZG1A 2BMKB 5JDSB 4PTUB 1E4XL 2AJ3A 3BH9A 1P4IH 1TCRA 1CXEA 1MQKH 4XPGH 1QZNA 1KGUA 2WSDA 4Y1AB 1JSYA 1PAZA 4OQTL 5E2TL 5JW3H 1PTZA 2DIJA 3RKDC 5IHUL 1V27A 4Y9CA 1B3JA 1F3JA 2VZVA 5L4IA 5TF1H 4C83A 4M5ZL 1NFAA 1KF9B 5IJBC 3SYPA 2Q2LA 3CE1A 1YEKH 2FQFA 4QRBA 4QRRE 2PTTA 1KCUL 1LQSR 4NWTH 3CDZB 4FXTA 1CT8B 3DJZA 3IDIA 4H25A 1I75A 5ECJE 3SYCA 1UWEH 1D6VH 1IKOP 5KYXA 1FHNA 4ADIA 1AD9B 1VEPA 2FO8A 4QMEA 5F72S 1N4XH 2RJMA 3BC9A 2EEAA 4JZJB 1H6UA 1TJGL 2ORBH 3Q44A 4HIIB 3VD2A 3NCYS 3QZOA 4L5FE 3RI5F 1QSFB 3QZWA 4PGJA 4Z76B 3T2LA 4LDEB 2E9BA 4OJYA 5FUZH 4DFIA 2X0WA 1KLGA 3N41F 5LAXA 4UQCA 3WNOA 2YAQA 4P59L 5E1AA 3D33A 4WK0B 1D9KA 2V7NA 4HKBA 2UZYB 3B6SB 1HEZA 4AGMA 1MXGA 1NLBH 3RY5A 1J0IA 5CJXA 3N55A 2Z92B 1VGEH 1NMCB 5BPPA 3ATAA 2VH5L 1A4KB 3WAKA 3VDCA 3T0WA 1UENA 1J1XL 2XN1A 1K5NA 4LVOB 4AH2B 4OCSH 1HI6B 1OARL 2YPLD 4UMGA 1UM6L 3OG4B 1UKQA 1MELA 2AW2A 1UXSA 3II1A 1WCBB 4FGMA 1PD6A 1H8NA 5TDOA 3WEXB 5HVFB 4QWWC 5GZOD 4QXWA 1BJMA 2NQDA 5K5YA 2NRDA 3DOSA 4FKHA 4OD3H 1T0NB 4M6OH 1DEDA 1DN0B 4YDLC 1KLGB 3CMOH 4UBDC 1HEJC 5B1JA 2O5ZH 15C8L 3MRRA 1Z3GL 5D7IF 2YLKA 4KJQD 2V7NB 1NDGA 3QORB 3RFZC 3SODB 2R2CA 1NKGA 1OT1A 4OCXH 3REWA 1XGUA 5F89A 2WBJC 4LHUG 1VCAA 2BVQB 4I18B 3EO1B 4WO4C 1VERA 4O51A 2OMTA 4MNGE 4XCNA 3HHSA 4AGQA 4E0RB 2QKIA 1O75A 5FOJA 3WDJA 1I9EA 5HHMB 1O6TA 2F53A 3M8OH 1JI2A 1SJEA 2D9CA 1JZEA 2R15A 1MLBB 4NFCA 5FV2A 4E41D 5KSBB 1IC5L 2DBJA 3B34A 3FCSA 3EJSA 5DJ6B 4DGIL 5ID0A 2XZZA 4P2OA 4XP1H 1WC7A 2BC4A 3Q8BA 5MENB 1F11A 1IM3A 4KI5E 4Z7UB 1RIVL 2AXGA 2HLFD 5HVWA 4ONHA 1C08A 3HZMB 4XPHL 5BUPA 2UWEE 3LDBC 5KOMC 4ZO8A 3PGDA 4M7ZC 5SX4I 5ADOH 2X12A 1UZ8A 1HYRC 2FH6A 2HG5B 3BO8A 5FHBL 1KGXA 5GISH 1NPUA 4R83A 1K85A 5HI4C 2ZWYA 1PY4A 2P49B 4MCYB 1JK8A 1ETJA 2V5SA 3K6IA 3B5TA 5IWLC 5C08E 4LBEA 4M3JA 4ZUTB 5TQ0L 2YIHA 3OB8A 4EZMA 4ZYKA 5CBAB 4I0CC 4P3DB 1KTDA 4KO9A 3QH3B 4J23A 4YFDB 1OHQA 3M86A 4YS4A 3TO4A 2YOCA 1HOCA 1SJEB 4HBCH 3IT8D 1FNGA 2B7DT 4BD4A 4UM8B 2ZX9A 3M7FB 4E68A 1MCRA 4Q8BA 1LD9A 3DUUA 3DX8B 5FFGA 2A9MH 2XA3A 1JV5A 3K6DA 2R4RL 2X6CA 3NZ8B 4WJ5A 4QRAA 4YX2H 3VWKB 4FFVD 4OZHA 3KH4A 3ZYZA 1EO5A 4GKLA 3PDOB 4J3XA 2UY6A 1EJFA 3D69B 3H9SE 4HHGA 5EB9A 4S1RH 4OBSA 5AB9A 2YR3A 2XFXA 1XGTB 3B9EA 3LRHA 5D2NE 4BIKA 3T04D 5IVOA 3ZRCC 1RZJL 1F00I 4NNXB 4H13C 1ZDQA 1EO8L 3D2UD 1NGWA 2I60H 4W68A 3EOTH 3W9DA 3AITA 1RQ5A 3MTRA 3T65B 1N68A 3IJSA 3VB9A 4NZTH 4OM1H 3PV6B 4PJGB 1SXSA 3MA7A 4ANWA 4ZMWA 1RZ7L 4P2RB 3J27A 4IBZA 1F0LA 2D7NA 3NTCH 4LIQE 1MHCB 2D2OA 4KX9A 4F7TB 1T7VA 5CKAA 1AHKA 1RUMH 4WLCA 1K5WA 1CXKA 4MXQD 1F4AA 3GPEA 4IRSB 4WEMB 5IV2A 3IK2A 5FB8B 2IANA 2A74C 1V7MH 5EBWA 5H94A 1HHKA 1MAKA 5FS5A 2Y6TE 4X6CB 2NY1D 3HC4H 2NNRA 4MNQB 2GW5A 4CC4C 1BF2A 3MRQA 5DJZA 5TK2A 2VLKA 2YC1B 5F7BA 2BCMA 3S35X 5FGBA 3T4YB 4D0BB 2VR5A 4XBPA 3MLXL 2WTPA 2XLLA 1AS6A 4M1GH 5I74C 3SCMD 5FO7B 5GJTH 3DX7A 4OZIA 5BO1H 2M1KA 1ZD6A 4KO7A 2CCWA 3WNNA 3FCGA 4WCYH 4JKKA 3OKEB 3WO3B 4PVNA 1D5BA 2Z1KA 2GIXA 2RIKA 4JHWL 5EIIB 4ZX3A 4PH8A 3O8XD 3LZRA 3ZQ9A 3A6CL 4CGTA 2H2SD 3V6OC 1ZT7A 3WDHA 2XZCH 3QPXH 4N2BA 3ZLQC 3MLPA 4OT1L 4P2CG 2NY0B 4OLXH 3S96B 5H94B 2Y7QA 2ZOUA 4KUZH 5D1XE 1SYVA 3Q3GA 4YQXH 3TBYA 1JYVA 1ZV9A 4DP2X 2XC8A 4KH9A 1ZIAA 5DLML 2X4PA 4PJXE 2ARJA 3EUUA 2DWYA 5JA8B 3MACH 4J3BA 2HP4A 5CGYD 1IC7L 5FYLH 2QPSA 4Z18A 2MOGA 5IW6A 1E6OL 5K1NA 3U7AA 4XBPB 4DVRH 3WS6C 3A21A 2DN7A 1KCSH 2Z65C 4IIQA 3C9NB 5I1HL 1AIFA 1RCYA 3NJMA 1ZSHA 2WNWA 1MQ8A 2R69L 1GS6X 1HILA 3HB3B 4JG1H 3TX4A 5ACZB 2CE6A 3CVIL 1LDPH 4HWBL 3NIGB 4P5TC 1BVOA 3FB5A 2DQFB 4Y2DC 2FX9L 1IKFH 4ZX4A 3W0WA 3IMUA 1ZT7B 4ZFFB 1LEKB 2H0PA 2M83A 4POZC 2FX7H 3UTQA 2D9QB 2BVYA 2H1PL 5C07D 4QUOA 4PRPB 5DJ8B 1KJ2L 5F9OH 2J8UE 3VFWB 3FQUA 3G6JB 4GLRI 4Q9RL 5BQ7A 2ARJB 4G72B 3HS0C 3CSYB 4NQQA 2VDLH 4U3XA 3C8KB 3GXNA 4JZOA 5E2WL 5H37A 3RRQA 4PJ9D 1WWBX 5B7EA 1UH2A 3F7VA 4NFDA 1BIHA 1X5AA 5G4OA 3UTSE 4OIIH 5AD0A 3WTUA 2P47B 4IIQB 5SWZD 3CX5K 3O0LA 1C16A 2ZSWB 3VXMD 1JFQH 2C7FA 1CFNA 1HSBB 5DRZA 2F19H 2IDCA 2H32H 4LF3A 4HIXH 4P5MA 1VZGA 4NGHH 3D0LA 4MJ4A 3N44F 1JHKL 5ISZD 2Y1AA 1MWAA 1TKWB 3GUTA 3MRKA 1G6RL 1ZLUH 3C5ZA 5T1JA 2WKOF 1FAIL 3D1MC 3OG6B 4HWNA 2OZ4L 3O3UN 4R7NA 1Q72L 3RVXD 5A2CA 4PP2A 2C9VA 3UTZB 4BFKA 3CCHA 1SOXA 1P84J 1DQTA 1WZMA 5DEFB 5KZCB 1AQ8A 1I7TB 4H0LC 2GSIA 5BVJB 2DJ4A 2VXVH 3FQWB 4HV8A 2MNWA 5KVEE 4Z3JA 2EZ0C 1KXHA 5SX5K 2YPLB 4KMLB 4XBEL 3EF7A 5JR1H 1E2VA 1BLIA 3HKFA 1VEMA 3U0WL 4YHYB 3GMLB 4Y4KB 4TV3A 2R4SL 4PJEF 2OULB 4LF3B 1GZPA 2W9LA 4OGAC 1GGCL 3WKPA 5KYYA 3MBEB 3N0AA 3X1NA 4L9DA 4ABVA 4X6FA 3OHXC 4HS3A 3TH4T 5FGCE 1T66D 2X4OA 1MFDH 4YUEH 1R5VA 5AFAA 3V4UL 4N24A 4ZZKA 1A2YA 4FJ6A 3OPZH 5DEJA 3S35H 2A4EA 2NYYC 3QA3B 5D6DA 3X3FL 2ITCB 3K5RA 1JPFA 3LN4B 3OR6A 4W6WB 4TQEL 2JB5H 3ESOA 4AL8H 5IB1B 1JGUH 3EGSA 1EK3A 1TO5A 2X87A 4LP4A 4HV8B 3K71A 1XBRA 4IBQA 5HDQL 1RMFL 1CLVA 3ZY7A 4LFHG 3SQOL 3NIFF 3PWLA 1SYSA 3OKOB 4UNVA 1HINL 4E41B 4R7LA 3ML8A 3V9FA 1T4WA 4XT1C 3T09A 2ZUYA 1GZPB 3O11A 2VDPH 4OZFH 3KR3H 1FYTE 5CP7A 5JXAL 3O2DH 3IWVA 4RMBA 3NEOA 5EU7C 3VGGA 2VLRD 2X4OB 3EJZC 4JDEA 4RFNB 3MUZ1 2X44D 1PKQA 5G4MA 3QCUL 3QARA 4Q52A 4G6KH 1OWWA 3QXUA 3KDMB 1AG0A 1BVZA 2PCFB 2YAPA 3EGSB 4GKOA 5A2FA 1DJZA 1PKOA 3BXNA 4NO3A 2AEPH 1KIRA 5DFAA 1CDGA 5ITFA 2C34A 3LS4L 2NZ1A 3QC5X 2AQRA 5IROD 2G0KA 1N7ML 3MSPA 3Q05A 5D2LB 5KVFL 5AOZA 3VGFA 3INUL 2Y0SA 3VSTA 1R17A 2AK4E 3ZQWA 4BE5A 5DI8B 4IKKA 3O11B 1ONQB 3TS8A 2XG5A 5T1MB 4HD5A 3SPGA 3AG4B 3FO9A 1TG8A 3FONB 3GI9L 2P9RA 4YSCA 3ULUL 1JZJA 3I50H 2CDFA 4JM4H 4TPRH 5BZWA 3EXJA 1CF8L 1HOEA 4AQ8A 4HF5L 2F58H 1BVLB 4HJGB 4WEEA 3X3GL 2IDUA 2W38A 2KDGA 4E9WA 4QNPE 5LGJB 1UXLA 2W0FA 5AVQB 3S3PA 1O7DE 1MUJA 3D2UB 3BXNB 3SCMA 4DEPB 1OWRM 3MV7E 2WN2A 3DYMA 4JQIL 1I1YB 1KXTB 2XU9A 1SEQL 1RZQA 1Q1PA 4XMVA 4DCQA 5D7KE 1E6JL 4OLZL 1IILE 1C8QA 1LHZA 3MYZA 2Y2YA 2VAJA 1FFRA 1M53A 3SDDC 4M6NH 3DSFL 2MOVA 3O8XA 3PYCA 2OR7A 4I7ZC 3PL6D 2YHGA 1HZHL 1JBJA 2Y1YA 1JRHL 1YNTF 2Y36L 3CZEA 5DRWA 3K46A 2BCKB 4H8PA 4MAYC 3P9MA 5CZVL 3LPWA 2NY1B 4ZUUB 4YBLB 4LPWA 1J9CT 3P30L 1X5MA 6FABL 4JR9L 2J7LA 1MG2C 4N6RA 3OKKB 3X13A 2EDTA 4AM0A 4NQCD 3OWRA 4ZUVB 1FI8C 1GSMA 1B3IA 5E8NB 1PZSA 2MCPH 1PU0A 2XKSA 3GI8L 4OKVA 1W91A 2IG2L 1ORSA 1L9OA 1HIML 1BMGA 4O00A 2KERA 1T4KB 1S7UB 1HZLA 3FAXA 1I8IB 1Q94B 2H6PB 4LCWE 3RNKA 2LFEA 3VVWA 5IVXB 1BFVL 2R1YB 4I0PA 3ES6A 1COBA 1AH1A 1CE1L 1CB4A 2C26A 4V11A 2FH8A 5DO8A 1B4TA 1SY6L 2Q2EB 3NJHA 4DP0X 1RHHB 2PR4H 2WY3B 4CILA 2PO6D 5MERA 5C07A 3TBTA 5J12C 1V10A 2AGJH 1CTOA 2XWBA 3PWVA 4JFHD 5JDJA 5IB5A 4MQXC 1DBJL 2EUVA 4KC3B 4B3EA 2HAZA 5T5FH 3JV4A 3X13B 3W5NA 1GGIL 4AM0B 3B5HA 4YFLF 4XCCL 3WNLA 5JHDB 1MCFA 4OW6A 4TL4A 4GRLA 1KC5H 2RTTA 3Q8CA 4BRVA 3UXFA 1O7SA 1AVAA 3D39D 3AY4C 3LPPA 1BFOA 1Q9OB 1OALA 4WUUE 5DGQA 2XI9A 4EDWL 3BQVA 5J56B 2XN9A 4G59C 4H88H 1K8DA 1YEGL 1EO7A 1JVKA 4IM8A 4KHXH 3WFCH 4AVHA 3GBLA 3J2PA 4WHYG 5EOCH 3QULA 1WZ1L 5HGDB 3T6WA 2E6PA 2NZ9C 2A2QT 3FU3A 4YXKH 3T0EC 5IQ7L 1WT5C 3AABA 3UZEC 4KXDA 2X4SB 3OGCA 5IVZA 1HJBC 1S7WA 3TA3B 1U92A 4BSVA 4L3CA 3UCRA 3WKQA 1BM7A 5C0EA 5JNYA 4CMMA 3B4NA 3IGAB 5C07B 4P9ML 3NABL 4Z7NB 3KEHA 5BRZD 4HUXB 1U8KB 3T3PE 4G8GD 4NRYB 3PV7A 4X6EB 4YSTA 4PJ9B 4EN3A 5ES4B 4YEEA 3V0VA 1Z9OA 4LRIA 3AT9A 3OAYK 1KELL 5SWZB 4JFQB 1DQQB 1RUAL 1XCQB 1YMMD 3CFEA 1DVUA 3VXMB 1J8KA 2W9EH 3I9IA 4GSXA 4Y19D 5T1DH 4N90D 1IEAB 4M7JL 3VFTA 3IJHA 3GLDA 4YGVA 5ISZB 3QYMA 4ZFZB 3LKNA 1I3VA 1LK2A 4OU3A 3ZGHA 4X42A 1OT4A 4XP9H 4BSWA 3C6LD 1INEL 1MI5B 1O9ZA 4N0CC 3HNTL 1A6TA 5AL8A 2FB4H 4NEHB 2D4FA 3OGCB 3TN0B 4BSVB 4ZJ9A 3QWOB 4NWUL 4CMMB 3G9AB 4LHUB 4WW2A 4BZ2L 3GMRB 3T3MB 4R2GC 1ODAA 4AIZA 1YECL 3O6FA 4PY7A 4AJ0A 1JNNH 1UWGH 5E7FA 1BZ7B 1I9RL 1E4WH 2F5BL 1GJUA 2BHZA 2Y06H 5EC1A 1MNUH 4LFHD 4U1LB 1EWHA 2OMZA 2FL5B 3VJ6B 1SHXA 3DX9B 5DRXB 3UACA 5IQLA 4M7KL 4HK3J 3MRGA 1I1FA 5EEVA 4PWKA 5AW8B 3RTQC 4YGVB 2F1BA 3MGTB 4FXKA 2HJFA 3WFBH 5B3JE 1N12A 3PREA 1GVIA 4JFFA 4D3CL 4E5XA 2H3KA 1J9QA 5HI5C 3ZL4L 5AVXB 1RKRA 2ZUVA 1EAJA 2CKBA 3P0GB 2IH3B 3NEXA 1ZHKA 3APMA 1UKSA 2Z34A 3D85D 1RLWA 3KNBA 1CYGA 4U1GB 4WW2B 3LXBA 1G4RA 3VD3A 2QEJA 1UZ6F 4EI5A 5EF3A 2BFVH 2W88A 1SXBA 4PY7B 1ETZA 3W39B 3ARBB 2QHLA 1HXYA 4KVPA 5C0JA 1EDYA 1HCYA 4K3DL 5A2JH 5IROA 4RGNB 1YEDA 4WTWA 1B0IA 3ARVA 3RWIB 3KYAA 1INQB 3DHMA 2Q0ZX 4IJ3B 5GRVK 4EXPX 3DX1A 1U3HB 4AE0A 5I15L 1DSFL 4E9VA 1JZFA 3FB6B 1GYVA 3HKZA 4PW4A 4U6TA 4BSJA 4P8QA 1E9PA 2VO8A 3BSZL 4K8RC 4OCYH 2QADD 1YQVH 3PHOB 4HJTA 4OB5H 2KYIA 4RMSA 4ONFL 2VLRB 4NPYB 1JPEA 1DJSA 3CFTA 2NSQA 5LWYH 1JZIA 2P3YA 4XOEA 3IETA 3FTVA 1MCBA 2Z6FA 2A6DB 5F1OB 2AJUL 3MNWA 4J3OF 2HX9A 3MHZA 4X6DA 3KNBB 3WTWA 1KXVC 3CVDA 3D6GA 3B43A 1ID2A 2C4FU 5DQDH 2P8LB 5EFIA 4APQD 2CG9X 3AWEA 3EO9H 4FFZH 1U8CB 3QXDA 4NO2A 1RSYA 3WIAA 4YGAB 5F0LB 1LK3L 4TKWA 2R2HB 4OZGA 1I7ZB 2K8QA 3VXSD 3S5YA 4KJYB 4LP8A 1ASPA 1KJ3H 2BOBA 3PL6A 1GJIA 3V55A 1L0XA 1QI3A 3DV6A 4YIQB 5JIIA 5DC2A 5CJQL 4WF7A 3O41B 1HJCA 3WENA 3ARDC 5EZIH 3HG1D 4DK5A 2BSDA 4L8SC 1D5IH 2D0HA 3TGXA 3ZYOA 4PJBF 3AY2A 1CFTB 1JUFA 4HKXB 3SKNA 3ZDZB 5CUSL 4PBVC 2C3GA 2A99A 5D1ZD 4YR6B 3RL1B 3EBIA 4DGYH 5KYWB 1QHQA 3C8DA 3TYFA 4TSBL 2WWKO 5FM4A 4PY8J 2EO9A 5FWQA 3C87A 4NO2B 4AYDC 5J1AB 4WAFA 3NRPA 4FFYL 4APXB 3HLAB 5D1QB 2ZG3A 4ODSH 2BNRD 5CGTA 3BI9X 4JO3L 3N06B 2IH1B 4OZGB 2HMID 3PE9A 4OF0A 2WZAA 4YH6A 1KN4L 4KK6C 4PG9B 5DJ0B 2E7MA 3RI5K 3DTUB 2W5PA 5I71C 3VD4A 3CVBA 3QUXA 5JW5B 1VADB 1YRKA 3K2MC 1FVCB 1IGTB 2G75A 3DV6B 4IOIB 4JY6B 1ULVA 5H4ZA 4YPJA 1YUHB 1QPXA 1WWAX 2PO6A 4FQXC 1X5ZA 2JV6A 2ZCLH 1OSPH 5CM1A 3SJVE 5L2KA 1T1WB 4ELMF 3L1GA 1CBVL 5CLTA 4GS7C 4RISL 1AE6H 1VB9A 1HHIA 2Q7YB 2DWDB 2J1XA 1G7IA 2Q7NA 3RIAF 5A43C 4WHDA 4NQXA 4NQCB 5T33H 2QQKL 1XL6A 1DBAL 1A6UL 3VFNA 1Q1JL 4FXGA 4TUOA 3TP4A 3OR7B 2XBZA 1QRNE 3E2HB 2XXCB 4ENEC 2QQNL 3T9WA 1S7QA 3H9ZA 1PZCA 4ZOCA 3SE9L 2WZ0A 1KEML 4X7SH 1QVOB 1F90H 3UADA 4J3UA 1FFOA 5F7FA 4I3SH 4AJVA 3EADA 1DE4A 4GAYA 1NCWL 3QIUC 3NA9H 4RWYH 1YEFH 4TVPD 3TNNA 2GITB 5KBPA 3PLYA 2XQBL 3P2BA 2I7SA 3F04A 5FA4A 5BS0B 2UVEA 2UZIH 4HGWA 4PJIF 4QRRB 1K72A 2XHNA 3RA7H 3V6FA 3MGOA 2CJTA 1P5UC 1UOWA 3VFNB 3ZIYA 3SE3C 1GL4B 3AU0A 4AENB 4G80A 1IBBA 4MDIA 4NQVA 3D39B 1IIIA 3IXAB 4Y19A 4UANA 3O2DA 3SEPA 1WD8A 3I6GA 1ZE3H 4QOKD 1G7MA 2QQLL 4EDXB 1OM3H 4NZDA 3AG3B 2DZEA 4GG6A 3C6LA 2VXTL 2YFNA 3GHEH 3F7QA 2WTRA 4N3TA 3VFUA 4G9DB 1DQIA 3T0VA 1S9VB 1AI1L 3BISA 3FQNA 1DE4B 1K6QH 2HVKA 5FFLA 2WZ6A 3AAZB 4N8VG 1ID5I 2X3CA 2CJUH 4FNLL 3UG4A 5BRZB 3CTTA 4NZRL 4G8GB 1HN1A 3EJTA 5B38G 1VZHA 4XCYA 3P11H 1PDKB 5FA4B 4LVNC 5GGQL 4KDWA 3VCLB 3B9KD 1GKOA 4XR8C 5F0PB 1JZ4A 4NUJA 2Z31C 1CCZA 1KBGH 3N2JA 1YMMB 4G8EB 1YNKH 4G80B 1RZKH 1URLA 1YZZA 4R3SB 3CFCL 1DBML 3LPGA 3NCJH 4IKIA 4M4RA 1IC4H 2N4IA 1F1DA 3FBQA 1JGLL 4X80L 3KPMA 1NFDF 3L3DB 1BAGA 4P4KA 2QHRH 1XF3A 4ZUWB 4IRZL 3GSNL 1JJUA 1T1YB 3PJLA 5IR1A 1WIPA 1I4FA 5EF0A 2IOMA 4K0OA 3FTZA 4XNYH 4AE1A 4M6MH 2VDKH 3PP4H 1I9JH 4XP4L 3NCYP 3ISRA 4JVUA 5CJBA 3BDBA 1G7QB 2Q7AA 2QPDB 4MD5A 1CI5A 5KSVB 5KSUA 5BZDB 4JKPL 1KIPB 3ATBA 4JFED 2O6CA 3LRMA 4UINH 5EZLB 1NC2D 4OFIA 1DVXA 4WWKB 3QFDA 4NUJB 5FCUH 1QOKA 4KK9D 5J6GA 5F88A 4TM9A 5FR3A 1C5DA 3PABA 4MNGB 1ETA1 1YEHL 2BY1A 4GW5A 2AHIA 3UMTA 2QL1A 3KGTA 3HCVA 1A0QL 2P5ED 2D31B 4YXLH 4XHJC 4W9GC 1D9KC 3TBWB 3BEVB 3ULVH 1JHLH 4K23L 1MFBH 3SOTA 1TZIA 3KPMB 4O5LH 4XMTA 1PQZB 3SIKA 5CJXC 3CBJB 2PYFA 5F9WB 2YD7A 4NP9A 3ZDYB 3DRQB 3LH2H 3D08A 3L9RB 5C0FB 3AJ7A 3D85B 4HJJH 5LGHH 5DUBA 3NPSB 3SY6A 3LN9A 4APQA 4N4YB 2WBKA 3OAZK 5FKAA 1AR1D 1QD0A 4GMTH 3UYRL 1JPGB 1PAMA 4LCUB 1UKTA 3BZDA 4NBXB 3VXSA 1YSOA 5EU4A 4ZD3L 5J6GB 3WO4B 1FG2B 2EIJB 2FWSA 3ULUE 3U4AA 4LL9A 3C08L 1F41A 1NC4D 4PJHF 2NY6C 5B1JC 2V5TA 1NGQH 2WWNA 4MDJA 3HG1A 3KH3A 4XO4A 3O9WB 4F2EA 1MWAL 4N86A 1ND0A 4G5ZL 4WFFE 2CBOA 1MOEA 4UDUA 2PYFB 4HU8A 2RR3A 5D1ZA 1DJYA 5J13C 3CC1A 1DSWA 3FRPG 3L17A 5CNHA 2AMUA 1J1OL 3KE0A 3SKMA 1EERB 3GXPA 1YCSA 4M93B 4PMEA 4XNUH 4APQB 3ZVVA 2DQDL 2QKIC 3IXTA 1VACB 4A66A 4GPVA 4KROB 1JZ3A 4QHMA 2NY2C 4BFOA 1TNMA 5FF6A 4ZS6C 2QPFA 5CN1A 4ABQA 2F54B 3DUSB 2YQBA 4F37K 4YVNA 4MS8D 5AYUL 4P2OC 3SE4A 2ZXBA 1TNNA 1R3HA 2G9KA 3IE9A 2OA9A 4OCRH 4UNUA 3OMAB 2VM3A 4GKNA 5I1DB 2A73A 4I89A 3CPLB 2ZOOA 5I1JH 3W9EB 4GRWH 5IJVA 1OCRB 2HFFA 2H1LM 2WYZA 1YYLH 3LEXA 2YD0A 1VGKB 2ICCA 1GY1A 3MUGB 2WLLA 3BRFA 4AT6B 4JDVB 4MVBD 3O4LB 1PYWB 4MB1A 3UTTE 4P5KB 1EGJL 2MNJB 2XV6B 4FYQA 5KJ4A 5EUOF 5IB2A 5JW4N 4CRPA 2IDQA 4HLZH 4B27A 3QEUA 7PAZA 5C92A 3KS0J 1R24B 3E8VA 1OAKH 1FBIL 3TO4C 1QLEL 1S9YB 3LVTA 4U1NB 2BNRB 3LKQB 1XCTA 3KS0H 4TOYH 2CRZA 4GW4B 4CW1A 3QB7C 2OYMA 3MRFA 2OXGB 5B8CB 1SM3L 2EDJA 3WSQL 3BVXA 3EJYD 3RVUC 4KDTA 1L5GB 1EFQA 3MJ7B 1L7TH 2BRRH 3I9PA 1EJ8A 1DVFB 4QTHA 3OKMA 1F4XL 1FG9C 3NJGA 2AJVL 5J6HB 2AJZB 4Q2ZA 4J3VA 3HZKA 4LOEA 5C9JB 4JO4H 5K9JH 2PF6A 3BHBB 1FFTB 5EBGA 5FIEA 3HMWH 2VDMH 3P9LA 4QOKA 1P4IL 1XCTB 5SWSE 1MQKL 1VFAB 4RCAA 3CZKA 4XPGL 2UUDK 4MA1C 5DWUH 2ROXA 2KT6A 3JWOH 4HHAB 5JW3L 3L3IA 4U31A 4KKLD 1IBYA 1J5IA 1UATA 3LKRA 3R0MA 4S11A 4CW1B 3BDXA 2EKSB 3CXHJ 5GJSH 2WSPA 4QHPA 5F7EH 5TF1L 5C2UB 1OTUD 1UZGA 4LOUD 4DUWA 3UYOD 1YEKL 3OHMB 5CGBA 2BNUB 4NWTL 5LBVA 4WK2B 1M71A 2YZ8A 1YNLH 3ME0B 1Y1UA 3IAPA 4L4TD 3ZSTA 5FGBC 5BOZG 1UWEL 1D6VL 3WY2A 1W16A 2Y22A 1D7DA 5L0QB 1N4XL 2F18A 3MA9H 2MCMA 3UJJH 2ORBL 5IUCA 2EDXA 1Z9NA 2R29H 3HB3C 1HTYA 2Z64C 4W70A 1P5VB 5FUZL 5EZOH 2H9GA 1J0JA 1M3IA 2WOYA 3P9LB 1CO1A 3OF6A 3FTXA 1KT2B 4OCWH 2R39A 1IBGH 1NLBL 5J1TC 4G8FA 4LLYA 3IMSA 1OGSA 4TNEA 1NLDH 1KTLA 1ZSDB 3O6LH 4AIXA 1MN4A 1PFOA 1VGEL 3CDGB 1HQRB 4Y5VB 1TSRA 5EU3A 3U83A 5F7NC 3EFOA 1GW0A 1F02I 4L37B 1WCQA 5E1GA 5HHOE 4CMHB 4AC4A 4YHKH 4HEPA 1OE3A 3QZPA 1TENA 3JZ7A 2A5UA 4OCSL 4KITB 4IIQC 5JPNA 2P45B 3B9KB 1UT1A 3N43F 4LEOA 4RDQF 4Z0XA 2VR7A 4ZOBA 1OAXH 4PWIA 3OC5A 4OD3L 3EUDA 4BV1A 4M6OL 4Q4IA 4H8VA 1E28A 3CMOL 4ZI8A 3MRBA 4DVBA 4BFNA 4AGPA 3BN9D 2O5ZL 3LH9A 5AVYB 4UAHA 3CN0A 1HCFX 2F9BT 3Q13A 4PRHA 4ZFOL 2J8UF 4MKMA 4W4OA 4R97B 5HHPA 3IVKA 3VFRA 3UEZA 1LYQA 1CXIA 2J5LB 2HRPH 4OCXL 4UT6H 3S6CA 5G55A 2PTVA 3U6XS 5CSZA 5KTEH 2X28A 3IWUA 1ZA6A 1KYAA 4WV1A 4X0KA 2D2CC 4YZWA 5GS0H 2IOIA 1BVKA 2BXYA 5FO9A 5GS1B 1ECYA 1IAKB 1CDJA 3RZWA 3SY0A 4EVNB 3IDGA 1HHHA 1M7UA 4JFEB 3QJFB 4Y16D 3AWFA 3M8OL 5FUCE 1NC2B 5ERWA 5DJXA 4AQ1A 2IAMB 4WK4B 3C60B 3ZX1A 2R7EB 4G7YH 4ODWB 1G9MH 4XP1L 2VLJE 4GY4A 4F58H 1KYDA 2P5EB 5JO5A 3L3OB 4YN3A 1LNUA 4JKMA 2IMMA 3C5ZC 4KJQC 3TJEH 1T5WB 1IGFH 5KBNC 2W95A 5JXED 5ADOL 5DVOA 2X40A 2VIRB 2WXFA 4MGXA 4B60A 2LVEA 4PJ7F 5GISL 2XZAH 5L6YH 1SJXA 4WV1B 3MX0A 3AUVA 1JTOA 2XPYA 3FOMB 2DLTA 1L9RA 5KSAD 3H3KA 2NOYA 3OMIB 3Q2NA 5BQDA 2PWFA 1DQMH 3N41B 3VXOA 1LP9B 4CA4A 4KH2A 4V1DD 1AR1B 4RZKA 5D7IA 4NIYE 1W72B 2ZKHH 1MFVA 3MOBH 4HBCL 4YE4H 4N0UB 3U1PA 4POYA 3FFCD 4EQ3A 1K3IA 4Y88A 3ZE0B 4OFYA 2ADGA 1SFHA 1R5WA 1ESOA 1NC4B 2HLFC 2V2TB 2A9ML 3CFBA 2XN0A 4N85A 4BRJA 2GJJA 4N2FA 2ICEA 4A7SA 2GBVA 2BVPB 4JFSA 3OXRB 2OJ1A 4XOBA 2BS71 4YX2L 3U9UA 4PI0A 5IHZB 5D6DC 1BGXH 1OF2A 2A77H 1JRHI 1Q9WA 4OD2B 4S1RL 4B0MB 4Z7WE 1V5JA 5CO1A 3FW6A 3VXNB 1WUZA 1AZRA 4H8HA 4ALAC 4C58B 2APSA 2NXZD 3T77A 3IKCA 2I60L 3HJ0A 1S9KC 1BQRA 3EOTL 5T3XD 2Z4QB 1IBHA 1MIMH 4M8RA 4NZTL 4OM1L 2V9UA 1TQBB 5ESVA 3EH4B 3NTCL 3KL3A 1OTTD 2TSBA 1RUML 4OKDA 1K4CB 5CBEA 2CIIB 4WGVB 3IFOA 1A66A 4ORGA 1V7ML 2NZIA 2X6AA 4Z1PA 1IFGA 2WXKA 2NCEA 6PAZA 3HC4L 4MNHA 1F8TH 1OTSD 3KPQA 5E8PA 2HX8A 2ICWI 4JRYE 4TULH 3V4LA 4RA0C 5D72H 1DUYA 1TTBA 2OLDA 2WQSA 4NXKA 4DEPC 3D4CA 4M1GL 3FTGA 2Y4SA 4K5MA 1XL4A 1JPSH 5GJTL 1E8ZA 5FYJD 5LKNA 5BO1L 5SV3A 1K4DB 3KYOA 3K6SB 1HHJA 4WCYL 4OIFA 2YD6A 3IBEA 1R3KB 2V8LA 4DKAA 1P1ZA 3ZTJH 4NQDA 1NKOA 5IHLB 4L9LB 1UUSA 4DESA 2XZCL 2JH2A 3CVHB 3QPXL 3GXMA 2I24N 5I1EH 3FTYA 5J8OA 5DJDB 3IF1A 4OLXL 4KUZL 3UBXA 5F7DA 4GOSA 4YQXL 3UEQA 2OQJB 3I84A 3JWNH 1S4IA 1X44A 1FE8H 1IBZA 3NDZE 3MACL 1W8OA 5FYLL 2R2EB 1UB5B 4LESA 3TIDB 1SMDA 4NKOA 4AQ8C 2D7TH 3Q0HA 1GTFA 4DVRL 2ATAA 1GW6A 5HDBE 1CLZH 1M42A 1KCSL 2JIXD 3SCMC 1RU9H 1TZHA 2E56A 4XP6H 2EIKB 1PZDA 3CC5A 1OV8A 4JG1L 2GJRA 2G5UA 1ED3B 3LN5A 3QNYA 4RAUA 2NY3C 4GSUA 4XBGA 1LDPL 1WH0A 5IBUG 3O8XC 1O7VA 5I6LA 4PTTB 2H2SC 3QEGH 1IKFL 1XAUA 2CNZA 2WVVB 5F7LB 3GSWA 3KBPA 1Q9LA 5ID1A 4I85A 1QHOA 3I2CH 2FX7L 2O5XH 4XMUA 2YMTA 1T6WA 4AV5A 5F9OL 4L29A 4N8VB 3DBXB 3U0PB 2VDLL 4L4TB 3MLWH 4LPXA 4Y9BA 5AB1A 5B38B 3P73B 4MRCA 3N40P 4YE0A 1JL8A 4OIIL 5D7LB 1DJWA 1GC1H 4RAHA 3V7AE 2UYLA 1JP5A 1TZHB 2W60A 1JFQL 3Q9QA 3D0VA 3CC5B 2F19L 4WDIA 4HIXL 4NGHL 2VDQB 3WIHA 4FKKA 5I5IA 1NDMA 5BMFH 4RMWA 4MXVF 4I0PC 2YAFA 4N1EA 2ZCKH 1RP9A 4U4BA 2WVUA 1A02N 1NFIB 2SODB 1U58A 3GSWB 2RA1A 1Q9LB 1UM4H 2R9HD 5DJ2B 2DQUH 1DHKA 4OF7A 3U6RA 3CXFA 2OFQA 3NFPB 4W93A 2HYMA 5I1AA 1NCGA 5DLLA 4HWZB 4LB8A 1HL8A 2VXVL 3M1OA 1T0MA 1DBKH 4C57C 3PF2A 5CIPA 4R4BA 2E7DA 5IBLC 2JELH 1P4LB 5FUOH 5HYSA 4Y16A 5JR1L 1T22A 2XTJE 3TZVB 1XFPA 4GRLC 1S9WA 1EHNA 3L3GA 2BNQD 4QTFA 4ZTEA 5DQ9B 4CVWA 1NJ9A 4Z7OF 4QDGA 5L4FA 4TTDD 2VISB 1WFOA 3MO1A 4YUEL 1MFDL 1TLKA 2DRUA 3K74B 5JXEA 3LD8B 3HE6D 3OPZL 3QG7H 3S35L 3T3PF 4LL4A 2E0PA 2ZPKH 3SDXB 3IRPX 1A6PA 3M1BA 1QLRA 3FRPA 2JB5L 1ZLEA 1J8HE 4NENA 4AL8L 4GKSA 4PJCE 5KSAA 1JGUL 1LE9B 2XACC 3MFFA 3DO7B 1T6VN 2HN7B 3BP6B 4EN3C 1BWMA 4I2XB 4V1DA 1BYNA 4D2NA 3GB7A 4LRIC 2HT2D 3JYBA 1CC3A 1DQKA 1FJ1B 2DDQH 3ZTNH 4UQBA 3FFCA 1QW8A 2HJLB 1S3RA 3MU3A 2QPUA 1WE5A 1MFUA 2VDPL 3WU1A 5CLZA 4JPVH 3KR3L 4PBWD 4Q7DA 4S2SA 3O2DL 4K7PY 1T66C 1UOKA 1A7QH 4X99B 1QEWB 2YRBA 3PGFH 4J1UA 5C2BH 4BE6A 2X1XR 2NW3B 1U93A 2CSPA 3W11D 1WFNA 4HK0A 2NUPA 5GZNA 3H42H 3H9HA 5AB0A 3FRPB 4WW2C 1P2CA 4G6KL 2XPZA 1F97A 5FK9A 3KPTA 3O6FC 4FJZA 3N44B 3UERA 3RIAK 2AEPL 4JAMB 3GB7B 5I2IB 3KW7A 2HTKD 4L4VD 2OP4H 3L6FA 5DO2D 1OGTA 4L3EE 5HY9B 3QS3A 3R4DA 1MHHA 2DYPA 2APTA 2OTUA 2RFXA 4PRID 3FFCB 2I27N 3V4VA 1K2DB 1BF8A 1RFDH 3MV8E 5KN5A 2G3MA 3M46A 4A2FA 3UAJD 4FXKC 3NFSH 3MN8A 5E4IA 3UBHA 1FL6A 3RNQA 3D25B 2X09A 2YQGA 4QHNB 2V2WA 2Y7SA 3KG5A 3LCYA 4KKQA 3I50L 1HH6B 3FCBA 4TPRL 4JM4L 4U1IB 4Y4FD 3VFMB 2Q87A 2YA0A 3CX5J 4PJEB 4HSAC 2R29A 4P05A 1E4HA 2F58L 5DK0B 1KB5A 1TIUA 1TYJA 4EI5C 2NXZB 4OJCA 2JKIS 4OFPA 2P8MB 2BP8A 2ZXAA 1U6AH 3GSRB 8FABB 4HVBA 3MRDB 3GDCA 2O5NA 4TQIA 4WSGA 5IROC 4B9KC 1OGTB 4PRDB 4MJ6B 4R9HA 1N2RB 1MHHB 5C3TA 1KTCA 2DB8A 3BP7A 3S2AA 4M6NL 2VXQH 3EZ8A 5EC2B 3DDFA 1T6BX 3D3VD 3V5KB 2ZNWA 3VD5A 5D4QA 3MLTB 2NXYB 5KUMA 4JFXB 5AW9B 3TEUA 4WI3A 1SHWA 3NN8A 4PP1C 5FPIA 4HXBH 4IOFD 2R8SH 3CQFA 1HU8A 4RRPG 2R56H 5E8DH 1C5BH 1V3KA 2FAUA 2R1XB 2VMFA 3KPSD 2MCG1 4YC2C 2E8YA 4KKBC 2PW1B 5JZ7D 3TTSA 2IALA 1BZOA 5CHNA 5SX5H 5AVRB 3E9TA 1MDAA 1ITCA 1OLZA 2MCPL 3QAZC 2JIXA 1B2WH 2WP3T 2B08A 5EPMB 5GGVH 5DZJA 1OP9A 3QXAA 4AK1A 4OM0H 4LT7A 3RWCB 1LO2H 2Q76B 2VDOB 4LSSH 3SO3C 3PL6C 1NKRA 1XBDA 4G1EB 1QSEE 3MTXA 2OAAA 1CG9A 2IQAB 2E27H 2QJDA 5FM5M 3T0AA 3S88H 2ZG1A 3PHQB 1TETH 2PR4L 5ANME 5ILTH 4HIJB 2GBAA 2EE9A 3DJSA 3IPEA 4ODUA 2AGJL 1LWHA 4AEHH 1U91A 5HSFA 2WO3B 3KPRE 1TTRA 3BPNB 5T5FL 1QPKA 4L5FH 4UV7H 4A55A 3VI3B 4G11A 2ZUTA 2DQTH 3MRMA 4HUKB 3VFSB 2JIXB 3SYQA 5C3LD 1KWKA 2OMYA 1VKXB 4TQ8A 3BZEB 1MZZA 1XF4B 1KC5L 3GLZA 3U0TB 5CCJA 2OMVB 1TTAA 3GSXB 4H88L 5F7WC 3ETTA 3QUHA 3NIDB 4KHXL 4RMTA 3WFCL 5EOCL 4MJIE 1FO0H 3QUXC 5TK4A 4QXTA 2Q9OA 3EOYG 1FRGH 4YXKL 3ARQA 1AS7A 2CALA 1CDIA 1WIUA 2PO6C 2Z0UA 4GJTB 1WAEA 4WJKB 3GMPB 2EJ1A 4M61A 1KBBA 1RJYA 5D96C 4HJ0D 2LFGA 4LVHC 3TASA 2VZ1A 2CH8A 3A4EA 2H26A 1FZKA 3RWHA 4O02B 1GXEA 5BCAA 3S36X 4OZ4B 4JVPA 5I9QC 2OMYB 3KLHC 4HYTB 4X5LA 3W37A 5I6MA 1YNTB 2BNQA 2KPNA 2W9EL 4XTRD 5T1DL 3VI4E 1X6LA 3L13A 3A24A 3LRGA 4HIPA 3P40A 4MZ3A 5K39B 3RUGE 4XP9L 5L2JA 4D0DB 2NY4D 5BXFA 1QI5A 3I9GH 4MX7B 1M6OA 4XMKH 3S3BB 5A2KH 2FB4L 1CGXA 4QPEA 4ZMOA 1PD1A 1TTFA 3CDFA 3K8KA 1BG9A 2QV4A 1FVDA 4DP4X 4M61B 4BK8A 1ZHNA 2CGZA 1W15A 4AQAA 1PSKH 3RWHB 1JNNL 1UWGL 2IADA 4QKTA 3LQMA 3NSFA 1E4WL 5LBSA 3KBFA 1OANA 5K33A 2Y06L 5AOLA 5KVMC 1MNUL 2FJHA 1I53A 3S8FB 4FF9A 1EZVX 3JV6B 4MFHA 4C54A 4QF1B 2BNQB 2HUHA 5FO8B 3RGBA 3JV5A 5BOJA 4NN5B 1XO8A 2WXJA 4YDJA 4UTAA 5E94A 3WFBL 2N0MA 3C6LC 3C09B 3VD0A 1RZ8B 4MBRA 4JKNA 1VIWA 3WMQA 1M6OB 2GK0B 5FYKD 3HE6B 4DERA 4YXHH 3KXFD 3HC3H 2PXYD 4F93B 1U8HA 1AHWA 3VXRA 1PZ5B 2OCFD 1BMZA 3HMXH 4X9HA 3VVVA 5AAWA 1EAPA 2BFVL 4PEEA 3QQ4B 3OAUH 3BVTA 5C0IB 4JANB 4UT7H 2KZWA 3S0PA 1U21A 3QDMB 4HS8H 2Z8VC 4GRMB 4WNJA 1EHLH 3QI9A 1H3WM 4QAMB 3T4AB 4NKQB 4F7EA 5D6CA 5A2AA 43C9A 1OPGH 1XIWD 4EUPG 3FUKA 3EDKA 3UAJA 1NTDA 2BS8A 2ICES 3FSZA 4K71C 5IW1B 4OCYL 1FC2D 1L6ZA 1YQVL 4AQEA 4Y89A 4DNLA 4OB5L 4P4KC 1AQDA 1ZWIA 5E9DE 2OL3B 1T83A 4GXUM 4I1NB 3LV3A 5LWYL 3MRPB 3GK8H 1OQXA 4XO8A 5IOPB 3EDJA 1U8HB 4W4NA 1HH9A 3EHBD 4FLSA 5GGSA 3IJ8A 5BRQA 1I8MA 4U1HA 2GIMA 4Y5YB 1K9TA 1TVDA 4A04A 2GTWB 4JS7A 5BZZA 1BD2D 2WB1A 5DQDL 3RZCD 2VR9A 4KBPA 1JV2B 5CEZE 3EO9L 4FFZL 4LIQH 5I1LB 4XO9A 4ZSOA 5C6TH 3FPYA 3VTTA 1A3RH 4L4VB 2VL5A 3SPVA 2ESVA 4HCRH 3JSSA 3U4EA 1E8YA 1XZ0B 4PRIB 1XR8B 1KTRL 5AOMA 5I76A 43C9B 1KJ3L 3D3VA 4HKZB 5LCVA 2WZ5A 2A6KA 1JNHA 3VH8G 2QADC 3ARED 3WTTA 1P7BA 1QHPA 1KCKA 4LMQE 5EZIL 3H54A 1A1MB 1F18A 1WBYA 3I74A 4AYID 3UO1H 1D5IL 3ZO0A 1X6NA 4Y4FB 5TGBB 4KKRA 4TVSa 3S36H 1ZT1B 2FJGB 2WWOA 4DGYL 4H0GA 2ENSA 1HH9B 3D9AH 2AQSA 1UB6A 1M1XA 4N5UA 4U1HB 4APQC 4S0HA 1VF5C 3OAYH 2E7LC 2IPUG 1BX2B 5FGRA 3TC9A 4RGOH 3GDBA 4NLAA 4L1TA 2BP3A 3ULUF 4ODSL 2DY2A 3VFPB 3SYOA 3GZPA 3U4EB 2IGLA 4KDVA 1QP1A 5DCCA 1E9OB 3EFFB 3G5ZB 4FNQA 2E5EA 5HD8D 2OBGA 1MCDA 1VAHA 2HKHH 4IRJD 3BDYH 5I0YA 4J4PA 4KJPC 1TXKA 1LDSA 2ZCLL 1OSPL 1S7RB 5MEQA 2OX5A 3G6AA 5ESAB 1AE6L 2JLPA 3KPSB 1NCCH 2GBTA 4QHUA 5D1ZC 5KS9E 3FSWA 1FNLA 35C8H 1Q9KA 3UPRB 5GGRA 5T33L 1H6EA 3CSBA 2F6AA 2PW2B 3SKJH 4EN2A 5JOPD 4WFHD 4IU3B 3LRSB 3BUBA 4FL4C 4JG0H 2ZAGA 3ZDXE 1E9QB 1PJ9A 2YD8A 1IQWH 5ENWB 3QG6A 3FB7A 3F6JA 1L0PA 4AVIA 5F96H 5LBGA 1ADWA 1KDJA 3IDXH 1ROWA 2ZE0A 3SE4C 5I1GH 5IBUB 1S8DA 2BK8A 4X7SL 3ABGA 5EF1A 2HCZX 5IFJA 1F90L 4RNRA 2FTAA 4XN5A 4QJ5B 5HYJD 5DK3A 4I3SL 2HKFH 5CZKA 2IGFH 2IPUK 5E1QA 1U30A 4FZ8H 3NA9L 4RWYL 1YEFL 4HCFA 2J4WH 4IMLB 1JMXA 2C3HA 4MJ2A 5HP5A 4EJ1C 5DQJB 4F7PA 2Q1EA 1BZ8A 4FABH 2RB8A 2UZIL 5BZXA 3RA7L 5LHDA 1QO3B 4AXWA 4F80A 4WFEE 3BPCB 4XXDB 4ZPTA 4NCDA 4PPTA 5IMOB 1VENA 3JTTB 1ES0A 4JM2A 4NRZB 4NZUH 5H4YA 2X2JA 4LLMA 3F05A 3LQZA 3PWJB 5AKSA 5JIKA 2VGLM 4ELMA 3II2A 1MAJA 1OM3L 4E42A 3LHPL 1SZNA 2F7OA 3UGEA 3WJMB 4NKDB 4PJBB 3MNVB 2EIEA 3GHEL 3IDMB 1H8OA 3TIEA 3NBNA 3QDJA 4KX8A 5INDB 3APNA 2Y25A 1UD5A 1A25A 5KVEH 1R0AH 3EYSH 4L8BA 3VX0A 1K6QL 4KDTC 3I6KA 4C56E 3TBSA 4M7LH 1U3JA 3B9VA 1X9RA 2CJUL 3MRCA 3RWGA 3V6BR 2UY7B 5IBTH 5GS2H 1NWPA 1B4RA 5IQOA 3P11L 4M7LT 5CP3H 3WIIH 3LKOB 5L0QC 4N8CH 3AC0A 1RZIA 3L95B 4RFEB 3QSKB 4ORZC 5EEYA 1KBGL 5HHNA 1USZA 2F7RA 2VQ1B 3A3YB 1YNKL 3C5JA 1RZKL 2C1OB 1UOVA 2QMKA 4HEME 4XGZA 5M94B 1NPNA 3MLYH 1U2HA 4UIKH 3WFHA 2ZIDA 3NCJL 2V4LA 3B2PA 5CAYB 1H19A 4FEIA 1IC4L 1MDTA 3BEWB 1M9SA 4H7VA 3PJSB 4K73A 4D9LH 4PVMA 2QHRL 3FQXA 4FTVE 3BAEH 3FU5A 5IQ9A 4PJIA 2OTWB 3RB7A 2EDEA 1HE8A 2PXYA 4NYLB 3DGCR 1GH7A 4LHQB 4XNYL 4M6ML 2VDKL 2M26A 3PP4L 4L8BB 1I9JL 2D7QA 2EYTB 4L2YA 4PBDA 3ZKXC 3ZZQA 5F8QC 3MRCB 4I13B 4QGYA 5B39G 1DLFH 4U3SB 1T0PB 3B9KC 3FFOA 4UINL 1BIIA 2M2DA 1GKEA 6TAAA 2VXQA 4KOCA 5FCUL 5HHNB 4LLWA 1T20A 3RKPA 5E5MB 1XIWA 4N2HA 4HZ1A 1C5CH 2DF3A 3MYJB 1EDHA 5IT2H 2FJUB 4YXLL 3GTTA 1T1ZA 1I3GH 3ULVL 5F0MB 1JHLL 3FRUA 1MFBL 1JDDA 2BZDA 3JUYA 4U6XB 1XF1A 4X7FC 4O5LL 1S7VB 3MBXH 5AVVB 4PJIB 5GIRA 4U4IA 4IKLA 4W9IC 1OK0A 4Q0XH 1EJ6A 1RZFH 2FECL 3KXFB 2B20A 2BZ7A 2CLRB 2PXYB 2PWDA 2HWZH 1JCKA 3HW7A 3LH2L 5KVGE 2BW5A 4HJJL 3VXQA 5LGHL 1AD0A 3HTLX 2D3NA 2ZAHA 1M7IB 5EO1A 2UX7A 1OGAE 3U30B 4M5YH 1R3LA 3RWDA 4N9OB 4XPTH 3X1BA 5IJCC 3RZCA 5JPNC 1A1OA 1JHTB 1QUNB 4GMTL 4PU2A 3B9DA 5HGAB 4I5BB 4KK9C 1A6AB 3N40F 2EXTA 2VR8A 2PYEE 2XV3A 2ZOLA 3R1GH 4PLJD 1NAMB 1YAZA 3QHTC 3SBQA 1OIOA 3NK3A 5LNGA 3AREA 3OKLA 1NGQL 3GLAA 1Y7VA 3ZMNA 3QXWA 4NBZB 3E80A 3TCLB 4GYBA 1EVUA 3HN3A 3S7GA 2X6UA 1FAKT 2FSEA 3R06A 5IB3A 1ET5A 1SXZA 1CPUA 3SPHA 4NN6C 3UC2A 1KGCE 4WV1C 4F9LA 1CBJA 2BSTA 3RKDD 4GH7B 3Q2WA 3DX3A 5E6YA 1JTPA 3AS2A 1OSZA 3WD5H 3DOHA 2QVIA 4XNUL 1BD2B 4U7KA 5EO1B 5J5EA 1MREH 1D5XB 1ADQH 1IFHH 1I1AD 2COQA 4JG9A 2LU7A 4Z7WB 2ZP8A 4NN7C 1CGVA 4CC0A 5BO0D 4AQ1C 1FO0A 1NFDB 5CN3A 5C0CE 4MHHI 2FJFB 1VSCA 2F2HA 3L4XA 2HVBA 4YO0A 2DQEH 3GIZH 2V3FA 4OCRL 5T8IA 4TTGA 3AREB 4MSWA 4HDIA 4IRJA 4YSRA 2EUXA 3UTSD 1SF3A 2QT6A 4MTMA 4X0NA 4DGVH 5I1JL 1WWCA 1A7NH 2B5IB 1E30A 4X98B 2VW7A 1G87A 1XH1A 2QZQA 4ACPA 2IDFA 1YYLL 4AV4A 2YGPA 3K2UH 3E3QC 4XVTH 2OTPA 4P4RA 3AQDA 4K55A 3S48A 3GS7A 3V4PA 1DO6A 2APXA 5AKTA 1VFBB 2Y2TA 3CN1A 3CVHH 1NCAH 5HGHB 2CUIA 4XH2A 1G7JB 2W07B 1OAKL 4HCGA 4X8GA 4QYOA 1J7VR 4TOYL 4MS8C 3L4ZA 1PBYA 3CHRA 1QFWM 4IHOB 3ZTCC 2FWUA 2IXQB 4JN2B 1LO5B 2P5WE 1YC8A 1F3RB 5A16A 2DD8H 1KG0B 5HYJA 4PGCA 2OJZH 4IRJB 4WSJA 2L7JA 3PGCA 2NX5B 2ICEC 2JKNA 4M1DH 3T6VA 4N2IA 3ZK0A 4RQQB 4R0LA 3KPNA 1DBBH 2DQCH 1L7TL 2BRRL 4ZW8A 3RX8A 3VGAB 5B3SB 3L7FA 4MVBC 3HR6A 3NJLA 3V4PB 4HH8A 5A6LA 5I6XC 3L1EA 3AT0A 4XNQB 2UWEA 1MCCA 4XH2B 4J3TA 5C0BE 2WBJD 3WIFA 4PJHB 3G5VA 4JO4L 5K9JL 2Q10A 1NMAH 5GRUH 4JFPB 3HMWL 2WD0A 2VDML 4A2HA 4YL9A 1JYWA 2EO1A 5F9JA 3A4FA 4OY9A 1MPAH 5FA3A 5DWUL 5JQIB 1TQSA 3JWOL 4NS0A 1A5FH 4NQEE 5AAMA 4OJFH 1ZVSA 5DZVA 5GJSL 5A16B 3STLA 4K5PA 2IPTH 5F7EL 3O3AB 5ADPH 5HYJB 3LEYH 3IRZA 3LNEA 4UAOB 1YQ2A 4FS0A 4OJAA 4HCIA 2VDQH 2CJSA 3A6OA 3BCFA 4UQ9A 5IMMA 1YNLL 5HHVH 1IIKA 4I4WA 3B7UX 5I8OH 3ILDA 1FYTD 1E0OB 3V0WH 1AFVH 4DOHE 3RGVA 4E9TA 2WCPA 1X5KA 4HXAH 3MA9L 1MFEH 3UJJL 5KBLA 2R29L 3R0NA 5F7UA 4QJ4B 1TZGH 2AKRA 4OVUA 3VW3H 3FO2A 1F5WA 4XCEA 1IFRA 1UM5H 5DMJB 2HLAA 5EU6B 5F1IB 4CVXB 5M95B 2CUAA 3EJJX 2YARA 3Q8AA 4F8OA 1YO4A 3U1SH 1XVSA 5D2NA 1DTUA 3V0GA 3QFJD 4KKLC 1IRAY 3KPLA 4OCWL 4X9IA 3S5LG 2G5BA 1IBGL 1SDAB 1OTUC 1UXWB 2W9DH 1NLDL 4LOUC 1BV8A 2L7QA 3O6LL 4PJDE 2LABA 5DHYA 3SGKA 4J39A 5EUOB 3DX4A 2IEPA 4IK6A 1ZGLB 3D7PA 4RSVA 5K93A 5GSRA 43CAA 4CU6A 1UTDA 3S3SA 2Q3ZA 2FO4A 2JJWA 4GINA 4TNWF 3QNXB 3BZFB 1CN4A 4YHKL 1CGUA 2QGDA 4D8PB 2VKWA 3DROB 4J3SA 4XMPH 3QJOA 3HR5A 3BWAA 1SXCA 1AKJB 3BE1H 2VE6B 4QY8B 5C71A 2BOCB 1OAXL 1U8QB 2QVFB 2CJ3A 3TH3T 4Q9QH 2H1XA 2MQCA 4C47A 5FECB 1OAJA 1G7LB 4TNVK 5F3HB 3MFGB 1BQUA 1RV6X 3NAAH 3TWCH 1UJ3B 2Z8WC 2EEXA 1WBXA 3RDJA 4KY1H 3RY4A 3C2SA 4GXVH 5FW6A 3AUWB 4A38A 4UT6L 1D5ZB 2HRPL 2VL4A 5KTEL 5D7KD 2Z35B 5L8JB 1HESA 1N59B 5GS0L 3WXVH 1IEHA 2NQ3A 3QJXA 1FF5A 4MKTA 4LEEA 2FO4B 4JCMA 4QRPE 1MRFH 3LQAC 3FOLA 1U33A 2CHNA 3HE7D 4HH9A 5D1XA 3IDJB 3MCKA 2DQGH 1J0YA 3HUJB 1RK1A 5AOIA 3KWVA 3VG9C 4G7YL 2XWTA 2YN5A 3X1FA 1G9ML 4EUPB 1H0DB 3F62A 2CM5A 4F58L 3BN9C 3TESA 1QKZH 3QUMH 3WL9A 2IPKA 3TJEL 2HTLD 1SVBA 4MB5A 4AVKA 1IGFL 5D5ME 4DPCX 3DV4B 3SBRA 4RMQA 1DEEA 3IJ9A 5DS8A 3L81A 4LCWD 5CCHE 2XZAL 5L6YL 3EW3B 2DW5A 1LMIA 2KUTA 3ECVA 2B9BA 1DQML 2ERJB 1MH5B 3CHSA 1I1AA 3PHSA 4Y16C 3FQ4A 4OV6F 4TLTA 2ZKHL 3ISYA 3UAEA 3VM7A 3MOBL 4MMXA 3MODH 4YE4L 2J8UA 3V10A 4LCCA 4KKPA 1EIBA 2DL2A 2P26A 3TT3H 2H8PA 1R46A 6CGTA 2ZWLT 1BVNP 2XWTB 4GIAA 3V7MA 3VXUE 1EEYA 2JKSA 1FV1A 3F01A 3CN2A 4J2QA 5FC9A 3VE0A 4BH8A 4F2MB 3VH8B 3UTSA 4P49A 4Z7VF 2WJ7A 4EOWH 3P0VH 4MA3A 1R3JB 4BZ1A 2P24B 2BH0A 5JXEC 2J2ZA 1NDTA 4WU5B 1U2YA 3S3DB 5LN4A 3UPCA 3KMDA 1BGXL 1G9NC 4H1LH 4WUUD 5E1HB 2A77L 5TH2B 3VU2A 3DSNA 3N43B 1CD1A 1A1NB 4JFDD 4BA8A 4TSCH 5KSAC 3DBSA 1UFGA 5L8LB 1KIQB 5T1KB 2K45A 4POZD 3AU1B 3F7KA 2F74A 5DD3H 4MD0B 3P4NB 4LSVH 5C09D 1MIML 4N26A 5GRYA 2EECA 3MRHB 3X17A 4DZBA 5IMLB 1Y6MR 4BDVA 2DJSA 1RPKA 2XV2A 1DN2A 3PPSA 2H8PB 3HZVA 3DLQR 2X4NB 4Y1AE 1FL5A 1SMAA 2AXFA 4AITA 2B4CH 1SDDA 1N0LB 3DECA 4ZT1A 5I0ZA 2LW3A 4MA3B 2W8CA 4BFIB 4XAWH 1SBSH 4KWUA 2WIMA 2PABA 1F8TL 2DKMA 4TULL 3VDAA 3LB6D 1ZLDA 5D72L 2DAVA 5GZNC 3T1FA 4U3CA 5H2BA 4AIOA 2VMEA 2PR9A 4TYUA 2BXZA 2NXZC 4NDMB 4WTZA 1PZ2A 3RQ3A 1G0YR 1FNEB 3QHFH 4AZ8A 3RHWK 1JPSL 4G7QB 1E5BA 2F74B 3JWOC 2MEJB 3UH8A 4U05A 1M56B 1NH6A 1QSFE 1AZBA 2VW6A 2EC9T 2VM9A 5E56A 5IF0B 4I87A 2XV0A 5D1ZI 2ATKA 2FWOB 2FGZA 1TEYA 4PJ7B 2ZTBA 4BH7A 1EEZB 4UM9B 4S0SD 4Z78B 2P8PB 3QDGD 4WU7B 1BBJB 5I1EL 3UBGA 4KFZC 1IEBB 2ZG2A 4UOJA 3U2IA 4YDLB 2XG4B 4QO1A 1ZHLB 2ZKYA 4ODBD 3D34A 3N9GH 2CBMA 2FE0A 3RJOA 1JAEA 1FE8L 4R90H 2E7CA 3MRIA 4M6AA 4JNXA 1FYTA 3OLEA 2EIBA 2D7TL 5TFSH 2OK0H 3RFZB 2VRKA 4A67A 1CLZL 2WXNA 3NCMA 4PRAA 4DZ8B 2KHAA 5CGMA 5JORA 4TL5A 4K3JH 1RU9L 1WZKA 4XP6L 1XB8A 2ALWA 2WBJB 2ZOKA 3HRZA 5F8RC 2DS4A 1E40A 3G04B 3MJ8A 4WO4B 3GHPA 3MVSA 4HMEA 4CVUA 5I8KH 3I3EA 5HHQA 5ICYA 3QFJA 2ADJB 3EDDA 1ML0A 5ESQB 3QEGL 3UCQA 1WTGT 1XV8A 1TMCB 3VQLA 3OJDA 3I2CL 4YAQB 3IJYA 3KBHE 3NDYE 1TYEB 4MMZA 2O5XL 5LCVL 3BP4B 5E95B 4F5CE 4HUWB 4PN6A 2UXGA 3CZGA 2AK4A 5AW0B 3MLWL 5B39A 3EJZD 3HG4A 3LDBB 5AALA 1JZ2A 3VFOA 2G3NA 4M7ZB 4L8CB 1N67A 1GC1L 1LQBC 2VLLB 4YHPA 1M2VB 5HHME 1YJDH 3C6SB 2IWEA 4HC1A 4EPSA 3HRZB 3B2XA 4DP8X 5DK2A 5KSBE 1EHKB 1OZTG 4N2CA 1BXUA 5BMFL 4U1KA 1JZGA 1I9IH 3TNMA 2ZCKL 2SEBB 5CMAA 3WLBB 2YPKA 5MENE 4KV5F 3H9YA 3NCWA 2X5PA 4LSTH 4Z7UE 3MV7A 1UM4L 3EBGA 3NZSA 4D7PA 5GS0C 2DQUL 2X1OA 1HAUA 4S1QH 1EXUA 5EUKB 3ESMA 3BIKB 3LIZH 4HUUA 1RK0B 1E3XA 1OGPA 5CILH 1VDGA 1CFQB 5KG9A 4A6YA 1ADQA 3DKHA 4QD2E 3KWUA 1WTLA 1XGQA 4PR5A 4I88A 1DBKL 1F4YH 4JRXD 5B39B 3I02B 2JELL 1YPZB 2C3VA 3HE7A 5FUOL 3TJHC 5CSBA 1I8KB 3MLRH 4V2BA 2Z91B 4O2CA 5C70A 3HN5A 1XH3A 3T2PA 2WOBA 1LILA 2F53E 3FJTA 4KTDH 3ILPB 3JQOB 3D4GA 2QTVA 1SUHA 4J6IA 4CBZA 1U3YA 4D7BA 2Q3AA 1PIGA 1J05B 1S78D 3L08A 2HFEA 1FZOB 4PV8B 4EZJA 5A40E 1UD2A 2R9HC 2YBRB 3QG7L 3NJIA 3VYNA 1HC1A 1V54B 4GSRA 1PZAA 2ZPKL 2YJQA 2Q8AH 3SDDD 1G7PA 5K9QI 4LCWA 1GY2A 1OAYH 1X5YA 2X70A 3ZE2F 1Z3RA 1I31A 4IEFB 5KG9B 2A74B 3GD1C 1Y18A 1CU4H 1RVFH 4X5XA 2C3VB 4PREB 1L3NA 4X8JA 1BAWA 3SJVD 2DYRB 2DDQL 5I66B 3ZTNL 3RUGF 1F6AB 4FC3E 3GC3A 2K9FB 2I07A 4NN5C 2R1WA 4PJGE 4W9ZA 4P2RE 1I3RA 3QE5A 4JPVL 4JFYA 5I74B 3C09C 3RPIA 4G6MH 3U1QA 3WN5A 1OEZW 1P7KB 1WBZA 3H2QA 1A7QL 2V9TA 4PHXA 4PJ8A 4BWWA 1QRND 3PGFL 1ZS8A 4IIZA 5C2BL 4AI7A 4X6CE 2QLVB 4WUUA 3HPJA 1B9KA 3PXHA 4MNQE 3X14A 3BJ91 4GG8A 3H42L 5DTFB 2APBA 2YD9A 2VTFA 3MJGX 1E3ZA 2Y72A 4HUNB 1FLTX 2QDVA 4KXZH 3HBZA 5HI3D 1JXDA 2HT2C 5CR8A 1OL0A 4W81A 4FA8A 5EBLB 3TF4A 2PPDA 3OL2A 4IBYA 4MQXD 2OP4L 5MEOA 4X9BA 2PP8A 1J10A 3RWEB 5J9PA 1MIEH 1RFDL 4HKJA 3NFSL 4KKCD 2A6IA 1TVHB 2WKGA 1N6UA 4N1HB 3AXHA 1N8ZA 4H2AA 1WAAF 5ETUA 4MLIA 5DMYA 1JVOA 4HX1A 5KYUB 3W11C 4QGTA 1RIHH 3B7SA 4P5TB 4K7FB 3HI5H 3X14B 1AHWC 1IC1A 3PDDA 2X41A 4JFDB 3T0ED 3ZMEA 4Z77B 3OZ9H 5KYNA 2P7TB 1F6LL 3FXIC 5AAWC 4YEFA 2DWSA 1M6UA 5FV1L 4TLSA 4Z7OB 1W2KT 4BKLB 3FH7A 4HW6A 4KFMA 1U6AL 2HTKC 1QASA 4UQ3A 4BKTC 1RAMA 5C09B 3QI9C 3ZZ1A 2RH0A 3PG2A 2PPEA 4G71B 4X7DC 3DURA 3G08B 4HS6B 2VXQL 4XMZA 3NIGE 3UAJC 1FGNH 4U6VH 3K7UA 2V3DA 3JWNC 2YD2A 3ARRA 1D6EA 1UUNA 4ECNA 4H8WH 1R5IA 2LLNA 4HXBL 2R8SL 4P5SA 2WTOA 1T83C 2MQ3A 4NBYB 2JVUA 2R56L 4PWJA 5E8DL 4Y4FC 1C5BL 2OR8A 5DYOB 3ROOB 2DWTA 4PRPE 1U8IA 3G6JE 5K59E 3MI6A 3CDCA 1NCHA 3LJ3A 3V0AC 4ZS7H 1B2WL 1KNOA 3U36B 4HBQA 4AC2A 5GGVL 3MBWA 3ZOAA 3D0AA 4JMXA 2C1PA 2ZAIA 4OM0L 3H85A 4R2GD 2N7AA 2HG0A 1LO2L 4MD4A 4XX1E 4YPGB 1WPCA 4LSSL 5DZOA 1V3MA 5CR1A 5JOFA 1DR9A 2VWEC 5CU5A 5IB4A 5AL0A 1WF5A 1P7QD 3QDGB 3E6FA 3ZT5A 2E27L 4TMPA 2NTFB 3S88L 3O3DA 3NP3A 1AC0A 1MRCH 4IOFC 1TETL 3L3KA 3SDCD 3BGFC 3WE6A 5ILTL 1XSJA 2YEZA 3RAJH 1H5BA 2ATPA 4AEHL 3DXAB 5IEHA 1LO0H 4NO5A 1U8JB 4GP4B 1GC1C 1MVYA 1U8OA 2CO6B 2GT9A 5DZAA 5JZ7C 4HUVB 4UV7L 4L5FL 5SX4H 1AHMA 1AO7B 2DQTL 2OMWB 4Q6YA 4J8RB 2GTQA 1CR9H 3EYFB 3FHQA 2YPLE 4D9RD 5BJTA 3ETBF 4CUCA 3QUMA 4YSEA 2ZJSH 2J72A 4Z8FH 1IT9H 4LDCA 1KIUA 1X5LA 1MEXH 1FO0L 3F85A 4J3WA 4XNBA 4J3OC 1FRGL 5JOFB 4DP9X 2MKWA 3F8UB 3S5LB 3E6FB 4B3VA 4J4PC 1GIGH 3F7LA 3N6YA 4NAJA 1EX0A 5F2FA 4B96A 2NLJB 2GTZB 3B56A 2VXSH 4FFTA 4HUCA 2EXSA 4K8RD 3ULUD 2OCJA 2FATH 5FLUA 1JGIA 2VCOA 1FFQA 4M29A 1J5OH 3ZDXF 5DHDA 1SEBB 2AQPA 1T7XA 1XB3A 3SB3A 4A7GF 1WV7T 2HVJB 2CIKA 1QTYT 5EO0A 4GW1B 3L4WA 4H40A 4R5XA 1OD9A 1XR9A 2L7EA 1XX9C 3GMMB 1SBBA 3MV11 4CKVX 1UJTA 3UBXI 2RQ8A 5G5DB 4WGWB 5AZ2H 2QV2A 4K7PH 4E41E 5BUGA 1KACB 4ZXBA 4TLKA 1F42A 1MCJA 1WD9A 3TV8A 1BPLB 2WAHA 2AEWA 1AXSB 5DSCA 5KBMA 1JNJA 4JY4A 2XYCA 4H1LA 1TPXC 3GNMH 2X05A 3I9GL 4E2OA 4FYSA 4XMKL 2R2BB 3G5WA 5AW4B 5KEZA 2DI9A 4F3FA 2CM6A 1F3DH 1AZVA 4OGXH 5MP6H 3BZ4B 3T2QA 3IN2A 1BQKA 3VD9A 3O3BB 3UZQB 3KVPA 5JIQA 4HJ0C 5GSVB 2ENJA 1PSKL 4JRXB 3M7OA 3G5XA 2FECI 5D4JA 1ZVYA 3SJVA 1S7TA 5E2VH 3LEVH 4WGKA 4G42A 4JM2C 4XTRC 1PX8A 2R69A 2VN7A 5D2LE 2CO7B 2I9TB 2IF7A 1HWHB 4G5AA 1KXQE 2YKKA 3EO0B 3UTTD 5C0GB 2NY4C 3FB8A 1KJVB 1QRNA 2AK1H 2WJ5A 2BHYA 1AS8A 3FU7B 4KNSA 2EIZA 5DMGC 3F12B 4Q14A 5EIVA 4YXHL 5JUEH 4KK6D 3HC3L 3SDDB 4WW1B 2YAMA 5CZRA 1NAMH 2ZSVB 2DYSB 1YEWA 2DH2A 3HG0A 4AV0A 4PRBA 3HMXL 3K72A 1NBVH 4FQXD 4MAYB 5F1SA 2W91A 3K6FA 3OAUL 3BQUA 4AY0A 4DKFH 4ISVB 1IAMA 2Q86A 1TZOA 1NGYB 2VN3A 3G5XB 4UT7L 2V2XA 4HS8L 4DN4H 1EHLL 3UAFA 2VMCA 2R83A 1OB1A 5AUMB 4AYFB 2Z93B 1OPGL 4RMVA 1YEEH 3DGGB 5BUAA 3MAWA 3F2LA 1NCJA 4ENED 3HEIB 5EU5A 1X5GA 1PZUB 2W65A 1DVYA 2A83A 3S5ZA 1YY9D 3FO1B 1ZXKA 2C9AA 5TPWH 2EUZA 2PXYC 2OZ4A 3VD1A 4HSQA 3MKKA 3GK8L 4I48A 5DFWH 2NNAA 4L8DA 2R23A 4UTBH 5C0DA 4LBAA 1KJ2B 3VSQA 4PLKD 4LQFH 3CD4A 2ALAA 2R0WH 4AUJA 2Y7MA 3GRGA 4GLRH 4LIQL 2Q86B 3K2IA 4QTIH 4Y2LA 4FJYA 3V0DA 5C6TL 1A3RL 2A9NH 4ZMLA 2KH2B 4HCRL 1S5HA 1D5MA 1MJ7H 2XPGA 1XIWC 4X7TB 3VXPB 1KSRA 1E7VA 3KYKH 3GYRA 4W6XB 2BSED 4G43B 2QR0A 3V5HB 5E8EB 2OSLA 1RSFA 1CE6A 1O6VA 3Q6GH 1G6RB 5HGGS 4D9QD 3L7EA 3P4OB 2DQHH 1HE7A 2PN5A 4K3HA 3UO1L 3FQRA 2PMZA 1A3QA 4X9GA 3CWGA 1SVCP 5I17A 4Y1TA 5E23A 3S36L 1PNCA 1IGIH 3EHBC 3T0EB 5TJWK 1KCVH 4ZFGH 3D9AL 5SWQB 4BA0A 3RZCC 2C4XA 3KYMB 1JXFA 5JHDE 1BSIA 3L5WB 4RGOL 2CA3A 2WQ8A 4ZDHB 3BVUA 3OD3A 4P57A 5DA0B 5FGSA 1NSNH 1S5HB 3LZLA 4LARH 3GGWA 4H5SB 1D5MB 5FOBB 1ZLVH 4QHLB 1YVLA 4LCYB 2FBRA 3H2WA 4XXWA 5DHVH 3TYGH 3AREC 1FFPB 2B39A 3QIWD 4AX3A 2BFGA 4BCXA 1HS6A 1PJWA 1Z9LA 2HKHL 3BDYL 4LRNH 3V7AG 3WMSA 4HG4K 3O3EA 3SDCA 3P4LA 3QEHA 2Y23A 2L0DA 3ULSA 3GLEA 1PX3A 3QPKA 4ZMYA 5C07E 1NCCL 5I17B 4LZKA 1CICD 3GJFH 35C8L 3IN0A 4JFZH 4MS6A 4Z5RB 4Z7NE 1JZHA 1IC0A 1MFNA 3HAEG 1XF5A 3QO1B 4UQAA 1NCNA 3NA4A 4MCZB 3SKJL 2WKLA 1XCXA 1ZHBA 3RWJA 3T8XB 3WS3B 4U1JB 4JG0L 1CTMA 4WY7H 3CLEH 2WYTA 1IQWL 4IBVA 1MW0A 5SWZE 2ZT9C 4FLOA 1OLLA 2C7UA 3VXME 3ARGD 3CAFA 5TQ2H 3FMGH 4R2GB 5F96L 4QRFA 3IDXL 4OGYH 2ZXWB 3KVQA 5I1GL 3I9AA 3SYAA 2B77A 2MQ0A 4P23A 5ISZE 5ELIA 4A7UA 3IS0X 4IRJC 2ZUQC 5A2BA 1P7QB 4OUOA 4FDWA 2HKFL 3S9DB 2IGFL 2JF1A 1MI5E 2CD0A 3VWJD 4FZ8L 3MOQA 3O45B 3O3EB 4WI0B 1GYCA 5A1AA 1PIFA 1AMYA 2J4WL 5DJAB 2XKNB 3QXVA 3RTQB 1J12A 1D9KD 3MCYA 3EBAA 1A4JA 1DYZA 2VLJD 4FQHB 1CD0A 2WIIB 1BBDH 2ZKXA 3NFNA 5GGUB 4FABL 2DIAA 4ELDA 3T3ME 1XF5B 4CJ1A 1CIDA 3VM5A 1TSHA 4KI1A 5EO9A 4N20A 2DLGA 5T5NG 2X89D 1RL1A 1ZA3A 4NZUL 4JQIA 1IGJB 5GRVL 2CO3A 5DD1H 2O61B 2ITDB 4G8IB 3CFKB 4Z7QF 2AP2A 2E6JA 5H37G 3MLVH 4F1SA 1U8LA 4NM4H 4XXCA 1ROCA 4AEFA 4UIMA 1BZ9B 3F7YB 3HFMH 1CURA 3HHMA 3PWNA 2CDGB 2WP3O 1OE1A 3H7BA 2VDRB 2IJ0C 2VUYA 3ROLA 2H6OA 2XNAB 3V8CA 4NUPA 5I5RA 5KVEL 3EYSL 1R0AL 1P6FA 4R0LC 3TEXA 5IJDC 3CUPB 4M7LL 2GI7A 5IBTL 3ZUNC 5IK3A 3WIIL 5K1VA 4N8CL 4YSUA 1OF0A 1L9QA 2WO4A 1I7RA 3WTXA 2DICA 5IEKA 1QMUA 3LNFA 4PRNA 3DWTA 2NPLX 4NAQA 4XPBH 5DS1A 4RGNE 2BVTA 3MLYL 4UIKL 3JTSA 3FL7A 4DT2A 3BW9A 3H6AA 3QIBD 3UTTA 1CFSA 4D9LL 5AAMC 4K9EC 4ZS6D 3BAEL 3UAAA 2GCYB 3SE8H 3H7BB 1S9XB 2VLRE 3KVDD 4YSAA 1X5FA 3GSUB 2E7HA 3ZKQD 2VAAA 4EUPH 1BZEA 4F7CA 3NCBB 3Q8FA 4YK4B 4RGMC 2EC8A 2JI1A 3BKYH 3GSQB 1DLFL 2CLZB 2WWMD 4IHBA 5IK3B 2AS5M 1AGDB 4MJ5B 4L8SB 1RJZA 1MXDA 3RGVC 1BEYH 2G2RB 3IJEB 1Y6KR 1KBPA 3IBOA 1JGEB 5TDNB 2WYIA 1I7RB 2Q6WA 3SD5A 5KUKA 4Y2OB 4JRYD 1Q0XH 4PJAB 3MRNB 5J06A 1C5CL 1WAPA 3PCYA 1KBKA 5IT2L 1SGKA 3BW9B 1I3GL 2EDRA 4PJDF 3DDGA 1A6ZB 5E7BA 4H0HB 4CBPA 4PJFB 2FBOJ 3M17B 4X8XA 3TO4D 2ICWB 3SGJA 3MBXL 2EYRA 3PP3K 1HXMB 3PQYB 4PMFA 3SGKC 2AV7B 2FD6H 4Q0XL 1RZFL 4G1MB 3QZNA 2HWZL 5EEZA 2YAEA 4OQ1A 5I71B 5SWSA 2H45A 5F1NA 3ZDZE 2XXFA 4PVBA 5C0AB 3MJ9H 1XZWA 4HWEH 2V7HB 1FFNB 3PAZA 4HQQH 4IMKA 4LL1A 1IGMH 4FQXB 4KZDH 4M5YL 1MLCB 4KJWC 4XPTL 3HC0B 4KMQA 3EJRA 1OW0A 4YFLI 4C55A 3R1GL 4JFWA 5D1QE 2AJYH 3FQYA 3D18A 1VHPA 2BSEA 4OZGE 5CEYA 4Q9CA 4S1DC 1CGTA 3NJVA 3WNIA 5J1SC 3DHJA 4JLRA 1Y0LA 3MRJA 1QSVA 3LHAA 4WEUD 2QVTA 1WGVA 4M9PA 2A6JA 4CNIA 4NJAH 4BCYA 4JO8A 1U8PA 3FUJA 4FP8H 2WLHA