2OZNA

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
EVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
molecule keywords O-GlcNAcase nagJ
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oznA00
4DH2A 3KCPB 1OHZA 3UL4A 2VO8A 4UMSA 4WI0A 3GHPA 4FL4B 1ANUA 4N2OA 2W1NA 4IU2A 2XDHA 5LXVA 3KCPA 4WKZB 2BM3A 2Y3NA 1AOHA 1TYJA 3F2LA 3FNKA 4UYPA 3L8QA 4IU3A 4FL4C 1QZNA 4UYQA 2OZNA 1G1KA 2B59A 5G5DA 2O4EA 3BWZA 2VN6A 2JH2A 2CCLA 5AOZA 2ZF9A 1ZV9A 2VN5A 5K39A 4U3SA
chains in the Genus database with same CATH superfamily
2NY1D 1SDYA 1WA0X 3V7AE 4OCYH 3WEMA 2JJWA 1CDUA 3TWCH 3X3GH 2G3XA 3CDFA 4UDUA 4OZHA 4PRPD 2ED8A 4XCNA 2O6DA 1AANA 3RBGA 4DZ8A 1QZNA 5KSUB 5L2KE 2BIPA 1KCRL 3FFDB 2UY6B 1A1NB 5FHBL 4BA8A 5I24A 1CE6A 2J12B 1QKZL 1U4FA 3P4NB 2R1YA 4JQIL 3CXHJ 4YSDA 5B7MA 4E2OA 4XOEA 4BK5A 1ETZA 4RMTA 4NQSA 2ORBH 1IQWL 4U1HB 1KCUL 3ZUNC 5C0JA 2YQGA 3UP6A 1I8MA 1ETA1 1JZJA 4WCYH 4W9ZA 2AZAA 2KMWA 3C2AH 4N6RB 3D07A 3SHSA 1QR1B 2GJ6A 2PYFA 1J88A 4Y4FB 1XCTB 2AXHA 3KR3H 1HU8A 3MLYH 4WKZB 3V4UL 3BDYL 4E9LA 1WCBA 4R7XA 5CEZD 5JDJA 2E6QA 3IBEA 1XAUA 3UEQA 3ZY7A 35C8L 5FK9A 1AG0A 3BKYL 3HVNA 3NZHH 5TQ0L 4DVBB 3F7QA 5HJ3B 4OD2B 3I6GB 4D94A 2NXZC 3PPSA 1WWWX 4N9GA 4U0RC 1BWMA 3K1KC 1NUFA 4P5SA 4HWUA 4QHUA 1WIPA 4PJGB 3VGAB 2HWZH 4WWKC 1J10A 3QUKB 2IMMA 4DH2A 3KNBB 4AJWA 3VACA 1NCBH 1P5VA 1J8HB 3FQRB 2W9DL 3T0VA 4BBWA 2WWNA 1NM4A 2XJLA 2DQHH 1F4WH 1YEHL 1NAMA 5D1QE 2CPUA 1TZAA 1E5AA 3EUUA 2BP8B 3U0PA 1FC1A 3AWEA 2CGRL 2F19H 4LLQB 3VDCA 3WIIL 4NKMA 2C1OA 2XYBA 4APQB 3BESR 3BZDA 2CHXA 3NABH 3HAEH 2NQDA 1UA6L 5DHDA 1SXCA 3TIDA 1AACA 1BXXA 1MIML 1I1RA 4IBTA 5CUSL 1A65A 3O6LL 3IU4H 3FTUA 1E2VA 2WNWA 4LSQH 1UKSA 5FKPB 5F8QC 3VNZA 1T1YB 2HTLD 3ECVA 5E08H 2J4WL 5DHEA 5FWRA 2R8SH 3S35H 4OFYD 4M62L 4PLKD 4R8WL 4UAHA 4FNSA 2YSSB 4G6KL 4Z95H 3L5HA 1BOGB 1YNLL 4P46D 4AQ8A 3T65A 4KMQA 5MI0C 4KI5F 5EU6A 3LEXB 3F5WB 2KZWA 1I9RL 2H9GB 4XPFH 3WNKA 5HDBB 25C8L 1CE1H 3GPSA 3D0LB 3PGFH 4F1ZA 1DEEB 1WFJA 2ZNXA 3H0TA 1H9VA 1JGLL 4P07A 3LPPA 4NO0A 4QRQB 4NFDA 1S7TA 1BF5A 2GG1A 4LEOB 4AKQA 4DP2X 3K91A 3L81A 4PQXA 1FFOB 3VGDA 1YG9A 3ZSSA 4XT1C 1JAEA 4X9FA 4HJ0C 1KIUB 3ARBC 3TU6A 3ABGA 2D3NA 1AR1C 3H9ZA 3QWNA 4L05A 1DSFH 3ESUF 3T0EA 1MG2C 2PCPB 3T09A 3R4DA 2OAAA 4XNMB 5DJYA 4ZTPL 2ZWYA 2J2ZB 2E6PA 4BCZA 5L8JB 5FUOH 1J11A 4Z7QB 1S7VB 3DK0A 4XODA 5D7IA 2P5WA 3HPLA 4FYQA 5JHDD 3SYAA 3MJ8A 1NC2B 1QFHA 4F7MB 2CO6A 3HRZA 3H54A 3IDYB 4ODXB 3V8OA 1HHGB 1X7TA 2P3YA 4RNRA 5ID1B 1IEAB 3MCLL 4XPHL 2YK1L 1EUUA 4ZYKB 2XZQH 5ETUA 4JMNA 1WE5A 3IAPA 3M8OL 5JMRA 5HY9B 4GQ9H 3KLQA 5BCAA 5FA3A 4CC1A 5CLWA 2WQRA 1U3HD 1DEDA 1TMCB 3NACL 2X0VA 32C2A 3O3EA 2WYZA 1OXYA 1A6WL 1SJHB 2EQDA 2W91A 2LVEA 4CU8A 4HG4J 4K23H 4LSVH 4KQ3L 3MRNA 4K8RH 4R26H 3DTDA 4U6HA 1UJ3C 3BO8A 4N90D 4FLQA 4Y5XB 2TRYA 4LVEA 4XP5L 3EYFA 4IDJL 1PGRB 1KFAL 3KYMA 5DYOA 3T3ME 3PHQB 2A77H 1ASPA 4CC0A 4YHMH 3UABA 1I9EA 2J7LA 3ESMA 3BRDA 5KSBE 4NM8L 2EZ0C 5ANMB 1KCUH 1HNGA 2Z8SA 4PRIE 4HALA 4GAGL 3BMWA 4NGHH 4JFZL 2CJSA 3K80A 4MDJB 4RISH 3UTQA 2CSPA 1TCRB 2P46B 5FM8A 4RCAA 2WXNA 5KSVB 1OP5H 5ECGA 1L9TA 1T83C 1KCKA 2Q8BL 3L3GA 2CK2A 3VD0A 4O02H 2EXYC 2XXMB 3QUXB 2DWYA 4Y9FA 3NJLA 2YQ3A 5HPMB 3QUYD 2FQEA 2K70A 1BZDA 4O2CA 5KYXA 4G8GB 1ES0B 4ODVL 2GJJA 1RIHL 3N1MC 4OGQC 4DKAA 3TZVC 4NQVB 2G9HB 4BELD 1QLEH 3S7GA 4TUUA 1SUHA 4L0ZA 4I3RH 3EYQD 3KEHA 1AGFB 3V0DA 2DQHL 5LB1A 4Z3FA 3V4PB 5L2KD 1S7SB 3WTYA 2KDYA 1S3KH 4N2KA 1A4KB 4ETQB 4QF1A 3JWDC 4TVPE 4BK5C 1WIUA 3CLFH 4H0HB 1BZOA 1KNOA 4Q4IA 5F3HA 3FQ4A 4HIXL 1TVBA 1MFBL 1C8QA 4ZO6A 1S9YB 5J9PB 5IR1A 2ADGB 1OAQH 4YX2L 4XNZC 4XPAH 5BRZD 2RHEA 4RETB 3UDWC 4FJYA 3UBXB 2N01B 5BRZE 1N67A 5CBEB 2VDQH 4FQHB 1AC0A 3N55A 1T6VN 1KB9J 1ZLVH 2I9LB 2FJFA 2OZ4L 1OP5K 4WDIB 3TYGL 1WBXB 4MMZA 2DWDB 4KUCD 1LVEA 1ZV5A 3PNWB 2YXWA 4O2FB 4KPHL 4CMHB 4LLDB 2Z7WA 2LLNA 1PZ2A 4OJFH 1AQKH 4ANXA 3MOAH 3TZVD 3CFKA 4QHKJ 2AFNA 5BQ7A 3GSXB 3AACA 4HFWB 3SYOA 3P4OB 4LF3A 5D5ME 1QSEA 3B6SA 4KX7A 4AC2A 5E2UH 1NSNH 2MMXA 3KAAA 3B7TA 3MLSL 4J3SA 4P5TB 5FYKU 1KFGA 2O26U 1UXWA 3LRHA 5CIPB 1X6LA 4ZW8A 3JYBA 3UAAA 1VFUA 1V3KA 4AMKH 1KIRB 3M86A 1NGPH 1MN4A 4ZUUA 2MKLC 1QLRA 3DOSA 3AW5A 1ZA3A 3P1VA 1BJMA 1P5UC 3RX8A 5IJVB 5LN4A 1G7LB 3SGEI 2VDPL 3IGAB 5DS2A 7PCYA 5I18H 3LQAC 3GB7B 3ZO0A 1VFAA 4M7ZB 4FG2A 5DU7A 2EEXA 3KBEA 2DQTH 3HG1E 1G6RB 1UH2A 1UCBL 4HW6A 2FIRT 2VO5A 1IC7H 1NBVL 3WXWH 2NY5C 4N0UA 1JNHB 3O2DH 2QSTA 4X6DA 4A68A 3VTMA 1CXKA 3BCFA 1UD3A 2CLVA 1G7JA 4WY7L 1NICA 1HYSC 3F64A 1H5BB 4H8WH 2NYKA 4RMRA 3D6GA 3ALXA 5EEUA 5CLZA 1MVUA 3MTRA 4Z7NF 4HV8A 3BPLB 1VZGA 2YPVH 5D8JH 5LGKA 3SPVA 3ZPDA 3TFBA 4TXVB 3CMOL 4K3EH 2YN5A 2RQEA 5HDQH 5K5YA 2OMTB 3SSGA 4JFOB 4PJHB 3GBEA 1MLCA 3RGVB 1M2VA 2QR0B 3BQUD 3DX9A 4MA8H 1OTUC 2DIAA 1GGYA 1OY3B 3KDMA 4PREB 4M5YL 5ICZA 3EFOA 4NQDB 5EFIA 3QJVB 2ZWZA 1R5VA 5IJDC 3W9DA 4HAGA 3WEOA 1FNEA 2XTSA 5EZOL 3VM7A 5DFVD 4Z7IA 5BVJA 5K59F 4M43H 2QVTA 2K4AA 3BJ91 2YBRA 43C9B 1WITA 4GRLD 1UWEH 5HHOD 3FTWA 2RH0A 2BOBB 4WTZG 4CVZB 1JGIA 1OTUD 4HPOL 1RERA 3ENEA 5I6XC 1TTGA 5TF1L 4R2GD 1R3HA 3DTUB 2GEQA 2NY2C 4IKKA 3QPXL 3ARSA 3MR9A 3O3BB 4UT9A 2OMTA 2Y0SA 4JDVA 4HUWB 5EIIA 3CHOA 3CN4A 4EIZC 1WUZA 1JPFB 1QA9B 3RJOA 3T6WA 4B41A 3Q01A 1N12A 1KCSH 5BRPA 3EHBB 1GHFH 4KTDH 3B2PA 4PJCB 2ETWA 3LZNA 3ORJA 3EGXB 1CLYL 1PAZA 5DMYA 3WU1A 3OPUA 3UCRA 1ZHNA 3IXAB 3OKLA 1AGEA 3FF8A 1MCFA 4F37F 4BFRA 5E94A 2P8MB 1KEMH 4ATTA 3LIZH 4I13B 4JE4B 4AMWA 3OQ3B 4JFEB 4JRXA 3ISRA 1FFNB 5ES4B 3BAXA 2WKGA 2BM3A 1G5GA 1L3NA 1UACL 2OSLB 5DUMH 5KVGH 1X5IA 1A1NA 3N42F 3COOA 5JHBA 2C3VB 3VRJA 4WEMB 1TFPA 4AQEB 4V2BA 2ICWB 1JYNA 1AR1B 3FH7A 4LCIL 3G5ZB 4M1CD 4I3SL 4NN5C 3WE6A 4OB5H 4PMFA 1BG9A 2C9VA 3TV3L 2AQNA 2VLRA 3GS4A 1U41A 2I60H 2JB5L 3CTTA 3SB3A 4AV0A 3N40F 2XWXA 2WANA 2BP3A 3GXMA 5F88B 2CKBB 2WXOA 1OLLA 4L4TA 1JZ2A 1OO2A 1N4XH 3MOAL 3VG9B 1YYMH 5K1JA 2E9BA 4G43B 2CA3A 5E6IA 4F58L 3LNIA 3N1QC 2VXQL 3QI9A 3OHXC 1TF4A 1ZS2A 2ZG3A 1J9SA 3UBXA 2VC2L 4AW4A 1HHHB 4L3EA 2DH3A 4ZI8A 1NH6A 3ARFD 4PJIA 2QMKA 5B1AB 3ZSTA 4YNYA 2PP8A 5DGRA 3VGFA 1SVBA 1FV1A 2UUDH 1M42A 2YRZA 2WXPA 4W1TA 4WF7A 5DVOA 4JPVH 1NOLA 2DOCA 2AF2A 2A5UA 2VLKE 1LWHA 4WRLA 4B9PA 4I1NB 3Q2VA 1LO3L 4PJ8C 3ECWA 1EAPA 4GMSH 5KVDE 3QRGH 2AMGA 3EOBA 2YLHA 1YLBB 3U82B 5JA8B 3GO1H 2XPGB 2OX5A 1NWOA 1OOWA 4LGRB 4IOSA 4MB5A 1FFOA 1FO0B 2K6YA 1CGSH 1NGXA 3KHQA 2R4RL 2IWGA 3IS0X 1D5XB 5T8IA 3OKDB 1WPCA 3CBRA 3QIUB 3V9CA 4IMKC 3OZKA 1RZ7L 4MAYA 5GS0L 1JGUL 3K7UA 3J8F7 3K6NA 4X42A 1A21A 3AROA 3QQXA 1T2QH 4Y88A 4IGBC 4JM4H 1MFAL 1T3FA 1FL6A 3MR9B 6PAZA 2PW2A 2MQ0A 2ZG2A 2VM9A 5FECB 2KI6A 1NBYB 4JB9H 5AAMA 5EEXA 3KVQA 1UWFA 4MNHB 4XHQA 1K8DA 2RFXA 3MRBB 4OCYL 3VXNB 4GG8A 5DZ9A 4FLSA 1AGDB 5IV2B 4NKIL 4XN5A 1DUZA 4KJQD 3L7FB 5I5RA 3PJLA 2EAEA 3FB5A 3TJEL 5JHLA 4WNQB 3HG1D 4KGJA 3N9GH 4NC1E 3NA4A 4XAWH 1U8IA 2FNWA 2QFPA 4UDTA 2EP6A 4UTCA 4Y5VB 4HK0A 5CILL 3RX9A 4EDWH 3NP3A 4KOCA 1TEYA 2R0LH 3SD2A 1V7ML 5DJ6A 1IKFL 4UOZA 1FZMB 4PS4L 3KNBA 1CYGA 4YHOH 4F24A 4PJDF 1YEJH 3VXRD 5DLLA 4WI5A 4YWGL 1L7TL 4HV8B 4XP1H 4H20H 3MLYL 4JVWA 3MHZA 3TNMB 1QEWA 2GCYA 2WLIA 4MCZB 3PJSB 4JZJC 4ZTOL 1ET7A 2IGLA 4ZPVB 3RNKA 1IRAY 2GK0A 4D0DA 4JHAL 4LB8A 4PJXF 4QRPA 2GUOB 4MA7L 4ZMOA 3WTUA 4JDVB 2JXMB 1T66D 3G6DL 3Q44A 1M7IA 5J1TC 1YN7B 3KPMA 1UVQA 3U0WH 3F83A 1K85A 1RZQA 3CQFA 3L3DB 3E3QE 4MQTB 1OAKH 5A6IA 2P52A 3K2IA 2X6MA 4JM2B 4HJJH 3PAUA 2ITDB 2RACA 2OL3A 4F7EB 4GYBA 3GSNA 4U0QB 4X0KA 3P3UA 1OP3K 3QSKB 3X3FH 2AVGA 4DVRL 4M93C 4J1UA 1T66C 1FNEB 5J57B 2YD3A 3GRBA 4QXVA 2D0HA 3U4KA 3C5ZC 3H53A 4GQQA 2ESVD 5JOPD 5D7JD 4I5BB 5ILTL 2Y9RT 4FFYL 1EHKB 1QACA 4TUJA 5BS0D 3IAGC 4G1MA 1PKQB 2XA3A 3GRWH 3RWJA 4JZNA 4NPKA 1SEQH 4AOFA 4NO0D 1LEGB 3STZB 5CKGA 2ZZUT 4XVOA 3PFQA 2P28B 5DJDB 3MRGA 2X4RB 3L5JA 1KGYE 4LPYA 3OF6A 1BM7A 3UGUA 2GT9A 4MNQD 3QEQE 5DJCB 1A4BA 3A6CL 5IUCA 5J7CC 1YDPB 2J88H 2XNAA 4FI7A 1Q94A 1TXKA 2OXGB 4KU1A 2HYMA 2LABA 5DGQA 1FYTD 3GRWA 2VL5B 4N2AA 4NUJA 2WSPA 1H15B 3BI9X 1KELL 1B0GA 1OW0A 3MREA 3V4VB 2B4CC 1MHEB 1RUAH 3PLYA 4R2GB 4YDIH 5FUCC 1BEYH 4GAJH 1FUNA 2YZ8A 1CFTB 3WTSA 3UG4A 4YIQA 2ICES 1TZGH 2Z4TA 5T3ZH 5E99H 5IQ9A 1FCCA 2QGEA 2GBUA 1G9NH 3QAQA 3GJFK 3FSAA 4XTRC 3MV8A 1IUZA 1F00I 2MNWA 2VUYA 2ZXAA 2M1KA 4ORZC 1FG2A 1FYHB 3CFKB 1D9KC 1TTFA 3OWEA 1OGSA 5BQ7B 3M8OH 3N50A 3IJ7A 1D5MA 1JNLH 2C7UA 3KYKL 4QRBA 3KPNA 3JV0A 4WFGD 5EOCJ 1RZFL 2R0KL 1BLIA 1FZMA 2GBTA 5F7EL 1YEGL 4LCWE 1GS8A 1BMGA 4WGKA 1UXMA 5IVXF 4MLSA 1U8PA 4LL9A 3T0BA 4GUQA 5EZLB 4H25A 4LEXL 1QRND 4MZ2A 3RL1B 4GKZB 3D06A 4LMQI 2IPKB 4X2UA 4OQ1A 2LU4A 3ARBD 2XQBL 2Q7YA 4WWKA 3TH3T 5DJ8A 2O72A 2P5WD 4X4ME 3NSJA 3WDHA 4GQPH 3U6RA 1D5MB 1CJYA 3DUUA 4YR6A 3NPZB 4LPVA 5DMGD 2A77L 4LCYB 2R0LL 2EIDA 3N85L 1Q0XL 3B8SA 3QUMB 4RWHA 1FLRH 2BSRA 3EH4B 1WD8A 5LG1A 2HKFH 3D39D 2W65A 3LZFL 4HPYL 4U1JB 2F18A 4AENB 3QNXA 3TEUA 1HCVA 5E5MA 4PJDA 2X4TA 5AVQB 3RKDC 4Z78A 2CM6A 4HKJB 5FOJA 3MBED 5JW4N 1RU9L 4AGLA 5MERA 2O1AA 3D8MA 3ARRA 2H3NA 5I16B 4ZX5A 3IFPA 4ADGA 1HCYA 5EZJB 1M1XA 2EIJB 2H32B 3GJFH 4V1DE 2CO3A 5E7BA 4FQCH 2HTKC 4IU3B 3DWTA 5B7EA 2LT9A 3HG2A 3ILQD 4DKEL 4WK4B 1XB8A 5FM5M 4NOFA 4WSKA 1BAFH 4XMPH 2H2PD 4JREB 1M57B 4PPTA 2WLZA 2HFEB 2PWHA 5CWSA 2XVBA 5F70A 3FFCD 1R46A 3AUVA 4I18A 3FYIB 5ALBH 1MCLA 1S6NA 2UX7A 4NO5A 4KUZH 1P4LB 2MPVA 5J12B 4K7PH 9PCYA 1FRGL 1WBYA 5JW3L 1CZ8H 5IESL 3GI9H 5ICUA 4NZFA 2KLRA 3H55A 2I32A 4MBOA 2J2ZA 4MQSB 3S6CA 3F7PC 4DVRH 5MEQA 3U46B 5E5LA 5E2VL 3R1GH 4Y16C 5LHDA 5EU6D 1WWAX 4B3EA 4KXZI 3KCWA 4BH8A 4X5QA 3CLFL 3CXFA 4P46A 1EFXA 4P9HH 3M7OA 1P0SE 3LV3A 4MWFB 4NQQA 4YHYC 1A3RL 3MYJB 3CHXA 1J9QA 4AE1A 4JBSA 1AIFB 1HHJA 3NRQA 4LCUA 3ZHNA 2VH5H 2YGNA 2YMOA 3OG4B 3QCTH 5LNEA 2LU5A 4JHWL 5F6IB 3ULUE 3N41B 4U3CA 1S7XB 4Z77A 3MGTB 5IZ7A 3P9LA 1HC1A 1IM9D 3IKCB 3TESA 2KT6A 5B21A 3E8UL 5L4FA 2R29L 3O9WC 4AGNA 3HTLX 1ZEAL 3H3PH 1MI5B 2Q3XA 4N86A 1K3IA 3ETBF 3S0PA 2F54B 4H40A 4J12A 1QOKA 5I1HH 1JPGB 5ETUB 2L04A 2L4OA 2X1QA 3PWJA 2QHRH 4M8VA 3Q8CA 1NAKH 3L3DA 1UOWA 3ECQA 5ID1A 1BYOA 1RZ8A 5F6IC 1BJ8A 2QKIC 1JXGA 3BEWB 1D9KD 2WQAA 3QAZC 3GMNB 3T8MA 4OCSH 3HC3H 5GRJL 3TT1H 4NZRL 4EOWL 1ZVYA 2B59A 4UB0L 3CFQA 1GCFA 4AGOA 1S3RA 1VB9A 3OKYA 2HRHA 3S97C 2F9BT 4ZAKC 2BIHA 1INEH 1A02N 2LAGB 4NCC1 1XEUA 3ZL4L 1FDLL 4W4NA 5A2LH 3VXOB 3FUFA 3I02A 1AZUA 4MCNA 2Z0UA 1N18A 3KGSA 1UH4A 3QGVA 4Y2DB 2JKWA 4MNQE 2F7IA 4RAVA 1G84A 4UDTB 4X0NA 3IPBA 1OQXA 2WBJB 3B2UC 1OTTD 2OMWA 2KZBA 4WI4A 3U1QA 4FQPA 2WVUA 5JXEC 4J6RL 1IVTA 5DJAA 5LBVA 5DEGB 1JI2A 2WB1A 4PSPA 4W9GC 4TL5A 2GY7B 2R0WH 2XTJC 2YPVL 3AQZA 5D8JL 2W5PA 4ZFQA 1F90L 3HKZA 4C4BA 1OGTA 3WDJA 3KMDA 3TF4A 2NZ9C 4WFFD 4N2MA 1K8IA 3FBQA 1Q9LB 3QQNA 1B9ZA 4AYFA 2DQFA 4JVPA 2F2HA 2V7NA 2J43A 4LEEA 4ZXBC 1F42A 1A6UH 1ZV2A 2B2XL 3NIFF 2NR6C 1A7BA 3PNRB 4HSAC 4UOQA 3VGGA 1DVYA 2A1WH 4OQTL 5HYSB 2HFGL 1IAIL 4AL8H 4MAUH 4LSSH 5KVDH 3OKDA 4FKKA 2YKLL 5JHAA 2GIMA 1BDYA 1QWNA 3IRZA 3NFPA 1NKRA 4L5FE 5C7ZA 1KPRB 4M5TA 3P77A 3IT8D 1JNHA 4DGIH 4FTVB 4B9JA 4PJHA 3WN5C 1RK0B 3MI6A 1NSNL 3MLSH 4M6MH 3GS0A 4Q8BA 1KBGH 3EH5B 4WEUD 1GMEA 3EYQC 2K3HA 5JQ6L 2ESVA 1H3XA 3ARDC 3IJSA 3AVEA 3IFLH 5T3XD 1KPUA 1M71B 3MRRB 1BPVA 2CWRA 5ITBH 2CDFA 4Q2ZB 1T4KB 3IFOB 2OMZB 1CDGA 3WUWB 1S7WB 1SOSA 2BJML 3OPZL 1WCQA 1ID5I 1N64H 3WNPA 3CDGA 3QJFA 2OP4L 5LQBL 2VAAB 3B1TA 4RAUB 4YK4B 3EO9H 3MV7D 3NCBB 2NY1C 3MRHA 1VGEH 2Y1YA 5DDHB 5F1NA 5IKCB 1THAA 1OAXL 1Q94B 1M4KA 3MNZA 2G75B 4A66A 2N7AA 1WEJH 2J8OA 1NGWA 5DA0B 4IU3A 3RAJL 3VYOA 3CVHB 6FABH 3BP5B 3UAJC 2WSDA 4HHGA 3APNA 1XCXA 3VFWB 3G5YB 3QZWB 1LNUA 4Y4KB 4N68A 2VISA 1DN2A 1VPOH 4WHTB 1I1YA 4LCIH 5KSBF 2FIKB 1GOGA 5T3ZD 1XGQB 1EO8L 1H6TA 3MRLA 1WT5A 1ZVHA 3ET9F 1W8NA 2RIKA 2BVOB 5CEXB 5EU4B 3WO4C 3QDMB 3KWTA 3QIBA 5F8RC 2WBJC 4XX1G 1JUFA 3RWEB 4ZXBA 5DUPL 3M6DA 3JUYA 4OJYA 3CUPB 4QHKI 3SDAD 1CGXA 1T2JA 4M9PA 4TQHA 5EIIG 4DGWC 1GSKA 1MFEH 4BH8B 4GUCA 3AG3B 5FLUA 2RALA 1YMMA 2K78A 4QY8A 4AYSA 1CVSC 5FA4A 5DZOA 3VMOA 3LXCA 2C5DC 1NCDH 5DRXB 1URLA 4IIQB 3RB7A 1KB5L 3LSOA 5FO7A 2QDVA 4P2QA 1FNSL 3TBTB 1T03L 1SY6A 1A1MB 1NCTA 1S9YA 4PJ5A 1JBJA 3QIWB 1LWJA 4HXBL 4AQAA 1PFOA 1SXNA 2IFFH 3ARGB 3E6FA 4EOWH 2YARA 2CBQA 2XA8H 4MJ5B 5E8NA 2C3XA 2G2NA 1XFPA 3NGBC 3DPBA 2QPSA 3VRLF 3Q7JA 3RI5F 3OC8A 4NC0B 5F1IB 1L0QA 3MV9E 5D1XE 2H2SD 1MHHA 4HCFA 1QO3A 3MBEB 4PV9B 1PJ9A 3MRDA 5BV7L 4F7PB 5CAYB 3TN0B 4RIRB 4JGMA 3FSZA 2AJXH 2V5MA 3QXTA 4D0CB 1J87A 4ODUA 2DMBA 5I1DB 5E5MB 3F6LA 4DPRA 2W1NA 1MCIA 3O9WB 3LCYA 5EO9B 3UTSD 5I1JH 2VZVA 1TU2A 2HWZL 4C83A 3KEDA 2VR8A 1BFTA 1II4E 1WS7A 3MXWH 4JFTA 1ZK5A 4NN7C 1SMOA 5KAQG 1L9OA 1UWGH 1CD0A 1T7ZA 2GSIB 4X80L 1MHEA 2OYKA 4ZFFA 1FVCA 4FLOA 3GMNA 2R1XB 1I1AA 3R19A 1TCRA 3OX8B 3RA7L 1DQLH 4FS0A 3T4YA 4IS6A 5E4IA 4UM8B 4BFEA 2H8PA 5D6CB 5MENA 5KJ4A 4PG2A 5F7UA 5FW7A 4NZTL 4POZD 4XO3A 1XCWA 4P04A 3L3HB 3VQ2C 1K5NB 3BEVA 2R39A 1AQDA 1WK0A 3ARGC 3CXDH 3NTCL 3T8XB 3CLWA 4M5ZL 3L4TA 2JIXA 2ZUQC 1IM9A 5CN1A 3ULAB 1SBSH 4PTTB 3KL5A 2QLYA 2H45A 5E9DE 1A22B 3VGHA 3QIUA 3QJTB 5C9JB 1LE5B 4RQQB 4ZQTA 1RVFL 4G7VH 3VFGL 1BX2A 1URZA 1OARL 4S1SH 4XVUC 5HYQA 1LO5B 5JQHC 4Z76B 5D1QC 1QBML 4N0UB 5JHLH 2A73A 1INDH 4Q9QH 1P4BH 2DTML 1F1GA 3GJFB 3SDAA 4DP5X 3FO2B 4LCVA 1FE8H 5KOMC 3CK0H 3CFMA 3FUNA 2EE6A 3CDYA 4M93B 1TKWA 3RJQB 5KBMA 2Y36L 3N3EA 3KPLB 1MFVA 5JR1L 4PM1A 1IM3B 1JZ3A 3D08A 5KVEL 1E9QB 1U3NA 1A1OA 4KQ0A 2FHFA 3UTOA 1R19A 3CZSA 3KGTA 1UB5B 3VH8B 1DVUA 3HS0C 4BFIA 5KVMC 2NNXA 3I9PA 3QFJD 4FQ2L 2RBLA 1OAXH 2H2SC 4BQCA 4R3SB 4M8RA 4BFGA 4M4PA 3ZVVA 4BZ2A 2Z6FA 4ZODA 2YA1A 3PV6B 4M1CC 1OD7A 3C6SB 3AFLA 3UTTE 3WLWC 1P84K 2OFQA 3K1DA 4LF3B 1ACYL 5G4MA 1JWSB 1INQA 4KV5E 3SGDH 4Q58C 4HJUA 4JO1H 1TQSA 2YPKA 3D48R 5MERB 1H6FA 4PGDB 3CU7A 4PP2A 5EUOE 1GTFA 3KL3A 2PN5A 4JPQA 4GMTL 3V4PH 4YSSA 3U7WL 3SIKA 2H26B 3BUQA 5J1AA 4F1SA 4L23A 4JN1H 3LZOA 4PRDA 1J1OH 4X6CE 1BREA 3K72A 1E4XI 1ZHBB 4A7QA 4X6FB 4IRSA 3E2HB 4ONHA 3GSWA 1MFUA 4K8RL 3VFSA 1F2XK 1PX8A 2VDOL 2YD5A 2X41A 2F5AL 4MHHG 4X6BB 1XF4A 1E9PB 4AXWA 1U8QA 1UFGA 2CUMA 3HNVL 3LRSA 3U2JA 3ARED 3GSNB 4OLWH 1QR4A 4P59H 2AERT 1LL1A 1QRNA 1QTYT 2CHZA 4TQ8A 1GSMA 5C92A 2VZTA 3TX4A 3PWUB 1YEFH 3N1FC 3FTGB 3HI1A 3MUY1 4X5RA 5AYUH 2MNJB 3K6SA 4JRXB 4NM4H 4N2IA 1D5ZB 1USZA 2GW5A 3E2HC 4PS4H 4XP4L 3DECA 1CK0H 5J1AB 1HKLL 5HYJB 3MACH 3L17A 3IPFA 4PJBF 4J4PA 1KLGA 4OTXH 4ESKA 1S9VA 4JPWH 4ES9A 2C1OB 2D4FA 3FU0A 3RVVC 3BFOA 2OI9B 4I7ZC 2C9PA 5ALCL 5L88L 4DEUA 1COBA 4XNUL 4FTVE 5E2JA 4OLEA 4P9ML 3BDXA 4K0OA 3TC9A 4OKVA 5EBWA 2N3JA 4Z8FL 2ZX9A 4HQQL 3D69B 2I26N 3E1ZA 4KHTL 1RLBA 3BW9B 2BHUA 1GGBL 1RZJC 3HMXA 4MA7H 4HBCH 1M53A 1N9PA 4PJHE 1AD9B 5CSZA 3QEQB 5IMLA 3HC4H 4GXVH 4PRAB 2J8UB 3K0WA 1W80A 4OSUH 3E9TA 3WCYA 2FTAA 1U8IB 4Y5VA 1LQBC 4DCQA 1KCVH 1F0LA 2BOBA 4CVZA 3ZE0F 3EYSH 4NQCE 2NYYD 4NQCD 1Q9OB 1FV1B 2XJKA 1CF8L 4WO4D 3D4YA 2BX5A 2PYFB 1D9KB 4JGJA 4Y4FA 3O81A 3BVDB 3UGEA 1U8OA 4NJAL 3VTTA 4L3EB 2FLBT 4YXLH 2NX5E 4DQOL 1QW8A 4JN2B 4MKTA 3L9YA 5AUMB 4WI0B 2ITFA 8PAZA 3P4OA 1WFIA 2IOOA 4KXDA 4M5ZH 3FB6B 3FQXA 4Z7OE 5IROC 3OZLA 2ICEB 5DC0A 2HKAA 1NGYB 4G9FE 3LQZB 4G6ML 4N9OB 4ACTA 1E4HA 2X6UA 1NC4B 3ME0A 1RVFH 1DJSA 3DMMD 5KN5A 1XF3A 4M29A 5FYJU 2ZF9A 4QRRB 3ZZ1A 3VD5A 2Q2EB 4AKOA 2RQ8A 3GM0A 2D73A 4MD5A 5D6CA 1U92B 1RMFH 4LE8A 4X6DB 1FLRL 3CVCA 3A67L 4O02B 3MYJA 4CU7A 1TJGL 1U8OB 4CKQA 4KHXL 3OJ2C 5ANHA 3ZHKA 1BBDH 4P46B 4I1PA 2BIOA 1CYWA 4Z3GA 4PGCA 3S37L 1EGJL 2GSIA 4BD4A 4E41D 3LYRA 3OMIB 4PJFB 3NMEA 2F8IA 2PCXA 5HHQA 5TK4A 4HEME 2EIZB 3QULA 4E41A 3Q1EA 4FP8L 3NEOA 4NPYB 1EPFA 4XXDB 3KH3A 1X7QB 1J5OH 4N0FA 1F3JB 4OCWH 4BSVA 5CP7A 3FKUS 5AW0B 4CNIA 3W9EB 3CVIH 4ES8A 1K6QH 1PSKH 2WHVA 3NCJH 3QZOA 3LKQB 4O51A 5LN8A 5LAXA 5DEFA 3MVSA 4WFEE 1KLUA 4X6DF 1AXSB 3GM8A 4PB9H 1FL3A 4CN4A 4LEOA 2DQJH 4TLUA 3WGUB 4MNGB 2KLSA 3O0RH 1L0YA 4IW4C 3DX7B 4K7PL 1E4WL 2QPFA 1VGKA 4FI8A 1S8DA 4QLWA 5I16A 3WS6A 4F7CB 3O2DL 4GQRA 5I71B 2X4NB 1JPFA 3E6FB 1EIBA 2JKTM 1E3ZA 1AXTH 5L6YH 4F8LA 4PJDB 4CNIB 5F7EH 2X7LB 5AD0B 3U1SL 3RWGB 3SE3A 2QQKH 3LPOA 3X3GL 4M48H 3X13B 2DLFH 5DUJA 4QO1A 4OFIA 1EA9C 1S5HA 3EUDA 3I2CL 4KK6C 4PJFA 3TFKC 1JTOA 2NY7H 2EH7H 3FB7B 3CFCL 4GAYB 2YFOA 2XWJB 1XR8A 2W07B 4X50A 3FHQA 3HS0B 4TS6A 3KLAB 4X7FC 4XWOC 5AW7B 2YXMA 2CCLA 5C09A 4CMMB 3LXAA 3LPFA 4B7IA 5AZ2H 5GHWL 2Z34A 2UVEA 4FLRA 3MCYA 3LB6D 3K72B 1DDHB 1I85C 1YEIH 3KPQB 4LLMB 4KK9D 1R5WA 4WSGA 4OD1L 3JT2A 4Y4KA 1NA8A 4HWNA 4DK5A 5AENA 5I76A 2R7EB 1W6LA 3VNYA 3PQYA 1YUHA 4FL4C 1MFCL 3A0OA 4Y4KD 2EKSA 1J9CT 7TAAA 3HKFA 4UIKH 3ZO9A 1FYTA 3CC5B 4FQCL 2GY5A 1R3JB 5GRYA 5BPPA 1B0RB 3QNYB 2L7QA 1DL7H 5IMKA 4DKEH 1K4CA 1KGCD 4RDQF 5MENE 2X4QB 2X1OA 2AAAA 3JV6B 2FHCA 2JE8A 4JR9H 2HKHH 1QG3A 3OKOB 1FDLH 3I84A 2WAHA 2HG5A 3ESOA 4KNQA 3P54A 5CEYB 2VSMB 3JV5A 3DV6B 3S88H 1C8PA 2KLTA 5B8CB 4J4PC 3RIAK 4F33A 7PAZA 2DLGA 3KPLA 3CG8A 5I15H 2HVKB 4JFEE 1KPUB 1M71A 1KIRA 4NJ9L 3GINA 1KGJA 1OPGH 4HS8H 5C0CA 2QQLH 4UZSA 3NCEB 3FN9A 3HHRB 3ARWA 3GMMB 4DGYL 3QJRB 3F01A 3VO0A 3C8KA 2O93L 3S3CB 3HCVA 4KKBD 4NNXB 2VKWA 1MCPL 4GRWE 2IJ0C 5DVKA 1HE8A 1QSEB 3B6SB 4IRJB 4R8WH 4D0BA 1RXLA 3GMLA 2ZJSL 3KJ6L 3RVTD 4KK5C 3O8XC 5HGAA 3NH7H 3F04A 3BD5A 4L3EE 3SDCB 3ZXAC 4YL9A 3EFDL 3Q2LA 4P3CH 3BUYB 1V3MA 3AG2B 5E00B 1R3IH 5HYJA 3RZCD 3GIZH 4RGND 4JJOA 4WVRA 1A3QA 2FL5B 3HZ3A 3LKOA 4G8FB 1LM8V 2YGQA 4KH2A 4LDEB 3SYQA 4PGEA 3B34A 3T4AB 4F2ME 4YQXL 3D0AA 2RR3A 4U3SB 1T1YA 2Y3AA 2HJLA 2XC8A 1PL3A 3B3BA 2X70A 4ZFGH 1A9BB 1BQLH 2E9JA 1TVBB 2Y3NA 2Q7NA 5CSBA 3QFDB 4QHMA 3EHBC 4JL2A 2PPFA 2ZSWA 1F6AA 4FQXD 2ZX7A 5GJSH 1UM6H 3IDXL 4NWUL 2Y23A 1J5CA 4F8TA 2IV8A 1T80A 5BS0A 5IVNA 1VKXB 4D7BA 1UQSB 2VLJD 3W5MA 1AI1L 4GKLA 3SKOA 3U6XA 4PWJA 2G2PA 1INEL 3EJRA 1EXUB 2Z31C 3ZDYB 3V0IA 1JPTH 2IAAC 3NK3A 2R1WB 3GHPA 1SLWA 1XGUB 2RJMA 4YJZL 4ZMTA 5BMFH 2YBGA 2VQUA 2XTJD 3PWVB 1GYCA 1F18A 4R0LB 2WNGA 1FGNL 3M46A 3TWYA 3WI9A 1R3LA 4CSPA 3LS5H 4ZNEA 3D4CA 5JIQA 2XKUA 3SO3C 3DSNB 5HVHC 4HISA 2BSBA 2Y24A 1WEJL 5I30L 1GAFH 1XH0A 1DEEA 5DVPA 1MRFL 2X44D 5FO8B 2BXYA 3D85D 2VZUA 5HDBF 5EIIB 3SPJA 3UTSA 1QFUH 4N3TA 4EUPA 1MJUL 3KPRA 3NEEA 1F90H 1SZNA 2P5PA 4LK4A 3LVTA 2C9SA 5HYIA 5HP5A 3EH1A 1K2DA 4YHPB 1A6ZA 4HK0B 5LDUA 3FU5A 2WUCL 3KWWB 4P8QA 2ZUYA 3WMPA 3U9PL 1ZLEA 3BPNC 4JFFD 1XWVA 5KBKA 5AVWB 3FULA 1JWMA 4M4RA 5CINL 1G5AA 3VDAA 3QEQD 4BFJA 2PO6A 1D7FA 2B5IC 3HJ0A 3BP4B 1HOEA 4PB0L 2OXHA 4OT1H 4PRNB 1FYTE 4F3FB 3T6ZA 3SYPA 4WW2B 4QRTA 5C0FB 3IS1X 1WZ1L 3DURB 3L1OH 2H26A 4BXVA 1OD9A 4NZDA 5HHNA 5K1NA 4RFNC 4ZW3A 3UMTA 4N0CC 3VI4F 5F9OL 5JW4M 1IKFH 1JF1A 5DI8B 5LG6A 3JQOB 1LK2B 3EYUL 3F84A 4PYHA 1GGCH 4NIKB 4MX7B 4BV1A 3GWJA 5FF6B 1LMKA 1FL3B 2UWEE 1AKJB 1FIEA 4G59C 4GSUA 3U6XS 3VXUE 3UYRL 1CFSB 1FO0H 4I3RL 1H19A 3L1FA 4G3YH 3QUYB 2CIKA 1OGPA 3FW6A 4XNYL 4LBAA 1H9DA 4WI3A 1EHNA 3X11A 1OVZA 4RFNB 2JMRA 5ELIA 1IZJA 2NNAA 4PJXA 3BSHA 3UJTH 4JFDE 5IJBC 1FAIH 3MLVH 4N0UE 1UCTA 2BRRH 3QUHA 4Y9BA 4YDKH 2GTWB 2UXFA 3VI3E 1G9ML 3VYPA 4TF4A 1CVRA 2DWEA 5B39A 4M61B 3DYPA 2EE3A 2J8HA 1T20A 4UV7L 4XO5A 4LFHD 1JF1B 5DI8A 1CLZL 1P1ZA 2NYZA 2W95A 2VUOA 5E03A 4YXKL 3T0EB 5FLVA 1AFVL 4XO8A 4LSUH 3VE0A 2CM5A 2X4TB 4G5ZL 3U25A 3RA7H 4WNSA 4N2NA 4ODTL 1NGZA 2OI9C 2VXVH 3QNYA 2F1BA 2MCPL 3HFFA 1BWWA 1D3CA 3EG9B 3GRGA 2V17H 2W9LA 4GKNA 4HSQA 4TOYH 5FOBA 5IVZA 3ETSA 4GEIA 4PRIB 4QWWC 1N3NB 4ALAC 1TVHB 3VWKA 5TGBA 3LKRB 4KGLA 2DBJA 4PJ9B 2DJ4A 2IVFC 2XBTA 3EFFB 2YOCA 3ARPA 4ZRGA 4JPIA 2CALA 1KIPB 3HZKB 3TJHC 1CLOL 2QZ5A 2FQGA 3SBPA 1MQKL 3POCA 4HGWB 2NTFA 5HGHA 1DBAL 1XMWA 1OGTB 4XE0A 4UUJB 3ZDZB 3QXDA 4ZTPH 4G8GE 5L8LB 1AAJA 4OM0L 5K33A 1L9NA 1HINH 1I7TA 1RJZB 2X9WA 5FO8A 3C5ZD 3OSVA 4M03A 2QT6A 4G80B 2AJZA 2YQBA 3X13A 2XETA 3UAJA 1ZHBA 4FKEA 2B1OA 5EBLB 4N0YH 1RIVL 2XIBA 2AEWA 4NHCL 3OGOE 5C07E 1NC2D 4GXUN 2CDGB 4WHTA 2BZ7A 4M9OA 1YHPA 2E47A 3OKMB 3BOVA 1JP5A 2GITA 2C9QA 3TURA 5AL0A 1O9WA 4DNLA 3O8XA 2VDRL 3MX0A 2YEZA 1UQSA 1T0PB 3GLEA 3WFHB 2F68X 3OMAB 1FNAA 3DPBB 5K9QG 4L8BA 2YAHA 2ZYRA 2W80C 2XKSA 3H9SD 3HRPA 1CO1A 2ICWI 4EXPX 3SDXE 4BUQA 3BISA 4P05A 1EDYA 1XH2A 4N22A 4P3WA 3TBTA 5TH2B 3U7WH 4GW1A 4P06A 2IAMB 3OL2A 5K9JH 4Y9GA 2Q1EA 3WHXA 2LV4A 2VE6B 4NWTL 5I8KH 3DO7B 3SY6A 3DV4A 4EI5D 1M7DA 1KYFA 3RVUD 2X4UA 1NGQH 4GRLB 4RZCB 1LDPL 2ZXDA 2FEDD 1YEEH 3VD9A 1KXQE 5LLIC 1JRHH 5DMJB 4TNEA 4C8XA 2WIMA 5GGVH 1IC5H 3U9WA 4F57L 5K1VA 2P1YA 5IK3B 2XQBH 2Z64C 1D5BA 1VFOA 4PWFA 1G7MA 3O3DA 3GF8A 2JJUA 3N91A 2ICWJ 3V4VH 2F8XC 2F53D 4ZD3H 2JKIS 3QZLA 4HLJA 3TNNA 1OGAB 2AV1B 3RB5A 3HCVB 3KGUA 4NNXA 3S37X 2WLNA 5DJZA 3S3DB 2XWZA 3LV3B 43CAB 1CDIA 2V3DA 2J71A 4HGMA 2BNUA 5DTFA 4BCYA 5E6UB 1O0VA 4X0KB 3L7EA 3RWFB 3U1PA 3FQXB 2W0KA 3ZZSA 3QB7C 3GMLB 4PS7A 5KYWA 1I85A 4MRBA 1WBYB 2YUWA 1FO0L 2HP4A 3T77B 5C0BD 2EO9A 3I75A 3MJ9L 2OBGA 4WK0B 3OB0K 5AAWC 3H7LA 2BHYA 3LH9A 3UTZB 2Q0ZX 5PCYA 4UOW0 1YECL 1Z5LA 2APVA 3B9KA 1SJXA 3NQKA 3SDCC 3GSRA 3L5XL 4O9HL 3BSZA 4ZFOA 1QSVA 4KJWD 1F6LL 3QDGB 3UYOD 1H3TA 2G5BB 4AQOA 1KWKA 4IMLB 1IT9H 3VFPA 1EFXD 4E9YA 4GXVL 1YMHA 3EYVA 4ZSOB 4YPJA 2DBLH 4Y5XC 4ANUA 4HXAH 4FABH 1BEXA 3FFDA 1N68A 2XKNA 5LBSL 5MI0B 5EIQA 4LPUA 4ENED 3MLXL 5ADPL 4DGUA 4GT7A 3MBEC 3N44B 2BVPB 1HXMB 3SDXA 5ISZD 3DURA 3ZIYA 1RK0A 4Y4HD 5AB9A 4FFZH 4JDTL 2KH2B 4FA6A 5EBWB 4PR5A 4TSBH 4LIQE 3OJDA 1U95A 4UIMB 4YSPA 3UTTA 1MCBA 1WV7T 2ENPA 5IB4B 2EKSB 2C9UA 1NEUA 5DRZB 4IBSA 4KUCF 1RUQL 2J1YA 4HX1B 3HI5H 3TASA 2G2RA 1VADA 5AYTA 1YYML 1OCWH 3UTPE 3VXSA 1C08B 2JV6A 3DVGA 4MJ4A 2YO3A 2HUHA 3KHOA 4Q9RL 5EOTA 3N6YA 4UQAA 4NZ8A 1WD9A 4XXWC 3GBMH 1MLBA 1JN6A 3H3PL 3BVWA 1KXTB 2R4SL 4NM4L 4PVBA 1CT8B 4Y1AD 4Y1AE 3LMJL 3KPRB 1NGPL 4MMYB 5I1HL 1TTUA 4GRWH 4YSTA 1HWGB 3SE4A 2WYTA 1MWAA 4OLVL 3KWVA 2ZIDA 3N0PB 1DSFL 3QK0A 1XGYH 5FGCB 5H37A 4GS7C 5LWYH 2BRQA 3NSDA 4XNBA 1OSZB 1FFTB 1LMIA 2JK5A 4JHZA 5I6NA 1UJTA 3SGDI 3UZVB 4G82A 1XGQA 5IMOA 5D5MB 4OF3A 2CXGA 2EO1A 3FUHA 5HHVH 4UB0H 4MJID 1ZLSL 3FU7A 2EC9U 5IJCC 5JDSB 1ONQB 1HEZB 1AHWB 1RUMH 3BFQG 6TAAA 4PI2A 5DJ0B 3ZL4H 4ZUWB 5BO1L 4UV4L 1KJVA 2KDGA 1TOXA 2VDNB 4EJ1C 4XBEL 2B7DT 5IIEB 1XMEB 3SE3C 3D2UB 2X4SA 2IBGA 1MWAB 2Z1KA 3GSOB 2DMKA 3OXRB 5CJXA 2R2EB 4PGCB 1BD2A 1NIBA 4XN9A 4M6NL 1IE5A 3FN0H 2H1LM 5I71C 5EORH 2FVNA 2K8QA 1A1MA 2EDLA 4PBVC 2OXGA 1A5FL 2DQGL 2WBXA 3L4XA 4NQSB 4HWEL 4P49A 5I8OL 4PG9A 3W81A 4PJEA 1LILA 5KYWB 4KO9A 4ZUTA 1CTNA 4DEWA 1MEXH 4W93A 4O00A 2VITB 2ZPKL 4HZAA 3S5ZA 3K2UL 4XBMA 3GKWH 2KZKA 4NO3B 2HMIC 1CYXA 2Z8VC 3CDZB 1F58H 4G8EA 2EYTB 2D3JA 3QO1A 3MBXH 1ZGLB 2XBZA 3C6LC 1PG7W 4U05A 5TF1H 1VFMA 3TBYA 3VX1A 5FHBH 3V7AG 4YPGB 5GJTL 3WTXA 3TEWA 2BVOA 5CEXA 1V7MH 5C3IA 4LHUA 5DHMC 5AZ2L 4KAQL 3QO0A 2VRAA 3F85A 4LSSL 4DO5A 1QEXA 1F86A 2WPGA 3HI6H 1S9WA 1D9KA 1EANA 1SHMA 2HUEA 2FAUA 2XKNB 4Q0XL 1DBJH 3QEGL 1HDMB 5FA3B 4OI7A 4Y2OB 4QMEA 4ZFZB 4KQ4H 3RVXC 3GLAA 5DHXB 3PWNA 5ACMA 2OMXB 5D2NE 3NDYE 2ESVE 4JN2A 4UM8A 1I7RB 1KEML 2XTLA 3KLKA 4GUPA 4O58L 4WI9A 4ZUSB 3ZIMA 4HAFA 4Z3TA 3CZNA 4QTHB 3PAZA 1F8TL 5CN3A 1G7QB 5CF3A 4XVSL 4PUBL 3MTXA 1EX0A 2CUAA 2G30A 3OPZH 1HQRB 1RUPL 3CQPA 1JWUA 1Y6MR 3CZFA 4NN6C 3PL6A 4LDLB 4R96B 4X5WA 1AXIB 3ISYA 5LQBH 1OP3H 2DW5A 5E9AA 1W8OA 4F8QA 4N2GA 3QWRD 5I1LB 5ID0B 5DVNA 3FO1A 3WXVL 4JFWA 2XN2A 2FNBA 3D30A 3QISA 1F4WL 2BSTA 3C9NA 3QA3B 1UC6A 3D1MC 1N0LB 4NI6A 2GAZB 5A7EA 4X99A 3X3FL 3L4VA 4WIQA 1DSWA 1MH5B 4E9WA 2PCPA 2XPYA 4N4YB 5J8OA 2FSEA 5CJBA 4L2YA 1BM3H 1HOCA 1R5WB 4NKOA 5C0FA 2I60L 2JB5H 3H4HA 5JHDE 1R9FA 3WNMA 1M9WA 1RZIB 2V9QA 3L13A 1OSZA 1SXSA 3KS0H 4N2LA 2V5TA 3KD4A 4O5LH 3ZRFC 3EF7A 3PWLB 3LNDA 1TSRA 1T5WA 1ZDQA 2BNQA 1F6AB 3IN2A 3QFJA 3REVB 4DFIA 3VGEA 3IGUA 4I48B 5EZIL 4DAGL 3EFDH 2X1XR 1HWWA 3CN1A 2F54D 3LAFA 4JO4L 3AABA 4L4VA 2J88L 1XR9B 4ZMXA 3HBQA 1NFIA 1X5YA 4JM2F 3AJ7A 1NBZB 4JG9A 1A3LL 4OBRA 3VI4A 4E5XB 5TH2A 2XX1A 2PW2B 2FYVA 2VMCA 3TIDB 1DQQA 4QJ4B 2H5UA 3AU0A 1K3ZA 2NMSA 1KUMA 3MV8E 2G2RB 2D3VA 3QPQC 3B7UX 3QUGA 1KYUA 2C7UB 2XWTB 4APQD 3SOBL 2C1PA 3FC8A 1MIEH 1BECA 5H2BB 1RPUA 2IFFL 3IBOA 5D70L 3Q5TA 2X1PA 5D93B 4EI5A 4PCTA 1NGZB 4PHZA 3MFGB 1XF5B 4V2CB 4PRDB 3TCLA 3NZ8A 1JJUA 3MDJA 4Q6YA 2VDKL 4EZKA 5IBTH 5IGXH 4J4PD 5I18L 3IDUA 5IQ7L 3PQYE 2QSVA 2VLJB 3QPKA 3N44F 1Y1DA 4Z7VB 4D8PA 1YEWA 5IFAH 4Z3JA 5BMFL 3DDGA 4KMTH 1L9MA 4WW1B 3BAEH 5F72S 1H0DA 2H7WA 3CC1A 4IRSC 3ZLQC 3EH3B 2KUTA 4D9RD 1HYSD 3WAJA 4EVNA 5FYKE 5KG9B 1KC5H 3H2WA 2CHWA 3HVDA 1G9MC 3CVDA 3DXAE 2NDGA 4R5VA 1T22A 3WL9A 4L18A 3FT3A 3JWDH 1P7QB 4HC1L 1A6WH 4HGWA 4YGVA 5IEKA 4HU2A 2MHAB 3T77A 5FF6A 1T4KA 2VDNH 1OSYA 1ECYA 2HPOA 3IFOA 3PWNB 2DPKA 1OAUH 4TRPL 5AW8B 3VA6A 5IQNA 1W72A 4P4KD 3INOA 4KK9C 3B43A 2X10A 4P5KB 3SDDB 1UEMA 5K9OA 5A2CA 4OFKA 1CICD 2OK0H 4KI5C 1DVFD 1GY2A 3B9KD 3P73A 3TIEB 1GGTA 3EYOB 3BWZA 5JO5B 3PXHA 3FT4A 3GIZL 4WK2B 4JJHA 4KROD 4HUNB 1E8WA 5D6DC 4PJCE 1I1FB 4A6YB 4PWHA 2HJKB 5I66A 2F0CA 2D2CC 2DLEA 1JCKA 2D7NA 2W38A 5CGTA 1G7PB 1DQIA 2ODHA 3DTXB 4HPOH 5IBUG 2ADGA 1VACA 4FGMA 2MPAL 1RLWA 3BXNB 1Z3RA 4Z18A 2A9BA 4RA3A 5GGRY 2LTQC 2NW2A 2WMPB 1TETL 5JHLL 1FNLA 4FF9A 1S5HB 5ADOH 2DWEB 4QF1B 2DMGA 3TV8A 4UNTA 5AWNH 1X44A 1DLFL 4PS3A 2H8PB 1IBYA 4MAYC 5FX3A 1RAMA 3K6DA 3WHXB 2O61B 4WO0A 1JV2B 5HI5D 3HG3A 1HHIA 2MJWA 5IB5A 4YS4A 1P6FA 5E95B 2WVVA 3IDMA 1QSFD 3EDFA 3T9WA 3T2PA 4NQDD 5AB2A 5KSAA 1T2XA 2GUYA 4FHJA 3KPSD 1BXAA 3QH3B 2W81C 4HS3A 4U1MA 4N28A 4DUVA 1OSPH 3U4BL 2XXGA 1U58B 2CBTA 3H56A 3SOTA 3SE9L 1IL1B 4MJIB 5AVUB 4JGNA 3PABA 1YAIA 4HWZB 1XSOA 4M56A 1QA9A 1QBLL 3ZYZA 3L3GB 1KLGB 1BMZA 1UACH 3DI2B 1V27A 3ECBB 4IRSD 3ARGA 4G1EA 5C0GB 3C09C 1MAJA 3BPCB 2J6EL 5FYJE 2VLME 5J3HC 5FYJD 4PJ5B 1SEQL 4NN5B 4TPRH 4M7LT 4X5LA 2QGDA 2VR4A 4XB3A 1FZKB 3LSOB 1KXVA 3MNDA 1L3WA 5FO7B 4NPYA 4YX2H 1E3FA 1AYOA 2NW3B 3NQIA 1PLBA 2EEAA 4TUKL 2FT7A 3L8QA 2A9MH 3Q8EA 4WUUB 3VFNA 3WIHA 4FX5A 4U1NA 1I7TB 1B3IA 2XQYA 3UBFA 1JPST 3GXIA 1R24A 4MNQB 3ZW3A 1KPVB 5CM1A 2CO1A 2D7QA 2Y6SC 4PRID 1EHAA 4DERA 2F5AH 2J44A 2P24A 1JYVA 1D6EB 1I4FB 3GTVA 2IDFA 3DHJA 4Y1AB 4ZX6A 5FW6A 1M2VB 2QR0A 4D8OA 4LSTH 2G3MA 4ZK8A 1ASQA 1T3FB 4LPWA 1MIEL 1V8HA 1PNDA 1JMXA 3HC3L 2BFGA 4U4IA 3RX5A 3DUSB 3MODH 3OR6B 5IVZB 1EJOL 5FOBB 2LVCA 1HL5A 3M1BA 1JRHI 1C1EL 5FEBA 1KSRA 3C2AL 4AYMC 2VLRB 2PCFB 4XPTH 5AUMA 1OHQA 2I7OA 2IAND 4TUJB 3ZE2E 5IEKB 2VDPH 4WFFE 5EMYA 3QZMA 2OTUA 3ARDA 2WTPA 1LNUB 4QTIH 3NN8A 3B2DC 1QLFB 5IFAL 4JZOB 1KTLB 3JTSA 1B2WH 5JPNA 2YEQA 3VB9A 4HT1L 2DY2A 3ZUCA 1YJDH 2JJVA 12E8L 5EU3A 2GVYA 2P7TA 4PJIE 5EC1B 3U2SA 3V5HB 5CP3A 4E41B 3D5OF 3NFNA 5IW6B 4PVLA 2HH0H 4JFFA 2K4WA 4DESA 4FHKA 3TBVA 3N0AA 4YNYB 3R4RA 2H41A 4IKIA 4MHHI 1YEGH 1AS7A 4KTYA 3FO2A 1B4JH 3QUZA 3Q5OA 1AR2A 3HAEG 1KZYA 5A1AA 1CFSA 2WBJD 3QJFB 2A73B 3DYOA 3L4WA 2HFEA 2OCCB 4LEXH 2JJTA 2ERJB 3OXSA 1KTDA 2OSYA 4NQTA 3RNKB 4B97A 3D34A 3OAZH 3D85A 4UAOB 3VXRB 3W11C 2OK0L 3PJSA 4MX7A 4AY0A 2BVYA 3CC5A 5ESVA 2Z7UA 4JB9L 1OALA 3OR6A 4S1QH 4HJIA 3K8KA 3IGKA 4B50A 1C5DA 4FZEH 5GRUL 3UEZA 1NJ9A 4X7TA 5JLZA 2QQNL 4P5RA 3BWAA 1Y18B 5F7DB 1IQWH 2R56L 4WCYL 1MREL 4G6MH 5I8CA 1CLOH 4ZAKA 1KG0B 2OJZL 4KWUA 3UJJL 2BVUA 4QAWA 4EN2A 3MXVL 5E2TL 3V2AR 4ZD3L 1E40A 3QRBA 4RDQG 1OB1A 2NLJA 4UWQB 5EF2A 5DEGA 2AHIA 1QFWH 3KE0A 2DQUH 4G8IB 2ZXGA 3RVVD 1YEJL 1XSKA 5K59E 2BSED 5E6ZA 4C57C 1KDIA 1BQUA 1C5CH 4LXFA 3FCTA 1K8IB 2CGZA 4XB8A 4ABQA 3DRQA 3SYCA 1RZPA 1QRKA 2IADA 3CSYB 4MTMA 2NOYA 3T3MB 1QBAA 4HD9A 3FUDA 3RGVA 2EILB 4PJ7A 1KB3A 3AM8C 1Y18A 4FG4A 4RWYH 4EI6B 2GSGB 1N8ZA 4XMXA 3AT8A 4PJBA 3CFEA 2XY1A 5DO2D 1P5UA 5EB9A 5DJ2A 3D51A 4MXQC 3CFBB 1PLAA 2XFXB 3L5IA 1ITCA 4L1DA 2IBZY 4LKCB 5IWLC 3I6SA 3DX6B 3I9IA 1GZPB 4GSDH 1T0NA 3X14B 5M95B 1LO2L 2WNXA 2WXIA 4L3CA 2ICCA 3W0WB 2MKWA 1A3RH 3ZTNL 4K71C 3MROB 3QXAA 4PW3A 4N6RA 2YUXA 2GHWB 3KH4A 2AJSL 1D5ZA 5DJ6B 1F1DA 4OM1L 2DQEL 4Y7OC 3B5GA 4GUPB 4ZDHB 3HI1B 3RVWD 3W57A 1E9QA 2Y25A 4OB5L 3BLKA 3OJMB 2ENSA 3QULB 1NLBL 4KXBA 5D1XC 1ZT1A 4WWNA 3ZR6A 4JRXD 4Y2OA 3NJJA 1P7BA 4A7UA 3PAVA 4XNXH 5E1AB 4TSAH 1B0GB 3MREB 4HKBB 3V4VA 5CJ5A 2WGXA 3ECUA 5JPNB 2Z91A 3DNKA 1GC1C 1HSAB 3I2CH 5TD4A 3T0EE 3V6BR 3NN8B 3J07A 4Z7UF 1KGXA 3NVQA 4FA7B 1AP2A 4L4JA 4JGUA 3QC6X 5AZUA 5I1GL 2ALAA 3RDTA 3WTTA 3H42H 1AE6H 2X9YA 3MV9B 4TV3A 1IGYA 4XCCH 5D1XB 1G9EA 5KVFH 1UB6A 1R17A 4DP1X 5FKAB 3FPXA 4NUPA 3B9EA 4NZRH 2H1PL 4KFMA 2VRQA 4NDMA 3BEVB 1MVUB 4GKNB 3FB6A 1KELH 1RURL 3NT0A 1JZEA 1U36A 3NCYS 4PH8A 2B5IB 2MHAA 2P24B 3HUJE 1AIFA 1CQKA 4WFHD 2IQ9H 2FH6A 2OMUB 1G7HA 5DC4B 1MWAH 4WV1B 1Z9MA 3BPOC 3P4MB 1XXFC 1OAJA 5AG8A 4BK8A 2VJ8A 1R24B 1RJCA 3IMWA 5E56A 2V2WB 5F7YC 2FCBA 3MPCA 4PY7B 1D2PA 1T1WA 5AKRA 3V6OA 1M3IA 2WNKA 3C5JA 1VRSA 2CO7B 3QRLA 4A7SA 3S2AA 2BSCA 3RIKA 3WKNA 4UQ3B 4HXAL 4N5UA 2VQ1B 3DJRA 2ENYA 2FWOB 4ADJA 4B96A 4ZNCD 5CEZL 3X12B 4RGNC 5E2WH 3U83A 2B16A 3QDJA 4ORGB 1ACCA 5M94B 3MLXH 5CIPA 4L0YA 1SF5A 1KJ3L 2JLPA 3DYMA 2JELL 2A83A 3KYKH 1C12B 4Z0XA 2WTRA 1XF5A 3HNSL 2PCFA 4I89A 1SRDA 4O2CB 3SBWA 1R3JA 3STLB 4W4OA 4B9CA 2DQDH 1UYWL 5AEAA 1M56B 3CXDL 3MLUH 4EIGB 2FBRA 1P4IH 3D7PA 3MRMB 3TCXA 2AEIT 4NQED 1HKFA 2QGBA 4WEEA 3D4ZA 4I18C 2YPVA 4NGHL 3JWOL 3NGBB 3QZBA 3VG0H 4DK6A 1Z0MA 3KG5A 3ESVF 3VVVA 4CKVX 3AC0A 4DJMA 1ZGLP 5JXAH 4JANA 3U7AA 3WLBB 3FUJA 3EGSB 1D5IL 4OCXH 3ZHDA 2BVTA 2A9DA 4W9FC 1FE8L 1GS7A 2DQUL 3C87A 1UATA 3MRPA 4DP4X 2WWMD 3S5LA 1JHLH 4U1NB 1C5CL 5FO9B 1F02I 1R0AL 3PIQB 1K8DB 2RFXB 3KWWA 4Y5XA 4AEIH 3CFTA 2NW3A 4IK6A 1L6XA 4KQ4L 3QQ3A 5EU4A 2BK8A 1FZKA 1X5KA 5HHMD 5C09D 2J8UF 1A64A 2B1HH 4A6YL 4NQUA 3ULVH 2ARWA 2AXFB 1Z9LA 1HOCB 1X5JA 1FNFA 2EXWC 1ZLSH 2NY3C 3B9KC 1LHZA 4GO8A 1HSBB 3FTYA 4FKHA 4UT9H 1KJ2A 2CBOA 3GZOA 3VFVB 3DMMA 2VLRE 4KKAC 2C3HA 3V52H 2ZOUA 4XOBA 5EUKA 4BZ1L 4ZS7L 5D1ZB 3LB6C 1G0YR 5AKSA 4CADB 4XRCA 3D85B 3VXRA 3B9VA 1UUNA 1VZIA 5D4QA 3T5WA 2V4LA 3RFZA 5IB1B 4OZFG 4K3JL 5JYMA 4BDVB 2CLRB 1SYSB 5J06A 3FN0L 1O7DE 4WY7H 4YDZA 3TPKA 2KHAA 4OGYL 4K94C 3VFUA 5AVSB 1XIWD 1Z5HA 4ELMA 1L0XA 3SKOB 1RZKC 3WY3A 4F15C 3VDBA 1G7LA 3ABZA 4RFOL 1NIEA 1P6AB 4N5ED 4R0LC 4KDVA 1HXYA 4PJ9C 1MZYA 2V6HA 4N90E 3DX4A 4YBLB 3TS8A 2YHGA 1BLNB 3SGJC 4YDJA 2I9TB 3HNVH 1OB1B 2EIKB 4NNYA 1KTLA 1SOKA 4ONOA 2H0PA 3BZEA 5F21B 1NUNB 3I6KB 2NNRA 1KMGA 1IEBA 4CAGA 4BE6A 1UZ6F 5C7XL 2B3IA 1YEKH 1MW0A 2QL1A 2GJ6D 1RZJH 4G11A 4PVNA 4XN1A 3IDIB 1E4XH 4FQIL 4YDVA 4YE4L 4G8GD 5D9SB 3ULSA 3ETBJ 1IGJA 1BOYA 2OZ4A 1C5BH 5DK2A 4XOCA 4BFOA 2EVIA 3TO4A 1LP9E 2R0ZH 5D2NB 2ARJA 1HT6A 4W6YB 1KF9B 2X0UA 2K8MA 3NPSC 3L3HA 4P5KA 1FG9C 1RZGB 4XMLH 1BOGA 5B22A 1RJLA 4GI6A 1IFGA 2ED7A 1ZJAA 4KI5E 1X9RA 2Q20A 1J9TA 4JY5H 5MENB 1WA1X 4AYGA 5DR5H 1Q72H 3O4OB 1TJIH 3C8KB 1RFDL 4PP1C 4GW1B 4Z7OF 4LLUB 5EU7C 2FBJL 3R7QA 5IG7B 2I24N 2R51A 3WL9B 4DTGL 5C1MB 5IB2A 3H1ZA 4X8CA 3T0DA 3BKCH 2YOAA 3K2KA 3QORC 3UJIH 2EYRA 4MJJA 4QKXB 5K9QI 1MCEA 4DKFH 1JHTB 1OAYL 5HVWA 5ICYA 2WP3O 3O0LA 3T1FB 3TONA 4AZ8A 4C4UA 5CEZH 3ZDXB 2Z35B 3TA3B 4NQEB 4WI6A 5B38G 1QEWB 2WXMA 2IG2H 3NSFA 4A38A 3KLHC 3IFPB 1TNNA 1EZUA 2N1TE 4YBLC 3RHWK 5TPWL 3Q13A 3KW8A 3C5ZA 4M8UA 3SDAB 2BY2A 1QHOA 4MAYD 5LCVA 4PJGF 2PMZA 3NZ8B 4KKBC 1Z9OA 5SX4I 5GGTA 2W65B 4U1JA 3IMUA 3EGXA 4X8GA 3VH8G 4KDTA 4J3TA 3WKYA 1EMTL 2WLIB 3II3A 4W6XB 4S11A 5GZNA 5HGGS 4QYAA 5FK9B 4G5ZH 5IY5B 3CFBA 5I1LA 2H1XA 2ADFH 1YUHB 1H3PL 1QABA 1W8EA 1VF5C 4AQ1A 4EO5A 2EXTA 4B9YA 4JFDD 2BMKA 1E30A 4PJ8A 4WJG3 5JHDA 1QKZH 1JTTA 4EZJA 1OF2B 4NQCB 2H3KA 2NX5A 3O4OC 4LVHB 5HI3D 5TFSL 4QXUL 5K39B 1PU0A 4JFYA 4ELDA 5FKPA 4GI9A 4JM2D 1OP9A 5J9PA 3MN8A 4DOHB 1LWRA 1ESOA 3L3OB 3CH1B 3VXSD 3WJJA 5DWPA 1M2OA 4ZFFB 4FEMA 3EJJX 3MZGB 1KBGL 2AJYL 4WUUA 5KVEH 1RSFA 3LDBB 3WV0A 2Y7MA 3NJMA 2NT1A 2Z92B 3GI8H 4NQDA 5EFIB 1K4DB 4BJLA 1U95B 1IAMA 2EDNA 5DZNA 4NXSA 3X2QB 4LCUB 4ANKA 3DJZA 3MRNB 1JXFA 4UT9L 4BGDA 3KYOB 1I9IL 4S0SD 5ICXB 2OJEA 2ZWSA 3KCPA 2FECL 4OGAD 1SLXA 2VDMB 3KJ4B 3P73B 4K7FA 1E7VA 4PB9L 4JCLA 1U8NA 1RULH 3INUL 4FFWD 4PJDE 4OUUB 4GMSL 3QQ4B 5DMKA 4K9EL 5F89A 5IOPA 2JQMA 5E24E 4Y16B 1UD6A 3AM8A 4H2CA 4MMXC 1GL4B 2ZP0T 4KROB 5GGQH 4DPBX 1JZ6A 4JLRB 4NIYE 2E4TA 2VN4A 4AQAB 2R4RH 3ZRSA 2A74C 4MJ6B 1RZ8B 3LN4B 3UTQB 3BSZH 5A2KH 1UXLA 4CN6A 4NERA 4IBQA 4GSQA 3PWJB 3SPHA 4M48L 4MKMA 3ZTJG 3QBTB 4PYGA 4HPHA 1Y7VA 4OZIA 1RJLB 1A6VH 3MRRA 5I23A 4NP4L 3M1OA 4TN9A 4L3FA 4LCWA 5IB3A 4GIPD 3BGMB 1OKEA 2JNZA 5KVEE 2O5ZH 1RZJL 1HHKA 3MC0A 2FHBA 3HS8A 4LO9A 1JRHL 3EHBD 4F7KA 2Y1ZA 3OKNB 1A2YB 3GUFA 3W56A 2QELA 2WZ5A 4G1MB 3RWJB 4OZFA 3L9RB 1SHWA 2ZUTA 4JUTA 2WZPA 3ZE0B 4KKPA 4WHYG 1DSYA 3G5ZA 4AG4L 4V1DA 2IDTA 2UYLA 3BDYH 3I3BA 3DJTA 2ICWA 15C8L 3JTBA 2BH0A 3OAZK 4V1DD 2FJFB 5MEQB 5B3JE 3NJFA 3A6BL 2VXQA 1ZLUH 2VQ4A 4PJEB 1HZHH 5EN3A 4KITB 1WRFA 5EZLA 5SWSE 2QSCL 3RKDD 4LVOB 1FBIL 2WQXA 1E4JA 2BC4B 1C08A 2A6IB 2R1XA 5TDOA 4BKLB 3H9SA 4OZGA 1QP1A 3LEVL 4ZTOH 3SD5A 5GGSA 1I82A 3FUEA 2EH8L 3BVTA 5ESAA 4L3ED 4GPVA 2HT2D 3UZQB 1X5HA 2Z31B 2JCCE 1CFNB 1YPZA 3DA0A 3NJXA 4YLQT 4H1LB 1CF8H 3BP6B 2OMVB 3OJDB 4U6VL 2NQCA 3UTTB 3WFCH 1M1XB 2H32A 4J39A 4WO4B 3H9YA 1T1XA 1YQVH 1AO7D 1F41A 1IT9L 1YEDA 2VDML 1QBLH 2Y4SA 4L37B 3WN5B 1XTMA 3HMXL 1SF3A 3CZGA 3IU4L 2VN3A 3AY2A 3O4LA 5HGBA 3ZDZE 1WZMA 4AENA 3O2VH 3TCLB 2HT3C 3QIWD 4QHNA 1ZTXH 4HHAA 1KPRA 2YGVA 2JFCA 3MAWA 4G8GA 4UQDA 1X5ZA 3ZDYE 5ADPH 1DP0A 1K4DA 2W9EH 5HD8D 1IAOB 4AITA 1VKXA 4U1MB 1JGEB 1HK6A 3HN3A 3REWB 5JORA 1T6BX 1RJZA 4EDWL 1Z7JA 4JRYE 1OF0A 2J21A 5KJ7E 3RWCA 4FZEL 4NFBA 5GISL 2WXKA 5IG7A 3QJXA 3BPLC 2CNYA 1HHIB 4YFDB 3LN9A 3FOLB 5DRNB 5I5IA 4S0HA 1JMZA 5I6KA 2YKLH 4ACPA 2R2HB 2QEJA 5I1CL 2X88A 2XN1A 3M17A 4AIXA 5C0AE 3WKML 1MLCB 2ZYHA 4FQXB 1WO2A 3ZKXB 2IQAA 4FNUA 4MASA 4JAMB 4PJ5D 1E8XA 1CR9L 3P9LB 4NKMB 3RDJA 3SY0B 4GP4B 1JUFB 1E6OL 2OMWB 3NSCA 4MS6A 1NDGA 4FXGB 3RX7A 1IAOA 5T1DH 3EG9A 2VGLM 2YWYA 3TN0D 3NESA 4HWBL 4TNWF 2VUKA 4LIQH 5AALA 4BQ8A 5KTEL 4KI1A 3O4LE 1ZLUK 5HGBB 1C12A 4Z0XB 5JXEA 3QZWA 5E8DL 4FCHA 3QRFM 4IU2A 4PJ8D 3RUGA 3SGEH 4J6IA 4NNYB 5C09E 4NT6B 3RURA 3BZEB 1JK9A 1K5WA 1BLNA 4NO3A 2P5EB 2P26A 1F11B 1E65A 5HHVL 2AI0L 2RA1A 4AM0Q 4F37K 4S1DC 3BCDA 1UHVA 1JZFA 3DV4B 2E7LA 3WIFB 3GFUA 1KACB 3WKQA 2BCKB 1QLRB 5EC2A 5AAPA 3TBSB 4Y19E 2J55A 1ACYH 3HBPA 2EADA 1J86A 3EW3B 5HHOA 4NPJA 3FONB 4K23L 2CO6B 4GFTB 2DI7A 5I0ZA 3WO3B 1G7HB 3EIFA 3I75B 3KM1A 3KXFD 4J8QA 3CMGA 1F3RB 1LO0H 4JKWA 4DW2H 2GJPA 3B2UD 3C2SA 1KYOK 2F15A 1ZA3B 2WN2A 3CHSA 4MCZA 3ZKNC 3V5HA 1FYTB 4PJ6A 5DO2C 1J18A 5DT1H 2QTVA 2P5EA 5JDSA 5DTFB 5GRUH 4YHML 4JZOA 2YMXL 3TP4A 1OWWA 3QNFA 1AQKL 4GAGH 4P2RB 4QIRA 3C5SB 5C08B 4Z3IA 2WYHA 3RWHA 1KB5B 1HEHC 1SDDB 1EEYA 3UJJH 4UQBA 4Z23A 1DFBH 4OJDH 3CGTA 2FATH 3C60B 4LNRB 2PYEE 3F2LA 5IR1B 2UWEB 4MZRA 4MMXB 3PHAA 4I4WA 4LCWB 1IKOP 5CXPA 3P3TA 3WTVA 2DWSA 4P23C 4GRLA 4RZCA 3P2TA 2EVJA 2M83A 4MA3B 4B9ZA 4LDOB 2V2XB 3HHSA 4L8CA 4PHXA 4JEGB 3DO7A 3TJHD 4ODSH 4H25B 3N06B 1RURH 3NIDB 1XGPB 4HK3N 2WO3B 1TLKA 3PQYD 3BP7A 3OX8A 5AVVB 2V7HB 3NJNA 3BKYH 4HH8A 7CGTA 1VA9A 2CRMA 3U36A 3I9GL 3KZ8A 3QDHA 3EOAB 2BNRD 1T5WB 2I69A 1I7ZB 5JORB 3D05A 3VFNB 2ILLA 1ZSDA 3WLWD 3GSQA 1HILA 4XC3H 3W11D 1SN0A 3US1A 2BPBA 2GIXA 3MRQB 1HQ4A 3OR7A 5CGBA 5TF0A 4O2EB 3ILQC 5F9JA 4W68A 3L3KB 4IJ3C 1SQ2N 3KL0A 1E3XA 4HIXH 4JDZA 4BRVA 5FHAL 3L45A 1AFVH 1FNHA 3HE7D 1MELA 4EI5C 4Z78B 4CUCA 4LU5L 2IGFL 5H4ZA 4PJ7B 1NDMA 2ZKHL 4J3OD 5I75C 4OM1H 5E2VH 4WLCA 2L7UA 3SDDC 5CMAA 2R2BB 1GC1H 3P9MB 5D7HA 2Z92A 4ZZFA 4G80A 4MJ5A 5TTRA 1LD9A 4YXHH 1TQTA 1WCBB 4X4ZA 3FXIC 1MI5D 3LPWA 2VMDA 1E4KA 1UT2A 3MLUL 3UTTD 3G6AA 3NTCH 3V6ZA 1MFDH 3HAEB 4JFDB 4G7YH 3IJ8A 3HG5A 4YOKA 5IROA 3BP7B 1CL7L 4XCEB 3S96B 1HZKA 2ITCA 3TFKD 2EDMA 4J27A 3LD8C 3MGOB 1LLAA 3VFGH 5H4YA 3LQAL 1XAKA 5DRWA 3IU3B 5E8PB 5JXAL 2NY4D 3SZKC 4L5FH 2WXGA 1J5IA 4JFOA 4KZDL 3RJDA 5DHYA 1MJ7H 4UU9A 1ZAGA 1ZT4B 3BH9A 3FT4B 4B5ZA 5J6GA 3ZL1A 2X6BA 2ZXCA 2AEOA 4HFUH 4MAYB 2OKMA 2V3FA 4HOMA 4EF3A 3ARBA 4Q97A 3V55A 4LESA 1CG9B 4ALAH 4RVBA 3MRLB 4Q56A 5SWZE 5HYQB 2WTRB 1BQRA 4K3DH 4LASH 2WSKA 1AQMA 3OXSB 2WOYA 5D71L 2VISB 5E6YA 3I6KA 1JSYA 1HXMA 2YUVA 3MNMA 4PMEA 3T0EC 3U79A 3AXLB 2ATPA 1BVNT 3LIZL 5IB3B 3IEAA 5I5MA 3ERXA 4TLKA 2W0PA 2VDQB 2KQNA 4M4RB 4K5LA 4JE0A 1ADQH 5J89A 1Q9KA 1IQDB 3G5VB 5IQ7H 4ZX3A 1FORH 2WN3A 3MUGA 1UJ3A 2IOIA 3SJVB 3FTZA 2GTQA 3IRPX 4G2AA 4LVHC 2DQJL 5DUML 5DZVA 1QFUL 1WAEA 3DIFB 3CMOH 2MOQA 5BZXA 1F4YH 1H15A 3M7FB 4ICWA 1UXWB 4LLYB 3GMRB 2YSTA 3C8HA 3K0YA 3EZ8A 4A2DA 4H4NA 3HEIB 5CZXD 2AABL 4RESB 1XL6A 1J1PL 2UY7B 2OMZA 4LQ1A 4GXFA 1WF5A 4N2DA 4AI7A 3D09A 2NNCA 2ZAGA 3TNMA 1MJJB 4P2AA 2YMXH 1P5UB 2LGNA 3A5VA 3AB0C 1Z1WA 2CK0H 4XOAA 1JK9B 5I76B 1MCNA 5FWQA 3ASNB 4YK4C 3G08A 4LQFL 2AXFA 1NAKL 3W39A 2PTTA 5I19H 1M6UA 2NY6C 3LHPH 1OT4A 5KUKA 1I7UB 4GEJA 3PP4H 5C7XH 4RSVA 1A6TA 4PJBE 3BC9A 2XN9A 5FUCE 5LNDA 3GGWB 5DMGC 4AZUA 1TQWA 1JPEA 3GMQA 1ORQB 1VZHA 2NXYC 3PWPB 1Q8MA 4AT6B 4AQEA 4OFVA 3T2NL 1U93A 3LKPB 5D93C 1A6PA 2AQ3A 2XRAH 5F1KC 3FL7A 3OV6A 1ZT1B 4ZNEE 1Z9NA 5HJDA 4I8DA 4GI8A 3HMWH 4PRPE 3NJVA 4AYFB 4EN3C 4EMZA 3LNFA 4YDLC 2Q7AA 5FM5O 1JG9A 3FK3A 5L4JA 1JTPA 4XNZB 4XNDA 4PLNC 3ELAT 3ILPA 3F7VB 3REVA 1L6PA 3LKRA 2JJSA 2NY0D 1CN4A 1TVHA 2WLLA 3FFCE 4TQEL 3V52L 3I3EA 3F6IA 4AQ8C 3PDOA 5C0NC 4CW1B 1L9QA 1JZ8A 4Y4HA 1PFCA 4XR8C 4N8VA 5D7LB 1IAIM 1WGOA 3DRTA 2D7OA 4UF7C 4FULA 5KYUA 3S3SA 4E41E 2CGRH 2NY5H 1MUJA 2E7MA 4D9QD 4PU2A 4OFQA 4D9QE 3VWJB 5KSVA 2B14A 2KERA 3VH8A 3QJUB 1UA6H 4N9GB 3WEXA 2R15A 3BKMH 4U1HA 1I8MB 2ODIA 5HJ3A 5DYFA 5E4EC 3FCTB 3CWGA 1VDGA 1ZKAA 4RFOH 5EA0L 1IM3A 2WXLA 3EDKA 1M1SA 2Q3AA 1I8AA 1JXKA 1T1WB 4AL8L 3KJ6H 3FCUB 2F74A 1JVKA 1EO8H 2YJLA 3P30H 2P5ED 4UINL 3SGKC 4PV1C 3AXLA 3TJEH 4U1KB 1A9EA 1QYGH 2J5LC 3N9GL 3V6FA 1AD0A 1KIQB 4URTB 4ANVA 1DQML 4WV1A 1E27B 2HX8A 1G0XA 1NKGA 1JDAA 4Z0BL 4B6ZA 1UD2A 1DQVA 1AKPA 1QZ1A 5TDPB 2D3LA 4LP5A 3KVPA 2J56A 4DT2A 3QCUH 5TFSH 3WS3B 5IBUB 1QUNA 5LO7A 4UAOC 4X4YA 1IGIH 1U3HC 3HE6B 1X5GA 1I31A 4U33A 5GGRA 1O7VA 5D2LA 1HCFX 3A4FA 3OB8A 2D03H 1XCQA 4WW2F 3LEYL 2X2UA 2WV3A 4OCRH 5HGAB 1NMAL 3B3IB 4PJ5E 2P44B 4B5EA 1UASA 2O6PA 4U1LB 3JVGC 1QHQA 3FSWA 1HHKB 3FSVA 1BZ8A 4HUVB 2DI9A 3FT1A 1IBBA 1AD0B 1KIQA 3OAWA 1TO4A 1T22B 2QADC 3D25B 4XPGH 3HS0A 1MDAA 4LCCA 4PJAA 4LL1A 1VCAA 1RUML 4KVCH 2ZCKL 4JPKH 4GAYA 1PZDA 4HJTA 1JV5B 2AXGA 2GTZB 2KKQA 5MEPB 1I8KA 1Y0LA 4P5MB 3FZUD 4B3VA 1TQUA 1IIIA 2HSIA 3QS3A 1L5GA 1CI3M 1SYVB 2NRDA 12E8H 2WAQA 4R83A 1T2QL 1BVZA 3V10A 1LE9A 3S8WA 4PJIB 3BIKA 1GAFL 3PJNA 3T0WA 3UL4A 5HHPB 1KT2B 5B4MD 4QJ5B 2B8OT 2NZ1A 4P5TA 2XG5B 3WNJA 3BW9A 4GQZA 3SEPA 2ZUQB 1HX0A 2UX6A 2DQGH 2KQMA 3MKKA 3F6JA 5MEND 4PRPA 1BBJA 1B0RA 3IK2A 1URIA 2JK5B 4KQ3H 4XBGA 4PRHB 5ACZB 4DO4A 3VFVA 3ULVF 1H3PH 5B7FA 5DC2A 5I1KH 2VXTH 3CFEB 5DEJA 3IWVA 3F7VA 2FJHB 2VSDA 1KB5H 2DEXX 4R90L 3Q2CA 1KFAH 4X6CF 1E9OB 1X7QA 3Q05A 5F2FA 1J0YA 1RY7B 3VRLE 3KPPA 1JV2A 1W9XA 1Z9PA 2APSA 3GHBL 5E0QA 3FT0A 4WSJA 4D9LH 1EO7A 1WGVA 4JFHD 5M7QA 1FNGB 4WU5A 3WOVA 4PJEE 2AVFA 5F7KC 2ZYSA 1YC7A 3L3JA 2EDHA 1PLGL 5I26A 5SX5K 4GY4A 5F3HB 2HG0A 4GH7B 1TENA 2C3VA 3RVTC 3VRJB 3NDZE 1F4XL 4QHLA 3PWLA 1QBMH 3GTTA 4OZFH 3TBWB 4HVBA 4YDIL 4WFGE 3L4ZA 1PX3A 2R2CA 4O02L 5C3TA 3TJPA 1JXJA 4R5TA 2UZIH 1U2CA 3BWSA 2ZNWA 1BMWA 3F7LA 2BZCA 4FLHA 4KTDL 4QGTA 1I8LA 5FIEA 2C9RA 2OL3H 3IYLW 4ODVH 1KCBA 4J5VA 3FDWA 1CLYH 2LU7A 3G5YA 1WAAA 3ZE1B 2IDQA 3OLDA 3UYRH 4PJGE 3EO1B 3CN2A 3MRMA 3UP1A 1Q9WA 5IQMA 1UFUA 4KNTA 4G3YL 2IIJA 2N7SA 1F3DJ 4X80H 3TZVB 3RQ3A 3WIHH 5ECJE 2FO1A 2VSCA 3HN8A 1EDQA 1U3YA 3JVFC 3NEXA 1Z32X 1YN6A 3VXTA 4ZG1A 2L3BA 1TTBA 2OW7A 4NJ9H 3C60C 3LZPA 2UZYB 3QUXC 2A4EA 2QADB 1QR1A 3O3BA 1G7QA 3G6JB 5SWZA 4NZTH 1EXUA 2EYSB 5FB8A 4XI5C 1Q1JL 3QDGE 1A14L 2YAOA 4D3CH 3WJMB 2OMXA 3S36H 5IJVA 4JKNA 3RPBA 5KBDA 4FYSA 1KDJA 2VDRB 1TSHA 3AS3A 2W8CA 4NP4H 3FQWB 4F8NA 4WENB 3FFOA 3BN9C 1DBBH 2LLGA 1JD7A 4Z0BH 1BYPA 2BVEA 4HUVA 3A6CH 2JCCA 1KCWA 4Z7UA 5FCUL 3GXFA 5CZVL 3BUPA 1GYVA 3P02A 2CDEA 4NUGL 2P49B 2DTMH 5L2KB 2F08A 4N8VB 3V9EA 1R3KA 3P0YL 3U4EA 5HYJD 4YQXH 5D1QA 5KOVC 3PFUA 3A21A 1MHPH 3IGLA 2VXQH 3FTVA 3WKMH 5JZ7D 4D9RE 4OCRL 15C8H 1TPXB 3ILPB 3IF1A 3LHAA 1GZQA 4YHLL 1BFVL 3ASWA 1CR9H 2XG4A 4OLUH 1M7DB 3D33A 2CLVB 4AMKL 5CBEA 4GAJL 5FAAA 3QUXD 3VFOB 3N41F 1RZKL 4MS8D 1D5RA 2OV0A 1NFIB 4OLYL 4XMPL 5AW2B 5EO1A 1G9NL 2PUQT 5CD5C 1GIGL 4DO6A 1T04A 2YD8A 1U8CA 2AJVH 1YQ2A 4XNUH 3AB0B 5IT2H 4HKBA 1AGBB 3LEVH 4LKXA 4CBPA 1TZHA 1YNKL 2F7OA 2FQDA 4CSZA 1UCBH 1GGBH 3BIBX 3HR5A 1TCMA 4E9TA 1DO6A 2ADIB 3UPRA 1FA4A 2BP0A 1I7UA 5B1CA 4H8UA 2HT4D 1MRFH 4W9EC 3F3HA 4OSUL 1ZRUA 4XWGL 3JTTB 3HE7C 3S8FB 2UXVA 3RNQB 3ZT5A 3BPOB 1CXFA 4C47A 3TWCL 3O45B 2EE2A 2NY3B 1QO3B 2VDNL 3ULUH 2Q5BA 5IJKA 3UZVA 2IMNA 2VN7A 5AOJA 3AZUA 4TLTA 1AY1H 4DVBA 1I3RA 4DW2L 2E74C 2QBWA 2B9AA 1ZSDB