2JLPA

Crystal structure of human extracellular copper-zinc superoxide dismutase.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
DGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords EXTRACELLULAR SUPEROXIDE DISMUTASE (CU-ZN)
publication title The Structure of Human Extracellular Copper-Zinc Superoxide Dismutase at 1.7 A Resolution: Insights Into Heparin and Collagen Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2jlpA00
3S0PA 1YAZA 3T5WA 2WWOA 1AZVA 2GBTA 1UXLA 2WKOA 3L9EA 1SXZA 3QQDA 2WZ6A 2AQNA 2AF2A 4A7GA 1OAJA 5KBKA 3H2QA 2XJKA 1OZUA 1PU0A 1U3NA 3SODB 1SDYA 3GZPA 3HW7A 2WYZA 4A7QA 1XSOA 1SXAA 2LU5A 2ZKXA 3GTVA 1SDAB 1COBA 1QUPA 1UXMA 1BZOA 4A7SA 2C9SA 3KM2A 3F7LA 2NNXA 2AQSA 4MCMA 1YAIA 3KBFA 4BCYA 3ECWA 1SRDA 1F1DA 4B3EA 1IB5A 2JCWA 1RK7A 1E9QB 1PZSA 1HL4A 2ZKYA 3ECVA 1Z9PA 4MCNA 3KH3A 1E9PA 2VR6A 3CQPA 1FUNA 2AEOA 2JLPA 1CB4A 1TO5A 1IBBA 3KH4A 4OH2A 1IBFA 3KM1A 3L9YA 3MNDA 1HL5A 1SXCA 2VR7A 1IBHA 2C9VA 2XJLA 1JK9B 1MFMA 1B4LA 2Z7ZA 3GTTA 1OALA 3H2PA 4N3UA 1B4TA 4BCZA 1N19A 1IBDA 1PTZA 2GBVA 2AQRA 1E9OB 3GZQA 1SXBA 3PU7A 3GQFA 1DSWA 1SPDA 2Q2LA 2AQTA 3RE0A 4A7VA 4BD4A 2APSA 2E47A 2Z7YA 1ESOA 3KBEA 2WWNA 3CQQA 1BA9A 1OEZW 4N3TA 3F7KA 5KBLA 1E9QA 4OJAA 2GBUA 4U4IA 4A7TA 4L05A 1SOSA 2V0AA 1TO4A 1Q0EA 1DO5A 2SODB 3QQDB 2ZOWA 4A7UA 1P1VA 1EQWA 2ZKWA 2C9UA 2WYTA 4FF9A 1F1GA 1JCVA 1JK9A 1Z9NA 3K91A 1S4IA 2Z7WA 5KBMA 2AQQA 1OZTG 3MKGA 3LTVA 1SXNA 1CBJA 1E9OA 2AQPA 2E46A 2R27A 2K4WA 2VR8A 3ECUA 1L3NA 1XTLA 3HFFA 1YSOA 1EJ8A 2WZ5A 3GZOA 3HOGA 1F18A 1SXSA 5CU9A 2WKOF 1F1AA 2WZ0A 3CE1A 1KMGA 1N18A 4A7GF 1E9PB 1XTMA 2Z7UA
chains in the Genus database with same CATH superfamily
2HT4D 4JY5L 2HLAA 3Q2CA 4V1DB 1CPUA 1YEWA 1DJIA 2BP3A 5KYWA 1RD6A 2JIXB 1F58L 2COQA 4ENZA 4ODTH 2MNUA 3U7WH 5JW3H 3SD5A 4MMZB 1OOWA 1XD1A 4XMPL 5B7FA 4PGBA 2FWOA 1U2HA 2MTPA 3PGDB 3VTAA 4IOFC 1JGVL 5LQBL 2G30A 4B5ZA 3S5YA 5DHVB 1DFBH 2CBTA 3LZFH 4L9DA 4YL4A 3QQ9D 4GI6A 2CCLA 4P57B 1MVUB 2Z92B 1JPEA 1UH3A 4PVNA 2AKRB 3RL1A 1ULVA 2IDTA 2WXGA 2ZP0T 2EKJA 2Z4QB 1AZBA 4U2YA 4IRJC 2VLKB 4ZMOA 4L4VE 2YD0A 3GSWB 1KDIA 4HIEB 4RDQF 3GUTB 4HPYL 4FZ8H 4XP6L 2X7LB 2CO6A 4M61B 3VQMA 3CFDB 1A22B 4HJGA 3F7YB 3I74A 4JHAH 3N44F 3L3KA 3QXDB 4XGZA 3CU7A 25C8L 3L9RA 4ODXA 4KTGA 1F3JA 4OD2A 3FOMB 1DBAL 4B9FA 1G1CA 2GVYA 2NNAA 4HBQA 1F8TH 1ODAA 1DUZA 3BLPX 1KY6A 1XHHA 2FO8A 2BSSA 4NHCH 1RIHL 1RZIB 4YR6A 4DKEH 1ZIAA 4N2IA 1NIBA 3WTWA 4U1JB 3VW3H 2GFBA 4FGMA 5T3ZH 1T1XA 4AYBA 4K5NA 5CD5C 1T1YA 43CAB 4U1SA 1KCRL 3AREC 4BQ8A 3QUZC 4N3TA 4L8BB 4NUPA 5IMKB 1QFOA 5D1QC 3N1GC 3Q6GH 4L0PB 3BPLC 2WUCL 4AE1A 1HQRA 4EOWH 5KYUA 2VN6A 1JHTB 4PLKD 4GQRA 1XF2B 4O4YH 4OGXH 5GRUL 1U8IA 2ZONA 3QQXA 3OKEA 5FW8A 2PYEB 1HHIA 2FUTA 4XAWH 2IQ9L 3TZVD 5EZJB 1KC5L 1X6LA 3BH8A 3SPIA 1UXWB 4Q89A 2LFEA 1ID2A 3DC0A 3RWHB 2P8PA 3DX8A 3IAPA 5AWNH 1IL1A 2CLZB 3WN5A 4DQAA 1HNFA 2VSCA 5FUZH 4QJ5B 5JLZB 4A38A 4L2LA 1YUHA 1K5NB 4Z7IA 1L3NA 3TURA 2P43B 2VXUL 4JCMA 1MREH 3FO1A 3CVHH 3QXAB 3WTSA 1A5FH 4LVHB 1GGTA 1WJ3A 1JV5B 1ACYL 2FX7H 5B3JF 5IJVA 3MO1A 5EO1A 1OAZH 4MJJA 4WTZA 1LMIA 1MJJB 1NFAA 3TBVA 3D4CA 4JFXA 3OKLB 5DRXB 1MRCL 2DIAA 3U9PH 3B2DC 3CX2A 3N9GL 3G7TA 4JAMB 1MLCA 1VFMA 4B9ZA 2IIJA 1GSKA 3I3DA 3V6OC 5EORH 4YFDB 2GHWB 3GGWA 4D9RD 2BVOA 2W0KA 3F64A 4UTCA 1GC1L 3BJLA 4PJXE 2DLGA 4IRJB 2SEBA 1UQSA 3RA7L 2JJSC 4KK6D 5EIIA 3OF6D 4X8XA 1CLOH 4IBZA 3FT4B 3BZFA 3ESOA 2D03L 3FAXA 3LZOA 4NRYA 4XVJL 1PAZA 1P7HL 4Y4FA 4XNMB 3H9SA 3U0WL 1JPGB 1SJHB 3CFEB 1L9OA 4MAZA 2ZXGA 3NFSL 4FJYA 4LLMA 1MCNA 1I31A 3K8KA 4FFWD 1LO3H 2VDLL 3KPSB 3WXWH 4NBYB 3P9WB 2BP0A 3NT0A 1CGUA 1FO0L 3LKOA 3BLKA 1E4JA 5EPMB 4YDKL 4OKDA 1THAA 2HJFB 4YXLH 4BQBA 2ZCKL 4CDGC 4EDWH 3P9MA 1GGBL 3MXWL 4Z7WE 3BPNB 3PUUA 1U3ZA 4PJ7E 3DMMA 3S3DB 1NC2B 1YPZB 4H7VA 3AREB 1I7UA 4JO4H 3QUZB 3UEQA 3PJSA 3MV7A 5E2WL 1T0PB 3ZRSA 3TNMA 4MXVE 1V27A 5BVJA 4HMCA 3Q48A 3WNJA 2NQDA 2JJVA 1OF0A 2Q8BL 5E6YA 4F2MA 3QDJA 5M95B 2YSSA 4YGAB 3EFOA 5JR1H 1NDTA 2ZG2A 5FB8B 2WNKA 5IFJB 3KL3A 1CGXA 5E9DB 1ZWIA 5CGBA 3OSVA 3ARDD 5HHOD 3V4VB 2A6IA 3ECQA 5E00A 4NPYB 1VZIA 1MHCA 4KDTC 1U4EA 5HHPA 1CDGA 1AGEA 2BIIA 3M1CA 2DB8A 2VAAA 3CMOH 1KGYE 4HJ1A 3VFPB 5HGAB 5BVPH 5B1JC 5T3XE 5IW3A 4EBQH 2FIKA 3ZSTA 1U8JA 4JRXD 2LAGB 3ZHFA 1SDDB 3P73B 3FCUB 4EI6B 4M00A 4OTXH 3QNYB 5JXAH 1J9QA 1TDQA 5C3TA 3GBNL 1B88A 1X44A 3QK0A 2FB4L 1K5WA 3FH5A 4ZDHA 1E2ZA 4N90E 5I1JH 2MNJB 4XP1L 3QQ9C 3AUWB 4MZ2A 4B0MB 4Q0XH 3VXME 1CF8H 1MW3A 3APCA 4HEPA 2VXSH 2OX5A 2YD4A 4F7MA 3FRUA 3OXSA 1AMYA 2WO4A 3NJIA 2CKBB 3L9EA 4N0YH 4IRSC 1FL6B 4X9YA 5IVZB 1WITA 4JFDA 3VWJA 3ZTJG 5IHZB 5L4FA 1OO2A 2CXGA 3N44B 1WZ1H 3TO4A 1I3GL 2BVTA 1URIA 3UADA 6PCYA 2X0UA 4PJCE 4Z3IA 3H3KA 3WFCH 4P0DA 1BG1A 4GAFB 2EKSA 2NDGA 1QNZH 2ZOOA 1FFPA 3FCBA 4LARL 5L8KB 1MFEH 3RAJH 4DJMA 2VDOB 4KRMB 4LOFA 3US0A 5EWIH 4XWGL 3PUCA 4F7CA 2BK8A 1K72A 3R7QA 4P2QB 1M1SA 1C8QA 2WNGA 3QQ4B 4PB9H 4WUKH 5LDSA 3GJFB 4WHCA 5DJ2A 4AH2B 1CYXA 4O58H 3MJWA 4YHKH 4C56E 4HGWB 5TE7H 1ZHKA 3NSJA 3CZFB 1B0RB 1I85C 1LEGA 1W16A 4Z7UF 2X4OB 5I1EL 2I27N 2JCCF 2Z91A 1LL1A 1P4BH 3GRWA 1GS7A 5DQ9B 4ADJA 4MKMA 2IH3A 3BVXA 3DIFB 3T0ED 2VRQA 3C75A 4Y1AB 4YSEA 4UTAL 1DN2A 2WXMA 5DI8A 4JKMA 4XO4A 5HPOA 2LW3A 3FOLB 4OUUB 1KTKE 2VJXA 2AXHA 3KPTA 1NLBL 1R3JA 2W65A 4FQHA 5GZND 3WD5L 2N01B 4H88L 1KTDB 1S5HA 2BW4A 3ESNA 4UBDD 4ZX3A 2TRYA 3LNHA 3PDOA 5TE6H 5TGBA 2V2WA 2Y5QA 3SYAA 3MJ9H 4HFWA 5KN5A 1W2KT 5E08H 2BZDA 1HYSD 2V7HB 2C9PA 2XNAB 1E8WA 2EDTA 2PXYD 3NAAL 3SBQA 1MCKA 3QFJB 4J3WA 3AITA 4PY7A 3WEXB 5K33A 5KSVA 3GFUA 2FHBA 3WFBH 5F1NB 5AVVB 5IB1B 3FULA 5CR1A 4OUOA 5DO8A 1Q0XH 4ANUA 4S1QH 4XMZA 2J43A 5FYLH 1UA6L 3EH4B 1CFQB 1PFCA 3EJYC 1OGPA 4JQVA 4KKLD 3VFOA 2A73B 1S7WB 2RAMA 4WWKA 3BEVA 1JPFA 2YWYA 4G9FE 1KB5B 3DTXB 3RIFK 3A6CH 4XMLH 1PBYA 5I1IL 1AQ8A 1BJ1J 2A4EA 3IMSA 2N59A 2ADFH 3WY2A 2RCSL 4LSQH 4EI0A 3FHQA 1AANA 2FBRA 3IDMB 1R9FA 2H2PD 2WYIA 1KPRA 3GZOA 2VL5A 4B9YA 1MIMH 4PUBH 1T66D 3QB7C 5KVMC 3C2SA 3D39B 4ALAL 2PTUA 1OGAE 1HESA 4IRSB 3P4NB 1FBIH 4IJ3C 4CVWA 2DKUA 5GS1C 3QRGL 4KK6C 5F8RC 5DF0A 1CI3M 2HVJA 3EH2A 4XBEL 3FU7B 1QTPA 1MUJA 1AIZA 2ATKB 4M56A 1FLTX 2AJSH 5DRZA 5F7MC 1ML0A 4JVPA 1WCQA 4O5LH 1A7QH 1MJ7H 3GSOA 1YNTF 3G6JA 3VFNB 1CDBA 4YVNA 1U0QA 4H26B 4FQXC 2X05A 4X9BA 5GGQL 3F8UB 1QPXA 4FFWC 1RK1A 5J6GA 3ATBA 5GS0D 3S3SA 5CILL 2Z34A 1PEWA 1BP3B 5BUPA 2NZIA 4E0RA 3RI5K 1ZSDB 5GS0L 1D5BB 1QA9A 4ADIA 3H9YA 4ABQA 5LG1A 3FQTA 3ZIYA 1E4HA 5F7BA 3UAFA 3C6LC 1AXSB 2HX7A 2M26A 1H9VA 4K5OA 3C6EA 1FL3A 2BOLA 3CPLA 3ZT7A 1SLUA 2Z8VC 4KTEH 4L0YA 1RUPL 4G8EB 4KVNH 1G9EA 2WUBH 3F58L 2VLRA 4NNXB 1WGVA 2EICA 3LPGA 4E9RA 3UTQA 3IETB 4TLKA 3BO8B 4OCSL 3E9TA 2V2TB 5A6MA 4PM1A 4RSVA 3KXFE 4S2SB 3UP1A 5AVWB 3W38A 5D2NC 1V05A 5EUKB 1KCKA 1SOQA 1UATA 4JJ5A 1T21B 4GP8B 5ELIA 5H4YA 5L4IA 1QLFB 3T1FB 3BISA 3QHZL 2XBDA 3NMEA 3GSUB 5PCYA 1J87A 3MNVB 1WFMA 5D7IE 1BOGA 4ZNEE 2VC2B 1Z5HA 2UY7B 4AQZA 3WTTA 2E7CA 5E1AA 5E8EA 4YJZL 5FYKD 1LO4H 1MDAA 4UAOC 4EKJA 2BXYA 4QRPA 3LRGA 2AXWA 5FYKL 4JREC 3DPBA 3ZZSA 3OJDA 1V3MA 5D6DC 1JNJA 5B39A 1Q0YH 2SODB 4G80A 4AGMA 3SB3A 3MLVL 5JO5B 4L0ZA 1X7QA 2LAAA 1NGWA 2WXLA 5E4IA 3U82B 4Z77A 3SPVB 2WINB 3I50H 2CLVB 3C6SB 3O2WL 1NMBH 2FD6L 1NM9A 2QSCL 1KFAH 2VITB 1IBZA 3MOBH 4LCWA 3UGEA 4NM4H 5E0FA 4C4BA 3KWUA 2WTRA 5GS1B 4X4YB 3QDME 4HAGA 4HJSA 1OM3H 3QH3B 5ABAA 3I6LE 3X1FA 1KIRB 3V8CA 1RJZB 4AM0B 2NTSP 5ENWB 3HAEA 3QDGA 2NT1A 5C0FA 3X3FL 1N67A 2XKNA 3SQBB 3NACH 3APFA 3H0TB 3K6DA 3O6FA 4NWTH 4KMTH 1XXFC 2L3BA 4HBCH 1IGFH 2R0LH 1P53A 2CIIB 4FQXB 2IFFH 2AJXH 4WY7H 5C0CA 2EQDA 1URZA 2NY1D 2DYRB 3WI9A 3FUJA 1ORSA 3SE3A 5AL0A 3LH8A 3NK4A 4Z7UB 3B2PA 4WNQB 3CHXA 2JCCB 3R06B 1KPVA 2WIIB 3BUPA 1I9JL 3WNPA 4CBZA 3BP7A 1INDH 4RGNC 1XBDA 4ZMAT 3C6LB 1R46A 2OMUB 2F54E 3T0EC 2Z1PA 4UT7L 1EO7A 5D5MA 1AP2B 1ZS8B 2UVFA 4ZS7H 3ARYA 4ZUTA 5L2JB 4JDTL 3S9DB 4UM8B 2B59B 4Q9QL 4OZGE 4MCZB 2HT3D 5FA4B 3WIHL 2DWTA 4WUUA 5DLMH 5BXFA 2KMWA 3F65A 4IIQC 1BAFH 3L9YA 5FCUL 1CICA 2GT9A 3KGTA 3OAZH 3AS0A 3UYOD 4WTZG 4KJWC 2GG1A 2YOAA 1ASQA 1BYOA 2BNQA 2X0WA 3LDBB 1DTUA 4MS6A 4RZCB 5D93B 5DJZA 2R4RL 4QXWA 1P7QB 2BFGA 4LBAA 3BAIA 5CKAA 2X4SB 3LN4A 2H0PA 4UAOB 4UQ3B 2YPKB 4KGJA 4JREB 3QWOB 4AGNA 4NO0A 4JPIB 5BV7H 2UV3A 1NKOA 1PJWA 1RLWA 4ZAKA 3EOTL 5AZUA 3MRIB 4BFIB 2J3SA 1EDYA 1D6EA 4KROC 4WEMB 5EIIG 4BSWB 3RPIB 4NQSB 1XGRB 1WSST 4J3SA 5EBLA 3HRZA 2H2PC 1QEWA 2OCJA 1IGJA 1TO4A 3LQZA 4JPKH 4OLEA 4OLZH 2Q7YB 2JB6B 2AXFA 1ONQA 4Q97A 2DQEL 3GJEB 1U8QA 2JELL 3IE4A 4QXGL 3O6LL 1AHKA 4U6VH 5DQJA 1C9SA 5BO0D 2Z7WA 1HXMA 2O6CA 1XL4A 5EZIH 5C0GA 1T03L 1LEIB 1YNTB 1EZSA 5ALCH 3E8UH 4JZNB 4CC0A 5ITBL 1QTYT 2EE2A 4HLZG 4DERA 4K8RH 4K7PY 3QS3A 4H0LC 5AUMA 2Y1VA 3APDA 1GKOA 5BUGA 4Y4FD 5DFVD 1B0WA 3H9SD 3KAAA 1J05B 3C09B 2X1XR 3FO2A 1OCWH 4RGOL 3IU3B 3NRFA 5F9DC 1CC3A 1P5VB 3UIYA 4XE5B 4XMVA 3IB4A 5A2AA 2GBAA 4N86A 4AWJC 1RHFA 1EJ6A 5L8LB 3LHPL 1NCGA 2BC4A 2EVGA 4GAJH 4L3FA 3ARFB 1NUGA 4RGNB 1O5PA 2A9DA 3HG3A 5H8DA 4Z3TA 4ZPTA 1X3DA 4ERSH 3QNZB 2KHAA 3P9LB 3WY1A 2D4FA 4NKOB 2GIMA 3AT0A 3DMMD 2P42B 3HB3D 1EZUA 2CR0A 4PYGA 2ZWNA 1UACL 1M71A 5A2FA 2C9SA 1SEQH 3QPXH 3NABL 4I2XB 3VFMA 3MV7D 5JQHC 3NZ8B 1FVDB 2PP8A 1S7TB 2PYEE 4W9GC 1NFDE 4IIQB 3BIKA 5JPNC 3L4TA 1QTSA 3M88A 3DX6B 4DQOH 4GXVH 4M8UA 3QDJD 5IMMA 3CCHA 3PWUB 3OX8B 4MD5A 3WMQA 3A5VA 3F6IA 4NSKA 3F7RA 4MA3A 2P5PA 3AAZA 4F20A 3DWTA 1B0GB 1LXMA 4DFIA 2PLTA 1T0OA 1F56A 2DV6A 3BP5B 4G7VL 1YNKH 2BMKA 1DHKA 3LN5B 4PFEA 4PS3A 5B8CA 2OKMA 3RPBA 4KKCD 5E2VH 4HUMB 1GOGA 2ARJA 3R4DA 1PDKA 2O5NA 3NIFE 3LEXB 3VDCA 1FZKA 2XWDA 1FNSH 2EUWA 1PY0A 4YDJB 2P5EB 1BDYA 4KROB 3U46A 1KEGH 1UOKA 4GQ9H 4W4OA 4KJYB 4NBZB 3E6HA 1I8MA 3FQYA 2DAVA 2QHRL 4N9OB 1S5IL 5DGQA 2ZKMX 4R4BB 1OTTC 4DEWA 2Q6WB 2J88L 3EYOB 5IBTL 2XA8H 3O45B 4I0PD 3DO3A 3JV4A 3K5RA 3T3PE 5HHVL 3PWPA 4JFDD 3TV3H 1A25A 1MF2L 1EFXB 1W0YT 4UZGA 1F3DH 4WW2F 2QVKA 5EOCJ 3TO4D 1F0LA 1G4MA 1UENA 5F7EH 3OKKA 1ZPUA 4JM0A 5BRQA 1EZVX 4XP5L 3RG1C 1JVKA 4RA3A 1QBML 2RD0A 4RNRB 4X7CC 5TE4L 4FXTA 1A2YB 2G2PA 3TPUB 2AERT 1M6UA 3W9EB 2IANB 1V10A 3HI6H 2DBLH 1WBYA 1XEUA 1RIHH 1M6OA 1X7SA 3I75A 3DX7B 3EAKA 4N0FB 3IT8D 3FB8B 2D7NA 5LBGA 3S4SB 1AZVA 5DZOA 2WBKA 4WKZA 2I25N 3MCKB 3OG4B 2BWDA 2FJUB 1WTLA 3OGOE 5D1QE 4PRIE 3MV01 4MLIA 2DQGH 3O8XA 3NIDE 4YSDA 1J88A 2UZXA 1FDLL 4NOFA 3SJVB 3VD7A 3GRWL 4J7RA 3MRFA 3PWJA 1IBYA 8CGTA 4Y5VC 4JCLA 2X4TA 2ZXDA 4Y5YC 1BZ9A 4QF1A 3K6NA 3B6SB 5JPNB 1T83C 4ONGL 5KVGE 5AOZA 4ZZKA 4AW4A 1GYCA 1I7RA 4G5ZL 5I76A 4GMTL 2FBJH 5EUOF 3X3GL 1T3FB 3PFQA 4KK8C 2W95A 3BVUA 3KPOA 3MLZH 4OM1L 3SGEH 1NGPL 1Q9WA 5DZAA 2YQGA 3UIZA 3AG4B 2J72A 4YQXL 4BFBD 3WBDA 1QUNB 3UJJH 2W81C 1IKOP 4ONHB 4JZJC 2QKSA 1HH9A 2BS9A 3GLDA 3S2AA 5LUMA 5KSBE 5DJYB 3BVWA 5T5NG 5IFHL 2DL2A 3AQZA 1WWBX 2B2XL 4PJDE 4KRPD 1OSYA 4WWKD 4YDMA 4IBYA 2OMWA 2C3VA 1TQBB 2W9EL 3VH8B 15C8L 3CFTA 3Q5OA 2GTWB 1BQHA 4JG1H 2E7LC 4GBXA 1HHGB 3QXTA 5LN4A 3RFRA 4PRHA 1AS6A 1NLDL 4KHXH 5E94A 3V6OE 2AVFA 2DQCH 4RAVA 3VFSA 1VGEH 4UOZA 5IUSA 3AG1B 1KJVB 4YGVA 1QSVA 5GRJH 2K3HA 1AQDA 4N2GA 1ADWA 4WW2C 1KGWA 3U7AA 3SKJL 4OV5B 3DOSA 4M5ZL 4P06A 2I9LB 3ETBF 1JGUL 5A2KH 3VSVA 1MW0A 5CBAA 3QEQB 4KO9A 2ROYA 1JZ3A 3HC3H 2VMEA 1P84K 4JKWA 5AYQA 2C3WA 3Q8BA 1L4IA 4E5XB 4C55A 4XVJH 5AVSB 2WVUA 5DFVC 3FT1A 1VLXA 2EVFA 3MNZA 1S9YB 3CFBB 5ES4B 3JTTB 1KIQA 2PKDA 3I9GH 4MS8D 5EN3A 4F7PB 2GIXA 3EGXB 5EU4B 3L3GB 1DJYA 4ANXA 3U30B 2X42A 1DVXA 1L0XA 4XZUB 4N0UB 4UM9A 2D0FA 4ZT1A 5F0JB 5F21B 3MRNA 4N20A 4M1GH 4OR1A 4BINA 3QIUA 3SE6A 1BECA 4YHPB 5DMGD 3CHOA 1A1OA 4B53A 4BA0A 1GGBH 4PG9B 4XXCC 5D9SB 3GWJA 3HB3C 4HKJB 1PLGH 1L7IL 2XG5A 3DRQB 5HD8D 1I8IB 1KDJA 4HIJB 5FYJD 5ERWB 4DGYL 1HI6A 3N2JA 3MTRA 2YO3A 1S7RA 2WP3T 4DUXA 2VLRD 4FL4B 4XRCA 1X5XA 2RACA 5FYJL 4DZ8B 5A6LA 1S7VA 4Y5VB 1FAIH 3IDNB 1OVZA 1NCWH 2JQZA 4U1NA 4X4XA 1UB5B 1TSRA 1BD2B 3LOWA 3SODB 3U1PA 3QXVA 4LXFA 5JUEH 5EEZA 4K3GA 4U1HB 4MVBD 1YC8A 3L2LA 1TYJA 5B39G 1OT1A 1ZJAA 2BZCA 1LLAA 1TSHA 2Q87A 1GYVA 4U1IA 3I02A 2Q3AA 3SEPA 2OYKA 2DTSA 2W91A 5B3JE 4XVUD 1QYGH 4JZJB 1P6FA 4LLUB 4XO8A 2OTUB 3GF8A 5AAPA 2QTVA 1BAGA 1NIEA 4QRPD 3OQ3B 3P0VL 3ELAT 2CALA 4PWKA 4M7LH 3BOVA 3VGHA 3VXPA 2VR6A 2HLFD 1KNOB 3AG2B 2ZSWA 3LS5L 4P4KA 1KEML 2AHIA 3IVKB 1MWAH 2LU7A 3D30A 2R2HA 4RGMB 3FFCD 3JV0A 4PJ9B 2WZPA 5IHBA 1MFCH 1J5HA 1Y0LA 5DS8B 1HWHB 5DVPA 3T6VA 4XP9H 4FXLA 5IJCC 1E5CA 3L7EB 2B08A 5CP3A 4I0PC 2EC9T 4JFEA 4WW2B 4EN2A 5AG8A 5J13C 1IAKA 3UZVA 4LCWD 3RWIA 4PJEA 2WJ5A 1UKSA 3P3RA 3VI3A 3ZKXB 2FNWA 4EZKA 1VIWA 4AMKL 1PG7X 4KNSA 5AYUH 3ZR6A 2YARA 4GG6F 4K5LA 1ZT4B 3SQRA 4NQDA 4FLSA 3IBOA 4H20L 4QRAA 4JKLA 1FGVH 3MJ7A 3QDGD 4PJ8B 4QRTA 2AEPH 4J8RB 1E6OL 3O6FD 2W60B 4DWHA 1XSJA 2PO6C 3ZIMA 5C0CD 4OM0L 5I1GH 4P5TA 4KJPD 1TZIA 4WZ9A 4K71C 1WAEA 1MELA 3HS0C 4K5MA 3MXVH 3TNNB 3BRFA 3AXLA 4P3DB 1NOAA 4F15C 4Z7VA 1CFBA 1H6FA 3FTGA 3TBSA 5D4QA 2MCG1 4Q52A 1EEYA 2ZOLB 4F7KA 4DN4L 1RFDH 5GSRB 3D2UB 3PP4L 4NDMB 3B34A 5ESVA 4CNIB 4Q9CA 2ZX8A 1ZLDA 2F53D 3PV6A 4YOKA 4F7TB 4U1LB 3BWUC 3CN1A 3UPRA 1Z1WA 3HNTH 1SXSA 3MYJB 3FQWA 1L7TL 1W72H 3W39A 4NUGL 3VXQB 3WD5H 1JL8A 1YJDH 3NCJL 5EUOB 1PS3A 5ACZA 1BVNT 1UUNA 1ERNA 4U3SB 1OK0A 3IDIA 1R3IH 4TSBH 1V7MH 5I1AB 3QSKB 5KUMA 5DD6A 1CICD 5DTFB 1U8KB 2AK4D 1AS7A 2BNQD 4QXUH 2XXFA 4TVPD 3RUGF 1ZTXH 2HKHH 2FEDC 5F97E 1T7ZA 1UJ3A 2XV0A 4TRPH 1JRHL 4TVPL 4AUJA 3ZKQD 1BZOA 1AD9B 4KRPC 4OZHA 4YMPA 1MQKL 5C6TH 1KYAA 3OR6A 4MXWL 3ILEA 4X6CE 4GRWE 1I8UA 4YSTA 4JVWA 3C5ZA 3AQXA 4QO1A 5TPWL 4MAUH 3U9WA 4HSCX 3D85B 5ITFA 4ZAKD 4HS8L 1IC0A 4RWYH 3LNGA 3EF4A 3GLAA 1FORL 4KUZH 2MCPL 1MHHA 3BKYH 4KBPA 1J1OH 2VE6B 4IU3A 4NZFA 4D9RE 3S97C 1B0IA 3OZ9L 3A67H 1H3PL 4OH2A 2BCMA 2JJTC 2OP4L 4TNWK 43C9A 1HQ4B 4DP4X 1WISA 3EZ8A 5IHWA 1RZ8A 4XMKL 1CI5A 2N1TE 3G5ZB 4ECNA 2AITA 2YJLA 3RHWF 4GRLC 1YYCA 1T4KA 4Z95H 3KYNB 1R3LB 4FADA 1JD7A 2YQBA 5CBEB 4X99A 1ZMYA 1J8HB 3PL6A 1PX8A 4FE9A 5KSUB 2FL5B 4AYFB 1E6JL 3WHE1 1S7XB 1W15A 1LK2A 2VT0A 2O61A 4EN3A 3NJKA 5E70A 3SBWA 4Z7UE 3F7KA 4X8GA 1C08A 3CVHB 2PO6B 1B4JH 5C0DA 4UAHA 3STBA 3ZE1E 4BUGA 1XCXA 1FQ9C 2Y7MA 4K71B 4NQEA 1IT9L 3V0WH 3GMNB 4A2HA 2F74B 1TQCC 2HG5B 1MWAA 2X3CA 2F19L 2XQYK 5DMGC 3UXFA 4F15B 3DVNB 1GY2A 4N6QA 1WD8A 2PYFB 1J9CT 4NUJA 1FHGA 2N7BA 1G9NL 1FYTA 4BUHA 3NEXA 5J1TC 1Z66A 5BS0B 2HT2C 3DSNA 4MJ2A 1PG7W 5IVXF 2JE8A 1GS8A 2I5YH 3AM8C 3U4BL 1FPTH 3QJFB 1QACA 3BKCL 2DMBA 3LH2L 4P4RB 1X7TA 4BXVA 3I6KB 1M7IA 5D2NE 3ZMNA 3MACL 3DPDA 2EEFA 2GPZA 1HWWA 2CO7B 3GIZL 4MVBC 5F9AC 5IV2B 1N6QL 3I9PA 2IALA 2EYSA 3QR2A 4A7GF 1LEKB 2IG2H 1NDMB 1P4UA 1U6AH 4Z3GA 5DUBA 3FB7A 4XVUC 5GQBA 2QGCA 1XGYH 2NXYB 1P5UB 5G4OA 3WIFB 1I9EA 5FDWA 1NICA 2Y7LA 3AROA 5BW7A 1FHNA 2YAMA 5G5DB 5DJ6A 4X5QA 2B8OT 3LKPA 4JGMA 5I15H 4L8CA 4HDIA 3LPFA 2HLFC 3LHAA 4HZLA 3SDAA 1RY7B 4ODUA 4FJ6A 2HRPL 4JN1L 2IGFH 7PCYA 1VERA 5F9OL 1GA2A 2F8OA 2W9DL 2VM3A 5L88L 2J2ZA 3L6FB 3H4FA 4XP4L 5JNYB 1MNUL 5I0WA 4XI5D 1E4XL 4AYGA 2NX5A 2Q76A 4NC2B 1CL7L 4PB0H 5D2LE 5C0IB 2R2EB 3V4PH 3ERXA 4GW4A 4ZUWB 4HIXL 4AQAB 5D7SL 4GRLB 2DJUA 4YZFF 3EYUL 3Q3GA 1JK9B 5DUPH 4OCXL 1ETB1 3NQKA 4MQ7B 4CILA 2CPUA 3N06B 4I13B 4GKSB 3UTOA 2VDPL 4IBQA 4JKKA 4DK6A 1Q90A 2WHVA 4WEBH 2AQRA 1NCBL 3DGCR 3ZE0E 4EUPA 1YMHB 2PUQT 3SE3C 4OT1L 4KJPC 4IM8A 4Q8BA 3BAEL 4MQTB 5F89A 2H47C 2WWNA 4MDIB 4X5RA 1Q9KA 3T0EE 4FZEH 1TQCB 3IJYA 4P9ML 2VQTA 4RWHA 5CSGA 3CFKB 1JN6A 5ID0B 2DQFA 2BIHA 5J1AB 3R19A 1ND0B 2Q8AH 1SYVB 1Q4NX 1MAJA 1XEDA 3IMRA 1A9VA 5GZOC 3AB0C 3V4UL 3O8XD 1DBBL 4JDTH 3O3BB 3L3DB 1OQOA 1L5GB 3Q1SL 3HLAB 2B1AH 2D3VA 4Y4KC 3QG6A 4IRZA 2K70A 3MRHB 2WSKA 4MXQD 1A6TB 3RWFB 4XC3H 5DVLA 1CICC 3IRCA 5LCVH 5FCUH 1MCOL 1Q1JH 3WENA 3TEUA 1JIBA 3IMTA 3IFOB 1LK3L 2QGDA 4DP6X 1IGTA 3ZTNH 1MRFH 4Q74A 4CW1B 5IG7B 5J9PA 2YAQA 2BJMH 3G5WA 1Z9SB 3W57A 4PD4K 5CXPA 3NJFA 2OZNA 1FIGH 2QSVA 2NUPB 3NJGA 4ZAKC 1EERB 3FQ4A 3MLXH 4ZW8A 4LIQH 3DUUB 3GI8H 1MFAL 2XJKA 1DVFD 2E74C 5CZXD 1IBGL 2VR9A 4B3VA 5J12C 3D0LA 1MRDL 1O7DC 1AO7D 3U36A 4GBXD 1R5WA 4PRHD 3SQOH 1GH7A 5IIEA 1ZEAL 1UD8A 1WEJH 2JKWA 3Q5YA 4A7SA 7FABL 1UWYA 5CN1A 4NP4L 1L6ZA 3ULSB 3A4FA 1E30A 3U2JA 1CXLA 2AJYL 4ZPVB 1ETZA 1MPAL 2OZ4A 3I9IA 4HPOL 2CA4A 2D4DA 1DP0A 3OBAA 1UADC 5FW6A 3QUMH 2EE9A 3GXFA 1BFTA 3QEUA 3MLYH 4OI7A 4IKLA 5F1OB 5LXGH 2F5BL 3QZWA 4L8SB 3HBGA 4HUUA 4U2ZA 2X9XA 3HC0A 3FN0L 5IB4B 1SHMA 4ZUVB 4A6YH 3KLQA 1XIWC 2CO2A 1MFBH 5L7XL 1D5RA 3V9FA 3KLHC 5FC9A 1OHQA 3CVDA 3MBEB 1DJZA 2C7UA 3PHAA 3S36H 1T1WB 4HIHA 4UM9D 5IVXB 4XCYA 3BZ4B 5F6IC 1R6VA 5I6XB 3QIUD 4NLHA 4OAWA 1BBJB 3GDCA 4PRAB 3P77A 3MRMB 3BZ5A 3PQYB 4RAUA 3C8KB 1AOZA 3D48R 3S8FB 4UQ2B 5JHAA 3Q8CA 4IS6B 1QKZL 4BKLB 1EQWA 1MCRA 4Y4KB 4PU2A 1KCWA 1QR1B 2B20A 1F4XL 1NINA 1KV3A 1R5VA 2WYTA 3LV3B 5E5UB 3D0AA 1OSPH 1JZ8A 3BRGC 4R90L 1G6RH 1GW6A 3V0DA 5HHMB 4QAWA 5CLTA 5FYKE 3UTZB 3DBXB 3I2CH 1F2QA 3V0GA 5INDA 4BH8A 1CBJA 4ES9A 4PBXA 1J1XH 3AZUA 1XH3A 1DUYB 3W2DL 3UEZA 1N10A 4F37F 4E9SA 5B8CC 5GJTL 3ARTA 5EF1A 2VSMB 4XVTL 4AV0A 2WMPA 4P99A 2ZNXA 3WL9B 4W9ZA 5H94B 1NAKL 3EYQD 3O2VL 4JDVB 3UYRH 5F1IA 5DJAB 5J0BA 2VZ1A 3WE6B 2HVBA 4UU9B 3KPPA 1MZYA 5C9JB 3SE9H 3GSRB 3KCPB 4OJYA 5B4MD 4AG4H 5EEYA 5TF0A 4W4OC 3K7UA 2DL9A 1PAMA 3G08B 1JZ2A 1WC7B 4P4KD 4B5EA 3QFGA 3GIVB 1CD1B 1UJTA 5D4IA 3WN6A 3RLSA 4WW1A 3LXBA 1GZPB 1EGJH 1LJMA 3IKCA 3EH5B 1MQ8A 1VFUA 3KJ4B 4MNQA 3U9UA 4BEIA 3T9WA 1Z32X 1PZ5B 1QSEB 2YN3A 2N0KA 4L8DA 5B1CA 3SY0A 2DWDB 5LCVA 1QFHA 4NERA 3HS9A 1V8HA 3C87A 1MF2H 1CG9A 2CAKA 3P30H 1UM6L 5HHXH 1BFVL 1J5DA 2J56A 4Z7QF 3UAAA 4IMLA 2YFNA 3DSFL 3U4KA 4AENB 4DAGH 4NQDD 4D3CL 4GUOA 2R0KL 2B1HL 2J8UA 4O51A 4DW2H 2EE3A 4FQ1L 4Y1SA 3ABZA 4XP5H 3OTTA 3WNOA 1UZGA 4AEIL 2DQHH 5KJ7E 1FWXA 5FM8A 5KJRL 1IBBA 1XGPA 3L3OB 1WG3A 3L7FB 5BV7C 1KBGH 1XIWB 5A16B 4P5TD 4DPRA 4I18A 1E4XI 2HH0L 4FG4A 3C08L 3O11B 4ODSH 4A66A 4ZNCD 1A6WL 3L95B 2QTEA 4BCZA 5JHLL 3DI2B 4MJ6A 5F6IB 3EBHA 3R4RA 2H1LM 1AKJA 3PWLA 1KACB 3O8XC 2XWTB 1J12A 3CDZA 4XPBH 3FBQA 4L5FH 2OTWA 1HZHL 2HAZA 4L4TB 3D12B 2F15A 2K6YA 1QQDB 2DQTL 2C3XA 5DUMH 1CE6A 1S9VA 5K9KB 3CZLA 4OJAA 5DU7A 3ISYA 4G6KH 1G9ML 4XMUA 4LHQB 1DQJA 4J6IA 2F9BT 3QUMA 4PREA 1HWGB 2ENPA 4KH2A 5HYFA 2ZYRA 3NBNA 2FT7A 4K8RC 2ZE0A 3WXVH 1BM7A 3AT9A 5IJKA 4EI5C 1P1VA 3X3GH 4J4PA 3KPRB 3SZ6A 5DUJA 1A7RH 2DD8L 2XRAL 4DP5X 2HZHA 1QRNB 4ZFGH 1ADQA 4Z3JA 5IJDC 1XR8B 5C0BA 1YO4A 2CJUL 5IFHH 1P0SE 3FO0L 3ETTA 4JO1L 4KXBA 4S1SH 3MRDA 3VVVA 1F90L 4ZI8A 3KBHE 3NP3A 2P5WA 4OVVA 1E5UI 1DVFC 5G55A 1MCCA 3C5ZD 3FU3A 4O00A 4G7YH 3GMOA 5DYOA 4E42B 4G8GB 3IFNL 1WAPA 3DXAB 5E2TL 2FJFB 2WLIA 1JTPA 3DGGB 5A2IH 2OS7A 4YFEA 2CMRH 5C0AA 8FABA 4LNRB 5DJCA 3DO7A 4F8TA 1N68A 2DRUA 1FFRA 5I0DA 5CCKH 4GT7A 1D9KB 2XKUA 4MNGB 3HJ0A 2VXTL 4YE0A 5TQ0H 1UKQA 1BZEA 3D05A 2XHNA 3ARZA 1QFWH 4FP8L 2ZWSA 1MCQA 2I26N 4I3SH 3WHXB 2Y5EA 4ZUSB 1A02N 2BVYA 2P49B 4LSRL 4X4ZA 1K4DB 3QC6X 3PL6D 3VG0H 3GMQA 4K3DH 5EB9A 2J71A 4K15A 3RZCC 5CP7B 4IW4C 4EN3D 1P7KA 4GKNA 1QHPA 4GXUN 4D0CB 2D2OA 1AG0A 5BV7B 1HE7A 3FMGL 2Y06L 1OF2A 4HU8A 5DZPA 4LPUA 1USQA 2IXQB 4GSDH 3TH4T 4NQED 3INOA 5CEYB 3BZEA 1JVLA 1YHPA 5K59F 4KZDL 4M7KL 4R4FH 2DJ4A 5CMAB 2Z35B 3DVGA 1EK3A 3MSPA 5A3ID 1FYTD 3MV7E 3IDXL 5EU6D 1QWNA 2VERN 4KV5E 3IE9A 1OP3K 3BVTA 4CSZA 4DEUA 3A6OA 3RY6A 3ZDZF 4I7ZC 4FQLL 4P46A 1BQSA 4JFYB 1L3WA 2JLLA 2J20A 2W07A 4N1HB 1ORQA 2YHGA 3E38A 2H8PB 4P04A 3KYKL 5EZLA 2FECL 2XBZA 4WLCA 5K1JA 1P7BA 3DVIA 3K4AA 1WK0A 1QSFA 1BIIB 5FGBC 1JUFA 1Z9MA 4NKIL 4AOFA 3S35X 3VXNB 4EI5B 1BXXA 3LPPA 4F3FA 2NSQA 3BHBB 5IBUG 3F12B 1JPTH 4F57L 4PJHF 2OFQA 3O4OB 4KX8A 3EYQC 4JM4L 3QZOA 5T3ZE 2JK5B 4PJ6A 5D7LB 4QYOB 3WNNA 4F8OA 3T3ME 4NXKA 2B4CH 3LN9A 3K91A 5EG6C 1P69B 1YN6A 2C1PA 2C1OB 2XPGB 3F3HA 3SDAD 2HSIA 1JHLL 1JF6A 4QHUA 1LWRA 4PJBF 1FF5A 1NJ9A 1R1CA 2R27A 5FUCE 4P4KC 5IQLA 1UKTA 1Q9LA 2P8MB 1USZA 1U8NB 2HJLA 3MRCA 4DEPB 2COVD 3F84A 3AQDA 2WXFA 2BVQB 1IC7L 1PKOA 4RMBA 5A2LH 5FHAL 1NCTA 4IHBA 4LZKA 5CJXC 3H3PH 1N70A 2P44B 5DA0B 3TA3C 2NX5D 4JFDE 5GXBB 1KMGA 4RQQB 2NY5L 2YSTA 4EUPG 1RZKL 1F4AA 2BNUB 5F7DA 4OF3A 4KAQL 4Z7QB 4B9IA 1KYUA 3S0PA 1J8HE 4HXBL 4OCMC 1D5ZB 4HIIA 4IIZA 3RNQA 1MW1A 3UYPB 3C5SB 3B8YA 5IM7B 2QL1A 3MRRB 3DYMA 4JFZL 2AQ1A 1ZHNA 3T4YA 4N2MA 3RZCB 4QRUA 5ABZA 2LR4A 1TEYA 4PTUA 4XCCL 1LP9A 2XWRA 4NCC1 1ZT7A 1TVDA 1F4HA 1KTRL 4P5TC 5L2KB 4JPQA 2VWEC 1JWMA 1BGXH 2BNRA 4BFRA 2AK1L 2HLEB 1IC5H 4KXCA 2E27H 3NA9H 5FM4A 4NN7C 4BFFA 4EE2A 3ZRFC 1NGZA 5GIRA 3V0AC 3QYCA 4ETYA 1LDPL 3H56A 2IAMA 4JY6B 4W6WB 3FT2A 4OIIL 4AT6B 2JF1A 4AZUA 4GUPA 2CIKA 3RWCB 1U91B 4R9HA 3WO3B 2G0LA 3SGEI 3FCTB 1NC4B 4W81A 4WWID 2AANA 1MOEA 1JGDA 4AYMC 1UH2A 1Z5LB 1BVZA 1XGTB 3T0AA 2JNZA 4IRZL 3PPEA 1U2CA 2MEJB 2OMYB 3DHMA 1IO4C 3UC0L 1O9WA 2BSBA 1RMFL 4X5XB 2YEZB 5E2UH 2NNFA 3PS6A 4H8HA 1HXYA 1F41A 1A3LL 1LGVA 5JXEC 3T77A 2XN9B 1F02I 1GGIL 3ZMRA 3MJ6A 3ARGB 2BOCA 1IEBA 1DO5A 3VRLE 2FNBA 3LJ3A 3SOBH 1WZMA 3B9KA 4NC0B 4X98B 5ADOH 2WVVB 3EGDB 3ZDXF 2IEPA 4R2GD 3ROLA 3U25A 1WF5A 1YG9A 5ACLA 3MBWB 4FG6D 4GG6E 3TBTA 2E9IA 4QMEA 2XUWA 3HCVB 3QZWG 3TA3B 4S10A 2FATL 2W0FB 3K6OA 1OGSA 1AG6A 4XCFL 1WBXB 1KFGA 1FZOA 2CGRH 3LKRA 1BMZA 3VI4A 1XF4B 4NX0A 4C4KT 3HMWL 4ZMVA 3C9NA 1CFSB 4CL7A 4MJ5A 1ZLEA 4MWFA 4NEHB 4TL5A 3O6ML 5BMFH 3G6JE 5JIIA 2NLJA 2OZ4L 3QAZC 3ULVD 1NTDA 4HS6A 2WCPA 4FAAB 1D7CA 4GG8A 4XN2A 3ZE2F 3ULVL 2FVNA 4EN3C 2RALA 3JTSB 1HDMB 1UA3A 1U3NA 3JWOH 4YC2C 5E1HB 1W0WA 2DMGA 4LCCA 5DRNB 4YDZA 5H4ZA 4DCQA 1YRKA 4UIKH 1DEEB 3GM0A 2FQEA 4H25B 4IMKA 5CEXB 4P5MA 5A3IC 2KPWA 4FTVB 3ZDZB 5T1LB 1JWUB 4NN7B 2B0SL 2VLRE 1DJHA 2DY2A 4YLBA 2AJZB 5LBSA 2O5YH 3GHEH 3EHBD 5FOBA 1DSFL 4GFTB 5F9WC 4HUWA 1AVAA 3ROOA 3BWAA 2CJ3A 2QVMA 4JZOB 2PMZA 2IFGA 3S37X 1AGDB 3THMH 4OLXH 1UWEL 3RUGE 4YHYB 2ZYHA 5CHNB 4PVMA 2FX9H 1N0LA 2OPCA 3V0EA 2O6PA 1N6QH 2WLJA 4F5CA 2IPTH 4YHNB 1NAMA 2EEXA 3ZTCC 2PTTB 5D7HA 2DQIH 2PCXA 4YXKL 2ZF9A 2OMXA 4DK5A 4HCRL 1VPOL 5KWYC 1MCIA 3IU4L 4QRPE 2VNCA 1HAUA 3SDDA 2B7DT 3GSVB 5BW7C 5MEQB 1BAWA 5C07A 4QJ3B 4DFHA 2DW5A 1ZLVK 4BZ1A 1VFOA 4R26L 4L1TA 4PJBB 2JTDA 3FT9A 2EZ0C 2V17H 1X4YA 3LVEA 2OMVB 4GW5A 4Z18A 2IH8A 3FFCE 1N0XL 2GJJA 3UACA 1L0PA 2DQUH 3GSQA 2VN4A 4YN3A 4JN1H 4Z6AT 5FK9A 2DS4A 2TRHA 1SEBA 2X1PA 1IFRA 1TNMA 1OPGL 2NW3B 1JNHB 5LGJA 2OMZA 4G1EA 3UMTA 2ZT9C 1R24B 2OXHA 1HEZB 4LCWE 2YXMA 5FFGA 2HKFL 4PG2C 2XCMC 4P2RB 4MZRA 4KU1A 1YJDC 4MNQD 1U58A 4P3CL 4G82A 5IF0B 1AR1D 2Y3AA 4W9CC 3ILQD 3QDGE 2Y5TB 3WFDH 1T7VA 3VFGL 4XMTA 2Y7NA 3QS2A 3KJ6H 3LMJH 1RZJH 1XVSA 3RIFF 1CS6A 5IQ9A 5AAWA 2OL3A 5C0CE 3WS6C 3DETD 2EJ1A 2R69A 4YEFA 4PWJA 1R0AH 3O4LA 1A1MB 1FV1A 3GSNL 4YC2B 4BSVB 3IEAA 5GRVL 1A9BB 4KK5D 5IP4A 2D2CC 4HX1A 1S9XA 2HJKA 3EYVA 3OM3B 4GSXA 3OKMA 3GJFK 2F53E 4L29A 1HNYA 5D5ME 4TLTA 5DEGB 3OZLA 4LDLB 4B41A 3NIGE 2X41A 1AR2A 1JHKL 4L1LA 3MX0A 3K6FA 4PCSA 4MQXC 3PHQA 4PGEA 4NQVA 1AKJD 1KGXA 3QJTB 2KERA 4Y2DA 2CZNA 2D7OA 4N8CL 4N87A 3VD1A 1HIMH 3GUFA 4O02H 3FU8A 3Q1SH 4P9HL 5JPMA 1VCBC 2CWRA 3QHFH 1MY7A 1OB0A 2KZBA 2AK4E 5HHME 5CLWA 1EHKB 2VLJA 4UT9A 4TVPE 2HMID 1KLGA 3RI5F 4LEBA 4DO5A 4Z0XB 4NO3A 1SJEB 4J4PD 4ZXBC 5TQ2H 5EEXA 5IEKB 2W5PA 5C0ND 3MLWL 2CDFA 1AJ7L 3VU1A 4PW9A 5BO1H 2YMTA 5DEFB 3ZKND 4XXWC 5C0BD 1SXBA 1QO3A 1ADQL 4IKNA 4TPRL 2NY3B 5CWSB 2OULB 1U3HA 3ZDXB 1O7DE 5JOPD 1FNFA 3HZKB 5BRZA 2AXJA 2P5WD 1IVLA 3U2IA 2HFFA 3PHSA 3A24A 3BVNA 3AADB 3FYIB 1E9QA 4GXFA 4LAQH 1KUMA 2X40A 4FG6C 2YPLB 3EDJA 4RDBA 1T04A 3UOAB 4JGUA 5JA9A 2BP8A 4WAFA 3VXRB 1AC6A 1W72B 1PNCA 2HP4A 3BUIA 2AJYH 3V5DB 3K46A 3SKNB 3O0RH 2E9WA 1DEDA 4UMSA 4GT0A 3PWVB 3MBXH 5CFHA 3U6RB 1JZGA 3HPLA 1JWSB 1A8JH 1JMZA 2DKMA 4HCFA 4M5YL 5TD4A 2E7DA 1A7PH 3DJRA 5J3HD 2CUHA 4B27A 1WHPA 2I9TB 1A4JB 2QJDA 1BLNB 2IGLA 2EECA 2OR9L 3V0VA 2D3JA 5CJQL 4OJEH 1RUMH 1C5CH 2H9GB 1MFDL 3BDBA 2XU9A 1ZXQA 2CDEA 2I07B 4JR9L 5FX3A 2IV9A 5FF6B 4LHUA 3VRJB 2J73A 1CDIA 5F7YC 3TCLA 3ZUNC 1DBJL 3P4OA 1NBCA 1VF5C 2AJUH 2WNXA 3GDBA 2V5RA 4XPFL 3UO8B 4DT2A 4XT1C 4TSCL 4UDUB 4YBLC 1P2CB 2Q86B 1TZHB 3FQXB 2PCFB 1JS4A 3BSZA 4FI7A 5HGBB 4P46D 4K55A 1INQA 1S3RA 2J8OA 1WWWX 1PVHA 2NYYC 5IWLA 2WWKT 1T0NB 2P1YA 4GJTB 4Y16A 1ZV5A 4FA8A 2YN5A 3G5XB 1K3IA 2R4SH 4LLDB 1J1PH 4O2CA 4E9TA 3KLAB 4XB7A 1F6AA 1JPSH 1OD7A 1TYRA 2DN7A 3VFUB 4QHKJ 3ZVVA 1Z3RA 4D94A 1QSFD 4X80H 1WO2A 1NGXA 3DJSA 3BWSA 4HV8B 5IEHA 4ZXBB 1Z9LA 1KIPB 2YMXL 3UZEC 3BUYB 3U0TA 3CK0H 2MWCA 3ULUD 3JVFC 4QKXB 3AACA 5C0RH 1KXVC 1IM3A 2H26B 3AW5A 3ZK0A 4Z76B 3ULUL 1F86A 1XCQA 3N3EA 3AGVA 1AHWC 2BPBA 1XF5B 3UTPE 4OD1H 1NWOA 1IKNA 3DXAE 4ODBD 4M6NL 1G1KA 2ZAGA 3ZX1A 3IJSB 4PJGF 4OF5A 2NMSA 5T1MA 1HCVA 4G8IB 3V6FA 3EJTA 5I19H 4PCTA 4Q4IA 2OW7A 1IJ9A 4NWUH 4AYSA 3MRBB 3DX9B 3KW8A 3BAJA 3UBXA 3H3BC 3CSTA 5E56A 3L9BA 4NZRH 4PGDB 5GHWH 1AR1C 1KWGA 1F13A 3DLQR 4YPGB 3ZO9A 2E7MA 3ILQC 4D7PA 2XWBB 3FU0A 5IHLB 4PVLA 5F3FA 1LO0L 1KT2B 3G6AA 4GUCA 1ZANL 1BZ7B 1WIUA 3ZU8A 2YAOA 1BZQK 5KVDL 1QWUA 1VHPA 3GEWB 4N0CD 1Z9NA 4HH9B 2ITEA 1ZDQA 2NY2C 2OQJA 1QLRA 3TEWA 4PJFA 2XWJA 2XX0A 1A47A 4FXGA 5KBDA 1DBKL 2IPKB 2PN5A 4RFNC 2QKIA 2E0PA 3F2LA 4PBDA 2H6PA 1QBBA 2HRLA 3GMMB 4XPGH 4A04A 3FONA 2FAUA 3O41A 2EDMA 2HLAB 4XBPA 4HC1A 4HK0A 2BNRD 4KY1H 2HYMA 3T4AA 2ICES 4QOKD 1A6VL 4FLOA 5CS7A 4PJXA 1S46A 1A3RL 4LCUA 3EUUA 1C12B 1HHKA 3KR3H 3RL2A 5DJ8B 3ZYIA 1JGEA 3LRHA 3KYMA 2AS5M 2Y6TE 3MGOA 4HSQA 2IAMD 5ICYA 5BRPA 1IARB 2EDQA 4JLRA 4JFUA 2Q0ZX 4WI3A 4YLCA 3HKZA 4W70A 4L3CB 1X5JA 2XV2A 5TFSL 1WIPA 5ESQB 3M45A 4EDXA 2EH8H 2ZKXA 3EYSH 4UOJA 2HMIC 4NI3A 1CU4L 4KK9D 3CSGA 5HI5D 5HY9B 1N3NB 4Q6IC 4CVUA 5BUAA 3FO9B 3A47A 3G9VA 4IHOA 1FL5B 3GINA 5HYSB 3WIAA 2Q3XA 5D1ZA 3TA4D 5CJ5A 3L45A 3L3KB 3TP4A 2DD8H 2F8VA 1FFNA 2UVEA 3QXUA 1PZUB 2DLFL 4HQQH 3W0WB 3CVIH 1CK0H 3ZKNC 4LEEA 2EVHA 2X4RB 1S8DA 3O81A 4YSUA 4KOCA 2NUTA 5DZ9A 3FCGA 1AO7E 1AHWB 1FZJA 3WELA 1VZGA 4OI9A 3BPOB 4JE4B 3X14A 4PRHE 3WDHA 4BDVB 4AQ1B 3UCQA 3B9KD 3IFNH 3K2IA 2VDML 1T1XB 4F2EA 1FCGA 1W8OA 1U2YA 4XPAL 5IFAL 3VJ6A 4RX4A 4Z7QE 4NHUB 4N85A 1ET5A 3CN4A 2PW1A 1H15B 5CIPH 1G1YA 1T5KA 1BF2A 2JJWA 5C6WH 1MIEL 2XLLA 3IXTA 4H1LH 1ESOA 4CN1A 5T33H 3FJTA 4OFKA 4DNLA 2A9NL 4PJIA 4QRSA 3AJ7A 3BLBA 3GKWL 1JXKA 2RFXA 2HX8A 3A4AA 2DQDH 4LLWB 4BZ2A 3A6BH 3C8DA 2NY2B 3ETBJ 1SJVA 2J1XA 3VMOA 5GPRA 3QORA 1F4YH 3L4UA 3WN5B 4HPHA 2R0ZH 3HE6A 4ZW3A 5KS9F 3KPNA 5IVOA 5LJYH 5MHSE 1Z5YD 2GUOB 2VDRL 3HG4A 3AFLA 5AD0B 4L37B 5MERA 3BW9A 3B2MA 4ONFL 1EAJA 2DTML 2L7QA 4FQCL 3FO1B 3NH7L 3TYFB 3KNBA 2AEQL 3KE0A 4NI6A 4IJTA 1X5LA 2AQ3A 4JFHD 5HDOA 1Q94A 1YSOA 3NCMA 2WZ5A 3HE7A 3TBVB 4EPSA 5JHDA 5C08B 2VLMD 2X53A 2DQ6A 5IK3A 5C2BL 3QUGA 5IUCA 1ZSHA 2HFGL 3HG1A 3IGLA 2HA1A 2FO4B 5I73B 5LBSL 1Z3GH 2FR4B 3C60A 3ZHDA 4R7DA 2NY6D 3SDCC 3CFQA 1DCLA 4MD0A 1R19A 2LABA 4OCYL 1KJMB 1TTCA 4LSUH 2YUXA 2EDDA 3I6SA 5T1KB 3CXFA 4K3JL 4Q6IB 2HFEA 3ILPA 1HINH 4PCYA 1XAUA 1M05A 1SUJA 1WAAF 5IR1B 3E0GA 3VD4A 3D3VA 3PGCB 3OZKA 9PCYA 3IGUA 2FTAA 4QHMB 4C56A 1NAML 4S1RH 5SWQB 5D4JA 4A6YB 2UUDK 3ATEA 3LCYA 3SDDD 3ZYZA 5BZDA 2L7JA 3PXLA 4RMVA 4LLMB 5C07D 2XZCL 4JHUA 2YFOA 3CFJA 4MAYA 4M8VA 4DO6A 1FIEA 1ZE3H 5TF1H 2QFPA 3TWCL 2NQCA 2Q9OA 3MUUA 1H0DA 2WD0A 1NCAH 4BZ1L 5JW4Q 5F96L 2YMOA 3LKOB 4HXAH 4ETQA 3S8WA 2D0GA 2BM3A 4G6JH 1LMKA 3N42F 5DK0A 5DO2D 2X87A 1CLZH 2BWIA 3POCA 1UCTA 5HP5A 1TJHH 4QWWC 5C0EA 5BZWB 5I1HL 2D7TL 5LNDA 4NRXA 4PJEE 2ICEC 3QI9C 4M4PA 4TNVK 4GFXA 5LB1A 1PY4A 3VAEA 4M7JL 4LSTH 3TNMB 1N64L 3KDMA 1CFNB 1G6RB 3JWNH 4NB7A 3FSOA 3G5VA 3R1GL 4LGSB 4M9OA 4UZSA 4DKAA 4F7EB 3OWEA 4J6RL 5L0QC 4HHWA 3FQUA 1KCVH 4G9FA 3HNVH 5MP6H 2QADD 5MENB 5EC1B 4OJDH 1TVBB 5KVEH 2GCYB 1ED3B 2A6IB 1KJ2H 2IAAC 5EOQL 3VFRB 1UB6B 2OL3L 1OP3H 1MHCB 2GSMB 2VWEE 5IROA 5SWZA 3HN5A 4UTBH 3QCVL 4N5ED 2R69L 3QA3A 1M1XA 4Z7VE 3KZ8A 3N0AA 1AGEB 3CMGA 3MROA 1JVOA 4OW6A 4ZRGA 4F58L 3QNXA 3TH2T 4FTVE 3D4GA 1F4WH 4I0KA 3L5WA 2DQMA 3J8F7 2AK1H 4NQXA 1O7SA 1IGCH 2MHAA 4XCNB 3C12A 3NN8A 2BRRH 4KQ3L 4Q7DA 4MRCA 3EFFA 1NFIA 5CUSH 5JMOC 4HJJH 5FLVA 4APQC 3CFCH 2YZ1A 4NQTA 1HHHA 1DJXA 4M8QA 4Y2DD 4Y19A 3HG2A 3HKFA 4HETA 4F33A 1E7UA 1HNGA 3SDCB 1LNUB 3GNMH 3VGFA 2IBZX 2K7PA 2XT1B 4PJHE 5IB2A 2ZIDA 1CDJA 3T09A 3VWJB 3QUXA 3T8XA 1XTMA 3MLSL 1MVYA 1JK8A 2H0FA 2K9UA 2VLJD 3PNWA 3FF7A 2WXRA 1B2YA 4N9GB 1ACCA 1OK8A 3K2UL 2R29H 3OSKA 4UT9L 3RRQA 1FG9C 1EHAA 5HTSA 2IADA 4DOHB 2V7NA 4LT7A 1R3KA 1WIOA 3FTZA 4M48H 3U0PA 3VXTB 4R7NA 4WDIA 5HYEA 5I6OA 1AHMA 3PRZA 5J6HA 3N85L 1WT5C 4JFPA 1D5XA 3E6FA 3RGVD 1BVNP 3WU1A 1GGIH 5LXVA 5F7NC 1OV8A 3BDYH 2MQGA 4WFHD 4XNUL 3CUPA 1WFIA 3A4EA 1U3HD 2E4FA 4H8QA 4M6AA 5DJ2B 5EN2B 5IOPB 1HAWA 3CN0A 3NFPB 4M29A 1TTAA 2P8LB 4OLUL 1F5WA 3N50A 4AEHL 4P2RE 1QFWI 3EKCA 5I1DB 5KOVC 4JMXA 1YEEH 1EXUA 3ZUCA 2OJEA 4ZTPH 1DQKA 2ICEB 3QI9B 5I2IA 1AFVL 3EJQA 3QRFM 4K23H 2ZPKH 2CBPA 3VFTA 2LFGA 4PLOB 4DETA 4Z8FL 2FUQA 3EFDL 4XWOD 3BCDA 1KN2H 5DK2A 2WLMA 4V2BA 2MH4A 3RNKB 2WP3O 3PDOB 1DQQA 4E9VA 2NT0A 4UQBA 5I1LB 3SIKA 5L0QB 2RGSA 4JO3H 1KPUB 4LHUG 1Z0NA 1BWWA 1IJNA 2A38A 4TUJA 5KSVB 5AKTA 4C57C 2ZXAA 1KENL 2GQHA 4ZSOA 1I1FA 1AGCA 3ARPA 3NJMA 3O9WA 2Z31B 3A21A 2B4CC 5DT1L 5F3HA 1NBZB 1ILUA 3F00A 3H1ZA 2KBGA 3IRPX 4HKXB 4AKOA 1ZVSB 4CMHB 1G7LA 3QT2A 4NJ9H 4UINH 2LLLA 2R15A 3FN3A 1FYTE 4JFFA 2EXWD 3DX3A 5EU6E 4MNHA 4CU7A 2VUYA 4YAQB 3UTTB 2GITA 2JKTM 2GW5A 3BN3B 1E2WA 3N5AA 5CZVH 4LHUD 2EXYD 2Y36H 2V4LA 2Q1EA 4HWUA 1EBPA 1TJIH 4QRRB 5E8NA 3WFEL 3ZT6A 3BE1H 3HHMA 4NZ8A 3REWB 3KCWA 1AY1L 2A6JA 4AL8L 5JYMA 4APQB 3J07A 4AMXA 2ATPA 3K74B 2MPAL 4YIQA 1NANH 1ZA6A 2XC8A 2BIOA 2NY6C 5B1BB 3W82A 1N8OE 2GJ6A 3B9VA 5AYTA 1U30A 3TTYA 1KJ3L 2GJRA 3V10A 3BDXA 3BSZL 4G2AA 2PCPB 2VMJA 4Y16D 1N5AA 4OGQC 3ES6B 1CFVL 2Y9RT 4YSSA 5J7CC 4J3BA 4GS7C 3MRLB 3EO9H 2AABH 4G6MH 2K8QA 2JWYA 3JBG7 4PYHA 5DRZB 5TH2B 4HCRH 1S9WA 3MOAH 5DR5H 1KJ2A 3QZMA 2YXWA 4F8PA 2GTZA 1MCWM 1QW9A 3GSOB 2R7EA 2WBJA 5H37H 2UWEA 2F54A 4LLQA 2V2XA 3UBXG 3ZL4H 2XPYA 4NOBA 4CC1A 5J6GB 1IM3D 3N42B 3CGTA 4FX5A 4JM2A 1A65A 4IU2B 1G7IA 3RTQA 2UZPA 3MGAA 1OAQL 2N0MA 3WAJA 4ZJ9A 5FPIA 3BN9D 1F97A 1U3YA 2H1PL 5DO2C 4EO5A 5DSCA 4YS4A 3B2VL 3RTLA 2NX5E 3HMXA 5FGCB 4IK6A 3EOAA 5JIQA 3IF1A 2EDRA 3DO4A 3K72A 3F7LA 1EEZA 3HNSL 2Q20A 3FPXA 3CPLB 3EO1B 5ILTL 3T6ZA 1FC2D 3GBMH 3LIZH 2XZQL 4OFYA 4DN3L 4W9IC 3MUGA 4N2KA 2CM5A 4BH7B 4Y2OB 4IOIB 3QDAA 3ZE2E 4AEFA 3LZLA 5DA4A 4ACPA 5ISZA 1U8HA 2VXVL 1DQDL 4V1DA 4MMYB 2AMUA 2KYIA 2A9MH 4GUQA 2JIXA 1EJOL 3CXHJ 4JB9H 1FRGL 5LNGA 2ZKHL 2QADC 4JJ5B 4K3HA 5AAWC 4FFZA 3LS4H 2CK0L 3PGDA 3UP6A 3RVWD 4UIMB 5EOCL 1Q9OB 1YEJL 4N5EC 1RZGB 1G7PB 1VJSA 2PPCA 3K5SA 5DHVA 5GGTH 4X5PA 3VACA 5DMKB 2F8XC 2JI2A 3GSNH 3QO0B 4P57A 1MVUA 2Z92A 4TLSA 1JP5A 4I3RH 2AKRA 1TYEB 3INUH 2JI3A 3DPBB 3G04B 4TNWF 1HSAB 2XX1A 3S96B 2Z4QA 3NA4A 1OWWA 2VLKA 5DJDB 2JKJA 3GSWA 4HIEA 5B39B 3GUTA 2R0WL 3VWKB 2ZYIA 4B0MM 2NY4C 4HC1L 1QLEL 3ZHKA 2X7LA 4M61A 5ADPL 1AIFB 3CFDA 3F7YA 1X7QB 2ZAIA 4FQIL 1NGWB 3MGTB 3B1UA 3QXDA 3S7GA 1YDPB 2X6BA 5D71L 4DUWA 5GRWA 4FFVD 4R8WL 2APVA 2HX9A 3FOMA 2Y23A 4E36A 4YSAA 3II3A 2XTJD 1CE1H 4LMQI 4NKMB 1ZLVH 1MG3C 3EADA 4PV1C 4HT1H 2DEYX 4CADB 1AZNA 3AT8A 3D2TA 2XWXA 1I8LA 3MKGA 1MCDA 1UZ8B 3FRPB 1PL3A 4GS7B 4W4NA 2TAAA 5D72L 4X6BB 4U1JA 3ECUA 4W6XB 3HAEB 5IVNA 5D1ZD 2RMNA 2ICWI 4XNDA 3JWOC 1V3LA 2YC1B 1F18A 2Y25A 1FGNL 2DIJA 2R2BB 5B38B 3RGVC 3SE4A 1N18A 4L8BA 5IMKA 4HOZA 2OM5A 4KVCH 1ORSB 3RX9A 2YK1H 4UV7H 3GXTA 2NY7L 2XOTA 1KB9K 2PWGA 1JHTA 1HYRC 1Z0MA 2WXJA 7PAZA 3EJCA 1XF2A 1HVXA 2PYEA 1EHLH 5KBKA 2EINB 5EZJA 4A2EA 4YE4L 1ET7A 1UXWA 1G7MB 4NO5B 1Z6JT 2UXVA 3Q13A 4RBPK 3RWHA 3GS4A 4K9EC 4L1DA 4KGLA 2CLZA 3FSAA 4ZTEA 3IS1X 4K94H 4RX4D 4ZUTB 5JLZA 3VA6A 3RJOA 4ILDA 1HK6A 1K5NA 1KOAA 3ULVE 1UCBH 1WRFA 4X6FB 3MCLL 3EBGA 4WUUB 3GPEA 2ZJSL 3QXAA 5ICXA 3CSBA 3WO4B 4NN6C 1JV5A 4POZD 3OPZH 3U48A 3GJFH 3NZHH 4TSAH 4I87A 1MJJA 3LKNB 9CGTA 3T2NH 1H3WM 5T3XD 3OKLA 4ZQTA 1U3JA 4BZ2L 4X6EB 1EDQA 3QORD 5DS2A 5T3XL 2GI0A 3HE6D 5FLUA 3OKDB 2ICWB 3PABB 1UEMA 4KQ4H 4RVBA 1KLUB 1QVOB 3GT6A 2VZ3A 4NO2B 1O5DT 4NO0B 4PW3A 1N26A 1DQMH 3GZQA 4IRJA 5JQIB 3PU7A 4X6DF 4FFYA 2EXYC 4K9JA 1AI1H 4HEMA 1DLHB 4IDLA 4A7VA 1MFNA 4ELMF 2YRPA 2NY4B 3FT4A 3B2UD 3HE7D 3BKJL 4HHAB 1K6QL 5JHDD 5E6UB 2ZZUT 1D5IL 1PX4A 4XNMA 3VVWA 3JVGC 1MJ8H 3WS3B 1SJHA 3CFEA 5CSZB 2X6AA 3HG1D 1T6VN 3L54A 2YR3A 2VB5A 3C60D 4Y16C 4R5XA 2ETWA 4K2UH 2V5YA 3KPSA 4KI5F 1CQKA 1RZJC 2ZKWA 3BD3A 5EPMA 2QMJA 1KB5H 1YEFL 1EZLA 2HJFA 1FFOA 1QASA 2L0DA 5T1DH 1JZDC 3D3VD 4S1DC 3GHPA 2FX8L 4HG4K 4QGYA 1BXVA 2ZX9A 4TL4A 1YPZA 1GRWA 3AREA 3FO2B 3QUZA 1NMAL 1BX2B 1RIUL 5JDJA 5GISH 4G6FB 2WXHA 4MAYD 4PRIA 2EUZA 2E8YA 2ESVB 3IRZA 1IKNC 2DWYA 1U33A 3BN9C 4G72B 2ZXWB 1MG2C 1YN7A 4Y2NA 4N8VB 1ZGLP 1XH1A 4YLQT 3M6DA 1ITBB 2JB5H 5DD1L 3UO1H 1A14L 3N6YA 4WEUD 5FB8A 2YD9A 3RKDC 2NZ1A 5IFJA 3GYRA 1Z2KA 4ZPTB 2WKOA 5IESH 3RWDA 4ATWA 1A7OL 5DD3L 5E9DA 1RZPA 3T0WA 1DR9A 4TYUA 2IH1B 5FO8B 3CH8A 3V4VA 4JBSA 3UJIL 4M7LT 2L4OA 4NPYA 5C7XH 1M71B 1IIIA 3M86A 4ENED 5ICZB 5E23A 5HYJB 1NCIA 2RBLA 2NDFA 3VFPA 1M56B 2C3GA 4WI5A 5HGAA 1B3IA 4HF5L 3BIKB 1ZANH 4LP8A 4NN6B 1BM3L 1SDDA 3P73A 1IC4L 3MPCA 4EI6A 3QNYA 4YHLL 2OYMA 1HH6B 4HCGA 3RVWC 4DP0X 3ARWA 4U3CA 2OI9C 4FXGC 1G5GA 4XVSL 3WLWC 4UQEA 5LAXB 2FZ3A 1TTUA 3I6GB 2G2NA 3DHPA 3MV8B 1QFUL 3TASA 5SWZD 4YHML 5IROD 4OZFH 3V6OA 1SNRA 2ZXCA 3NCYS 5E9NA 4DPAX 1HL5A 2CKBA 2WLYA 4M6OL 4XCEB 1FL6A 5IVZA 5IHZA 1QP1A 5I82A 1CGWA 2JJSA 3U46B 4D9LL 2X2JA 2UY6B 3AS2A 5E8PB 3UBXI 1EAPB 1IQWL 2EIZB 4E9YA 2A6KB 2IOOA 3WTVA 1HL9A 1YQVH 4JRYB 1M2VB 4KI5C 4EKXA 3DARA 4Y19D 5AOIA 4AGLA 3GXNA 3DX1A 1SJMA 2ZICA 1CDHA 1NUNB 3QARA 1TTGA 3JV4B 4M8RA 5JW5A 4P2QA 1MSPA 3BSGA 3QQ4A 4U4BA 4AKQA 3PWPB 3HI1A 4AH2A 2FJGB 3QUXD 4YVUA 4HGWA 3HHRB 1I7TB 1X9LA 1B0RA 1E4WL 3KWWA 1OT4A 5C0BE 3PYCA 4FI6A 3ML8A 4YNYB 5EFIB 3DIFA 4G3YH 4PJGE 4PRBB 3DIDA 1JCVA 4Y1AA 5DQDL 4Y5XC 2P5WE 1F3DJ 1UYWL 3DROB 4HFUL 3FOLA 4I9WE 3LTVA 4QUOA 2FWSA 3JV6B 3QWRA 2WSDA 3I3EA 4OD3H 1KTDA 5ECGA 1AQMA 1JFQH 3ZGHA 3BMVA 5FUOL 1S9KC 4YPJA 2H6UA 5LWYH 3D8MA 4D0BB 1SVBA 2XNAA 2OSLA 3WEXA 3QFJA 5DGRA 4CKQA 2GABA 5F1NA 4G59C 5IB1A 2ADGB 4XNAA 1FNEB 1YAZA 4I77L 1YEHL 5A7BA 1HL8A 4KDTA 5I18L 5I9QB 1CFQA 1IEAA 4UQ9A 5AOKA 1Y07A 3F7VB 3VG9B 1QBAA 2A73A 1S7WA 3QPQD 4LNVA 3ORJA 3TYGL 5IB3B 3CNKA 4QF1B 3DTXA 3IDGB 5B1JA 4POZC 3UZQB 5G4MA 4AIZB 2AW2A 2DH3A 2ITDA 1IGIH 2IOIA 4PRNA 5I5JA 2AEIT 4UT6H 4XNZB 5JZ7D 1CD0A 2OI9B 2X1OA 4BJLA 2CLRA 1YEIL 1TQWA 3CVCA 4HISA 4X6DB 2ADJB 1BPLB 2L7UA 5IQNA 2N3JA 3T6QC 3JWNG 2EYTB 3FQNB 4ODVH 3D39A 3QUKB 4ELMB 1EVUA 1PNDA 4IRSA 3P4NA 2YA1A 3MFFB 4NGHL 4UV4H 3BVDB 3TT1L 1JNNL 4TQEL 2YPVA 2YKLL 4N2DA 4JFFD 4DK3A 1L9PA 4CVZB 1BQHB 5ALBH 3B2UC 3FU7A 1R47A 4OLYL 2ATKA 4A1RA 4GEJA 4F9LA 3OKNB 3N1PC 3DK2A 5MEOB 3IJ7A 1KTCA 1SBSL 3KGUA 1U92B 3E1ZA 3VFNA 1UD6A 1NKGA 2Y69B 3B2XA 2R56L 3JUZA 4H26A 1MI5B 4Z5RB 1GGUA 4JDZB 1AQDB 2DICA 3G6DH 4DP7X 2GJ6D 2HPOA 1QSFE 5AZ2H 2Q2LA 2AQTA 3CXDH 4JGJA 2ID5A 4Q9BA 3N1MC 1D5BA 2YD6A 1RZ7L 1PG7H 3FT3B 3ULUE 2AV7B 1K8IB 1I85A 4CJ1A 1AXSA 4FN0A 5KANG 4NCDA 5ABDE 1JD9A 4YUEH 3QPKA 1I3UA 4G8EA 5IBLC 2WBJD 4Y5XB 3MFGB 3V55A 3SO5A 2X38A 4KZEL 1MJUL 4OF7A 3IETA 3BO8A 4JM2D 2V2TA 3JWDL 1DLFL 3S48A 4S2SA 1R75A 1RPKA 3RTQD 1LO2L 1GGCL 1ZXKA 3RP1A 2OR7A 5EUKA 1BQLH 1DE4B 4KFZC 4LRNH 3GM8A 1CBVL 3T1FA 1T21A 3MLRL 4PP1D 4WI8A 1I9IH 2VR8A 3GSUA 1G43A 2K8MA 1GIGL 3MNVA 3OL2A 3HMXL 4KFMA 2W38A 3MUZ1 4KWUA 2UY7A 1S7RB 4OFYD 4I48B 3FQRB 4M03A 1SY6A 4NPKA 4XVOA 5KS9E 5ISZD 1EUTA 2XQBL 2X70B 2NRDA 4X7SL 4V1DD 4FMVA 3H7BA 4OGYH 1TZ8A 4AYEC 1KWKA 4LASL 1IE5A 4M4RB 1H5BC 2I60H 3QWQB 2JIXD 3QJVB 4TUOB 2WNWA 1B9KA 4OSUL 1LP9E 4GOSA 5A1AA 3AU1B 1CGSH 1JGIA 1D3CA 4FFZL 3H85A 3SPVA 3ZL1A 2WINA 2LU5A 2BNRE 3C6SA 1W0VB 12E8L 3NCBB 4N2FA 2BW5A 2JTYA 3TBWA 2IH9A 2VITA 5I74C 2PETA 5F72S 4QOKE 2APBA 4G7RB 2P48B 4IKKA 4J3OH 1NCNA 2E4TA 2VABB 5GS1A 3LZRA 1XSIA 2YQ2A 1N8ZB 4HMEA 2DM2A 4RMUA 4X4YA 2VLKD 4H8WL 4ZD3L 1X5IA 3QH3A 1KCUL 1HOEA 1KIRA 1RJZA 3G5YB 4AM0A 4CN4A 2GK0B 1A7NH 2R2HB 3RWJB 2J1YA 3F6LA 3MRPB 3SQBA 3QZPA 3H0TA 3GKZA 5F8QC 1WAAE 1BZDA 2XDHA 1URLA 4QJ4B 4ZOAA 1EJFA 2CIIA 4FQXA 3V5KA 2UUDH 4JFEB 1GAFL 1EUUA 4HK3N 2FLBT 5DHYB 4L1SA 4QTIH 4HOMA 5IGXL 1UH4A 1M3IA 3QUXC 4Z7UA 5HGGS 4TTGA 5BOJA 2HUEA 2JCCA 1KIUB 1UEYA 2J21A 3R06A 2WIIA 4UT6A 3GRBA 5FOJA 5JDSB 2IDFA 4NQDB 4CJ0A 3SYOA 4MHHG 4NUQA 3C6LA 3LQAL 4FNLH 2OMUA 2APFA 2VOTA 3O3DB 3CFIC 2D31B 5F7KC 3F04A 4LB8A 2LGNA 2VZUA 1AP2A 4JPVL 1ZS8A 4FHJA 1UWXK 5DURB 5E2JA 3DJZA 5L2JA 1NGYB 2B59A 5KTEH 1RAMA 4K4KA 3VTMA 4MCZA 5FA4A 2ZCLH 3GBEA 4TULL 5FGCE 5HDQH 5I17A 2YRBA 1T2QL 2VDNL 5D2NA 2IMNA 2N4IA 4KKPA 1NCCL 2DDQL 2ED8A 2PYED 3DX0A 2A1WL 3TTSA 3QZBA 1RUAH 4RZCA 3AS3A 5ESVB 2WLKA 4IDJH 4JFQA 4LEXH 2JSFA 1P7QA 4KTDL 1CMOA 2ISDA 2J4WL 2VKWA 3SYQA 5FECA 4QR7A 2MOVA 2LQRA 2X4SA 5GJSL 3QPQC 2WK2A 4UQ3A 5DWUL 1VRSA 3O2DA 2KLRA 3S37L 2YPKA 3OMNB 5I8CB 3EW3B 4ODHL 3QWOA 5D6DA 4AQ8A 4JPIA 2K4AA 1H5BB 4O9HL 3MRIA 3WMPA 4BFIA 3ASNB 5JZ7C 5KSAC 4X9HA 4BSWA 1JDDA 4FKHA 1MDTA 3RPIA 4NQSA 4WK2B 4N2AA 1XGRA 4JRFA 4RFOH 2B39A 4YH6A 4X7EC 1ZE3C 3SDXF 5E6RB 4IOFD 3GO1H 2JB6A 3VU2A 1OAKH 1UJ3B 3APNA 4LCVA 4OLVL 3E8VA 2QQNL 2ZOUA 3GJEA 3NRQA 1ZCRA 4OZHB 5I74B 4JFHE 4ZX4A 5DHDA 5CO1A 3N91A 1NL0L 3QXWA 3B7YA 2VLME 5DMIL 1D6VL 3OAUH 4IRJD 4BK8A 4OQTA 1LEIA 1G84A 1YNTA 3MUJA 4NZTL 3JQOB 4JZNA 4N4YB 4FFYL 1AD0B 1GSMA 2UX6A 3ETSA 1RJYA 4M6MH 1Z9OA 3L5HA 4H1LB 3SE8H 4GYBA 1J05A 3F05A 1NBVH 4WHYH 3JWNC 4XBMA 4DP8X 4W93A 4F5CE 3IU3A 1RZ8B 1P5VA 2PPFA 5D7KD 4GO9A 3L2MA 3LXCA 3KPSD 3BGFB 3NCXA 1FVEB 3RGBA 5JYLA 4XMXA 4UUJB 3ARFA 5C07E 4XXDB 4F37K 1OAXH 4BFNA 4TOYH 2NYZA 3NGBC 3X2QB 3S3JA 3WKYA 3T0EA 4LL1A 2GBVA 3U79A 5I16B 3QNZA 1LK2B 3P9LA 4FQ2H 5CD5D 4NKOA 5AB9A 1LE9B 1NC2D 2CE6A 2AJVL 3ARED 1SLVA 3QUZD 5H2BB 2E9BA 4I2XA 4PWEA 4YHZL 1OSZA 3NZ8A 3UBHA 5E24E 3VRIB 1GTFA 1S7TA 3DV6B 1ZAGA 5IT2L 1W6LA 4ANVA 2G60L 2W80C 4IIQA 4N8UA 1TENA 4PP1C 3T08A 3GMRB 4X9FA 4EIGB 3PWUA 3OX8A 4FTDA 1B2WH 1C1EL 1TETL 4HWEH 5E9DD 2PTVA 1SGKA 1B0GA 2WB7A 1KCSL 1LTXA 2F58H 4C47A 2MKLC 3BP5A 5IOPA 3LN5A 5KVGL 5DXWA 5I0ZA 5EEWA 3EXLA 3V4VL 4LMQE 3VB8A 2G3XA 4YDVB 2J57A 4RDQG 4XNQB 3EBIA 4KKQA 2VXVH 5AAMC 3K8LA 3VO0A 3X11A 4BHUI 1SQMA 2WBWB 3B83A 3H55A 1NZRA 3LEXA 4H5SB 5J5EA 4NC1C 4YDJA 4WEEA 2P5EA 3L48A 3WYRA 4MMZC 2R39A 2WXKA 4MJIB 5KSAB 3QJXA 3P4MB 5KAQF 2CK0H 4HKZB 4KJYA 3VXSB 5EEVA 5E8DL 3UJTL 4AUUA 1REIA 3JYBA 2J5WA 5IHHA 2WKGA 2Y7QA 5FDWB 3VD5A 2LU3A 3L16A 4BZYA 2Q6WA 4ICWA 1KBBA 5AOLA 2CPCA 1K4CA 3EYOA 4HAFA 1C7SA 4ELKB 5DEJA 3ZKMC 2TSAA 3QJOA 3ARXA 4X0KB 1RVFH 3L5XL 2DPKA 4QYAA 3D09A 3V5HB 1EFXA 4LU5L 2WAQA 2CKBL 4ZFZA 4Q56A 1QLEH 2M83A 1A8ZA 5D71H 2G5UA 2O5XH 2HTLD 1E5AA 5IQ7L 3TCTA 4RNRA 1RIVH 2RQ8A 2VLJE 3IFLH 1S3KH 1A2YA 1F1DA 4X0NA 3L5JA 4RMSA 3TPUA 3GMPB 4GW4B 4ORZC 2VDOL 2RA1A 3W9EA 4P2QD 1U21A 1YY8B 5KBPA 2F68X 1FH5H 3UABA 3DX7A 3N55A 4N0FA 5GGRA 4FEIA 3FB8A 3S4SA 3KH4A 2OMTB 3NGBB 4YXHL 4C4KO 3MCKA 4L2YA 3NPZB 2ZAHA 5E5MA 1U8MB 3SE4C 3SJVA 1UM5L 4Y1AD 4ZFQA 1EANA 2AI0H 3C5XA 3IGKA 4ZYKB 3MRJB 2YRZA 3MZGB 1INEH 1RKRA 3DOIA 3QWRD 1BIHA 1C5BH 1KG0B 5I30H 1XFPA 3RE0A 3B6SA 5JPNA 3ULAB 2D3LA 2AC0A 2W94A 4KOBA 4XPTL 4P59L 3P2BA 3BD4A 1IGML 4IEFB 4YE4H 1T3FA 4GI9A 2QQKH 3WHE0 3FTSA 1CTNA 2WBXA 4JO2L 4M3JA 3QFJD 3TVMB 4YX2L 2VO8A 3BJ91 4ONHA 5ECJE 4O2EB 4I5BB 1I9RH 1JGLH 3LSOB 5DJYA 4IK7A 4BM7A 4HIPA 4E41B 1IC1A 4LCIL 1VEPA 4LLAA 4PHZA 2B3RA 1JNLH 4LVHC 3VH8A 1V7NL 1TTRA 4RMRA 4JRLA 2PWHA 4Y89A 4YHOH 2GTWA 5DD5L 3SDXB 1LDSA 4PQXA 2YBRB 3VYPA 1HHGA 2NY0B 2OK0H 3IMVA 3RU8L 1BWMA 3OV6A 4JGNA 1I1AC 1NSNL 3P11L 3O3EB 3IPBA 1O0VA 4LPWA 2Y07L 3WUZA 3IJHB 2LU4A 1KJVA 2C4FT 4MRBA 2YUZA 5IHUL 3LEYL 2CM6A 3IJ9A 4MHHI 1P6AB 5CJOL 2I9LA 3D39D 4IRSD 3CTTA 1NANI 2QLVB 3QEQA 4GINA 4L9LB 2AZUA 4XNYL 3U1SH 4B96A 4PJAF 3D0LB 2FQFA 1HJCA 3CJJA 3SKOB 5T5FH 5CU5A 2YPVL 1R5WB 4E5XA 3L4VA 2VDQL 3IAGC 1OHZA 5IIEB 1HKFA 1X9RA 3BAYA 2XZAH 5EO0B 4JS7A 1S9YA 1SHXA 2XIDA 4F7PA 3ZJAA 3GTVA 1IKFH 1NEZB 1COBA 3EGXA 3KLDA 4OCRL 3L3GA 4JKPL 3L4WA 5K9JH 4DKFL 1ZHLB 4FC3E 4XZUA 1P4LB 2QPEB 4MZIA 4N0UA 5FO9B 5F3BB 3W3BA 1KN4H 5KEZA 1YEFH 1CFTB 2MQCA 2QVFB 4GRMB 4YHPA 3ESPA 4BWUA 3U6XA 3BPNC 3NFNB 4PG9A 4PWHA 5D9SA 2EILB 4HKJA 4WI6A 3DHUA 3SN6N 3T0BA 3DA0A 3DRQA 1I8IA 3D69B 4HIJA 4RBPH 5ERWA 5FYKU 1BBDL 4DO4A 2ORBL 2AGJL 4LBEB 1KXHA 4DZ8A 4AUYA 1VDGA 4H0GA 4Y5VA 2DMHA 2QPFA 3IDNA 1T22B 1SBBA 1OY3B 4Y5YA 1UB5A 2C34A 1BD2A 4QNPF 5C9KA 1Y7VA 4HIHB 2DEWX 1T83A 2I7SA 4O2FB 4U1HA 3MREB 1EXHA 3TJHC 3L4XA 1TVHA 2FJHB 3AVEA 4DF9A 4ZK8A 4LQFL 3WUWB 3S8GB 4JZJA 4LLUA 2OTUA 4L3EE 1FJ1B 1J0HA 4EIUA 2VC2L 1IGYB 3EJYD 3BQVA 1D5MA 1SY6L 3B1TA 4YSCA 1SYSB 2HWZL 5DD0H 1VB9A 5K93A 2KDGA 4PJFE 4LVNB 1KNOA 3L3JB 2E7LA 3MA9L 5GGVH 1BEYL 3IVKA 3O6KH 4G1MB 3DVFA 2OXGA 4M3HA 4PJ9A 4R84A 1I1AB 4XVSH 3TJEL