2JLPA

Crystal structure of human extracellular copper-zinc superoxide dismutase.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
DGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR SUPEROXIDE DISMUTASE (CU-ZN)
publication title The Structure of Human Extracellular Copper-Zinc Superoxide Dismutase at 1.7 A Resolution: Insights Into Heparin and Collagen Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2jlpA00
1UXMA 2Z7UA 1DO5A 1F1DA 1Z9PA 3F7LA 3LTVA 1SXCA 2GBTA 1S4IA 1IBDA 1XTMA 3ECUA 3KM2A 1EQWA 2GBVA 4L05A 4OH2A 1PZSA 1IBFA 3CE1A 3MNDA 2WYTA 1XTLA 1JCVA 1UXLA 3GQFA 3ECWA 2Q2LA 1E9OB 3QQDB 2WWNA 1OZUA 3HOGA 3KH4A 1SXNA 5KBKA 1CB4A 3GZQA 3KH3A 3S0PA 4A7SA 2GBUA 3SODB 1KMGA 1ESOA 1XSOA 3CQPA 1PU0A 4B3EA 4MCNA 4BD4A 2AEOA 2JCWA 1L3NA 4A7TA 4N3UA 4A7GA 4BCZA 2R27A 1OAJA 3MKGA 3GTTA 1BZOA 1F1AA 2AQRA 3QQDA 1E9OA 2ZKWA 1FUNA 2ZKXA 3CQQA 3H2QA 3K91A 1RK7A 4A7QA 1COBA 1JK9B 1SOSA 1PTZA 3L9YA 1F1GA 1Z9NA 4U4IA 2NNXA 2WKOA 3ECVA 3HW7A 1N18A 4A7UA 2ZOWA 1E9QB 1HL4A 4MCMA 2APSA 2ZKYA 1P1VA 1MFMA 1JK9A 1EJ8A 3F7KA 1DSWA 2Z7WA 2XJKA 1QUPA 3KBEA 2WZ6A 3HFFA 1SDYA 5CU9A 4A7VA 1B4LA 1Q0EA 2AQQA 3H2PA 2AQPA 2AQNA 2VR7A 2WZ5A 2XJLA 3GTVA 3KM1A 1BA9A 3KBFA 2Z7ZA 2WYZA 1OZTG 1TO5A 4A7GF 1YAIA 1E9QA 1IBBA 5KBLA 2E47A 4OJAA 1E9PA 3GZOA 4N3TA 1IB5A 3RE0A 1B4TA 2E46A 2V0AA 2WWOA 2JLPA 1U3NA 3GZPA 1YSOA 2C9SA 2C9UA 2WZ0A 3L9EA 1E9PB 2WKOF 4FF9A 2VR8A 2Z7YA 1HL5A 4BCYA 3PU7A 2VR6A 2K4WA 1OEZW 1SXZA 1IBHA 1OALA 2AQSA 1CBJA 1N19A 2C9VA 1SXSA 5KBMA 2AQTA 2AF2A 1SXAA 1SDAB 2LU5A 1SPDA 1TO4A 1YAZA 2SODB 1SRDA 1F18A 1SXBA 1AZVA 3T5WA
chains in the Genus database with same CATH superfamily
4F15B 3FQTA 5L8JB 2XY2A 3F7QA 2OL3A 5HJ3B 1TQBC 3G04B 2W60B 3HS0A 4WJ5B 2NR6A 2WTPA 2W8CA 1L9QA 4L3ED 3LN5B 3ZQWA 4AT6A 1G6RL 1U3HB 3KPNA 4FAAB 3MBXH 2QVTA 1KYDA 4P5MB 1XGUB 4KHTL 3PJLA 4GRWH 4JO8A 1IL1A 3P3RA 4ZTEA 5T5FL 1HU8A 4FGMA 1ETB1 3N41B 4KI5E 5A43C 5A3IC 3P3YA 2B77A 2DMKA 3BZFB 1QTSA 3P4OB 4WWKA 3APCA 3UYRL 3EF7A 1XGRB 1RULL 1L3NA 3FTYA 1VFMA 3QJTB 1X5HA 1GGYA 1DYZA 2GTWB 2LT9A 3MRLB 4NKDB 5AOLA 4PJHF 2OX5A 5C2BH 3MODL 2XN9E 2VJ0A 1A3ZA 2HRLA 4OLUH 4FZEL 4GMTH 3FN3A 5BOPA 5BS0B 4RAVA 3LEXA 3ZOAA 5G4OA 4X8JB 3FO2B 3ETBF 5D1XD 1N3NB 5MI0C 5F6HI 5IQNA 5E00B 2ARJB 1U8MA 2GJZB 4UQ2B 2PW2A 5J3HC 1AQHA 1SMOA 3DHMA 4G5ZH 2BDNH 3SGEI 5HTSA 5CFHA 2B4CL 4JX0A 4FXLA 1WFOA 4UI2A 4WDIA 2EDYA 4B27A 1Z9MA 3AWFA 3APNA 4QRRD 3CN1A 1IQDB 3HFFA 4R7XA 1YEGH 1LO0H 1LDPL 4PYHA 4HUXA 5IBUG 2NRDA 2IDQA 1LO2H 1PLGH 3DUSB 3IWVA 1DR9A 3SDXB 5BQ7B 3AU0A 3WGVB 4ZUTA 4AMWA 4DUVA 1JTOA 2VDKB 1VFAB 2GSGA 1BFVH 2V8MA 2XTLA 2EIMB 2FQFA 2VLJD 1G94A 3WKMH 1OWRM 3QNXA 4U7MA 1J1PL 3HBPA 3VA2C 5MEOA 3TH4T 2OJEB 4P4KB 3OB0H 1RZGA 2WN3A 3MBEA 4ZW8A 1T03H 2XQYA 4YLBA 1EPFA 1DEEB 4PG9B 1RIUH 4Q6IB 5HPMB 5FGBA 2WQVA 4MD0B 1N59B 1T0PB 4X5XA 3WHXA 4KZDL 4PLKD 5DMIH 5BPPA 4N2IA 3P9MA 3SZ6A 4NQCA 4JB9H 2GFBA 3EGSA 1JOIA 4NDMB 5CJQL 4QJ5B 4B9KC 2ARJQ 1Z5YD 3ASWA 3QDJE 2HVKA 4JM2B 3FQXB 2NY1B 5DFVC 4NENA 4X6CB 1R3KB 2WQ8A 1WH0A 3DOSA 3HFML 5AEAA 3O3AA 4P9HL 1N0XH 1RY7B 3BD3A 3HI6L 4P2OB 4XAWH 3WS3B 1U8QA 4KITB 3NCYS 5KEZA 3JWNH 4G1EB 4QAWA 3V0GA 1AO7B 2V9QA 2F7QA 4PRPA 3SQBA 1I3VA 5LCVH 1F4AA 1EFXA 1NMAH 1QSFB 3X3FL 3K1KC 1KY7A 3KW8A 1HQ4A 5EN2A 3VXMA 5IESH 3L5IA 1IJ9A 2YD6A 4HQQH 3NT0A 1IU1A 1MAJA 2ZKHL 3U46A 1X9LA 4MNQD 1IFRA 2BSEA 5LGJA 1OAUL 2ESVD 1JWUB 2XCMC 3BFOA 3CZFA 2FWOB 3NCWA 2NY7L 4YHML 1A1OB 1F90L 4XZUA 3TO4D 4A6YB 2Z31D 3DJ9A 2YKLL 3PREA 5ALBL 1ETZB 3KLKA 3H42L 5EOCJ 3IAGC 1SJMA 3KGUA 5F6IB 1DJXA 2D9CA 3RX7A 3US9A 4UQBA 3OR6A 1EJOH 2WVTA 4NB7A 5CEZE 4XMVA 4L8SA 4R4NC 3EJYD 2ITEA 4AQ1A 1LEIB 3G08B 4UNVA 1UT1A 2OMUB 4XMKL 3TT1H 3NSJA 4LMQE 2WKGA 5DO2C 2DEXX 2IGTA 3ZLQC 4PP1C 3FXIC 5F9WC 2GVYA 5DQ9B 2K8QA 2H8PB 1PG7H 5E8PB 4XNUL 4HCRA 2I07A 5EZIL 1K3ZA 2OTWB 1BD2A 2IJ0C 2HWZL 4Y5XB 4J3OD 2BJMH 4EI6B 5IV2B 4KKAD 5DXWA 1HZHH 4WUUA 1TNMA 3CFEA 5L6YH 4ESKA 1NIAA 2XKNB 3MCYA 4M1DL 5DD3L 1FNLA 1KCBA 3P40A 3VI3F 2HG5B 3JV4B 1RFDH 1AS6A 4HJTA 4PRHA 5JUEL 4G7YL 3W11D 4PJDE 2X53A 1C7SA 1TQBB 3D12B 3FDWA 4KV5E 1QFPA 4YFLI 4FFVD 1D5IH 3P2DA 3ZBMA 4FFWD 4PGEA 1DCLA 3JTSA 2VR6A 3BVNB 3FU9A 3HG1E 4FP8L 1HHIB 1MF2H 3B3BA 1W0WA 1OP9A 1I7RB 1X9RA 1ZWIA 3HMWL 1H8NA 3IKCA 3LY6A 4K3EL 4NHCH 1IFHL 4U6VH 4A04A 3IDMB 1P1ZA 2XVBA 1T7VA 1UT9A 3FYEB 3OKMA 4K5NA 3VWKA 4JFDE 5SX4I 1MRDL 5TH2B 2Q6WB 4S0HA 3QUYA 4AVJA 5EO0B 3RNKA 3NJFA 3CLFL 5GRJL 3HAEB 3MLWL 1FSKC 2APVA 4I3RH 5HYQA 4OH2A 5L88H 4YWGL 4JRYB 4G6JH 2EVGA 3WBDA 4NRZA 4GKSB 3G6JE 2HFTA 1AQKH 1F56A 4X4KA 2DKUA 4JK0D 4OBSA 4NN7C 5DGRA 5MI0B 4YE4L 3GKZA 1ZHNA 2F54A 4DT2A 3U1PA 1N2RA 3SE4A 3VGBA 1CZ8L 3D39E 4QTHB 3MJ9A 1UKSA 3KJ6H 2NPLX 4WHTA 1NCNA 5LBSA 5IWLA 3C09C 1Q94A 2UWEF 4FHBD 3NN8B 2ENPA 4JQIA 4YHPB 5I1EH 1UOKA 2HFEB 4R7NA 1OAXH 2A73A 1GKOA 3TNMA 2O93L 5LJYH 3PP3H 3L16A 3MBXL 3DO3A 1UD5A 2YLKA 4MA8H 4ODSH 3QORA 4XPFH 1UGNA 3RVTD 4E0RB 3BQUC 3C5ZD 4Y7OC 3UZVB 3WN5B 2V5YA 3GS4A 4YZWA 4H20H 2X3BA 3CAFA 5JQIB 3X1EA 3VE0A 3AS0A 2Z7WA 4DSYA 4WFHE 4OZHF 5DTFA 5FW8A 3BW9B 4RESB 1X4XA 4AY0A 2HXAA 5AYQA 2UYLB 5C2BL 3DI3B 1UURA 3KR3H 4OLUL 4Y5YC 2AK4D 2ZNWA 3GMLB 3DXAB 2B14A 3B5TA 4MJIA 1ZGLB 4GMTL 5DUBA 5JZ7D 2EDMA 2WJ7A 1RZKC 4OZ4A 3GLAA 5LN4A 4QXUH 3F64A 3RX8A 4YSPA 3T6QC 5DEFB 4F1ZA 5E6ID 3S5ZA 4F7PA 3L9EA 4G5ZL 2BDNL 4QRQB 4L8BA 3ATAA 4ZRGA 3OAZK 2X9YA 3CHRA 2OMTB 3ARVA 4ILDA 4TUKH 2TRYA 4KOCA 3T0AA 1YEGL 4MD4B 1LO0L 1N10A 3K6SA 2FAUA 1AMYA 1LO2L 1PLGL 2BNUA 2DIAA 1E5YA 2NYKA 1ZPLA 3D25B 3L5WA 3QPQC 4Z7OE 1NEZA 4XVUD 1MJJB 1WG3A 5F7DB 4M62H 1ID5I 3UG4A 1E65A 5EC2A 4I48A 2I7OA 1BFVL 1F18A 2P46B 4L29B 1JRHH 4JANB 1J12A 1AD9B 4MSWB 4UBDC 5FO7A 3WKML 4JVUA 3NSDA 2ZF8A 5JOFB 3VO0A 4HMCA 1TMQA 4NQVB 4DTGH 4ERSH 4XXDA 5DJXA 3IS1X 3D2UB 4JJ5A 3KPSE 1T03L 3IRCA 4JFHE 3JTBA 3RWGA 3T4AC 3L4XA 3ZZLA 2MOGA 5H37G 3O0LA 1H5BA 4NAQA 2JIXB 5DMIL 1OGTB 4OGXL 4HIEB 3DPBB 4JB9L 5EF1A 3FAXA 3GSXB 5GPRA 7PAZA 5IKCA 4KQ4L 4OLWH 1SJEB 1YA5A 4Q7DA 3TBVA 3L5HA 1U8HA 3U6XA 5F9WB 1IARB 5DGQA 3BYYA 1PZUB 4NWTH 3FQ4A 1T0MA 4UOW0 1HCVA 5E5UB 3TM6A 1ETA1 1CI3M 4XMWA 4PREA 2FJGA 3UTTE 1N0XL 4H40A 1MCCA 4NKMA 4YC2C 5G4MA 1J0HA 4XAWL 1SY6H 5AZ2H 1AACA 3O4LD 2ZUYA 3S5YA 4YHIB 4EJ1C 3C6LD 4ONOA 4NQED 2JWYA 2ZCZA 1KG0A 2FUQA 4KXDA 3ZDXB 5EUKB 3UAJD 5LB1A 3NA9H 1TZIB 3AS1A 2ZQKA 3APDA 4AM0A 3GF8A 5IESL 2LVCA 1KIRB 4PBVC 3VYPA 5HVFB 1E43A 1IEAA 3D3VE 1X5KA 1XXFC 5CMAA 2VQUA 3UTPE 2MTAA 4NP4H 1JZHA 2VT0A 12E8H 1Z2KA 2F8IA 3WIHH 5FA4A 2ZOKB 3QFJB 2XYCA 2EXWD 1NFIA 3O11A 4PJFE 3RAJL 2VZTA 5GJSH 2YQ2A 2C1OA 3QQ4A 5KN5B 5T1KA 1A1NB 1KB5H 3VWJC 5K93A 4JPQA 1IV8A 4CADA 3UDWC 2P80D 4EI0A 5E4EC 3RU8H 1EJOL 4C4KT 2BIMA 4LHUB 1CBVH 1C12B 3LZPA 3ML9A 4MMZA 3U7WH 4Z78A 4QNPE 3DARA 3L3OB 3UFIA 2ZYHA 3L13A 4PJIE 2KQMA 4NKQB 2FT8A 4OFVA 4WEUD 3ZE2E 5IVXB 4QRRB 3TT1L 5FOBA 3BZEA 1D5ZA 3F58H 1F5WA 5JHDE 2P5EB 1FSKB 4U6TA 2OZ4A 4BQ8A 3DETD 4ABUA 1KPUA 1S78D 2EDWA 5EZLB 5C0IA 5KSBE 4X6DF 1PG7L 4L9DA 5K1JA 2HJLB 4G9FE 4BGDA 3EFOB 3N0AA 5CJ8A 4NN7B 5D55A 5JXED 3WU1A 4ODHH 2BJML 4HGWB 3MNVA 2O5ZH 1HZHL 2LLGA 2IPTH 5L6YL 1RFDL 4P46D 3C09B 3R06B 2Y7SA 2QSTA 4ANXA 3U2SB 3HS8A 4HUUA 2CLRB 2XFGB 4ZFGH 4EIGB 2JXMB 1VFUA 1D5IL 3AB0C 3E1F1 2J55A 1HHGA 3MRQB 4L23A 1GL4B 4X5RA 3VG9C 3ISRA 1MF2L 2NXZD 3BQUB 2F8XC 2A6DA 1WTLA 4JREC 4UDUA 3CMOH 1OCZB 2UZYA 4NHCL 1DUYB 4U6VL 2EIKB 4GNKB 2OXHB 4NJ9H 5JIDA 4FA8A 3NJVA 1DQQB 4ZQKB 1QSEE 4Y9EA 4LEOB 3SGDI 1RQ5A 4PJGE 3VFNB 1NUDA 2ZSWB 5C0AA 1S9XA 3C6EA 4EI5C 4ONGH 4LVOB 4K5MA 2Y25A 4I3RL 3UJJH 4ELMB 5I28A 5L88L 5KG9B 1X5GA 4Y5YB 4BGLA 3FTGA 5IFHH 3WFDH 2Y23A 4G6JL 4LLWB 4ZFQA 1U8CA 1TTBA 2NNAA 1RJLB 4YDLC 2CRZA 1AQKL 4MLIA 4N2CA 4OD2B 4UINH 5FUCE 2QZQA 3GMOB 2ZXCA 1EVTC 4KI5D 1N18A 4U0QB 5I5IA 2BSDA 4L1DA 2UY6B 2VXQH 3E3QC 4OLEA 3UMNA 3IJSA 2QELA 2V5SA 4MS8C 2IQ9H 2JCCE 1JMXA 2ZOTA 4A7VA 3N85H 1YPZE 3OZ9H 4PRDB 3VFOB 3H3KA 3B6SA 2N56A 4NRYA 1NC2A 1CQYA 5BRZB 2JJVA 2XN9D 5I1EL 3SDAA 2E27H 3NVQA 3UCQA 2VLKE 4R7DB 1OAXL 2XBZA 3H9SD 1WWBX 4F7KA 3ALWA 3ISYA 3RWFB 3H1ZA 4ZUSB 3GC3A 4MA8L 2NW2A 4QYOB 2FIKA 1UUSA 5JA9A 3IMRA 4XPFL 4F7TB 4DP1X 5D8JH 2Y7OA 1KB9K 6CGTA 1AOHA 1KBBA 3OKEA 1UB6A 1XH0A 1BQKA 3ZTCC 4RDBA 1G9NH 3TO2A 4H20L 4NT6A 1E4HA 1GZQB 2X6UA 2BNRE 4PJ9D 4NP9A 2VLRE 4X6EB 4QD2E 1YMMA 5IOPB 3T4AB 3UX9B 4HPYL 3SE3A 1OLLA 4I0KA 4F3FA 3TH2T 1KXQA 1N19A 4QF1A 3VFWB 1YUHB 3KR3L 1IGML 4R0LC 1TTGA 1KC5H 3NCCB 5GGSY 1RLWA 4X7EC 4LCWA 5DQJB 2EO9A 1E2VA 1CTOA 1LDSA 2Y0SA 4KQ0A 1UXMA 1F4WH 3BDYH 3V6ZB 4E41A 3EDJA 3CQFA 2TAAA 4Y16A 3SGKA 1PDKA 3NQKA 4QXUL 5CKGA 1T7WA 4YC2B 4BFKA 4DGYL 2Y6TE 5E2VH 3FSAA 4JE0A 1WE5A 3QBTB 1OK0A 3WEOA 3ZTNH 3O41A 1DJHA 1X5YA 3AS3A 3IDUA 1RU9H 4TUKL 3DROB 1AYOA 1CLVA 5E56A 7PCYA 4RX4D 1L6PA 4XVSH 2WWMD 4MAYA 5A2IH 3F5WA 1J05A 3K6IA 1GC1C 5EA0H 4HG4K 4LHUG 5ANMA 3H9HB 4CBPA 3MLPA 3MRDB 3FTSA 5INCB 1MVUA 4M62L 1TTUA 1H8SA 1PKQE 3EIFA 3IXTB 1JRHL 1S78C 1MHCB 2JKLA 3ULVH 1T66C 4OAWB 5HHNB 1T4KB 5FAAA 3RPIA 5HHQA 5C2UB 3ZN6A 4KK6C 4YPJA 1YVLA 3VWJB 1JWSB 1UEMA 2NLJB 2YGOA 4PJ7A 4XXWA 4Y2NA 4M8VA 3O8XA 4DTGL 5ERWA 4ERSL 2R1WA 1TOXA 2MHAB 4N2KA 4Q9QH 1XF2A 1J48A 2YUZA 5GS0D 4HLJA 4JY5H 4F1SA 1W0YT 4JDEB 1MFUA 5JO5A 5IEHA 3ECVA 2AJ3B 1BVLB 5CSZA 2F58H 4AUUA 1AIFA 3EBHA 4OZGB 1EUTA 5I76A 2LU7A 4WKZA 2ZKYA 4BSWB 3CN0A 4OLWL 2DWTA 4ODXB 5D5MF 4V1DE 1HWHB 5C6TH 4JQVC 2KL6A 5AOKA 1XF1A 3HG3A 1HCZA 1AP2A 1OZTG 2FSEA 4NZDA 4PS4L 5AD0B 1SY6L 4N68A 5AZ2L 4X0KB 2YXMA 2WNKA 4Q9RH 4AKPA 3O6MH 5GZOA 3N2JA 4F24A 4N0UB 1IQWH 2HPOA 3NA9L 2WWOA 1RP8A 5E0FA 3E0GA 3GFUA 3WE1A 2A9CA 2QADD 1SVCP 2X4NA 4ZMVA 1P69B 4NCDA 1JGVH 4NP4L 4AQ8A 1A3LH 12E8L 2ZX8A 5IUSA 3ZR5A 5DJ8B 1AXIB 3WIHL 2BHYA 4OQ1A 1E4WH 2EYSB 3AB0B 4W9CC 5GJSL 2FO8A 4XN1A 3QSKB 1KB5L 2KC0A 3VG9B 1YYCA 3B5GA 3QWNA 5HVWA 4C83B 3KLAB 5E6YA 4JREB 5I17B 3RU8L 3DURA 3V0VB 3OX8A 2F74B 3U7WL 3Q2VA 1P4LB 1G7IA 5T8IA 1U8JB 2C1PB 2XWJB 4F37K 3BCFA 4BFEA 1OGSA 4JFFD 2B08A 5TQ0H 4Y1TA 2V4LA 2IO5A 1I8KA 5FCSH 5A16B 1JK8B 4EI5B 3F58L 2WYTA 4P23A 3BYTA 3B7RL 2WBJA 1I1CA 1I7UB 3HG1D 2IDCA 4LGSB 3ZKSD 3EOBB 2R7EA 3ILDA 4LFHD 4YDLB 1EANA 2XZZA 1FFTB 4F8PA 3B83A 2MCG1 2EIBA 2R51A 7TAAA 5F3HB 4M3JA 4TPRH 3VU2A 3VSQA 3QIBA 2K4AA 4ODHL 2N59A 1E4XI 4ZZFA 2A4CA 2O5ZL 2ZXWB 5JYLA 3PIQA 2IPTL 5IVZA 2X70A 1FNSH 3FUFA 2YOAA 4JRXA 1RK1B 1PCXA 5A6MA 5FO9A 1ZK9A 3WMQA 2QKIC 2H0FA 4FL4C 4JFPB 2D03H 2AHIA 4ZFGL 1RPQA 3CFMA 3UIZA 1XB3A 4HALA 4QRUA 4E5XB 1A66A 3VMPA 1GTNA 1OSZA 4JCMA 2C34A 1UKQA 1BMWA 5FB8B 1E30A 3EKCA 1AXSB 1I75A 5FYJH 5EO9B 1T04A 3CMOL 4K3DH 2YPLE 2WQWA 3DRQB 4MJ4A 1G84A 2XG5B 4NJ9L 1CMOA 2YPVA 3D39D 5F89A 2CGRH 3L3IA 3BGAA 3JWNE 2OULB 3V79C 2EE2A 3N1QC 5EEXA 2Y3NA 5J13C 1CXEA 3K80A 3IBEA 2Y5EA 3KWUA 1H3PH 2OJZH 4AKQA 4AZ8A 1DVFC 2PW1B 4WW2A 4EF3A 3NK3A 1DQKA 4ONGL 3AXHA 3H6JA 4XNQB 5D1QE 3UJJL 5LXGH 3Q8AA 4RDQG 2CZNA 4R0LB 4K71C 5IFHL 4A63A 3V5DB 1LD9B 1I3GL 4JKPH 4Z7NF 3AW5A 5C08B 3GBEA 1TJMA 1UJ3C 2Q5BA 3FB7B 3FH5A 3HPJA 1RUMH 2VR3A 3L9RB 3IJEB 2A2QT 1CDIA 2X4OB 4RFNC 1O7SA 4HWUA 2WUCH 4ZXBC 5EUOB 3PHQB 3I3BA 2VXQL 1CI5A 3CBJB 4WFHD 1P7KB 3E7JA 5IJVA 4ZX3A 2IQ9L 3GSWB 1ZTXH 4MS6A 1KIQA 5EOCH 5LO7A 1TTFA 3ULAB 3N85L 3OZ9L 3GSUA 3ECBA 3E8VA 2XVKA 3FUHA 1KCVH 2VAJA 1RZJH 1HCFX 3RVVC 1NDGA 4JO2H 4LAJH 5F1KC 3RUGB 3DHPA 1I8IB 43C9B 1JHTA 4L3AA 1DJZA 3PDDA 5EFIA 5F1IB 5JPMA 5D8JL 3D9AH 2YAFA 4P2QA 1KOAA 4BH7A 1XBDA 3UCRA 1G9NL 1P2CA 2CUAA 1NDMB 4Y8DC 3D06A 3RWJA 3MRHA 1CFMA 2EIZB 5CR1A 3NFSH 1D6VH 1P7QB 3ZDZF 2X2IA 2WSDA 1TPXC 3W39A 1JWMB 4GW5A 3D2TA 5DUJA 3BZ5A 3NTCH 3CSYB 3AY4A 5HJ3A 4ORGA 3G04A 2G3XA 1BXVA 1XB6A 5D96C 1RMFH 3SQRA 2EUVA 4EN3D 5DHVA 1CD1B 1U3HA 1KC5L 1GPOL 1MUJB 2WLHA 5CEXA 1G1KA 4WJG3 4G80A 5DJ6B 5AOZA 2FRGP 4PGBB 3HC3H 1XGUA 1F4WL 3BDYL 3VCLB 1KDIA 3U2IA 2CJ3A 1U92A 3P02A 4XBEH 1O7DC 2M8XA 9CGTA 1S7QA 3P4OA 1HYSD 5E2VL 3MYZA 3ZTNL 4YDVB 1K4DB 5DRNA 5LNEA 4JFHD 4KRPC 4YSSA 3KWVA 1RU9L 2IH3B 1EERB 3BJ91 2J88H 1DEDA 2BIOA 4NKDA 3M17B 3U9WA 5BVPH 3ZHLA 4XVSL 3K6DA 1A6VH 3OZLA 5EA0L 3VFUA 3LPFA 3O3DB 4ZNEA 4IHOB 2AXFB 1WFIA 3SOTA 1C5DA 3EO1A 2WZ6A 4LCUA 3FO2A 4S0TD 1HQRB 3SHSA 2VZVA 4TF4A 3UTTD 1K4CA 3HZKA 3T0EE 3BT2H 2OJ1A 3TV3H 1MCJA 1LP9E 2XPZA 5ENWB 4TL4A 1XO8A 2FECL 1IBBA 4Q9QL 4J1UA 4ETYA 5SV4A 3POHA 3T71A 1J5HA 5EF0A 3P4NA 4JY5L 2YXWA 1ZV2A 4FNSA 4Q58C 1OT1A 5IR1B 2X1QA 1IQDA 4NNPH 3VSUA 3W9DB 4TNVK 3RZCC 3GSOB 2F58L 2FZ3B 3RA7H 4M43H 3CFNA 2RHEA 3D3VD 4NI3A 3O9WA 2YJLA 3P0GB 3BWSA 3DUSA 4X4XB 3SDXA 3UTPD 5BQ7A 5J1SC 5GRVK 1CFQB 4BQ6A 3KD4A 1CYXA 3KYAA 4YQXH 3PU7A 5GQBA 4ZFOL 1W72B 4MASA 4UILH 5JPNA 2JJTC 3BLBA 4JJHA 2ZCHH 1Y1DA 3BPNC 2J12B 5C6TL 3AT0A 3RNQB 1U8IA 2HTLD 4R9HA 2OJEA 3MOBH 4XP1H 1QEWA 5TDOB 4XN4A 1TJIH 1X5JA 4Q9RL 4PG9A 3KPMA 1D5RA 3BH9B 3O6ML 4Q6IA 4MD0A 3T65B 4CKQA 1IQWL 3MUGB 3L5XH 3EBIA 4RAUB 1R3LB 1H3UA 3FFCA 1FVEB 3MV9A 3WLWC 1PNCA 2NT0A 1JGVL 1S9YA 2QKIB 4GY4A 5JHDD 4OD1H 3P3SA 2EDLA 2VW6A 4JM2A 2I24N 3FQXA 1E4WL 3GNMH 4X6CA 5LBVA 2GB2A 1KBWA 4NXKA 4G9FD 4TYUA 3WEAA 4V33A 3SO3C 3HIZA 1JZIA 3VXRB 1J1XH 2LFGA 2IV8A 3CXHJ 3DSFH 1LE9A 4G1EA 3SDYH 1QW9A 4YBQD 1GGTA 2Y1YA 3IS0X 3HNSH 4APQA 1BOGB 3QAZC 4XO4A 4HV8B 4PWJA 2DYRB 3GD1C 2WLJA 2VDMB 3HC0A 2Z64C 4OGAD 5TQ0L 5J13B 5JHBA 3FPYA 3WAKA 5HDRA 2EXYC 3P2TA 5EIIA 1DVFB 5I15H 1JWUA 2E56A 3K2KA 2AEWA 1OB1A 3CMGA 4QRAA 4DZ8B 1F6AB 4NWUH 2EZ0C 4ZW5A 3QDJB 3DBSA 3V4VB 4RAHA 3L95B 1UJ3B 4ENED 2RB8A 4CJ1A 3ALXA 5DC4B 4NJAH 4TPRL 1CLCA 4RFNB 1WD8A 4ZXBB 4PRIA 1A9VA 3WEMA 4D9LH 1QUPA 4JUSA 2BHUA 5F1NB 1FNSL 1QSED 4IKIA 3QIUD 4PLJD 4JFEE 1LEIA 3AGVA 5D2NC 3V8OA 3G08A 3QARA 5J7CC 3KPPB 4OFYD 3ZTEA 5DO8A 3MLYH 5IJKC 2B1AH 4F33B 3FZUD 2D03L 3VYOA 4GRLC 2V37A 3DX0A 4R5VA 5CGYD 2WOBA 1B4TA 2DZEA 4KUCD 4NQDB 1EV2E 3SOBH 1ZVNA 5E2TH 2DJ4A 1NBCA 1DVZA 4LCVA 5FYJL 3MGAA 2VKXA 4K3DL 3P3UA 2PWDA 4E68A 2CGRL 5SWZE 3U36B 3VXQA 2H9GB 3BAYA 4JO4H 5SWSB 1OALA 3UG5A 4L4TA 4M7LH 1TPXB 3BGFC 1W16A 3JV4A 1WCBB 2EDFA 3D08A 2C9PA 1H3PL 2OJZL 2YD0A 4MRBA 4GIAA 4KDTA 4Q89A 4ZK8A 2JFCA 3RI5K 5D96B 2ENJA 1YAZA 1XIWA 4UB0H 1KULA 4LESA 2X2UA 3MXWH 1NGYB 3ZKMC 1HHIA 3DO4A 4JKPL 3NCXA 1HEZB 1UVQB 3T8XB 1RUML 5IQMA 5EU7E 1I7RA 5K9QI 2EE9A 1EEZA 3CE1A 2GIXA 2WUCL 1D6EB 3GJFK 1KJ2B 2DMBA 4Q74A 1PFOA 4WWNA 3SPVB 2BNRD 4BZYA 2QHLA 3ECWA 2VLRD 2CALA 1VHPA 1EJ6A 1MG2C 4AXWB 4KRPB 1ZTXL 2M1KA 5EOCL 2QJDA 5EO0A 2R0ZH 3BN3B 2VZ1A 4H1LH 3HAEA 2LU4A 1KCVL 1RZJL 3GZKA 5FM5M 1PQZB 3BCDA 4PJDB 3T6ZA 4JO2L 4JRYA 2NY6C 2GUOB 1JF5A 5A2AA 5CHNB 3U0PB 4CC0A 3ELAT 2H3NA 3D9AL 3P30L 4EUPG 5FYKE 3FUKA 4FQPA 5DI8B 2WZPA 5IJCC 4WK2B 1J8RA 3VU1A 3BKJH 3B2UC 3NFSL 3DJTA 1D6VL 2APXA 4QTHA 4U33A 4R5TA 5GISH 4P2RB 1USQA 5HD8C 1N68A 1R24B 1WJ3A 1WITA 1H3TA 4ISVB 4JFDB 5E5MB 1S7XB 3NJLA 3T0XA 4HEPA 3RZCB 4HJGB 4KPHH 2HFEA 1RMFL 1QATA 2GITB 3FHEA 5D6CB 3K74B 2L04A 3RVUD 2YIHA 4NS0A 3IFPB 4N9OB 2AQQA 3HC3L 4E0RA 4HSAC 4QOKE 4XB8A 3TJHC 2FJFA 4PRBB 3KBFA 2DM7A 4XBEL 3BPNB 3DX6B 3I6GB 1FFRA 2F1EA 2GJPA 4LLDB 3OGCB 5C0NC 1Y7VA 1OTUC 1GS6X 4BQCA 1A1MA 1ODUA 1RUKH 2ED8A 2HRPH 2R8SH 3RGVD 1ID2A 3N41F 5KSAA 2GTZB 2J88L 3D39B 2CGZA 4RSYA 4XP9H 4ZO7A 2UYLA 3ZIMA 5BVPL 4E9TA 3IDIB 3NRFA 3NA4A 2PXYD 3TFKD 3SN6N 4K9EH 2OSWA 1A6VL 3CZNA 1HE7A 1HI6B 1FFNB 3FN9A 3DXAA 3GMLA 1FA4A 1M6OA 4YHNB 1AC6A 4V1DD 4DEUA 3EOAB 4E42B 5HVGB 2C9VA 2J1KA 4ZUWA 3TPUB 4HLEA 2CSPA 2ED9A 5DEFA 3SO3B 3TV3L 3BT2L 3UYOD 4NN6C 1SPDA 4DESA 4PTTB 4FFTA 4PJHE 1Q38A 4BINA 2Q7AA 2OMTA 1CTMA 3PE9A 4IIQC 3QAZB 1GZHA 3RJDA 4NNPL 4CA4A 4MD4A 3WFEH 3QNFA 4PJAE 3RA7L 1R17A 3F6LA 2EYRB 3D25A 3Q9PA 4C57C 3BVUA 2VO5A 5B21A 2Q87A 3LRSA 2HKAA 5IOKA 4R2GC 4YQXL 2LV4A 4OF3A 4QJ4B 2WXMA 3LMJH 4JANA 1HHHB 4MNGE 1KBGH 1MCHA 3SDXF 3AU1B 3LDBC 3LPGA 5GRUH 3FO9B 8CGTA 1QFWM 4MMXC 1PU0A 5JOFA 2DM4A 2MQCA 3WL9B 4EVNB 2JCWA 3MOBL 4XP1L 5TFSH 4TTDD 1E7VA 4XC3H 1RJYB 1F42A 1TJIL 1GW6A 2VR4A 2YSTA 3DJSA 2ZKWA 3DI2B 5DJ0B 3CSTA 1OGAB 4A7QA 3GXMA 4ONHB 3L5XL 5D2NB 5AW5B 1KFGA 1J9CT 2LTQC 4GFTB 4HIEA 3VXTA 3WE6A 1KWGA 3NSFA 4KJQC 4YSRA 2H32H 2Y36H 3CWGA 4LDEB 5G2NA 1NAMH 1SJEA 4OD1L 3X3GH 3GSNA 4GRLB 3GS7A 4L3EA 4CNIA 3D0AA 5KS9B 2AJVH 3VFOA 3DHUA 2NZ9D 4NNYB 2AJSL 1WPCA 4JPVH 4CSPA 1J1XL 1MLBB 1MCSA 1J5CA 2GKIA 3DSFL 4FQHB 4KU1A 4JM2F 5C0CE 3SDYL 3B37A 4GKZB 2PWHA 1JV2A 4X6CF 4BZ1A 4YHIA 1II4E 3JSSA 3HNSL 4HWBH 3IK2A 4QO1B 4WCYL 3IJYB 1TZIA 3KPSB 1U4EA 3WTYA 5F7BA 2IH1A 5D9SA 1INDH 3FBKA 5C1MB 2EDKA 3BO8A 4MJJA 3UP6A 2YN3A 5I15L 2ZOKA 4F2ME 3SCMC 1EEYB 4JCWA 2FT7A 1SYSA 3O6FC 4NWUL 2I32A 4Z3TA 5KN5A 3MAWA 4K9JA 4KC3B 1KGJA 3C6SA 1EAPB 1G6RB 4HHAB 4XHJC 4IGBD 5D1XA 1NFAA 3TFBA 2YPLD 3UTTB 4NJAL 4O2CA 4H13C 1C12A 4D9LL 2A77H 3L3OA 3QIWD 4MHHG 5AVZB 4DP8X 2CO4A 4POZD 1GAFH 1NANH 1ZT4A 2GUYA 1OK8A 4FNQA 1GOHA 2C3VB 5MP6L 4PJEE 4Z3FA 2ZXGA 5IVXA 4QRRA 2P5WE 1P7HL 3MLYL 2B1AL 5D1QD 3FB8A 5BW7C 3EJSA 3EXJA 1JPSH 3VXOA 5HGBB 4KUZH 1SXBA 4U2ZA 4DKTA 4WGVB 5CILH 3CCHA 3B5HA 5LAXB 5AAMA 5D6DC 2NY6B 5CIPH 4YSUA 2HJLA 3SOBL 1G7PA 3IN2A 4ACPA 5E2TL 2VLJA 4LCYA 2F8OA 3EFOA 4YSOA 4PJCA 1T6VN 2XN2A 4JM0A 2YD5A 4WO0A 4HGWA 1EZSA 1NKOA 4IMLB 2ADFH 4NUJB 3CHQA 5E4IA 5F9OH 2Q1EA 1CDCA 2BSCA 2NY4C 2H45A 3ULSB 1FZKA 4JO4L 4Y19E 2DLFL 4M7LL 2GCYB 4UQ9A 3U2SA 1I9IH 2HMID 4PJIB 1NH6A 1IAII 5B39B 1E3FA 2BERA 4MDIB 3BVDB 4UB0L 3S5LB 1OP3K 1P4BL 1XD0A 4RRPG 4X9BA 2IAMD 3KNBB 3SDCD 3CSGA 3NFPB 3ZK0A 4YFLF 2AZAA 3GM8A 1MNNA 4H5SB 3VI3E 1DUYA 3ZTDC 1XMWA 1A4KB 2UXTA 4IQHA 3RB7A 2R2EB 1JZJA 4Z3JA 1DQQA 1UWEH 4ZQKA 3B2DC 2ZSWA 4G8GE 2H1LM 5GGRY 2R0ZL 3ZJAA 2X4PB 4ZFFB 5EG6C 1EJ8A 5C07D 2X6VA 3BN9D 4ELMA 3F7RA 2XWBB 2AVGA 5KG9A 1I7ZB 3QRBA 4MNQA 2BRRH 5BVJB 2ESVA 4L1BA 4Z5RB 2L7UA 1RJLA 2VTFA 2CKBA 2AFNA 4YSQA 4AYEC 2VMCA 2HRHA 3N55A 2CJUH 3GMOA 3S3JA 1TVHB 2WGNB 1PKOA 1A3QA 3T2QA 2Z31A 6PCYA 5TE7H 3V9EA 1F45A 3FQRB 2R0LH 2UY6A 4UQ3A 4L8DB 5KWYC 2KUTA 3BKJL 4LQFH 4NN6B 5FF6A 4N3TA 2W0PA 5GISL 3GPEA 3QA3B 4HIJB 4WNJA 4PGCA 2IALB 4IIQB 5SWZB 4CN1A 4F20A 3QJRB 1QSEB 3UZQA 4PJGB 2IBGA 4KPHL 4YH6A 3NCMA 3IYLW 2Z9TA 1NKRA 4R7DA 3KPLB 2WYIA 2CUIA 2FL5A 4M8UA 2D0FA 1SBBA 4HS6A 4X98B 1KYFA 3L6FB 4R2GB 2DWDA 3DX2A 2LHAA 3RQ3A 3MLSH 3FQWB 4F7TA 1Z9SA 4D0BA 3QQ9D 3LDBB 4U6HA 4FFYH 4PM1A 1E27B 1WBZA 3GRWA 3T0ED 5HI4D 3JBG7 4MMXB 1BM3H 1PJWA 2CNZA 1ZHKB 2YLHA 2EO1A 3AUWB 1EZLA 1E5ZA 2HRPL 4X6EA 5FYJE 3LCYA 2XOTA 2R8SL 5IOPA 4QRSA 3MREB 3IRZA 2G0KA 4XP9L 3MUY1 2J2ZB 1J0KA 1YPZB 4K9EL 3ZRFC 2LTQB 3FKUS 5F72S 4OY9A 2Q3ZA 5HGGS 4GIOA 1T83A 3RG1C 5DQJA 3P77A 1DVYA 1S8DB 2VLKB 3WELA 4ODWB 3M8OH 5AB9A 4YHYC 3UC0H 5FYLE 2IWFA 4BELD 1S5HB 1J8HB 1JTPA 5KOMC 1ZA3A 2OP4H 2CDGB 1A4JB 3STZB 3BUQA 4GIPD 3SQOH 4ZQTA 1BVNP 4OZHE 2E6PA 4JKNA 2EDJA 2EEAA 1O5DT 5DURD 4OF5A 2H26A 2KERA 1SYVB 1XAUA 3FC8A 2BCKB 4BM7A 1DANT 3FB5A 3JWNC 1MI5E 2BNRB 4PJXA 3VFTB 5MENB 3LZLA 3WFEL 2NY0D 4CVUA 3MGTA 3B2VH 2V8LA 1ZTXE 4AWJC 2FDBP 1WFNA 1MIMH 3Q5OA 3W1ZA 3KLDA 1SZNA 4ZW7A 5INCA 5LGKA 2P8LB 2CBTA 2V5TA 1NCTA 3LMJL 4P3WA 4KTEH 3GT6A 1KBGL 3SCMB 3L7FB 3P73A 1RSFA 3O6FB 4I4WA 5GRUL 2WLLA 4BH8B 4JG9A 1XAKA 4MXQC 1JWSA 5E7BA 2NLJA 3UDWA 4HHWA 5TFSL 4XC3L 2MHAA 3SO5A 4QRPE 3FAWA 3NZHH 3EG9B 4LOUD 4HJJH 5F7KC 2VB5A 1Q9WB 1WHPA 2KBGA 3SSGA 4JDEA 4X9IA 2AJ3A 2VLLA 2NY3C 1BBDH 4M5TA 2X88A 1BZEA 2AP2A 1XF4B 2F7PA 3RFRA 4OZGA 1R3IH 2DKSA 3WIFB 4JZNB 1IE4A 1SHWA 1N8ZA 3OJVC 4MAUH 2DLEA 2Y36L 2E47A 3RX5A 1NAML 3IAQA 3HBGA 3X3GL 2ZZUT 3MJ8B 3QISA 4JZJA 1FZOB 3B9KD 3II3A 4EDXB 1TSHA 1WFMA 2AJVL 2QDVA 4TUOA 3UYPB 1N64H 2YK1H 1FFQA 4JPVL 4YHOL 4UT6A 1FVCB 1ET7A 3C5ZA 1AR1D 3S5LG 1YO4A 3SDDD 4AIEA 4FXGA 5HPOA 2OS7A 3S96B 1QLEH 4BEIA 4HWBL 5DS1A 1KFAH 1A4CA 5ALCH 2PCXA 5LXVA 3CDZB 5GGUA 4JFED 2NY4B 4HKJB 1JXGA 3KYMB 2VN3A 1MCPH 3F65A 4TQ8A 1INDL 3NCFB 1ZMYA 2WNXA 1MRFH 2GJ6E 3EO9L 3ZDXF 4MQXC 3WTSA 2ZXBA 1IAKA 3HR5B 4QXVA 2DQFA 1T7XA 2AK4A 3ABGA 4Z77A 4JFXB 4JDTH 3FBQA 5L2KD 2V6HA 1JJUA 4BCXA 4AGQA 3HB3C 2GK0A 5I17A 3N43B 1U30A 5FM4A 2DLTA 3V0VA 2NZIA 2F74A 5D1ZC 4H8PA 1P4LA 4GRWB 5SWZD 3M45A 2W07B 2A77L 1EHNA 1U8JA 2C1PA 2OM5A 4HFWB 2XWJA 2D4DA 4K7PH 4PVLA 3TF4A 1GAFL 4AENB 2NDFA 4UM9B 5CZKA 1KLGB 2PYEE 1U8KB 1VZHA 1JK8A 3FQUA 1OP4A 5KBNC 3CZJA 1U8PA 3MXVH 1BG1A 1YQVH 5AW9B 4UT9A 3W0WB 1JPSL 3GSVB 5D70H 4KUZL 1JS4A 2Z8VC 5LKNA 2WM0A 4XMUA 2DQCH 5IVXF 2DMHA 2HTKC 1VA9A 1OTTC 2ICES 4AYGA 1TQCC 5EBWA 3TA3D 3QUKB 2YPKA 3EYVA 1XVSA 4KJPD 5J9PB 1BZ7B 2NNXA 3PL6C 4G6FD 2KI6A 2ADFL 5F9OL 1SNRA 3X2QB 3RWHB 3EFFB 3EJZD 1TVBB 3BKMH 4E9SA 3MRCA 1AGFB 2HFFB 1I9IL 1IGIH 2ILLA 2NXYD 1TEYA 4M5SA 1MW3A 5TJWK 4X6DE 4S0SD 3V52H 4F7MB 5CN2A 4JFPA 1S7SB 3WJLC 4NFCA 3IPBA 3MA9H 3T2NH 4E5XA 2FIRT 1QFUH 4PJBA 5DJCA 4PUBH 3KLHC 2Q2EB 1J86A 2ZUXA 5DSCA 3WY2A 4ZW6A 5FYKD 2OCCB 1AXSA 2FQEA 1YAIA 2VDLH 4KO6A 4AYBA 1EHLH 3DRQA 4YDIH 5F7HA 1G7MB 2XG5A 4NIKB 1CN4A 1H3GA 3QQ3A 1UWEL 1HKFA 2I9TB 3Q2NA 3C6LA 2PPCA 4NQEA 1GA2A 1KPRA 3HHSB 6PAZA 1QNIA 3UAJA 2EUZA 2X4QA 5FFOA 3S35X 5AKVA 5JYMA 2VR8A 5HHPB 3QXAA 4GO8A 4HEMA 4KZCA 3EYFB 2BRRL 4WI3A 3UBXA 3V5DA 3LZRA 2GY5A 5AG9A 1AFVH 1LD9A 1SLVA 2DWSA 4D94A 1B3JA 4QOKD 4YHYB 4ELMF 4GG6A 2CJUL 3IJEA 1XMEB 1SXAA 4W9KC 1IE5A 3BVWA 4OIIH 4KI1A 4M5YH 4QY8B 3SE9L 5TE7L 2A74C 3PHQA 2R0LL 2CO1A 1X7QB 4LDLB 2M2DA 1D2PA 1AMXA 1MG3C 4LQFL 4PVBA 1P7KA 3QNZB 4O51B 3HZ3A 4ZPTA 2FEJA 3L54A 4Z7UE 5J89A 1P6WA 3WNOA 2BZCA 1WD9A 4I0PC 4WWOA 4JHBA 2J25A 4ZI8A 1ZS8B 3RRQA 3B9EA 3RUGA 5KBKA 4LP8A 1DQJB 3ZKND 5KZCB 3KH3A 3GMQA 3MLSL 3S0PA 1YQ2A 2L0DA 1JGLH 3TEZA 4B3EA 1BDYA 2NCMA 3WFHB 4LKXB 2QZ5A 2BHZA 3SGEH 4OV5B 5BXFB 1CE6B 1BM3L 2EIZA 2AJUH 2VDPB 4UNIA 3MRPA 3THMH 2VQ1A 4OZIA 2WYHA 2FEDD 3BSZA 3IBOA 3CSYA 4M93C 4H0HB 1QI5A 2NY3B 2GAZA 1L7TH 1CFVH 3IFOB 4P46A 1CD1A 2ATKB 2IADB 5DFWH 1H3XA 1MUJA 4B60A 2YSSB 4PH8A 4DKDC 1IZKA 5DJ6A 3WJMA 4YGVB 3QUXD 3M8OL 3UC0L 3U2JA 3VCLA 4MJHA 5K39A 4ELDA 4GAYA 2E8ZA 2OP4L 2XA8H 3DTUB 3SQOL 2OMXB 4TQIA 3A6CL 3CVCA 3T6WA 2VMDA 4GQQA 4YDVA 4ZSOA 4PJ8D 3LKPA 4EZJA 3WFBH 2WP3O 4J28A 2D0HA 5F0JB 4DK5A 5JHLL 3M17A 2QSCH 1VZGA 1FNGA 2FEEL 2JF1A 2LU3A 2ZX6A 4M7KH 4UIKL 4Y2DD 3B2VL 4I13B 1IAOB 4GBXD 3ZRSA 5IW1A 5EU6E 1MIML 2ORBL 4MX7B 1WAEA 2AXFA 2XZCL 3LQAH 4RDQF 1DE4B 4LOFA 3JWOC 4ETQB 5D4JA 4N0RA 1HQRA 4KTEL 3AS2A 3CJJA 1BXUA 2VRQA 5C0BB 3CFBA 1L0YA 1S9WB 1EDYA 3IU4H 5A2FA 5ENWA 5C0CD 5EU7C 4ICWA 3K5RA 2X9XA 4G6AC 1RHHB 4M6NH 1NGXA 1C5CH 2MSPA 1IBHA 3NZHL 4HJJL 2VXVH 2CUHA 3Q2LA 1OQOA 2VITA 2ZUQC 1CFTA 1D7BA 1BZDA 3WY4A 5IR1A 4E9RA 2R2HB 3IJ9A 2JKJA 2D9QB 3U0WH 1BBDL 2FZ3A 1TLKA 4TRPH 3SIKA 3ZQXA 3M6DA 1EXHA 3CSFA 3WMPA 2CHDA 3HVNA 3OR7B 4MAUL 4JHZA 2XN9A 1ZVSA 3G5VA 1W72A 4A6YH 4MRCA 5ICZA 4OZGF 3KM2A 2YRZA 5EEWA 4FCHA 4ABVA 1N64L 2YK1L 3RNQA 5TGBB 1TQCB 35C8H 3DJRA 5IY5B 4B96A 4U1KB 5TDOA 4OJDH 4NXSA 1L9PA 1MNUH 4JHAH 1QLEL 3PL6B 1LP9B 3BH9A 1KFAL 3DX9A 5ALCL 5AVRB 3UTSE 5I0YA 5JR1H 3T65A 1G43A 2A83B 3B9DA 1G9EA 3DGGB 4PJ9A 2VZ3A 4RAUA 1R3LA 1MCPL 5D5ME 2P5WD 1ZE3H 4E9XA 1TNNA 1MRFL 1EDQA 2R27A 2BC4A 2X5PA 3UJIH 5H35B 4X4YB 4JDTL 4Y4FC 1NGPH 5E95B 3NRQA 5H37H 1BZ8A 1MCWW 1FBIH 4CKVX 5GSRA 5CBEB 4IOIB 2HB0A 5LDSA 2ZUUA 3HRZC 4LIQH 2VMJA 4Z0XB 4FI8A 1BOGA 4B7IA 3DUUB 4HV8A 4FQQB 3E38A 4WU5A 2FQDA 4K7PL 2DWEA 5GGSA 5ACLA 3T6VA 3TBSA 4X8CA 3I85A 3A3YB 4X8GA 4KK8D 4RX4A 1DVFA 2OTPA 1CYWA 3MXVL 2EINB 4MWFB 1YQVL 4PS3A 5D70L 4X42A 5IW3A 2FCBA 3IDNA 3R8BB 2UY7B 2AQPA 4PJ5B 1F6AA 1RUQH 3QDJA 3VH8B 2DQCL 2GW5A 4WFGD 4IYKA 3L95A 2K3TA 4L4JA 4J12A 1UJ3A 4GEJA 3BJLA 4JO3H 4GQ9H 4Y1AB 2HA1A 5SX4H 1FYTE 4ZXBA 5C6WH 1GS7A 2A74B 1MWAB 2GSIA 1Z5LB 1W0VB 5F1NA 4WI8A 4N6QA 1XCQA 1MCBA 1KDJA 1P4UA 2Y3AA 4G8GD 4MMYB 3IFLH 3KPPA 1L6ZA 4R7VA 5DVOA 1EAJA 3ARSA 2G60H 3BH4A 4J4PC 4ZAKC 3V52L 3IMTA 2Y9RT 2F08A 3AVEA 3MRFB 1QRND 4I0PB 5H2BB 1DVQA 3MA9L 3T2NL 2J57A 3W9EB 3TLRA 3BIAX 2Z34A 3PAVA 1QFUL 3REWB 4NQDA 5IB4B 4PUBL 2HT4C 1ZDSA 1BMZA 2IPKB 3DDGA 5TDPA 4LSVH 4JHVA 1VLXA 5DYFA 5EEUA 3QZWA 1O9ZA 1U95B 2VDLL 1HJCA 2AK1H 1JXJA 2JQMA 4AVKA 3CIAA 4YDIL 4AEEA 2C4XA 1EHLL 1JRHI 1YYLL 3SDDB 3A21A 3BVTA 2F53B 3PUUA 2H9GA 1RZPA 3ECUA 3GBLA 1G9NC 1SOKA 2GEEA 4M61B 3VDCA 4U3CA 3S88H 1TF4A 4JUTA 2CM5A 2KH2B 1MLCA 3FSWA 3MRBB 5CWSB 3VFPB 1FAIH 2W0FB 4IRJD 4JFEB 2DJMA 2IANE 2G5RA 3MKKA 4LO9A 1HKLH 2XV0A 3CX2A 4GLRH 4X5LA 5JLZB 3ROOA 3AREC 5DRXB 2R69H 5CEYB 4DK6A 1ZT7B 2RA1A 3OLGA 5AQ0A 4CAGA 5J11C 2JKSA 5J6HB 3WTWA 1WLHA 1XH3B 3ILEA 1AFVL 1QZNA 1NCOA 5AOIA 2PF6A 1A6PA 4KAQH 3KWWB 3BD4A 1S7RA 3KE0A 3K81A 3IF1A 2H2PC 2B39A 1NCGA 4N25A 4OIIL 2BSRA 4M5YL 3SPVA 2W91A 5L9DH 4OF7A 3DTXB 2MWCA 4IBTA 4DGIH 2QGEA 2M26A 3U82B 1BV8A 1DLHA 4OW6A 2J5LC 4W81A 5EUOF 4KXBA 4NKIH 1AR2A 3N6YA 1UXSA 1C5BH 5IHZB 3ZO0A 2EDRA 4Z7NE 1S7UB 1PQZA 4N9GB 2CDEA 4PJDA 4CGTA 2OMBA 3HE7D 5DUMH 4M48H 5FYLD 4KXAA 2WXPA 3VSVA 1RJZA 5CHNA 5E1AA 3U0PA 1N5AA 5HDBE 3R0MA 4MCMA 1JGLL 3HG1A 1WUZA 3MCKB 4FYQA 1NBZB 3RUGF 1BM7A 3ULVC 2BP3A 4G7SB 5F9JA 4KMTH 3TN0C 2YWYA 2AJUL 1G0DA 3IJHA 5IROC 1G7HB 5J1AB 2OXGA 1KB5B 1MI5D 4CILA 4IRSC 4DH2A 2ZUQB 4ISVA 4JFDA 3KLLA 1FL3B 1S7XA 4OFKA 5GZND 4LB8A 1M7IB 4HJGA 1YNLH 4XCEA 3CDCA 3VXPB 5D6CA 1L7TL 5KVEH 2VDKL 1CFVL 2PTUA 1W8EA 4RMBA 1T1YB 1E9PA 3CVHH 3UPRB 2Z92B 3DBXA 3IFPA 4G5AA 4AEIH 3MV11 5ICXA 3IGLA 4F8LA 2IVFC 4UYPA 4A68A 2JJTA 2DKMA 2CA4A 4M3HA 2XA8L 1S7WB 4LLDA 3KYOB 4XNDA 4W9GC 4XHQA 4BA0A 3MLUH 3T3MF 3ZGIA 3VD4A 3IJ8A 3DMMC 3R18A 1JZ5A 4ALAH 3IVKA 3W3BA 4C55A 3WCYA 2X4TB 3CZKA 2R29A 4XWGH 3WFBL 2GTZA 3D39A 4JKWA 5FK9B 1Q1JH 2QSCL 1L9TA 3IDIA 3RWCB 4M7KL 2JJSC 1L4IA 3L3GB 5D7EA 3NFNB 3RL2A 1HI6A 4KTYA 1FFNA 2AKRA 1T80A 2VYRE 1QSVA 9PCYA 3V0HA 2RCSH 3LQAL 3MUHL 1ASOA 2V2WA 1N12A 2IDFA 1WCQA 3C60D 1EHKB 2W38A 4E42A 1ASPA 2C3GA 1JHLH 4Y4FB 1NCDH 2VZOA 3ZL4H 1WGVA 3HE6C 4MA1C 3TPUA 4CVXA 1QWUA 1F2XK 2DPKA 3IU4L 2XU9A 4URTB 5C7ZA 2CE6A 2I69A 2Q76B 5E8OA 2QVIA 5DZLA 4R8WH 3HRZB 3PXLA 2YD7A 1C5CL 4M6NL 1KPVA 2ZG1A 4U1JA 4MJ5B 2APFA 4IS6A 3QJUB 1D9KC 3U0WL 4TRPL 5BV7C 2GJ6D 4BSVB 1ILUA 4PFEA 3UBFA 2DQ6A 3LRKA 4N24A 4TL5A 3NG5A 5TD4A 4MKTA 3KDMB 3HMXH 4IJ3B 4JQXC 3ARBD 4A6YL 4YBHA 5I5RA 3ZO9A 3WNNA 3CFKA 3AU1A 5F97E 4FTDA 4YSEA 2YARA 4M3KB 35C8L 2DLHA 3WL9A 4TSCH 5B1JA 1A9BB 1HEHC 1J8SA 1MNUL 4JHAL 5FDWA 3M7OA 3TVMD 5AB0A 5JR1L 3QFDB 4Z7WB 2HX8A 4NQSB 2LAGB 2PYED 3IE4A 4G8FA 4K3GA 1AHMA 5JIHA 2WO3B 3C12A 1M9SA 4IRJC 4PJAB 3AM8C 3TV8A 3SPCA 2A6IB 3KBEA 3RHWF 3WTXA 3FULA 3BLKA 2XY1A 4NRXB 4N8VG 6TAAA 1BQLH 1A6ZB 3UJIL 4EN3A 4FG4A 3BWUC 4G1MA 4TTGA 5GJTH 1NGPL 3GDCA 2CJTA 2BFGA 2VISB 4MNGB 1FBIL 2EQDA 4FQHA 1QFWH 2HJFB 5AALA 4GKZA 3S3DB 3QUMH 1EX0A 4J8RB 5C86A 4LIQL 1INEH 4QO1A 5F7LB 3IJYA 1YSOA 4NUPA 1WWCA 5ID1B 3KPSA 4AUYA 1MCOH 2NTSP 2EC8A 3TURA 2XQYK 1OPOA 2EKSB 2QT6A 4ZT1A 1QASA 3NSYA 2MTPA 4XXCC 4Y2DB 1MCLA 4BKSC 4EN2A 4HDIA 5ITFB 3WS6C 1ADWA 5FKPB 5J11B 1RUQL 2OCJA 3I6SA 1KTDA 4IBVA 3LOWA 1G6RA 2EDEA 3LS4H 4K5OA 4JO3L 2BXZA 1BD2D 1SDDA 1MREH 4GQ9L 5E2JA 3UTTA 4J3UA 1PMYA 3TBTB 5B8CC 5T5FA 1GGIL 5JW3H 2VDNB 5M7QA 5SWQA 1ORQA 3JV0A 1M42A 3PWNA 2BIPA 3IFLL 2Y1AA 1ADQH 2G60L 2J5LB 4U0RB 4LGPB 2BVEA 3LEVH 4M7JH 2VN5A 3D3VA 5DMJB 5DVNA 4HOMA 5HGBA 4L8CA 2AQ3A 3EDKA 5LAXA 1LWRA 2CIKB 2I26N 5IREA 3T8VA 5DFAA 4ANUA 5AUMB 5TDNB 3ORJA 2A4ZA 1ED3B 4F2MB 4PJFA 4LSVL 1JV5B 1UWFA 1ACCA 1I1AD 2YMXH 5E9AA 4HJIA 2AK1L 1CGWA 3F05A 4IMLA 4QCIB 4NUJA 3TZVC 1O6SB 3TN0B 5HJGA 3LXUX 3ULSA 1ZHBB 2HN7B 4CSTA 1U2HA 3S88L 4ACTA 3WIIH 4WSJA 5C0DB 1KT2A 4IRSB 1KB3A 4PJIA 1FAIL 4P06A 2FECI 2RIKA 5B39A 4KRNA 4LHJB 4NO2B 4BK8A 4MDIA 1HT6A 1HKLL 1WS8A 1JFHA 2CHXA 3P4MA 4FNPA 4PJEB 3RDJA 2P5WB 5F3FA 3X12A 2R69L 1KTJA 3GEWB 4S11A 2ZF9A 3BUIA 5JHDA 3N0PB 1T89A 3KNBA 3M7FB 4KAQL 5KSBA 3NFPA 3JTTB 2WLKA 3RDTC 1KEGH 1IC0A 4Z7QB 4NYLB 4G9FA 4ZFOB 1AGDB 1A4BA 1O75A 5GRYA 2F54D 1FJ1B 5L9DL 1T5WB 1NCJA 2R2EA 3VFVA 3DMMB 3ARGC 4QLRA 1QMUA 4DGIL 2R4RH 5FO8A 5EULV 1WBYB 1FFPA 1HSAA 3IGAA 1DO6A 2XA3A 3V10A 4BSJA 4YFEA 1KNOB 4Y19B 4P3CH 4NKIL 1CGVA 5CN1A 2VSKB 1C5BL 5HYJE 1GYVA 2XWBA 1FGNH 4LLUA 1I7ZA 4HAGA 2NY2C 5BVJA 1CFSB 3QQXA 3B7UX 5C92A 4X4ME 3VTTA 1XZ0B 4WI2A 4Z5RA 5DUML 3UEZA 3JYBA 4M48L 3U4BH 1HHKB 1FL5B 2XTJE 3LJ3A 4WI5A 5IEKB 1O9VA 1SF5A 4PJDF 1U8NA 1H8OA 2MEJB 3HE6B 4MA1B 1G4MA 3FQRA 4MA3A 1CD0A 4L8DA 5FWRA 1JHKH 4KMTL 2V7NB 1CT8B 4A1RA 1OLZA 4C54A 4HIJA 3IGKA 3D5OF 2BZDA 4A2FA 1LMIA 4LSRL 1D9KB 1FNEB 2IV9A 1QSEA 3TBYB 3QIUA 3VB9A 4PJGA 1YNLL 4HVBA 5KVEL 1TU2B 3BMVA 5EU6D 2X9ZA 4OFYA 5BV7B 3DV6A 3CVHL 4H2CA 4KFMA 5F1OB 1HDMA 1GY1A 1R3HB 4X98A 4AEIL 1BYPA 3K8MA 5ISZE 4F7CA 2HUEA 3FQWA 2CQVA 1ZANH 3SBWC 3WUWB 2BSTB 1E27A 4NZTH 4XOBA 5GIRB 3PGDB 3DYPA 3MLUL 5EV7A 3VGFA 3PABA 1PAZA 2WXNA 2G2RB 4J8QA 4NAMA 4ALAL 4JGUA 4KDVA 5TF0A 1Y6KR 4XWGL 4PWIA 1WT5C 3MREA 2Q8AH 2J2ZA 1Q1JL 2PP7A 2JCCA 3WDJA 2EDQA 1UH4A 1YPZA 4C56B 2R0KH 2WSKA 4CL7A 4LPUA 4HT1H 2D73A 3TGXA 4IRJB 4MTMA 3VGHA 2RCSL 5CJXA 2I9LB 2VC2H 2VLKA 3CQQA 4Q14A 2EECA 4ODWA 2PMZA 4FA7B 1S5HA 3AMKA 2AV7B 2E9BA 4OZFG 1FIGH 1JHLL 3ZL4L 1NCDL 2CDGA 3LV3A 3QDME 3FW6A 2VOTA 2E5EA 2K9FB 3KPRE 3R1GH 5CLXA 5SX5H 4WY7H 3SPHA 1GS8A 5EH1A 5LGHH 3BHBA 4OVUA 4CN6A 4R8WL 1QBBA 4DPAX 5AW4B 4FJYA 1NC4B 5HJDA 2X40A 4N0FB 5JDSB 3EW3B 2BNRA 3JYCA 2UVFA 5GRWA 2CHNA 3VFTA 2VLRA 2E7LC 1WC7A 4HIHB 4KKZA 2ISDA 1C16B 2WQXA 4M1CD 1CR9H 4OCRH 3GGWA 2NSXA 2WO4A 1ILSA 5E70A 2Y7MA 3HMXL 1OANA 2G4GA 4M8RA 3FOMB 5DHEA 5BS0E 5CCHE 3L7FA 1FDLL 2UV3A 5EWIL 1V8HA 1X5MA 3CLEH 5DA0B 5IB3B 1VPOH 4TSCL 2ADJB 5D93C 3CVDA 2AMUA 2JB5H 1J9TA 5B8CB 1S9KC 1FO0H 5CLWA 3T04D 3FTVA 1EK3A 1MCKA 1OSYA 2CAKA 2WLIA 3K7UA 3N40F 5I6NA 3WIFA 4JZNA 3TEUA 5C09B 3TBWA 4PR5A 3LKQB 4S1SH 3TIEA 4WI0B 1UT2A 1UWYA 5BW7A 5GSVA 4NQTA 4YXKH 5HDLA 1QI3A 3MJ8A 4ZMAT 1BQLL 3SY0B 3FNKA 3RYMA 3BP5B 2AQTA 3QRLA 4J2QA 5GJTL 5TTRA 3PAUA 4JY6B 3BH8B 1PKQA 1KGXA 2RTTA 3C8HA 4KROC 1FVCA 5T1KD 4IKLA 2F5AH 2A6JA 5K5YA 3CK0H 1FYTD 3QUML 1ECZA 4Y4HC 3S96A 5KS9F 2ICWB 2ICWI 1INEL 4GAAA 4YL4A 3CDZA 4LCIH 3EYOB 3TZVB 1JUFB 1E2ZA 4HKJA 3KYMA 4QRPB 1VAHA 4TNFA 4FNUA 5K1NA 1MCOL 4GP8B 4XX1G 3TWCH 1AVAA 1IBGL 1GMIA 3U79A 1E6JH 3OKYA 1G7LA 2PLTA 3PLYA 2PXYA 2L7EA 2L8AA 3HR5A 3BP4B 1TEGA 1KIPA 1MAMH 3EHBC 4U49A 2YS4A 4YLQT 4V1DA 3RJOA 4X80H 4A38A 1N6UA 1B0IA 3ESUF 5HGHB 3LS4L 3QS3A 3RDTB 5GRXG 2BM3A 5F93C 1QRKA 1MREL 3N91A 1V05A 32C2B 1X5ZA 1A4AA 4RNRB 5EF2A 3V6FB 1AO7E 4XH2B 4K15A 3U9UB 3CHOA 4GSUA 5JW3L 3AG2B 3ARGB 1JK9B 1QSFE 2PPFA 4XI5C 5T5NF 4B53A 3AXLA 1KLGA 1G7QA 1ADQL 2IAND 1Q72H 1U8KA 4FNLH 3LEVL 3NDYE 5DD5H 4M7JL 3LN4A 1J0JA 5DEJA 2ZOUA 3BESR 3D07A 3QJXA 4M6MH 2NY2B 4IMKC 1LEGA 2HZHA 2AXGB 2FR4A 3LKSA 3QUKA 4TLUA 4K5LA 5J9PA 2YMXL 1JXKA 1WAAF 3ME0A 4XNAA 1BOYA 4P5KB 3GMMB 5HYSB 3LYRA 3RWHA 3WUWG 3QDGE 2P44B 1HOCA 2O5NA 3I9GH 4H0LC 3WIIL 1OTSC 1AGFA 3OKKB 5IQOA 2GYSA 1NUFA 5EN3A 2ZWYA 4I77H 4IOSD 5IZ7A 5FM5O 3UTOA 3CH1B 2EAEA 2YO3A 4NAJA 1KUMA 1J8KA 1OCRB 1R3JB 1BVKB 4PYGA 3TTSA 1AGCA 3H7LA 5F21B 2FO4B 4HLZG 4PJIF 2C9SA 4K23L 1W9XA 2W94A 4OLXH 1R46A 1KEGL 5DK0B 4PGDB 1NGZB 1XCTB 4PWHA 1G7MA 1SXZA 3LQZB 4E9WA 1QWNA 2H0PA 2BVPB 3GRBA 4IJTA 3GM0A 3FONB 2R4RL 2Z1PA 4O2FB 1G9MC 4LIQE 4YPGA 5B38G 3QCVH 5E8DH 3MDJA 1CGTA 4KTDH 3HHSA 3CFDB 2BXYA 2D31B 1CQKA 4P3CL 2YAEA 2IBZY 4LHQB 3IMBA 1FGNL 1H19A 3SDAD 5HHPA 1C08A 4XN7A 3EYFA 3VD7A 3MHZA 4K9EC 4GFXA 1EAOA 5DHMC 3U4BL 3FHQA 1JFQH 4YN3A 1GH7A 4DVRH 2H0EA 3D85B 4HUMB 2NDGA 2PWFA 1J0IA 2BP5M 4QY8A 3QQDB 3GXFA 3U6XS 1X7QA 4IGBA 4NBZB 1JHKL 4Y1SA 2IPUG 2YPLA 4O51A 2VCOA 1KGWA 2D8KA 1CDUA 3OG6B 3QIWA 1CFNB 4MZ3A 4CBZA 1UATA 3UTZB 3T2OA 4WSKA 1OARH 2DWXA 4MVBD 3H4HA 5D1QA 5DS8A 4LCWD 4OFPA 3UJTL 2HVBA 4AL8C 1DQJA 1ZLUK 4JRYE 3GHPA 4PJGF 2H6OA 1MJ7H 1ZANL 4OIFA 4GQPH 1J5OL 4P07A 1JNLH 4E41D 3WFHA 4LKXA 3CFIC 3ARWA 3QRGH 1GW0A 4NZTL 5I75C 1ZJBA 1KJMA 1S7TB 2XDHA 1QPPA 3U9PH 4L1LA 4L2LA 4XPGH 4JDZB 2BVTA 1YY9C 3WMSA 5JNYB 4NO3B 3CTTA 5I1IH 1UA6H 1JZFA 3K8KA 1KCWA 3PQYB 4Q2ZB 2Q8AL 3OJ2C 4IBUA 2Y22A 5K59E 4EUPH 4MAYD 2R0KL 3RTQD 2FQGA 4HT1L 2WNWA 4Z7UB 4K73A 2YSSA 4PCSA 1XV8A 5E99H 3QWOB 2DQJH 4ANVA 2VC2L 2Y07H 4YSCA 4YGVA 1N6QH 2FHCA 5E8NB 5I16A 1YPZF 4L9LC 4YR6B 3NSCA 1FIGL 4NUQA 4TVUA 2E9IA 3R1GL 4WI6A 1ZLEA 4WY7L 4G71B 2HT3C 4JG1H 4KROB 3SDCA 5LGHL 4R4BA 5LBGA 2WTRB 3O8XD 4JL1A 4Y4HB 2FT6A 1XGPA 1OW0A 1PZAA 1CXFA 2QQKH 2ITDA 1WS7A 1UD8A 3ULUH 2FJHB 2DYPD 5LWYH 1TZHB 3N9GH 3K46A 4QWWC 3ZE1B 1CR9L 4OCRL 1DFXA 1GZPB 4HIXL 3P0YH 1F58H 4RMUA 1SOQA 1HHJB 3P1VA 4ETQA 2AJZA 5JORB 4QXTB 3SKNB 2BS8A 3D1MC 1MXDA 1R5IB 3DX8A 3EHBB 3OSVA 3WI9A 1XH2A 3IDGB 1VPOL 5GS3A 4I1RA 1RHHA 2EE3A 4KK9C 2JB5L 5EIVA 2SEBA 1FO0L 3CVBA 3ECQA 2R2HA 2XHNA 1XF5B 1PZSA 2HH0H 1FP5A 3KPQA 2PR4H 4NLHA 2OYPA 4PCKA 4S1SL 1GJIA 3KH4A 2DDQH 3FFOA 4YXKL 2A9MH 5KVEE 3V4VH 3LSOA 2XRAH 4XNZC 3VXSB 4FFZH 1N5YH 1K8DB 1ZEAH 2K1MA 5AL8A 1WQVT 3FT9A 3WKQA 1SN5A 2E76C 2F5AL 2H6PA 3IM1A 3CK0L 3AY2A 3T0EA 1LP9A 4NNXB 4CVZA 2E3VA 4U6YB 2A83A 4LCIL 3S4SG 3VFMA 3DGGA 4JFZH 5DK2B 5JMRA 2FO1A 4JFQB 3TWCL 1XZWA 1AGEB 1OE2A 3RVWD 2XUWA 5F88B 1E6JL 3G7TA 4OI8A 1IKNC 2P45B 4FG6C 1YC8A 4FQLH 4YDNA 3U0TA 4F8TA 1TJHH 1IM9B 5H35A 4PTUB 1MAML 5DS2A 2GTQA 4X80L 4ZTPL 1NZRA 5CBEA 5DDHB 1UENA 4IOIA 3QUZD 4K7FA 1IUZA 3ATDA 4N2OA 4UMSA 1DQLH 4EO5A 1ZA6B 3UTSB 2LGNA 2DD8H 3N43F 1BBJB 1RURH 1M3IA 1LEKA 1Q72L 4FNLL 4GRWF 4IK7A 3L7EA 3V4PH 5DD5L 1DBMH 3ZRCC 1UC6A 2VDOB 2IIJA 3O3EB 1HXMA 2LR4A 4M6ML 1VJSA 1QQDA 1HH6B 3QFJE 3N1PC 4JZOB 3VH8A 5BCAA 1CLOH 1KJVB 3FQ1A 2ROYA 2ZYIA 3QI9C 1DL7H 1KJ2H 4KNTA 1BW8A 1Q0YH 2YD2A 3ARFC 3DX1A 5B4MD 1IGYA 3DVGA 4FCAA 3CHXA 1W0VA 4XPTH 4G6MH 3NJIA 1CVRA 2VL4A 3L3DB 4Z9KB 3HG4A 1F3JB 1SQ2N 1GC1L 1SRDA 4I77L 5HYJD 4WUKH 4KK5D 3MRFA 1YCSA 5E9NA 4ZBJA 1AG6A 5H2BA 4DO5A 4PY8I 3EO0B 2P5EE 3FT3A 3UO1H 1WWAX 5CZVH 3HJEA 1T2JA 3REWA 3AAZB 2F61A 2XSKA 2ZXEB 3HG0A 5DA4A 3WAJA 2DQMA 2XTJD 2FLMA 1FVDB 4OLXL 1R1CA 1PZCA 2Y7LA 4NOFA 4QXGH 4D3CH 5I75B 3DSNB 3UP1A 1KY6A 2CIIB 3SDDA 4TSBH 4LE8A 2JKXA 1T1ZA 1XSIA 5F1SA 1WZAA 2NUTA 2A6KB 3CUPB 4Y2OB 3QCVL 5E8DL 3MRBA 5CWSA 4UDTA 4YK4C 4JFEA 2ENSA 2CCVA 3EYQD 3A22A 3FH7A 4GT0A 5CZXC 4AGPA 2D2CC 1WFTA 1P5VB 1BZOA 2J7LA 2P48B 4JRWA 5JLZA 3MO1B 5IHUH 5J6HA 1RUPH 2HLEB 1WIOA 5ISZD 2PPDA 3FO1B 4JFVA 2XFXB 3KWWA 4FJ6A 3VVVA 1JFQL 4GRMA 4DVRL 4L9LB 5IF0B 1OKEA 1NAMB 4KX7A 4OF8A 5EC1B 5I6KA 3A5VA 1A25A 2PP9A 3GXDA 5CUSL 1ETJA 2VE6B 3MRJB 3KXFE 5K9OA 2K6YA 1RK0B 3DTXA 3HHMA 2X0VA 1RHFA 3HI1B 2C4FT 4MA7H 4NPJA 5SWZA 1SY6A 3EYSL 1X5IA 4XMZA 1MJUH 5IHZA 2LLNA 4ES8A 1OARL 4N9GA 1U3HD 4GINA 4W6XB 5KANG 2KHAA 1E5CA 2A0LD 4ZO6A 1JZ6A 3UZEA 5L4FA 2NY5C 3WEXB 2JKTM 1MJ7L 1MHEB 3EFDH 3QDMD 4WTXA 1JNLL 1CGSH 3QRGL 2FTAA 3CGTA 1OWWA 3MCKA 4LKCB 3WIHA 3U9PL 2YMTA 1NBZA 2BY3A 5ESAA 1FQ9C 3WV0A 4WTQA 3TA3A 4XPGL 4F9PC 1WGOA 5AZEH 2YQGA 5I82A 4Q6YA 3OXSB 2CBOA 5I1IL 1E5AA 1UA6L 2GABA 4APXB 5HBBA 4N90D 5LNDA 3DIFB 1KF9B 4G70B 4KKCD 5I19H 2PKDA 3E6HB 3M1OA 4X7SH 3ZW3A 1I1FB 4NZ8A 3QGVA 3VXPA 4CMHC 5BRZE 3LVEA 1MFEH 2COQA 2IOIA 4GAFB 4PCYA 5BO1H 3UPRA 3ABKB 2Z92A 5E99L 2DQJL 3BXNA 2Y07L 5I1KH 5BS0D 3T4YB 1N6QL 1FNAA 2JJWA 3A6BH 1G5AA 5T1MA 5C0GA 4XNZB 3EUDA 1DQMH 2YQ3A 4H26A 1KGUA 5DYOA 1OT4A 5LHDA 5HDBB 4JG1L 4KNQA 1GSKA 1BYNA 2C3XA 5CIPB 3VFGH 2X4TA 3ILQD 4N2BA 5F2FA 5DZJA 2ZWLT 3CLWA 1ZJAA 2QQKL 2KKQA 2E86A 4IOFC 4U1LB 3RWCA 1U3JA 3L3GA 3ULUL 3NFNA 4Z7VB 3HG5A 5LWYL 3N9GL 3F2LA 4LNVA 5HHOE 3CXHK 3P0YL 1F58L 4XO5A 2NNCA 1BF8A 2F15A 2PTVA 3CDGB 5DMKB 4QMEA 2E0PA 3M1CA 5J6SA 1VACB 1KELH 4Y4FA 1GOGA 2EEDA 5EOQH 1J88A 4RMSA 3NCEB 5D7JC 4QOKA 3L4YA 2OR8A 2Q76A 1K8IB 1A6TA 4P4KD 5CLZA 3HRZA 4MBRA 3ABZA 4KRMB 1GSMA 3GWJA 4MJ5A 4GXVH 4D8OA 5EB9A 2HH0L 2NYYC 2DH2A 1CICC 3SJVE 4KXCA 5J6GA 2PR4L 4LARH 4FC3E 4HJUA 2Y5QA 3L4CA 4W9DC 4GUQA 4DKAA 2DDQL 2AXWA 1CYGA 2IDUA 2A9ML 3V4VL 3S7GA 5GGVH 2EEXA 4CC4C 4JM2D 4GMSH 1A64A 2XRAL 2NY1D 3JT2A 3QUGA 4FFZL 1TTRA 1N5YL 4P2OD 3D7PA 4P5TC 1VADB 3QI9B 1A9BA 3D48R 5KYUB 1AO7D 3ARFB 4BFJA 2H47C 1FL6B 1BFSA 2XKUA 4HWZB 2Y72A 4PJHA 2UZPA 2O6EA 4JFZL 1QSFD 1V5JA 4PCTA 4UM8B 4NQSA 1NCWH 2VXQA 3OF6A 5I1DB 2MQGA 3KJ4C 4QRTB 4HKBA 1LP9F 4PJAA 4QUOA 1HYRC 2VDRB 1JYWA 4J4PA 5JIMA 2W9DH 2DV6A 3D18B 4FQLL 1A6ZA 1XDTT 2WP3T 1TJHL 1FNFA 1THAA 4PWGA 5B1BB 5C0EB 3K8LA 3VUAA 2CUMA 4LSDA 2VISA 4MNGA 4KH2A 3N1GC 1EZUA 3MROB 4N2MA 4U1IB 4LL4A 3RY6A 1IEBB 3QDAA 2MOVA 5D71H 4AV0A 3FCTB 3LH2L 3VG0H 3QDGD 5ID1A 5CSBA 3D33A 3F84A 2V17H 4N0UE 1IAIH 2P28B 3OHXC 2DD8L 4HD5A 2EKSA 1RURL 4WO4C 5D7KD 1URIA 1P4IH 3T5WA 4DN3H 1JP5A 4Y2DA 3V4PL 1LJMA 1DBML 2GBTA 4GBXA 3EGXB 5ITFA 1YMHB 2CA3A 4LSTH 5AOMA 3VFRB 3VI4B 3MRKB 4N5EC 1D5XA 4YLCA 1JPST 1TJGH 1CLOL 2NQDA 5DMGD 3AITA 1NGWA 4AOFA 5JW5A 4ZYKA 1DL7L 1KJ2L 5IFJB 4IU3B 1Q0YL 3AT9A 3MRRA 1EJFA 1BQHA 5DVKA 5B1KA 5HI3D 5C0CA 2BINA 4LVHC 3LKRA 4XPTL 5GS1A 1ZLWH 1I82A 4G6ML 1TEFA 3L17A 5FYJU 3UC2A 1QBLH 1JN6B 2CLZA 3OV6A 1BREA 3ASOB 3F7YA 3MN8A 4S1DC 4WUKL 3I50H 3QYNA 3O4OB 3QJHB 4DPRA 3MMEA 3ZIYA 3UO1L 5CZVL 2R1XA 5E1QA 1CL7I 5AUMA 5TDNA 4F2MA 4ZMQA 1ED3A 4JS7A 4YOKA 1CXHA 3L9YA 2BX5A 3BX7C 1JV5A 5DWPA 3QB7C 1XXDC 3X14A 4QXGL 4D3CL 2OSLA 4QCIA 1QO3B 3WLBB 3IXAB 3FFDB 5A3ID 4ZUVB 4TSBL 3TN0A 4GKNB 2W92A 5MEQB 4H8QA 2HN7A 2AXHA 5CLTA 2Z35A 3E80A 3SBPA 4R96B 4NO2A 3O45B 1ZGLA 4PJEA 1JNJA 1E42A 4CMHB 2P5WA 1B9KA 4GW4B 3QR2A 1T0OA 3KM1A 4PPTA 2JTDA 4PV9B 5IHUL 2TRHA 1EO5A 5EU3A 1RUPL 1MHPH 5I6PA 1I8MA 3SD5A 4JRYD 1G0YR 3EJQA 2DL9A 2ZOLB 3E6FB 4QGTA 5K33A 1JGEA 1EO8H 3HUJB 5E8EA 3FCUB 4RIRB 4ZFOA 1AGDA 1UWGH 3SB3A 4UNTA 5TPWH 3WHE1 3O3BA 3QH3B 3QUZB 2XX0A 4WTZG 5J3HD 1TFHA 1WBYA 3NUKA 2QDWA 2CHZA 3MR9B 5IBUB 5DFTA 1BIIB 4NFDA 1KNOA 2CWRA 2JK5B 3FT2A 4Y19A 4F7EB 1FHGA 1WK0A 1QW8A 2JJSA 1MJUL 2Z65C 3MFFB 5IMMB 2XWDA 1CFSA 43CAA 1XZ0A 4D9QD 1HHKA 4OKVA 1AQMA 1FL5A 2OYLA 1GR7A 1NFDB 2BPBA 3LQAC 3EFDL 5C08E 1CGSL 2AEIT 1SMDA 3FF7A 5IK3B 2Z7UA 5D7JB 3DDFA 3LZFH 5I66B 3GUTA 3SKJH 2FLBT 3BEWB 2GJJA 3PV6B 4W4OC 1S4IA 2V7NA 5EUOE 1KB9J 2X2JA 5AZEL 3NESA 1TZGH 4RGMB 3VI3A 1CLYL 4XMPL 2D3NA 4G43B 2BNQB 1IM3B 1D9KA 3TBYA 5I19L 4X7SL 1ZKAA 1L3WA 3DGCR 4G8GA 5DLMH 3VRJB 1CICB 3F12A 4RA3A 1OL0A 1OOAA 1OAZH 1MFEL 5BO1L 3T77B 1EWHA 1J7VR 1R3HA 3QO1A 1RZIB 2YN5A 4MJ6A 1OM3H 5I1KL 3QJSB 3K4DA 1E40A 4O00A 4JY4B 2VL5B 3A6BL 2BSTA 2Q7YB 2XZQH 5DFVD 1DQML 4HKXA 5GIRA 3PGDA 4K55A 2R0WH 2XTJB 5DZOA 1F4XH 3SKMA 2ZKXA 1OF0A 4P5TB 1J0ZA 3KHQA 1WEJH 3VFGL 1HOEA 5CP7A 3S48A 3BUDA 1U91A 1ASQA 3FU8A 1WAPA 1LGVA 3CHPA 4LOVA 4TLSA 3QEHB 4MQTB 1YY8B 1EEQA 3K4ZA 3II2A 5AG8A 2XWXA 3KJ4B 2D7OA 4IRJA 2DN7A 4M1GH 4NC0B 2I9LA 3PYCA 1ZCRA 4H8WH 2Y5TA 1D5BA 2ED6A 1ZE3C 4ZOEA 3T3ME 4HG4J 3ZSSA 1KELL 4LBEA 2IBBA 4HAKA 5EOQL 2XXGA 2EE0A 3NDZE 1MFNA 3FRPA 2WTOA 2I7SA 4TSAH 4H7VA 3IRPX 3D2UD 3FYIB 3L4ZA 5F7YC 4ZX6A 4M02A 4W9EC 2C9RA 5JDSA 4GXVL 5HI5C 2VDLB 2Z1KA 4R4ND 4DP0X 3KEDA 2JIXD 3OHXB 5F3BB 3QR0A 4LARL 1F4YH 1V55B 3GXTA 4PI0A 4GUOA 4KKQA 5BZDA 3DNKA 4LDOB 4XXCA 4KOBA 5DO2D 3VFSA 3KL5A 5GGVL 3WS6A 4PP1D 4GMSL 3V4UH 5L2JB 3FU7B 4B9JA 3HE7A 4RSVA 1AHWC 3NGBC 1WO2A 3OD3A 4F8OA 2E9JA 3QDMB 3V0FA 4MDJB 3KPRB 4OZHA 3BPLC 4OCWH 4HA1A 1WA0X 3L3JB 3HLAB 5B8CA 1BXAA 2HT2C 4XB3A 1NCWL 1MI5A 2HKHH 4JPIA 3LKQA 4PW4A 3BD5A 2DIBA 3H7BB 4WI0A 5GZNA 2W9DL 4Z7WF 3SY0A 4EDWH 2YGVA 1ZHLB 2O61B 3QFJD 4XP6H 1JDAA 4GOSA 3MYJA 3MNZB 4JY6A 4L1TA 1MFAH 4PJAF 4ANWA 2A9AA 2BMKA 2PPEA 2O5XH 5FIEA 4J23A 1YUKB 3ZYJA 4HUKB 4OB5H 2AEQH 3BT0A 3VSTA 2EE6A 3ZY7A 1FF5A 2ICWA 3B9VA 5D71L 4LHUD 1KMGA 3D69B 3VG0L 4QRPA 1X7SA 4G59C 3QC5X 2DMGA 3TYFA 2APTA 2YA0A 2V17L 1IAIL 1Q9OA 4I9WE 4GYBA 2UXFA 2IG2H 3DRTB 1P4IL 4DN3L 3SGJC 3C5JA 5KOVC 3ULUE 3BP4A 5IVOA 2P5ED 3QEQB 4LSTL 1KYAA 3B8YA 1T1WA 2OA9A 1PTZA 2CO6B 1KXTA 4X99B 5F8RC 2HLFC 1TJGL 2OMWA 4G72B 4G6KH 3NZ8B 4GS7C 5DRWA 3X11A 3C60A 5FFLA 4X7FC 3MGOB 2BP0A 4W9ZA 3VXRE 2DM2A 3CSPA 1YEJH 1SBSH 1XCXA 3MJ7A 3H6AA 3LB6C 1R6VA 3V6FA 3U9UA 4NIYE 3MU3A 3PJSA 5FEBA 1JK9A 3GSNH 1QBLL 2WIIB 2CLVB 5JW4R 3CX5J 2J1WA 1PNDA 1HWGB 5GGTH 1CC3A 4JFYA 3I50L 2YMOA 1RIVH 4HP5A 2GJ6A 4M4RB 2RFXA 2XWRA 2AXGA 3BAXA 2VR5A 1J10A 2CR6A 4XNXH 2Z93A 3ARBA 3BIBX 3BQUD 2BS9A 3DX3A 3RE0A 3KXFD 4P5KA 5HYSA 4FN0A 2OMZB 4I5BB 2FJUB 1BVNT 1JD7A 2ALAA 3KYKH 3SKOA 3TVMA 4P4RB 4GG8B 4BZ2H 2CO2A 3RWEB 4PHZA 2G9HB 1TYRA 3ULVF 4YNYB 1CXIA 2PYEA 1FCGA 4WU7B 3ARDC 2P24A 2N3JA 1ZLVH 2H1PH 1T2QL 4UTAH 1MHPL 2Q86A 1AKJB 4HC1H 4FTVE 4RA0C 1JF6A 1PG7W 1D5MB 4PJEF 4NQDE 1EO8L 4LF3B 2KS0A 5DK0A 4PGDA 1NGZA 1O9WA 1XCTA 5AVQB 1L9SA 1UWGL 3LQZA 2FYYB 2VDPH 1NMBH 3G9AB 5TPWL 4HK0A 2BVPA 4HMDA 3IMWA 2GEQA 1H3WM 4RZCB 4LLMB 4HOZA 4U1MA 4Z7QF 3ZT5A 5SWSE 5E1GA 3TEYA 2P8MA 3QDGB 4ALAC 2D31A 2X1OA 3OKLA 4WGKA 4X4ZA 5HY9B 4RWHA 5BRZD 2XV2A 5LG1A 3GZQA 1B6UA 2PP8A 4X6DA 5KYXB 3WFZA 3QPQD 4JAMA 1P6FA 2ICWJ 4HU8A 4RMTA 1LK2B 3R0NA 3T3PB 2CU9A 4P57A 3D85A 2GSMB 5DJZB 3Q6FB 1M1XA 3RKDC