2JLPA

Crystal structure of human extracellular copper-zinc superoxide dismutase.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
DGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Human Extracellular Copper-Zinc Superoxide Dismutase at 1.7 A Resolution: Insights Into Heparin and Collagen Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords EXTRACELLULAR SUPEROXIDE DISMUTASE (CU-ZN)
total genus 40
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2jlpA00
1SDAB 3ECUA 1COBA 3KH4A 4A7SA 3KM1A 3T5WA 3H2PA 5KBLA 1XSOA 1UXMA 4OH2A 2AEOA 3S0PA 4BCYA 1TO5A 1OZTG 1BA9A 1EJ8A 1XTLA 2ZKXA 3HW7A 1E9QB 2WZ5A 2Z7YA 2C9VA 2WWOA 1XTMA 2GBUA 1TO4A 4FF9A 3H2QA 1E9QA 1PTZA 1FUNA 2JCWA 2WKOA 4A7TA 1CB4A 1ESOA 1F1DA 1MFMA 2AQRA 1S4IA 1EQWA 2JLPA 2AQSA 1B4LA 3HOGA 1E9PA 5KBMA 2WYTA 4MCNA 4BD4A 1JCVA 2XJKA 3LTVA 4A7GF 5KBKA 1SXBA 1AZVA 1SPDA 3KBFA 1SDYA 1KMGA 1CBJA 1F18A 1QUPA 1SXCA 2AQPA 1SRDA 4A7UA 2AF2A 2AQTA 4A7GA 1SOSA 1Z9PA 3GZOA 3L9YA 3GTTA 1SXZA 4N3UA 1JK9B 1E9OA 2E47A 1E9OB 4OJAA 4BCZA 2NNXA 3GQFA 3CE1A 3SODB 1IBHA 2Z7UA 3MNDA 1HL5A 2WKOF 1OAJA 3HFFA 2V0AA 3CQPA 4N3TA 2VR7A 2XJLA 2VR6A 3F7LA 2APSA 1Q0EA 3QQDB 1DSWA 1L3NA 1N18A 1DO5A 1Z9NA 2C9SA 3ECVA 3RE0A 3K91A 2AQNA 4L05A 3L9EA 2Z7ZA 1F1AA 1PU0A 1U3NA 2Q2LA 2WYZA 2Z7WA 3GZPA 3GTVA 3KBEA 1OEZW 1RK7A 2R27A 1IBFA 4U4IA 1N19A 2GBVA 2ZKYA 2C9UA 2VR8A 1IBDA 2GBTA 3ECWA 1E9PB 1HL4A 2ZOWA 2AQQA 4A7VA 1UXLA 2SODB 3KM2A 1SXSA 2LU5A 3MKGA 1OZUA 1IBBA 3QQDA 1JK9A 2WZ6A 1PZSA 1SXAA 2ZKWA 1YAZA 1IB5A 3F7KA 1SXNA 3CQQA 1BZOA 2K4WA 1OALA 1YSOA 4A7QA 3KH3A 5CU9A 1P1VA 2E46A 4MCMA 2WWNA 4B3EA 1F1GA 1YAIA 2WZ0A 1B4TA 3GZQA 3PU7A
chains in the Genus database with same CATH superfamily
2VZSA 4LF3A 5C8JB 4N5ED 1AG6A 2O5NA 3PABB 5DO2C 2R2HA 1BYNA 4F8QA 2WLZA 3NGBB 3PGDB 1PLBA 2W5PA 1NCJA 4ODBD 4PJ7E 5I1KH 4W9LC 3RVTC 2FJGB 4D3CL 3T77B 2K7PA 4GRWE 4BSVA 4JKPH 2C9VA 1T6WA 3HE6A 3RDJA 4N85A 3FT3A 4PSPA 1FBIH 2WQVA 2XPGA 3ET9F 4LSVH 1I3RA 1QEWA 3AXLA 1FN4B 2VDOH 2A9NL 1I9JH 3OAUH 4JLRB 4AEFA 5JHDE 2XVGA 4K3DL 3BKCH 5AZEH 1KLGB 2VTFA 4KK6D 4G6FB 4C4UA 1JXFA 2B3RA 2NY5H 2XZZA 1I75A 4WK2B 3HZMB 4PJ5D 3KJ6L 1PZDA 4S1SH 1NBYB 1TNNA 5T1KD 3V5HB 3PWUA 4A7UA 1D2OA 5IKCB 2R1XB 3OKOB 1LVEA 3CVHL 3QWRA 1Y1UA 3UTTD 3X1GA 4FG2A 4A2FA 5A2AA 1E4WL 1CE6B 1S7RA 3ARWA 4HWZA 4CUCA 2NXYB 3IDJA 3N5AA 3HS0A 4IBWA 2X9WA 4QMEA 4CDGC 3TOPA 4BH7B 2EINB 4P5TD 2Z7UA 1HL5A 2A6KA 1LLAA 5CLYA 3PG2A 2UXVA 4FTVD 4IBYA 2Z3FA 3RIFF 3UO1L 1VEPA 2YO3A 3TA3C 1MCOL 2VQ1A 4JPWH 2LLNA 1JI1A 4QOKE 2PPEA 1YC7A 1CS6A 5IR1B 2IG2H 4PB0L 1WP6A 1VIWA 2D03L 2ZP8A 4L05A 2K6ZA 5KSBB 1W8EA 2WIIA 2E27H 2WYZA 3GHEL 1Z9MA 5EU6A 3U2SA 3MRJB 1TITA 1TZ8A 5CMAB 3PGFH 5KYXB 2Z8SA 1TVDA 1BLNA 1G5AA 4K94L 3ARBB 1IEAB 4H8HA 3IJYB 4FFVC 4DN4L 4P49A 4XPBL 4HU8A 3KXFE 4CN4A 4Y9BA 4MX7B 3OJMB 3VQMA 2AQQA 3V9FA 4FQIH 2FO4B 3DX8B 3T0ED 2BFGA 4N1HB 3VXRD 1HTYA 3TNNA 5DQJB 5IEKB 3HE7C 2N7BA 4IIQB 4PJBF 4NFCA 5TH2A 2OMBA 2GW5A 1ETZB 1BM7A 1WFMA 2FL5A 5ALCL 4UT6A 1QWNA 4Q9QH 1F1GA 3GLDA 3VACA 1HJBC 4AE0A 4HF5L 1P4BL 2PKDA 4LCCC 5F7WC 5BO0D 2FATH 5ABAA 3T04D 5AUMA 4WFFE 2ATKB 2HSIA 1JF6A 4NM4L 32C2A 2F8IA 1W0VA 1OTUC 1UZGA 4RMBA 4ELME 2WQUA 3PWPE 5JHMA 3M7OA 2B14A 4KK8C 2VDMB 4MMZA 1UFGA 1XGPA 5INCA 2BXZA 4YDJA 3JVFC 4AG4L 3OKNA 5AW4B 2FUQA 3DVNA 4HAGA 1RVFH 3KDMA 2X2HA 3T77A 4AE1A 1LE5A 3FUEA 1YMMA 1TQTA 1S7RB 4JG9A 4XZUB 4RDQG 1RXLA 3U6XS 1NCCL 4G7YL 3VGGA 5IIEB 5KBMA 1ZSDA 4N8CH 4P9ML 3UAJA 5AW8B 4XOCA 4Z7VA 1CTOA 4OJDH 1GC1H 4UBDC 1PD0A 3G04B 3SKUD 2ZOKA 4LSSL 1M57B 5FYJL 3E38A 3PP3K 3IMSA 4F7TB 4FNRA 3A6BL 3C5XA 5HP5A 3T2OA 3S35X 4ZQKA 4AUYA 5D93C 5C08D 1T83C 4BH8B 4DFHA 1FL6A 2XV6B 3QFJE 4AVIA 4FOMA 1KN4H 3EJTA 3ZKQD 3HBQA 1SOQA 5TD4A 1C16A 2H26B 4N3UA 3H3PH 3VNZA 3LD8B 2CBPA 5F1OB 3OV6A 1GSMA 1U93B 2APBA 4U4BA 4GI9A 5DFWH 3VXSE 2CJ3A 5DRWA 3CN0A 3D4ZA 4ZMPA 1F6AA 1DSYA 1PIGA 5J57B 1PAMA 4RSVA 1JXJA 2YXWA 3M17B 2VXUL 2YRBA 4GXVH 2ZXBA 4ODWB 4GIPD 4H2CA 3QH3B 2FZ3B 4K8RL 2UXTA 3DJZA 4ZUVA 4DZ8A 1CFBA 2YWYA 4CADB 4PCTA 2BVOA 1I8UA 5F6HJ 3VJ6B 1MLBB 4Y5XA 2CA3A 3D3VA 4OZIA 5MP6L 5DJDB 5E1IA 5A16B 1M7XA 2QPSA 1TQSA 4LVNB 3AB0B 3HHMA 2BW4A 2DQCL 3ASWA 1YNLL 3MUJA 4NHCL 1DDHB 4UOQA 2G0LA 3L1OL 3AMKA 2ZKYA 4FFZH 2VMEA 3LXAA 4PJXE 4UZUA 3TEYA 1XT5A 1U8OA 5KEZA 1YYMH 5BQ7A 5BXFB 3WNMA 4JGMA 4OB5H 1CFTB 1UA6L 4F8NA 2YQBA 3MJ7A 4U31A 4YPGA 2J1YA 2BZCA 2LU3A 1R75A 3QHZL 1X44A 5BRPA 2O93L 4L3EB 3WFEH 3JWNG 2P5PA 1ZTXE 3LPFA 4UCFA 2IPKA 4U1NA 2X4QB 4YDJB 5AKTA 3INOA 2FGZA 4MGXA 4PG2C 5AOKA 3FB8A 5CWSA 1Q1JH 2YMTA 4MA7L 4RZCA 5FO8A 2B16A 3DOIA 1FYTA 4JS7A 3SD5A 1J9QA 1J0IA 4B5EA 3W2DL 3CDFA 1AHWC 3C60A 4I2XA 5KBPA 4CJ0A 2WHVA 4XMXA 3NT0A 4NNXB 3QRGL 5JXAH 1BBDL 2EC8A 4GAFB 4AGQA 2OS7A 2YFOA 2OSLA 3DURB 4P5SA 3FUHA 3KLHD 4I3SL 1BVOA 2AEQL 1N5AB 4CVWA 1J5CA 1P6WA 3A22A 1ZJAA 2ENSA 3NEXA 4HKXA 2H3KA 4LOEA 1IGTB 1B4LA 5D1ZA 4X5WA 3INUL 1FDLH 3KW7A 2WYTA 3QUHA 1AO7A 2AC0A 4ELDA 5L4JA 1SJMA 2WMPA 5I0DA 4HT1L 1YMMD 2YBRA 3UADA 1MCRA 2CRIA 2D7MA 5JIMA 5JQ6H 1B4RA 5AKVA 4QTIH 5ALBL 5EPMA 3TESA 4PYHA 1TIUA 3MHZA 1JZHA 3TBSA 5F1KC 2WIIB 4ENEC 4Y9GA 3Q1SH 4X8CA 2QPEB 4HIJA 3U30C 2FBRA 3FFCB 3Q6GH 3X1BA 3QA3B 4DTGH 1QRKA 3PIQB 4U6XB 3VYNA 1MPAH 3HFMH 4D7BA 2LTQC 2NQDA 1T4WA 1H3GA 2B1AH 4HJSA 5I9QC 1BG1A 4KTDH 2LLLA 1I85A 2XKNB 4BZ1H 5L2KB 5F7KC 4DP1X 1S9VA 2XWDA 4HKBA 4JY4B 3GPSA 4BQ9A 3QDJB 4I18A 4OLVL 1JHKH 4OGZA 5KN5A 4WKZB 3TFBA 4LCWB 1CFMA 2IGLA 4Y4FB 4MKMA 1CXEA 4LLYA 3FPYA 2JV6A 4XNAA 5AKSA 5E2VH 4XP5H 3FQRA 2UZXB 1JV5B 1TSRA 4PJHA 3IDXL 5DDHB 1I9IL 2F8VA 2CRMA 2X12A 2YWZA 3BVNB 5J1TC 5GRUH 1GPOL 5DEFA 2JELH 1EZVY 3L5XL 4PEEA 4DQAA 1IL1A 1U8CB 3WFBL 1L9MA 4ZMZA 4XNZC 1EEQA 2YGPA 4ICWA 1XBRA 4YSEA 2OK0H 3N85L 2P80D 5DHDA 5KYYA 2Q2EB 3MLVH 3KYNA 5F89B 1YAZA 4X6BA 1CWVA 3VXTA 4QRPE 3AQYA 5CS7A 2X4NA 2AGJH 1IAIM 1A5FL 1IZJA 4H0GA 5K1VA 1F41A 1UD6A 3QXTA 3GI8L 1XGQA 4BEIA 3TBWB 4CU7A 3TN0C 2CMRH 1ETB1 1U41A 5BZDA 2Y06H 1EPFA 2AXFB 4IRSD 2V5TA 1PW3A 4OF3A 4YHOH 5F1NB 5CJ8A 1SHWA 1N64L 4FS0A 2GK2A 3SDCC 3HMWL 3V6OE 4CAGA 1TZAA 2BSDA 5ICZA 1YQVL 4GXUN 4KJQD 3HW7A 5HD8C 2JQZA 1IIKA 3BDXA 4ZUUA 4PLNC 4OLUL 1T80A 3C09B 4NQUA 2NY0B 4XMUA 3VFUA 3F7VA 5L7XL 1IFRA 1AOHA 2YRPA 4ZUWA 3EZJB 4XWGH 4AL8C 3TA3D 3DETC 3N55A 3B3BA 1C1EH 5DWUL 3IMBA 1YEGH 4YSDA 1G7IA 1G6RH 5E1AA 4TRPL 2KLRA 5DT1L 4LSPL 3QDJA 2Y7MA 4G42B 4I18B 5CR8A 3KPLA 2ZYHA 4HKBB 1K2DA 3NABH 4IKLA 5C97A 1S9XB 5D7SH 5D96B 1UT9A 2GUOB 3HB3D 4YBQC 3NZ8A 3K4AA 3GSQB 4L4JA 2Y69B 2C1OA 3MA7A 2Q6WA 1OT4A 5B1AB 1FFTB 1CI3M 2WQAA 3FONB 1SYVA 3MLZL 4FNQA 4PCKA 4XNMB 2NNXA 5FDWB 4H8VA 4ZAKD 4JY5L 3REVA 5KVEE 1KIQB 1M2VB 1UASA 4QRAA 2VJXA 5DJ2B 2R7EA 2FR4B 5FC9A 2WXPA 4LCUA 1BSIA 1SUHA 3O9WC 4NXSA 5FM5O 1PLGL 4RFNB 1GGIH 2EDQA 1GSKA 4OFYD 5IMOA 4F9LC 1IBGL 4KPHH 4NKIH 5KS9E 3G6DL 1F1AA 2VM9A 3CH1B 3EFFB 2PXYD 4W6YB 2UWEE 1JK8B 1YVLA 4M5ZH 3M1OA 4PW3A 1EGJL 4BFEA 4U7KA 5D7JB 5DFVC 3RFZB 1ADQL 3AY4A 2F8XC 1R3JB 1RPQA 4CMHC 5I6LA 1AE6L 1V7NL 4ETQA 4JFWA 3HI5H 3CPLB 4PRPE 5GGUA 4WKXA 5IESH 1YEEH 2DQTL 1EFXA 2NDFA 2OMXB 4ODVL 3HTLX 4FQ2H 3FTUA 4JFQB 3UP6A 1IAMA 5I8OH 4TQEL 1DR9A 2XKUA 3TEZA 1LEKB 4I87A 4MAYB 2X6UA 1UOLA 2JIXB 4LEBA 3RTLA 3HUJE 3VFTB 4C83B 1BF8A 2FH8A 4FXLA 3WLWD 2IGFH 5EZLA 3QQXA 4UT9L 4MCMA 2O6PA 3LZQA 3VM7A 4L4VA 5HDQL 4LGRB 1V3LA 2IWKA 2MQCA 3QIBA 4F57H 1D7FA 1ACXA 3BSZH 3IFPA 1LL1A 4CVXA 4KZDL 5IJBC 2DWEA 5I73C 3DDFA 4IKJA 3QXAB 4O2FB 1ID5I 1IM9B 1XR9B 3UTSD 5J3HD 4HBQA 1EDYA 1QTPA 2HKFL 4NO2B 1WFTA 4YMPA 2J3SA 5BV7L 4MQXC 4KQ4L 4KHXH 1U8MB 5LB1A 4UOJA 3S34L 4HS8L 1OAKH 2FHBA 3QFGA 4OCYL 4XPAL 1ETZA 4JZJC 2OJEA 3TLRA 3NH7H 3GLEA 4AZ8B 4LHQB 4PG2A 1M7IA 2YR3A 1OHZA 5D1ZB 1DO6A 4JZOA 3IAQA 4IU3A 4MQTB 1JXKA 2JLPA 2FLBT 3ARYA 3GSQA 5KSBE 2W60B 4MBOA 2A7BA 4LHJB 3F12B 3FU7B 1I1AB 3HPJB 4M8QB 5K33A 4A1RA 4XNQB 1C5BH 2NRDA 4Q2ZA 4NQDB 4NUGH 3GMMA 4Y4HC 5EIIG 4M29A 4A7GF 3RWDA 3EJCA 3QIUD 2HPOA 4HDIB 4QRRE 1RFDL 2ZWZA 3BWUC 3K74B 5DR5H 1FE8H 3SY0A 1S9YB 5HHOB 1CL7L 1VA9A 5ESVB 5IVNA 2J56A 4JO4L 3ULUL 3V79C 2I7OA 1MSPA 4JRFA 1BREA 4YDVB 5SWZD 1I7RB 3QEGL 7CGTA 4Q9RH 3FK3A 4HV8A 4X7FC 4NQCD 3GD1C 5DMKB 1F3RB 1IC4L 1I53A 1TYEB 4ZW3A 1WUNT 1NKRA 4V11A 4ZBJA 1XSKA 2B9BA 1MG2C 4FI6A 3WDJA 1VFBB 3MNVB 1CE6A 4PGBB 2C3HA 1U8KA 2H2SD 4LLYB 1TZOA 4MBRA 5JDSB 5DJ0B 1BZEA 4AL8H 4H5SA 3F58L 4L4VD 1MHHB 3D87B 3Q5OA 5SV4A 1QBLL 4NP9A 1LE9B 4YNYA 4HGMA 2GFBA 4MVBD 2F1EA 4G80B 3RVWC 4XNQA 2C4FT 4NRXB 4P2QE 2NW3A 2AQ2A 2X4UA 3FSZA 3QDMD 2FX7H 3O2DL 3S96B 3KCPA 4UNUA 1E4XH 1ZLSH 2RCSH 4FJ6A 5K1JA 4WV1B 3TASA 3JZYA 1KGCD 5BVPL 2NCMA 4CGTA 3U1PA 5DJ8B 1KB9K 4K3EH 5IFHL 4IW4C 2Y24A 1P7HL 4XN4A 4B97A 4Z3EA 3T4AC 1QR1B 3ILQD 4GQ9L 4S1RL 2BVPA 3NA9H 4JG0H 4XMKL 3V4PA 3TT1L 5HYJA 5GGTH 1QX1A 3F5WA 2FNWA 2ZXEB 2AEOA 4HWBH 4CVXB 1G9EA 5KVEL 5D2LE 3I85A 2ERJB 2XWZA 1YEFL 2J20A 3RX9A 5EEUA 4OJFL 4UIMA 2ROYA 5DI8B 4Z7OE 2UZPA 3RVVD 1ODAA 2IALA 4M3KB 4Z7WE 2CGYA 2BMKA 3C5JB 1U92B 1QLFB 1TZIB 2OP4H 4A2LA 4Z7UA 3RGHA 4EF3A 1S5HA 4HFUH 2DIEA 3WIHH 1XCQB 4G6JL 4HIIB 1NGZB 1O5PA 3W39B 2Y2YA 2YD2A 3HUJB 5D55A 3MDJA 2FO8A 3G6AA 5BO1H 2CJUH 1CLZL 1NL0L 4UZSA 2VQ1B 2VIRA 5H4ZA 1JNJA 2G3ZA 1WAAF 1CTMA 1NAML 2Q7AA 3TO2A 4HWEH 2QQNL 4X4YA 5CN2A 1BIIB 4EN3C 4JDTL 3L3KA 5F1SA 4L3ED 3DRTB 4K23H 4F8OA 1HH6B 3SEPA 1RKRA 2CCVA 4JNXA 4MA1C 1KCBA 4HP5A 3SPCA 2N3JA 5DEGB 3MLSL 4LRIA 4AK1A 4B9YA 3BSGA 4XBEH 2QR0A 5B7FA 2NUPB 4LNRB 3C09C 4PRNA 4G82A 3AW5A 3FCGA 2EH7L 3FRPA 3FH7A 3KLAB 3MXVH 3ZKND 4ADJA 1BHGA 1B88A 5MENE 1JGVL 1JIBA 1MNUH 3QDGE 4WWKD 3G6JB 3V4PL 4P5TC 1JYNA 1U58B 1IGCL 1QQDB 3HZYB 3SBQA 1N8ZB 1FZOA 2ZOLA 3BH4A 5EIIA 5I1HH 2FEJA 1Z5YD 4Q6KA 5IW6B 5BS0D 3MPCA 4ZX5A 1F2XK 1AQKL 3S8FB 5EUOB 1CFSA 1MFVA 2DM2A 1E8ZA 1KJ2A 3GM0A 4U1GC 4NQDE 2GY7B 5DSCA 2ZF9A 3N1GC 3ASNB 5L4FA 4XN8A 1NGZA 2HRLA 2IMMA 3M6DA 1FFOA 4H13C 5HD8D 3RL1A 4K8RD 5D7LB 4B0MM 2B1HH 2P80A 4EKXA 1G9NL 2QFPA 3HNTH 1AR1D 3MBXL 4AXWB 3O0LA 4FZEH 2CAKA 2AI0L 2QJDA 3L4YA 3LZFH 3UTPD 1HX0A 4MMXC 3P4NA 3HN5A 2V17L 5DFAA 1M71B 1VACA 1TUPA 3BC9A 2NW3B 1JUFA 5IHLB 2TAAA 5B1CA 2X70B 5AD0A 3MFFB 2A6DA 1XCXA 3ELQA 3O81A 1U3HA 1I7TB 1DVZA 2ATPA 2VDRL 4P99A 2X9YA 4HPYL 3IDMA 4XCNB 4YUEL 2AAVA 4XVJL 2Z35A 4FFYL 1MW2A 1MNNA 4KKQA 3ZDZE 2Y1AA 5JR1H 4Z7VB 3K81A 1L0YA 3JWOL 1MN4A 5I5MA 2BVOB 3NIFF 1WZ1H 3MOAL 2KZBA 4BCYA 4GSUA 3QGVA 2FYYA 3DSFH 1UH2A 1OWRM 1FNEA 5TK2A 2VH5H 2XN9D 4PJEE 4XCCL 2F5AH 1Y7VA 2N59A 3LQMA 4FF9A 3WHE0 3MRIA 4OZGE 5DQ9B 1XGPB 4WU5B 1XIWC 3QDJE 2W65B 4ZMOA 1NWOA 3V0HA 2RACA 1T7WA 1AYRA 1F1DA 5E6IB 3H2WA 1QI5A 4R4ND 4R7DA 4X99A 3ZK0A 2G3MA 1UM6H 1EJOH 2EIEA 2HWZH 2LFGA 1EHNA 4OCMC 4ZMAT 4ZDHA 4L9LB 2DQGL 3CQFA 3T4AA 4C56B 3QO0A 1MJJB 4Z23A 2X10A 2CNYA 4RLDA 3HC2A 2VUOA 2GCYB 4R5TA 2IAMA 5I0XA 2NY1B 4HUWA 6FABL 4XPHL 3SE4A 3C5ZD 3WFZA 1BVNP 2O61B 2X4TB 1QSVA 1ZV2A 3FAXA 2FX9L 4Y2DC 1T5XB 1LDSA 3PWLA 2LU7A 1JGUH 3KBPA 3L5WB 3QK0A 1N6VA 5MEPB 3DRTA 1HEZA 3IGAB 5JLZB 2GVYA 2ICEA 4UT7L 5CZXC 1IKNA 2WV3A 4GRWB 5F0LB 4U1IA 1WAEA 2B59A 3LPPA 2GAZB 1LK3H 3QJTB 5KG9B 2F15A 1RZKC 3VM5A 5CD3A 4XPGH 3B5TA 3TA4D 2JXMB 4G8FB 5EZJA 2NDGA 5HYSG 4GMSH 4LFHG 4OFDA 5F9DC 3HG5A 5A2JH 1KYUA 1OGPA 1S5HB 5F9WB 3BHBA 4B60A 4FLHA 1GZHC 2VL4A 1WH0A 5IMMA 1P9MA 3QDAA 3SY0B 3IDGA 4F7PA 2GSGB 5JPMB 3F7RA 1TYJA 2BNRB 4AV4A 1RZ8B 3MBEB 4WIQA 2ZX9A 3DV6A 5LN8A 3MV8B 2P52A 3G5YB 2GBTA 2FBJL 4TNEA 5AOIA 5JOFB 4MNQD 2VZ3A 1SLXA 2D31A 4BFFA 2M83A 1RU9L 2R1YA 3VQ1C 3CDCA 2A6JA 3CDZB 1S46A 4TSBH 3UZQA 1M7UA 5B39A 2YXFA 4IMKA 3ZDYE 3D0VA 3JWNH 3MV8A 1E2WA 4HX1B 3LMJL 1FZKB 1MRDL 3HC3L 4ORGB 4HHAA 3VX1A 1U6AH 3OMIB 4R26L 4QOKB 1JG9A 2VC2B 1I4FB 2DKSA 1V05A 3ZE1B 1V10A 4W6XB 2Z34A 4GP4B 4XOEA 4YFDB 2WXFA 1MCBA 3BAJA 5DZNA 3VQLA 1MW1A 1CICA 1QOKA 3VWJD 4RRPG 3L4ZA 1O6SB 4AIZA 4XNXH 3VGFA 3IBOA 3O8XB 2VXQA 2NZIA 1D9KD 5SX5H 4KI1A 2GBAA 1JV2B 1BBJB 2EJ1A 3UYPA 1TZIA 3KHQA 1T5XA 1TCMA 3ULSA 4X98B 3RWJA 5J12B 1KULA 4X4KA 2FX8L 3APNA 5I30H 1PDKB 5HJ3B 5C7XH 2EYTA 2OQJB 4HK0B 5F70A 1CJYA 1QI4A 3EOAB 3P9WB 3F7QA 5C8JA 3T0WA 2H2SC 4NEHB 5D1QD 5F7DB 4M4PA 5EF0A 3KYKL 4DKAA 5DTFB 4MNGA 4URTB 3QS2A 5TGBB 1I9EA 4L5FE 5GRWA 1ZLVH 1HWHB 2ZCKH 5DEJA 1I8IA 4KKPA 3MUY1 3BDYH 1EZUA 3DX1A 3V9CA 3CN4A 4M93C 4JRXA 2X2JA 3X14B 4P4RB 4F2MB 3EAKA 4I77L 3NFPB 4KH9A 4PY8J 3VFPA 5DD1L 2OXGB 4RWYH 5E4EB 2F7IA 3G5WA 4L4TE 2FECL 3KWXA 4ONGH 3NZ8B 5E7FA 1D6EA 4DPAX 3VTAA 4KRMB 1LEGA 1XVSA 3TGXA 3CZNA 5E7BA 4JCLA 4APQC 2VN4A 2UXGA 1UCBL 4RAVA 3QHFL 4HETA 4X8JA 1KGJA 5JQHC 3LH8A 2N1KA 3VFGH 5BCAA 4QTHA 2ZXAA 3LEVL 1UACH 2DDQH 3OTTA 3GXNA 1A4BA 1PKQB 5LBGA 4P57B 1L5GA 1JZDC 1EXUB 1TCRA 4W9GC 5BZXA 2APVA 1B0IA 4N68A 5IHUH 4Q9BA 5JW4R 1NEZB 1YMHA 2D3LA 4QYOB 4L8DA 3CD4A 4JVUA 1CYWA 1HHHB 4NO2A 1ZLUK 4N2OA 1IB5A 4OKVB 2HFFA 1EERB 1GY2A 1WEJL 2ZNXA 4LDOB 4PVNA 3NFNB 4PGJA 3IKCB 5CD5C 4GXFA 1D5IH 3UTQB 4X4YB 3GUFA 4GFXA 5AYTA 5DJZB 4OZGB 3FT2A 3L3OB 3LIZL 2EDYA 2OMVA 3QZMA 2XU9A 4XHJD 5I1LA 1UQSB 3FYIB 2OZNA 3GS0A 4Z0XA 3S4SB 3O6FB 4JFPB 5LXGH 1P6AB 3D18A 4K7PH 3S35H 4HZ1A 1BWWA 4O9HH 5ESQB 5HDRA 2XDHA 1T22A 2AK1H 3OF6D 1OSYA 1PLAA 5FWQA 3T0XA 1EMTH 1GGYA 2UVEA 5SWSA 4OZFB 5B8CA 3FU6A 4JPSA 2WKGA 2ZYRA 2Q76B 4LPXA 3VSUA 1RH8A 3QJSB 4P4KC 2FL5B 2WWOA 1WBXB 4IBLT 1WAAE 1QFUL 3Q8AA 3PWJA 2YPVA 5K93A 1I1FA 4IOSA 1NCIA 1RMFH 3BP4B 3WKMH 4H8PA 1FNSL 3RUGB 5KW9H 4JVWA 4AITA 2OMUB 5I17B 3OMZA 4A6YA 3CFCH 3RJDA 3HE7A 2PW2A 1SEQH 3BVXA 2WSDA 3L7FA 5DVNA 3B2DC 3MZTA 2QHRL 1M05B 5E00B 3FTSA 5JOPD 3BX7C 2B2XH 3MGOB 4YZWA 3TP4A 1KXQA 1SZNA 1CE1H 3L4VA 5EPMB 4Y19A 4Z7OB 3FQRB 3U83A 3L3HA 3BH9A 3JZ7A 1KFAL 2BHFA 2K6YA 1I3GL 2ZYIA 4HKZB 1MRFH 4A63A 4PWJA 2NSXA 2ZSWA 5FYLL 3GTTA 3TYFB 4KBPA 4HYTB 5C86A 1SQ2N 1AFVH 3C5JA 4FQLH 5BOZG 2R1WA 3US0A 2O5XL 5FO9A 2DS4A 4Q56A 1EANA 3WXWH 1JGDB 1HILA 4JN1L 4XXDA 3ETTA 4I9XA 5GSRA 3HAEB 1HHJB 2F53B 1A7RL 1B3IA 2H1LM 2HFGL 2JKJA 5G2NA 1M3IA 5EULV 2AJSL 4I0PA 4J28A 2IMNA 3H85A 3S3DB 3LZLA 3WJMA 1MHEA 2I07A 1FVDB 3BEVB 2ADFH 1KG0B 1EHKB 1NJ9B 4WI0B 3ZDYF 5E2TH 1RZKH 4AQAA 1FIGH 2ZAGA 1YEIL 5IJVA 4I4WA 3CU7A 5CLTA 4XWOC 4FHJA 4NZTL 2XWBA 3ECWA 4L3EA 3CZFB 2EIDA 1QYGL 3L5WA 4BFBD 1SBSH 3D9AL 4ENZA 3KNBA 1MFAH 4FQJL 1W9XA 3BEWB 1WIPA 3BVTA 3EG9A 3ZE1E 5HYJE 3QUML 1SOKA 2VN7A 4WSGA 4R7LA 1QPPA 1KOAA 2NX5B 4TYUA 1U3HD 1DVFC 3IB4A 1SXNA 5I5JA 2I5YH 3RGVB 2QKIA 3OSKA 2EIBA 1KIQA 5ICYA 1F4YH 5GGRY 2E46A 5C2BL 4PJEB 2FVNA 3BWAA 4H88L 1XGQB 1CL7I 1DQKA 2WOYA 2JJUA 5EIQA 4R8WH 3GKZA 3WY1A 1JZ4A 5IHZA 4KMLB 1COBA 4IMKC 1AGCB 3LS5H 2OL3H 2QV2A 4XXWC 5LBSH 2QQLH 2X28A 4OBRA 2V7NB 4PJDF 4D0DB 2ICWA 1L6PA 3QI9B 5DQ9A 4U1NB 1K5NB 3OHXB 5E9DA 2CUIA 2KERA 3LEYH 3QI9D 4XN2A 4Z6AT 1GXEA 1J05B 3FTWA 1NKOA 3BUIA 3MRKB 4UANA 4A7TA 4MQXD 4WU7B 4PTTA 5D7IE 5IB3B 1QKZL 2Z31D 4HUMB 3QS3A 1A6PA 3PUCA 4PRIE 3N44B 3SGEH 2VN3A 3NJNA 4HIPA 3UCQA 3SKMB 1U8OB 3QUGA 5FGBC 5GS0H 4EDWL 4ALAL 2XN0A 2QQQA 4KNSA 2VDLH 2X4RB 2CU9A 4J4PC 4UB0L 3X2QB 3H55A 4MCZA 2R4SH 1OGAD 4NM8H 3VFWA 1FLTX 2DLEA 5TDOB 1HHJA 5GRYA 4WWID 1RIHL 3MRBB 2VDNL 4L4VB 4Y16A 2ADGB 3BGAA 3QJUB 1A4KB 5HPMB 4DVBA 4L8BB 1HOCB 2C4XA 3Q2WA 4ZFOA 1M71A 3T4YA 4OF8A 1AGFA 2VLJA 3BAXA 2G2RA 1RZGB 3VI3A 3HHRB 4G8EB 1MFBH 3L5HA 1BBJA 1JV2A 3MJ9L 1TEYA 4JKNA 3UYPB 5CGMA 3EYQD 1ZDQA 2V7HA 5B3NA 2AJUH 4X42A 2HLFC 4DN3H 5D72L 3JTTA 4X6CB 1A7QH 3ECQA 3NSDA 1L3NA 4IBQA 3BEWA 1AGDB 5TK4A 2ZXQA 1K8IB 5LGJB 3FNKA 3B1UA 2K9FB 5GZOC 4XVUD 4GKZA 4IEFA 2HX9A 5E6RB 3VWKB 3W56A 3UG3A 2PXYA 4Y89A 2DWEB 1IBYA 4MNGB 2UY6A 1MCEA 1T2JA 4WTWA 5TGBA 4KFMA 4DO5A 2DWXA 1CLYH 3HB3C 3WO4C 3ABLB 2O6FA 3EHBD 4LL1A 4F7KA 3UJTH 4N5EC 3O9WB 4OQ1A 2CO6A 3MYZA 4TNWF 2DKUA 1VADB 2VLKB 1J5DA 3TBBA 3EO0B 5LDSA 4QWWD 1QSEB 3P2BA 1Q0YL 3PS6A 1UZ6F 4NO0B 1BAFL 5HI3C 1J87A 1G5GA 3BGFC 3KYOA 4G11A 4JY4A 3SGDH 3K6SA 1I82A 4OGAD 2JI2A 1GA2A 3CFBB 5INCB 1MWAB 5E2UH 4I48A 4MAUH 5KVGH 5EN3A 1IMHC 4ABQA 3ZDXB 1QR4A 3GLZA 2K6WA 4JFTA 5DRXA 2X0WA 1IQWH 2QSVA 1WFJA 4GRLA 3S3BB 5DHEA 4K5LA 2X3AA 4Z7UB 3LIUA 5I1DB 1WFNA 2XY2A 5T8IA 4IRJB 2GJZB 3UG4A 4YSAA 1HKFA 1NGYA 1QHPA 4AKPA 4ZTOL 3W37A 4XBGB 3F83A 4KNUA 5L2JB 4V1DD 4KROC 5HGAB 4L1LA 3UTSA 2W9DL 4CN6A 4AQZA 2WZPD 5HJGA 3C08L 3TNNB 3HS0B 5IEKA 3OB0H 5HGGS 3CK0H 2YPVL 4ZD3H 4MXQC 1LP9B 1NEPA 1M9SA 5ISZD 3A3YB 2B9AA 4WJ5B 3EO0A 3GUTB 3DV6B 5IFJA 2BHUA 3PWUB 5IKCA 5B38B 1CFVH 1KZYA 3RX8A 3PJSA 5I66B 2PTVA 5BUPA 5HI4D 2EEFA 2JK5A 3QEQA 4XCFH 3GJFH 2W38A 4MLIA 3TBYB 3U36A 3Q48A 4B50A 3BSHA 4HW6A 1F4HA 4R7DB 3RJQB 5IHWA 4JRXB 1E5BA 3GBEA 1SFHA 2CR6A 4AQ1C 1CZ8H 5I8KL 1F42A 4ZUWB 5IMLA 5T1MB 1AS8A 4NC2B 4EPSA 4L0YA 2DBJA 2EDWA 1TZHB 4RMQA 1XH2A 1OAJA 1E28B 2O5ZL 4XB3A 3LDBB 3BE1H 3GSWA 5LDUA 4ODTH 5T33L 1UM5L 1JZ5A 2CDFA 2HA1A 5F1NA 4YDKH 2PW1A 1KT2B 2KPNA 2IADB 2MHAB 4PUBL 1GGBL 5T1DL 1E2VA 5HGDB 2Z7WA 1M1XA 4P46C 4EOWH 3VD0A 1S7VB 3P11L 1XF3B 1W8OA 1KN2H 5AAWA 2FAUA 4LSUL 3FU8A 5D1XA 3VXTB 2OR9L 2JCCE 4EXKA 1Z9SA 12E8H 3PJNA 3SDYH 4KI5E 3KPNB 5KUMA 2ZSVA 1BD2E 4LLVA 1FWXA 3VGHA 3GK8L 5IOPA 3Q6FB 1VPOH 1MVYA 3O3AA 1SXAA 3GBLA 4TLUA 2YD8A 4MXWH 5HDBB 1Z0MA 1J8RA 1GVIA 4P06A 3CFEA 3B4NA 1JFHA 5DC4B 3KH3A 1T2XA 1P1VA 2OV0A 1WAAA 4N1CA 4Y4HA 3QPKA 2E7DA 1HQ4B 2Y22A 4R90L 2R2HB 3RNKB 3SE6A 4EUPH 1IAOA 2P49B 1CF1A 1NPJA 3LKPA 3R06A 1N8ZA 2HXAA 2P46B 3IBEA 5F0JB 5HHNB 3EH4B 3ILPB 4JZOB 3FQ4A 2VR3A 1EXGA 1ZHLB 4ACTA 4OGYH 4ZMNA 2BIOA 3BPCB 3N06B 5HGHA 3NJGA 4ENED 3WNOA 1MQKL 2DQDH 3K2KA 4PVBA 3KG5A 1WWCA 4QRSA 2OSLB 1QA9A 1U95B 3M8OL 1BGXH 1ORSB 2F08A 4GSDL 4NDMA 5FA3A 1YMMB 1JJUA 1Q94A 2VC2L 3S2CA 3B2VL 4GRMA 4JFYB 4KMTL 1WTLA 4DCQB 4QYAA 1NBVH 1ZA6B 5DC0A 3PE9A 3UC0H 2DM4A 4ZAKA 5J5EA 1FCGA 5E08L 1FZMA 3EYSL 1RUKL 3CSYB 1HS6A 3MX0B 1DJGA 5T3XD 4QAWA 1XSJA 4ONHB 4Y7MA 3SDDA 3I75B 1Q9OA 2X9ZA 3Q1EA 5E8DH 1GAFL 4YE4H 4PRBA 3H1ZA 1E9OA 3IDUA 3MR9A 2HT3C 4J3UA 4LPWA 3U4BL 3FHAA 3TPUB 1IBHA 3IJSB 3AS1A 2NY2B 5LNEA 1WSST 5BQ7B 1NGPH 1KB5H 4XVSH 2MMXA 2P5WB 1I8MB 2A6IA 3TT3H 2YZ1A 2V37A 4BFKA 4PREB 3W81A 3DWTA 1OD9A 3NZSA 4HLZH 4OUUB 5CLXA 4J6IA 2OYPA 3RWIB 5ADPH 2HJKB 4KVNH 2KQMA 4KQ3L 1JTOA 3MSPA 3NBNA 4MB4A 3G5VB 1TTUA 3SY6A 4PTUB 4MNQE 3S36X 3HUJF 3CX5J 3W82A 3SGEI 2X44D 3CZJA 4HLZG 3T0EC 1ZANH 4QXTA 4Y4HB 5J06A 3TN0D 4F7PB 1TFPA 3L08A 3KEDA 1VJSA 1E4XI 2X2UA 3UJIH 3MA9L 4EZJA 4DCQA 3T1WA 4N1EA 2NY4B 1HL4A 4L2YA 1OIOA 3DHJA 1AHKA 1GGUA 3TYGH 6PAZA 4ZNEE 2GIXA 1XGTB 1J5HA 1YEHL 1BQHB 5KTEH 2C9QA 4HAKA 3D2UA 1QEXA 3A67H 4K3JH 5HGHB 4PGDA 1HEZB 5JLZA 3MRQB 4TLSA 4LEXL 1DBKH 1FFPA 1RJZA 2ATPB 5DK0A 5EBMB 1ZMYA 4OM1L 2E7CA 1UM4L 3TTYA 3ZE2F 1NDMA 2DJMA 3WKQA 3EJZD 4AYGA 2ESVE 3OPUA 1OY3B 2HFTA 4WHYG 4XCYA 3ASOB 4K2UL 3RL2A 5T5FL 3S8WA 3JV6B 2GUYA 4E5XB 2CLZA 4ZMTA 2XBTA 3QUKA 3MNWB 4XO3A 2V8MA 4YZFF 4RDQF 1WFUA 3BD5A 3UC2A 3TBVA 5HYFA 4HJ0D 5DHYB 1YEDB 3VDCA 3BT2L 4GQZA 5C1MB 4XGZA 1FZJB 1ZT7A 2BVQA 5EUKA 5IMLB 2X3CA 4A6YL 4AWJC 3ZLQC 2E7BA 2HUHA 2UX7A 5E5UB 1KELH 5J6SA 3SYPA 32C2B 3EFDH 1UWGH 1EHLH 3NACL 1BAWA 3NESA 3HEIB 5D5MF 2R0ZH 1KJVB 2XTJE 4KUCF 2DQEH 2DBLH 2YGOA 1MFEH 4OZHA 3MUUA 4UDUA 2HH0L 3QZOA 3W38A 2Q86B 3NJXA 4A7GA 1I8KA 1Z0NA 5D1QC 2Y07H 2WC7A 4NKOA 4FNUA 2F19H 1JXGA 4GI8A 1TDQA 1IGJA 3LIZA 4MYWB 4MNGE 4YDIH 4Z5RB 2ENYA 1MJUH 1IM9D 1QBML 1IC5H 3UAEA 4AMKL 1SJHB 1SJEB 3EJUA 1AHMA 1IKFL 3ARBA 5AW5B 3ME0A 3NSCA 2BWDA 1E6OL 4PP2A 4DZBA 2A77L 1NDGB 3L7EA 4ABUA 4XH2B 3MROB 4HGWB 1YPZE 1MH5A 4DW2H 3B9KC 4KKCD 4XMLH 1T4KA 1JNHB 2WP3T 4WI4A 4N25A 5ID0A 1CK0L 5I8EA 2Y0SA 1RD6A 5AL8A 5E23A 1I1YB 1YO4A 5K9JL 5DJAB 1HK6A 1A6ZA 3K0WA 3GLAA 1R6VA 1XIWA 2A0LC 5L9DH 1ZK9A 4AX3A 4W93A 1ZPUA 4NN7C 1RUAL 2WANA 2OPCA 4TQ8A 1QSFA 4AZ8A 3V4PB 1X5GA 1VGEH 1T83A 2XWCA 4JQXC 1BG9A 2ZCHH 1CD9B 3VTTA 5FPIA 4Z7QE 1NGQH 2B4CL 3CFJB 3TJPA 2A3TA 2XWJB 2EAEA 1YJDH 2WZPA 2ORBH 1MLCB 3GEWB 1SNRA 2KT6A 5CUSH 2VRAA 4OCRL 2LQRA 5FV1L 3OWRA 3MCLL 5E1HB 4Z77A 3GBML 3ZDXF 2V3EA 1V3MA 5J13C 1FNHA 5J9PA 4GKNB 4YC2C 2PETA 2Z93A 4X6CA 1JPSH 1WZAA 3QZNA 4PS4H 5K39B 5E94A 4JFDE 15C8H 1BFOA 4FDWA 1HHKB 1R24A 4DOHB 1KEGL 3RDTC 2JCWA 2AVFA 2JKNA 2VLJE 1FV1B 4AIXA 5GISH 1SYVB 2F0CA 4XNMA 5SWZB 2DQMA 4HWZB 5EEYA 4PJBE 3UYRL 3OR6B 5E5MB 1LD9B 2NY0C 2DI8A 1AGFB 3QARA 2Y1ZA 5FF6B 1A7OL 4B9IA 1BXAA 4IS6B 5BMFL 2L4OA 2HN7A 2OMTB 3D25A 4NZ8A 3O9WA 1H6FA 1MF2H 1KGXA 2MFNA 1KBVA 5EMYA 1GGCL 4RRPM 3U0PB 1XGYL 2GSGA 3L54A 3T2NL 3FOMA 2CM5A 3AM8C 1T4KB 2YLKA 1TZGH 4MHHI 4H1LB 2EDOA 3UBXG 1U4EA 1C12B 43CAB 1AGDA 2BNQD 1YY9C 4EI5B 4GW5B 1T1XB 2DIJA 3MRLA 4BHUA 3CE1A 5DJ2A 5E8EA 5L6YH 3LZNA 2AKRB 3ES6A 5E4IA 5C09D 4P9HH 1MCJA 4YVNA 3DO7A 1KPRA 2NTSP 3UAJD 2IQAB 2OJZL 1IGML 4QTFA 1PX8A 1UA3A 1KTJA 2FDBP 3GMOA 3H42L 1S7SA 3CHRA 1S7TB 3OGCA 3WHXB 1AQHA 2GITA 1T66C 2BIQA 4HJGA 5GQBA 1WA1X 4PRHE 5JHDD 3NSYA 1P5VA 1J5OH 2X4SB 1JDCA 4J3OF 2CJTA 2PPFA 5E56A 3S6CA 3CX5K 1K2DB 1ZKAA 3IFLL 3IMTA 4OIBA 5T1KB 5CN3A 3NN8B 4XP1H 1W72A 1TVBA 4DQOL 3S3PA 3EH2A 5D1ZC 5DRZB 1A4CA 1QSFE 2YOAA 4TUJA 2DI9A 3H0TB 2VQTA 2ZWSA 5F71A 3V4UL 5D1XC 3BISA 4IHBA 4OVVA 4A7VA 5IGXL 3S5YA 4PJIE 4E68A 1TEGA 4U1KA 4PRHA 4R5XA 1KYOK 2CKBL 3QQ4A 1PLCA 1C12A 1DTUA 4EKJA 3ZE0E 5I1JH 1BQLL 1YEDA 3WKPA 2EICA 3OHXA 1ZPLA 1ZWIA 3LZRA 5GRJH 2W9EH 3BD4A 1XF3A 4JQIA 3W9DB 1MIMH 4AGNA 4LCYB 3ZVVA 4N0YH 4U1GB 2HN7B 2OMTA 3QVAA 4WQOA 5IW1B 3ZOAA 4Z3JA 3FO9B 4NKQB 3U9UB 2H2PC 1Q72H 1E5CA 3C6LB 1I7TA 4R7NA 1BZDA 1S7QB 2A83B 1S9VB 4GQRA 2R0LL 1J0HA 2ZG3A 3FSOA 4NQDD 2ODHA 1NLDH 3U9WA 4NO3A 4GG6A 4X6DE 5TQ2L 2R29L 2IFFL 3B9VA 2Y1YA 1DFBL 1JPST 3CSPA 2NNRA 1KJ2H 3FS9A 3EFFA 2RH0A 5BUAA 2F2HA 2JSFA 3FN3A 3GMRB 3WN5A 5D7LA 3S37H 2DQHH 3RJOA 2FO1A 3ZKNC 4DGYH 4BCXA 4HWUA 3ZDYB 3VTMA 1NIFA 4JDVB 3D09A 2BJML 3MGOA 3X3FH 4JW3A 3NCMA 3D0VB 5FFLA 3H3BC 3AREA 4CSZA 4HC1H 5EIIB 5AFAA 4E9XA 3LHPL 5TTRA 1M9WA 4JQVA 3ISWA 4ECNA 5AL0A 3DARA 1JYWA 4LRIC 2XACC 3IGFA 1R0AH 5F7EL 4BWWA 3TJEL 3GS7A 1X3DA 1U8PB 4LVOC 4QHPA 2EO1A 5AW6B 4RWHA 1WISA 1C5CL 4XBGA 3DURA 5JPMA 3UCRA 4POZD 3Q8EA 5E99H 5HDLA 3SKOB 3UBHA 4Q0XH 1G6RB 2FSEA 4NO5B 1MHCA 4EIUA 3IFOA 4JPVH 2AEPL 2VDOL 4W9KC 3D18B 4YWGL 2J73A 4CU8A 3G9VA 3ALPA 4N0UE 4LASL 4TMPA 4ZX6A 5C0DB 2EYSA 4WFEE 4WUUD 4ETQB 3QEUA 2QVIA 4LCYA 3ULUE 2VIRB 1AY1H 3T2LA 1U4FA 3CWGA 4XC3H 1U8LA 5IV2A 5CLWA 2WMPB 2FT7A 4HH9A 4NCDA 2GSIB 3PAUA 1WAPA 2X1PA 4MRBA 4GRMB 3ULUF 1OGTA 1FA4A 2PWEA 4F7EA 1T89C 4HS6A 4NBXB 1KYAA 1XL6A 4OJEH 5EA0L 1E4WH 5DS2A 1J9CT 3UPCA 3IK2A 3POCA 3BIKB 3B9KA 4DP9X 1YEKH 1U8HB 1N5YL 4F1ZA 3RTQA 2EE3A 4I85A 4K5OA 1A3RH 5E8PA 1A8ZA 2V6HA 3AG4B 4HXAH 3L45A 4HVBA 2EVIA 5J1AA 1MCOH 2GT9B 1RIVL 2BSEA 1VZIA 2ZUTA 5GS0D 4JUTA 1UKTA 2GEEA 4TV3A 2WVSA 4UWQB 1JRHI 3BP5A 4JO3H 2H6UA 4OH2A 4XC1H 5LGHH 2XZAL 2WVVA 1BPLB 4AGOA 1WWAX 1ID2A 3EGXB 3T6ZA 4KJPD 5HYSB 3X11A 4PRPD 5AAMC 3GKWL 4FJYA 1ZLDA 1IM3A 1YNKL 4JDEA 3B9EA 5ICXB 4ZO7A 4UV7L 4G8EA 2J2ZB 2OSXA 2E6PA 2A9AA 2X87A 4XOBA 2DICA 4M9PA 1TLKA 2CIIA 4BV1A 3AY4C 4P0DA 3FT4B 3QIUC 1FRGH 5EWIL 3GM8A 1FVCA 4MKTA 1Y0LB 4WCYL 3M1BA 4F5CA 1T04B 4NUJA 3U6XA 5ACZB 4L8CA 2VLME 4XCYB 1MCIA 5BS0E 1G7QB 1RK1B 2X88A 1FNLA 2YN5A 1EO5A 1GY1A 2BS71 1OGAA 1A65A 3U0PA 4GH7B 2VWEC 5ANMB 5FOBB 3RTQB 5KVMC 3OXRA 3FZUD 5TFSL 1MKFA 4WI5A 3EOAA 1QI3A 3FTVA 4YLCA 2OMZA 2WOBA 3X1FA 1NIEA 3MV7D 4P3DB 3ETSA 1TQVA 2I24N 3R0MA 4HA1A 4IRZA 5EO9B 1A6TB 1A9EB 1ZXKA 2XQYG 2OYMA 2Z31C 5FX3A 3SODB 4U1HA 5B8CC 3UTZB 4UU9B 2Z4TA 2HT2C 2CRZA 3DLQR 3L9BA 4YO0A 1HZHH 4EEEA 4JKLA 1PCSA 3L4WA 1HKLH 3PHAA 4M1CC 4QHNA 2E8YA 4NENB 3WD5H 1CBVH 5F6IB 3QQDB 1CGYA 3H9HA 4MASA 5IQ7L 2WVVB 2LFEA 2GQHA 2XHNA 4UTBL 4PWHA 2Y5TA 2BDNL 3X12A 4YGVA 5CBEA 3O2DA 1ZT1B 4K73A 1H3UA 4F33B 2AITA 1LILA 4PJ8B 2MSPA 3TU6A 1JYXA 4N8CL 3AAZA 4L29A 2Y3NA 3NZHH 4X7TA 1M7DA 4QOKD 1CF8H 5PAZA 2VSCA 2VDPL 5JHLH 3E1ZA 4M8UA 3HBPA 3ZMEA 5LUMA 1FHGA 1F6FB 1X7QB 4LSRL 4TQPA 3WNNA 1RY7B 4C59B 2CNZA 4OT1H 3IGLA 4J2XA 3Q5TA 4NC0B 4DGVL 4J23A 5EN2B 4CC4A 3RDTB 5IWLA 4HOZA 2BCKA 4FG0A 1VKXA 3F7KA 5JOFA 1FVEB 3H3PL 1H3PH 3VI3F 1Z2KA 1XIWD 3OR7B 3V5DA 2DWDA 4DAGH 1AHWB 1T1WA 1P5UC 5CU9A 3SJVB 3LNDA 3RIAF 4APQA 3O3EB 4F2FA 1PZAA 4M1DH 1JERA 3FSWA 3WFDL 5KS9F 5DK2A 4GXVL 4JANA 4PWFA 1ZE3H 4X7EC 3IEAA 3EHBC 3NAAH 5AKRA 2AMGA 4JFYA 2HLAB 3JT0A 4R97B 1IJNA 2BPBA 2O6EA 2Y23A 3JV0A 4XWOD 5I6XB 4NQEB 1D5XA 4CBPA 1I7ZA 2NY2D 1YY9D 5T1JA 1HXYA 3QPXH 2ICWI 1ET7A 2OFQA 2PYFA 4P2QD 4WUKL 4K0OA 5HYEA 1TU2B 4KRNA 4FFZL 1U8NA 1CU4H 5IB5A 2PYEB 1IAKB 3V4VB 1F6LL 4M7JH 4YHML 5LVEA 4HKXB 5TQ0H 2EDRA 3VI4E 1K8DA 5HYJB 3N50A 5TE4L 2MTAA 4J1UA 4E42B 4FG4A 2W07A 3TA3A 4K7PX 4WI6A 4H8UA 5DURD 4G7RB 4ZS7L 5I0VA 3EDJA 3L3IB 3LY6A 4X7DC 2BW5A 4PJHE 2IBBA 3L7FB 2RQ8A 4JFOB 5CBEB 4PV1C 5CCKH 2D9QB 2YUWA 3PWPA 3AROA 3QR0A 2MQGA 3PREA 2ADJA 2XA8H 3BO8A 1SF5A 1VDGA 3VXUE 1QFWH 2C7FA 2JE8A 2WTRA 1A7BA 2W65A 1GW6A 3OHXC 3NIGB 3R18A 3BKYH 5SV3A 2IWGA 2X2IA 3SE8H 4G6ML 4E41E 3MV7B 1I7UB 5F88B 1YN6A 4J4PD 5K9KB 3GTNA 5ESAB 3QCTL 2FB4H 5CINL 1INEL 3I2CL 3H9SA 2PWHA 1TQCC 4ZFOB 3B9DA 4MDRA 1ADWA 4PRIB 1F86A 2VXTL 3O41A 2ZUXA 3OKEA 2IAMB 4TVPE 1JMXA 2OI9C 4PM1A 4JO1L 3UTQA 5EG6C 2X4OB 3D0LA 4G42A 4FXGB 4TL4A 1DVQA 2BRRL 3P73B 3UBXA 5DHXB 5FECA 3RPBA 5DHVB 2WPGA 3V6OA 4JB9L 3TWYA 1TJMA 43C9B 3MRGA 3BGMB 1YPZF 5E6IA 3JWNE 4Y88A 4NZRH 4AGMA 4W9HC 3H56A 1BJMA 5EU7E 5LGKA 2JKRM 3FN0L 1IU1A 2WXQA 4EI6A 2AV1B 3Q6GL 1W91A 2IXQA 4XP4H 2CXKA 2XI9A 3QCVL 2WVUA 2ZUWA 4O58L 4PJXF 5JW5B 4D0DA 3ZMRA 4U0RC 4ZNCD 3UAFA 4G1EB 1MVUB 1G94A 2X2YA 3MYJA 1FO0B 1C16B 2B39A 2H26A 3BVWA 4NNYA 4WWKB 3C8HA 2Z91B 3K71B 5KAQG 3F12A 1QRNE 1K8DB 35C8L 4YK4B 5DFVD 2VDQB 3CLFL 5BQDA 5C09B 5A1AA 1MJ7H 5BS0B 3P3YA 3BKML 1A3ZA 1V3JA 3OAZK 3QUYA 2J1ZA 1DBMH 2J7LA 3ARXA 3IDNA 2AANA 2HKHL 3LN5A 4EZMA 4JRXD 3COOA 3VSTA 1KGUA 2WKOA 4O02L 2VMCA 3ARBC 4IDLA 3EO9L 4WNSA 4OGXH 2W8CA 4M7LL 4NO0D 3HOGA 3QJZA 3VI3E 43CAA 1E9PA 5A7EA 4XN5A 5I1DA 5CN1A 3O6ML 5HHPB 5DTFA 5JDJA 3S36H 1L9TA 1PKQE 1KY6A 3CSTA 4BGLA 3IETA 1MG3C 4BK4A 3ZTCC 2BSRA 2V33A 1JNLH 4PSRA 4ANUA 4NNPH 4BXSV 4DKFL 2Q7YA 3NCJH 1LD9A 2BP5M 4PJ7A 3LXUX 1A4AA 1RLBA 5ERWB 4OM0L 2MPVA 4G43A 1QLRA 5F8QC 5CAYB 5IB2A 3LX9A 5EO1B 4KXCA 2O5YL 1ORSA 2D0FA 1D9KA 3KJ4C 4HMEA 3I50L 4PJGE 4JO8A 5TDPB 3HMWH 3MXWH 4TUUA 3SOBH 5I1GH 5I0WA 2Z93B 1XZ0B 3B7TA 4GO8A 4DPCX 1BMZA 5K9QI 4KXAA 3TN0A 1USZA 1INQA 3QFJB 1A64A 1BZQK 2Z0BA 3RB5A 3WKNA 5JYMA 1OCWL 4NGHL 1ZT1A 4KV5F 4QHLB 5I82A 3CVBA 3TVMA 3RI5F 2VDOB 3FFDA 1EWHA 4Z95H 3RU8L 4X5QA 1G0XA 1UWXH 3QNXA 4JPKL 2YQGA 5H35A 4HIIA 3E6FB 3HI1A 4JJHA 4S1QL 5GS2D 3W39A 4DF9A 1IBDA 1B4JL 4LOFA 1QASA 1TJGH 1UENA 1B0GA 2EYRB 1KB5B 4DVRH 1FYHB 3PP4H 2EIZB 2IH3A 2XQ0A 4ZOEA 2F58H 1RZJC 4X83A 4JHWH 3SKNB 4CA4A 1K4DB 3P69A 4BYHA 5D4IA 4ZW7A 1SMOA 3T4YB 4XN9A 5E2WH 2A74B 4N0FB 3MO1A 1DJZA 5AEAA 3S98A 3T6VA 3QO1A 4YZFE 1UGNA 1CFQB 4K5MA 1DQDH 5CSZA 5ANMA 1MFNA 3MC0A 4IYKA 3KLQA 5EO1A 3R8BB 2GHWB 5D5MA 2VE6B 2ZTBA 3H4FA 4YSQA 4NHUA 5K59E 5FYKD 5JTWA 3U7AA 2H0EA 3GXIA 5AW0B 3SDAA 3FBKA 5INDA 3QBTB 2R8SL 2VM3A 5E4OA 4M5YH 4NWTH 3ZYZA 5M94B 2K8QA 3ZRFC 1JPGA 2MWCA 2VKWA 2OMWA 3AB0C 5DHMC 5AVSB 4RCAA 2E5EA 4XAWH 5CNHA 5DHYA 1TQUA 4ZPVA 4BZYA 1OGAE 4HV8B 1XMWA 2EC9U 3P9MA 3DRQB 2ADIA 1E0OB 1PG7W 3GSNH 1IEBA 5IVZB 3L2NA 4PJ9B 4OCSL 2K70A 4Y5XC 3OXSB 3W3BA 4BSJA 3EADA 3IDIB 3C5ZA 3DV4A 2VJ0A 5HTSA 1P4IL 4G3YL 3O2VL 4N8VG 5I1IL 1PF3A 1HE7A 3CHPA 3FO0L 4JQVC 4XBPA 1RULL 1S7XB 3CVIH 5LLIC 4Z8FL 3ESNA 3WIFA 3U4AA 3QDMA 3DGGB 3GBDA 5KSAB 1AP2A 1DVUA 2HAZA 3VA6A 3L2LA 5KSUB 3PGDA 4BQ8A 2Y6SC 3PF2A 1ZHKA 5HDQH 1QPXA 3OX8B 3CPUA 2G75B 4WJ5A 4HEMA 1K5WA 4KZDH 3GZOA 4UQ2A 1ZGLP 2WTRB 4OLXH 3R8QA 3LQAH 5I2IA 2ADJB 1FO0H 1N7ML 4NQVA 1ZT7B 1E5ZA 4IBUA 4F15B 2HKFH 4LHUB 2WXOA 4HWBA 2VABA 1M1SA 1HHGB 4U3SA 1RZ7H 2LW3A 1O9WA 5EORH 1BV8A 1VEOA 4UINL 2F54B 2XWEA 3RHWK 4OF0A 1KTRL 1D5ZB 2QV4A 2X38A 3NH7L 1D6VH 1U3HC 4ERSL 2DMHA 2XC8A 2W07B 4G8GA 4WTZA 5LJYH 2F18A 1IGFL 3KPMB 4XP9H 1YMME 1CLVA 3QC5X 3U25A 3HA0A 2NY6D 1XR9A 1Z6JT 1FL3B 1VFUA 3B7RL 4OZHF 4W9CC 5DRXB 2B15A 1U3HB 4PLKD 3S5ZA 1HHIA 3U7YL 4EN3D 4MA3B 5FUCE 4GMTL 3B34A 4L1TA 4YSPA 2JF1A 2WWMC 4QRRA 5DZPA 1OSPL 2WB1A 2EKSB 3CSFA 1REIA 3NCFB 1BQHA 1UYWH 2JIXD 5LBVA 1OB1A 2BERA 4HJIA 2XQYK 3RP1A 1VGKB 4K94C 1NCOA 5AOMA 5FUZH 4IU2B 3F8UB 1RUQH 1NSNH 1P4LB 4FLOA 5C09E 1YN6B 2QFRA 4YDLC 3BYYA 4L5FL 2PR9A 3SDDB 2X42A 1D5RA 1FNFA 2XTLA 4M48L 4U1SB 3BP6A 2E7LA 3CSYA 4Q9RL 4AVHA 2J1WA 4Q74A 3ZBMA 3O3DB 4ATWA 4HC1A 1ZE3C 5MEND 3MOBL 2OMNA 1DUZA 4LLWB 3FPXA 4NX0A 5ETUB 2BCMA 3GBNL 1EO8H 3H2PA 2WBKA 3ZJAA 3DX9B 4WTXA 3WTTA 1AXTH 1EFQA 1Q9WB 1VZGA 2JMRA 2LLGA 3FO1A 3VD5A 5T3ZE 3B43A 3KXFA 4HEPA 4APXA 1CGSH 1XBDA 3STLA 1WZMA 3F64A 1D5BB 4Y19E 4XX5A 3PWJB 3BIBX 2YOCA 4WUUA 3TONA 3WNPA 4DFIA 2H32B 1QBLH 3LN5B 4WI2A 2BNRE 4MAYA 4I3RH 3V0DA 1DQLL 3D34A 3SCMA 4IIQA 3CFKA 1E4HA 2WO4A 2MOQA 5JNYB 4PJ8A 4UAOC 3EOYG 1PJ9A 4IKNA 3A6CL 4LSVL 4ABWA 2IDQA 2HLFD 1E4XL 1ZLSL 1TTCA 4RFEB 1W80A 3D39A 1H19A 4NNYB 1IZKA 1CI5A 3MV7E 3VFWB 2DEWX 2ZUSA 1EXHA 3Q8CA 1RZFL 3QUYC 1RJYA 1R5WA 5HXMA 2OZ4H 4U7SA 3L17A 5FKAB 3JTSA 4C4BA 4Q97A 2C9AA 3L9YA 5LNDA 1E27A 4RGMC 2N4IA 3NA9L 3CVHH 2OTWA 3FUNA 2HG5A 4JG0L 4NQSB 3SBPA 2BMKB 3RWFB 3BZDA 5MI0B 4JFXA 5DQDH 2G5RA 4B7LA 4ZW8A 4Y1TA 2F7OA 1ILSA 3IMWA 4HJUA 4NOFA 3QUZC 4D0CA 2GY5A 3LH2H 4XNDA 2X41A 1E6JH 4UTAH 1OE3A 3RHWF 2IDSA 3L1EA 4GAYA 3IFNL 5ITFB 2J72A 1MCWW 1C9SA 2EILB 2DPKA 1MAML 1TR7A 1AD0A 2FGWL 3PDOB 1NC4A 3EW3B 1FVCB 4JN2A 2D03H 5DF0A 3JBG7 5K5YA 2GK0A 4P59H 3WIHL 3P77A 4V1DE 4LBAA 2E74C 2PTTA 1ZIAA 2WNGA 1CD1A 4B3VA 2AXGB 4BE5A 3AWEA 1FCCA 4JVPA 1NAMH 4AJVA 4WAFA 4DN4H 3LSOA 2WLLA 1HESA 1JP5A 1U8JA 5I16B 4BGDA 4ZO9A 3HNSL 4QHUB 4DP8X 3N9GL 5C9KA 3WJJC 2ZKHH 4JCMA 3ESMA 5J6GB 2AXGA 1DVFA 4Y5YA 2UZYB 4BSVB 2KBGA 2DYRB 4XBEL 4UTAA 4Y4FD 4FL4B 1LK2B 2CDGB 5ALCH 5D8JL 2CIKB 2JKSA 3ZX1A 3HZ3A 1MJ8L 4HF5H 1HH9B 4WTQA 4HCRA 4OLZH 4QT5B 5DJCA 2A0LD 4EI5C 2CZNA 2Y7NA 4ZFFB 1JZ2A 1BQKA 3HAEA 3OKKA 4TL5A 3MRNA 3DVNB 3CVHA 2JH2A 3II1A 3BXNB 4WGKA 4MJIB 5T5NG 1T2QH 4HH9B 1VHPA 3B83A 3D39E 5KUKA 2W0LA 4QRPA 4YBLB 5DCCA 4ESKA 2CJSA 4FI8A 2FWUA 1DBAH 1QRNB 2OTWB 2EDEA 3HNTL 3LPGA 4JFDD 1E43A 4OFKA 2H6PA 4OCWL 5B7EA 3LZFL 4NQQA 3GIVA 1G6RA 2FSEB 2FJFB 4NO5A 3O0RH 4LBEA 2V17H 4W9ZA 3ULVE 3GMPA 3QNXB 4Y5VB 4Z3FA 4S11A 5GJTL 4XMZA 1OL0A 1SXCA 1NWPA 3RAJL 3VE0A 5CZVH 1FORL 4F3FB 2V2TA 2X4PA 3EYFB 1WE5A 3QQNA 5BZWA 5JZ7C 1WTGT 5AQ0A 1A1MB 1H3VA 1I1AA 4M8QA 1EEZA 4EN3A 2EDMA 2APXA 2GT9A 1N3NA 2ZG1A 3RDTD 5AG9A 2ENQA 2RTTA 3UIYA 4YC2B 4OSUH 4DK5A 2YMXL 5C07A 1URZA 2C7UA 4GIAA 1PZUB 1CGTA 2D31B 1NFDB 3GDCA 2W80C 1WZ1L 5LGYA 1OSZA 2ZJSL 1C8QA 4PJXB 2HX7A 1ZHBB 3MLTB 3VDAA 2WNWA 3B6SA 1QUNA 3B1TA 1VESA 3RZCA 3ZT6A 3RUGE 3RFZC 3ESVF 3BHBB 1NMAH 4J27A 3A4AA 1KIPA 3DXAE 3PXJA 1X9RA 4M61B 1KGIA 3GMLA 1IGIH 5I1CL 3OKLA 5D5ME 3VG9C 4QF1B 3NIFB 4DGIH 3TH3T 3IGAA 3BUDA 2JFCA 1SJVA 1KYDA 3E3QC 3HC4L 3D51A 2X6CA 1P4LA 2VLRD 4UQIM 1TKWA 3MV9E 1BEXA 3FUIA 5LO7A 1YG9A 5FGCE 5C6WH 3GSUA 1AO7D 1XF5B 2WAHA 3VFSA 5EZIL 1A4JA 2FX9H 4TVPL 4PJ5E 2QMJA 3QORB 3AABA 4HOXA 1DLFL 4M6MH 2DQIH 4P5RA 3WFEL 3ZTNH 4N24A 1NUNB 3D3VE 1LO5B 4BBWA 3AXIA 4OZIE 2VLKD 2QMKA 4H0IA 4LO9A 4PJDE 4JQIL 1N0XH 3ECUA 1LK3L 4Y5YB 3REWA 3RWEA 4PG9A 3UPRB 3X12B 3VMPA 1I85C 1X9UA 4GMSL 3KWTA 4B9PA 2BO0A 4P5MB 3ZGHA 2IV9A 3E80A 3QRGH 5GZND 5JXAL 5I0YA 4OZHE 5FK9B 2HX8A 3ZZ1A 3ZE2E 3MNWA 1M56B 4TS6A 1CDYA 2NY2C 2WWKT 3FONA 1NCAL 3DNKA 1JNNH 1W72L 5K59F 4A68A 4KRPB 5IHBA 3IRCA 4XMWA 43C9A 4YJZL 1CGXA 1N0LA 1XEDA 2AVGA 1YNTA 4BM7A 1FDLL 5KSUA 3QDJD 2HG0A 3WJLA 4YBLC 5GHWH 4NC1E 4OIFA 3BLPX 2Q8AL 3ULVL 1J48A 1AZZC 1QFHA 3LMJH 4L9LC 3T08A 1XF2B 3ES6B 2WQSA 4QIRA 1WT5A 1A4JB 3MMEA 1CCZA 5ICUA 4JHAL 3HC3H 2CO2A 3TCTA 3D4GA 2YGQA 4RDBA 4RIRB 3WFCH 1U6AL 3G5ZB 4PHXA 4QAMB 4N2HA 2WAQA 1UB5B 1D5MA 2BXYA 1RZJH 1GJUA 1HSAA 3HR5B 3UZVA 4OLWL 3GNML 3AUVA 5FYJD 2G5BA 3FTXA 5BV7B 3WI9A 3RTQC 3F7LA 2QVFB 4GPVA 4KXZH 1UWEH 4G6KH 5HHME 5ISZB 3CZGA 4KTDL 3QEUB 2OW6A 1RZIA 1OARL 2HRPL 2TRHA 1H15B 3D4CA 3FH5A 2G75A 4X6CF 5EDXA 5F2FA 1NCHA 1FLRL 1LO3L 4IGBD 4ELKA 4I9WE 2P3YA 1AYOA 2CUAA 3L2MA 3UG5A 4LQFL 4CDHA 2Z64C 1SGKA 1UZ8A 4X9YA 5FLUA 1CXLA 1OAQH 2EEAA 4GAJL 1OM3H 3NPSB 4QEGA 4JZNA 1P2CB 1FNGA 1P5VB 3I6KA 3KLSA 1WV7T 5KYYB 2JELL 3L5XH 5C07B 3DMMA 3ARDA 4HQQL 5IFAL 3WFBH 3DX8A 4RISH 3ZY7A 1HH6A 4NZUH 5EU5B 2XG4B 3L3KB 3AREB 5B4MD 1NLBH 1AIFA 2YD3A 4NQCB 5SX4I 5F7MC 5DLLA 3N40F 1E4JA 3V9EA 3HE7D 2YAMA 1MCSA 4YXKL 5TPWL 4KZEL 3BMVA 1J1PH 3ZRCC 2IPTL 5DMIL 4UI2A 2JJTA 1KXTA 3AT8A 4OI7A 4IRZL 4GS7B 4P46A 1A1NB 4QGYA 4OFIA 4A2DA 4U05A 4F8PA 4YE0A 4QRQA 2GAZA 5KG9A 5I74B 5A3IC 2DLGA 1A6ZB 5C0RH 4R4BB 2NUTA 1U91A 1T5WA 3WJJA 7FABH 2QT6A 4AKQA 3NQKA 3MVSA 2DMGA 2DLIA 1MXGA 2VZTA 4P2RA 1LEKA 4G9FB 2EE6A 4JKMA 1WD8A 2FO4A 2Q1EA 2YJLA 3ZUCA 4RMVA 4Z7AA 1G9ML 4LLDB 1B0GB 3FQ2A 5GSVB 1QSEA 4BSWA 4GG6F 4XWGL 1N59A 2OJ1A 3UGXA 1WS8A 3QG7L 2DOCA 2CIKA 4G6FD 5FCSH 3V4VH 2XZQL 3I9GL 4QLWA 2J4WH 1G6RL 1KCUL 3SJVE 2AQPA 3MRJA 4LSPH 4ZXBD 2G2PA 1MREH 1QNIA 3E8UL 4LVHB 4HULB 2I60L 2WO3B 5IVXE 5F9JB 4JFEB 3GHPA 3E3QE 3RNQA 4TOYL 4X0KB 3NABL 3OKDB 3T6XA 3VFOB 3DIDA 1QEWB 3AXLB 1GZQB 3BAIA 2RR3A 3RGBA 2X05A 3CGTA 1K3ZA 3I6KB 3MNDA 4IBSA 1H3XA 4KX7A 5GZNA 2A6KB 3ULUC 3DIFB 1IVTA 3DROB 2AJVH 3SGDI 4BH7A 4DEUA 3WTVA 4UQDA 4ES9A 4OTXL 4L1SA 3T3ME 2AERT 3DX7B 3BIAX 3ZDZB 4HXBL 1U42A 2EO9A 3RE0A 3QULA 2Y7LA 1YCSA 3I6LD 4JFPA 5FCUL 4AEIL 2P8PA 2XPZA 1GGIL 3MLWH 1IBGH 1S7TA 4KPHL 3BUBA 4NKIL 3O2WH 3QW9A 1F3DH 1G9NC 1SLVA 4JFDB 3ZQXA 1EGJH 3UX9B 2NY3C 4LSTH 5BVJB 5AWNH 1CYXA 2LABA 1EZLA 3O4OC 5J8OA 3GRWH 1X5YA 4LT7A 4QCIA 3TWCH 1V27A 3VG0L 1A7PL 1UB5A 5M95B 2W0PA 1I3RB 4JJ5A 4M6NH 1AG0A 5C0GA 3BGMA 1AGEA 1E50A 3VXPA 3ULVC 2YUZA 4KI5F 4TLKA 3QUXB 3EF4A 2DB8A 3TCXA 1NDMB 4ICXA 2GK0B 5KYNA 1YAIA 4TPRH 3JWOC 1F4WL 4GI6A 3CLWA 4XVUC 4UNIA 5CSZB 3LKSB 5I6NA 1BDYA 3HMXH 2X4SA 4F27A 2JB6B 3ARSA 4UQBA 1TVHB 1N10A 2VZVA 3Q5YA 1T6VN 4IGBA 4WW2B 5CLZA 5EU3B 1U8QB 2D4FA 5DWPA 4ZW5A 2VXVH 1PEWA 3LKOA 4OCXH 2OM5A 1OP5H 3W0WE 1TJIL 3I02A 5L88H 3P02A 3HPLB 2YFNA 4OFQA 3HI1B 4HS8H 2XVBA 3HJ0A 5T3XL 1GZQA 3RIAK 1MFMA 4NPYB 1BZ8A 4Z7NB 4ZQTA 4P04A 3DRQA 1Q9WA 3BAWA 2FRGP 4X4XB 3VXOA 4GKOA 4ZMVA 3QUMH 2BSSA 4FA6A 3GXPA 4PMEA 1JHLH 3KPRA 4Z78A 2OI9B 4ONFH 1T0PB 3RBGA 3HN3A 4Q7DA 3UABA 2WQXA 2P8PB 3QORD 5EEXA 3PNWA 2QTEA 1JN6A 5E1GA 3CXHK 4HK0A 2NTFA 4MNQA 4OJCA 4LCCB 1CL7H 2HJFB 5LAXA 2YJQA 4E0RA 3C2AH 3APDA 3IU4L 3V4VA 2NSMA 4L3CB 3RA7H 1LE5B 1YA5A 2BWIA 1X4XA 1HINL 2F53A 2PYEA 4IRJC 4JFZH 5GGVH 4GBXA 5KJRL 3P3SA 4AMWA 1L3WA 4PBVC 3MREB 3WNLA 2EE2A 3PNWB 3QEGH 4OIIH 5CEZL 3ZPDA 1CICB 1QNZL 1E65A 1AGBA 3ARGC 1DSWA 2PO6D 5EU4B 4TVSa 4ANXA 2PYEE 3UTTA 5IUCA 2VISA 5DD3L 3STZB 3IXAA 3FFCE 2ZPKH 3QIWD 1K8IA 3RWCA 2VITA 3MACL 1BF2A 4BWUA 4OY9A 5TE7H 2BZ7A 3OBAA 1RIUH 4KWUA 4Y9FA 3VFNB 3ZHLA 4KKNA 5FW6A 1AHWA 3C60C 5DZJA 1OP9A 4Q52A 5HGBB 2DYPD 5ENWB 4NQXA 2ED8A 4D94A 1JGEA 4NB7A 4QXVA 2UZIL 4U1LB 4A38A 3OL2A 2C4FU 4P23C 2FX7L 1KZQA 4D9LH 3ARQA 3AC0A 2GUOA 3ZZQA 2H0JA 2NUTB 2ED6A 2AEWA 3IMRA 2BVTA 3E0GA 1Y6NR 4F9LA 1SUJA 5T3ZH 1A7NH 1MWAL 1UH4A 3BQUB 1I7ZB 1IAIH 3NIFE 4OZFA 2OYKA 2FBOJ 4A2EA 3QXDA 4K3EL 3AM8A 5IFHH 2D3JA 4AEHH 5D72H 4GY4A 4XBPB 4MD0A 1A7QL 2QEJA 4I2XB 5BRQA 3KPMA 4N0UA 3ATFA 3KLDA 4GQ9H 4AENA 1X9QA 4NJAL 5CSBA 1ZOXA 1B2WH 2CKBB 3UDWC 3O3EA 5GGTL 3SO5A 5DJZA 2JJSC 3N0PB 4WU7A 5CSGA 4Z78B 2Y7SA 3VWKD 2DKMA 1E9QB 3N3EA 1WFIA 2WLHA 2CALA 5DU7A 1BAGA 2OMWB 5DLML 4AJ0A 2DD8H 5F0MB 4UT6L 1A6TA 4FTDA 2JI3A 1VERA 1BFVL 4U2ZA 3LJ3A 4KJQC 2CHXA 4W81A 4QRSB 4QT5A 4NKOB 1SVZA 4TKWA 3MLYL 1VFMA 3LZPA 1CXIA 4HH8A 1R47A 2VKXA 2GCYA 2GJ6B 1WA2X 3BYTA 4KVCH 1TVBB 3QUYB 3WIFB 3L95A 3MGTB 4AYFA 3DX2A 4G6JH 3J27A 3ZE2B 5I6XC 2P24A 1W0WB 4GT7A 2JB6A 4YX2L 3G6JE 3IE9A 5D7HA 1AC0A 4TN9A 4JDTH 4QRTA 1THAA 3UTSE 1AR1C 5E03A 4N90E 4ZOCA 3CFUA 3FQTB 4PY8I 3FU0A 4KDWA 5C0EB 4WU5A 25C8L 1H8SA 5ENWA 5MHSD 3PQYB 2DYPA 4N2FA 1PX3A 2H9GB 2PCPB 4LIQL 5A2FA 2ROXA 4UDTA 3WY4A 4WO0A 5FGRA 5LQBL 2ZAHA 5I71B 2D7TH 1KJ3L 2XBDA 3WGUB 3ESPA 3MMEB 4PJBA 1BM3H 2IANE 3NP4A 3FU9A 4X7SH 4R4FL 1F90H 4HPOL 1RK7A 2P5EE 4TTDD 1VSCA 2QQKL 4KJWC 4FC3E 1BFTA 3KWVA 2GBVA 5DGRA 5L2KE 3ZHFA 4P3CL 5GS0C 1WITA 1T5WB 4NS0A 5FFOA 3OHMB 3ABGA 2HT3D 1J88A 1GJIA 2BY3A 5IBUB 2AP2A 1SVBA 5H8DA 3FHQA 4JE4B 1M6OB 5ICXA 4Y1AE 1CZ8L 4B9ZA 2FIKA 3D52A 3TH4T 2NY6C 1G7PB 2R4RH 3L1FA 3K2MC 1OCRB 1JPEA 1R19A 1QBBA 1SHXA 1UM5H 4JFEA 4RMTA 4YUEH 5E5RB 1J11A 4KMQA 3CFTA 2PW2B 3S5LA 3MUZ1 4FFYH 3GXUB 4H26B 2FHCA 5ID1A 1G87A 4Y4FC 4FADA 3VX0A 1OAXL 2VR9A 4YLQT 3FRPB 3KLAA 3JWOH 4GKLA 5E51A 3FFOA 4E9YA 4LARH 1GOGA 3LRKA 1OAYL 5B3SB 4F7CA 1FF5A 2X1WL 2BINA 4Z3TA 4JL1A 4CSTA 5CKAA 4XNYL 4JGNA 2XQYA 5B1JC 3WCYA 4ODSL 3FQUB 3VVVA 3ULAB 2UY6B 2XWTA 2CPUA 3BD3A 4DK3A 3CNKA 2NNFA 3A4DA 2B5IB 3NSFA 1A1OA 4WNQA 2YD1A 4QY8A 4HS3A 5FLVA 1SN0A 3LKSA 1SPDA 2XX1A 4ZAKB 4B6ZA 1EJOL 2HWZL 1F18A 4Q4EA 2VRQA 1RI8A 1XGZA 3DPDA 4YFLI 5A2IH 3QIBD 3OJ2C 3CHOA 1KCRH 3TNMB 2V7HB 2NQCA 2QLVB 2HLAA 8PAZA 1A66A 2AV1A 2DQJH 3CDYA 4YS4A 3VA2C 1UHVA 2FD6H 1A9EA 3EXLA 2P8LB 4HEME 2E9WA 5C0GB 1GJWA 4ONOA 1QA9B 3EJJX 2YS4A 2NXZD 4R2GC 4UUJA 2QZQA 3I3EA 3C87A 1JZJA 3HLAA 4M3JA 4O4YL 4S0TD 5EOQL 3OPZL 5IROD 2XQBH 4H20H 3P0VH 4OGYL 2XJLA 2AJZB 4TNVF 3JV4A 3BQVA 5HHQA 1AQDA 4UILL 3U9UA 4RGOL 1AS6A 2HJLA 3RX7A 2F54D 2CHWA 2NQ3A 5JHDB 3V4LA 1H3TA 3SE3C 3OZ9H 1J7VR 4BFRA 4I1PA 1A3LH 4G1EA 4R0LA 3SDCA 3QH3A 4ZUVB 4HCRH 4Z7QB 3OAYH 4X9IA 1J10A 2V5MA 1ZT4A 3PHQA 5F72S 3SGJC 2VABB 2CUHA 1ZLWH 3X14A 1RZIB 4F2MA 3EYSH 5IG7A 2OW7A 1UD4A 3QR2A 1SXSA 2WLLB 1N6QL 1HNGA 3HS9A 3QIUA 4NENA 4YE4L 1RU9H 1KBGL 3PHQB 3LKQA 4OD1H 1DQQB 4PGEB 2VMDA 4NWUH 2IPUK 2XCMC 1HSAB 3HR5A 3DX6B 1NGPL 2OXHA 1BQUA 4FGMA 3TT3L 3VI4A 1O0VA 3D85D 1A2YB 4M7KL 1CUOA 3H7BB 1GH7A 1G9HA 3KGUA 1MCNA 3MLRL 1AXIB 2IJ0C 2PABA 4PY7A 3RYMA 3SDXF 3WHXA 5HHQB 3IKKA 4YQXH 2JQMA 3FOLB 3QUMA 2MPAL 3U2JA 5C0FB 1BXUA 3S2AA 4G72B 3QXWA 5I76A 1J8KA 2OL3B 5D4QA 1MHPH 3VGAC 1UG9A 1FG2B 2PYFB 4V1DB 3OKLB 3EDFA 2EDHA 1Y0LA 1KTLB 3GIZL 4ALAC 1BIHA 5KS9B 1ORQB 2EYSB 1S7UA 3NJKA 4PLJC 3EDKA 4P46B 1UCTA 3DJSA 2VCOA 3FMGL 3LV3B 5JMRA 1FFNB 1AMYA 3IJEA 4M5SA 3TBCA 4LPUA 4JANB 3HC0B 3MRPB 4EXPX 1ROCA 4NERA 5DUBB 5EU7C 3PL6D 4D9QD 4PCYA 3NDYE 4FTVB 4UNVA 5JHDA 5AOJA 5HHOD 4BE6A 5MENB 4KI5C 3EYVA 1IAII 4KRLB 2Z31B 3VD9A 1UATA 5AB9A 5AW1B 1SM3L 4IU3B 2A5UA 1RV6X 2XBZA 3MTRA 3PAZA 5IOKA 3HBZA 2BNQB 1F3DJ 1BQ5A 1VADA 1NINA 1X5KA 1INDL 2VR7A 5E8EB 4WI8A 5CJQH 4A2MA 1KLUA 1HEJC 1UWFA 4CW1A 5DD1H 5DJYA 3TCLA 4RWYL 3FO1B 5ACMA 2PN5A 3BT2H 2DLTA 2AQNA 3JTSB 2GTQA 1A8JH 5CP7B 1EGJA 3KE0A 4O2FA 3AU1B 3VYPA 1RJYB 4Z76A 4J6RL 1H15A 4MWFA 2G3NA 3SPJA 2YPLD 4WWKC 5FO8B 4KHTH 4MZRA 1RURL 1T7XA 4U1IB 3MJWA 3OLEA 2R0ZL 3PHOB 3MRCA 4J3OG 5FYKH 1UH3A 5CP7A 1WQVT 4LAQH 2DQEL 3LEVH 2DDQL 1BJ1J 1MFEL 1MHCB 2WTPA 4UOZA 1E8XA 2ED9A 3E9UA 3VSVA 3LS4L 4O5LL 2WGXA 2O26U 5EZOL 2Y07L 1QW9A 2GTZA 4TXVB 1JRHL 5LXVA 3KL5A 1R3KA 3WE6A 3OXRB 3UJJH 1OPOA 2FHFA 1BVLB 3GB7A 4K71C 1QBMH 5I5RA 4APXB 1WWBX 5DD5L 3V0IA 3P4MA 1MRCH 2Y36L 5JUEL 1DQQA 1N2RB 2ZSWB 3GI9L 4OF6A 4Z0BH 2RMNA 1A1MA 5EV7A 4LKCB 1KPVB 4P2QA 1T04A 4M5TA 1XWVA 2V5RA 5FUOH 1MI5A 1LXMA 2OX5A 1EJ8A 2H0PA 4PJCB 3BW9A 3GZKA 2Z6FA 3DIVA 4XMPH 2JKWA 4XO5A 3WELA 2NY5C 2R2CA 3F84A 1O7DC 4HFWB 1CVRA 4LEEA 1RZGA 4FFWD 4H8WH 4HUUA 5EC1A 4FNLL 3S88H 1NC4B 3CCHA 3D2UD 4MJ6B 1TTGA 3ATDA 4PVMA 1T20B 2GITB 4IM8A 1FO0A 2HFEA 2LE9A 3MRBA 1SEQL 1AQDB 1SDYA 1YYLH 4FQ1L 3VCLA 4ZFFA 2VLKE 2FK9A 4LCIL 3WSQL 1H0DB 5AENA 1NFIA 1T21B 1JWSA 3N1FC 4AYSA 3H7BA 5GS3A 3M86A 1NICA 2ORBL 5IW1A 2COQA 4YHIB 1AZNA 3K2IA 7PCYA 3ME0B 5EUKB 3I9IA 5C71A 1DEDA 3MRKA 1ZVNA 3KDMB 2P5EB 1JD7A 2GJ6E 3S7GA 3TO4A 4JAMB 2DY2A 3WAKA 2Q3AA 4D0BA 1I1CA 4RA3A 1KXHA 3FB5A 3X11B 4MJHA 3CBKB 4MLSA 4Y4HD 5F96L 1KEML 2ITFA 2DWYA 4JM0A 4HBCH 1OP3H 3WN6A 2ZXCA 1SY6L 3PPSA 4NZJA 1T7VA 3ZKXB 5DZLA 1MXDA 3O41B 1N4XL 4E5XA 1MHEB 3BEVA 1W0VB 3U9PL 1IC7L 3EDEA 2VUYA 4PS3A 1QFPA 2WUBL 2F1BA 5KVDL 3VRIB 4YHZL 3LYRA 3NOIA 3SDCB 3SDXE 5BMFH 1E7UA 1UJ3A 3C5SA 4LE8A 3MV7A 5IQ9A 1DHKA 4X50A 4ZOBA 1XAUA 4ACPA 5JMOC 5E5LA 5A6LA 1L7TH 3OQ3B 2ZCLL 2K9UA 1NM4A 1LP9E 3STLB 3QA3A 1W8NA 4X8GA 1A0QH 3OKDA 1OGTB 5C07D 4QO1A 3EGDB 3MQIA 1PZSA 3P3UA 4ZPVB 5F1IB 4HJJH 4N86A 1YEJL 5BZWB 5JIIA 2LAAA 1NCBH 4Z1PA 1KGWA 3G6AB 3QE5A 5D7LE 3T8XA 3WIIH 4ORZC 4Z7OF 1JDAA 1JZEA 3IMUA 1RSFA 3ARPA 3DMMD 2D7NA 2OJZH 1DJHA 3KH4A 4ZZFA 2IFGA 3AGWA 1J8HD 1HNYA 1S6NA 2ZWKA 2VJ8A 3VXUB 4QNPE 3ROOA 2D2CC 1LO2L 4NCC1 2V2WA 2CSPA 2CK0L 3CLEH 1FFPB 1RJZB 3ECBA 5DK0B 1HN1A 2QSTA 1IO4C 4JFFB 3AWGA 1B9KA 4I3GA 1PNCA 4R4BA 1SDDA 3KPRE 1PJWA 3H2QA 2V8LA 3FC8A 4Y1SA 1RP9A 1J1OH 2AZUA 1CB4A 3C75A 4FABH 3MRFB 4YR6B 4L3CA 4PRBB 5KVFE 2B0SH 2CO4A