1SLUA

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
133
structure length
131
Chain Sequence
IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMHCPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 131
sequence length 133
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sluA00
2Y6TE 1AZZC 1XXFC 1XX9C 1FI8C 4IW4C 1EZUA 1XXDC 1IFGA 1P0SE 1ID5I 1SLUA 1N8OE 1ECYA 1SLVA 1EZSA 1ECZA 1SLXA 4NIYE 1SLWA
chains in the Genus database with same CATH superfamily
1ETA1 2BJMH 5B1AB 2JB6A 4ANKA 2DQMA 2IQAB 2O26U 4KVCL 2W0FB 4HAKA 5ELIA 4ZX6A 1M53A 1FG2B 3A4EA 3B2XA 4UTCA 1B6UA 1FVDA 1AY1L 3OHXA 4XMUA 3QDMA 1ZCRA 4UNTA 3NP4A 1DN2A 5C0AD 4W1TA 1IKNA 5I26A 5TGBB 5D2LB 1KPUA 1TF4A 2D7QA 4ZSOB 2EDMA 4PRNB 1DVFD 1DR9A 5BS0A 4N9GB 1BQLL 3MLSL 4F8TA 1UT9A 3SDXB 4GP4B 3B5HA 4MJ4A 5F7UA 2EZ0C 3DK2A 4RGNC 5CZXC 5FFLA 3U9PH 2HLEB 1CK0L 3UYOD 1HX0A 4J3OG 4J3SA 4N2OA 1IGYA 4GIAA 2X53A 3FTGA 3KPMA 3LIZH 1PKQB 3QEQE 5IK3B 4G42B 2C34A 1ZS8A 3MLRH 3NIDF 5ES4B 1QX1A 2FATH 2AABH 2VIRB 3U2IA 3IMBA 4QYOA 1H9VA 1NGXB 4J4PD 4YHZH 4U6YA 4H13C 1I8UA 2BC4B 1PX4A 1ZSDA 3UZEA 2EUVA 5FYLH 4UWQB 2V2XA 1WZ1H 3QUYD 5AAPA 4IOSD 3FU6A 1JGUH 3OMZA 4F2EA 2UY6B 1F4YL 3P4MB 3GF8A 3ILPB 1TTAA 1MF2L 1LYQA 2VLKD 4PJHF 4PJ5A 5C0BD 3KLHD 1AGBB 1YSOA 4KRPD 3C6LC 4K3DH 4NPKA 2WINA 2VABB 4ZBJA 3NG5A 2WAHA 3ARDA 4U3SB 4TQEL 2B9BA 5D9SA 1CICA 1JTPA 5KSAA 2IH1A 4AL8C 4W81A 4E9TA 4GH7B 3E8UH 4UAOB 2W0PA 4MDRA 1ZTXH 3IYLW 2PR9A 3SKNB 3ECBB 4DN3L 2HX7A 3VI4A 3MJ9H 5DJZB 4GMSL 1VZIA 2NSMA 2EYRB 4NPYB 3EFFB 3T8XB 3RY5A 5EU3B 4FXKB 3D39E 5DZPA 5KOMC 4IIQC 3KGUA 1BX2B 5FM5O 1PZDA 5DRNA 5JDSB 2CBQA 3CQPA 3F58H 3OPZH 5JHDA 1UWXH 3ULVH 2EE9A 3WUZA 4BKLA 4WENB 2YMXL 5IT2L 2GCYA 3GHEH 4TRPH 1MNUL 3GXTA 4DW2L 4LPCA 1E3ZA 5KTEH 3KYMB 2I5YL 1UURA 4M48L 1HHJA 3I6KA 4ZTOL 3JTTA 3T9WA 1T22A 2ENYA 4C8XA 2FL5B 3DX4A 3CVIH 3W5MA 2X4OB 2DWYA 2VDMB 4FNLH 3MRLA 5D6DC 3SCMB 4C4BA 5C2BL 1AIFB 1IEBB 3KGSA 3EFOA 3IDJA 4E9XA 2O6PA 3OHMB 4U7KA 3ULUE 4JVUA 1A6UH 3SE3A 3MJGX 4OSUH 2HG5B 2BFVL 3DURA 1R34A 2OZ4H 3QCTH 2GVYA 3ULVF 1DDHB 5CZRA 4XMKL 4NYLB 2HT3C 5I5JA 1R75A 1CDIA 3SE8L 3G08B 1FAIH 1NANH 3DBXA 4A1RA 4CN6A 3OKNB 1D6EA 4X5WB 3W0WA 2VE6B 4NAJA 3GIZH 5EDSA 4DK5A 4EO5A 1CL7H 1JXJA 3NPSB 2PETA 4H1LB 4DKAA 1G9HA 1AJ7L 3QUML 5B38G 5C08A 4ONGH 4K3GA 2ATPA 1FE8H 3BKJL 2O5ZL 1SXNA 3NJHA 4NSKB 5DC9B 5FA3A 4D9QE 1IAKB 3LAFA 3PHAA 3UPRB 4AIZB 4MAYB 1MXGA 1DVTA 4HJGA 1KB5H 3VWKB 2FT8A 4LARH 5ICZA 4M56A 1TJMA 3EJYD 1P9MA 2FX8H 3MVSA 2P5EE 4WEMB 4HPOL 2B9AA 3LHAA 1RFDL 3WJMB 4DN4L 2QGEA 4ZD3L 1TQUA 2H8PA 2Y72A 1QRNA 1IQWH 1E9PA 4XCYB 4CSPA 1RHHB 1BIIB 1GVIA 4MXQD 3V4UH 3QDME 4A37A 2WGNB 1XIWC 1N8ZA 1NLBH 5F89A 3KCPA 4HK3N 1TJIH 3H4HA 1J8SA 1NOAA 3K6NA 4TVPH 1VPOH 2FD6L 3SDAC 1BEXA 4ZX3A 5IWLA 4YBLC 5JZ7C 3QXAA 1PS3A 4G9DB 4HFUL 3CGTA 1YCSA 5BS0E 1T04A 4I0PB 1O6TA 3QJSB 4D9LL 4YSEA 1CG9A 4LCYB 1MJUL 4DZBA 5B3SB 1BJ1H 3K46A 3CDGA 4P5MA 4BE6A 4YFEA 1ID5I 2PYEB 4GT7A 5KG9A 3K6DA 1PDKA 1QR1A 3HG1B 3SGDI 2AV7B 3GMLB 4ZQKB 3NACL 4MTMA 1A4KB 3QXTA 5DR5H 4P46B 2QVIA 3D4YA 4MHHI 1WG3A 3VGBA 2YBGA 4XNMB 2ZPKL 5D1QA 2EJ1A 3FCSA 4PGBA 2G3ZA 4PW9A 1W72L 1NM9A 1JK8B 1PGRB 1QI4A 4MYWB 3WE6A 4ONFH 3WY1A 1LP9F 2F5AL 3H6AA 2XFXA 5B4MD 1EO8L 1ZHLB 3V7AG 4FTVA 1XGQB 4MWFA 3V52L 2DL9A 2V17L 3FUNA 4UUJB 5K39A 3GI8H 1UOWA 3IDYB 1XXDC 3EOAB 3L3DB 3ZE1E 3QK0A 4MXVF 1G1OA 2B16A 4XNQB 3SDCB 4LVOB 3LKNA 2XXGA 2WWMD 3GSXA 2D03H 4PJ5E 1GXEA 4CVXB 4O51A 4NN5C 2CJTA 2B3RA 2C3XA 1IGFL 3L3OA 3PWVB 5BQ7A 4PBDA 5L2JA 3VQ1C 5JLZB 3D07A 5ECGA 3QUZC 2DMKA 3FS9A 3BH9B 3QQ9D 3QORA 4RZKA 2NY0B 4EN3B 2OAAA 1U8PB 3VI4E 1TZAA 4ZMZA 5EBMB 1D5XB 2R4RH 5A1AA 5KSUB 2IQAA 1T03H 3P2DA 1ECYA 3DMMC 1P1ZA 3S5LA 4R96A 5TPWL 1AG6A 2W0FA 2EC8A 3FB8B 2P5WB 5C09B 1FG2A 4N2GA 3T04D 3WG7B 4KOBA 4BFRA 3FCTB 4ONHB 5JIQA 2VDNH 3L5JA 1O75A 2D3JA 4DK3A 2E9JA 1XF1A 3DOSB 2GK2A 4GXUM 3JSSA 4NHUB 5JHDE 4PR5B 5HP5A 3UFIA 4YC2C 4ZW7A 3SSGA 3QEHA 4MBRA 5LXVA 3OLIA 3QFDB 4OR1A 4PP1C 1CT8A 2QR0A 4PRNA 4QGTA 2W9DL 4RWHA 4XP9H 3H7BB 1QZNA 2X4NB 3MA7B 4N9GA 1HCYA 3P30H 4XBGA 5E8OB 1OP3H 5L4MA 1ZIBA 2QADB 3FQ1A 2FLBT 4WNSA 4ZO8A 1VRSA 4Z0XB 5CNHA 2CRIA 2P44B 1ZIAA 4L0YA 3MX0B 3B6SA 3D1MC 2A73B 4DEUA 1ROCA 4G42A 3MXVH 4L1LA 2VIRA 1ODAA 3RI5K 3SKMB 4IOIB 3L1FA 3P3TA 1QO3A 4B60A 2VC2H 3CLWA 3MV01 1TVHA 2ENQA 2BC4A 4XCFH 5CIPH 4XHQA 1W9XA 5K9JH 1ZRUA 3TCLB 3L7EA 5DZOA 5TE6L 1G7QA 4IU2B 4EKJA 5KSVB 3F7KA 2YPKB 5DC0A 43C9A 4YSCA 1JYXA 1E5CA 1JAEA 2UY6A 2VLRD 3EDJA 3QZOA 3P4MA 4TKWA 3P3RA 5C3TA 4JLRB 4APXB 5JIIA 3QQNA 2EXSA 5TH2A 3OXRB 1NDMB 1USQA 2HZHA 3GS0A 3OVUB 3QFJB 4Z23A 5DD3H 1HE8A 3W0WE 1G5GA 4GAFB 2A7BA 2VABA 4L1DA 4Q6IA 5IF0B 5K69A 1JN6A 2VDLH 4U3SA 3SO3C 5AZUA 5C0FB 2BJML 2XYBA 2E74C 1P5UC 3D0VA 3LSOA 5C08E 3OWRA 3O3EB 4ZYKB 1BQRA 4UV4H 2J55A 4FXTA 4L9LC 4HKJB 2G5RA 4YEFA 4YSPA 4AUJA 2Z8VC 4PJBA 3IJEB 5KVMC 4AQAB 2XC8A 3SKNA 3ECBA 2NY1C 1U8NA 4JNXA 1G9MC 2Q76B 5BRZD 1ES0B 1RLBA 2YRPA 2AFNA 4XPBH 1EEYB 1OSPL 2EYRA 4LVEA 4NPYA 5DMGC 3T8XA 3GIVA 4FXKA 5I82A 2VNCA 1EBPA 2IPTH 1QRNE 4JDVB 4XPAH 1BX2A 2CKBB 4XPHH 1T0MB 2WC7A 5F3HA 1FNFA 2PUQT 4FFTA 2WBJB 4ODUB 3U9PL 4Y2OA 2Y24A 4JZJB 2K9UA 2X4QB 2YUVA 3T4AC 3LIZL 4K8RH 4ZK8A 2E59A 3R7QA 3ROOB 4ZG1A 1HSBA 2OSWA 1VA9A 4OI8A 2AABL 4IRZH 4S1SL 1I1YB 3KYMA 4G6FB 3N42B 4CA4A 1PZUB 1XL4A 1L9SA 3LZRA 4WIQA 1U93A 2DQEH 5FYLL 2VZTA 2BVQB 5EV7A 4RQQB 1WZ1L 2FL5A 3EF4A 1F4AA 1JGUL 4P3DB 1EXUB 2X4OA 1ZSHA 2CBOA 2ZXAA 3PJLA 4KI5D 5F0LB 3UO1H 3I6GB 3SCMA 2DQTH 2DW5A 1AIFA 1IEBA 3CN3A 4PG2C 3VMNA 2WXGA 4JFSA 3BSZH 4JDZA 2R29L 5D55A 5D1QE 2XN1A 5D1XA 5F8RC 1A9EB 3VFRB 5SWZD 4I9WE 2OW6A 1DSYA 4JAMA 3HBQA 1DUZA 4FTVE 1CTMA 1E8YA 3MO1B 3T6WA 1CS6A 5ALBH 4NBYB 1PSKH 1DDHA 2GJZB 4PV8B 3GEFA 5C71A 3DI2B 2B3IA 1I85A 2KKQA 4IBQA 1VFAA 3E8UL 3VX1A 1ZTXL 4L48A 4J2QA 2VXQA 5D1ZC 4X5WA 3OAWA 2VE6A 5B1JA 3TBYA 2K6ZA 4UNUA 3MJ9L 1E5BA 4H1LA 5DZLA 1XVSA 5DQDH 1NAMH 4Q58C 5D4HA 3QO0B 3CZEA 1AAJA 4OCNC 2GJ6B 2NXZC 4NSKA 3BUPA 1THAA 2QVKA 4JMXA 3KHQA 3S37H 4AIZA 3UPRA 1LE9A 3OPZL 3ULVL 3CH8A 4GRMA 4IKJA 5GGUB 4KJWD 2DF3A 4NNYA 3GHEL 4TRPL 3X1FA 3QHZL 2AV1B 3UBXG 2EIEA 3MLUH 1ZLVH 3AQYA 1J48A 5LG1A 4JBSA 2DEXX 5KTEL 1UHVA 1Z66A 4F9PA 5HYJD 2EIKB 1RHHA 1XTLA 2VM3A 4WSGA 1JFHA 3T6ZA 1N6VA 1ZT1A 4JFQB 3ZPDA 3S96B 3QR0A 4PVLA 4WW2A 1HKLH 1OAKH 3GRWA 4NO3B 3U36B 2EXYD 1S7QA 1VCAA 3D85D 3ZN6A 1LE5A 4KFMA 2IO5A 1C5CH 2CD0A 2QSCH 3B9KA 1EWHA 4I0PA 1WTGT 2DS4A 4YDVB 4URKA 4M8QA 4G6AD 1A6UL 4KNSA 3KPQB 3LPFA 1SMDA 4LCYA 5DZJA 4OSUL 1KUMA 3T0WA 3DUHA 3DK0A 3BGMB 2OZ4L 2O6CA 3QCTL 4ENED 3BGFB 4X6DA 2Z8SA 1A3RH 3HG1A 4QRTA 3SDYH 3GINA 1PZCA 1LO2L 3GMLA 3P40A 4ZQKA 4HF5L 4P46A 1PJ9A 2DB8A 5E5LA 3WIAA 3WY2A 4HH9B 1O7VA 1YEIH 5CLZA 4XNMA 2EUZA 4LCWD 3ILEA 3GIZL 5C0AB 1NJ9A 1JK8A 1CL7L 1KY6A 1WHPA 3LRMA 2WWOA 1ZHLA 1XGQA 4UUJA 5J6HA 1J5DA 1RXLA 2Y1ZA 3RGVB 3EOAA 5HYQB 3L3DA 4DWHA 1DVFB 1G7HB 4WI9A 2VDPH 4S0SD 1LK2B 4LVHC 4XNQA 3SDCA 1FVEB 2W0KA 1ZV2A 1KB5L 1U42A 2AI0H 2ZOKA 4XNYH 1IAOB 4CVXA 2WKOF 4XBPA 3H3BC 1QLRB 3HLAA 3FBQA 4HIHB 2IWGA 3IN2A 4TVPD 4DUVA 2H2SC 1T83C 4YXHL 1U3HD 2ENPA 2ADGA 3PWVA 3UPAA 3NFNB 1MAMH 5JLZA 1IQWL 1JF5A 4JGJA 1CBVH 5I75B 4JJHA 4PJBE 1YYLH 2X05A 4YDLB 1UKTA 4PG9B 1NLBL 4R90L 4W70A 3MLVH 3UACA 2ZP8A 4TSAH 1RUMH 1TJIL 3SZ6A 3QUYB 5EBMA 1D5XA 5GS0C 1VPOL 5L7XH 1JDCA 3PQYD 5KSUA 1IU1A 1Z9LA 4OAWB 4L3FA 4XO3A 4ZMPA 5DQJA 1OAXL 5K33A 2UWEF 3FB8A 2OPCA 2P5WA 2XN2A 4W6XB 5DD0H 4ZFZA 1IJNA 3EYUH 3MLWH 5C0BB 2ZXGA 5KVEE 2F5BH 1HYSC 2JQMA 5DMKB 4NHUA 1G9NL 4EI5C 1F4XH 3EJUA 3V0WH 4A63A 4RWYH 1YEJH 4QRSB 5E5UB 3MZTA 4L0PB 1JGIA 5HGHA 4LQ1A 1LD9B 1AS6A 4P2QD 2RBLA 4NXSA 1JYWA 5K9OB 5DR5L 3TO4D 4B3EA 3H7BA 2X4NA 3MA7A 3ZE0E 1TUPA 1CR9H 3UEQA 4K15A 3FQXB 1BW8A 3S34H 3VFUA 4HPYH 4FQXC 4ONFL 4TQ8A 2WK2A 2PF6A 2CCWA 3K4AA 3LN9A 1CQYA 2YARA 3F6IA 4M02A 3WEOA 3MX0A 4XNZC 1SF5A 1L3NA 5D72H 5M7QA 2A73A 1JVOA 4GAYA 1T5XA 1OGPA 3ETSA 1CB4A 3K6FA 1PZ5B 1QKZL 4Z77B 4L4VE 4YIQA 2E6PA 4F5CA 2H41A 2NY6B 2D03L 5H37A 5D1XE 1OK0A 2B0SL 4KQ0A 2AQSA 1WWAX 3CFDB 3TCLA 5BZDB 3QIWC 2PXYD 3TURA 3VFSB 4IU2A 1AZUA 1BHGA 3APFA 3VWJD 1N3NB 4YOKA 2E47A 4APXA 3SGKC 4JLRA 2YAPA 1XHHA 3UABA 3OXRA 4MMZC 2NY7H 4QY8B 1SXSA 2ZWSA 4CDHA 3UADA 3H53A 3MFFB 5IF0A 1XT5A 3II2A 3MCKB 3CDCA 2BK8A 3L5XH 2JMRA 4MVBC 5HHME 4MQ7B 1WP6A 2DAVA 2F08A 4JQIH 4ZYKA 1SQMA 5C9KA 8CGTA 4XBMA 1PG7H 4UANA 4AQAA 2VDNL 1RERA 2WBWB 4AYBA 1NKGA 3JWNG 2Z31C 2Q76A 1U8CB 2Y23A 2R4SH 2FEDC 2WTRA 1JGEA 3QUMB 1H6TA 1GYCA 5CLWA 2Z91B 1EEYA 4X8GA 3LOWA 2NX5B 3IRZA 4N0UB 5A2AA 4ZUWB 2XIDA 3LQMA 3P30L 4JDVA 3SDDC 2P80D 1UYWH 1IBGH 2CKBA 3KWVA 2K1MA 1S9WB 1T0MA 1OWWA 1IC4L 4LL1A 3HC3H 4ODUA 4GEJA 1ZE3C 4S0HA 4YAQB 4AYDC 2WLMA 2A3TA 1R4XA 2X4QA 1DVXA 1HSAB 2OMTA 5FM5M 4AZUA 1MFAL 3QZBA 2WOYA 3MXVL 3QXWA 5CCHE 1ITCA 5L2KD 4KMQA 2A9CA 1I1YA 1GYAA 2XWCA 1A6TA 2VC2L 1S5IL 4TL5A 2R69L 5H35B 1WH0A 4E0RB 2GEEA 1SM3H 3HTLX 3VMOA 4JHBA 5K9JL 3K3QA 1MIEL 1I9RH 4RQQA 4X6DE 2F74B 2JKIS 3HG1E 1X5FA 1J7VR 2MCPH 4P3DA 3RWDA 1ORSA 2WQWA 4AT6B 3I6GA 3O2VH 1HOEA 5AVUB 3EOBA 4DVRH 4KKBC 2AZAA 2GHWB 1A9EA 5CD3B 3MRCB 3CJJA 2VDLL 1JFQH 3O6FC 3ARUA 2EDTA 2EZ0D 2HKAA 2ZX6A 2ZXCA 3MO1A 5CZXD 3FN0H 4PV8A 1CPUA 2CKNA 4Z7NB 3P1VA 4FS0A 4K7PX 4UV4L 3RGHA 4KDTA 4NM4H 1WQVT 3UJJL 2B39A 3QRBA 4ISVB 4TV3A 3I6LE 2I9TB 2Z3FA 4GAAA 1MDTA 1J8HA 2ZUYA 4S1DC 5KS9B 1HH9B 2BZDA 1S7XA 3QO0A 4JFDD 5CHNA 4K8RD 4OBSA 1XGUB 2BIHA 3LNDA 1ZPUA 4GUCA 1B9KA 1NCCH 3RPIB 2IPTL 4OTXH 3TESA 4XPHL 3VU2A 2EDLA 3ZKMD 4GRWB 3Q2NA 2QKIA 2BSDA 3KL5A 3EJSA 5GGUA 4PMFA 4K8RL 1CXKA 3KYAA 1R17A 2BPBA 3PXLA 4K2UH 3PF2A 1E3XA 4XAKE 4IRZL 2A6DB 3G3LA 2P5WE 4KGJA 3UTOA 3JV5A 3FJTA 3QYCA 1LDPL 4LSQH 1K2DB 4PJFB 1HHKB 2B20A 3U36A 1SGKA 3W9EB 1GYUA 4LPVA 3FRPB 2WVSA 3RB5A 5FM8A 1Y6KR 1P7QD 1XH3A 3D9AH 1PEWA 2DQTL 2NNRA 4D9RE 2WZAA 1S7UB 1S9VA 4JFED 1UH3A 3C5ZC 3UJIH 3KPQA 3QPQD 4KKCD 2VDQH 1KC5H 2V37A 3BGMA 2NR6D 2WO2B 3IDIA 5ALBL 1PSKL 3SBWA 1PQZB 2UXTA 1U30A 1KMGA 4TM9A 3VE0B 1AOZA 4HOWA 3LPOA 5CUSH 4HH9A 4JVPA 3SPHA 4L1HA 4F5CE 3B2DC 5JA9A 5HI3C 4I1PA 1GGIH 5C0IB 3T2NL 2R23A 3KPNA 1VFUA 1MCNA 4J3OH 1URLA 1NAML 5DQDL 2LQRA 2QQNH 1L7IH 1NBYB 4HSCX 4Y8DC 2DKSA 3RGVA 1RAMA 2XTJB 1G7HA 3TF4A 1LK2A 4DFIA 1S9YB 1DVQA 3S37L 4JHWH 5GIRB 4RMSA 1KNOA 1IAOA 5C8JB 3QZPA 3VMPA 1JXFA 1NMCB 1QLRA 1MQ8A 4NXKA 5I1AB 4HIHA 2YA2A 5DMIL 1EK3A 1KT2B 5L8JB 3DYOA 3Q9QA 2XWDA 2J4WH 3MLUL 1I8LC 4Z3IA 3NFNA 3HJ0A 4AKOA 2HT3D 3DUSB 4FMFA 4XB8A 1SOQA 1KTCA 4PG9A 4M03A 5DC4B 4AJ0A 1HKLL 1OAKL 5I1IH 1UD8A 5L6YH 4BZ1H 2OM5A 5FO7B 5GGVH 4EZLA 4KQ4L 2FEEL 3AREC 4J3OF 4IOSA 1C5CL 3NIDB 5EWIL 1OCRB 4OAWA 4Z7WA 5D96C 2QSCL 2VLRB 3TZVC 1LO5B 4X6BA 3AZUA 2C3VB 2BX5A 4MB4A 4HJSA 4PGCB 4ZXBA 4OZIA 5BO1H 1KN4H 4HWNA 2VUYA 5D7IF 3UTPE 4ELMB 1VZGA 4QRSA 4N8CH 4YXLH 2YQGA 1A3RL 5FO8A 1ZLUK 1LD9A 3MA9H 3SDYL 4U3HA 4AITA 3IJYA 2DKMA 4NP4H 3CBRA 1UZ6F 3VRLF 5C3LD 4WKXA 4CC4C 1U8JB 3HAEB 1YEIL 3BPLB 4J3TA 5ICUA 3FQXA 2XQBH 4HPHA 4TS6A 2CR6A 2IAMC 4N5EC 1QA9B 4ZDHA 3KL3A 5JIKA 2ZAIA 3DO4A 2BM3A 1XIWD 4E42B 2K3TA 5MP6H 4KMLB 4J7RA 1C5DB 2VDPL 4KKRA 2M2DA 3RUGF 1ZVNA 2CK2A 2A9AA 1YNLH 3OTTA 4UB0H 1JYNA 1FGNH 1OAQH 1PZ5A 1USZA 3AU1B 4WV1C 1UXLA 4LRIC 4Z77A 1RLWA 3Q7JA 2VW6A 2J12B 5GRVL 3I3DA 4XNYL 1CLZH 3GM0A 2OL3H 5KBKA 3CFDA 3TBTB 5BZDA 1MW1A 5KJ4A 1E2ZA 2FJFA 3MUY1 1AHKA 1T2JA 4Y5XA 2AXGB 1UUSA 4QHKI 1DSFH 3Q01A 2NXYC 3FU8A 1CBVL 1AS8A 5HGAA 3BVTA 3V6FB 1A25A 1NFIA 3WEXB 4QY8A 4WI6A 5HI5D 3QG6B 1OE3A 1J8HE 4OZFB 4F37F 3MLVL 5FV1L 3MCKA 4TSAL 1RUML 5E8PB 2FIRT 5L7XL 1AGDA 1UM5H 3B7RL 1DQDH 3TTYA 5C0JB 4JPKH 2EIDA 1FL6B 4WFFD 5ACMA 1KCSH 3VFWB 3EYUL 1S8DB 2F1EA 2F5BL 1EV2E 2YKLL 5SWZB 4TUKH 1F4XL 3V0WL 1U21A 4AIXA 1U8CA 1YEJL 5DA0B 4RWYL 2PPDA 3VTAA 1Z7JA 4EZKA 2NYKA 4OFVA 4L4JA 4HWBH 2FECL 1NIAA 4XMZA 1JPEA 1JZIA 1MH5B 2MQCA 2Z91A 3QJUB 5DEZA 3VD7A 2NX5A 3HMWH 4JL1A 4ZUWA 3TIEB 4OJDH 3D7PA 1CR9L 4KRNA 5IMKA 5I6KA 5T5FH 2OR8A 1T20B 4A2LA 5CJOH 2AMUA 3S34L 4DEWA 1L3WA 1S9WA 4HPYL 1F1GA 2I27N 4JE4B 3I50H 4NB7A 4Z18A 3REWB 1HSAA 4NUJB 4RMVA 5D72L 5D71H 1F6LL 3IT8D 2GITB 2FDBP 1W0WB 1T1WB 3DX0A 4MAUL 1FBIL 2EDBA 1RZGB 4NCC1 5DURB 5JHBA 3DMMD 4FQ2H 3F65A 3O11A 5H35A 2FO4A 4OM0H 1MCEA 1G7JB 4LRNH 4B7LA 3IMVA 1FYHB 3BAJA 3HE7C 3KJ4B 4XTRC 4NZRL 1TOXA 5EEUA 1KCVH 4PUBH 3BP5A 4W9IC 4AT6A 1M9SA 1SY6H 4M4PA 3R0MA 5CEXA 4MJ6A 5JYMA 1WYJA 4LVNC 3M46A 4F57H 1BF5A 5A7BA 4N2KA 2YD8A 5CD3A 1UVQB 4KKLD 4UOJA 3TNNA 3D85B 3TEZA 4KHXH 3L5XL 1EMTL 4TL4A 3OAUH 3U6XA 2G9HA 2QFRA 1E4XI 3KHOA 4JQIL 5JR1H 2Y4SA 4M93B 4CJ1A 1PG7L 4MMXC 5F1SA 1OHZA 2VM9A 4ISVA 4L0ZA 1H8LA 3ULAB 1U2HA 4MJ5B 4Q97A 4UQDA 1JHKH 2Q7NA 1H3GA 3TJHC 3FYIB 4GKOA 2I25N 1AQMA 2R4SL 5DVNA 2HA1A 3O3AA 5IG7B 3CHXA 5F96H 5TTRA 3OR7B 3HS8A 4W9HC 1J0IA 3RPIA 3SOTA 5E24E 2HPTA 2VRAA 3S0PA 1NCBH 1OALA 1IBGL 1MIMH 1UYWL 2OA9A 2LFGA 4N85A 4LCWB 1JZ8A 5IHUL 2FSEA 3GK8H 2N7SA 3L7FB 2ALWA 2NLJB 3HC3L 4JRYA 3GTNA 2VQ4A 3NA4A 4N24A 5F3BB 2K8QA 3AXIA 1ZTMA 3ZO9A 3T08A 1CF8H 3LTVA 3BW9A 4IEFB 1M1SA 3FYEB 1SVCP 2FH6A 1BZ9B 4Z7WE 3MOQA 4NQUA 4OZGF 4X98A 2DIAA 3LS5H 2A6DA 4NKQB 1OB1A 3Q48A 4FMVA 4RFNC 1LP9B 4PSPA 5K9QG 2CDEA 4OZIE 4Y2DC 5J13B 1K2DA 1SM3L 4LF3B 4PJFA 1ADWA 1HHKA 1U92B 5EU6B 5DVLA 4JO1H 3WO4C 4OCWH 1I9RL 4PHZA 5J06A 5IJVB 4FLSA 3FRPA 3OZKA 1U3HB 2MCPL 1FZMB 4Q9CA 2CCLA 3O2VL 1A5FH 1YAZA 3OJMB 1S7UA 4DVRL 1KLUB 5DMGD 1ZGLA 5AB0A 1QYGL 1HN1A 2D7PA 3JV0A 1F56A 4QTIH 5CLYA 1JPSL 3JWOH 4GLRI 4KV5F 4QOKD 3TEYA 4Z5RB 3G5XA 4FHJA 4LLDB 3FN0L 4CVWA 3PQYB 1KGIA 1PQZA 3BUYB 1IVTA 3VE0A 1EGJH 1XH1A 1A6ZB 4NM4L 4QEGA 4JZOB 2V7HB 2RR3A 4PRBB 3ELAT 1KIRA 3HHSB 1GGUA 4MD5A 4MDJB 3CBJB 4HX1B 4D0BB 1N0LB 3ZR6A 1WS8A 3QI9C 4AYSA 2JQZA 1NBYA 25C8H 3W82A 2X6CA 5D4IA 4P2QB 4OTXL 2WQAA 1IBDA 4JREC 4X0NA 4YBQC 5I9QB 1S9YA 4NKDB 1S5HB 3GZOA 1JOIA 4MSWB 2DOCA 1HAUA 1J0ZA 4XOBA 5GIRA 3MR9A 4LLUA 5C8JA 3RVXD 2YEVB 3HNSH 4PS8A 5I1AA 3VFGH 3OAZK 4QXGH 1KWKA 2DH2A 4UT6A 2OR7A 1KT2A 2CLRA 3B7SA 3NUKA 4AGPA 3WI9A 3DHPA 2R7EA 2ZSVB 2XT1B 4K2UL 3LN4B 1MSPA 5ESQA 1WT5C 3KWXA 3V0AC 1YMMD 5CD5C 3ARPA 4X50A 3MV9D 1G9NC 1O7DC 4LSQL 3NOIA 4FI7A 1F3JA 1VAHA 2EAEA 4WHYG 2A77L 3CFUA 3IU3B 3CZFB 4G2AA 5C86A 4YZWA 2J5WA 5EA0L 4KKAC 1ZD6A 3D9AL 2NX5E 1EZUA 4XN4A 1IBZA 1LO5A 3IFOB 4BQ6A 3VFOB 2C3VA 5T5NF 2CAKA 1E2WA 2NXZD 5HSFA 3AG4B 4PGCA 4WFGE 1OAYH 2NT1A 2VDQL 3LB6C 3RB7A 5DFVC 2CLVB 3D0LB 1KC5L 1RIHL 2JKTM 5CXPA 4TLKA 1EFQA 1FNSL 2OI9C 1LO3H 4Z7QB 3WAJA 2OYKA 3UXFA 2ZCHH 2HXAA 3FRUB 4MBOA 4TF4A 1L4IA 3E8VA 1VEMA 2WQRA 4A7GA 4JHAH 1U8JA 3HAEA 5CUSL 1Q0XH 4ZFGH 3MCYA 4H26B 1GGIL 5FCSH 2PPCA 4GJTB 3T3PB 4Q9QL 1DQMH 2RQ8A 4PRIA 1XGTB 1QA9A 3MU3A 4FA8A 4AMXA 1I1FA 2QQNL 1RHFA 1L7IL 1H0DB 4MFHA 2QELA 4WSJA 2ZAHA 5GGTA 3UBGA 5KW9H 2YS4A 4WF7A 1G1YA 1U95A 2FNWA 1QACA 1MELA 3AU1A 5I1GH 5ALCH 2H0FA 3QW9A 4TLTA 5CIPB 1YLBB 4B9KC 3CLFH 5E2WH 5TF0A 3MLZH 5DK2B 5F9OH 3FUIA 3CDYA 3Q8EA 5BZXA 3FT2B 1ACCA 1BJMA 3MUUA 2AXGA 3EYSH 4FNSA 4Z7NE 3K4DA 1MFBL 4JRXD 5I0VA 5CU5A 3PL6C 3WEXA 4IJTA 5JW4M 3O0LA 2DQDH 2E8ZA 5JOPD 5I1IL 3FBKA 1QWNA 2BVUA 4OZFA 3O3BB 5L6YL 1LK3H 5GGVL 3BP4B 3F2LA 4MA8L 5C0EB 1ANUA 4IYKA 1RQ5A 4KBPA 2K78A 3ZKXC 3KJ6H 3B9AA 5C0JA 1KYUA 3I2CH 4MCZB 5EU4B 5I1DB 4K9EC 4WNQA 3MRKB 5GRWA 5CCGE 2OSYA 3CN1A 3ARBD 2WB7A 5CR8A 5BO1L 1KN4L 5SWZA 4GRWE 4JRYE 3SPCA 3B37A 3MGTB 4N8CL 3FT4A 1QNZL 2BZ7A 4HULB 1MH5A 2OCJA 3MA9L 4G7YH 3X3GH 5JHLH 1JP5A 3CE1A 3ECVA 2VTFA 4OIIH 4X6CB 3UTSD 4GKSB 5G4NA 1HOCA 1VACB 5A3IC 1ZHBB 3VXTB 5H94B 1T20A 2P8PA 2Y3NA 3DVNB 1Z2KA 1NPNA 3CFQA 3MOAH 4PJFE 4UTBA 3RX8A 1XBDA 5GZNC 4ANXA 3FU7A 4JFDB 3REWA 3GPSA 4ZI8A 1IM3A 4NUJA 5MP6L 4OLWL 2AQQA 2GITA 4UB0L 1W0WA 1YNLL 2CIIA 1KGCD 2IAAC 5ECJE 2NCMA 1RZGA 2NCEA 4NDMB 1RJYA 4WI3A 4GUPB 4DGIH 3EJTA 1CLZL 3WIFA 1MHPH 2OL3L 3EUDA 4PJCF 1KFGA 3VJ6A 4QJ5B 5KSBB 3L1OH 2QSTA 3LXBA 3MUGB 4U0QB 4ADIA 4UZSA 1JI1A 3IGLA 4MA3B 3QA3B 15C8L 2ZQKA 4MD4B 1GIGH 3NCFB 1UVQA 5A2BA 3UDWA 4D0CB 1INEH 3WNKA 4LCCC 1MUJA 3RWJB 1P7QB 2F53D 1UM5L 4MMYB 1DQDL 2XTJE 4KXZI 4JPKL 4DP7X 4TUOA 3KDMA 4JFEB 1KCSL 3V8CA 4OQ1A 4XP4L 2YLKA 2ZF8A 3WIIH 1KV3A 4IIQB 4YHOH 4IKLA 4TUKL 2K6YA 3ESOA 3MTXA 5EN2B 4U1IB 5IG7A 4HWBL 5E6RB 2BP0B 4HJEA 3OR7A 4YE4H 4H8WH 3AROA 3K0YA 3HMWL 1MW0A 2JJTC 3RNKB 3N50A 3ARXA 4C56D 1I8KA 3QJHB 3MRDA 4OZHA 4HJ0C 5CJOL 4LCWA 1QASA 1SXZA 1YN7B 4H7VA 2NLJA 3GMQB 1JZ3A 3I50L 1BEYH 4ZX5A 5D70H 4X4XA 5D71L 4YUEL 4ICWA 4R4FH 2OJZH 1BZ9A 4AEEA 1LILA 4MVBD 1X6NA 4UMGA 4FQ2L 5FX3A 4ZZFA 4NIYE 4OM0L 4LASH 4LRNL 5E4AA 1UD3A 2J2ZB 1U92A 2P4AB 4YK4C 5EU6A 1M2VB 2EACA 3CFBA 4GP8B 3D2UD 4FAAB 2V9UA 1JHLH 1ZKAA 1U3HA 2Z31D 1KCVL 3OZLA 1FZMA 1R5IB 3TS8A 1SY6L 4X9YA 3ME0B 4PFEA 3GMMB 2YEZB 4GS7C 1KLUA 4F57L 3LKRB 1RK0B 2X7LB 4HDIA 3EF7A 1H3UA 4KFZC 3FXIC 4BSWA 4KHXL 4PRIE 4ZTPH 5C7XH 4Z5RA 2BSRB 2C7FA 4LLDA 3OAUL 3PQYA 3KS0J 1ADQL 2V6HA 3BUYA 1CCZA 3HCVA 3C5JA 5L0QB 2CO3A 1MCFA 3PGDA 5JR1L 3PUUA 5D8JH 3IETB 1A6ZA 2WCGA 2DD8H 4KUCD 2V7HA 3AADB 4HT1H 3HHSA 4WU7B 1HILB 3H7LA 1JHKL 4MDJA 4FABH 2Y07H 3HG5A 3BUDA 2UZXA 2WP3O 4D0BA 4P59H 4YDIH 2ICEA 1N0LA 5F96L 1X7QB 3RDJA 3V4VB 2NYYD 4LCIH 4P4KC 3KYOB 4P2QA 2E9WA 2VDPB 3NN8B 4GQ9H 5AVXB 1MIML 2XHNA 4NKDA 4PJGB 1J9CT 1S5HA 3VXSA 4NC0B 3EO1A 5MI0B 1FHGA 4Y1TA 1OSZB 2BSEA 3X14A 1A02N 2Y6TE 1CF8L 1XIWB 3BPCA 4KI5E 1DHKA 3O6FD 4AYMC 2ZSVA 4YSSA 3LN4A 3LS5L 3G5YB 1MEXH 1OVZA 5DEJA 2DZEA 4W4NA 2CUMA 4HJUA 1KCLA 3L9BA 1FC2D 4MZ2A 5SWZE 4YEEA 4BQCA 4JO1L 4OCWL 1E7UA 1N59B 1K4DB 1I7ZA 1TDQA 1SJHB 1HC1A 1ONQB 2D2CC 1OTTC 2YPVA 2ZUSA 1OAUH 5A2JH 2V9RA 4LBEB 1A5FL 4IRJC 3W56A 2ZWKA 2WB1A 3W2DL 2JLLA 3TCTA 5GJSH 4PW3A 3ATAA 5HHOD 3JWNH 4QTIL 5JPNA 3FFCD 3D0LA 5F93C 3MQIA 4Z7IA 1WZLA 4O4YH 4B9PA 1SN0A 3US0A 1I1AC 3TV3H 3EXLA 1FZOA 3FTYA 2GY5A 4AK1A 1EGJL 4XZUA 1EZLA 5I28A 3ZUCA 4U1GB 4TPRL 2N1KA 3DHJA 2FO1A 3FSVA 35C8H 3PS6A 4PJXB 4H26A 3S3BB 1FGVH 1WA2X 3QAZC 1DEDA 4PJAF 2E7MA 2ZKWA 1UADC 1F90H 3DYPA 2Q2EB 3BGAA 5PAZA 2JTDA 2W9EL 3EKCA 4NN5B 5JW3H 1KYDA 1IVLA 3ZDZB 5CJBA 4H8PA 4F15C 1VHPA 2DV6A 1JGLH 4ORGA 3VNYA 4ZW6A 2YSSB 5D7SH 3HNSL 3QUZB 4Y2NA 3AWEA 4MB5A 3WS3B 3C5ZD 3VFGL 4QXGL 4U7MA 5DK2A 4FI6A 1BWMA 1HWWA 1OLZA 3X1GA 4BGDA 5I1KH 1UA7A 3FT2A 4GG6B 4M7JL 3WFHB 3V0VB 3AG2B 4B9CA 4F7PB 1PYWB 4PRHA 3MBEC 3DMMB 1OE1A 5ID1A 1P4IH 2DWEB 3CK0L 1PIFA 4POYA 3JV4B 4JRFA 1AMXA 2GABA 4ZAKC 1N0XH 4XPTH 3BP4A 1NFDF 2APXA 2QSQA 4Q89A 5C0EA 5A40E 2E7DA 4KPHL 2E27H 4U6VH 3DPDA 4YC2B 1KBGH 2IV9A 1ASOA 5EU4A 1RKRA 1EPFA 4OZHE 2GK0B 2WUBH 4LCWE 4RIRB 1LQSR 2Z65C 1OAYL 5LN4A 1JBJA 1T7VA 3MGTA 4F9LC 3KLDA 1KIPB 4FF9A 2YGNA 3N41F 5HGBB 5FDYA 1X9QA 2ZCHL 2DQGH 1LEKA 1HK6A 4HLZG 4GRLD 4GKSA 1IRAY 1BFVH 4JHAL 4YLBA 3WYRA 1Q0XL 1ZHBA 3NZUA 3VXTA 2G75B 2IWEA 3MNZB 4YSQA 1TCRA 3DVNA 1DQML 4P2CG 2JKJA 3DRTB 1X5KA 2CDFA 5AB9A 4OQTL 1UWYA 5EU6E 1UFUA 2OKMA 1T21B 2CCVA 1DL7H 4JFDA 1L0QA 1O6SB 2LU4A 3EW3B 5KW9L 3KWUA 5IMMA 4GBXC 3CXHK 2H3NB 3ARED 4BXVA 3MGOB 2W9LA 4PGZA 2VL4A 3DHMA 1I7RB 5I1GL 2X9ZA 4HISA 4NDMA 5ALCL 3RZWA 4QKTA 4GUPA 3KBHE 2KLRA 3UJTH 2EVFA 3CLFL 5E2WL 3C6LA 2A83A 5KOVC 2Q10A 3V0EA 3VI3B 5MEQB 3PQYE 2V9QA 3ZGIA 2EDXA 3X13A 2WHVA 1LEIA 3EYQC 1P5UB 3MAWA 3MUGA 3S5LG 5F7NC 2J25A 5LDSA 5EO1B 3QA3A 1SJEA 2KC0A 4J1UA 1TKWB 1M2OA 2I60H 3MZGB 4MD4A 3R18A 3EHBC 1I9EA 1ILSA 2ZF9A 1LK3L 4D0CA 2E56A 4M7LL 5EZOH 4F8OA 1BV8A 2NY1B 1MRCH 2VSDA 2IAMD 3N6YA 3VD5A 1P7QA 4P2QE 5E1IA 2VO8A 4YFDB 2R39A 3C8KB 3MV8D 2IOIA 3MUHL 4A38A 43CAB 3V5HB 1Q1JH 2C1PA 3VXSE 4IIQA 3L9RB 2GJJA 2NUTB 1OP5K 1ZA3B 5EN2A 4QOKB 4U1IA 3WFEH 3QT2A 2BP0A 4KJYA 4XX1E 4G7YL 5JHLL 3X3GL 5IB4B 2ZKHH 4OIIL 4OGZA 5FWRA 4Y1AD 4OFDA 5DFTA 1T66C 4HKBA 3P4NB 3QJHA 4YHIA 1SOSA 1GPOL 4OCXH 3TPUB 1SDDA 1YN7A 3MOAL 4BINA 2ED7A 1RVFH 1WFNA 4IDJH 4O2EB 2KZWA 3OMAB 1F3DJ 1F00I 1JNHB 4X5XA 3VO0A 1F41A 2BOLA 3FUEA 4FC3E 2CR0A 1MCOL 1YUKB 1X7SA 3IWVA 5IV2B 1NGZB 4JFXB 4FERA 5D6DA 4DT2A 4P4RA 4K5PA 3LX9A 2J2ZA 3ARTA 1MHPL 2ENJA 1M2VA 5D7JC 1Y1UA 1KCWA 1ZWIB 3ZVVA 3L1OL 1J0HA 1G6RH 1R5IA 2V3FA 3Q5OA 3ME0A 1BSIA 5FGRA 2YEZA 1YMMB 1CXEA 3RL2A 3SODB 1CXHA 3MV9B 3ZE2B 1RK0A 2X7LA 1M6OB 5BCAA 5EB9A 3QS3A 5E4OA 1GIGL 2X4SB 3B8YA 5F88A 3T3PE 4BH8A 1TJHH 2QT6A 3U4EB 2WPGA 4OLVH 3FU5A 1F1DA 3OKOB 3IETA 2NXZB 1ACXA 2RTTA 4RA0C 3WIIL 1JZGA 1HILA 2ZWZA 4YHOL 3ATDA 4XC3L 4XRCB 2A38A 1YNKL 1KYOJ 3VD1A 4HC1A 4PY7B 3ZO0A 3CDZB 4IDLA 4H8WL 4YE4L 4NQTA 1VADB 3V4VA 2NY2C 3KYOA 4UM8B 4O5LH 3MNVB 1P53A 4S1RH 3BI9X 4XTRD 4RGMC 2H6UA 4PJGA 3P0YL 3INUH 4PRHE 3DX6A 1U8OB 4C4KO 4H8VA 3RI5F 1DJGA 1M7IB 4DCQB 4B6ZA 1OSZA 2QPFA 5D70L 1SMOA 1XGZA 1NBCA 1J9TA 1KBKA 1WAPA 2RACA 3PWPB 3T1FA 1XIWA 3DKHA 5EIIA 4R4FL 2XWEA 3UMNA 2AJSL 3F64A 2IMNA 3SDAA 4QHKJ 2J8HA 4U6HB 1F2XK 2ZXWB 5J1AB 4LASL 4LOUC 3W39B 4IGBC 1YYCA 2F61A 4WWKD 4L3EA 3TJHD 4RGNE 2O6FA 1S3RA 3H1ZA 2ZOOA 1K4DA 3EG9B 1SJHA 1ONQA 3RWGB 2X9XA 1D5MA 1F0LA 1NIDA 1CTNA 3N1PC 4KK9D 4LBEA 3NCYP 4JRXB 2VUOA 3KYKH 2WLIA 4Z8FH 3WENA 3TA3D 3PLYA 5DRXB 4CVZB 4MD0B 1BGXH 3OGCA 1VGEH 4R7NB 4ZTPL 3RHWK 5C7XL 2YHGA 1B4TA 2J1WA 5AB1A 4H1LG 4JFDE 2XVBA 5C6TL 2KZKA 1IBBA 3AITA 2BWDA 3DJZA 4PWGA 4WO0A 4Y4FC 4UTAH 3T1WA 5D8JL 1X9RA 2IJ0C 2DD8L 3HZMB 1HNYA 2APVA 1QUNB 4HT1L 5CCJA 2AVFA 5ANMA 3TN0C 4FABL 2DLIA 2Y07L 3DJRA 4LVHB 2BNQA 4P59L 1L9NA 4QR7A 1GZQB 1YY8B 4AK2A 5EF3A 1ND0B 3RQ3A 1TPXC 4LCIL 2AEIT 3MJ7B 3AWFA 4GQ9L 5A6MA 2XBZA 2EVJA 1HAWA 2WNGA 1QVOB 4N3UA 5CCKH 4L8CB 2JELH 3GHBL 4BK5C 3QUZA 3T3MB 3CZLA 3WS3A 3L4UA 4K0OA 1JZ5A 2IH3B 4X8XA 4BWWA 4GG6A 4FLOA 3FU3A 3V0VA 4LMQE 4CL7A 4F7PA 1A3LH 3DMMA 4QHUB 1QFOA 2DWEA 2ZOLB 3JV4A 4BFKA 3DO3A 4WHTB 1QSFD 4H40A 3RP1A 4EI5B 1OAUL 3GD1C 1E4WH 3CWGA 1FC1A 3F7VB 3O8XC 3FDWA 2BNRD 4PJ9C 5M94B 3FUDA 2GK0A 3OKLB 1FFTB 4RIRA 5FGSA 3VH8A 2XWZA 4L3AA 4ZUSB 5E0QA 3F7PC 3FHQA 4FHKA 1JDAA 4GO8A 4O4YL 4OLUH 1L0PA 4B9ZA 3HZYA 1KIPA 3UMTA 3F01A 5SWSB 1LQBC 3DROB 2F53B 1RZKC 1NBVL 1O6VA 4DGWC 4N3TA 1EDQA 1LJMA 5IM7B 3ZR5A 5LJYH 2P52A 3WOVA 3ABKB 35C8L 2G75A 1WEJH 3FH5A 3OSKA 3BDBA 3WNNA 1FGVL 4XWGH 1ID2A 3DRTA 2RHEA 3BCDA 4NFDA 3MC0A 4CMHC 4G9FD 1F90L 3I02B 1T21A 5F7KC 5JOFB 1O6SA 2X12A 3CFIC 4S1QL 5KVGE 1CLCA 1HJBC 2LLGA 4G6KH 3B56A 4AG4L 1X5ZA 2H3NA 3QIWB 4C56B 3MGOA 1JGLL 5J1SC 2HUHA 1I7RA 3GSRA 3CU1A 4MNGA 5CBEB 2EXWC 3HC0A 5D7SL 1YA5A 3MMEB 4MMZB 5E99H 5I30H 5K93A 3E38A 3F85A 1TCMA 3I84A 3VI3A 5I1KL 5AEAA 3BZEB 1GGCL 1AIZA 4D3CH 4HK3J 1NL0H 1R3IH 3GTVA 1P5UA 3QZWA 5EZJB 2ZKMX 3NIFF 3WIHH 5EO1A 1QHQA 1R46A 4L9LA 4N8PA 4QLWA 5T1JA 4XH2B 1AKJD 1MREH 1N0XL 1XB6A 5AW7B 5ID0A 3D2UB 4XPTL 1KJ3H 4JFWA 2Z31B 1QLEH 5JORA 2IBZY 2E27L 4U6VL 3GRBA 3V4PL 1KBGL 3RE0A 2RAMA 2GQHA 2Z34A 2D4FA 4E9RA 4PJGE 3V5HA 3WL9A 2NUTA 1FLRL 1ZA3A 1B4RA 4XC1H 1QFWH 5IB4A 4UT7H 3B9DA 4KTDH 3IS1X 4NNXB 2K7QA 4N2IA 3T4AA 2DQUH 1BFVL 4FDWA 3P4NA 3ZTDC 4R3SB 3D09A 3E0GA 3KS0H 1IKFL 3S3SA 4P05A 1IGCL 1JPTH 1KBBA 5H37G 4O2EA 1W2KT 1FNEB 3CFKA 1DL7L 2IANA 4L3EE 4WK2B 4EUPG 3WNJA 3BQUC 4AY0A 4AV5A 1FNGB 1DJYA 5HHVH 2L7EA 3JWDC 2CO7A 4TSCH 3RKPA 5E9NA 4PLKC 2V4LA 5IV2A 1OK8A 4M6NL 1NGZA 4J8QA 1GGYA 2FWUA 3M1OA 4HJ1A 1MRDH 4PG2A 4CU7A 2F7OA 5E94B 3IBOA 5D5MB 4NKIH 1V5JA 1CFTB 2APTA 1ESOA 1IE5A 1S46A 3CX5K 3O6FB 5CGYC 3VFPB 3H8NA 5I0ZA 1B2WL 1KDJA 2BMKB 1I3VA 1S2EA 3SN6N 4Q0XH 2EABA 5ANME 3QUKA 4FNUA 2I60L 3T8MA 3BXNB 2BNQE 3OLGA 5D1ZA 5EZOL 4LKXB 3U4EA 1MRCL 3GO1H 3U7YL 1NGQH 2X70B 1Y18B 5EZLA 3P9MB 2BCKB 5GZND 1DUYB 4PTUB 3TU6A 3O2DH 3OKOA 2MKWA 1J18A 4LESA 2P9RA 4EPSA 1J0JA 1QBMH 4AKPA 3UIZA 1Q1JL 1T1YA 2B8OT 4K9JA 3L5WB 5HHOB 2JK5B 4XRCA 3WFEL 1BXUA 3P73B 5ICXB 5AKTA 1SOXA 3HR5B 3HLKA 4PY7A 5FCUH 2IGLA 3CDZA 4BYHA 3HFFA 2ZKHL 4DESA 1VADA 1BMWA 3QDGD 4KC3B 2ZG2A 4PTTB 1MFEH 4KO5A 4GG6E 4OFYD 2CK0H 5E6SB 5GJTH 3MTRA 4IBTA 5CKAA 1BXXA 3O45B 1U8OA 1IZJA 1GHFH 4HCRH 3GC3A 3KLAB 5LAXB 4UQBA 2RJMA 1RVFL 4IDJL 4I4WB 1A65A 4MA1C 4NQQA 2MTAA 4IRSC 3PWPA 3ZY7A 1ZHKB 2R0WL 3BX7C 3FOLB 1W15A 4NQCB 1QI5A 4NS0A 1J9SA 1QPPA 12E8H 1B3IA 3OB0H 2ODIA 4TNFA 4P06A 3VXPB 2X6VA 2A6JB 4WFEE 3CV5A 2E9GA 3FU9A 4J3VA 3HHMA 1QEWB 4E9VA 2J6EA 5J1AA 3W39A 4BQ8A 4X4KA 4YDMA 3C5ZB 3RVVD 3IKKA 2N3JA 3C9NB 2X6MA 1UKQA 2OP4H 3EG9A 3RWGA 4YN3A 3SYAA 1RUPH 4JRXA 5C0GB 3OKMB 2R8SH 2W88A 1V05A 4KXCA 4MD0A 1KCBA 1RIVL 1PLGH 5LAPA 4RAHA 4WQOA 3BISA 5LUMA 2IPUK 3ULUH 3S3PA 1T5WB 1TJHL 4YVUA 5FDWA 4OLVL 9PCYA 1Z3RA 1MXDA 4U1SA 1FF5A 4ZW8A 3G6JB 1TQTA 3HZMA 3V8OA 2MFNA 4HIPA 4NI6A 3HMXA 4ATTA 5KAQG 4MNGE 2VMDA 5IJCC 2PO6C 5HHPB 4Y9EA 1GZQA 1YY8A 2Z93A 4GEIA 4MAZA 3ZDWA 3FH8A 1ND0A 4CADA 2EVGA 2CU9A 4RVBA 3VI3E 4O5LL 5JW4Q 3MJ7A 2GSIA 3UG3A 2Z0BA 4WCYH 1Q9OA 1UD4A 3SKOB 2WWKO 1T83A 4K7PL 5EZPA 2GBVA 3TO2B 3RVTC 1QVOA 1ET8A 2Y06H 4L8CA 4RSVA 4ZNCD 3K72B 3ULUF 1NANI 4GO6B 4U05A 3AT9A 1KFAH 1CE1H 1AZNA 1NC2A 5DO2C 4KKNA 2IH3A 1OWRM 3HE6C 3Q6GH 1L0YA 3AREB 3U4BH 3IMRA 3U30C 2JCCA 2EO9A 4QHUA 5JNYA 5FW8A 2ZOLA 2Y7QA 5HDRA 3VFVA 1MVUB 2P5PA 4WHTA 1JG9A 2DI7A 1OANA 3CHQA 1GZHC 1GZPA 3FCUB 4EI5A 2AQRA 1TQCB 4AJWA 3E1F1 3C5SB 3KYKL 4A7SA 3H2PA 4Z8FL 3F7VA 3LPWA 4QRBA 4P4KD 1AGFB 1KIUA 1BGXL 3Q8CA 1AHMA 1JV5B 3OAYK 3OKLA 4P3CH 1O5PA 4ENZA 3VM7A 5D7LD 1VGEL 1ZLDA 4ZUSA 1WBXB 2IPKB 2AJVH 5I6XC 1DE4B 2FNBA 3N40F 4G1MB 3EBIA 4FQXA 4C59B 2IANE 2IAMB 5SWSA 3GLAA 2WNXA 2F53A 2G5BA 2L8AA 4UTAL 3HNVH 4JVWA 3ZHKA 3MV8B 2A9ML 2DYPD 3TXAA 5DVMA 5IM7A 1CD1B 4BDVA 1XF2A 1NUDA 1VF5C 4P99A 2BHYA 3LEXB 5T3XE 1AQHA 3VD3A 4M1CD 2J1ZA 2IDQA 3L16A 3EJZC 4GB9A 3DDFA 4Y1AB 1BVNP 4R9HA 3QIWA 3E6FB 3FFOA 4M4RB 1T4WA 2CDGB 2P7TB 4XVSH 4IRJD 3RWFB 5CCKL 4I3RH 2NXYB 4DP6X 2JELL 3NZ8B 3PGCB 3SGKA 1MOEA 3MMEA 1A4JB 4MMZA 3CXDL 3RAJH 3FO9B 4OJEH 4F20A 3MLYH 4Y4KC 3BZEA 2VCOA 1XSIA 4PU2A 3T65B 2H2PC 2WYZA 2A9DA 3C2AH 4FQIL 3EGSB 1YDPB 2G4GA 1UFGA 3ENEA 4OV5B 3GS4A 1Y6MR 1ZV5A 5HGDA 3LNEA 4FJ6A 1HCFX 1F3DH 1UA3A 3A4FA 5AG8A 3KEDA 3U7AA 4XH2A 4L8DA 3Q3GB 2X10A 2L4OA 3HI1B 1HE7A 5CKGA 1PFOA 1ZJAA 2Z31A 2BSTA 2D0HA 1TT6A 5EO0B 4DP9X 4R4BB 1E4WL 1HI6B 2GUOB 2WM0A 4ZUUB 3H54A 2OW7A 2E6JA 3ZE1F 4PBXA 3II3A 1JL8A 4UZGA 2WXMA 3SDDA 3OKEA 3BAEL 3CZGA 3P0GB 2R1YB 4YPJA 3TJEL 3EDDA 1AKPA 1KG0B 3PWPE 4NNXA 3RVUC 5FO9B 1PX3A 5ETUB 4EQ2A 3NZSA 3ALPA 1WEJL 1T5KA 2OXHB 5LDUA 3PP4H 4XWGL 1KBWA 2AJYH 3FF8A 1FNEA 1G4MA 3AAZA 3G7TA 3E6HB 1ZLUH 1FNGA 4G6KL 1LMKA 2WP3T 2WXPA 1M7DB 4ZAKD 3RJDA 5C0DB 4A7TA 5FF6B 2NNCA 4JRXE 1X5HA 3FC8A 3MKGA 1AQDB 3AM8C 2PCYA 2Y9RT 1AGCA 2D7TL 5E99L 5I30L 2AVGA 5E94A 4UQCA 1AMYA 5D5MA 2X2UA 4G82A 3P4OA 1E43A 3SO5A 1PZ2A 3O6FA 1KGYE 2YBRB 3VFPA 1TFPA 3WFDH 1NL0L 1OF0A 1R3IL 2J56A 4KVNH 4CVUA 2PWEA 3WUWA 2Z7ZA 4OM1L 4B9IA 3WIHL 4BKSC 3OBAA 4DP8X 1R3JB 4MMXB 4NQDA 1AFVH 2UX7A 2VZ3A 4TLUA 1F58H 2HT2D 2W0LA 2ED8A 4WWKB 3BYYA 1ODUA 1V10A 4GIPD 4LKXA 2G3NA 5CP7B 3S7GA 1DUYA 4PTUA 2VLLB 3VGHA 4GNKB 3H9YA 3TA3B 4N1HB 1KN2H 4D8OA 3QJZA 3Q1SH 4GBXD 5T1LD 3H0TA 2YOAA 5HHOA 5LVEA 4NT6A 4XI5C 1NCNA 2JK5A 5ACZB 4F24A 5BPPA 5ICXA 2VW4A 3P73A 4XC1L 5MERB 1R5WA 2ZG1A 5AW4B 3T3ME 1QFWL 4KTDL 3UTQA 4PTTA 3RZCD 5DVOA 4DOHB 2DQUL 4HJIA 2X42A 5DF0A 1U3NA 1GOGA 3VB8A 3SYCA 4JKMA 2UZYA 2JCCE 4PJDB 3LQZB 3O45A 5LAXA 4FNTA 3KLAA 1AHWB 2YLHA 3VA6A 1A14H 4KO6A 4GW5B 1MDAA 4RFNB 4AX3A 2GEQA 4R97B 4MX7B 2FCBA 3BP7B 5F8QC 4AQ1B 2FLMA 5GGRB 1A9BB 1ZHKA 3EJQA 1IGIH 3IDXH 4WGKA 4TSCL 4NQCA 4Y5VC 4UMSA 4JRLA 3UH8A 3VXPA 1CDGA 1MJJB 2MOQA 2C1OB 2HJKB 1YUHB 1CZ8H 4JM4H 3W81A 1YEEL 1MRDL 3QQXA 3C5ZA 5EOTB 4NKIL 1ZXKA 2A0LD 3BJLA 2CBTA 3C9NA 1IM9D 5SWSE 1XCQB 2F53E 4BQBA 2R1XA 1CGWA 2BIPA 3RNQA 3OKMA 4Q0XL 2X1QA 2P42B 5HDBE 4N1EA 5CEYB 3RU8H 4ETYA 1UM6H 1T66D 2XG4A 5IVXB 2Y6SC 1E8WA 4UIMB 4DAGL 4DUWA 1T7ZA 1QSFB 1FO0A 1T5WA 1XF4A 2Z0UA 4Y7OC 3GO1L 1NGYB 1NGQL 5DLMH 4DTGH 3NMEA 4JM2D 4UU9B 5AUMB 1S9XB 3WXVH 3G6JA 3O2DL 4HLZH 1DBBH 3FQTB 4HCGA 1GMEA 4K94C 3D39D 3IJSB 3QRLA 2BNRB 2D73A 4URTB 3Q6FA 4JREB 5IIEB 5AWNH 4ADGA 1AR1D 1SHXA 2TRHA 4DPBX 5FCUL 4QRPA 2LV4A 1HIMH 1SLUA 1Q94A 4ABUA 2FK9A 2PYFB 4OLYH 2CK0L 1IGMH 5GJTL 2ZCKH 3SKOA 4F7EA 3TO2A 2FYYB 1I8LA 2EE6A 1GHFL 2PMZA 4HCRL 4MS8D 3RTQD 5EORH 4HZ1A 4X99B 1L5GA 3SPVB 3CXHJ 3RFRA 3UAAA 4G9FB 3K72A 3FONB 1PD0A 3FNKA 1XF3A 3TFBA 3WU1A 4Z1PA 4I5BB 3N40P 3FOMA 1CFQB 3FRPG 4MNQA 12E8L 5F0JB 4BZYA 3K6IA 3AREA 1F6AB 2XWTA 3DIFB 5CJQH 3ZZQA 2ZICA 1FDLH 3O9WC 4W9EC 3TZVA 4F3FB 4Z3GA 2OK0H 3ULUD 3EH3B 3LS4H 3PIQA 2AP2A 5FB8A 1FV1B 4HMDA 4G70B 4NZUH 3IFNH 3MRBB 1G7PB 5E7BA 2GTZB 2R56L 2OP4L 2KH2B 2NTSP 2OI9B 3C5SA 3VACA 3EZ8A 1RY7B 4M8UA 3DC0A 2ORBH 4KKQA 1PLGL 4GKNB 3QPKA 4CC4A 3ULUL 4YX2H 1AKJB 4NN7C 5AFAA 4NQSB 5CLTA 3F5WB 4AQZA 3D50A 4APQD 4HG4K 2Y3AA 2IAMA 2RFXB 4QTFA 1XAKA 5EIVA 4DUXA 1DLHB 4Y4HC 4AVHA 3ILQC 4ERSH 3L3GB 2W59A 3MROB 2FEEI 3BWZA 1WFTA 4OF8A 3ZRCC 2IWKA 2XY1A 2HN7B 4WV1A 1AZBA 3PPEA 2BNUB 4LRIA 3D48R 4YQXH 1IL1B 3UAJD 4AQEB 3CZUB 2IFGA 2PP9A 2XV0A 4FXGC 5CU9A 5D5ME 1F11A 3DX7A 4IGBD 3QYMA 2CIKA 2BHZA 2FJHB 4Y1AA 1A0QL 2HMIC 4WCYL 4NO5A 1MCDA 3E6FA 6PCYA 5D2LF 3PWLA 2HVJB 4M4RA 5C70A 5GS2H 2P7TA 4DKDC 1T1ZA 1LWRA 3RWFA 2Y06L 1UACH 3PGCA 3PL6B 3EJRA 4DSYA 1J5IA 4NQDE 4P5KB 3QDMD 1A4JA 4HW6A 1I1RA 5DI8B 3SDXF 3U6XS 2ADYA 1KFAL 3S5ZA 3FO9A 2MH4A 4L23A 1PIGA 1UD5A 3Q6GL 3T65A 5D7HA 4JDTH 3EGSA 1DBJH 1ACYH 4LGPB 4OV5A 4NRXB 5BS0D 3ZKXB 3UO8B 2OYPA 1FQ9C 1FUNA 3FO2B 5C3IA 5HHOE 4B9FA 3NCJH 3WHXB 3X3FH 3BC9A 4NLAA 1MHCB 3Q3GA 4DVBB 3HI1A 3OAZH 5DJXB 2DIJA 5DXWA 3DGGA 5EO0A 4R4BA 5AYUL 1HI6A 5L4IA 2FAUA 1UCBL 1JZ6A 1TZIB 2WVUA 1HZHH 4ZPVB 4PLJC 1XZ0B 4P3CL 1FWXA 2V2TB 5F1KC 5KVEH 2AJVL 1OM3H 4KDWA 2R1YA 1LTXA 1TNMA 1JWUB 4N8UA 4Z7OB 2EXTA 3NK4A 1KG0A 2K7PA 4YWGL 2F19H 2FYVA 1GMIA 4NQCE 1NUNB 1Q9WA 5ETUA 4WAFA 2GG1A 3CVHB 4I18C 5B7EA 1WIPA 4GAGH 1MRFL 1UD6A 3MRRB 4TVSa 4JN1H 2R29A 4PJ5D 2XPGB 1KWGA 1GW6A 5JO5B 1S3KL 2XZQL 3HE7A 4I0CC 4QCIA 4PRDB 5IHHA 3IN0A 1CICD 1M7DA 5H8DA 2ROXA 5F9WC 4BH7A 1EVTC 5C0DA 2EC9U 2IDFA 4PWIA 4ZMQA 5I66A 5KSAD 1WIOA 3L9YA 2VDMH 4GI9A 2Z4QB 2APSA 3N44B 1ZT7B 4JFVA 2O6EA 1BM3H 4I3RL 4XMXA 3ZJAA 3DGDA 2PR4L 3ZQWA 4XX5A 1K3IA 2EH7H 5DHVA 4XO5A 3GMPA 5E4EC 3RAJL 4B97A 2J73A 4OZFG 1OW0C 5CAYB 1SEBB 3MLYL 4J23A 3CHPA 2L7UA 1G6RB 4R4ND 3NJMA 1LO0H 3G6JE 4HETA 1DFXA 1G7IB 1JWSB 5D6CB 5H4ZA 2H1LM 3LQAH 2AXHA 4IBLT 5DUPH 5AW5B 4OD2B 2JE8A 4MMXA 3WJJC 2VXQH 1A64A 3F00A 3OGOE 4Y9FA 4QRPE 2Q8AL 4K55A 1EFXD 2FR4A 3TT3H 4H1LH 2ATAA 5CP7A 2HLFC 5AW2B 5I5RA 1R1CA 4UQ2A 3WJLC 2FH8A 1QP1A 2VLLA 4HIJB 3NFPB 4AVKA 1FZJB 1LDSA 2AXJA 1PZAA 4QRUA 4R0LC 3UC0L 5ACZA 5IB2B 1MI5A 4NWTH 3HC2A 1AVAA 1NIEA 1PTZA 4XODA 1CGVA 5F72S 1H19A 4OT1L 1GTFA 3K80A 1FJ1B 3BMWA 4N6QA 4NC1C 1XF5B 4MNQE 3I9AA 1XCXA 2X0UA 4Y5YC 4H8HA 4PJDA 2Q20A 2AJYL 5DQ9A 4PGEB 2VXTL 1SBBA 2UXGA 3TASA 5FK9B 4XR8C 3QJFB 1XTMA 4NC2B 4MNHB 3GRWH 4MX7A 4Y2DA 5AKVA 5DYOB 5FFOA 4D0DB 5L8KB 1A9BA 2LTQC 4U6XB 4JJ5B 2ZX5A 1X5GA 1EJ6A 3V95A 4JO8A 3COOA 3S88H 1MJJA 1QMUA 4IOFD 3U0TA 5LXGH 1GSMA 2AMGA 2BVTA 2C1OA 2HJKA 1YUHA 2HG0A 1V3MA 2LHAA 3FQNB 1Y7VA 4UQEA 1J5OH 4GS7B 3W0WD 4M5YH 1UA6L 1FAKT 4TUUA 5EOTA 3WXWH 1MAKA 1ETJA 3OMIB 2K6WA 3QRGL 4HGKC 3EYOA 3ZDYB 1XCQA 5C08D 5LHDA 1HINH 2P28B 2F15A 5EU5B 5HDOA 4HUCA 4Y9CA 3VDBA 4EBQH 4JGMA 5IVXA 1AFVL 4N2DA 5DGQA 2DIBA 1K85A 3ISRA 1HS6A 1NGYA 3Q2CA 1J0KA 1IGJB 3H42L 1S9XA 3QI9A 2C9AA 2FQDA 4Y1AE 5ABAA 1E8XA 3FQTA 4PJEA 4P4KB 3BQUD 1FRGH 1KN2L 3FPXA 3FT9A 2BNRA 5DDHB 3B2VH 1DVSA 5D7LB 4LEXH 1BM7A 4XOEA 4K71C 2BSCA 4UOW0 5JIHA 1Q1PA 5G4OA 1BD2A 1BBJB 3ZLQC 1KDIA 3TL5A 2DYPB 4HXBH 5IEKB 4Z7VB 3BZ5A 4AXWA 4JFOB 4E9SA 2N0MA 4F33B 1A14L 1E30A 4X99A 4CSSA 1WT5A 3SPVA 4AKQA 2ESVE 3JBG7 4LLYB 4G9FA 2Z64C 3LKQB 1B0IA 1HT6A 4FYTA 1JVLA 1Q0YH 2VQ1B 2GAZB 3ARGC 4UZUA 1CFQA 1IGIL 1Z6JT 3IDXL 3MREB 1J9QA 1GSKA 3PWUB 4G6MH 1TR7A 2HRPH 4LCUB 1CFNA 4WGVB 3DIFA 1T3FB 4AGLA 4IRJB 1H3TA 1LLAA 3DTXB 1I8IB 2OCFD 4JM4L 3NSDA 4RX4D 1JZ7A 3K6SB 3NESA 5D1QD 3E2HC 2OTUB 2X2JA 5EUKB 4MQTB 3BVUA 5E2VH 3MRBA 1G7PA 2GTZA 1UXMA 1Q9LA 1CFSB 5IJKC 4FTVD 2FT6A 3RKDC 5I6MA 3ZKQD 4X6FB 3I9IA 4E41B 4P2OC 2OJEA 4U2ZA 4FL4C 2JI2A 1UM6L 5B1KA 4UYQA 4WUKH 4GKNA 2J8UB 3LEYH 4LOVA 4QHNB 3K74B 4NQSA 2ZXDA 3F5WA 1KXVC 2QZQA 4JG0H 1F1AA 4XNBA 3WXVL 5F7EH 1DBBL 4NO0A 3DUUA 1I1CA 2QL1A 2CQVA 2FQGA 3PAUA 3VXOA 4B27A 4IU3B 5FS5A 2EDNA 4PBWD 5AWNL 4F15B 1P0SE 4G5AA 1NINA 2EE3A 3PNWB 1ZLSH 3WN5B 5DSCB 1JSYA 1KXTB 1NC4D 3QORD 5H37H 4AQEA 1HIML 2A74B 2J1YA 1CDJA 4QXTA 2LR4A 1JE6A 4XX1G 2C5DC 2FJHA 4OLYL 1IGML 2ZCKL 2R2BB 5LG6A 1I3RA 2XN9D 4HXAL 2HVJA 2ZYIA 1A4CA 3NSFA 2IWFA 4G7VH 2DI8A 3AB0C 4ZMWA 4ZS6C 1CIUA 3PL6A 3RWCA 2KBGA 5DI8A 5DJAB 4IJ3C 4NRYB 4ZAKB 3RNQB 4RZCB 4U1NB 4F2FA 1OSYA 2X41A 1HNFA 4KTGA 2ARJQ 4NRXA 1FDLL 4HUUB 3LNGA 3CX5J 3FO2A 4TYUA 1ZEAH 2YD6A 3LS4L 3QZMA 3FTZA 3R7RA 4NZUL 2OZNA 1MI5E 3IFNL 1CDBA 4DVBA 1QLEB 3DJ9A 4RRPM 4N8VB 1TZ8A 4H4NA 4FFWC 4JCWA 1XO8A 4FLHA 4DOHE 1FFNA 3DSFH 4ZPVA 4PJDE 2Q8BH 2CKBH 2D7NA 1UXWB 2R69A 2ZXQA 5GPRA 1J05A 3AY2A 2OTWB 3DV4A 5GZNA 1T89C 2VT0A 4ZMAT 2PPFA 2JXMB 1NEUA 4ERSL 2J1XA 3CVHA 5H2BB 4R5XA 3BE1H 5GS2D 3MRRA 4GBXB 5B39B 2QGBA 1E4KC 5T1LB 2XBDA 1LNUB 4PN6A 2ERJC 1YNTB 2XPGA 1BZEA 2H32B 4HJTA 5EBWB 2UUDK 3BOVA 5JO5A 3JT2A 3NCEB 3RZCB 1MZZA 2AK1L 4PRDA 4FE9A 5A43C 2COVD 2UV3A 4NN6B 1AZRA 3BD3A 4EZMA 5E1GA 2DJMA 2Z4QA 5E95B 1SHWA 3O4LA 1ZT7A 2B4CH 3GDCA 5TFSL 1WCBB 1UACL 3CVCA 1JTTA 5IVXE 4JANB 3QUHA 3HG3A 3S97C 2BHUA 2EC9T 2HTKD 1ORQB 1OB0A 1R24B 2P43B 4P2RA 1MKFA 4JDTL 4LCCA 1DBJL 1G7IA 1ACYL 2ENSA 3H6JA 4PJEE 5D6CA 4I2XB 2Y1YA 5AVTB 1JV2B 1N2RA 2BNRE 3C6SA 4AE0A 1RI8A 2ICES 5ITBL 1WD8A 2CM5A 3NCJL 3PHOB 3CFMA 3N42F 1SVBA 5KYWB 1A1OB 1IM9B 1FL5B 1TZHB 3T2LA 1BD2E 4AI7A 3ZZ1A 4ZW5A 5IBTH 3EJZD 1B4LA 3NFPA 1HZHL 1FZJA 4HIJA 4KJPC 1DN0B 4TQPA 1EIBA 2JJTA 4ODSL 3GBMH 5KVEL 2EDYA 2I85A 2BVPA 4L8SC 2NY3C 1DBKH 5IB2A 4GUOA 1X5JA 4ZMNA 1BVZA 3IDGB 4G9FE 1O7DE 2KERA 4JM2B 4BSVA 1X9UA 1BVLA 2F19L 3A4DA 1XF5A 4JO3H 5M95B 2ICWB 4D94A 1DTUA 3D39B 2C4FU 4GAGL 4Y4KD 1E9OB 1WWCA 3SCMD 4EE2A 4ZT1A 5I8KH 3CVDA 4L4VD 3CBKB 4JN1L 3MRGB 2B2XH 2WQUA 4PGEA 1AR1B 3R19A 1EVUA 4P5RA 3V0DA 1U33A 1ETZB 3IM1A 5D1XD 1NGPH 1J0YA 1E9QB 4M6MH 4MNHA 1J1PL 1X5XA 2FGWH 5DD6B 5DYOA 4ZMXA 3ML9A 4U6XA 4JJ5A 1H6UA 4X9IA 3AJ7A 1DJXA 5IB1B 2VDML 1FHNA 1L0XA 1LEGB 4WRLA 2ZSWA 1IUZA 1MCRA 1BM3L 4OJCA 3RTQB 3SJVB 5BVJB 4RFEB 5F7WC 2EH7L 3N43B 5KAQF 2B1HH 1IMHC 2LE9A 4IW4C 2Q1EA 4LGRB 4ATWA 3CFCH 4NERA 1A6AB 3FO1B 5C0CD 3GI9H 1E4HA 1LO0L 3KG5A 5HHMD 2JB5H 3W9DB 1A7OL 4Y7MA 1AZVA 3ZK0A 5EU5A 2A4CA 3LQAL 4WI8A 5FOBB 5DUPL 3B1UA 2VLJA 4UILH 4OD1H 2VXQL 3HBZA 2A99A 1UWFA 2PABA 1UT2A 3H56A 2BRRH 4JFPA 5DJ0B 4XWOC 4YLQT 3ISYA 2QV4A 1Y07A 1UZGA 5E03A 4S11A 2M26A 1EZVY 3EBHA 3H55A 4P4KA 2MNJB 2EVIA 3FHAA 5DDHA 1KJVA 2PW2A 2IMMA 3CVBA 5D7LA 3RY6A 3AGVA 3DI3B 3S4SG 3TNMB 3L5IA 1IC5L 3QULB 1E5ZA 4APQB 1TG8A 1BBDH 5EOCH 3AWGA 5ERWB 1NCIA 1BBJA 2VDRB 3RG1C 2O61A 1BVKA 4HWZB 2YJQA 3ML8A 3WDJA 2ODHA 5IEKA 3F7YA 5TDOA 1PG7X 4LE8A 3B9KD 5G55A 2DJ4A 4LU5H 5E1AB 2QVMA 4F33A 1TQWA 2ARJB 2Y25A 3RYMA 4KK8C 4FEMA 2D3NA 2WKOA 3DPBB 4LLYA 3LKQA 4UT9A 3GRWL 3LZLA 5T33H 4IGBB 2VQ1A 5IGXH 4DP0X 3PWUA 3LVTA 2JB6B 3ZL4L 3DX9B 4UYPA 1IFHH 4LSSH 2N4IA 2HFGH 4LCUA 1LVEA 5LXGL 3S88L 3VRJB 1T3FA 4IRJA 1I8IA 4XCNB 3K6SA 4K3EH 5AB2A 3QDMB 4M3HA 1MFVA 3WFBH 1NEPA 2OTUA 1M56B 5EUKA 3KLLA 3RPKA 1I53A 1TU2B 1J1OH 3SIKA 3WXWL 4YHPA 2X89A 1CFSA 3HG0A 4Z7OE 4HBCH 2J44A 4OVVA 4N9OB 4X6FA 4E41A 1I1AA 1LWJA 3CXFA 1RIUH 3SYPA 2VN3A 3U2JA 3L3KB 1RK1B 3GSNA 1BXVA 1HZKA 3SDCD 4ALAH 2X4TB 5C2UB 2J8UA 2M8XA 2E9IA 3QJTB 5I8EB 2JV6A 4QHNA 2DYSB 4TXVB 4XN9A 3T71A 2YC1A 4L4TA 3FTGB 1KCKA 1R3HB 1WAAA 3OG6B 3BIBX 1N19A 4ZFFB 1ZS8B 3B2VL 5LNEA 3WTXA 4IU3A 3O4LE 4QYOB 3PNWA 4LEXL 3LZFH 1ZV9A 5DSCA 2W94A 2MIZA 2V2XB 3DOIA 4ZOCA 4TNVK 1IT9H 1WITA 1S78C 4RMRA 1K9TA 4P2RE 5EIIG 4AV0A 2W5PA 4XAKD 5I2IA 1HEHC 1V27A 3BLKA 3MRJA 3MBEA 4PJ5B 5G4MA 1EZSA 5JPMC 1BMGA 1IBFA 3NCCB 3BVXA 3WFZA 5DJAA 4NRYA 4ZAKA 1UOVA 1CICB 1MY7A 4RZCA 4U1NA 3KL0A 4G6ML 2HRPL 5KSAB 1MJ8H 4HH8A 1OM9A 4MB1A 5AAMC 3ARFC 4HUUA 3HI5H 1FH5L 4PJ9B 1GA2A 1KIQB 1UM4H 3VI4B 4GP5B 5AOLA 1MCSA 2ETWA 4F9LA 1SHSA 4N8VA 4TLSA 5E2JA 5FECB 4LSVH 3U25A 1DJWA 4O02A 1YEHH 2IOMA 2FJGB 5J6SA 1MQKH 4WUKL 1A7PL 5DJDB 4HALA 2F7IA 5AQ0A 1EFXB 1EAPB 5T3ZL 4CJ0A 2OMNA 2OTWA 4JG0L 4BKLB 4W9DC 1T4KB 2AJXH 4JPWH 2FWSA 3PV6A 5F7EL 1WUZA 1X3DA 2Y22A 2JXMA 2HFFB 2G30A 3BZFB 5H2BA 4GBXA 5B39A 1F02I 3SGEI 4HIXH 4XP1H 2XNAB 1SXBA 1HHJB 1ZLSL 3GMOA 3HBGA 1MAJA 2I69A 4HKXB 4P5TC 4H0HB 2H32A 2DM4A 5E8EA 2CXGA 1P6AB 3C87A 4JG1H 4LIQE 5DUML 5LBSA 5LNDA 3HG2A 1WTLA 5JA8B 3ZDYE 1VLXA 3EJCA 2NZ9C 1LXMA 1MHHA 3FO0H 2R9HC 2WJ7A 4G7VL 5CR1A 1WCBA 2VLJE 3C8HA 4GQZA 1YRKA 4PCTA 1TO4A 4QNPF 3DURB 1KGUA 1ORQA 3LYRA 3S35X 4W9KC 4L8BB 3OX8B 4I2XA 5TF1H 3H3PH 1RZJH 3OLDA 1JV2A 5I71C 5GZOC 2ZUXA 3DBXB 3B2PA 1ZEAL 5D7LE 2CMRH 5FOJA 1D6EB 2VKWA 3PHOA 3VH8G 4LDOB 2EDHA 2HTLD 3VG9B 4HCIA 5KYWA 1R3KB 1A1OA 3UTPD 3C2SA 5HXMA 1IM9A 3L4YA 3RHWF 1FL5A 1TZHA 2EVHA 5C08B 4OD3L 4Z7UA 4DNLA 5HD8C 1GYWA 2Z1KA 3KLQA 1IV8A 3DSFL 3EH2A 1DN0A 1KZYA 4FG0A 2ZOTA 3EH5B 2Q8BL 2CKBL 4G6FD 1FZKB 5IQMA 2VN6A 4GRWH 4BA8A 3IDGA 5KYYA 2J8OA 1IAII 4TSBH 3I3EA 2R2CA 1J86A 2ICWA 2YD1A 3BQUB 2JKNA 2FSDA 1KEMH 5H4YA 1E9OA 2Y2WA 4Z7NF 1E9PB 2Y5TB 1DDTA 4K23H 4U1KB 3MRGA 1ETZA 1TYRA 4RAUB 2FUQA 3MN8A 5E6UB 2DLFH 3KCPB 5DD6A 2C4FT 1NGWB 5D7JA 3M1BA 3L6FA 5KS9F 4MCNA 4X5PA 1L9OA 4E41E 2XA8H 4E68A 2B4CL 1CVSC 3QZWG 4WJKB 3SJVA 5BVJA 4BZ2A 2W81C 3TBVB 2J8UE 4DZBB 4JO2H 1J8HD 3CDGB 4P5MB 2FHFA 4GRWF 3JZYA 3KCWA 1PDKB 5BV7H 2R0KH 4L4TE 2V5MA 3VXMA 1WAAE 2H4EA 1PLCA 3CSFA 3L1GA 3UBXI 5D1QB 4PGBB 5JIMA 1G7LA 4B41A 2XFXB 1CYXA 4FTVB 1PPIA 3NJGA 4LP4A 1G43A 4PJFF 5K39B 1ZMYA 4BRVA 3QNZB 2G0KA 5IBTL 4P9HH 2EKJA 4HG4J 4A2MA 4DGVH 5K9KB 3GBML 1NCHA 2O93L 3ZHLA 5CBAA 1DBKL 5TD4A 3MYJB 4EAEA 5FV2A 5KYXB 3QULA 2JFCA 2IG2H 4LO9A 2CA3A 2HRHA 4J3BA 4HWZA 3LDBB 4JO3L 3ESNA 4UT6H 3L3OB 4CMMB 2NMSA 4U4BA 4YL4A 5BQ7B 3NAAH 1HH6B 3VD9A 4DEPC 1KB9K 5CGBA 1NSNH 2B2XL 1ERNA 4NHCH 3QNYA 3DPBA 1NC4B 1NGPL 2JIXA 3QORB 4M6ML 1OL0A 4WU5A 2FGWL 2J6WA 1UWGH 4IGBA 4P2YA 1AE6H 2Y0SA 1ZK5A 3RPBA 3K7UA 3EJPA 1HXYB 1U8MB 3DX9A 1HHHB 1P1ZB 3S5LB 4R96B 2XN9B 3TEXA 3OLEA 3VRJA 4MZIA 2EDFA 3KWWA 1E6OL 1OGTB 4FZ8L 4I77L 3WNOA 4BK4A 3ZU8A 2Q3ZA 4XCNA 3F8UB 1CU4L 4HMCA 4OV6F 1QSED 1CMOA 5HYSB 2B1HL 4O2FB 1BZDA 3KD4A 2C4XA 1TU2A 2E5EA 3BRFA 4NENB 1WA1X 3QEHB 4NUGL 3TYFB 3A6BH 1WRFA 4R2GC 3L13A 4FG6D 3RGVD 1GCFA 1CT8B 2QR0B 2ZG3A 3L3KA 4XBGB 1RK1A 4G8GB 4MQXD 4Y4FA 4UILL 4V2BA 2VR3A 4OD1L 2X4TA 1YAIA 3HAEH 1G0YR 5DUBA 3VGEA 3ALWA 5AVSB 1VERA 3LEVH 2VMFA 5I8EA 3AG1B 3TN0A 4J2XA 3KBEA 1HTYA 2BRRL 2JSFA 2MKLC 3H9SD 1YJDH 3DSNB 1KGJA 3T0EC 1SZNA 1M05B 1R3HA 3B6SB 5GGTH 1M42A 4HK0B 2NPLX 4ZFFA 4G1EA 1JZDC 2K3HA 4LPTA 4Z3EA 5B8CC 2G3XA 1QO3B 4IKKA 3HEIB 4GW4A 1TVHB 1CGYA 1BBDL 5EOCL 1JJUA 4BK5A 4ABVA 3L7EB 4NLHA 4ELMF 1G7QB 4JFFD 3ZQ9A 4F80A 4QXUH 4JFYB 4Z3JA 2JF1A 3UYRL 43C9B 4A7QA 4I2XE 1QOKA 3QWNA 2RIKA 4LU5L 4W9ZA 3X1EA 1O5DT 5TH2B 3U30B 4A7GF 4ZXBD 4Q6IB 1N12A 4U3XA 3S8FB 1JN6B 5B7MA 5T33L 4OZFH 5DC2A 4OB5H 3PPSA 5HVHC 4U1LB 1MCQA 2B1AL 3D0VB 3LSOB 4Z7UE 1ITBB 3GEWB 1IFHL 4LSSL 5C0NC 2HFGL 5KYXA 4NQVA 4B0MM 2VXVH 2CHNA 3OWEA 1JZHA 4TN9A 5FYKD 4F8QA 2XICA 4PJBB 4U3CA 3O8XA 5DFAA 4PJ9A 1KIQA 1U8NB 2OV0A 2YKKA 3MNMA 5AVWB 3DV6A 3O3UN 5SWQA 1B0RA 2GIXA 4M9OA 5FECA 2OX5A 3GIVB 2W95A 2FJGA 2E7BA 1F4HA 3STLA 5INCA 5ENWA 3QWOB 1T2QH 2E86A 2ZUWA 5F3HB 1TSHA 2NY6D 4Q52A 5DJDA 5FGBC 2HJLB 3EXJA 3SPIA 3BVDB 4Y2OB 1EFXA 2GBUA 1EAPA 5CFAA 1RH8A 4UTBH 4UQ9A 3P0VH 1T4KA 1KLGA 4PIRF 2HKHH 4NRZB 1M4KA 2HFFA 1HSBB 3BZFA 4XVTH 3ZE0B 4KI5F 2CBPA 1H8SA 4OF5A 4PCKA 5EFIB 2IV8A 3SJVE 2EICA 1JD9A 1OAZH 2XNAA 3LZFL 4HKXA 5MEPB 4JQXC 1U93B 4JO5A 4RBPH 4AM0Q 4WTQA 3JQOB 1NUGA 1BPLB 4IHOB 3NGBC 3VXME 3T6XA 4R7VA 4Z7AA 2NY5L 3K2IA 2KZ1B 4Y4KB 4OLXL 1WV7T 3G6AB 4UAOC 3RKDD 3QIBC 4L4VB 1WK0A 2WXHA 4PSRA 2DQJH 1SFHA 4JDZB 3STBA 3MLPA 3OG4B 1WDAA 4P2OD 5D1XB 3PAYA 4JAMB 2PWHA 1DUZB 4GKLA 3UBHA 1KCRL 3T8VA 4KROC 4WTXA 3T5WA 1MJ8L 3A6CH 2NX5D 4L8BA 3OX8A 1VFAB 2P3YA 3RL1A 1OGAA 1QEXA 4DPRA 3HI5L 3RDTC 1UH2A 2DJUA 3EYFA 2VR7A 3FB5A 3GBNH 3KR3H 3NSXA 4WFGD 1UM4L 3B2UD 3LXUX 2APWA 2YO3A 1BP3B 1X6LA 3NZHH 4FQJH 4G7QB 1R3KA 3TBYB 3ARYA 4X4YB 5C0CB 1G1CA 1IC7H 1GS8A 4BBWA 2QPEB 4B9JA 5HHMB 2V2WB 2LOEA 1YEHL 4N20A 1YQVH 1O0VA 1PD1A 2XYCA 4TNWF 5IFAH 5INDB 5FUCC 2O6DA 1KB3A 1D5IH 1XR8A 5FKAB 4EZJA 1FZKA 1LE9B 4R5TA 1PLBA 3RJQB 4O58H 4NQXB 5EPMA 3ECUA 4GRMB 2XCMC 4ZS6D 3IXTA 2AJXL 4JPWL 2F54A 4ESKA 4F1SA 4FCHA 4N2BA 1FL3A 4NNYB 4WGWB 4ES8A 3QUXC 2YK1H 4P2AA 3BQUA 2W1NA 1JRHI 3DVFA 4PVBA 3OAYH 2Y5TA 4FQHB