1SLUA

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
133
structure length
131
Chain Sequence
IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMHCPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
total genus 16
structure length 131
sequence length 133
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sluA00
4NIYE 1FI8C 1N8OE 1SLXA 4IW4C 1IFGA 1SLWA 1ID5I 1XXFC 1AZZC 1EZUA 1SLUA 1P0SE 1XXDC 2Y6TE 1ECYA 1EZSA 1SLVA 1ECZA 1XX9C
chains in the Genus database with same CATH superfamily
5G2NA 4N8VG 3CHSA 3WN6A 2WSDA 4UINL 1XZWA 1JHTA 1PLGH 3PREA 4YR6B 3ULVL 4U1IB 4GKNB 1Y18B 4PV9B 1CBVH 3VWJC 3IKCA 1C5DA 3TF7C 4I1RA 4A6YA 2NY5L 1PZBA 1PG7H 3BT2H 3FB7A 4PRHA 2HMIC 2HN7B 2ZICA 2RQ8A 3AU1B 3QUXB 4YC2B 4DP9X 2IH3B 3GSRB 4ZJ9A 3N5AA 3D8MA 2V17L 4P8QA 4UWQB 1INEL 1EVUA 3KBPA 2Y3NA 2YA0A 4YWGH 1AY1L 2OMNA 3LV3A 4ZYKB 4BJLA 5I17A 1I1FA 4L37B 4PWIA 1S78C 5CZKA 2E7HA 2D7OA 1ADQL 4HS8L 3J2PA 3HC2A 2VO8A 3IXAA 3T0VA 5DTFB 5I6NA 2L3BA 1P5VA 3Q44A 4LLWA 4N2MA 4OFPA 2H0EA 5T3XL 4OLVL 3PWPA 3HLAA 3T2LA 4S1QH 5F88A 3QJFA 4KC3B 2YK1H 4TNVK 2CKBA 5DJYB 4YSSA 3WE6B 4XPTL 1UA7A 4X6DB 1TETL 3EFDL 3CFNA 1DQQB 3KPSD 5JW5B 4NBYB 2OTUA 1IKFH 3N50A 1EZSA 4AV4A 4Y1AB 1SXZA 4YHNB 1T83C 1KTLA 1V10A 2XN9D 5HVGB 3D69A 5T3ZD 3VXSD 1DO5A 3DYPA 2QFRA 1KXHA 4U3SB 1I8KA 2A3TA 4FFWD 3EUDA 5E99L 2W9EH 1XGRB 4NYLB 4UQEA 3GBML 3O8XC 4YXLH 3O4LD 1MOEA 3T0EE 3JTBA 3STLA 5E70A 1IJ9A 2NSXA 4G3YL 5AL0A 4DEPB 2WBJA 3QT2A 2JF1A 4DO4A 1FFOB 4MDIA 1GMIA 4XB7A 5HPOA 3SY0B 2Q76A 1KB9K 3F7PC 3DX9A 4B5EA 3HG4A 3RZCC 3DOHA 1F3JA 4YE4H 4PY8J 5I1DB 3GSXB 3LVEA 4F8OA 1CDJA 2CRMA 1VADA 2WXKA 3HUJB 3KWWB 5EC2A 4WHDA 3VWKA 2VUOA 1AGBB 5H94A 1TR7A 1AI1H 4DPCX 4OVVA 3FYEB 4MWFB 3HBZA 4S11A 4HWZA 3UCQA 1L0QA 2P5WA 3DI3B 3Q6GH 3RDTB 3V4UH 2YMOA 2AQNA 1J8RA 3NIFB 3WUWB 2Q7YB 1NFIA 5D6DA 5C0IA 3V6OE 1HZHL 5F6HI 4HG4K 1A14L 2DYPA 2IAMA 2V0AA 2IWEA 1ORQB 5FYKE 4JDEB 1JGDB 2WAQA 4ZG1A 3DMMD 4JM0A 3L3OC 1VCAA 4JVUA 3UMNA 1IGCL 4WU5A 4FL4C 2CBTA 4X6DA 1PD1A 4ZMAT 4AGPA 3MLUH 5BS0E 4NQEA 2MH4A 2VNCA 1IB5A 5KVFH 2R7EA 5DUBA 1PNDA 3GFUA 4M48H 2DAVA 1TG8A 2CSPA 2LE9A 5EZLB 5J56B 2B77A 2X2UA 3TWCL 1JGLH 4ZPTB 2EDMA 1PTZA 5B39A 1MY5A 1YG9A 4PY8I 2G60L 1A7QL 2J2ZA 3B3IB 3K2IA 3QG7H 3FUDA 3APMA 4HFWB 3WXWL 2EIZA 3UERA 1QR4A 3WTTA 3PWUB 4Q2ZA 3ZZQA 4ZAKA 4HLZH 5ICUA 2VZ3A 3ZL2A 2VMCA 2P48B 4MJIB 3W37A 1IAIM 2ZKYA 4GNKB 3WKQA 5ISZE 3MJ7B 3SKOB 3U83A 1ODUA 1YA5A 1HCFX 3O6ML 1N67A 2F7OA 1LILA 3QG6A 4MD5A 2QKSA 2I60L 4APQD 3ZL4H 1TTCA 1LE9A 4MMXC 4L05A 4ZOCA 3MGTA 5JORA 3DSFL 3SO5A 3I6LD 1JK8B 4MNGE 2R83A 3FQNB 3TWYA 4FFZL 1KT2B 4AQ1B 1FV1A 3C8KA 2R9HD 4R4BB 3MOAL 2P24A 2Y3AA 5CEYA 1E8WA 4PRBB 1BQHG 4LSRH 5AAPA 2C3XA 1AKJA 3NCFB 3OKDA 3MRKB 2XIBA 4W9CC 4U4BA 3K6OA 4HCRA 2I24N 3CH1A 5FO9B 2XKUA 4GAGL 1D6EB 1LO5B 3O3UN 3HJEA 5I73C 5LWYL 2FBRA 3AB0C 4XTRC 1G94A 1V7ML 4XC3H 1HI6B 3IDMA 5JPMC 1WP6A 5KN5B 2R0ZH 1M9SA 3CLFL 4M1GH 2HJLA 4DVBB 5E9DB 4HQQH 5F71A 2BP0B 2WLHA 2C1OA 5I28A 3BIAX 3VXRA 1Q9LB 4OKVA 2YSTA 3UTPD 4ZYKA 5KEZA 2D03L 4YNYB 1MCDA 5J57B 4ZMVA 3F7VB 4W6YB 1JHKL 5FYJU 1UHVA 2J21A 3CQQA 1Q9KA 1YEEL 1YYLL 2F19L 2PKDA 3T08A 4C54A 4UMSA 5EU4A 4D0DA 4E9QA 4F8NA 3JVGC 4KH9A 5TE7L 5DHYB 4G7QB 5BUGA 3MYJB 3HC3L 3QE5A 1H8SA 3SGDH 3CJJA 1BBDL 3EOAB 4ZXBC 4AV5A 4LLUB 5AWNL 3K0WA 4EN3B 4PRAA 4LBEA 4U05A 1FZJA 2D7NA 2GC4C 3RWDA 2KS0A 3QI9A 4Z7WE 1GPOL 4WSKA 2F8IA 3T3PE 3Q8CA 4UDTB 3WD5H 1HEHC 4RNRB 1A4AA 3HN3A 4G7VH 2WP3T 1PL3A 1P2CA 4WHYG 1XEDA 3KYAA 5AW6B 1SMAA 2ZXWB 3SE3C 1YEFL 2MFNA 4OJFH 4ZX6A 1VPOL 3E8VA 3Q05A 1JGUL 5BVPH 4GBXA 2DWYA 3LNDA 3BJLA 2FO1A 1HWWA 1MDAA 4JO1H 5D6CB 2ISDA 4CMMB 3SPVB 1HHIB 3MAWA 4RAUB 4C4UA 4DN4H 1E65A 4NJ9H 3MRRB 3CFDB 3QUYA 4OLWL 4WI3A 4OT1L 5AB1A 2OL3B 2V2TA 4OJEH 3V0AC 1O9ZA 1Q9OB 5D7KE 3JWNE 2EDXA 1RUKL 1WFJA 3L7FA 2ZKXA 3NRPA 4WFGE 4UZGA 5GGQL 4E36A 1OD7A 3H9SA 3M1OA 1HNFA 2HFGH 3DPBB 3ULUF 1U8MB 4HUNB 3HG5A 3S8WA 1P84J 3QCUH 1NGXB 3BZ5A 1SHMA 3EDJA 5F7YC 4QO1B 2ZP9A 3BPNC 3RX8A 2QEJA 4NI6A 3SOTA 2D7PA 1UH2A 2GIYA 1AXSA 1GIGL 5HI4C 1RZJC 5IR1A 4D9QD 3DJ9A 3LPPA 1GGBL 3RFZA 4F7EB 4XMXA 1SFHA 2D0HA 3BAIA 3LEVL 4FXGC 3QS2A 1AFVH 2Z7ZA 3B5GA 1W91A 1WBYB 2ZSVA 3EO9L 3O3DA 4IKIA 4OGZA 3TN0A 4F8PA 5ADOL 2XWCA 5GZOC 1LWRA 1KENL 3ZDZE 1QBML 1N5AB 4KROC 3HBGA 3O0RL 1BFTA 1MWOA 3Q1EA 4PGCB 5C9KA 4HW6A 5I5RA 1KNOA 3VD1A 2DJ4A 4HVBA 2AJVH 2QVKA 3TBCA 3TPUB 5AVYB 2A6JB 4EDWL 5IMLB 3LRHA 5F9JB 2X4NA 1PW3A 2BNQB 4IMKC 1BFSA 5ICZA 3V5DA 5AKTA 2BRRL 4PGDA 1BPLB 1WCBB 2B3IA 3NJKA 3V4VA 3BKMH 1YQVL 3SBRA 2YQGA 1PLCA 1EXGA 1L6ZA 1JTOA 1UOLA 3DGGA 3P0YH 5T1JA 1J5IA 3VI3B 4BK5A 3DRTB 3K71B 3WENA 5CZRA 1BV8A 1BQLL 1KCBA 1MLCA 2AEQH 1NJ9B 1ZS2A 4ETYA 1NOFA 5ILTL 5IJDC 3O3DB 1E4HA 4GSDL 4Q7DA 3GNML 1GAFH 5AVUB 3FU0A 4PY7B 5T1DH 5JXEC 3BVXA 4XNBA 5ANME 5KVEL 1S46A 1BCIA 1XDTT 1LD9A 3ARBC 1E3ZA 2N7AA 1J1PH 3W9EB 4ANWA 2XCMC 3K5SA 4P3CH 2XIIA 3K6SA 1YNKL 1PZDA 2XV6B 5IR1B 3UZQB 1H9VA 5HYQB 4JDVA 1Q0YH 4FC3E 3MBEB 5CU5A 3AWGA 1PLBA 5JXAL 3MVSA 3UZVA 3ULVD 1P4LB 1BQLH 3LRLA 1O7VA 3QAQA 5IFJB 1R24B 1MCQA 4K55A 1Z9OA 4LCCC 5LJYH 1BVKA 4M5ZL 3LTVA 1H3PH 3VDCA 4CC4A 2OK0L 3CHOA 4N8VA 2YEZA 3D2UB 1X5ZA 3GMPB 4KO9A 3PPEA 4UM9A 4QEGA 2BY1A 5AOKA 3VI3A 5HYJB 3EOTH 2IQAB 4IIQA 1JPFB 4FFYA 4ODBD 2PO6D 5C08A 2E0PA 3B6SB 2PYFB 1JVLA 3LXAA 4AIZA 1J0JA 1UWGH 4FQ2H 3WEAA 3P9MA 2BDNL 1J8HD 3UTTA 3VI4A 4F2FA 1MW1A 1TU2A 4HUVA 2IH1A 3SDYH 2EKSA 3D2TA 4BD4A 2OP4H 4UTAL 1QBMH 2NUPA 3NSDA 3K6IA 2NPLX 2GG1A 2YRPA 4GKOA 1X5KA 5FGRA 4AYBA 4LIQH 5DGQA 1EO7A 3MLSH 4XPAL 1SY6H 1YN7B 3EHBD 3JWDL 2ZWZA 4KI1A 5TE7H 2E7LC 4E41A 1P7QB 1QG3A 3B7RL 2Z8SA 3OJMB 1F0LA 2NY2C 5D4IA 4H1LG 2W9DH 3PDGA 4FAAB 4U1HB 4YO0A 1NGWA 3MC0A 1DVUA 3H9ZA 3MU3A 4MNHA 3ZQXA 1X9LA 4QRPB 4EZLA 4KRPB 1H3GA 4QTIL 3SY6A 2Y5TA 2Z7WA 5KSVB 1YDPA 1YPZB 2FWOB 2QADB 1O6TA 3DVNA 3IRCA 3KM2A 3PL6C 1IARB 3CLFH 4M1GL 3IAPA 5GS3A 4BQ6A 2MHAB 3DX0A 3N85L 4Y8DC 3JBG7 1XF5A 2L7JA 4PJ9C 3EH1A 4ALAL 5E8EB 4UDUB 1NC2A 4PUBH 1JD7A 3OXRA 3WEMA 3VXMA 3WEBA 5TDPB 3H9SB 3SE8H 2NSQA 1KN4H 2ED7A 2K7QA 4JKKA 4HS6A 1HZLA 2CMRH 2JJSA 1SOSA 1OP5K 2IPKB 1MWAH 1YN7A 1XH1A 3TBSB 4GLRI 3MOAH 3B3BA 3D4YA 3MN8A 5D2LA 1W6WA 4PD4J 5F7HA 4XNUL 1RJYB 4KAQH 2H47C 2CIKB 4R96B 4X2UA 1A65A 5D4QA 4YSEA 3CZUB 4XHJC 3KWUA 2F53D 1VGKA 3EGSB 2EKSB 5I30H 4HYTB 4HETA 5E4EC 4RA0C 5DZNA 3SKMA 5L9DL 5SWSD 3JWNC 1RZGA 3U1PA 1QQDB 1X5MA 4ETQB 5CJXA 4OSUH 4P2AA 4I9WD 1EZVX 3DYOA 1S7VB 4FQHA 3P3YA 4Y2OA 5E1AB 5EZIL 5DQ9A 4NRYB 4P2OD 5JR1L 2EEBA 1L6PA 5AQ0A 1QPKA 1UKSA 3OSKA 4C56E 3UTSD 5SWQB 3EYQC 4GQ9H 1I3RB 3GKZA 3RKPA 1UYWL 2G75A 4PG2C 3V6BR 3O45B 1AGBA 1JZ3A 1TZIB 2P5EB 5E2VH 4CMHC 5DVMA 1IEAA 3DECA 5BRZD 3G5XB 1UB6A 4M7LT 4BCYA 1ASPA 2XJKA 2MNJB 4JM2F 4OF5A 3WJLA 4ES9A 5FW8A 4XN5A 2DEXX 2RR3A 1E4XI 2QSTA 4RFOH 1I9EA 1R0AL 4MDIB 4WUUD 2B5IB 2YKKA 3I9AA 3P73A 4BA8A 1ORQA 2VXQH 5FHAL 4MJ5A 2ZSWA 1DEEA 3QEHA 3NCXA 4LGPB 1JZ2A 3OGCA 5FYKL 2Y6TE 1VGEL 2VRAA 1TZHB 5I26A 3DRQA 2ZTBA 1ZLVK 4ADIA 1E6OH 1N19A 1F4YL 3VG9B 1B0IA 1A3ZA 3VU2A 3ILQC 2CKBL 2IDQA 2JKTM 2R4SH 3QQ4A 3SE9H 4ZDHB 3L5IA 4L1DA 1MCCA 2FSDA 5JLZB 2FAUA 2XA8H 4NERA 1MHEA 5HDBF 2DWDB 3U2SB 5GGSB 4R8WH 3HI1A 3BDYL 5IVNA 1E43A 1TQCC 4RGMB 4BZ1A 4P46A 3ULUD 5CZXD 1A3QA 3M07A 3O6MH 1BIHA 5DURD 5JOPE 3VW3L 2JIXB 3QQDB 1W0WB 5I16A 2NTSP 5LNDA 4CSZA 5LVEA 3LH2L 2IBZX 2GSIB 3KS0J 3DX7A 5GZND 1IBHA 3P3SA 1S5IH 4WO0A 1X9RA 2FYYA 1PDKB 3C6LB 4KJQD 5AAMC 5BUPA 2W9EL 4HX1A 3DHMA 2F68X 1MFMA 1ZVSA 4Z18A 1DEDA 5CJQH 1JGLL 1LO4H 3LKNA 3WTVA 4GJTB 4N9OB 5K9KA 1KG0B 1MCJA 2XN9B 4JQIH 4KWUA 2IJ0C 1HEZA 5DHVB 1AIFA 2X2HA 4P49A 3FK3A 3WKYA 2WN3A 2YD6A 1BREA 5KVFL 4PGEA 5F88B 2D8KA 3NZSA 4JPKL 4W9KC 2H2SD 2ZE0A 1XF2B 4C4BA 2MQ3A 1GMEA 2Y4SA 1NAML 4PRPE 5EB9A 5LAXB 5IOPB 3VD5A 1OQXA 1HHKB 2R0KL 2VR5A 5D72H 4TUJA 2OTUB 2YK1L 2EZ0C 2PW2B 2ZXEB 3BXNB 3GIZH 3IPBA 3WL9A 1HZHH 1JF1A 1NANH 3C5SA 5T3XH 2H2PD 5KJRH 2P7TA 3GM0A 3MNWB 4J12A 3V4UL 1XWVA 3Q6GL 2AQPA 5EOTB 4U7MA 4XXDB 2GKIA 5JR1H 1S7QA 4YZWA 1URZA 3AG4B 1SVBA 4YWGL 4B60A 3AB0B 2X1WL 4OSUL 3VFSB 3ZE0E 1AO7A 1IC1A 1NIDA 1BWWA 1YUKB 4GP5B 4MB5A 4ZW6A 4ELME 5F1NA 1GZQB 3X2QB 2CJTA 4JO2L 3BT2L 1USZA 1D5XB 2O61B 1SEQL 1UEYA 1CD9B 1MJJA 1XGTB 4MD4A 4L1HA 5TD4A 5F44A 3ARRA 1HYSD 3IN2A 3LQZA 2KDGA 4WKZA 2R2EB 1QW8A 5KS9A 4OJYA 4BSWA 4GRWF 1G9NC 1KFGA 2N7BA 4XMZA 3GSVA 4MXVE 3FQ4A 3ZYZA 3JWNH 4JFDD 2W0FB 4XWOC 4C4KO 5E5MA 5CSBA 1FNGA 5F3HB 4XX5A 4IKLA 4P48A 4G7YH 4G6JL 1T1YB 1DQML 2X4SB 4U1LB 1KB5H 5CGYC 1AO7D 2ZD0A 4ZMYA 3CC5A 1N64H 5J11B 3AZUA 4BFKA 3UAAA 5TQ0L 3E8UL 2X09A 3FPYA 1KYOJ 1HHKA 2RD0A 4AEIH 4PTTB 4GBXD 4AEFA 4WUKL 5FF6B 2Q8AH 1EXUA 4OLVH 4R4FL 4ZW5A 1E3FA 2V5YA 3DARA 4JZJC 1I1AD 2WXNA 3BAWA 1OT4A 1TZGH 4O2FA 3DX8A 1DFBH 2XT1B 4E0RB 5C0BE 4HLZG 3GSRA 4K9JA 5CCKH 3OL2A 1YPZE 3IEAA 2ESVE 2CK0H 4XCFL 4X99A 1XBRA 4KZDL 1K6QL 2FO8A 3A6BL 2EDWA 1FNGB 5IVXF 3U48A 1IU1A 2QELA 4ZFOB 2IQ9H 5IQ9A 3UG4A 4ES8A 3B7YA 1LEIB 4YDVA 3H42H 4N1EA 2QQNL 3TESA 2DTSA 2WXHA 3DHUA 1E50A 4A04A 4PYGA 2ADYA 1KSRA 1Q72L 1T89C 3GIVB 3KR3H 4JKNA 2CLVA 3PHAA 1T2QL 1RCYA 2EH8H 4FQ2L 1CLYH 1MUJA 3GZKA 2WNXA 1MCKA 1SF5A 4J4PA 4FKHA 2FZ3B 3WFZA 1GSMA 3BPCA 2ALWA 3U4EA 3D33A 2NZ1A 2OMTA 1N4XH 2CR0A 2ZWYA 2YWZA 2G2RB 5F6IC 3LZPA 4AQ8C 2QQLL 4GW5B 2HPTA 4ECNA 5KSBF 1EVTC 4FXKC 2UWEE 5I6MA 5MHSD 4Q4EA 4ZPTA 1ZA3A 1OWWA 2BVOB 1CZ8L 4KMQA 2V9TA 3HE6A 3L1EA 1CDUA 3R1GL 1VA9A 3C75A 5DF0A 1RSFA 4GUCA 1CE1H 5T1DL 3L9RB 4BWTA 3KVQA 2YZ1A 2Z1PA 3C5XA 4M7JL 4F7KA 5J5EA 1DLFL 4F33A 1CYWA 3MYJA 1Z2KA 1J5CA 4BELD 3ISYA 4H1LB 2Z8VC 3CDFA 5E8DH 3M45A 3NZ8B 4U49A 1EEZA 2LTQC 3MR9A 5HHQB 1D3CA 5HGAA 2CRYA 1BD2B 3L8QA 1BLIA 3QAZB 1QWNA 1IEBA 3NRFA 2XWTB 4JAMB 1NLBH 4FQXA 4PJCA 2K6WA 3UZEA 2Y7LA 2P5WE 4OLYH 1DJXA 2MOVA 3V7MA 2PUQT 2HKFH 3RGVB 2CG9X 4N25A 4N9GB 4HEPG 2VLMD 1FDLL 3IAQA 5HYEA 4ZFZA 4AGQA 4CNIA 4OD3L 5DYFA 1TCRA 3LSOA 2DPKA 4XE5B 1WBXA 2PPFA 5DFVC 1S7TA 2AP2A 4MJ4A 4P2OA 5IVXE 1XAUA 3BIBX 4PJIB 1QRKA 3CH1B 1K8DA 3HHSB 4PB0L 1UACL 2VDMB 1MF2H 3DBXA 3QORD 3V7AG 1BBJB 5HGHA 4EPSA 2WQAA 3EO9H 3FCSA 4XCCL 5DQJB 2EP6A 2BXYA 3QQ3B 1QFWL 4GUPB 4E9XA 3LEVH 3WFEH 4N2LA 3L5WA 4DGWC 2VQ4A 4KKAD 2UY7A 2W88A 4DKDC 1XD0A 1XGQB 3WNOA 4HPYL 2Y07L 3NJXA 1V5JA 2NTFA 4OD2A 4P9HH 4XVUC 1AQKH 3HZYB 3QRLA 4NO0A 2ZSWB 3PFQA 2EUVA 2YUXA 4GEJA 2PCXA 1FFPA 4TQHA 3X3GL 3WIHA 4QF1B 4YFEA 4MXWH 3APFA 3HMWH 3HPLB 1RUPH 4MA8L 2VDPL 5BO1L 1XIWA 1XR9B 2DRUA 3O6FD 1CIUA 2A1WL 2OYMA 3OM3B 1CGTA 3DV4B 1IILE 2L0DA 3QZBA 4RX4D 5GGQH 4MJID 1BQRA 3LXBA 2HT3D 1M7DB 2BJMH 5AKVA 3ZL1A 4BSVB 1CYXA 4KQ3L 3D25A 3QIWB 3B37A 1MVYA 3CN0A 2RJMA 2RB8A 3IWVA 4KZCA 5CILL 4ZTOH 1ZA6B 1VPOH 4KX9A 2JIXD 5KSAB 3O9WA 1ADWA 1G9HA 4IRZL 4RGNC 2XZCL 3F6LA 4E41D 2DJUA 3CSBA 4RMQA 3LD8B 2X2IA 1F4HA 4HS6B 1FPTH 1TJHH 4HBQA 4GO9A 3T4AB 2LTQB 4K7PL 1FGNH 5FPIA 3FQRB 4NAMA 3WFDL 5DMIH 5D2LB 5DRWA 3PP4H 2QGEA 4NRZB 3SPIA 2WLNA 4RAHA 3LNHA 1NMCC 5IROA 3P4MA 4M3KB 2E59A 4EDXB 2GJJA 2IBGA 1UXWA 3G9VA 4JR9L 4JFZH 2Y7SA 3VXMB 1OANA 5E5RB 4K71B 2ZPKL 4NO0B 3BSGA 4HH9A 5DD6B 2CLVB 2C9XA 2FWLB 3L16A 4IK6A 4LP4A 1BLNB 5B38B 1BDYA 5DJAA 3C60B 3L2MA 5GRVL 3GRWH 1BFOA 3KDPB 4E42B 3T6QC 2OXGA 3MUHL 2X10A 1P4UA 2EC9U 2V9UA 3IBOA 4WEMB 3A6OA 4WEBH 4FABL 3EFFA 2OMUB 1LO3H 3QUZA 5C71A 4V1DA 5HI4D 2HWZL 3EBAA 1EBPA 1HQRB 2QFPA 3P40A 3A23A 1QHQA 3OKKB 3TA3B 1K4CB 5HHVH 3AM8A 3P4MB 1HINH 4A55A 5KSAA 4OCRH 3OGCB 2JLPA 3GSNB 3IVKA 1ZPLA 5KSBA 3PL6B 3FF7A 4IEFA 2ESVB 1TEGA 2WKLA 1TITA 2BLFA 2EABA 2AANA 2C3WA 3KGTA 4HK3J 2GK0B 3CU7A 5LBGA 1SY6A 3BH8A 4ODSH 4WTZG 3MUZ1 3T4AA 3ULSA 3WE6A 3X1GA 3DUUA 3C60A 4KK8C 1JNLH 2Z7UA 3MV8A 4JRXB 5F7LB 2Y7QA 3WTXA 1E9PB 4AQAA 4L5FH 2CHNA 1UKTA 3UXFA 1MCLA 1OGTA 2APFA 3I02A 5E6UB 5F0MB 5F0PB 5FYJE 4Z7NF 3FUMA 3VWJB 1JPSL 4EDXA 3C5ZD 5FX3A 4MWFA 4ORGB 4WJ5A 3LN4A 4B9FA 1WSST 5CIPH 2DL9A 1MQ8A 3L95A 4Y16A 3G6JF 4ICXA 2X2YA 3MRMA 3QDGD 4FFVD 4GAFB 5IG7B 5ICXB 2ALAA 2P9RA 5BV7B 1GVIA 5FDWB 5ID1B 4QRSA 3IXTA 4C56B 4PREA 2AEPH 2XZCH 3KPLA 3M46A 3IDUA 1XB6A 2OSYA 3EHBC 5GSVA 2P5EE 3FQ2A 1NMCB 5DFWH 1H9DA 1FNSL 2X9ZA 5J13C 3DX4A 1BBJA 5HGHB 2ZP8A 4P5KB 2WB7A 2R7EB 4JLRA 2D7MA 1YEKH 1N0XH 4HCFA 1VFBA 2CHDA 1T22A 1GC1L 4ESKA 4PWFA 1GGIH 4MGXA 2E9BA 3AGVA 1THCA 1U6AH 4LCCB 4L8DB 3RZWA 3ECBA 3BKJL 5H8DA 4KXCA 5F8RC 3X3GH 4ZOEA 1ZTMA 4J4PC 2D4FA 4LRNH 4DO5A 4ELMA 5FLVA 5TDNB 2MQCA 3POCA 3BO8B 4OZIA 4N0FB 4P4KA 3I3EA 1DQKA 3PGFH 1FFNB 4GSUA 1NWOA 4W6XB 3W9DA 2DMBA 4ELMF 4JHAH 4RIRB 3QUYD 3SKNA 3ZDYF 3BGMA 3VFWB 1BZEA 4GLRH 1NGZB 3B9AA 2MSPA 1WZ1H 1CXIA 2R1YA 3KGUA 4NPKA 4ZBJA 3PCYA 2NXYB 4PU2A 5E6IC 3B83A 2HMID 2BP3A 1AQMA 4JK0D 4BXSV 3U2IA 5KYWB 1MHCA 4KQ4H 3PV6B 3L95B 4G6AC 4WQOA 1EHNA 1XCXA 5CS7A 4I0PB 4EI5C 4WW2A 4JHUA 1U21A 2UY6B 4I48B 2IEPA 1CLZL 3HG2A 4KRMB 4AKQA 2IDTA 1JGIA 3DJTA 4GH7B 3T6XA 1FL5A 3MRNB 2X6AA 3QPQD 4IGBC 1I8IB 1YYMH 1LGVA 2X9XA 5C0NC 1FDLH 3QDMA 4TSCL 3FB8B 1E2VA 3HNSH 4WW2F 5D1ZC 5DJ2B 1BMZA 1GS7A 4OD1H 2Q86B 4M6AA 5I6LA 2OR8A 3T04D 4IU2B 4UT6A 1H8LA 1OGAA 4OCXL 1WPCA 5HVHC 4W4OA 4X5PA 1BZ7A 1SHSA 2RQEA 5J1AB 1WH0A 5DK2A 3OHXB 4HDIA 1CI5A 4KTDH 1AZZC 3LQMA 2PO6B 2ZP0T 1U0QA 5F89B 3VQMA 4BZYA 1FFRA 4J2QA 4RETB 4JFDB 5EU3A 2KC0A 2ZAHA 3H7BA 4YSCA 4JPWL 3BO8A 2EDKA 4I9XA 4ZS6C 4DGIH 4OZIB 1PF3A 1J12A 4FQLH 1R3LB 1LK2A 2EIJB 4BUGA 3FN0H 1ED3A 1ETZB 1WRFA 1A1MB 1KY6A 4N3UA 2R56H 4QWWC 4DEWA 4FA6A 1E4WH 1JPST 2YAQA 4YLQT 4L8CB 3P3TA 2BP5M 3OAYH 4PREB 3CZJA 3D0LA 2ZOLB 3O6FC 2BHZA 3ZE0B 4N68A 4P2RA 4YJZL 3IJYA 3EDFA 1BHGA 3OWEA 3QUMB 4MA3B 2BVQB 4UINH 4XBEH 1C5DB 4M6MH 2P5EA 4U2YA 4XO8A 5D9SA 2OM5A 2D31A 3T8XA 4CRPA 3L2LA 2NX5E 3A0OA 1OGAB 4UBDD 2VJ0A 3D08A 5FF6A 3B34A 4QOKA 3RU8L 1BVLA 4PJ7A 2CCLA 5DXWA 3I6KB 3EH5B 2Y22A 3U0WL 3FUNA 4IBZA 3OVUB 4RWHA 3TN0C 4DN3L 1NDTA 4Y4HA 2X53A 5KSBE 3JWDC 3IPEA 3AU0A 3KYNA 4PRNB 2DOCA 3QQ9C 1CN4A 2C3GA 2VSDA 1A9EA 2DZEA 3VXNB 1NCBH 4S10A 3ZUCA 2OMVB 4Z9KB 1G1KA 5EDXA 4IRJD 3W39B 4B96A 1DVFC 2W91A 4HHAB 1Y6KR 4RSYA 2OJZL 4RH4A 1F6AB 3QWQB 3LKQA 3I9GL 3C2AL 1EAQA 1DE4B 1KC5H 1K6QH 2WMPB 3IJ7A 2X4UA 4R4BA 3P30L 4R97B 5E4OA 3KPPA 5AG9A 1ZHNA 3V0HA 5CCKL 4AYMC 3D3VD 3HI6H 3QFJD 1UWXH 2ZT9C 4X9BA 4Y7OC 5A6MA 1TXKA 5I8CA 4OGXH 4H25B 1T1ZB 4OGQC 1PZSA 2YLHA 2C26A 4NO5B 2F53B 5KYYB 5GIRA 5K59E 4J3OF 3RX9A 3EJSA 4DEPC 4CA4A 3FT3B 5T1LA 4XVJL 1VFUA 2NXZC 3QJHA 2ZOWA 1WGVA 5ESAA 3H3BC 3LQZB 1XBDA 4OFYD 3S3CB 1T0OA 3O4OC 5TE4L 4J39A 1ACZA 2WZ6A 2Q2EB 1RPKA 3SGKA 5C08E 1F3JB 3D85B 4XNQB 1TEYA 4PJGF 5CNHA 4MMYB 1EHLH 5HHMB 3QJXA 1JNNH 1NPUA 2E27L 4L29A 3KPPB 1R34A 1R3KB 4L3EA 4Y1SA 2H26B 1X5JA 1NBVL 4CVZB 4EF3A 3ZW3A 1INDL 3OKDB 4B9CA 5J7CC 1JZDC 3IJHB 4N0YH 2AV7A 1ZE3H 3HHSA 3UCRA 2HLAA 1IFRA 4UIMA 5DD5L 2SODB 4RFNC 3CZFB 1GW6A 2BCKB 3BDXA 4WDIB 4Z5RB 3DHPA 2VN4A 2J8UB 5CUSL 4ERSH 3INUH 4HD5A 3MA7B 4E2OA 2X44D 4P23B 3ZHLA 1NFIB 3ISRA 5AVTB 5HGGS 3C5JB 1OLZA 4BZ1H 3G3LA 2ZXDA 2Y36H 2BS8A 1I31A 1C7SA 4ONGL 1DFXA 3NJGA 1ZSDA 3HVDA 4GSRA 2X6BA 1HL4A 1R5IB 5EC1A 5H37H 2NRDA 1AGDB 3DOSB 1GJWA 1THAA 3K8LA 2BZDA 1IC0A 1KBBA 2LR4A 2JQZA 4HFWA 3KBFA 2GJ6E 2GK0A 4FLSA 1QSFD 2IGFH 3LIUA 3NJFA 4JFVA 3DO7A 5EA0L 3ETBF 4HKJA 4J3OH 4ZXBD 3QIBA 3JUZA 3LKPA 5HDBB 1BD2E 4JY4B 4U3HA 4YK4B 1OPGH 3OAUH 3O6LH 2K8QA 3KYOA 4LLYA 3AACA 4IGBA 4XRCA 2P5WB 3BFQG 3TT3L 5BQDA 1RK7A 5E00B 4H44C 2VAJA 2VXSH 3R0NA 4GXFA 2JTDA 5F93C 1ICTA 2YLKA 4N9GA 1A7PL 3REWB 3KM1A 4GFXA 2XWJB 2Z93B 4FLOA 3RPIA 2DWEA 3VFVA 4K7FA 2AJ3B 3II1A 4C83A 2HYMA 4R26H 1UQSB 3MCKA 3O6KL 4FYTA 2OL3H 2BNRE 3FQUB 5I8OH 3U46B 4NIYE 1AGFB 3X1EA 2J73A 1YEGH 2LU7A 2ARJQ 3BD5A 4HKJB 3FCSB 5KS9F 5EZPA 5GGSA 2EYSB 3PV7A 3GC3A 1U3HD 3L4UA 5J12B 1DZ0A 1O9VA 1EZUA 4KQ0A 4AGNA 3J7HA 2ZXBA 3M86A 4QIRA 2F1AA 4LLWB 2A77H 4LAQL 2QTVA 3DC0A 4F33B 3U9UB 3V79C 1G6VK 1RIUH 4OTXH 2ZG1A 5DJYA 2R23A 3FCGA 1XTLA 4P2QE 3KPRD 1J1XL 3ZKSD 5CD5C 1MLBA 3F12B 3BAKA 4PV8A 3S3BB 1TCRB 2FRGP 2XI9A 3LSOB 4KGLA 1L3NA 4IRSD 4X7SH 3GMQA 3H3PL 3QORB 4J23A 4H8WH 1FJ1A 1YY9D 2VDML 1CT8A 2CO6A 1JP5A 1TTRA 3BEVB 2AJXH 3KXFE 3RWJA 4CILA 1WWAX 4Z7WA 1UOWA 4FKKA 3ECQA 2ROXA 3BAEL 4K8RH 4RGOH 1KBWA 2ZX5A 3O41B 3SZKC 1UH4A 5IQOA 2BY3A 5EOQH 3T0EC 4NQCA 1J0YA 1G7HA 5CJBA 5BNXD 2CK2A 3X1FA 1P7HL 3VVVA 3EAKA 3RWEA 3CGTA 2V3FA 2OKMA 3LQAL 3UTOA 1G9NL 5JHDE 5C0JB 3TS8A 3MGOA 1XB3A 5HY9B 1HHIA 3L5HA 4Z0BL 4FZ8L 1BF5A 5L9DH 2DTMH 3D52A 4YK4C 5D2LE 4L8SB 4YXHL 4ZRGA 1SXBA 2KYIA 1OGAE 3MLVL 4I2XA 4LVHB 1A7OL 1HKLH 4YS4A 1AD0B 1XD1A 3L5XL 2APTA 1HESA 3IDNA 4NNPH 5E1HB 3BCFA 4L4VE 1T83A 5CINL 3VXME 3GDBA 1JYVA 1MCNA 2G4GA 3KCPA 5CN2A 1H5BC 1J9TA 4P2QA 1TVHB 1AYOA 4X8JA 5F7EL 5D5MB 3TM6A 4NC0B 5D1QE 3MMEA 6FABL 1OM9A 4FCHA 3V95A 1C5CL 5T5FL 4DHLA 4L3EE 3Q8AA 4FHKA 4NB7A 5AFAA 4WRLA 2DQIH 4QRRD 4PUBL 4ABVA 1YRKA 3QRGL 2J6EA 3U4EB 4E41B 4QRQB 4QR7A 3VWJD 4ZNEE 1KBGL 1WBXB 5F72S 1RU9L 4P9MH 1M6OA 1A6ZA 3RBSA 3LN5B 4X5WB 1C8PA 5INDA 5FYLH 3VFMA 4DW2L 4MAYC 1RZFL 3B2UC 4B27A 4LE8A 5M7QA 2GAZA 4O02L 5B1KA 3PWJA 1SLVA 3K6DA 1AG0A 5C86A 4P07A 4JQXA 3HZKB 4GQRA 3RL1B 3PF2A 4OZFA 1MNUH 3OKOA 3TA3A 2QVMA 4KH2A 4RWYL 1OTUD 1H6FA 4N90E 1U2CA 1OD9A 5ISZA 1E8YA 5LN4A 3JVFC 1AANA 1AJ7H 4IBLT 4JHBA 2H8PA 1USQA 4YLBA 1Q1PA 1F86A 2HVKA 2J5WA 3ROLA 3VD9A 2ENYA 2OP4L 4JFEE 4XVSH 3U1SH 4L4JA 5D96B 1WIUA 1G6RB 4XP1L 4Z8FL 2VDLB 3IDIB 2YXVA 4OCWL 3P11L 4UMGA 4LLMB 3ECBB 1P4IH 2EVGA 1ZSHA 5KWYC 4M8VA 4MD0B 4U31A 5F8QC 3NA4A 4A7GF 5TQ2H 2X7LA 1AHWB 5BS0A 2C9SA 5C3TA 2KHAA 2NY3D 5BMFL 4P4KB 3BRDA 1QA9B 4GUOA 1A2YB 5CBEB 2Q0ZX 2BIOA 1QRNA 4FS0A 3NT0A 2FBOJ 32C2B 1OAYL 1ZT4B 5KVFE 3WLWC 4BZ2H 1SJVA 4RDQG 3U0TB 4BFJA 1G7PA 1OIOA 1PIFA 4HXBL 3U2JA 4MMZA 5BXFB 5E2TL 1UGKA 1KN2L 2HT2D 1LYQA 1Q0YL 3A6CH 1A22B 3I6GA 4ZOBA 3UFIA 4XMKL 5I1IL 2EH7L 2WLIB 4LF3A 1QMUA 1RULH 1PU0A 1EMTL 2YPKB 4HX1B 1F3RB 1F4AA 3MBEA 3SPCA 2QVFB 1NIEA 1BEYL 1DQJA 1MZZA 4WWPA 3NYKA 1P1VA 1E9QA 2AXGA 1AIFB 1YJDC 1VLXA 1A4CA 1MRDL 3H9YA 2CRZA 3GZOA 2GJ6B 3R4DA 3WTWA 2NYZA 2GSGA 3ML8A 3S96A 4EN3D 2IOMA 1H6UA 3ZYJA 3E38A 1LDPL 1QSFA 2NR6D 4HUXA 2MMXA 5LAXA 3WNKA 5DEFB 3LXCA 5GZNC 1XGPB 1MLCB 2YXWA 2VR3A 1WUZA 4XP4L 3TTSA 1ZTXL 4Z78B 3DLQR 1NGXA 3BVVA 3HKZA 5DS2A 2APVA 3IU3B 2VUYA 4GAJH 1QSVA 4XAWH 5AL8A 4FG0A 3V10A 2JXMA 2QKIC 2AV1A 1EJOH 3ERXA 4XOCA 2Y6SD 5DUPL 2H2SC 2ADFH 3NH7H 3TGXA 5DDHB 4AV0A 5IB5A 4FG2A 4FX5A 5B7MA 2GAZB 3BGFC 4FJ6A 1M2VA 5CHNA 3UG3A 1YMMA 3DMMB 2UY6A 3VYPA 1EFXA 2NNAA 2R2CA 3AXHA 5AOIA 4ODWA 5LXGL 3WI9A 3H2WA 4LCCA 5K9JL 1D6VH 2X6UA 2X41A 3DX7B 3FFCD 2WXFA 4BSWB 1GGBH 4CKQA 4E9LA 4H88L 5F3BB 5KSAD 4XB3A 4XCYB 2PR4H 5D1ZA 5BCAA 4JG1H 3TVMC 3LKPB 3GBEA 3RIAF 3GXIA 4YXKH 1JV5A 4UQCA 2AAVA 2MKWA 2MHAA 3K7UA 4YQXH 3NTCL 4ATWA 4RBPH 4LOFA 4G8AC 3U7WL 4D2NA 3WIAA 4LL1A 1CLOH 5C07B 3IM1A 3ZRCC 4DKFL 3QXTA 3HR5B 4N0FA 3TO2B 4WW2C 4Y9CA 1U91A 4GMTL 4PBXA 3ZJAA 5FOBA 3FU7B 4R90H 3QNZA 3BWUC 4PLNC 4K0OA 1HIML 3PQYA 4Z7VA 1B0GB 4KDVA 5T1LD 3B9DA 1Z3RA 2VSKB 4RZCA 5TPWL 2ZUQC 3MRHB 4QCIA 2ZUXA 4JO1L 4PJ5D 4R96A 2ZOOA 5E9DA 2Q7NA 1ZLUH 5EZJA 4K23L 2BVPB 3VD0A 4B9JA 1RZQA 3QFJA 2APXA 4PJFB 4X4MA 1EV2E 1PY0A 1K4CA 3SKMB 3EYVB 3AU1A 3QUXA 4OGAC 2UXFA 3S88L 2QBWA 2YIHA 3O3AA 4UB0H 5JHDB 3MX0B 4W9ZA 3HZMA 1DUYA 4PJ9B 5CXPA 1MXGA 1NKOA 3VFNB 3CBJB 1VFAA 2VH5L 1BPVA 4WFFE 1QAWA 1XQ4A 3N1MC 2JKJA 1FZMA 4UYQA 5KJ7E 3RVXD 4NQDE 4MRCA 4DKEL 1DSYA 3M7FB 1D7CA 5C0ND 2IQAA 3QUZD 4IIQB 1B3JA 3SOBL 4WDIA 1A3RH 2IXQA 1J9RA 2FZ3A 3PE9A 1NDGA 2JVUA 3DUSB 3V4VH 1MCWW 1OSEA 2GSMB 4RESB 3FO9A 5E08H 3HLKA 3HVNA 1ZGLP 4RFNB 3SKJH 3T4YA 4L3EB 2YS4A 1LK3L 4CC0A 1EFQA 3C8DA 1KELH 2QVIA 2X6CA 4HWBH 2W60B 3S35H 1C1EL 4KI5C 1V7MH 4XC3L 4KKQA 3VRJB 1IUZA 3P3UA 3TO4A 1YEIH 2VDNB 4GAGH 1IM3B 1HHJB 1JXDA 5DD6A 5T1KA 3VXTB 5JYMA 4F2ME 3GMLB 3WHXB 2VC2B 5IROD 1XGUB 3C5ZB 4GI8A 3X13B 1M05A 4MA1C 3Q3GA 3VFRA 1DQDH 5ICYA 2G0LA 2XOTA 3FC8A 3QUYC 1EO8H 3IMSA 1KJMB 2WPGA 25C8H 1I1RA 1WHPA 1S9YA 2XKSA 4ZW8A 3L3OB 1XT5A 3QDAA 3EFFB 2CGZA 3LEXA 1OSZB 3RLSA 5C08B 1R3JB 5C0CE 2Z65C 4PJ6A 1GW0A 5GQBA 1OTTD 2J4WH 2OMVA 3B1UA 2CGRH 3MX0A 2EVHA 4ORZC 2Q7AA 1TU2B 4N8CL 4JCLA 4ZMLA 4NO2B 4FI7A 4TL5A 3AW5A 1JWMA 2VDLH 3GD1C 3K2UH 2V2WA 1TDQA 4GS7B 2WZ0A 2WM0A 3CVHB 3IGUA 2P8MB 5IFAL 3ULVC 5AZEL 2D2OA 3MTRA 4X7TA 1XCTA 2VLKA 1G4MA 4YDJA 3PDDA 4K7PY 4M5SA 5D4HA 2DQCH 3M88A 3RDJA 4Z3HA 1XIWD 2XC8A 3LPFA 1NL0L 5BVJA 1ITBB 2DLIA 3US1A 4OLXL 5D71L 5I6XB 3NACL 4E9VA 2R27A 3V0WH 3ARGB 1IGIL 3N43B 5I18H 1J5OL 1UM6L 1MJ7L 4YHZH 4DETA 4BFIB 2FT6A 5IT2H 3IT8D 5CHNB 3ARPA 2BP8B 4W81A 5DFVD 4OLEA 1KB5A 1IGCH 2WYIA 5CR8A 4NQTA 4XNAA 2Q6WB 4DQOL 4KDTA 5I1LA 3G6JB 3HTLX 4X5XB 1LMKA 2ATPA 5SX4I 4P5MB 5BRQA 2DQTH 1ORSA 3N1PC 3OF6D 4TPRH 2OMZB 5HDBE 2XQBH 1T4KA 1ZLWK 5LLIC 3Q9QA 3CFKB 1JPEA 2WAHA 1TYRA 3WIIL 3EXJA 5GS0L 2ZYRA 4L29B 3UBXB 3ZT6A 3ARSA 1B4JH 1MFAL 4G71B 1L7IL 4LSSL 5C8JB 5IEHB 3VAEA 5K1JA 4JDVB 4X6CE 2XTJE 3L81A 4PGEB 1G1YA 4NKOB 3UTSB 1WVZA 4FQXD 1NBZB 4FP8L 1QR1B 1N59B 3RY6C 4F7EA 4JJ5A 1UJ3A 4BDVA 1CCZA 1UASA 2ATKA 3W2DH 3S4SG 4EZKA 3CFIC 2CBMA 2BNRB 3GBMH 5HVHB 4UQ2A 5GIRB 4HIIB 4JFFB 1IC4L 3DOSA 4PLJC 4UOJA 4M4PA 3LNFA 4Y1AA 4WUUB 3I6GB 1NGZA 2DQEH 5DD0L 3LVTA 4Z7OB 7PCYA 4LSQH 1GTNA 4E0RA 3RAJH 1D2OA 4AW7A 4X8JB 3MLTB 4KI5E 1JXFA 3OKLB 2AJYH 1RZ7L 3VD2A 1KCWA 1QYGL 4YDLB 4ZS7L 4Y4FC 2QMJA 2WLKA 3V52H 1R33A 3QZLA 1WJ3A 1KIQA 4I2XB 5L4FA 2WKOA 4F8TA 2WQ8A 3OR7A 3D2UD 3VFOA 3SDXB 4K3EH 3ZE0F 2H32A 4AOFA 1XGPA 3SDAC 4L9DA 2J1YA 4GKSB 4R3SB 1HXKA 4DAGL 5I6XC 3TEYA 1K9TA 1J05A 5EIIB 5IW6A 3ZSSA 4K3DH 4ZUUB 5CGBA 4P06A 1ZLSH 1J9CT 2Z4QB 5B3NA 1Z3GL 2Q20A 3BC9A 5EO9A 1J8KA 4N8UA 1MCHA 3TBTA 4F58L 4YMPA 3VQLA 1H6TA 4PRBA 1AG6A 5IJKA 3LZFH 4R2GC 4XMPL 2NUTA 3FH5A 1F58H 5F7DB 4QRQA 4XNYH 4JFDA 5AOMA 3C12A 3W1ZA 5TGBA 3BE1H 1UTDA 3BLPX 3ZE1F 1NFDB 2GHWB 3MLWL 3N44B 5JW4R 3KBEA 2YUVA 5TE6L 3MA9L 4G6FD 4P5RA 3QWOA 4LP5A 1QWHA 3LOWA 4MAUL 5B38G 3JTSA 1QSED 3UBFA 1KZQA 2NMSA 1K72A 4UT9L 3ESMA 4QMEA 5LCVH 4FXTA 1XGYL 3V5DB 5IW6B 3ILQD 1MIEL 1F90L 3GI8H 2X7LB 4XHJD 5D5ME 3LCYA 4X80L 1BVNP 2F54E 4AYSA 1U3HC 5DK3A 2EUXA 2CHXA 1OVZA 5JQ6L 1IGMH 2Z31B 2FEDD 1GYAA 2MCPL 3H2PA 3QYMA 1WO2A 4IOIB 4JN1L 1PAZA 2YMXH 1UXLA 4FRWA 5E1GA 3N55A 3L3IB 5CJOH 3VGGA 5HHNB 2OJEB 1WAPA 1QI3A 4RRPM 5DLLA 5MP6H 2AJ3A 1FA4A 5AUMA 1UA6H 4Q9CA 2NT0A 1URLA 3OZ9L 2ENQA 2F74B 3VRIA 4IMKA 4RIRA 4GG6B 4OJDH 1GGCH 3FQUA 2DQGH 4POYA 1CF8H 4JFFA 2HJLB 4KJPD 4LSPH 1BQUA 4G6MH 4O4YL 1YY9C 3JUYA 4P5TC 3OD3A 1KT2A 5KYWA 1MELA 3RPBA 1MCWM 4UOQA 3S36H 5TTRA 3L7EB 1JD9A 1NFAA 4JG5A 4G8FA 1RZJH 1ZAGA 3ZLQC 3W0WB 3DPBA 1OAXH 3F5WA 3L6FA 5D5MA 3GK8H 4WFHD 1HX0A 15C8L 4M29A 3WGVB 4KK6D 1ZHKB 4PM1A 2D7TL 3TFBA 1P4BH 4ZUSB 4E42A 3OTTA 3A5VA 2CJUH 4PW4A 1NBQA 3F01A 4NN5C 1F4XL 1JRHH 4R3SA 4WWID 3QCTL 4QRFA 4JFYB 5J12C 1BG1A 2PXYD 1PZ5B 2AI0L 5I0WA 3VJ6B 1UWYA 1OF2B 3GTNA 4U6VH 4X4XB 5GJSH 5EEWA 4D3CH 2VM9A 2C5DC 3ISWA 3GXUB 3HMXH 5J8OA 4F7PB 2VW6A 4R83A 1AYRA 2DYPB 2VGLM 4MCNA 1DCLA 1G7HB 5I1KL 4G8EA 4HIHB 1H3TA 2FJFA 5I75B 4P3DA 2GSIA 2GBUA 1ZMYA 3ZDWA 3UYPA 5IGXL 3GSOA 5LGHH 5DT1H 5F7AA 1ZGLM 4F7TB 5JMRA 1CR9H 2DQHH 1N5YH 2MRYA 1I3GH 4WUUA 2DLFH 1NCUA 5F1IB 7TAAA 4YDMA 2YA2A 4JFQA 3FKUS 2H3XC 4WO4A 3DGDA 1TVDA 3QXAA 2H0JA 3CVHH 4PI0A 2WO3B 3V8OA 5K1NA 3ARFC 4KTEL 4WO4D 4NOFA 4JGNA 5A3ID 1AC6A 1HXYB 4M8UA 4TKWA 1JYWA 2AXGB 1OO2A 2CLRA 4PRPA 4HT1H 5AW2B 2AXJA 2H9GA 3VMNA 5GS2H 1ZGLA 1RQ5A 4GRLC 3KPMA 5E1QA 4FFVC 3U4BL 1TKWB 3K80A 3MJ9A 5JW3L 3NDZE 4PJCE 1GHFL 1KPUB 5HDOA 1XIWB 4X4YB 5ID0A 3DNKA 2CIKA 1KWGA 3PGCB 2XTJB 4IBTA 3PXJA 2J6WA 4XCNB 3QIBB 5TK2A 1G7PB 5FIEA 1HHGA 2NDFA 4FQJH 2ZCLL 5I71C 4JVWA 3ZKND 1PZCA 5F96L 3LS4H 5AUMB 4GQPH 1QOKA 2YR3A 5GRUH 4N6RB 1SN2A 4X4XA 5D70H 5C0BA 1BLNA 3S2CA 1ZHNB 1DBML 3ZKMC 5B38A 5MEQB 3B2DC 3QR0A 4IRSB 1TQWA 3ZT7A 3T2QA 1VERA 2DS4A 4JO3H 4FQXC 3M1CA 3SPJA 1N6QL 2XY1A 3BSZL 4GXUN 2X88A 1I3RA 5KBLA 1M9WA 2RALA 4X5LA 2DM4A 2YAEA 1PKQE 5JNYA 3NCJH 1UZ6E 2J57A 2VQ1B 2YXMA 1NC4A 3U9PL 4NQDA 1N5AA 2BOLA 4XNZB 4NGHL 4JFPB 4XWOD 3RTQA 3WHE0 3E6HA 4PS4L 2HXAA 4JZOB 4TS6A 4ENEC 1BAWA 3BP6A 3BX7C 3GJFH 5I6OA 2UZYB 4HHAA 4N20A 2VUKA 4YAQB 3SDDA 3DX1A 5C07E 2F58L 3RL2B 3QK0A 3BOVA 2K78A 2Y24A 5E9NA 3QDJB 1FH2A 4QXTB 1F45A 1A6TB 1MHPL 2G0KA 4LCIH 1E7UA 5L8KB 4F2MA 2HUHA 3HRZC 4Y9EA 4K9EL 1MEXL 1R3KA 3LQAC 4U1KB 3D39E 2NQ3A 1YEJL 2VZVA 5L2JA 4M7ZC 3UTQA 2WTOA 3WO4C 2XXCB 1JBJA 2P49B 1I1CA 1A6ZB 5HDWA 3DIDA 5BZWA 2HTLD 1K8IB 3CVIL 4JY6B 4O5LH 2VLLA 3ZR5A 5FECA 1DDTA 1OSZA 1ZKAA 4PJFE 1MAMH 2FT7A 4F3FA 3IJYB 4YBLB 5CP3A 3B2XA 3RKDC 2G75B 1IM3D 1YDPB 1YPZA 4LF3B 4NFCA 4PG9B 3CFEA 1WA0X 3UZQA 3HZVB 3PP3K 5C09B 3D85A 4KJWC 4GO6B 1N18A 4MA7L 5E2WL 1BZ7B 3VXUD 3LB6D 2YAMA 3AREA 4W9GC 4WGVB 5EMYA 2HKAA 1E4XL 1R24A 4FLQA 4QRUB 5FDYA 5E95B 1K2DA 4A2EA 4N2AA 1NC4B 3MLYL 4LOUD 4RGMC 2V5TA 4NZRL 4XP5L 4A7VA 3LN9A 1CTOA 5C0CA 5DHDA 1BIIA 3PDOA 1MFCH 3B9KC 4XVOA 3CV5A 3VCLB 3UYOD 2WOYA 2DQJH 1T5XA 1SEBA 2F54B 1R5WA 3AUWB 3GS4A 1NDGB 4MQXC 2WZPA 4L1SA 3VFTB 3DVGB 3EO1B 3NCCB 2FEEI 1JJUA 4ZMNA 2HFTA 3RX5A 2WJ7A 3L45A 3U82B 2BVTA 1AAJA 2Y5QA 5I76B 4O58H 5IM7B 2NUTB 3VX0A 3MROB 3D4ZA 4JG0H 4Z7UB 3TX4A 3NIDE 3DA0A 1HHHB 4AG4H 1BVLB 4PI2A 1RJCA 4HJGA 4JM2D 4XE0A 1S9KC 1A4KB 1ASQA 3SKNB 1BZDA 2A9DA 2H3NB 5FYLE 3TN0B 5B8CC 4FULA 4LCWE 3R8BB 4PRNA 5HPMA 3H3KA 3ECWA 2CR3A 2R8SL 4NQXA 1KCVL 1IBDA 5C9JB 2QLVB 4GP8B 3V0EA 3BH4A 4JGUA 5ABZA 3AADB 3FT2A 4N1CA 4PJXB 3B2VH 5IHZB 3V5HA 3AS3A 3B8SA 2GUOB 3CXDL 5EBWB 3G5ZB 5I1GL 3TT1L 3ZMNA 4LLQA 4Y1AD 1IKNC 4LEXH 1EAOA 5KS9B 2EJ1A 1TNNA 3L1OH 3IGLA 5I0DA 4MCMA 2GCYB 3QYNA 4HXAH 4G80B 2QR0B 1U91B 4G42A 2FBJL 5I2IA 4HDIB 3RDTC 4GB9A 1GZPB 1GKEA 1G43A 1B6DA 4YR6A 1S4IA 4U1IA 3PGDB 4M3JA 5C8JA 1BX2B 1RZKL 2AABH 2EIBA 2XXGA 3FAXA 3IMUA 3P2BA 5C0GA 5GGUA 1ZANL 2OMTB 4UT9A 2GC7C 4JKWA 4JPVL 4UI2A 3RG1C 2Y72A 4DSYA 4AQZA 4L1LA 5EOTA 2KH2B 3IJSA 3CXFA 2N56A 4OIIH 4DKAA 1MFBL 4WZ9A 4JHWH 2A0LD 3AY4A 4R7XA 4UQIM 2ODIA 5L8LB 1NLDL 3U0PB 4JNXA 3HRZA 4RGNE 4LGRB 5CEZL 3IXTB 4C56A 1JTTA 3U7YH 5CD3A 2OL3A 4PG9A 3NUKA 4JW3A 3GZQA 3OF6A 1NSNL 4YDKH 3DURA 2X4RA 1KXTB 5DUBB 3VG9C 2APWA 5F7KC 4M43L 3FQYA 3L6FB 2IFFH 4KU1A 2DQ6A 2K6ZA 1KEML 2BIIA 4KY2A 2FJHB 1L3WA 1GYUA 2JELL 3JXAA 1T22B 2OZ4H 1L5GB 4JY5H 2A6IB 4N85A 2PXYB 5EU6D 4X6CB 5AW8B 2AJSL 3ROOA 5D2NA 2VDRL 1DBAL 1S7XA 1HH9B 2E7CA 3D34A 5L2KE 1DBKL 4O02A 3D51A 1BFVH 3UBHA 3FCTA 5FOJA 1YZZA 3BKCH 4CW1A 4ODTH 5IB4B 1XCTB 2VLKB 2AK1H 2R29A 3DVGA 4S1DC 5DLMH 3HR6A 3W5MA 1LXMA 1QRNE 2L4OA 3ETSA 1V54B 1A7NH 2B15A 3MBED 1S9WA 3K4DA 4R2GB 4U3CA 2WW8A 2YAOA 3W9DB 2UXGA 4K3JL 5ENWA 4ANUA 2PYEE 4I77L 4LVOC 3O6FB 4N5EC 3MRLB 4S1RH 5FUCC 3TZVB 4G6KL 2ARWA 4P3WA 5EIQA 4ODHH 4CN6A 3QQ4B 3LRKA 4PGCA 3MUUA 5G4OA 2B16A 3HB3B 5CEYB 1KBPA 5CCJA 2P1YA 3BIKA 3POHA 3TEZA 3QNXB 1QUNB 2WLLB 2VM4A 4PMEA 2ODHA 2ZOKA 1WS8A 2DQMA 1YHPA 3MODH 4IGBB 4XRCB 5DVKA 3WXVL 1UM5H 1CU4H 4I2XE 3EDEA 4YHKL 3AQZA 5SV4A 3GHBL 4NM8L 4XNDA 3HFMH 3EOAA 5D1XD 1W72B 3L3HA 3S34H 4TSAL 4GQZA 2UZXA 3BEWA 5B4MD 2Y7OA 3V7AE 2HH0L 3QXUA 1H5BA 5B7EA 1YNTF 2VMDA 4K94L 4QXUL 2P7TB 3MNWA 5E6RB 2WN2A 1KJ3H 5FHBL 1AXTL 5EO0B 3SBPA 3D39B 4AL8H 3QNFA 1T04B 3LKRA 3RTLA 3H0TA 4QRPD 2Q8BL 1E67A 1F2QA 1DBBL 1F41A 2F5AH 4CADA 3IDYB 1UUNA 3L3GA 3VGAB 1UB6B 5T3XE 4U2ZA 4UZUA 2YD5A 2EVJA 2I27N 4I18B 1T66C 4ICWA 1UZ8B 1FLTX 3N9GH 1JF1B 2L8AA 3C5SB 1FAIH 5JUEL 4QXUH 1PJWA 4NQSB 3DTXB 3G08B 1RK0A 1Z5LA 1F2XK 2XG5A 3I02B 3AMLA 3WTSA 3MJ6A 2V4LA 2D3VA 5D8JH 3WE1A 2VW7A 3NGBB 4ONFL 5G55A 3L17A 5EG6C 5AD0B 2HLEB 4WJ5B 3WFCH 3I6KA 1OTUC 1A66A 4XNQA 4KHTH 2LV4A 4PJ9A 3LZNA 3D39A 2HKHL 3GLEA 4F24A 4KJWD 3BP5B 4PVBA 4LSTL 4JJHA 3FHQA 3A67L 4I4WB 2JI2A 5C0IB 4UM9D 3BDBA 5AZ2H 1NMBH 4OGYL 3BYYA 1T03H 2ITDA 2VW4A 4TQ8A 3WY3A 5CEXA 1K5WA 3GB7B 2NCEA 3KXFA 3OKYA 4JRXD 3OKMA 4WEEA 2ATAA 2AEOA 1MCBA 4M61A 4PGBA 3T2NH 3VO0A 1YN6B 1GSKA 1NGWB 4MNHB 4ZFGH 5JHAA 2X1OA 3HRPA 2E7LA 3KJ6H 1BXVA 3DBXB 5AVZB 2RCSH 3TZVA 1D5MB 1MJ8H 1U8CA 3T65B 2DWDA 3GEWB 3QUMH 3KDMB 1SPDA 3QO1A 5KYYA 3PHOA 3QPKA 3EYOA 4V33A 5DZAA 1PFCA 3CZGA 1A6WH 3PFUA 1WA2X 2VDRH 3WV0A 1PY9A 5A6IA 3HE7A 4F9LA 1FG2B 1IAOA 4JY5L 3C6SB 4PJXE 3QZOA 3R7QA 1V7NH 3KPSE 4UOW0 1I7UA 2AGJL 4Q6YA 1KIRB 4YSOA 3FO0L 5JPMB 1KEMH 3V6FA 1LJMA 2Z8WC 5D7SH 3MNMA 5BW7C 5T3ZE 1DQQA 4KBPA 4KUCD 3HAEA 2WY3B 2GTWB 4BE5A 4AUJA 1WICA 2XN9A 2AXFA 2AKRA 3QIBC 1OAQH 4LT7A 2XBDA 3AXIA 2NY7H 3VI4E 4KKLD 3RUGE 4L23A 4UBDC 4JM2B 4FN0A 1W8EA 2VERA 5GGVY 3O4LE 1G7IA 3US9A 3BAXA 1ZA6A 4UIMB 4OIIL 5H35B 1AGCA 3W0WD 3QJZA 5J1SC 5DC9B 2EQDA 5A2IH 1OW0C 4P23C 5I23A 5LO7A 2N01B 3OHMB 4XGZA 5IMMB 2O93L 1NMAH 3RI5K 2YN5A 4OBRA 1FVCA 3FFOA 2N0KA 2ZJSH 1CGUA 1SOKA 2XQYK 3IDXH 5H37G 1RMFL 3QJUB 2XVLA 4A2DA 4JFHE 4ZAKC 5GRXG 4HUUA 4IS6B 2D9QB 1M1XA 1MRCL 1QEWA 2EXSA 5DVPA 2XXMB 3OJVC 5G5DB 5JIMA 3O2DL 1R3LA 4OZGE 4GKLA 4KUCF 5FYKD 3Q8FA 4QNPF 1OSPL 3KLKA 3SKUD 2WHVA 3WKML 2N0MA 1J05B 1CYGA 3EG9A 2J3SA 4YHOL 3DKHA 1DTUA 1OB1B 3LH8A 4IDLA 4N2FA 3QDJD 3I50H 3ZU8A 2AV1B 4YHNA 4OM0L 1KNOB 4ZX4A 2Y06L 3M6DA 3IGFA 5FKAA 1F11B 4ZD3L 3IDGA 3S37H 2XPYA 4XP9H 4F37F 1YNTA 4M6OL 5DEJA 5CWSB 2BOCA 2ZWNA 4APXB 3AWFA 1XAKA 4JFQB 2F7PA 4ZFFA 1IGYA 3KCWA 3NEEA 1FLRL 1JNHA 4GAAA 2ZIDA 3QI9D 4HKZB 5DMKB 3MLXH 3L7EA 1ZEAH 3S96B 3SE4A 3EFOB 3KS0H 4XXCA 2QSQA 4HWEH 2NY4C 3FQWB 4PH8A 2HX9A 3SZ6A 4L9LB 1MVUA 1UEMA 5EFIB 4Z7NE 1WBZB 5ITFA 4YBHA 1T7VA 3Q8BA 2OSLA 5FW6A 5C09D 1T20A 1YSOA 3IF1A 5BOJA 3SQRA 1F6AA 3QAZC 1Q9LA 4XI5D 3EO1A 4FLRA 4Y2DA 4AMKL 3MKKA 1WFTA 1M3JA 4JFWA 1KOAA 3GXNA 1UUSA 4NZRH 2YD9A 3MLYH 4WNQB 4XP5H 5HHXL 1AQ8A 1GOGA 1TQUA 2P4AB 4K5LA 4AJWA 1VKXB 3ARFD 5L2KA 1PSKL 3FS9A 1MN4A 5L88L 4YDIH 3BUBA 2Y6SC 1NEPA 3N44F 3VYNA 2G2RA 2DWXA 5E0QA 4YHPA 2DM2A 4WV1C 2DKMA 2VOTA 2WKOF 2W9LA 1OM3H 1LP9B 2H32B 3LHAA 4TTDD 5KVMC 5BZWB 1MNNA 3MFFA 5DSCB 2JWYA 1CG9A 1MFVA 5E7BA 1A4JA 1U3JA 4P5SA 4XXDA 4QOKE 1MG3C 1FI8C 2VYRE 4FEIA 1ZJBA 1MW3A 3H55A 1VENA 4DGUA 1FH5L 1YEJH 3UTPE 2YGOA 3R06B 4ZTPH 2Q3AA 3DPDA 3IFPA 1EEYA 4GKZB 3KE0A 4G9DB 4NO3B 4XP6L 3TA3D 1NPNA 4LCIL 2OI9B 2JI3A 4PVLA 5IHBA 1AXIB 4LPYA 4JN2A 1JPTH 3ATDA 1MJJB 2DQUL 4JRWA 2IANE 1QLRA 3K72B 4MD4B 3F7VA 3H6JA 4O9HH 5FYJH 3SJVE 1OZTG 1JL8A 3L2NA 2WWNA 1WBZA 5ITFB 3UAFA 4QRAA 5IHUH 4Z7QB 2IDCA 1URIA 4LPXA 1CTMA 3IPFA 4KVCH 1KLGA 3VWJA 2OR9H 5E5MB 4NGHH 4NLAA 3V6FB 3OG6B 1F1AA 1BXXA 1IV8A 3P2DA 5HGBB 3ZTNH 5JIHA 2F1EA 1IFHH 4JRYD 4S1SH 3BSZH 2AAAA 4U1LA 1V55B 2FJGB 4MQ7A 4ZK8A 5IOKA 4MS8D 4BFEA 5T3ZL 5I8KH 4P59H 2QPSA 2BIPA 2WK2A 5M94B 3KPRA 2FL5B 1NBZA 4L9LC 4IU3B 1HHHA 1SOXA 4XBPB 3VXSE 1PYWB 5A2KH 1U33A 3WIHL 3GRWA 3LS4L 4APXA 3GS7A 2VLRA 4HWUA 1CVRA 4JFXA 5C0AB 2E56A 4P5MA 4ZO7A 1HI6A 3IDMB 4IK7A 3TBYA 4TF4A 3U25A 1Z9SA 2VQ1A 2IH9A 1IAKA 4WWKB 3T2OA 1XF4A 3QSKB 2K6YA 2XDHA 1FVCB 4AEEA 5HD8D 1PZUB 4V1DB 2RAMA 3BISA 1U8MA 1ZV5A 3PDOB 4CKVX 2ZZUT 4CDGC 1KCRH 2OMYA 5BPPA 5KS9E 4KO7A 2P8LA 3MNDA 4HUUB 3OV6A 2ID5A 4QKXB 4DGVH 2FATL 2AF2A 4KO6A 2CO3A 3WEOA 1OE1A 1ND0B 2ZX8A 1W0VB 2FH6A 1TZOA 3BH9A 4GY4A 3V6OC 4TULH 2G5UA 3MZGB 4KHXH 4YEFA 3OR7B 5D2NE 3F62A 2VABB 1LL1A 2JFCA 2WBJD 2XG4A 1JWUB 2FX9L 3LEYH 3OZKA 3Q06A 4QHLB 3O4LA 4L3AA 3E9UA 3QDMD 2NSMA 4NDMB 4LQFH 1U92B 2AQSA 1Q9WB 1TZIA 3D69B 3EH3B 2O6CA 4PRID 4YBQD 1A9VA 5TF1H 3QEUB 3E0GA 1J48A 2HRGA 2ADJA 2JSFA 2X4TB 3QHFL 4EZJA 2FB4L 4FQHB 1U3HA 4OIFA 3ATAA 3EYVA 5E8NA 1C16A 3CFTA 1ACYL 4RMWA 3FT0A 4PR5A 4Y4KB 4IDJH 1P5VB 2F8OA 4PLJD 3DVFA 4MFHA 4BK8A 1QI4A 2R0WH 5K33A 3GSOB 2K7PA 3JV5A 2AK4A 3FN9A 2BNQD 1I9IH 4YDJB 1X7QB 4Y16C 3ZTCC 4LMQE 2J72A 3DJZA 3TEXA 3SDDB 5ECJE 5BJTA 1HAWA 5FWRA 4UV7L 3SCMB 2EEXA 1YEDB 5LHDA 1I7UB 3QXAB 3KWXA 2X89A 1U8OB 1P7KB 4GRMB 3NAAL 3GLDA 4OZGB 4ONHB 1KCSH 5TF0A 3S97C 2VLKE 3QHZL 1HE7A 1NANI 5C07A 3LNIA 5GHWL 1F18A 4BCZA 3HR5A 1QI5A 3TO2A 3BAJA 2ORBL 3L9YA 1BGXL 4LU5H 1XMEB 1CURA 4XN8A 1D5IL 4MJ6A 1PNCA 2WLZA 4UT6L 4J8QA 2W60A 1SFDA 3QA3A 2K0RA 1RVFL 4OB5H 4PJIA 3B5HA 3EJRA 1JWUA 1RIHH 4X5XA 3UDWA 3SD5A 3FSZA 5CN1A 3BWAB 5EDSA 1FNFA 3GXPA 5F7MC 3SPHA 4WCYL 5EUOA 4DTGL 5LNGA 1NOAA 4JQXC 1X5IA 1G1OA 2YMXL 3VRJA 3BGFB 2JLLA 3HI1B 3KCPB 5SWZD 1TENA 3FUFA 5GRJH 2X4OB 1JZIA 1SM3L 1R1CA 2J8HA 2VDQL 3GSUB 2VMJA 4OZGA 3U30C 5JOFA 3PWUA 2LVEA 4HSQA 4ZS6D 4TQEL 3OXRB 2G5RA 1AC0A 3KEDA 1GYVA 1ZPUA 2JKSA 3AVEA 3QHTC 3CK0L 2CD0A 4XTRD 1E9OA 3CNKA 4Q8BA 1QKZH 3MV8D 3TYFB 4CU6A 4ZZKA 1U2HA 3MPCA 5AD0A 1AE6H 1XSJA 3D7PA 5HYIA 3ABLB 5HGDB 3BHBA 5IIEB 2B4CL 5SWZA 2Y7QB 3S4SA 3WNIA 5H2BA 1MFDL 4MAUH 3V4PH 1AR1D 1WZMA 3DHJA 5IUSA 4KUZH 3RIFF 3NCBB 3MOBL 4K2UL 5DQDH 3CMOL 4HIXH 4UAOC 4AZ8A 3EJQA 4WTXA 2FEDC 1PEZA 2UXVA 1CLVA 2F7QA 5E1AA 2XQ0A 4PJDF 2MJWA 3QIUD 1CDIA 4G70B 3UACA 3EO0B 4BKTC 3N40F 1A5FH 5D1QC 4HJJL 5TK4A 4NC1C 5D5MF 2E8YA 4PRHE 4YDLC 1D6EA 1LO5A 2G9KA 2PCFA 3JTSB 2YEZB 1UA3A 3ML9A 2F5BL 4JB9H 4DVRL 2IWFA 4H8QA 4RRPG 3KGRA 3GSVB 3OKEA 1G9MH 1HCVA 1ZDQA 5I66A 2PWGA 1MCFA 3UYRL 4KJPC 5I1DA 2I07B 3HNVH 2YPVH 3S3SA 2EDTA 2P5PA 4RRPA 5IQMA 2NYKA 5KBMA 2BSRB 3VE0A 3HI5L 3SO3C 3HEIB 3OB8A 1HXMA 3QNYA 3TIEB 2CH8A 1Y7VA 4KFMA 3SJVB 3PQYE 3TBTB 4Q0XL 3UC0L 3UJIL 4TLUA 4ADJA 2AMGA 4H5SA 3BP5A 3ZTJG 4Z7QE 5DWUH 1NM4A 3FU7A 4OFIA 3GXFA 1U4EA 4J3XA 4ZQTA 1A0QH 1KF9B 2IXQB 4HJUA 4CVWA 4HPHA 4FZEH 4IW4C 1TZAA 1VZIA 3FQXB 5GJTH 1MI5B 4LSQL 1UC6A 1A9BB 4NKMB 3TV3L 1IKOP 2XWJA 1R3IL 2DQEL 4MLSA 1CFNA 4F7CB 1F6LL 1UCBH 3M8OH 2YZ8A 4GRWB 1JE6A 1Z0NA 4F9PA 3MJWA 4XCNA 4FQCL 2BY0A 5KYXB 4Z0XB 2IV9A 3K46A 3S37X 4GXVL 3JWOL 3C08L 4XPBL 4Z7VF 2GUYA 3LZQA 4RFEA 1ZD6A 5BRZE 3IS1X 1E9QB 1KYDA 1XHHA 3PWLA 3NBNA 3FTVA 3JV4A 1PIGA 1T21B 5F9DC 4OZFB 2W38A 3PWVA 5LQBL 1SN5A 3GO1H 4MS8C 5J4MA 5IW1A 2VZSA 4UZSA 2CDFA 2DJSA 1GY1A 4TSBH 2EO9A 1B0WA 2X1PA 1OKEA 5CKGA 3HNTL 1KCUL 3QCVL 4YUEH 3EDKA 1OCZB 2EIMB 2OMZA 3R0MA 1IGJB 1RIVH 5HDQH 3ARXA 3FTYA 1JGDA 1MI5A 2FT8A 3M8OL 3UZEC 1T7XA 1ET7A 1VDGA 3G6AB 3N6YA 4X6CA 1A4BA 3RRQA 4JM4H 5HP5A 4HK0A 3N0AA 5DC4B 2OCCB 2PO6C 5IJBC 4Y5XA 1X3DA 4UIKL 4ZUWB 4FA8A 1KJVA 3LNEA 1MY7A 3IDXL 1FHNA 9CGTA 3TH4T 4NHCH 4LP8A 2W81C 4FXLA 3VI4B 5HVWA 4KY1H 1CL7H 4N3TA 3ABZA 4R5TA 1NMAL 4NUGL 1SN0A 4P5TD 3REVA 3RHWF 1U3NA 4FQIH 4NZDA 1MHEB 4FHBD 4LSDA 2EDOA 4QRSB 3ECVA 2ZX9A 3X14B 1UJ3B 5C3LD 5ICXA 3SPVA 5ESQB 5I18L 2I85A 2AV7B 4R4ND 4PWKA 2IMNA 2X4QA 1GGUA 3HI5H 4NM4H 2OMXA 4U6HB 3QJTB 4IQHA 4WEUD 4AH2A 4M7LL 3NSCA 4QXGL 3L7FB 1CICC 1U8IA 3HMXA 1IBYA 3VFSA 1DQLH 1PG7X 2WLIA 1IL1B 4P5KA 2KQNA 2C34A 4NHUB 4JVPA 1UH3A 2GW5A 2F08A 3ZMRA 2EO1A 2XZQL 1RH8A 1U8KB 1BQ5A 1L9RA 3L4YA 1IC5H 1ZHLB 3FTGA 4WGWB 5KTEL 2B0SH 3ARWA 3QEQA 1V7NL 2WQVA 3LJ3A 2ZCKL 4ZODA 2HSIA 5EU4B 4N8CH 3CVHA 5FV1L 4W9JC 4IHOB 1IM9A 5F1KC 1NJ9A 2YD7A 3NK3A 1MLBB 3SBWA 5IESL 2HRPH 2B39A 1UCBL 4MNQE 2GK2A 1J0ZA 1TJIL 4Q6KA 4PJDA 2XWBB 1P53A 4Y16D 1OSYA 3DX6B 4HC1A 1SEBB 2F54A 4NJAH 5GJTL 1JZEA 4GO8A 3PHQB 1JRHI 3UG5A 1YN6A 5I0VA 1TJGL 2RIKA 2X3CA 4EXPX 4FTVD 1ADQA 5D6DC 4DP6X 3K3QA 2VMFA 3LKSA 3QFDA 3SDXF 1CDBA 1IT9H 3QJSB 4K7PX 2OPCA 5GRJL 3LMJL 4L8SA 3HG3A 1Y18A 4MKTA 2VMEA 2EECA 1RZPA 4HIEB 4PRDA 4GRLD 2IANA 1HWGB 5EUKA 2AJUH 3VD4A 3ZO9A 2VXQA 3NP3A 1A6UL 4K94C 3SCMD 5GS1B 2F5BH 4QT5A 2NOYA 1U8LA 1LQSR 4B50A 4G9DA 3NIDF 4JUSA 4XMLH 2XRAH 5HJBA 4BA0A 3K91A 5KVGH 5DEGA 2XXFA 3U6XA 1S9VA 3F58H 1D5IH 5K59F 4LHQB 1CI3M 3RGHA 1P2CB 3KLDA 2D0GA 1J1OH 2A73B 1KGCD 5FDWA 5JW4Q 4LPWA 1XGUA 3C5ZA 3MV7A 3NESA 4LLDB 3MOBH 4FQQB 4K2UH 3QI9B 1SXSA 4U1JB 1T0NA 2DH2A 3GHEL 3KW8A 4JO4H 2PW2A 3BXNA 3WL9B 5IFHL 4PGBB 4CDHA 4JY6A 1ED3B 1ETZA 2QQKH 4LCVA 5HJ3B 1U41A 3T6ZA 1SJMA 4UANA 4F91B 2GEQA 3MGOB 3B4NA 1Q9OA 2G3MA 1CD0A 3LXUX 3TNNB 1S7QB 4Y88A 5KW9H 5DRWB 4UQDA 2TSAA 4W9DC 4JPQA 3DX8B 5CSZA 2R9HC 3THML 4ZMTA 1AR1C 1YY8A 1I7ZB 1CFVL 3RX7A 4DCQA 3H0TB 2A2QT 1UXWB 3MUGB 5SX4H 4PGZA 5I82A 1SYVA 2WXJA 4CU7A 2CE6A 5I73B 3GT6A 3S5LG 2UZPA 1UADC 1U95A 2NTFB 4V1DD 2OI9C 5LCVA 1W72H 5DUMH 1DL7L 4NKDB 3RY5A 3DX9B 2WD0A 3ZQWA 3O9WD 1QACA 3CLEH 1DANU 3P77A 5A1AA 1EIBA 1AR1B 1I1YA 1KGYE 3DV6A 4QI3A 4EMZA 2B59B 1ZLUK 2AQ3A 2ZCHH 2YPLA 1LQBC 1NINA 4X6DE 1LEGA 1EUUA 1F11A 3OKKA 4Y2LA 3KHQA 1FZKB 2IADA 4OZFH 4FJYA 4N2IA 5MHSE 5ETUA 3VXSB 4RZCB 2DM3A 4OUUB 5FA3B 4S1RL 4DGVL 3STLB 4AIEA 1NAKL 2A38A 1IM3A 1HHJA 4IOFD 3K5RA 5T1KB 1QVOA 1EXHA 4B5ZA 3VGHA 1M2VB 3DOIA 3SE4C 4AWJC 4H7VA 2QPEB 4AMXA 4MMXB 4JMXA 4X4ZA 2AQTA 4LPVA 5GRWA 4RCAA 2SEBB 5C0AA 1A7NL 4EOWL 2ICWA 4WI0B 5J9PA 3UAEA 3W11D 4TQPA 3DRTA 3UAJA 4BK4A 3GMRA 3MRPA 4LOEA 3QARA 3UJTL 1AGFA 5AVXB 4XP4H 1BVOA 2A0LC 4MJ2A 3LAFA 5DO8A 5I1EH 3VG0L 5ITBL 3KPQA 1I9RH 5T1MB 3DGCR 1QATA 2NY3C 2VXVL 2YGPA 3G5YB 1QUNA 2WLLA 1FCGA 2WQXA 3QORA 4LKCB 3U36A 5I8KL 2IAMB 1ZXQA 4MXQD 5T3ZH 4AGLA 5ACZB 1G0YR 4B7LA 4OH2A 2GTQA 2VLME 5L4MA 5TF1L 4HCGA 4NQVA 4A63A 3V6OA 4LQ1A 4DZBA 2VZ1A 3Q5OA 3ZTNL 2HLAB 2CUAA 2YQ3A 4HBCH 4OQTL 5H4YA 4YHLL 4H20L 1DR9A 2W5PA 3ZX1A 1NSNH 1S7VA 2DY2A 1EMTH 1XL4A 4MAYB 4YN3A 4D9LL 3O6FA 3SSGA 1AGEB 5I1IH 1BVKB 1A47A 1XVSA 4F80A 1KEGH 2VXUH 2XPZA 1LWJA 1I85A 2BZCA 1BMGA 4KMTH 1NLDH 4KHXL 2VDKH 4NDMA 5LBVA 2ZNXA 4M6NL 1Q9WA 4HKBB 3MCG1 3KEHA 1PVHA 1BEXA 1NWPA 4N2NA 4TXVB 3UP6A 1MREH 5BS0B 3LV3B 1WQVT 3ZTEA 2IOIA 3KPQB 2A7BA 1K4DA 2ZWLT 4A67A 1RURH 4JO5A 3WKNA 1I9JH 1UG9A 4L0ZA 1S7UB 3CIQA 4U1GB 3FQ1A 4LKCA 3JT0A 3T0XA 3TBVB 2R4RH 1FH5H 1XGQA 4I3SL 1FIGL 2ZOLA 1MRFH 4L3FA 1MWAB 1P4IL 3BUDA 1IAIL 4ZUTA 4ODVL 1CD1B 2VT0A 3L3KB 1OAZL 2P8PB 2PW1B 1FBIH 2NY5C 4OIAA 4F5CA 2VAAA 4MJIE 1RJLB 5FCUH 3CHPA 1FO0A 2QV2A 4RQQA 2YA1A 3T3MB 2Z6FA 1NCDH 1U8PA 3FOLA 2AXHA 1KLUB 1OM3L 3RVTD 1NEZG 3ALWA 4MQSB 4C4KT 2B2XL 2AJZB 1I8KB 1BZQK 4LSUH 4TNVF 4W9EC 4XO5A 1DVYA 3TJEH 4E9TA 2X05A 1ZGLB 1MFUA 1S3KL 3DV6B 4G8GD 4RWYH 4KXZH 2KL6A 1XCQB 1YNLL 4J4PD 2O4EA 3OX8A 4MCZA 2EDNA 2FL5A 4OQTA 3F7LA 4PQXA 2VZTA 5B4MC 4ZMZA 1WZLA 4GMSH 3OPZH 1U2YA 4PSPA 4Y89A 4QRPA 1Z32X 3GEFA 4DP5X 2DLHA 2E7MA 5DU7A 3O45A 2BC4A 1PEWA 2BVEA 2OTWB 4EI0A 3MREB 5L7XH 5INDB 1A6VH 1DJYA 1V05A 3BSZA 4DUVA 1Y1DA 5LN8A 3JT2A 5DA0B 1D7DA 1I53A 5L7XL 2DQIL 4WI8A 2UZIH 3HZKA 3HC0B 4CSTA 1FZMB 2F53A 4KOCA 4B3VA 4OF0A 2Z31A 5IHZA 1TT6A 5F7EH 4JL2A 1GZHA 3BZEA 4GMSL 4EI5B 2WQWA 5GISH 3I6SA 3N41B 4N8VB 2XV3A 5CINH 5ABAA 4B9PA 4NQXB 2UWEF 5HHNA 1XF1A 1A1MA 5F7UA 1EUTA 1RJYA 2FX7H 3QJFB 5EORL 3ZO0A 5HD8C 1E4XH 2XFXB 3MLVH 3SQOH 4PJEE 2NY1B 4OZHB 4PBDA 4MA7H 4RQQB 3OQRA 1L7TL 2OX5A 2O5ZH 2J8OA 1FVDA 4GBXB 3Q2LA 3WDIA 3A24A 2VDOL 3CFJB 4HALA 4N2KA 4Z7WB 5AAMA 3MV9B 1Q94A 1OV8A 1OHQA 5A3IC 4TUKL 3UTQB 2C3HA 4YHPB 1S78D 1MRCH 2E74C 3BAEH 4K8RL 4RGOL 3WMQA 2A4CA 3UZVB 3CZKA 3S3JA 2BP8A 3T6VA 1BQSA 2R4RL 3INOA 4HCRH 4Z7IA 4ZQKA 4OV5B 5HY9A 4K9EH 1WUNT 4P46C 1GXEA 4YO0B 1OARL 1I75A 3VMPA 4MA3A 1I9JL 5JPNC 2FO4B 3CDZA 2R2HB 1RPQA 3RA7H 4HWEL 3BP6B 5KG9A 4FCAA 2O1AA 2NW2A 2WANA 3EGDA 1JERA 4BGLA 4YDVB 1JAEA 3G5ZA 5I1JH 2VDKL 2AXFB 1HOCA 3QDGE 3OPZL 3C8HA 3UTTD 2CIIA 1B90A 3PRZA 1FCCA 4OZ4B 1MI5E 3GBNL 3NPSB 1H6EA 5LDSA 6TAAA 3K8MA 3IDYC 4P46B 4POZD 2AW2A 3GS0A 5KYUB 1F4WL 3DXAA 2MWCA 1UQSA 2R39A 3MCKB 5EBLB 2DDQL 4OCYH 1T1XA 4XPGH 4TVPD 4N0CD 4HJIA 1LE5A 3OX8B 3OB0H 2V9RA 3EJZC 2YGQA 4MCZB 5DO2D 3TJEL 4KI5F 4FERA 1KIUB 4FI6A 4MB4A 5IW3A 4AJVA 4AKPA 1GOFA 3P0VL 5KYXA 5FK9B 3EF4A 2H7WA 1ZLVH 1NCDL 5EUOB 3FH7A 1DYZA 1U8KA 2AK4D 3U4AA 1FBIL 1FC1A 4FQJL 4IKJA 2E6PA 3JV4B 3FDWA 1A1OB 1XXDC 3MRNA 2ROYA 1WD8A 2OJ1A 3GMNA 4MDJA 1MXDA 4QUOA 2GI0A 5E2UL 3IB4A 1U8IB 3WNJA 3SJVA 4KKBC 4AVHA 5CU9A 5F0LB 5GGVH 4GG6F 2EIDA 4OLUH 5FCUL 4PJDE 2ICES 4Z95L 3JV6A 5KAQG 2Z34A 1LMIA 4PRIA 2HTLC 4H2AA 3UPRB 1E0OB 2BSTB 3O3BA 1FO0B 4NQQA 3VI3E 1MCEA 5CAYB 2COQA 5IMKB 1T03L 5DK2B 1XV8A 5D7IB 3EYUL 2E7BA 5JQIB 1LEGB 1OCCB 2XZAH 1BJ1H 1TJMA 5IG7A 1JV2A 1K3IA 1CFQB 2HKHH 3ELAT 4OF8A 4F9LC 3QUYB 4Y7MA 5LGHL 3BPOB 3G5VB 4KHTL 5EIVA 1BM7A 3P4NB 1ZWIA 3UJJH 2CDEB 3CUPB 1UCTA 4O2CB 5D7SL 1II4E 1N12A 5F1SA 4M6NH 5SX5K 1KBVA 1OP3H 1PKOA 1TMQA 3TTYA 2FJUB 2PCFB 2CO6B 3BEVA 1QHPA 2WGNB 4QLRA 5DRNB 2H3KA 4JLRB 1L6XA 2K3TA 4AQ8A 4D9LH 3SE3A 5FS5A 4GIAA 3TCXA 2BVPA 3BQVA 1FVEA 4N2HA 4APQC 2OQJA 2XZZA 3G08A 4WJG3 5AG8A 3ULUC 5GGRB 3NIGF 3QIUC 4Z3GA 3G5YA 4NN6B 4CL7A 4XOEA 1W0WA 2QPDB 1SYSA 5D7LE 1SUJA 4OVUA 3IFNL 4LL9A 1PX8A 1UVQB 4LPCA 4UDUA 1J87A 3UTSA 4XVTL 4BQ8A 4W68A 4KKLC 3GK8L 3AS2A 3MXWL 1FFNA 1IE5A 4MZ2A 3VG0H 1S9XA 1AQDA 4ZFGL 3VXUA 3FMGL 3S36X 5C7XL 3LY6A 2CUHA 1J1OL 3H9SD 4YEEA 5JHLL 3TH3T 1RSYA 1M05B 2LFGA 3CFKA 4CN4A 4F2EA 3MLRL 2K8MA 1OEZW 4FGMA 3OKNB 4AQAB 2JB5H 3SYOA 3QUKB 3VRIB 4P04A 4W9HC 1OGPA 2I5YH 5KVGL 4LEOB 2NX5D 1UWEH 3C5ZC 3COOA 4HOZA 3U2SA 2EINB 3T1WA 1LNUA 3OJDA 1UM5L 4M62H 4PIRF 3TFKC 1UWEL 5AB9A 5E8OA 2WUBH 4CMMA 4X6DF 2EICA 1YMMB 1N8ZA 3A4FA <