1SLUA

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
133
structure length
131
Chain Sequence
b'IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMHCPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
total genus 16
structure length 131
sequence length 133
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sluA00
1XXDC 2Y6TE 1FI8C 1P0SE 1SLXA 1N8OE 1SLWA 1XX9C 1IFGA 1XXFC 1ECYA 4IW4C 1ID5I 1EZSA 1SLVA 1ECZA 1SLUA 4NIYE 1EZUA 1AZZC
chains in the Genus database with same CATH superfamily
2EO9A 3NFSH 1TZGL 4MB4A 1TDQA 1WZKA 5ESAA 3ZR5A 3X2QB 2XNAB 2DQUL 2IOMA 3APFA 5AWNH 1R19A 4HXBL 3GMOB 1MQKL 1UD8A 4YSTA 1MXGA 4FXGB 1PLCA 1NBQA 3HE6B 3BPCA 3GLDA 1CICB 2DRUA 3WS6C 2R9HC 5CKAA 3DUSB 4QRPD 5T1DH 3V95A 2BXZA 2CRZA 2N0KA 1ZE3C 4KXAA 5HYSG 1H5BA 4PJ7F 1NC4B 4PJBE 3ZKMD 4C8XA 1KENL 4P5TC 5C0BE 3OB0K 1A0QH 4DQOH 2OQJB 3AQDA 5IEHB 1WFNA 5E00B 1WGVA 5FOJA 2J21A 2NY4B 1AGFA 4MXQD 1RIVL 2PYFA 4KPHL 4TVPD 4A7GF 5E4EB 5EU3A 1XXFC 4OLUH 2QGEA 5FHAL 4XTRC 2P1YA 5L2JA 1CLZH 3NFSL 3I75A 4XNXH 2Y5QA 2YN3A 1BMGA 2VUOA 4PUBH 3RGVA 3RURA 5J6GA 5IGXL 4H1LA 5AWNL 2WMPB 4L5FL 1A25A 1OVZA 4A68A 2YPVH 2WBXA 2YS4A 5D4QA 4CSZA 1HL8A 2VLJB 3PV7A 4P2QA 5CEYB 1H3PL 5ACZA 1KLGB 3MRLB 2WAHA 4HIIB 1JYNA 2BSTB 1TPXC 3SPVB 5D1ZC 2H7WA 5T1DL 4PYGA 1ZJBA 3T6WA 1AMYA 3MRFB 1QR4A 2Y72A 3VFRA 3LZNA 2GABA 3MLRH 4D0DB 4DO5A 1RP9A 3QC5X 1ZWIB 1A0QL 3B4NA 4DQOL 4XCNB 4HKZB 4N2NA 4IMLB 3VFVA 5JZ7C 3ARFB 1FFRA 3D2TA 5GGRY 4OLUL 5TPWH 3VMNA 1ZPUA 3GMPB 2UYLA 1CLZL 3ES6B 1ZPLA 4Z7UA 2YO3A 5F9WC 3FQWA 2BHYA 3FOMB 5DZJA 3CHOA 2ZAHA 4OVUA 4RIRB 4C83B 2YPVL 4FXKC 2G75B 4QHMA 2V7HB 1Q94B 3FSZA 3B2VH 2DLFH 3BSGA 1AIFA 1QBBA 3CBKB 2KPWA 2UZYA 2CQVA 1I1AA 4B97A 4FL4B 2H0EA 3Q44A 4YHNA 2A4ZA 3RFZC 3MLRL 1ZEAL 5IROD 3KPTA 2D3LA 1BSIA 5DTFB 3ZMEA 1NGWA 5IKCB 3OMNB 1IAMA 2EEFA 1PDKB 2B1HH 2J6EL 4PJ8D 4FXLA 2VUYA 1D5IH 3PDOA 2TSAA 5KUMA 5TPWL 3O2WL 4BFIA 5C6PB 2Y07H 3BEVB 3ILEA 5LXVA 3WFEH 4B9KC 5EO1B 4KJPC 2VDPH 2GCYA 3AAZA 4U0RC 4NQDD 4U33A 4HUUB 5E8PB 4EDXB 3D39B 1F4WH 7PCYA 4QCIB 4FLSA 3B2VL 2HPTA 5IV2A 2W81C 5FV2A 4FYQA 5J06A 4KRPD 2XQYA 3N2JA 3N41B 2W9LA 4HK0A 4OF0A 3RVXD 5AVXB 1JL8A 1QRNE 1ZHKB 1I8LA 1DANT 2W8CA 1MCLA 2D31B 2PCYA 4P4KB 3WMPA 2FO1A 4MCMA 2XY1A 1S7RB 3MLYH 1NDMA 3BZ4B 2A0LD 2IWEA 3GPEA 4DKDC 3R19A 1WBXA 1X9RA 1G7IA 5JXAH 5JHAA 4X5RA 2VRAA 1MKFA 3TVMD 1CVRA 2ZYIA 4ZW5A 3JV6B 1W2KT 1D5IL 2ZX9A 1XEDA 3FUKA 4QXTB 2Y07L 1S5HA 1P4IH 3DYOA 5AW7B 4JG5A 4M3HA 5DFWH 2E9JA 5EU7C 5I8OH 4GPVA 5IVXB 4LEXH 4JKMA 3SPCA 1D7DA 5EOCH 1F4AA 4PRHD 1MFVA 4OT1L 1N5AA 2JIXA 5EEZA 4QLRA 2XT1B 2DQMA 1CBJA 3IDJB 4WI0B 5JMOC 1E67A 3HVNA 3MR9A 3EFFB 4ZOEA 2J72A 2JI3A 2FB4H 3BUYB 3IDUA 5DWPA 2IFFL 4G8GB 3GBMH 4A2GA 1MFAH 4Y4FA 1JMZA 4YAQA 5IMLB 2NNAB 5FF6A 1T22B 2K4AA 1X5MA 3SKMB 1OCCB 1OKEA 2NX5D 2WOBA 5BVPH 3MLYL 2D03H 2IGTA 3ALWA 2JKJA 3QUXA 4UT9H 1HXYA 2TRYA 1EK3A 3ISWA 5CWSB 2VRKA 1HAUA 3BXNB 3D3VA 5HPOA 4Z7WF 3HMXA 1P4IL 1H9DA 1HI6B 3QR2A 2CJSA 4F7KA 3L3KA 4LEXL 4F15C 3REWA 5EOCL 4Z7QE 2OSLB 4OLYH 3M7OA 1R3LB 1GRWA 3SGEI 4X6FA 5KSBA 3RJDA 3VI4A 2FB4L 3QA3A 4LSVH 3GBML 1MFAL 1NDGB 5DK0A 4QTHA 1UZ6E 2KHAA 5FHBH 3T6QC 1O5DT 1FO0B 3ZTNH 1CGYA 2EE6A 3B8SA 3QIWC 2DEYX 5BVPL 3TCLA 5C0DB 1JWMA 4GI8A 4ZRGA 3BVTA 1MUJA 2H2SC 3C2SA 3PL6B 4UT9L 3UG5A 5T1MB 5I82A 3BP5B 4QIRA 5CO1A 3L2MA 3L9YA 4RFNC 1AP2A 3IDGB 3QXVA 5EPMA 2VNCA 2ICES 1U8LB 1P7KA 2XVKA 3H2WA 4NBYB 1J86A 5D7IF 2MTAA 3T9WA 5E8EA 1CDIA 4RAUB 3O6KL 5ANMB 2FBJH 4OLYL 2JJWA 1G7QA 4TPRL 3VX1A 3NJLA 4JDTL 4KI1A 4NB7A 1OGAA 4G6KL 4AYMC 1DO6A 1FYTD 4KH2A 3P9WB 1IBFA 1UZ6F 5CJXA 2MNWA 1H6FA 4Z8FH 4HIHB 4YHPA 3P4NA 3J2PA 2FO4A 2XTJD 3FB5A 1IZKA 2V9TA 2ZXQA 1QUPA 5IJDC 1Q38A 4TV3A 1ICTA 3P3UA 4P5MB 2PUQT 4IBYA 4LLQB 4MQ7B 3QE5A 3H2PA 1A4JB 1TTBA 4PJGB 3MBEB 4XNZB 5JDSB 5FOBA 2QGBA 5C09B 2OYKA 1KLFB 1EGJH 2VN7A 1PZUB 3UGUA 2MOGA 2HFFB 2OCCB 1SDDA 3BSHA 3ILQD 4NO5A 4Q9RL 4FMFA 4MWFA 1SFHA 2XU9A 4NQEA 2ZXCA 3IXAB 4Z7VA 1JN6B 3QFDA 4DW2L 4LLVA 3VVWA 5IHZB 5FA3A 1QFHA 3ZE2B 5BO1H 3V0GA 5CGYD 3OBAA 2B8OT 4DEWA 1GYAA 3FU8A 2BVOB 2FBJL 4XO5A 4N87A 1VF5C 4JGMA 4PFEA 2I9TA 4JQVC 1NC2B 2J8UF 3A6OA 5GRJH 3F01A 5AZUA 3B43A 5D93C 1EHAA 1MI5B 3B2UD 2BC4B 2DW5A 4EI5A 2XCMC 4K7FB 5C08D 1JWSB 1HL4A 3T3ME 4JY4A 1UWGH 1OTTD 4LLYA 4IOIA 3FRPG 4L9LC 5SX4I 4URTB 3HNSH 2DKMA 3KLDA 3JYCA 2DLIA 4LSQH 1OF2B 2E0PA 1Z7JA 3MNVB 1EGJL 1SMAA 2F8XC 4PVMA 1C8QA 3K5SA 1JZIA 4HZLB 4MRCA 4PI2A 4DGWC 5JW3L 3KMDA 4WK4B 4IBWA 1ZHNB 3CFJA 3ATDA 4HCRA 3KYNB 5K1JA 1XCQA 3VMOA 4UQ3A 3L5IA 4QD2E 4LSRL 4YBLB 4MJ5A 3K5RA 1CFNB 4MMYA 5DRNB 5B4MC 3G04B 1KCRH 1OY3B 4E5XB 4RFEA 1R3HB 2YA0A 2NY7L 1T21B 2ED6A 5JHLH 4KK5D 4KTDH 3QUKA 1HDMA 3AS3A 5HI3D 3BCFA 3T3MF 2OYLA 3GC3A 6PAZA 5D71H 5H2BB 2YEZB 2XWJB 4U3CA 1NINA 1OOWA 5IJKA 1A7RH 3BESR 2E9IA 4L3FA 4I18B 4MDIA 3UTTE 4AYDC 3N1QC 4K71C 4FQLH 3EOBA 2OCFD 3HNSL 2G5BA 4JPKH 2RALA 4L8CA 4PY7B 3II3A 3QQ3A 3F6JA 1BWWA 3I2CL 1NEZG 1MCBA 4UINH 1EV2E 2BRQA 1FVCA 3HB3D 5FGBC 1YMMB 3SSGA 3VXRE 3K6FA 1U95B 3KXFA 3L9RB 3LQMA 1T1ZB 4OJDH 4LP4A 4Y4HC 2EEBA 2W9DL 4Q14A 2EIZB 3RLSA 4OKVA 1WAAA 1I7UB 1V05A 2UUDH 5AW5B 4G6FD 5DRWA 2R69L 4KUCD 5EOTB 2BVEA 3BP7B 5C07A 4MAYC 5CGTA 5B39B 2BSDA 5JHLL 2R2BA 4KTDL 5GIRA 5DUJA 1NOFA 3AT8A 4ONHA 3H55A 5HHNA 3UOAB 4HJ0D 4U1SB 4TULH 1GGCL 2LTQC 4PLOB 3CSYA 2YD0A 4E9YA 4MZ3A 1IMHC 1T7YA 5DMGC 1I1FB 1A7RL 2EIJB 2X6CA 3NMEA 3GYRA 5EC1B 4J4PC 2AEQL 2F1BA 5K1NA 4MQXC 4NCC2 2E46A 2OR8A 3EJZC 4MHHG 4X7CC 1OAQH 3MXVH 2XN9D 4PJBB 4UINL 1RK1A 1WS8A 5E6ZA 3STZA 4ZUWA 3CSFA 4ANXA 2R27A 2V2WA 5C0BB 4YZFE 1QW8A 3MLTB 2FSEA 3RE0A 1D6EB 3FONB 3GSXB 2Y06H 3QCUH 4YLCA 2JK5A 4R3SA 5CR8A 1YY8B 5C9KA 2VZTA 2X6MA 1XH3A 1WE5A 3DUUA 3IS0X 1UOLA 3GBLA 5L2KA 4PJ5A 4DK3A 5LGJB 2GBVA 4X98B 2EAEA 3WFCH 1TTFA 3AC0A 3NIFE 4AQAB 4UUJA 1AGEB 1N70A 2WZ6A 2VQ1A 1U6AL 4BDVA 1KGWA 3SE3A 3QORA 3FB7A 2ZXWB 4H2CA 3MLZH 2B2XL 5ESVA 1FQ9C 2R7EB 1T66C 4XBPB 5EUKA 1CS6A 1KB5H 3IU3B 3CPLB 5K69A 1CTMA 2FR4A 1HWGB 3DVNB 1AGBA 1HE7A 2CLRB 3OAYH 4KY1L 3Q5TA 4C4KT 2OMTB 1OAQL 3MXVL 4YHLH 3CUPB 1OW0A 4AMXA 3HG0A 5A6LA 3ARGA 1RZIB 5C0FB 1CGTA 4HDIB 2Y1YA 1MY5A 5F7EL 4E41A 4XCYB 1RZPA 3DYMA 3QCUL 2Y06L 1JPFB 4WKZA 4NNYB 2BIOA 5DZNA 3GK8H 2XN0A 3P9LB 3EG9B 1FZKA 5LQBH 3CBRA 4H26A 1TJGL 3G5YB 2MOQA 4MQSB 4DEPB 4MD0A 1TTGA 4BSVA 5EO9A 1JD9A 3FU7B 5HYJB 1KTRL 4KI5D 1OE1A 3ASNB 4RVBA 1XCTA 3T1FA 2G3ZA 1KB5L 1W0YT 3GJFK 5C0AE 3VX0A 2Y2TA 2XJKA 1FZOB 1RJYB 4Y4FD 1RUKH 2XN2A 3KS0H 4YHLL 3MCLL 4OFPA 3GEFA 4TNWK 3V5HA 1HAWA 4GMTH 1JPGA 1AGDA 3QUXD 2ZOKA 1N0LB 3HPJB 2X28A 5DS2A 3GI9H 5JNYA 1KELH 5I6XB 3U0PB 4Y8DC 3GK8L 2AAAA 5CEZE 4B5ZA 3D3VD 3Q9PA 4U3XA 4ZUUB 1KB5B 5D4HA 4JRFA 43CAA 1HSBA 3OLDA 4P9HH 4PWJA 4B0MB 4NRYB 5DHVB 1EEYB 5MERA 3W0WE 3PHSA 3WTXA 1W0VB 4ZTPL 3GSVB 3BW9B 3B9DA 4WV1B 3QIBB 2YAMA 3WIIH 2NZIA 3WS6A 2DOCA 2HA1A 1JG9A 4JX0A 4DPBX 1KDIA 5B3SB 3PDDA 4LSPL 5AZ2H 4XBGA 2WXHA 3HLAB 1QRNB 3SQBA 1WHPA 1T83C 3BVNB 4LFHD 3NP3A 1JK9A 3RVUD 2X3CA 1PZAA 3FTGA 3KPSE 4GMTL 1X5LA 4XVUD 1X5ZA 1A1NA 3ZDXE 1EX0A 1ZT7B 3PAUA 1W6WA 3GI9L 3IEAA 1ZS8B 3ABGA 3EDDA 4K3DH 4LIQH 4X80H 4EXKA 5BJTA 1UKQA 5ADPH 1U8MA 2WBJB 3APCA 4ZMTA 3MKKA 4Y2DC 3SDAA 4FQJH 5LG6A 4Z0XA 4CL7A 1NBCA 3D05A 4JZJB 4D9RD 4XPHH 3EH4B 1F45A 2Z93A 4UDUA 1RU9H 4GKOA 4JCMA 1RZKH 4R97B 5F72S 1JZ5A 1IM3D 4KX7A 4TSAH 3W11C 2QADB 2R83A 5EN2B 3FPYA 5KBKA 3F12B 3OQRA 3SE8H 5B1KA 5BQ7B 4XPFL 3C60C 2VDLH 1CL7H 3EHBD 3SBWC 3TU6A 1B9ZA 3FO2A 4S0SD 4WRLA 1D6VL 4JFDE 2YGPA 5TF1H 4IEFB 2JCWA 3QXUA 3QZWG 4J3SA 1ET7A 3C75A 5HVGB 1WO2A 4K3DL 2HN7B 4UT6L 2EZ0C 2QPUA 1SJEA 2AGJH 3EDFA 4UM8A 4X80L 4WGWB 4F7CA 5ADPL 4J3OD 4WSJA 1SHMA 5F93C 3M6DA 4LCCC 5E5MA 4F91B 4ZMLA 3MJ8B 4FQJL 2C3VB 5BRZE 4MMXB 1HINH 2WTRA 2D8KA 2WZAA 3L95A 3MJ6A 4DQAA 4XPHL 2V37A 3FO9A 4JQXC 1RU9L 5D7IB 1RZKL 4OD1H 1ZA6A 4Z7QB 1FN4B 2ZX7A 5FIEA 3S3DB 1T4KA 3X1NA 3SE8L 4MB1A 2EO1A 4QNPE 5F1SA 2H9GB 3TO4C 3MUGB 2VDLL 3NN8A 5CD3B 2V4LA 1MJUH 4MA3B 5E99H 4PTTA 3DJSA 5EBLA 1ZT4B 3KLLA 3FSWA 3RFZA 1C5BH 4GW4A 5TF1L 1G5AA 4OZ4A 3MV8E 3NBNA 1RZJH 3A24A 1N0XH 3VI3E 3S6CA 1FNSL 4NC1C 3FQTA 1AD9A 2IALA 2NXYD 5AVWB 4B6ZA 2AGJL 2ADJB 1YUHA 4XMVA 2AQ1A 2W0LA 3GMRB 1FCCA 5AKVA 3KJ4B 4U3HA 3BEWB 3OKLB 5LGKA 1W0WA 3MV9D 4XVSH 4NZUH 2AQQA 2G2PA 1PD1A 4AGOA 1XMEB 3WCYA 4OD1L 2FLBT 1RMFH 1U36A 2QR0B 5EHFA 4YSSA 4QNPF 1ZGLP 3SDYH 1PG7H 2FWUA 3TBCA 3TIEB 3S37H 2ZD0A 1W15A 1I7ZA 3GSNB 2YOAA 2J8UB 4R4BB 4C55A 2GJ6E 1MJUL 4LCVA 2QDVA 2C4FU 3NYKA 2AMGA 1QEXA 3T4AC 2Y1ZA 3QJHA 2BOBA 2IADB 1SJVA 2QKIC 2QT6A 5HGBB 4DZBA 1C5BL 1HZKA 5DO2D 2I24N 1KIRB 4XWOC 4HGWB 1EJFA 4LARH 4WFEE 5I75C 3MV7A 5C0CA 4YPJA 4L29A 3VFMB 1WK0A 4YFLI 4NUJA 3TS8A 4H4NA 4TRPH 4TF4A 1FUNA 5F7UA 3U46B 5ID1A 3KXFD 4P04A 2BMKB 1E2ZA 3QDAA 5HJBA 3DX8A 2PP8A 4Q6IB 1CE6B 5I30H 1YC8A 2E56A 2FSDA 4FNQA 2NY0C 4NZUL 1PMYA 4C4BA 2VN5A 1A14H 1RMFL 4GRLB 1WCQA 2YPKB 4DUVA 3SDYL 1N59B 4W81A 1PG7L 4R5TA 4NKDB 5MEQA 1G4MA 2XFXA 4HAGA 1WBYA 2NDGA 1N7ML 2XZQH 3T3MB 1AO7B 4AEIH 1SY6H 1M1XB 3BVVA 5IG7A 3R4RA 1S7VA 1S7SB 3MRGB 1R33A 2JXMA 4JY6B 1QLFB 1IGYA 2GQHA 4LARL 2YMTA 4PJAA 1LK3H 4AG4H 4NQCA 5DK2A 5T5FH 3B5TA 4AQEB 4OH2A 5IJVB 2E4FA 4PCKA 5EZJB 3LQZA 4JFXB 4TRPL 2BW5A 3JVGC 1M7XA 3U79A 4AJ0A 2LU7A 2DQDH 3DDFA 4JO5A 3CZSA 4ENED 4KK6C 3FFDB 5ADOH 3A21A 2NZ1A 3BP6A 5I30L 4X4XB 5KS9E 2VSCA 5TE7L 2P8PB 3CZGA 3BT0A 3EOYG 1NSNH 3UTSE 5D1QC 3SDXF 3OM3B 2FHCA 4FFVC 4QXVA 1MVUA 3BKYL 5B38B 4MJIA 1JZ8A 1A14L 2MNJB 1XF4A 2YQGA 2VWEC 4JPWL 5E8NA 5L2KD 4PJ5D 3C5XA 5I8KL 5KN5A 4G9FD 3CV5A 4P05A 4IJTA 4QY8B 3NCYP 1G7MB 1JNLL 4ZD3H 5I9QC 4CNIA 5LXGL 1F3JA 2CA4A 2XIBA 2BO0A 3U1QA 2XZQL 8FABA 1N12A 4AEIL 1LO4H 3C6LB 3CVCA 1SY6L 3QIWA 1BXXA 5KYXB 5F0MB 2A74C 3MCYA 3UTTB 5TDOA 3RY4A 4KH9A 4TNGA 2CO7A 5A2IH 4KITB 4AG4L 1LK3L 5DQ9A 3QNFA 3MRDB 3PGFL 2PYEA 5T5FL 5GISH 1AXSB 2BXYA 1J18A 3BD3A 3CFEA 2Y4SA 4JZOA 1T2QH 2GTZB 3AQXA 3VXRB 3TNNB 3S8FB 1JYWA 3U48A 1NL0H 2XY2A 3RL2B 3KYOA 2JKWA 5E2VL 1KT2B 4BV1A 5K9QI 1LO0H 2UXTA 1B0RB 2XQ0A 1DBJH 4WHTA 1RURL 1SLWA 3NJXA 4BHUA 1NSNL 3KCPB 3QEHB 1NMCC 1KXVC 3GXFA 3ZHDA 1I7TA 3FCTB 4R4NC 3S5LB 5IW6B 2NQ3A 4RMSA 1IAIL 2FIKB 3TA3D 2YAHA 2DKUA 4N3TA 4AIZA 5DXWA 2GK0B 2Y7QA 5DMJB 5J1AA 1LO4L 4G1EB 5CZXC 3IJEA 2KBGA 1QYGH 1LO5A 1AMXA 5CIPH 4NFCA 4W9GC 3C6SB 2EDNA 1DQQA 3P30H 2N7SA 1L9QA 2IAAC 3TGXA 5ELIA 4OF3A 3VACA 3G5VA 2EIKB 1KBWA 1HHIB 1YJDH 4D0CA 2XWRA 1Q0XH 1KTCA 3GSRB 2VMCA 2ADGB 1DQMH 3NJVA 5INCA 1DBJL 1T89A 1JNHA 4Q6KA 5DUPH 3T2PA 4M4RB 1BVNT 5ERWA 2HFGH 4JQVA 4YZWA 4GBXC 3HC4L 2VL5A 1TJMA 3NIFB 3FUNA 1N10A 2K3HA 3MBWA 1PY0A 3NIDF 1SRDA 3EIFA 4L9LA 3ZKXB 4E36A 1PAZA 1QYGL 3F7RA 1AKJB 4HS6B 1KF9B 2R9HD 1JHTA 4NZDA 5E0FA 2WXQA 3NRPA 4NQDE 3QEUB 4P46A 3P30L 3UBXB 3O2DL 3V8CA 4P5TD 1SXZA 4MBOA 3TWCH 3VNZA 3QUZC 4AC2A 1CN4A 1W72A 2JJVA 1OL0A 1YJDL 3LB6C 2NUPA 3UBHA 2OTWA 4GQ9H 1OTSC 1DQML 2F53B 5DEFB 4K7PX 1WBZB 4XTRD 2DEWX 5DUPL 1GSMA 3MMEB 4AYEC 2HFGL 1S8DA 1FL6B 1PKQE 4DKTA 3KYMA 3WFHB 3WMSA 1U93B 2G9HA 5IQMA 1P2CB 1FFPB 4JDEB 4I0PC 3SJVA 1J8HD 3BGFB 5CU9A 4OCLC 3C8KB 2X70A 1OALA 4F8LA 3DSFL 5CCJA 4Q9CA 3N3EA 2BVPB 4WVRA 2G0KA 2BM3A 4MXVE 3L54A 1VEPA 3WSQH 3BUDA 2B1OA 3FAXA 3I84A 3M46A 1I8KA 5D1ZD 1JK8A 3BMWA 5C0AB 5KTEH 2J1YA 1JZ7A 2AVGA 1GW0A 1ZTMA 3IXTA 4Y4HA 4IW4C 4PRHE 1QEWA 7PAZA 2HX8A 4HIQA 4CDHA 5JZ7D 3BZ5A 3QDMB 2X4TB 2VMJA 4I4WA 2X3AA 2JSFA 4DO4A 3QJXA 3MJWA 4UYQA 3FT9A 4CMHB 2QLVB 1E8ZA 1PY9A 2KYIA 3F8UB 5H94A 4UTAA 1QG3A 4Y5YC 2CLVB 4OCRH 5E6IA 1NUNB 3CK0H 1B4LA 4IIQC 5FDYA 5T1JA 3QRFM 1D2OA 1FV1A 1N26A 3W0WB 3OSKA 4YNYA 4G8EB 4RX4A 4Q89A 3HTLX 3SKUD 4KRNA 1VFBA 2EVFA 5SX5K 4JFQB 2G30A 3WSQL 1D2PA 4HAKA 4RQQB 1LQBC 4YDJB 4TLTA 5KTEL 3NFPB 1Q1JH 1T7VA 3PIQB 3QR1A 3A6CH 4JFYA 3MTXA 1LDPH 1QPPA 2DN7A 4PGEA 2N01B 1LEKA 2A9NH 2DMHA 1R47A 1Y07A 2DWYA 2JQAA 4XOAA 4CVZB 1UUNA 1F3DH 2ZOWA 4KV5F 2NY1B 4BIKA 1U8JB 4O4YH 3GT6A 1KFAH 4ECNA 2A83A 2NR6C 4IKNA 4WI5A 1GC1H 4U3SB 1Y6KR 5EUOE 1N67A 4KJPD 3TV3L 4O5LH 1M71A 1T04B 4C54A 3HE7B 4OZFG 3P77A 5E94B 1ONQB 4Y1SA 4WEBH 5DC0A 1X5XA 4ODUA 1OP3H 5T1KD 1S9XB 1TG8A 2B4CH 4Z7NE 5C8JA 3T65B 2C9SA 5HPMA 2JNZA 5FECA 3ZZQA 1VZIA 1Z5LA 2NQDA 3SO5A 4ODXA 4X5QA 3B8YA 5HI5C 3QNYB 2C1OA 1IFGA 4UQ2B 1Q1JL 3ECBB 2D3JA 3FXIC 4MTMA 3IDYB 3A6CL 4WWID 2E5EA 1LDPL 1A1OB 4JFDB 1IBGH 2IPKB 3DTXA 2OSWA 1KACB 4IDJL 4N0UA 5F0LB 3V6BR 3EXJA 1WIOA 3LKNA 3SE9L 3TEWA 1NGPH 3D25A 2NUTA 2A9NL 3KM2A 1SOQA 1UXSA 2X1PA 6TAAA 4L3EB 1FYTE 5IMKA 1U8NA 3JWDC 1TLMA 3ASOB 1E4XI 4O4YL 4P23C 1KFAL 5EUOF 2R8SH 1CXKA 2PCFB 2BCMA 3BZFA 3ML8A 3NGBB 1TNMA 4G1MA 1UWXH 2XTJE 3WHXB 2I26N 5IB2B 2X40A 1YN7B 4Y1AD 3HG2A 3WFZA 5BRZB 2ZXEB 4PWKA 1A65A 1CGUA 1PIFA 2E7LC 1DLFL 4DUXA 3LHAA 1UT9A 3QW9A 4Z7NF 3EZ8A 4TLKA 1U58B 3PG2A 3T0XA 3V0DA 4OZIA 3J27A 2B4CL 4PGDA 2WXFA 3I3BA 1BLNB 4BWUA 4HU8A 3GUTA 5FM5O 2ZCLL 1TXKA 4HH8A 3Q5YA 2V0AA 3PGDB 1VFMA 1BEXA 5HHOA 3U30C 4Z77B 5CUSH 4U1LA 4L4JA 4XPGH 5EC2A 5EOCJ 1XQ4A 1IBGL 4BK4A 3B34A 3DDGA 1XGRA 4FZEL 3UG4A 2ZYRA 1XR8A 1Z3GH 2GHZA 5EIIG 3MV8B 2EIMB 1F18A 4XCCL 3WAKA 4G80B 4DH2A 2V5RA 2CBOA 3VI3B 3T71A 2R8SL 4ZQKA 3RL1B 3FTVA 5C08E 1U4FA 4NPKA 1ZVNA 3QJOA 1WT5A 5HHVH 4YSCA 2VJ8A 4GQRA 1M3IA 3L3OC 5IW1B 1BQ5A 2QVMA 2WQSA 4M3KB 4EIGB 4X42A 1JXDA 1OT2A 3E6FA 3FBQA 3LMJH 4MJID 3QDHA 3VH8B 4HGMA 2NLJB 2GY5A 2R2HA 3APMA 2YPLB 1NFAA 2X4UA 3BPNC 5F96H 1KXTB 1L0XA 5GRVK 3HR6A 1IAOA 5F97E 3LKRA 1I8AA 2ZG3A 1OARH 3O41A 5CUSL 3AREB 2FHFA 3MCKB 4XPGL 2WKOA 1GOGA 4JPQA 4KKRA 3QIWD 1SJHA 2XPGA 4QTIH 5IWLC 1IARB 1YRKA 4U6HB 3WUZA 5JPMA 1G5GA 2P49B 2H2SD 5AALA 4FULA 4ZMYA 3MO1B 2PYED 4XZUA 1G6RL 4M8QB 5GGQH 3FUJA 3DVGA 1IC1A 1CCZA 3IM1A 1MCWM 4YBHA 5D2NE 1BPLB 4TVPH 3JWNG 4EI6B 1FC1A 5EO0B 4KJYB 1MFUA 5C0GA 3L3DA 5TFSH 3U82B 1GMIA 2WWMC 4PJEA 4XZ4A 2FQGA 4CMMB 2O5XH 1B4JH 3LMJL 1BZ9B 3QQDA 4B41A 2F61A 4WEMB 1AH1A 4ZDHB 4PJXE 5CSGA 3SBWA 4KTYA 1A3ZA 2PLTA 3QHZH 5IM7B 5JXEC 1ETB1 2RCSH 1G6RB 3GMQB 5DDHA 5F96L 2XDHA 3ZOAA 5M7QA 4NO0A 1DE4A 1OARL 2DWEA 2HYMA 3TL5A 1R3JB 2D0HA 1RJCA 2DD8H 2FX7L 2J8HA 3QZLA 3PJSA 4W9HC 3VYPA 1XSIA 3RUGA 4QTIL 4X5XA 2GTWA 4ZMVA 1LWHA 3A23A 4N2MA 1UUSA 2NNFA 1CXFA 2OMWB 3KPQA 3QDGA 4OFDA 4P07A 3SD5A 5KBLA 5F7NC 5GGQL 3CN2A 2APBA 4FTVD 5D2LE 3PP4H 4TVPL 4M00A 1V8HA 5I1EH 3I02A 2X2HA 4AYID 4WCYL 3ZL4H 3UJJH 1QP1A 3DX6B 5DVMA 2NYKA 5AKRA 3ARYA 3BVXA 5KS9B 4R96A 5AD0A 4JQXA 4NQXA 4QRPB 1UVQA 2O5XL 3RWEA 1B4JL 2VISB 2TAAA 2XN9E 2GFBB 1GY2A 1N6QH 3KVQA 4P9MH 3TO4A 1T03L 4J12A 3P40A 5G4MA 1I8MB 5FXCH 5DCCA 3QHZL 3HHSA 3OLEA 3US9A 2RCSL 3T0DA 3L3GA 5CSZA 1UEYA 4ODTL 5DJAB 3WDHA 2DD8L 3O11B 4PRIA 4M93C 4JFSA 2BNUA 4TTDC 4E0RB 4GI6A 1SJXA 2EILB 3DX9B 5D2LF 3ZSSA 4XPTL 4WWKC 2VR5A 3EBIA 3PP4L 2VZVA 3CBJB 5HHPA 5I1EL 2YGVA 3T8XA 3JWNH 3NTCH 1JCKA 4NOBA 2XETA 1FHGA 3UJJL 1CFVH 5AKTA 3ZL4L 2ADYA 1P5VB 2DQEH 3QJZA 1Q90A 3QGVA 4KK8C 3VMPA 4IBVA 5B4MD 3HBPA 3UPAA 2EDRA 3DMMA 3GLEA 5FGSA 2VAAB 1MQ8A 5DRZA 4F8OA 1AXIB 1DSFH 2IOIA 1F6AB 3DX2A 5I6OA 2WVVA 4FOMA 4P9ML 4EI0A 4W93A 4DVBB 3S88H 3CFNA 1E5YA 3T4AA 3NEXA 3F58H 1EEZA 3KL0A 1KJMA 4WSKA 3MRPB 5KBDA 1Y0LB 1RFDL 3ARTA 3IJSA 4PJHE 5FO9A 2F54A 2XX1A 1YEIH 3NZ8A 2VSMB 5KSUA 1DUYA 2VDKB 1JZFA 2X12A 4Q74A 2BVTA 3K2KA 4ICXA 5AVVB 4ZTEA 4MCZB 3ROLB 4W9KC 4Y4HD 3LQAH 3W82A 4DETA 4HWZB 4YGVA 5DFAA 5F9JA 3MUUA 4KI5E 4B3EA 1CFVL 2BSED 1XBRA 2X0VA 2DQEL 2VXQA 3DROA 4LQFH 5MI0B 4PREB 3HZKA 3LIZH 3QJVB 1UYWL 3R7QA 5FDWA 4MAYD 5I1CH 5KWYC 4CVXA 2WXNA 3MRIA 3FB8A 2AK1L 2VJXA 3S88L 5T5NF 1WITA 5DMGD 3TO2B 1TQTA 4IJ3C 2BY2A 4PJ8B 4J4PD 3E6HA 1D5BA 1SYVB 1BHGA 1YEIL 3VXPA 4MQXD 4BCYA 3MOQA 3EJZD 1CYGA 3K91A 4NQDB 3BIAX 3FL7A 4APQC 4WO0A 3W5NA 1KBVA 2EACA 1XX9C 1NCAH 3Q3GA 2O6PA 2YD5A 1KIUA 4KRPB 5L9DH 4UMSA 1GGYA 4LQFL 1JIBA 1MEXH 2ICEB 3AG2B 4H2AA 4XWGH 5E0QA 1G7LB 2WLHA 3LIZL 4HC1A 2DWTA 2WB1A 3NSYA 3X14B 4BSWA 5MEOA 2MKWA 1PKQB 2VOTA 4GAAA 1LILA 3AFLA 4H8HA 4YHYB 4RZCA 1ZVSB 3ESOA 4QHUB 3QFGA 4AKPA 5FO7B 1BAWA 2BNRA 1X4XA 4W70A 1MFMA 3TVMB 3UX9B 1A6AB 5CHNB 4PS8A 2VLKD 1KCKA 4JPIB 1N68A 4JO1H 2WCSA 2CUHA 4D9RE 4N6QA 4N2KA 5F7FA 3TONA 4KXBA 4A66A 3MA7B 2Q76B 1HIMH 2WW8A 5F21B 4PRHB 4ACTA 3CIQA 4GKZA 3L1EA 1NCAL 5IHUH 5KSBF 2UY6B 3VI4F 1DVXA 1XGTB 2AQNA 2ZCHH 5AOLA 1EHXA 3VRJA 1MEXL 5HP5A 1I1CA 3HG5A 1SBBA 2XICA 3I50H 4WUUE 1KXVA 3LN5A 3D09A 5AYTA 1M56B 3HHRB 4JVUA 2NX5B 1QLRB 4D8OA 4I3SL 3ZO0A 3L7FA 3ZIYA 4A63A 4NFBA 2CLZA 5FKPA 2BLFA 5FUCE 1THCA 5JLZA 2BSSB 3E2HB 3CZJA 5G5DA 1YN6A 4XNQA 1Z66A 2F58H 3E9UA 1UG9A 3EYOA 3MYJB 3KNBB 4M4PA 4M7ZB 4AJWA 2BVUA 2HVKA 2X4NA 2ZWSA 4B3VA 5IFHH 4XP5H 2O61B 3U1PA 4UOJA 1NKGA 4JO1L 4Z7OE 2R1XB 3LEVL 2DQ6A 3KCWA 1WUZA 3I9IA 4ODSH 1QHPA 4W4NA 3CAFA 4MHHI 3IKCB 1AD0A 2XVGA 1X5JA 1ILSA 1JGUH 3AWGA 3J07A 3KLQA 3PU7A 3S3JA 3SO3C 1N19A 2ZCHL 3VXTA 2UUDK 3ZQWA 1DJZA 4PBDA 1S7WA 2JV6A 4ELDA 3CVHA 3J7HA 3EO0B 2P3YA 4AM0A 2DI7A 3FUFA 3EYQC 3I50L 1J9QA 3KS0J 2V8LA 2XBDA 4AEEA 2C3XA 5EUOB 1A64A 5HYQA 1DANU 4X0NA 2G2RB 3EF4A 3GSUB 2ZUXA 3LHPH 4U0QB 1D5RA 3UTZA 1EUUA 2ADIA 3LD8C 4PWFA 4I3RL 4QF1A 4MASA 4J3OF 2Z7YA 5F3FA 4Z7NB 3S9DB 3OHMB 4DAGH 1TTCA 1UD5A 2W5PA 3MU3A 1WTLA 2YZ1A 4DZ8B 5IFHL 3HEIB 4XP5L 4Z7OF 5GZOA 4RA0C 2R4RH 3IYLW 1BZOA 1F11B 2OMNA 2CHXA 3BFWA 3OJ2C 3MV9E 3T2OA 4KKPA 2DM4A 3HLKA 4Y2OB 1Q0EA 5F7BA 5SWSA 4H8PA 4PLNC 3T77B 2AVFA 2W0FA 4MZ2A 4XN4A 1XV8A 2J56A 4JR9H 1JGUL 1KCBA 4RMWA 1FYTB 2DMCA 3OKMB 4OLWH 2EYTA 2BS71 1EAPA 4R7VA 1V55B 3CXHJ 3V0WH 4ADJA 4ENZA 2Z92A 2AEOA 3NSFA 4Y2DD 5D7EA 3QI9A 2XTJB 2RGSA 5K33A 1YEDB 3UC0H 4KO9A 3AG1B 3HNVH 3LHPL 4R5VA 4AQ8A 4GKSA 3HRZA 4I0PA 4G83A 2CUIA 3KPLA 3QXWA 2DB8A 1HEJC 4H1LH 4PMFA 4AE0A 2WNXA 1RHHA 1GGTA 1U8QA 3S3CB 5EF3A 3DXAD 2GUYA 5EEUA 3MOBH 5DZ9A 4NRZB 4DAGL 5FM5M 3C60D 4DGIH 3ESNA 1FH2A 1E9OB 1Q9WA 1CL7I 2J8OA 3RGBA 2R4RL 4M61B 3OAYK 4LQ1A 1CZ8L 4RISL 3WGVB 1MCJA 4AQZA 1HZHL 4PTUB 4NJ9H 1NAKH 3QULB 2NNCA 4NNPH 4JK0D 3BYYA 1PVHA 4HFUL 4RA3A 4ZI8A 1JPEA 4J6RH 4OLWL 5AQ0A 5FEBA 2EZ0D 3MX0B 5CP7A 3V0WL 2Y7SA 4ZPTA 5F89B 5C08B 5I1GH 1CK0H 2J43A 3O6MH 4Y5YA 3UC0L 5JPNB 3HNVL 5GJSH 4K3EH 1TYRA 4PQXA 3TESA 2AV1A 2ZWKA 4R6UA 4Z78B 3WIFB 4F2ME 2XBTA 1O7DC 4OVVA 2HJFA 5H35A 5BS0D 3MOBL 3HC3H 3JWOC 4M56A 3TO4D 1WAAF 2F1AA 1IC7H 2P24B 1F00I 3BPLB 4OAWA 1ULVA 2H3NA 1ETZA 5J6HA 3VYOA 3MRKA 5CCKH 4N28A 1MRCH 1ZVYA 3BIKA 4NNPL 2EYSB 1P53A 3SOBL 3BH9B 3LYRA 5L2JB 4F2EA 1JV5A 3I75B 4MX7B 2WZPD 1QR1A 3QEQD 4G9FE 12E8H 4J6RL 4H1LB 4QGYA 4FFZA 4HLEA 4PB9H 5I8CA 5ITFA 2NR6A 4FI7A 5D2NB 3V6OC 2AZAA 2Y7MA 4ZW8A 3QQ4B 5I1GL 4H7VA 5CZKA 4DO6A 1D9KA 3O6ML 3CZLA 4N3UA 3BPOC 3W9DB 5KSVA 2CNYA 5GJSL 4HPOH 1J48A 3HI1B 4GYBA 5TDNB 5EULV 1RZGA 4HK3N 2JB5H 4YFEA 1KNOA 1OEZW 4C57C 3HB3B 4WTZG 1E90A 2YZ8A 5E1HB 1KPUB 2JTDA 5EV7A 1IC7L 1EZLA 4J3BA 1NQBA 1T6WA 1HQ4A 4DCQA 5I18H 1PEZA 4YHML 3VFVB 1NMBL 4Z76B 5CCKL 5JOFB 2VB5A 4HK3J 1XEUA 4G6FB 1MRCL 3HZYA 1ACZA 4XWOD 3VYNA 1M7DB 2XX0A 4GP5B 2JB6A 4BFKA 4KNQA 1DJGA 3W56A 1MPAH 1U3JA 1ZJAA 3V0FA 3VO0A 2XFGB 3PUUA 12E8L 3UAJC 1HILB 3FQWB 3LY6A 3RVTC 5AOIA 4XMLH 2XWEA 2AXJA 4B95C 3SD2A 5D2LB 4A7TA 1UJ3C 1UGKA 1A4CA 2BVYA 2YFNA 3GRGA 1VAHA 4H25A 4HLZG 5DJCB 1EXUA 1TJIH 4ZMZA 4HS3A 4KZEH 2XZCL 5HGDA 3L4WA 2DYPD 2NY0D 4IOSD 3RWDB 3U7WH 1HCYA 3EADA 2PXYA 4Y19D 5EEWA 1OANA 2FZ3A 2FJGB 2XN9B 4K9EH 3U9WA 4AVIA 5DR5H 3TA4D 4YIQB 3FU6A 4XNMB 5DQDH 4OM1H 2X9XA 5I18L 3VCLB 5JQ6L 2QPSA 5J12B 2VZUA 1PG7X 3WN5A 2BCKA 3GHBL 2GY7B 3ATEA 1IJ9A 3S37X 3IDNA 3DRQA 3OQ3B 1H9VA 4R8WH 3MLUH 3VGEA 2A77H 3U2SA 2B5IC 4HJ1A 1XF3B 5A2KH 1R6VA 3GUFA 3ZBMA 2PTTA 2Q8AH 1LP9A 2R29A 1S7UB 2CK0H 4OJFL 3GZKA 1K6QL 1VCBC 4ORGB 3FYIB 1TJIL 2EIBA 4KK6D 4HKBA 5IV2B 4NSKB 3HMXH 3F5WB 5JYLA 1J1XL 4DFHA 4FFYL 4ONFH 5D1QD 4FFVD 4FHBD 4HMDA 1YPZA 4BFRA 5L0QC 2DY2A 2PP9A 3VTAA 2QSQA 3F7QA 3ZSTA 1DQLH 2QQNH 4K9EL 3O8XD 5DR5L 4GW5A 4QRQA 1J8KA 1MFBH 5DQDL 3A4FA 4OM1L 1HE8A 4IS6A 4ZZFA 2WWKO 1TO5A 1IGJA 4KY2A 3TF4A 1G7IB 1NCWH 3MVSA 5IEKB 1QFWM 4X4YA 2BNRD 5LBVA 4EZLA 1HOEA 4PJHB 3K4DA 1JZ2A 4LHUD 2V8MA 2YFOA 2E6QA 3ARQA 2AK4D 4R8WL 3MLUL 2WZ5A 2W38A 2A77L 2B16A 2WB7A 1JFHA 1J8HE 2F18A 2CRIA 1QQDA 5ABAA 5I1KH 1T3FB 2VLMD 4UQAA 4P9HC 3BQVA 3CDZB 1PAMA 4HLZH 3JZYA 1WISA 4JKPH 3HMXL 4YXLL 1UM6H 4X6CE 4ONFL 5BZWA 1F0LA 3IJHB 3MRJB 3M1BB 4Y4FB 1D5ZA 2W0KA 4JUTA 4YAQB 1P1ZA 1ZDQA 2CGRH 2QQNL 1FFOA 4JGUA 1A6PA 1GS6X 1U92A 5E7FA 3AU1B 3RJQB 3K7UA 3MRNA 2Y0SA 1EZUA 3QUXB 4ZNEE 2WIMA 3D85D 3T2NH 2M8XA 3WEOA 4F7PB 3HZ3A 4JRYA 5CZXD 1H8SA 4ZXBC 3N0AA 3T2QA 3D3VB 5IT2H 1AHWC 1WA2X 3FPXA 2DIAA 4ZMOA 3IGKA 5ICZB 1TZOA 3T0EC 3F7PC 3POCA 5J13B 3ULUC 3SDDC 4QLWA 1G9HA 5FWRA 5DQJB 3VB9A 3L3KB 5I1KL 3REWB 4EZJA 3X17A 2J2ZA 4HIXH 2BZDA 5JO5A 4B9FA 2QHRH 3OAUH 2W65B 4J28A 4FQPA 4J3OH 3P0VH 2P26A 5A43C 2R2EA 4LCWA 4JKPL 2AS5M 2RQEA 4NQUA 1FGNL 5JA8B 5EH1A 1T5XA 4GBXD 4PRPD 2CGRL 3HNTH 3VFOA 1ZLEA 2BY0A 5E2TH 3ZE1E 3GI8L 5KYUB 2DQGH 4O2FA 1NLBH 5IHUL 4OCYH 3ZDYF 5E24E 1Y7VA 5CINL 3DV4B 3BWAB 1MUJB 2F7PA 4OSUL 4Q2ZA 4F3FA 3T2NL 2IBGA 3OC5A 2JI1A 1AR2A 1JVKA 3OV6A 3EYVA 3PQYA 4HAFA 2WTOA 3IFLL 4OF5A 4NEHB 3RTQA 3TJPA 4JN1L 5IT2L 5J89A 4BKLB 1K5WA 1NMAH 5IUCA 1TQCB 1KCVH 2BS8A 4UV7H 5SWSD 1UQSB 4YVUA 5JIIA 3QUZD 1IM3B 4QRSA 1J1OH 3CFBA 3LB6D 5FW8A 4V33A 1G7QB 3L4TA 3M1OA 2DQHH 2QHRL 4OFIA 4U1NA 3AGVA 3P0VL 2A73A 2AV7B 3OZLA 3U0TB 2RFXA 1OTSD 4HCRH 2YUZA 3JSSA 4MD5A 4N85A 4E9WA 3EHBB 1NPNA 4XP1H 4NNXA 4YO0A 3CLFL 1FRGH 2WIIB 5TDPA 3ABKB 3Q8AA 4AEFA 4MJ4A 2FO4B 2C5DC 2IANA 4N8PA 4EZMA 5ITBL 2HPOA 3HNTL 4HS8H 5E2TL 1NUFA 4XMZA 2IGFH 4H40A 1NLBL 4I0PD 4BRVA 3VSVA 4IBUA 1QHQA 5HYSA 2H6OA 3NCJH 1KYOK 2QMJA 4GH7B 3TWYA 2WJ7A 1I1RA 4QRUA 2ORBL 1SDDB 3EDKA 4NI6A 1RZJC 5MEND 1AACA 1YNTF 3L5XH 4P2OA 2OM5A 4Y1AE 3SHSA 2X87A 1NMAL 4JM2C 4Z7OB 5EU7E 5FM4A 1KCVL 1H6TA 2GSGB 5CLYA 3ASWA 4UV7L 4KNSA 2ZUYA 5D4JA 2ITFA 5SWZD 2WXMA 3P0GB 1MLBB 3U2IA 5DS8B 1F2XK 4R0LB 3NPSC 4KDVA 2COQA 4HJGA 1BM3H 2P5WE 3QIUC 4NDMA 3L13A 3KAAA 1PJ9A 4XP1L 2Y2YA 1FRGL 2AJZA 1SXAA 1DFBH 2F68X 4WU7B 4YHOL 3V5KA 1DJYA 4JY4B 5FO8A 5DHYA 3QPQC 4IK7A 4HS8L 1BM7A 1UCTA 4ZSOE 1LK2B 5J56B 2BOCB 2IGFL 5IBUG 3Q43A 3DOSA 4L8BA 4PJDA 4YGAB 5LBSA 3ZTCC 4GXUN 3NCJL 2OTPA 5ISZA 1QFOA 1M6OA 3DSNA 3KWVA 5IR1B 3B9KC 3AVEA 4EVNB 2NXYB 4YPGB 1ZLWH 4AC4A 3HRPA 4PSRA 2EUVA 1N2RB 4X6BB 5CZVH 5EBMA 2NW3A 3L5XL 4GRMA 3CXFA 3MLWH 4WTQA 1UXMA 3PHAA 3FT0A 5DJ8B 3AUVA 3MV9B 1KCUH 4QRBA 3RY5A 1TOXA 3R06A 4WI7A 2OJEB 3QXDA 3LKSA 1RY7B 5BCAA 5GSRA 3RQ3A 1MCDA 3MGOA 3CG8A 2I07B 1BM3L 1IC0A 3WTYA 2NR6D 4YX2H 1NGYB 1ORQB 1DFBL 4JGJA 1NCNA 2ID5A 2D73A 1KIPB 2PR9A 3L5WB 4NXSA 5EN3A 2L7EA 2YXVA 4FE9A 5F9OL 4HKJA 3FRUA 4U1IB 4CAGA 1BG1A 3ETTA 2G5BB 2ZF9A 4I1RA 4YL4A 2X4SB 3LKQA 3MI6A 2PYEE 1JMXA 3QQ3B 4XCFL 4OV5B 1NPUA 4G71B 4FI6A 2XG5A 2R0WH 3MREA 2H41A 4QT5B 2HZHA 1K5NA 4XX1G 2VQUA 4ZYKA 5HI5D 4JB9H 4ZFZB 3ELAT 4FQ2L 1F6FB 2X88A 1F4HA 4I0KA 4PJ9C 3MLWL 1JFQH 3HUJA 3FT4A 4JG0H 1LNUA 2BWQA 2NXZC 3DO7B 4IGBC 2X4OA 2C1PA 2WGNB 5I24A 5H8DA 4F5CE 2FGWH 3DK0A 4ZMXA 5I1HL 2WVUA 5HGHA 2XV3A 1UD4A 4A1RA 2ZKYA 2VDOL 5I1JH 4XODA 1EHLH 2FATH 2R2BB 4P23D 1DUZA 4UDTA 4HIEA 4L3AA 2NY6C 4ONHB 4QOKA 1B2YA 5JQIB 3K2UH 3V4VA 4JM0A 4WW1B 4NN5C 1EZVX 1NIAA 2KDYA 2X4RA 5J8OA 1JDCA 1X3DA 4O2CB 3CN3A 3A4DA 2XTSA 4W6XB 3ULVC 1T6BX 2M83A 3N44B 4E9LA 4GAFB 3CZFB 3QRLA 2XOTA 1KJ2A 1M53A 4F2MB 8PAZA 1X5YA 4FTVE 2FL5A 1NAMA 2BHFA 4H44C 4X4KA 1YCSA 2DL9A 2R0WL 1OT1A 1ZCRA 1JI1A 5KSAC 2V2WB 2VDOB 4CW1A 4JB9L 4QHPA 4Y5VC 4B9GA 4BGLA 4YHKH 4X9GA 1HEZA 4RESB 1I9IH 2C9AA 1JFQL 2DJMA 4JG0L 3MA9L 4QI3A 3CHPA 4W9DC 3OJDA 4L8SA 4GSRA 5D9SA 1F13A 3RJOA 1TZAA 3DUUB 2Y6SC 1UB6A 2FGWL 3FCSA 3V6FB 5L2KB 1KULA 4PJ5B 2EVGA 3SDCC 1T20B 4GW1B 2GT9A 1YZZA 2LU4A 4G9FB 3T3PF 5I1JL 1RZQA 1EHLL 1U42A 1VRSA 4QHLB 2EEDA 5I1AB 2FEDC 4LVHB 1BBJB 32C2A 2V2TA 3VA2C 2EDLA 4YC2C 3D4ZA 1QWUA 1KUMA 1ZVHA 3G6JE 2X2JA 4HFWA 4RWYH 4R4FL 5ESVB 3X11A 3ZKNC 2JWYA 5LAXB 1SUHA 4ZS7L 1VACA 2ZT9C 1UOKA 5DFVD 3U4KA 3WE6B 4F1SA 3IJYB 5BV7B 1D5MB 2X4QA 5AW2B 4MVBC 4CC0A 4OQTA 3O81A 2OKMA 1H15A 1E7VA 2OR9H 4BE6A 1X7SA 1W91A 2DWSA 4EIZC 4WNQA 4AWJC 3BZDA 5DJXA 1WRFA 1XIWC 2Q7AA 2CKBA 4FNRA 3L08A 1NCTA 1KTKE 1NBVH 4HKXA 3WEXB 1I4FA 1RH8A 4QYOB 1HJBC 3D69B 1LQSR 1O0VA 1QOKA 2WYTA 3VFGH 1RV6X 1A6VH 4TOYL 3P4OB 1WJ3A 1G9NL 4H26B 4JHBA 3O6FC 3VGAC 4ZUSA 4PJFE 4HG4J 1A4KA 1RK7A 1HHJA 4BK8A 4HJJH 4XN1A 3TA3B 1L0YA 2NYYC 1KXHA 2HFTA 4ZX4A 2A99A 2AXWA 4R9HA 3GGWA 5A16A 1F1GA 2EE0A 4RWYL 2W9EL 4LLMA 1FNHA 4MLIA 3T1FB 1XCTB 2WWMD 4OZGE 2ESVA 1EVTC 1I3RB 1OP3K 1XZ0B 5DVNA 2YWZA 1RCYA 4OD3H 3FZUC 1R4XA 4FLRA 5HJDA 3S96A 2J44A 4JFFE 4B5EA 4MJ6A 3NZHL 2OR9L 5C0IA 2ICWA 4MA7H 4C59B 2ED8A 2OYMA 2PCXA 4MS6A 4R7NB 4OGAC 1NBZA 1ZHLA 5JXED 1QVOA 3S97C 4B50A 4X7FC 1IBBA 1PEWA 2H26A 1NBVL 3QWRA 1KGCD 3O45A 4HCIA 3PCYA 4DP8X 1S9KC 1A6VL 2R56H 1R0AL 4KHTL 5C2UB 1PZBA 2Y5TB 3VDBA 3G7TA 1U8OB 2VABA 3PWLA 3WKMH 5C0EA 3TYFA 2QQKL 3U9PL 1S7QA 1SHSA 2I25N 4LB8A 4HJJL 5AAMA 1DVFC 1E28B 4I48A 4X9IA 1A6ZA 1P5UC 1UWXK 1KBKA 1S7XA 5KVDE 4OZGF 2ZX6A 3GDBA 3VFTB 2X10A 4AZ8B 1VIWA 4QRTB 2I69A 3LV3A 3QDJD 3TNMA 1FNGA 4MNGE 4KVCH 3BKML 3LH9A 4GAYA 3U0WH 1VADB 4MA7L 4MCYB 1IILE 3MRHB 4P5TB 1JK9B 1S9WB 2OK0H 1ECYA 5IIEA 1A1NB 5JIKA 1P7QD 3LZFH 1SDYA 1IL1A 4ZO6A 3PQYD 5BJTB 4PN6A 3K81A 2R56L 4TTDD 2VXVL 3Q2NA 5CP3H 3FFOA 3WKML 3LPFA 4WWKD 4ZW6A 4HOZA 4JFOA 3LKOB 3K8MA 1RZ7H 4H5SA 1J8HB 4W9IC 4YR6B 2PN5A 1BVLB 3THML 4FABH 4YDIH 2WQAA 4KC3B 5D72L 3U6RB 2P4AB 1R1CA 3H7BA 4HIJB 3GMNA 4UQEA 1TPXB 1CXEA 1WZAA 3LRGA 2VLKE 4KK8D 2EDHA 4N6RA 5D1ZB 1IGTB 5D7LD 4X6CB 1XGQB 4EN3A 3FJTA 3FO2B 3ARUA 1SFDA 1T7WA 2Z8RA 4HUXA 5DGRA 1AIZA 3I6KA 3FRPA 3VD1A 1OB1A 1EEUA 2XWXA 2HCZX 4HG4K 1EAOA 3VE0B 4GG8A 4R2GC 1TNNA 4U6YA 2Q2EB 2DQIL 3ZDYB 3LZFL 3V52H 4Z3IA 2WINB 1L9NA 4F7CB 2VLRD 1URLA 1ZK9A 5B22A 2YD6A 1LEGA 5E5MB 4G6AC 4MD4A 5F9WB 5LNEA 1BG9A 3UAJA 3QXTA 1MW0A 2GJJA 4U1MA 3L95B 1RZ7L 3SBPA 2HG5B 3VA6A 1QSEA 1GC1C 2JQZA 1FZMB 2HT3C 2J73A 3MHZA 4FXKB 4KXZH 1EO7A 5E03A 4RMBA 4FABL 2PABA 4YDIL 2UZXA 1L0PA 1Z9SA 4CU8A 5AOKA 1L9RA 3QUYC 2CRMA 3N06B 1T1WB 4JHVA 5EZOH 4GUPB 3NN8B 5HVFB 5I17A 3WTSA 4LAQH 4Y7OC 3EJTA 4FEMA 3ZT6A 1AQHA 3GSWB 3RFZB 3MXWH 1ORSB 5T3ZD 2VDMH 3UPRA 3ZE1B 1CG9A 2R0KH 3DYPA 2WQUA 4GW4B 2RAMA 3WXVH 3AS1A 3FMGH 2HT4C 2NRDA 4OZ4B 2JLPA 3VH8G 3VB8A 1QNZH 2A6DB 1P1VA 1AQMA 4YSEA 1E3ZA 4KMTH 2MTPA 3PRZA 5GGTA 5IQ7H 5F3HB 1QTYT 4U0RB 4OZIF 1YNTB 1X5FA 4APQD 2B14A 5DVKA 1IGIH 5AVTB 5A3IC 5T1KB 4GNKB 4N4YB 2WY3B 1K4CB 2VDQH 1INDL 2W91A 3T5WA 1NOAA 2CO3A 4C58B 3NABL 5I6PA 5EZOL 1G9EA 3QHTC 1A6TA 5IMOB 4BD4A 3D52A 1K9TA 2VE6B 1N8ZA 3HBZA 1BD2A 3IDMA 4PS7A 3CH8A 2BOBB 1H8OA 4C56A 2CK2A 4IU3B 1TYEB 2R0KL 5I0YA 2QSTA 1BYOA 3FMGL 1I1YB 3GSOA 4DN3H 1IRAY 4L29B 1ITBB 4OJYA 3FOLB 1UATA 4F7EB 3NCYS 4KMTL 2XBZA 1MG3C 5ID1B 4TTGA 4AV0A 5IQ7L 2K70A 2EVHA 2JLLA 3DX8B 4Y1AB 4RBPH 3EH5B 5DD1L 5TGBA 4KRLB 3SKOA 1KOAA 4ANKA 3GQFA 3UP1A 3DXAE 2Z35B 3WKYA 2OL3L 2P5EA 3KDPB 1XGPA 3MACL 1CFTA 2I85A 2VDQL 3GF8A 1CQKA 3VRLF 2DQCH 2EDTA 4LLWA 4AE1A 3NVQA 5AVYB 1BOGA 2WKOF 3LNGA 3FO1A 4DK5A 1IEBA 4N68A 5IF0B 3NK4A 4WO4A 1B90A 1AFVL 3VXUA 1B3IA 5IG7B 3P3RA 4ZSOB 3HS0A 1S7VB 3Q5OA 3QHFH 5HXMA 1VKXA 1DQKA 3QVAA 4ZFFA 1E30A 2QSVA 4RMTA 3X3FL 3DHMA 2H32A 3IDIA 1S9YB 1KPRA 1NEPA 2OL3B 1C5DB 5GS1A 4QDGA 5T1LA 4A6YA 2VDQB 5FCUH 4AENB 3K0WA 5CBAB 4G7VL 3VQ2C 4Q4EA 3DRTB 5EEXA 1E27A 2IXQA 4NYLA 3T0EA 3SDDA 2EUXA 1L6PA 1L5GB 2A9MH 3K6OA 3EYSL 1MHCA 1KZYA 3VFPA 4A39A 4F15B 3DHPA 3H9SD 3ARSA 3O9WC 3TCTA 3BRFA 1QPXA 5FFOA 5BS0E 5E8NB 4WFFD 2DQCL 3UZQB 5KN5B 2VR3A 4O02A 2K6ZA 2B3IA 4JEGB 3TEZA 3B83A 1F3JB 2UV3A 2APTA 5HJGA 3RUGF 4TNEA 2E47A 3GPSA 3P11H 4R83A 4GSUA 5DEJA 3EO1B 3QIWB 2BNQA 2F5AH 1ETJA 4GMSH 3WYRA 5TDOB 3QHFL 2CO7B 4QRRA 3QEQE 2H5UA 2AANA 3G6AA 5J6SA 2PYEB 1E2VA 1DQVA 3NA4A 2CBQA 3DBXA 4RFNB 1OD7A 1PCXA 4MNHA 3EGSA 4JZOB 2V2XB 1KYDA 1OAYH 3MPCA 1V3MA 5FCUL 5FAAA 3FTWA 2X41A 1BW8A 2ZUVA 4RRPM 1T1YB 2O5YH 2ZSWB 3OF6A 5DZVA 4AY0A 2A9ML 2CDEA 1VA9A 2AJSH 5I28A 5SWQA 1Q1PA 2BP0A 3L48A 1BJ8A 1IM9D 3OAZH 5HYFA 1DBAH 2VGLM 3LXBA 3HN5A 1GZQB 3AQYA 2V7NA 1W72H 3R1GH 3OG6B 1AYOA 1TEGA 2ZOTA 3CSPA 3QFJA 4PYHA 4NKIH 3FTXA 1A2YA 1WZ1H 4JO2H 5D7HA 2FH8A 2Y7QB 1C5CH 1M2VB 3F04A 4LSTH 4N8CH 3HCVB 4JDVB 2A6KA 4N2OA 1MCWW 4N8VA 2ESVD 4OD2A 1OM3H 4ZW3A 5CN2A 2CPCA 1KYFA 4YWGH 1TF4A 1I85C 1V7NH 3MODH 5CJ8A 4X7SH 1ZS2A 4FTVB 3VXMA 5D1XC 1BGXH 5LVEA 2WYHA 4D0CB 4JHZA 5I66B 3FO0L 1UXWA 3NEOA 4JM2A 1GAFH 1W16A 2O5ZH 5DJDB 2C8NA 4W9LC 1CXLA 4DGUA 2AJSL 1BFVL 4LLUA 3ALXA 1GVIA 1T1XB 1FSKC 3JWNC 5IJBC 4HX1B 2Q7YA 4Y19E 4HULB 1BX2A 4B96A 3SCMC 1NCBH 4G2AA 1MHHB 3TN0C 3WJJA 4LSUH 4TNVK 1MAJA 1CUOA 1W72L 3QIUA 1P84J 4EDWL 2VL5B 1QTPA 2LLGA 3VWKA 2Y3AA 5BPPA 2E3VA 4NKIL 3W9EA 2MPVA 3MBWB 1WZ1L 1J5IA 4P49A 1HKFA 3ARVA 3G6JB 1C5CL 4AUYA 4LSTL 4IRJA 4FXTA 4L9LB 3FQ1A 4Y9CA 4M8UA 35C8L 4HQQH 5SV4A 3WLWC 3UTQB 4NQVA 2YEVB 5D7SL 4S1RH 1EMTL 5JW4M 1CFSA 4YWGL 1V7NL 3NZUA 1NICA 2EDKA 3B9KA 1U91B 3BVUA 5IVZB 4FZ8L 1S9VA 5KVDH 2IQ9L 3IWVA 4DPRA 5K59F 3N5AA 3RZCD 1ID5I 3LNIA 2NUPB 1A3LH 4A2EA 3QYCA 4NX0A 2JJSA 2QZ5A 3QZWA 1GAFL 2O5ZL 4JFHD 3EF7A 5FO2A 1INQA 3P2TA 5CJOH 3GKWH 5IFJB 5D1QE 3LQAC 4E9RA 5IB4A 2VWEE 1AHMA 1T4WA 3B7YA 1NCBL 5CCHE 3OXSB 1S8DB 3QQNA 3QUMA 2X7LB 3G5XB 3MJ7B 1J11A 4UU9B 3SN6N 4FCHA 4PJFB 4MSWB 1TVBA 1SXNA 1OQOA 5C97A 2X6VA 2QGCA 4W4OC 4BKTC 4LNRB 2QVFB 4ANUA 4WKXA 2AJXH 2X70B 3L3IB 4TN9A 5A2CA 1N3NB 3O3BB 4HPYL 3WIHA 4K71B 2GSIA 3F64A 4HQQL 5E1QA 4OZGB 2MCMA 1B0WA 2AK4E 2BSRA 1JK8B 4S1RL 1G7HB 2CHWA 4IDLA 2VIRB 1OK8A 3C12A 2J71A 1VFUA 1J05A 2Z31D 4ICWA 4AL8H 3FQXB 1HS6A 1WD8A 1YEJH 2MRYA 4Y4HB 5KVDL 2ENPA 3UMNA 5EZLA 1PX3A 4PJ9A 1GGBL 1A3LL 3EBGA 1KG0A 1LEIA 3WS3B 4IGBA 4H8WC 4AQOA 5CJOL 2WLLA 4KROC 3WE1A 4WK0B 4BINA 5I71C 4QAWA 1CVSC 4MAYB 5CGBA 1QLEL 4G7YL 3RVTD 2B1AL 3JTTA 2LHAA 3U2JA 1I9RL 3EBHA 5K39B 3H42H 1FV1B 2LTQB 4PRDA 4XN8A 1YDPB 1VFBB 3WJMB 2Z8SA 3SGEH 2JCCA 8CGTA 1C9SA 3F7YA 4DPAX 3OWRA 5I6KA 4MLSA 2KLRA 3EJSA 1AAJA 3IGAA 4LCUA 5HHXH 1QSFD 4Z3HA 2VH5H 5A2BA 1S5IH 1F97A 1Z5HA 2MHAB 3T6VA 2N56A 1YEJL 3MOAH 2HFEA 4PVBA 3AJ7A 1LEKB 1QLEB 1P84K 4X4MA 1QW9A 2WP3O 2OXGA 5CEXA 4GSQA 3L4XA 4XCEA 2O4EA 2UXGA 3KPRA 2G2NA 1VERA 4IIZA 2A83B 4B9JA 1T0NA 3SDCA 3G5ZA 4PRPE 4BE5A 1FNFA 2BZCA 4GQPH 3P77B 4S1DC 2CHDA 1U3YA 1IBYA 1MJ8L 3CFKB 1ADQL 2ED9A 5H37G 3H42L 1NIEA 1FVEA 5K1VA 3GJEA 2DLGA 2ZP8A 4ODXB 4PV1C 2VLKB 2WUBH 2N4IA 4XC1H 3LNEA 1D3CA 2C1OB 5HHXL 1U0QA 2VH5L 2YA2A 1PLBA 2A2QT 5I8EA 3EOAB 3GIVB 3OD3A 4GS7C 1VEOA 1FJ1A 1QA9A 2H6UA 3QO0B 3DTXB 4DGYL 3Q8BA 1MH5B 1SHWA 1ZHBA 3LKNB 3MOAL 4FAAB 1IKFH 2P46B 1FL5A 2NUTB 1IU1A 5AENA 2VC2H 4E42A 4JRWA 4P2CG 4DWHA 4ZAKC 5IMKB 2ZSVB 4PM1A 1NA8A 3D0AA 5EBWB 3C08L 4LLDA 4RRPA 1HK6A 4ZOAA 3O6FA 3O6LH 3WBDA 1G87A 1ECZA 5ILTH 4JKLA 3WNLA 4Q8BA 3MFGB 3HBQA 1EFXD 3RPBA 3OXRA 4HA1A 5ETUA 4HJTA 2BIIA 2KQMA 2P5ED 2WQWA 4PGDB 3EAKA 1WAEA 2XWZA 1KIQB 4O51B 4EUPG 5EF1A 2ZAGA 4NN7B 3TBVA 5D55A 4D8PA 3CN1A 1TVDA 4FLHA 5MENE 2WUBL 2CIIB 2WLIA 1HHHA 2YD1A 5FLUA 1ML0A 4N0RA 4H8UA 1VDGA 3L8QA 4QKTA 3WY2A 2WN3A 2RH0A 1IB5A 2TRHA 3LNHA 5SX4H 1XH2A 4QO1A 3WLBA 1XF5B 4NP9A 4OGYL 5SWZE 1BQLH 1NM9A 3AMKA 2ZAIA 4KZDL 1XR8B 2XQYK 5TD4A 2VC2L 1J5DA 3BHBB 5LG1A 3LEXA 1H5BC 2MCPH 4ZXBD 4ZS6C 3ZZSA 2DI8A 4M6OH 3H53A 1XT5A 4NGHH 2HMIC 1ZA3A 3O6LL 3ULSB 3ZTEA 2R51A 5PAZA 5D6CB 5ILTL 5GGSA 4J3XA 3ULUD 1IKOP 1G0DA 1TVHB 1LM8V 4Y89A 3SDDD 2N59A 2WCPA 2ISDA 1IQDB 3PHQA 1GYWA 3D4YA 4PV9A 3RVWC 4E9SA 1EWHA 1NLDH 2R2HB 4BFJA 3B2DC 3RGVC 1RERA 2CUMA 2VC2B 5AYUH 1F02I 3V6ZA 1IAOB 5FB8B 4AIOA 1DL7H 2CGZA 1G43A 4TSBH 1XMWA 3SGJA 2J57A 2VW6A 1EJ8A 1MJJA 2WC7A 2XPGB 1BQLL 4N0YL 3CFIC 5B8CA 1DLHA 2JKNA 4PR5A 4OGXH 1A9EB 3QH3B 1XZWA 3LS5H 1VEMA 4PBXA 3ZU8A 5DI8B 5B1JC 5FFGA 5IHWA 2MCPL 2YAQA 1IAKB 2X38A 2KLTA 2FX8L 5IUSA 1KV3A 2VTFA 3KWXA 2HJKB 4Y2DB 4WUKL 4MA1C 5F6HI 1KYAA 2JVUA 2G5RA 4MZRA 1RUML 5E8DH 3OMZA 2EH8H 3H9HB 1UWEH 4KJWC 5DJ0B 1ZTXH 4AXWB 5JOPE 1MAMH 2OFQA 3DXAB 3MKGA 3UYRH 3FCGA 2XA8L 4PI0A 5JR1H 1BFSA 5F6HJ 1NLDL 5LGHH 3C60B 4M43H 7TAAA 2GHWB 1KB9J 5LWYH 5AYUL 4HW6A 2EICA 5DDHB 2OSYA 3MLXH 5FKAB 1SZNA 1WIUA 3S34H 4ZG1A 2DWEB 4GRWF 2CM5A 2ATAA 2R4SH 1DO5A 1JZHA 4OGZA 5AUMA 1OCOB 1SNRA 2GTWB 2QHLA 5G55A 4HEME 4U7KA 1XF1A 4G82A 4NUMA 4OGXL 1I8UA 1I1AC 2ITDA 3KWUA 3HG1A 1FORH 4MZIA 1NH6A 4P5RA 4N8UA 4LCCB 3I02B 1R46A 2J25A 2R1YA 4JBSA 3US1A 4JKNA 1AQDA 1OIOA 3KLKA 2P52A 1ZSDB 5IQLA 2YBGA 1HSAB 4J2XA 3DNKA 2EH8L 4PG2A 2M2DA 5D4IA 1ZTXL 3DX0A 4LPWA 3UYRL 3MQIA 2DKSA 4XBMA 1A3RH 4XMXA 5BS0B 4OCWH 1CD1A 2X89A 5JR1L 3U7YH 3TO4B 1SF5A 4M43L 4XXWA 1KGIA 3IDXH 1KN4H 5LWYL 1TT6A 3L3GB 5CSZB 2VXQH 3S34L 1WGOA 2VERA 1BBDH 3I6LE 3QPQD 2FX9H 1M05B 3D4GA 3K3QA 5T3XD 3UZVA 5A2JH 2C7UB 4FQ1H 3QARA 5C3LD 1UURA 3IMSA 1S7TB 3KPNA 3QEQB 4XXDA 1THAA 4BH8A 1T5WA 1QKZH 2RJMA 3GFUA 1FORL 2ZUWA 3B1UA 3RPIA 4QHKI 1I8LC 4RAVA 5DMKB 2DQJH 5KYNA 4AMWA 3FT2B 1RPQA 2DIBA 1OAZH 1FH5H 2C9UA 2ZNXA 3D0VA 3O3EB 4U2YA 1MCCA 3VU2A 3X12B 2GUOB 4ZBJA 1HESA 1NFDE 1XR9B 1XWVA 3C5JA 4IRZA 3H6AA 1C08A 1P7BA 4K3JH 4XRCA 4L0YA 3BQUC 4MAUH 4A2LA 4OI7A 3UBGA 2F15A 1ZY9A 1A3RL 2APXA 2OMYA 4OCWL 4U31A 2GIYA 1UM4H 2B39A 1AY1L 1U41A 3U7YL 3WNOA 3FHAA 3T4AB 4F58H 2IH3B 2X6UA 1EEZB 2GPZA 2QKIB 3VQMA 4CKQA 4B27A 4KHXH 4HC1H 1F58L 2FX9L 3TOPA 5FO9B 1A7QL 1OP5H 1RK0A 3NZ8B 3Q48A 1L9OA 4MDJA 4FQ1L 4XPBL 1IC4L 2VDRB 3LIUA 3GB7A 3WO3B 5I75B 3ESPA 5DRXA 3MRMA 2EDQA 1NGXA 5F1NB 1QKZL 1LP9F 2X1QA 4L05A 5LN4A 4NAJA 4ELMA 1RZ8A 2I32A 2DQJL 1NUDA 1QUNA 2KL6A 1DSWA 2OXHB 4YGVB 2V3EA 1KB9K 2CA3A 1B0GA 1FH5L 2KERA 4PJ9D 5F9JB 2GJZB 1YPZF 2K9FB 4IGBD 4JO4H 4KUZH 2DYPB 1JGDB 2NY0B 1I9EA 2NTFB 1A66A 5ICYB 3MGTA 2PW1A 4OKDA 2ATKA 2FT6A 1JTOA 4Y19B 1R3KB 4L4TA 2YXMA 5FDWB 1LL1A 1UM4L 2ATPB 3CH1B 4OZFA 1AXTH 4X0KA 3FB8B 4BFBD 2NY6D 3PWPA 2BERA 1KGCE 4NAMA 1MWOA 2R1WA 4P06A 4N0FA 1NCGA 4K3HA 1BPVA 2VXTL 4KHXL 1NWOA 4G6ML 1U8HA 4XE5B 2DMBA 2WXGA 3E6HB 4S2SA 1ZSHA 4LBAA 3DPDA 2NTSP 3ULVD 1NCDH 2ZKWA 4UOQA 2CWRA 4OB5H 5K9OA 4N9GA 3V5DA 3RPKA 3UZEA 1QFPA 1FL3A 1A22B 1NFIA 5KSAD 3LPWA 3VTMA 1F6LL 5K9KA 3DLQR 4MA8H 4FKKA 4L3CA 3RWIB 5CBEA 1BQSA 2QPEB 5E9DA 3LXUX 4KUZL 2VXUH 3D9AH 3QDJE 4OF8A 5D1QB 4PGJA 4PCSA 1VGEH 1U8CA 5ENWB 1MZYA 1KJVA 3L2LA 3O8XB 5GJTH 4BSWB 3JYBA 4B9CA 3N42F 3FN3A 2FEDD 5I9QB 5BUGA 1GW6A 5E6UB 2EDWA 2OS7A 1MHEA 2DBJA 2ARJA 3DK2A 5DMIH 3ZKND 2BNRB 2A74B 3CDGB 2LLLA 3MBXH 2DIJA 3Q8EA 4LHUB 1BQHB 2HKAA 2AK4B 2ZX8A 4FXGA 1A6UH 4MVBD 4RCAA 3LTVA 1FA4A 3H3PL 1QBLL 4QPEA 4Y7MA 3TZVC 3DUSA 1ZLWK 1X6NA 3FQ4A 4OFYA 1XIWD 5HYEA 4M6MH 1FG2B 4PD4J 5T33H 5CZRA 4MXWH 5D7LE 3D7PA 3U1SH 2OQJA 3VRJB 3D9AL 4GQQA 4HD5A 2GYSA 1E40A 5E00A 4AV4A 4J5VA 1VGEL 2HRLA 1NMCB 1Z5YD 3O6FD 4ALAC 4S1SL 5I1DB 1RD6A 4LGSB 1EXHA 1JGIA 2NYYD 2UWEE 4G6JH 5JIQA 3N1MC 3D85B 4FCAA 2WMPA 3VG9C 2Y1VA 5DMIL 4XMTA 1TEFA 5AB0A 3B3IB 1T6VN 3E0GA 3EFDH 9PCYA 2VLRE 3MBXL 4K23H 2RQ8A 2VLJA 3FZUD 3RNKB 3D07A 1KLGA 1I85A 2QADC 1CLYH 1A6UL 4EI5C 1X5GA 2BSTA 1PFCA 1Z3RA 3JV0A 3ERXA 4Y1TA 3N1FC 4DF9A 4OGAD 5BNXD 3MRFA 4M6ML 3V8OA 3ZHKA 5T33L 4XB8A 2GIMA 4XNUH 1B0IA 3UBFA 2VZ1A 3P2DA 2ENQA 1QI4A 4MXWL 3ZTDC 4X5LA 1ZWIA 3U1SL 3NFNB 2OI9C 3IFOA 4HKZA 4LPTA 4XCNA 4O58L 1B4RA 4IMLA 3SCMA 1XGUB 3ARFA 4TKWA 1EANA 5HY9A 1GPOH 3RIFF 4GBXB 5HYQB 4PRPB 4WGKA 1DQDH 4DP7X 4JPSA 3UBXI 4KXCA 1LDSA 2UWEF 3GMPA 2ZWNA 3ES6A 1DVFD 3UTZB 2AERT 1PNCA 5TK2A 2H47C 4CC1A 3R8QA 3IVKA 4G6JL 5AVSB 3LXAA 4UIMB 2FLRT 1JP5A 1QD0A 4RIRA 4C83A 1Z6JT 4PU2A 3BE1L 5BOZG 4UNUA 5FX3A 2V7HA 2IDCA 1Q72H 3KEDA 3NCEB 2Y7OA 4Y0GA 3QRBA 1CLYL 3V0AC 2O93L 2OSXA 3PYCA 2AXFB 5SWSB 4U6XB 5IJKC 3QUZB 3ATFA 4NP4L 5ANHA 3DX1A 4JFTA 3SE6A 1OCZB 4XNUL 2KQNA 4QTFA 3ILDA 1JYXA 4IHOB 4GUQA 2EYTB 3OKEB 5DTFA 3ZE0E 1N6VA 2J5LC 1DHKA 4FERA 5IKCA 4EMZA 1GPOL 4G3YH 1I9JH 4Y2NA 5D5MA 2A9CA 1DQDL 1O6TA 4GRWH 2FVNA 4PJDF 5ALBH 4H88H 5F7WC 2E9BA 5GS0H 3BEVA 4I0PB 4W4OA 5H4YA 4IBSA 4OZHE 5ANME 2M1KA 4X7DC 3Q6GH 2L8AA 2CIKA 3G6DL 2YD4A 4HUUA 5EF0A 3PWUA 2ZCKL 5E8PA 4EDXA 3D39A 4YLBA 2FQDA 5MENB 1Q72L 5TQ2H 3NRFA 3UGXA 4LXFA 4X6DA 5JIDA 2CO1A 2J6EA 5SWZB 4PJGE 1ZHKA 5C09E 1H8LA 2D31A 4P4KA 4R2GD 1K2DB 1S7RA 3AQZA 3MFFB 3BZ4A 3HG1D 4J2QA 4PJCE 1ACCA 4V1DD 1O7VA 2CCLA 4ZPTB 3ZPDA 1S3RA 4U1HA 4G6AD 3FTZA 2C9PA 3I9GH 4G3YL 4WSGA 4X9FA 5IQ9B 3JVFC 2C7FA 3JV6A 4DP4X 5ALBL 2AQSA 4QXTA 1VFAB 4IIQB 3WEMA 1B4TA 4OGQC 3ZE2E 3U83A 2HT3D 2AV1B 3JWDH 3LRKA 4E9VA 2XXGA 2HJFB 3Q6GL 5H35B 5IVXA 2X89D 4ZFQA 3QUYD 5FUZH 1KXQE 1MI5E 3IBEA 3HUJF 3CJJA 3H3KA 3IDJA 2V5YA 4OAWB 5TQ2L 5IB5A 2H3NB 3HR5B 5HJ3B 4Z95L 3WUWB 4BZ1H 3CFDB 3QORC 3BUYA 2FUTA 5F7YC 3H9SE 3I6GB 4G8GA 2A9BA 1YC7A 1PZSA 5HVHC 2IQAB 2HT4D 2NNAA 4GRWB 5IMLA 1T22A 1JV5B 2P8LA 4WFFE 3SKMA 3LN4B 2XWCA 1UM5H 3O4LD 2FLMA 4BELD 2ENYA 3NIGE 3IJ8A 1B2WH 2YRZA 4NZRH 1AGCB 4G11A 3TT3L 3BWUC 4L1HA 5CWSA 5EZIH 3I9GL 3P4MB 4UQCA 4HMEA 1PKOA 1CD8A 5IQNA 5LDUA 5KSVB 2DWDB 5A3ID 3BLBA 1HI6A 4YHZH 3JWDL 4YBQC 3GTVA 3HKZA 3LRMA 3ZKQD 4F33B 1EEQA 5E1AB 2WLNA 2R29H 3DECA 3V2AR 5FUZL 1HCFX 4HUVA 1M2OA 1Z9MA 2OSLA 1A47A 3RU8L 4DCQB 1QSVA 3CHSA 4P2RD 4BZ1L 4XOEA 4AQ1B 4W1TA 5BQDA 4YDVB 3VFUA 3ZUNC 4BFFA 5JW4R 5MHSD 3WNNA 2DTSA 4U2ZA 3UIZA 1FO0A 1ERNA 3NZSA 2R23B 3NIGF 1VENA 3NOIA 3ZRFC 3SB3A 4P23B 6CGTA 5C0DA 3JTBA 3J8F7 5J1SC 1B2WL 4PJ7E 4NZRL 2XXFA 3ZHLA 3PL6A 3BT2L 4MBRA 5T1MA 1GH7A 3BP5A 1DCEA 3FAWA 2EDOA 5EZIL 3IDGA 4HS3B 3CSTA 1PYWB 1OWWA 1U4EA 1U8LA 4F8PA 4Y9EA 1WWWX 4YHZL 4AKQA 1JZGA 3K6NA 1NIDA 4JJ5B 3DIFB 3QAZC 2QQQA 3IMUA 3U9UB 2J1XA 5I0WA 2R29L 4LK4A 4OJAA 5DHDA 4F8TA 4NZTH 3VGGA 2X4PB 1SPDA 5E56A 3TBSB 3AABA 3U30B 3MRQA 4ELKB 4KQ3H 4BHUI 3V10A 4UTBA 1TU2B 3LRLA 4HIHA 5FK9B 4GSDH 2PMZA 2F7RA 3M17B 4MFHA 3CQFA 1GJUA 4Q9QH 2WNWA 4A37A 4KXDA 4P5MA 4LP5A 4K9JA 5B3JF 4LLQA 4MQ7A 1FHNA 1VCAA 1A4JA 3L1FA 3D2UD 5JDSA 4F7TB 3KZ8A 1KLFA 3L3HB 5EDSA 4K55A 4K7PL 4PHXA 1O6SB 2HFFA 4I2XE 1F3RB 4HKBB 2J7LA 3L3OB 4ISVB 5E9DD 1IIIA 1NFDB 4Y9FA 1UA6L 4YSOA 3VAEA 3LPGA 4DOHB 3O9WD 2VM9A 5BUPA 4H8QA 5FFLA 1JN6A 3S2CA 5IHZA 4B0MM 4NM4H 4JZNA 3SDAC 4GW5B 4QRQB 4NZTL 1J5CA 3BPNB 3SQOH 1NC2A 2LR4A 5GZNA 4JFHE 2P80A 1IGCH 1KEGH 1JGLH 4QR7A 3ATBA 2BC4A 5C0JB 1YY9C 4BH7A 1JWSA 5ESQB 3VFSB 4GSDL 1TTAA 4G7RB 4Q9QL 3RFRA 4BFGA 1S6NA 1JUFB 1SJMA 3KBFA 5B1JA 3RX7A 1ZRUA 3BCDA 4ONOA 3O3DA 3V6OE 2WXJA 2K78A 1OF2A 4XN9A 2IDTA 4OFYD 3MNVA 1W6LA 5KAQG 2E8ZA 4X99B 1P4LB 1ZGLB 2XTLA 4HZLA 1ANUA 1ZHNA 3KYNA 2DJSA 1NEUA 3ENEA 4MJHA 1H3TA 5K9JH 1CFNA 1P1ZB 4XNXL 3BGMB 4NM4L 4WI4A 4PUBL 3G04A 5GHWH 4K5LA 3MV11 3SQOL 4AVKA 1R3HA 4HYTB 1SEBB 3N42B 3VRIB 2OMXB 1IGCL 1JGLL 2WSDA 4XP9H 5HYJE 4FADA 3II2A 3EYFB 1G4RA 2WHVA 5H2BA 2YEZA 5HHQB 2EDXA 3V0VB 2XWJA 2IAMD 1IBDA 2Y23A 5E6YA 3V0HA 4I18A 1D5XB 1BQKA 5DD6B 2XYCA 4UQDA 4PY7A 5D1XD 2JE8A 3DTDA 1P6FA 3TCXA 2A1WH 2J2ZB 3L3JB 2E76C 3QT2A 4RBPK 1YMMA 3Q2WA 2XPYA 3GZOA 4D9QD 1U95A 4MNQD 3L9RA 3C5SB 1T1ZA 2MH4A 4FNPA 3SKNA 2EIZA 1QSFE 3QDJB 1HEHC 3SCMD 3TN0D 3NH7H 4Z23A 4XAKD 3OPZH 1WVZA 5EOTA 5IMMB 2KKQA 4OW6A 1CDYA 3BP7A 4O2FB 2K3TA 4NKMA 1GGUA 1CDCA 4RMUA 1PS3A 5B39A 1P7QB 4Q2ZB 4F3FB 1XF2A 4XP9L 4RFOH 4M93B 1TYJA 2ED7A 4KK9C 3I9AA 2DLFL 3PQYB 3WLWD 4U1SA 5T3ZH 4FHJA 1I1FA 2APFA 5GRVL 3RY6C 5EC1A 4WWKB 5LBSH 3X1FA 3MLPA 4DP6X 1J88A 3S4SG 4KQ0A 4L8DB 2R69A 3REVB 2NNXA 4PJBA 3ZHNA 4U1NB 1PLGH 3VFWB 3FC8A 2RFXB 1E4XH 5D7LB 5F7AA 5C0BA 5JHLA 1J87A 3MLTA 3BQUA 4I9WD 4HHAB 2B1HL 4YO0B 3AWEA 2CXGA 1D6EA 1JV2A 3FONA 4YFDB 1JHKH 4QJ5B 2IC2A 1MREH 3M88A 3WFEL 4QJ4B 2VR8A 2CO6A 2VDPL 3OPZL 2WLZA 4Z7WE 4N1HB 3GINA 3KPPB 3NSXA 1J9CT 1KTDA 1KB3A 4HJIA 5LGJA 4PRAB 4X98A 5HYSB 4P0DA 1X9UA 2UWEB 2WAQA 4BZ2H 4AQAA 4UM9A 1F4WL 1F1AA 4RFOL 4QRUB 1XSKA 4JRXD 3KLSA 1MDAA 2ZNWA 2VLRB 3GXDA 3VQLA 1QBAA 2DLTA 2ARWA 5T3ZL 4GEJA 4HV8A 2R7EA 4XBPA 3RWCB 5HDOA 5ICXB 2R39A 4G42B 3RILA 4FJ6A 2GAZA 3IU3A 3CPLA 5F7DB 4UZGA 5I0ZA 3DVNA 5AL8A 3L7EB 4FEIA 1AZNA 1UD6A 3SYPA 1NCCH 1GZPB 2DIEA 2VDPB 3NQKA 5EEVA 1ND0A 2BRRH 3M7FB 3CUPA 1F56A 1DVYA 1PLGL 5E4AA 5J11B 5JXAL 1RZIA 1E4XL 5C0FA 4KROD 4HDIA 2B0SH 4MYPA 1QFWH 4XCYA 2WV3A 3OAZK 3LH2H 1JHKL 2W92A 1JPFA 3QC6X 4Y4KD 5DSCB 1IKNC 5FO8B 1MREL 1DFXA 5DHYB 2OJZH 2P28B 1WZMA 4OI9A 3B7RL 3B3BA 3KPOA 1EDHA 3EJQA 4L0PB 4LEOA 2ZWLT 4LPYA 5I8OL 3P4LA 4L8BB 1TQUA 5D7IE 2Z1PA 3G5YA 3FU3A 2DM7A 1J5HA 2Q6WB 2UXVA 4BZ2L 5L6YH 4OLZH 3QQ9C 3LZQA 4FP8H 4IJ3B 4WTZA 5D7JC 3V4VH 3LOWA 3VXSD 3BUIA 1P9MC 4P2AA 4Q52A 3SZKC 3FU7A 3DVIA 3U4BH 1NANI 2WQVA 1UT1A 5EBMB 4P5KB 5EU6D 4LIQE 3ULUE 5EIQA 4PRBB 5HI4C 4PVNA 2X44D 4APQB 3WENA 1FZOA 1RJYA 1A02N 3P02A 1NAMH 4AOFA 4U1JB 2D03L 2BRRL 3PAYA 4J7RA 5GSRB 5G2NA 3MGOB 3C09C