1SLUA

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
133
structure length
131
Chain Sequence
IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMHCPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
total genus 16
structure length 131
sequence length 133
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sluA00
1ECZA 1ECYA 1SLUA 1FI8C 4NIYE 1IFGA 1XXFC 1AZZC 1P0SE 2Y6TE 1EZSA 1SLWA 1XX9C 1XXDC 1SLXA 1EZUA 4IW4C 1N8OE 1ID5I 1SLVA
chains in the Genus database with same CATH superfamily
5D55A 3ZTJH 4KVCH 4X6BA 3BVDB 4JRXD 4NNYB 1AYRA 3IE4A 4ANKA 1AYOA 2H32A 4OJYA 3A6OA 1Y7VA 1MPAL 3OPZL 2VDMH 3GTNA 1EJOL 3DOSA 5D7EA 3MNWA 1FJ1A 5E9DA 4JVUA 2Y7QB 2WWMD 4Z7NB 3AZUA 5C6TL 5FECA 3DTXB 5LBSH 2B1HH 3WJJA 3VW3L 2QTEA 1EGJA 2Y6SC 1M3IA 4G1EA 4NJ9L 3HI6L 3SE4C 1LEGA 3IMTA 5C07E 1CTMA 5JW4M 5EN3A 2J8OA 3GLAA 2OM5A 3H4FA 4XAKD 4XPHH 5EIVA 3VE0A 4C4KO 5JXEC 3DHPA 3FUMA 3CVIH 4QHKI 1AXIB 1RHHB 3QWRD 4IK7A 4JFQB 2Q76A 3PQYA 4P4KB 1KPVA 3QJTB 2WBJA 1UJ3B 1KN4L 4X5WB 5FUZL 1QSEB 1IT9H 2APWA 4XNZC 4TQ8A 1UA6H 2BSEA 2YPLE 3PF2A 1AY1H 4N0CD 1FSKB 4M7LL 4A6YH 4MB1A 4M93B 4I2XE 3F65A 2H2PD 2IGFH 3SGJA 1CU4H 1I9IH 1EA9C 3RX7A 3P30L 2ZX8A 4AJVA 5IMOB 2CR6A 5JHDB 3WTUA 4NOFA 2OL3A 4EZJA 1KWKA 5ALCH 4H8QA 4EZLA 1MY7A 2A1WL 3VFPA 2WXMA 2G2NA 1KPRA 3UP6A 1LQBC 1BZ9A 5G5DA 4ZX3A 1T20A 3RKDC 1GGCL 1CD0A 1XF4B 2OSLA 4NGHL 2PXYA 5KOMC 1JGDA 3MODL 1QTSA 3QWOA 4B0MB 1ILUA 4ZAKD 1E4KA 1XGTB 2GJ6B 2J6WA 2X3AA 3PNWA 8FABA 1U33A 2AJYH 2AV1A 2MCMA 2ZSWB 5KUKA 2XG4A 2R8SH 4ZBJA 5BRZA 4Z6AT 1FI8C 3L3GB 3BKCL 1LP9A 3O0RL 3QC5X 5E94A 4DO6A 1NLBL 2UZIH 3KLHD 4BZ2A 1BX2B 4ZXBD 2IAMA 2JLLA 3HBGA 3HNSL 2BRQA 5IHZA 1GOHA 1SM3L 2A9MH 1A0QH 2YQGA 1NJ9A 1NMAH 1IKOP 1RP8A 2VC2H 4W9LC 2KPNA 2ZE0A 3FCSB 4JQXA 1BXUA 2F2HA 2VISA 3BGFB 4MCZB 3RWHB 4I3RH 1MQKL 4NPKA 1UM6H 3N0PB 3FB5B 4FC3E 2IFFH 5HHVH 1JGUH 4O9HH 5F6IC 4LPWA 4C4BA 1T0MB 5AVXB 1KCWA 2Z8VC 1A66A 1JWSB 2XBZA 3B56A 5HTSA 2DQTH 2HFTA 4OB5L 3MRRA 3BWAB 4LFHD 3Q5OA 1YMME 4M4RB 2J1YA 3HHSA 2Z7ZA 2BINA 3WKNA 1OAUL 2WZ6A 3M46A 1RFDH 1F4WL 5LBSA 1R5WA 3EOTH 3KEDA 4FQXA 1EEQA 1FFPA 3BIKB 6CGTA 2X4TB 3MBEB 1NMBH 4AGOA 1EWHA 4XTRD 1KDIA 4R90L 3SEPA 2WUCL 4JDZA 4EI0A 5T5NF 5KVMC 2BZ7A 2VT0A 4GY4A 3D12B 4MA3A 5I5IA 1SF5A 1XSOA 1RPUA 2HH0L 2CBMA 2NZ9C 1FLTX 1TOXA 4KY1H 5D7KD 1UT1A 2FT7A 5IVXE 4F15B 1F90L 5KSVA 3EYVA 3QORA 1BD2B 3Q48A 3HG1E 1BMWA 4YBLB 5E7BA 1IBDA 1FP5A 3VXNB 1FVDA 4N8VA 3W81A 1D9KD 1U93A 5D7JC 5F7NC 5J9PA 1E6OH 1K8DA 3EG9B 1H3UA 3DK0A 2K9FB 2GEEA 3REWA 4U6YB 2UVEA 4GB9A 4FTVA 4OCSH 3TYGL 4OD3L 3ISRA 3N3EA 4HWNA 3P4NA 4RZCB 1BOGA 3BLBA 4OD2B 1PGRB 2VJ8A 3HHRB 4TULL 1AD9B 1KTJA 5GS0C 1D5ZA 3FT0A 4HIXL 5E1GA 3GSOA 3VVVA 4MFHA 4WNQA 5MI0B 3H54A 5I73B 4NC1E 4DQAA 4GKOA 5IQOA 2BS8A 2F58H 3HEIB 4IKIA 1IM9B 4PRDA 4UILL 3ZE2E 5I19L 3QDMD 1A6ZB 1HH9B 3EGSB 5IHUH 3FU7B 4RFEA 4YHNA 1U3ZA 2P46B 3W9DA 2DYPD 4PJ9B 4FNLL 5AEAA 2VLRB 1BJ1J 1KBGL 2XZCL 5E2VH 4R83A 3DIFA 3GXNA 1K4CB 3EOBA 1KT2A 4HXAH 4LASL 3B7UX 3IN0A 1VADB 4G8GE 4J4PD 1KCUH 1VHPA 4H8UA 4JY5H 1KXTA 4OCXH 1TQCB 3OG6B 5C09D 2FEJA 2L3BA 3VI4E 5GISH 3TBBA 4DN3L 5C0FA 2DQ6A 3FTVA 3DJTA 1DN2A 1RJZA 1HC1A 1N8ZB 3V4UL 2BP8B 3A4FA 4NM8H 1NFIA 2AEIT 2IDCA 4XNYH 1F11A 2VDLB 5CIPH 1HKFA 1WFUA 2WSDA 1QFWI 4PRIB 4OUOA 4UZUA 4UI2A 3KGRA 4XPGL 1L9SA 3T4YB 2DPKA 5K59F 2NY2C 1JWMB 4GP4B 2AJUL 1H3TA 3K6IA 4BKLA 4F3FA 3PHOA 3T0BA 1OOWA 2VDKL 3MNVB 2QDWA 2D7PA 2ZWSA 5F9WB 5F96L 5E5MB 2AV7A 2ZKXA 2CBOA 3NUKA 3P0VL 5JW3L 1XF2A 4AEHH 2Q8AH 1RURL 2DM3A 3CFUA 1AZZC 3EYSH 4U6XA 4DZ8A 4X8JB 1BFSA 2X4UA 5K69A 3L7FA 1OANA 4DIXA 1IAKB 4MYPA 2V17L 4Y19E 3QUZA 2D0HA 1AHWA 5IREA 3US1A 1S9VA 5HJGA 3BAXA 5IQ7H 3V9CA 1EMTL 2I5YH 2YBRA 3EAKA 4U1GB 1FBIL 4LGRB 1J87A 2PUQT 2NSMA 5C92A 2CO6A 3CFDA 4JB9H 5F1OB 1E30A 1JZFA 4Y1SA 1A7NH 3UO1H 4AIOA 1AGEA 1Z5HA 2F19H 5H8DA 1N0XH 4BA8A 1RI8A 2APFA 5I23A 3S5YA 2PTTB 3GLZA 1ETA1 3HG4A 1H19A 1IEBA 3IXTA 3M7FB 4NQCE 4Y2DB 3S8GB 3SYQA 1JHKL 2FJHA 2XFXA 4WTZG 5GGTH 4TTDC 2KLRA 3TPUB 3ESMA 1BVKA 2X2JA 1ND0A 1UWEH 2J88H 4UM8A 2Z92A 2GCYB 3V6OC 4AUYA 4XWGL 4A7GF 3APMA 4GLRI 2OTUA 2MSPA 4LVOC 1A6AB 4NNPL 3WD5L 3TO4C 4UQBA 4FD0A 5EBLA 1NMCB 2ADYA 1WAAE 3WXWH 4Q56A 1ZT4B 1OT1A 1JZHA 4MD4A 4XBPB 2BCMA 4L29A 3HB3B 1B3IA 2MEJB 1USQA 2YC1A 3VYNA 1JV5B 2F53E 3BGMB 3NGBB 4H0GA 2WWMC 3S96B 5JA8B 3WHXA 5L4JA 3HAEB 3U4BH 1JPTL 5LAXB 1WE5A 2EIDA 3EYQD 4AYFA 2VXSH 2F5BH 2BCKB 4P2RE 4X4ME 1FL3A 3AT9A 5DLMH 1KJVB 2JB6A 4NP4L 1N5AA 1S9KC 5CIPA 5D1XB 2VDNH 3SPVB 1ZHNB 4QNPF 5A2IH 2F54B 1ACZA 3DURB 3OKEB 1AZUA 1XR8A 1RZQA 3RZCA 2BNRD 2L7QA 1BPLB 1N68A 5I5MA 3DYOA 4JFXA 5F3BA 4L3CB 4LIQH 1U8QA 1CS6A 1PLAA 1F3JB 1CFQB 1ONQB 2XJKA 4LSSL 4MAUL 4YL9A 4N0CC 1ZJAA 1YN6A 2H1LM 5F3FA 4BZ1A 2X1XR 3GXTA 1O0VA 3PV6A 2H2PC 2NTSP 2ZP8A 4TSBH 1G43A 1Y1DA 3IF1A 2P45B 4FXKA 1FRGH 2JQAA 3BT2H 4FQIH 3C8KA 3HZKB 2F74B 4YX2L 3B8YA 3O3BA 1T22A 3UADA 4G6AD 3T0VA 4FZ8H 3V0IA 4LCCC 3NAAL 3MX0A 3ZIYA 3DKHA 4HJEA 5DD1H 1UT9A 5BMFL 5DA4A 5E8DH 1QHPA 3V0FA 4G9FB 1EFXD 4LT7A 4QTHB 4BFRA 2DQIL 2VDOH 3MBXL 1AXTL 1MLBA 5GSVA 2BSBA 2P80A 2J55A 4PJHA 3V5DA 1IC4L 3GBDA 3NCBB 5JPMC 1B0GB 4ZAKC 1JK9A 3A4EA 1EBAA 4GPVA 5AW3B 3ZZ1A 5ACLA 1T7WA 1DFXA 1KLGB 1JRHH 1NLDL 5JNYA 4GOSA 1HI6A 3LV3A 5L2KB 4W9CC 2WIIB 3IGLA 1U58A 4JY6B 3E80A 1NCHA 4R9HA 5HY9A 4M5ZL 4Z0XB 4J6RH 4ZXBC 2J57A 3D34A 2Q6WA 4WHDA 1B2WH 2XVLA 5GGTA 3TP4A 4CC4C 4HG4K 4JO2H 2WO4A 1ZVSA 5IUCA 1FZMB 5HYJA 3UZEC 1E3FA 3S2CA 1J5DA 4JRLA 3VFRB 4PJ7F 3QUGA 2LR4A 3CC5A 4F7MB 3W39B 3UBHA 2ZX6A 1DVFC 3IS1X 5L2JA 2VE6B 5GRJH 1BEXA 3PJSA 2C26A 4GMSH 3VXOB 3I02B 1EH9A 4JZNA 2FQEA 3QQ4B 1R3JB 2CRYA 4M6ML 1D9KA 3CSTA 1PNDA 3OJDA 4E5XB 4EO5A 5C7XL 2E3VA 5ISZD 3GINA 5FA3B 1J5CA 4M5SA 1E5YA 3OX8A 4PJCE 3SPIA 1IAII 3FDWA 1ORSB 3TEZA 2BNQD 2Q3AA 3FOLA 4G1MA 1AE6H 2AKRB 3RFZB 2DQDH 2EDQA 2AXFB 3ULVD 2VIRB 4DH2A 2HLEB 1ORQB 1UQSA 4XTRC 5T1KB 3NFSH 5I6NA 2RBLA 3BEWA 2D3JA 3CJJA 5ICYA 5DEFB 1IGYB 3HVNA 3MXVH 1FVEA 2V7HB 1CICB 1TVHA 4QHLA 3WFCL 3F6JA 3F7KA 3F85A 4LMQI 2HLFD 2HT2D 2KQMA 1P1ZB 3U48A 1XIWA 3QUXA 5E8PB 3FO0H 1ZLWK 4DEWA 4LNRA 1JYWA 2VMEA 3DV4B 1YY8B 2LE9A 1PY4A 5E95B 1EUUA 1KEMH 4WTZA 1BQHB 3FKUS 3Q01A 1KJ2B 4G9DB 3PWPD 2FATH 1CYXA 1LDPH 1YCSA 2OCJA 3DUUA 5IFHH 3STZB 4QRUB 1YEEH 4BRJA 3MLXL 5E2UL 3RNQB 5ABZA 5TF1H 3MLWH 4C56D 3DOIA 1Z7JA 2HX8A 5IMKB 5KVFL 1JTOA 2WQXA 5KVGH 3LMJH 1KV3A 4G8EA 1FO0A 1ECZA 1GOFA 1H3PH 4NC0B 4MD5B 3S9DB 4P23D 4LL9A 1LQSR 3O4LA 4QOKB 1KSRA 2YPLD 1EFQA 3RUGA 4ES8A 4NO2B 1YUHA 4U3SA 4X83A 3MMEB 1EXUB 4Q0XH 5KVDH 1CFVH 4QRPB 4FQ2H 1I9RL 3SPHA 4K5OA 4AYDC 5T5FL 4HEPG 1TTBA 3OHXB 3QIBA 1PAZA 2A2QT 1NCIA 4ZSOE 1BVLA 3T6WA 1GZHA 3BAIA 1A4KA 2K6WA 2TRHA 3CZEA 3L5HA 4J4PC 3V7MA 1N19A 1F6LL 4CDHA 4LARH 2XKUA 4WV1A 3IJHB 5IJKC 1RZGA 1A8JH 4OF6A 2PNDA 1K8IA 1MWAB 3C9NA 5IB4B 3KR3H 3BXNA 3WTSA 4BK5C 3NACL 2VZUA 5GRVK 2BNUB 3K72B 4L4VB 2H1PH 4KZEL 4HXBL 1F4XL 5C0DA 1MCHA 4EN2A 2UV3A 3FMGH 1E9QA 1ZLUH 5AOMA 4YK4B 1IQDA 3VXUA 1B6UA 5B21A 2JKNA 3T4AC 5KWYC 1DBBL 5DHDA 1JN6A 3OJMB 5JDSA 5T3ZL 1R47A 1OGAB 3BUDA 4D9QE 4P57B 1QZNA 2FH6A 3F05A 5I0DA 1YJDL 2DLIA 3FQRB 3V0JA 3EHBD 3LSOA 4GQ9L 3RX8A 2OL3L 1RMFH 2WYTA 3L95B 5TQ2L 5ADOH 4OZ4A 1QKZL 4LPTA 4KMQA 4J3VA 4Z7QF 5E6ZA 1CVRA 3TO2B 3V6FA 1P7KA 4ONFL 1NCGA 4YHYB 3ARFD 1Q9KB 2QV2A 3RWEA 4WO4D 3OXRB 3MREB 2VKWA 2UZXA 2X1PA 5F9OL 5E6ID 5CJXC 3VXRA 1X9QA 4OI9A 4ZFOB 5I2IB 2ITDA 2DBLL 4X0KB 2AZUA 2Z8WC 5J13B 1YMMD 1NBVH 1WBXA 4N22A 1JZIA 4MJIE 4NPYB 4NQXB 3SCMD 1Q8MA 3Q8CA 2ZG2A 5KOVC 5AQ0A 1PY0A 5C9KA 4JFFA 4KDTC 4D0BB 3L13A 4GRWF 1FFNA 3KNBB 3LEVL 1B9ZA 3SGDI 2MKWA 3U0TB 2JJUA 1WV7T 2Y0SA 2X70A 5I1KL 4XNQB 4KH9A 4X7EC 3I9GL 5FKAA 2QZQA 3MO1B 2HJKB 4KQ3L 3X1NA 2C3VA 3G04B 3TL5A 1LM8V 4DK6A 3TYFA 3CZGA 1T7VA 4MZRA 2PCFA 4QJ4B 2C9RA 2WNKA 2XBDA 1L9PA 3P11L 4WWOA 5EBMB 1CFNA 5B1JC 3C5JB 1LMKA 3GLEA 4UU9B 3GI8H 4M62H 2X4OA 1MI5E 2WLIB 1P84K 3B7SA 3P77B 3L3IB 4EUPH 2CO1A 3V0WL 4JHVA 4UNVA 5C2BH 4L8SC 1W0YT 1NBZA 1DUYB 3O45B 1R0AH 2BJMH 4GSDL 3HE6A 4C58B 2YWZA 1Q72L 1HVXA 4PWJA 3ASOB 1MHHA 2VSDA 1XCQA 1U2CA 2CM6A 1U42A 2YJQA 4D9RE 5GS0L 2B1HL 1PDKA 1QSZA 3DX6B 3D4ZA 3BEVA 4UZGA 3WJLA 5I1IH 4FNTA 1DBKH 5E00A 1GJWA 2N0KA 5HDBB 4KKRA 2ZG3A 3CDGA 4XPHL 2VO5A 1DQTA 4GAGH 1KY7A 5BVJB 5F2FA 3I6GB 5I5RA 2D4FA 4K9EC 1OQXA 5DHXB 3P1VA 1RP9A 3QUYD 5SX5H 3O6FD 2NNXA 3GFUA 2I9TB 5E9AA 2DDQH 4MCYA 3MROA 4Q8BA 5DSCB 2ARWA 4A6YL 1W16A 2GI7A 4G8GD 3UERA 2ZTBA 1KLUB 3APNA 1QI4A 1N5YH 2DAVA 2G3XA 5D7HA 2ICCA 1DSWA 4JFSA 1T2QH 3BWSA 1U8OB 3VGHA 1SJMA 3H56A 3W5MA 2X2UA 1DTUA 3D33A 4JG1H 4WI5A 3VA2C 3SGEI 2CO7A 3MJWA 4XPTH 1KJMB 1N67A 2VERN 1G7MB 3KEHA 5KJ4A 2AXGA 3BSZH 1QR1A 3K46A 4G6AC 1C7TA 1RAMA 1WHOA 3HI5L 4NUJB 1BFVH 5KS9F 3QVAA 5DURB 4FI6A 2SEBA 4HEPA 5EIIG 4N6RB 1PLBA 2DLFL 2X0UA 3IPFA 3QPQD 1NEZB 3L9RA 1ZLDA 2XRAH 4L8BA 5AUMA 4I3SH 4JDVB 3SSGA 3FJTA 3DX0A 2QKIB 5KBDA 4GW4B 4PUBH 2OV0A 2ZKYA 3GO1H 3F5WA 2VERA 2G5RA 3QZPA 3L08A 4X80L 3S36L 1RZKH 2AEQH 4YXHL 2P47B 1RIUL 3RDTD 2CALA 1K4DA 4XVUD 1C16B 3K2KA 5FWQA 3BDYH 2VZVA 5KSBB 2ICWA 2QLVB 1XR9B 2XQBL 1ED3A 3FQUB 1I8IA 4F8OA 2Y06L 1I3RB 1IQWL 2WWKT 3EBGA 4L4TE 2AK4B 5J1SC 4PJIE 3E2HB 4RNRB 4F58H 1RKRA 1ACYH 1O6SA 2J4WL 4Y19D 5DDHA 5F70A 4POZC 3FB7A 5KJRH 5T1MB 1S78D 3QIUA 3QJFB 1ERNA 3BYTA 2WB1A 3F84A 3JTSB 4G59C 3TNMA 3U4KA 2BC4A 4EUPA 4G6KL 3LIZA 4JUTA 1GOGA 5IQNA 1KENL 2DQTL 4J5VA 2CGRH 3BN9C 3RLSA 1XZ0A 4NKMA 3PRZA 2BW4A 1GGIL 4AIEA 2JKXA 4XCFL 3KPOA 5FV2A 5HDWA 1PX4A 3A6CH 2J1XA 4F20A 1YNLL 1HHIB 3HS0B 3QJOA 3K74B 4JZJC 4Z76A 3VFSB 3EOTL 4QXTA 5C07A 2EXTA 4UQCA 1A9EB 3ULVC 1U3YA 1FLRL 2Q9OA 1UH4A 4M7LT 4AMXA 4QRAA 4RQQB 1XFPA 1XT5A 3V10A 3S35H 1NSNH 2DM2A 5LN4A 3B9EA 1TEGA 4HKBB 2FNBA 4NHCL 3GB7A 5CS7A 2H5UA 4I2XA 4U0QB 3BQUB 1N2RB 2HT2C 1L9QA 1RVFH 5I1LB 5FO8A 5JMOC 4YDVB 3D39E 4KK5D 1UD4A 1RJCA 2F53D 1E6OL 2CHXA 2YGQA 1J8HA 4U1NB 2JKLA 5IIEA 5IMMB 2XYCA 5TQ0L 1F4AA 4LCIH 5INDB 3LKPB 4GRMA 4UV7L 4MAYC 5CEYB 1C08B 4P2RD 5HJDA 2EO1A 3HBQA 4NN6B 3BSZA 1QRNE 5SWZE 3VXQA 4B9IA 1GGUA 5J89A 4AH2B 4ZUVB 5A6LA 1DBAL 2XUWA 3L6FB 3GF8A 4OF7A 3SO3B 1GIGL 5DS8B 2X3BA 3P9MA 4LKXA 2Y9RT 2F58L 3O4OC 3ZGIA 1P6WA 4IBYA 4O2CB 3KVPA 3T3MB 3R8BB 2N3JA 4L9LC 1KXVA 2ZSVB 5K39B 2LV4A 4KRPD 4PJAA 5IHUL 3ALXA 5EZPA 5I1EL 4ZYKB 2FWUA 3FQ1A 3BUPA 5DUBB 1ZY9A 1BFTA 1L0YA 2CU9A 3OLEA 1DUZA 1IBZA 4BK8A 5LGKA 4NZUL 4IGBA 4LKCB 1MJUH 4NENA 1MFDL 3LS4L 2QPFA 2Y5TA 4HUXB 4JY5L 4I3GA 4P59H 2HPTA 1N64L 4HPOH 1KBVA 3EO0B 2DI8A 1QHQA 3DUHA 5SWSA 3DUSA 4APQA 2ADJA 3GMOB 4ZS7L 2BZDA 4JREB 5AD0A 2EDNA 2J1KA 4K73A 4B9PA 1DLFL 3D2TA 1NGQH 4PP2B 5IM7A 4HK3J 1A3RH 1UHVA 4Y1AB 1AIZA 4Z7WF 3SE3A 2DEWX 3TEXA 3PGCA 4XXCC 1W91A 1Y1UA 2CIKA 4NM8L 5CGYC 5IQ9A 4RSYA 4XP9L 3TN0D 3EFDL 3Q6FA 3V79C 4DGVH 4K7FA 4E9YA 4MDIA 4UUJA 1YMMA 3SE9H 1YHPA 5EC1B 3POCA 4JGMA 1QABA 3DTDA 5CP7A 3CVHH 3L3OB 1JGLH 4P2OD 4XAWH 4BA0A 2J71A 4GAAA 2V7NB 3QRFM 1YMHA 3RA7L 1A6TB 3QUMH 5MEOB 4ZOAA 4BSWB 5CGMA 3LEXB 3UOAB 1VGKB 5L4FA 5GGRA 2HRPL 3KYMB 5DC2A 3C8DA 4OF3A 4OFKA 2ITCA 1YC8A 4RAUB 1TQUA 4TL5A 4TQIA 5EIIA 3LN5B 4G7YL 3BVWA 4L5FL 4HX1B 3VWJA 1KCVL 4W9FC 2PPFA 5ICXA 3R7RA 5C0EA 4AEHL 4QNPE 2Z7WA 2Q8AL 1OAJA 3A5VA 1WWWX 4FLQA 3R0NA 5GRXG 4Z7VF 1UD6A 3HG1A 5BPPA 5ICZB 3BZFB 3QEHA 1WEJL 2VR3A 1UB6B 3QAZC 2NNRA 1U8CB 4WI0B 5J1TC 5EN2A 1SDYA 3HR5B 4PY8I 4BFEA 5J6SA 2VQ4A 3QFJA 4Q6IB 3ARFC 4FNUA 4WO4C 4NKIL 4HIEB 2Z91B 4WWKD 2I5YL 3BH9A 1QFUH 4JM4L 1Z5YD 4DETA 5B8CB 1DSYA 1I31A 1IC0A 3KPQB 43CAA 3AABA 3NK4A 2BWQA 1E40A 1WFOA 4JB9L 4ZO9A 3SCMC 4C4UA 1A7NL 5C08D 2HFGH 4V2CB 2YKLH 4N5UA 1I1FB 1JFQH 2EYRB 2BSTB 5CJQH 4WFED 3DPBB 1IMHC 4JUSA 3HRZC 1P4IL 3PP4H 1JDDA 1P4LA 4LP5A 5EZJB 4J3OG 1DVSA 2WJ5A 1CDGA 3HR6A 1JNNL 2Z8SA 3C8HA 3E7JA 3S5LG 4LE8A 3ILQD 3RBSA 5JORB 1FL6B 1UWXK 2W1NA 3QZBA 4N8CL 5EO0B 3ARBC 5CMAB 5D7LB 1JXGA 3T9WA 1NIBA 4Z23A 1PSKL 1HSBA 4UTCA 3I9IA 2GSGB 4N0UB 1HWWA 4X6DE 1BMZA 1QBBA 2BFVH 1SY6H 4IEFA 4ZW3A 3C6LA 3F8UB 3MBWA 1TCRB 5EG6C 2G9KA 3E8UH 4PJ7E 2B3RA 3WN5C 5J3HD 4UCFA 4FHJA 1MCKA 2GAZA 4HKJA 3DXAB 3U4BL 3VSQA 1I8KA 1MCCA 1MAJA 2F7OA 5EOQL 4GG6B 3Q2NA 1WS7A 2VXSL 5C0CB 5DLML 4NC1C 5B7EA 4OCRL 1MFUA 1KFAH 2HJFB 5D1ZI 2DQJH 3F6LA 4OW6A 3GSRB 1ZLWH 1UZ8A 3L1GA 4U1IB 1XGUA 3S0PA 3D0LA 3OF6A 4GIOA 2IANA 4Y16B 1ZPLA 4NKDB 4ECNA 1T1WA 3QUKB 1W0VB 1OCZB 1A6PA 2V5RA 3CVHA 1PD1A 4G6JH 4F2ME 2OMVA 3MOQA 3QUMA 4YIQB 4ZUUA 2R0KH 1DVXA 4MQ7B 1TNNA 1C7SA 1RIHH 4J8RB 4KI1A 3ZL2A 3D25B 4K9JA 2HUEA 4KXZH 1HZHH 2ZUQB 4TSBL 4UAOC 4XN4A 5F1KC 2A74C 2Z1PA 4X99B 3SDDB 4R8WH 3NCJH 4OT1H 3LPGA 4ILDA 1QW9A 2X89A 4J3OH 2NUPB 4NZRH 1WZKA 3HN8A 4KV5F 4WK0B 3TM6A 5JOPD 1SGKA 3U2IA 5T1JA 4HH9A 5CCHE 4L1BA 3HI1B 3O41A 2P7TA 4LNVA 4ZUTB 4W9KC 1JD7A 2HKHH 2TAAA 1SYVA 2ZX5A 5DC0A 1JHTA 6FABH 2VAAA 2CDEB 1D5RA 4HGWA 3QH3A 5HVWA 3FN3A 1VSCA 2RA1A 3BQVA 5GGSA 3QPQC 1CD1B 2VLJE 4I9WE 4N2KA 4OZFB 4P2QE 4X7CC 2EKSB 1JRHL 5HI5C 1G84A 4LCWA 5CGTA 4CADA 4D9QD 1MFAH 3QNZA 4WFFD 3EIFA 2BMKB 2NY0B 2FJGA 1NCJA 4NQCA 4O4YH 4AJYV 5HGHA 1M7XA 1NDMB 1S9XB 1ZSDB 1QEWB 2R29H 5EO9A 3RDTC 4DP8X 1MN4A 1B2WL 1G1YA 1QLEH 3O9WD 1IIIA 1D6VL 4U0RB 1MW1A 5F7DA 2H4EA 2E7MA 1OWRM 1VFBB 2V4LA 1G9MH 4QRRE 3RY6A 3PWNB 3QNYA 4WHTB 2VZ1A 2FCBA 4PG9B 1WAAA 3PY9A 4ZMAT 3C60A 2CR3A 1P53A 1CLVA 1SXCA 1NBQA 1OSZB 4XMLL 3UC2A 2ZUTA 1M1XA 4P5MA 4JJ5B 3NA9H 3ZT7A 4MJID 5AYQA 4L1DA 4MA7H 3EGXB 1KTLB 1SY6A 5E51A 1G6RH 4BZYA 1CIUA 2WXPA 2X05A 5MERA 3AU0A 3VXSE 2BY2A 5AW0B 4NERA 1LWJA 1IB5A 2EYSB 1BF5A 4J6IA 1BLNB 3BSGA 1S9YA 1G7QB 4KZ0A 2DQDL 1JUFB 3NJHA 2AITA 3RL1A 4WSGA 3O3DA 4YHML 1VDGA 4AC2A 4PJBB 4YFEA 2PPAA 3ZDZF 2PW2B 1YEIH 1RZ8A 1X7SA 2AK1H 4QCIB 4W4OA 4Y2OA 2QSCH 1RUMH 2DMGA 5ALBL 4ZO6A 2B77A 2H6UA 1FDLH 1KPUB 2VKXA 3QHZH 4XZUA 1D7DA 2BY3A 4AL8C 1U9KA 3PAUA 1MI5D 4FLHA 3P54A 1ACCA 3VFVB 4UOQA 4ISVA 2WMPA 5IJVA 2XI9A 5I1CH 4R7NB 3NQIA 3V0VB 1X3DA 1F6AA 4JRYB 3FUIA 3VI3E 2ZF8A 4FP8L 3RJDA 4BBWA 1DQQB 2W60B 4KK5C 4D0CB 2MIZA 3UTTA 4D9RD 1NCDH 1FYTE 2VDQH 1CXFA 1Q0EA 4Z7QE 2IQAA 5BUGA 3S5LA 1I1YB 1MHCB 5J6GB 1WUNT 2EE2A 4OM0H 3LAFA 4IYKA 5IFJB 1J1XH 1CFSB 2IOMA 3HE7B 4FTDA 1RUQH 2PN5A 4K9EL 2XWCA 4PRPE 4EVNA 5JR1H 2WM0A 4XGZA 3DTUB 1DFBL 3GUTA 3BMWA 3NK3A 1R1CA 1L9NA 3PHAA 3RWIB 2ARJQ 4IKNA 4ZPTA 5BQDA 3U25A 4GRWE 3ISYA 3HFMH 4ZO7A 5AVYB 1OKEA 3KDPB 3V52H 2WLLB 5DJCB 4CW1B 2JQZA 4CN6A 5KBPA 1A3LL 2R29A 4F7EA 1SFHA 2OMBA 1MEXH 1K5NA 4B95C 5GGRY 1ZK5A 4F5CA 1P5UA 4WI4A 3SE4A 2J5LB 4LARL 1GMIA 1RIVL 3FT4B 2MOGA 3H1ZA 1XEDA 5HP5A 2R2BA 3HZVA 5J6HB 5JXEA 5AVRB 5AB2A 1QG3A 3SDXB 2ZX7A 1JAEA 1NGPH 2WSPA 1RV6X 4S0TD 4WJG3 3WXVH 4JO5A 5DZ9A 1EIBA 2QVMA 3FQWA 1F4YH 1I1AB 3WUWB 2BHYA 1MFCH 2X38A 2VWEC 3GS0A 5EB9A 1AH1A 1PS3A 1RZFL 1WCBA 3TN0C 4NUGL 4AIZA 4DWHA 5IB5A 2XFGB 3FMGL 1T3FA 4O2FA 4PG2A 5F1NA 3PL6B 1G6RA 5FLUA 2E27L 3GBLA 3SKJL 3VWKB 1OGTB 3M45A 1JK8B 1NC2B 5F3HA 5ADPL 2DMKA 3SDCA 4P2OC 4U6TA 3KWWB 3FRPG 2V9RA 3PV7A 3I75B 1HS6A 1KYDA 2FNWA 5K9OA 2LW3A 2XTJB 3UXFA 5J1AB 3IRCA 2YSSA 1S7VA 1HZLA 5I8CB 5IF0A 5CJOL 2Z34A 1VERA 3FHEA 5E6RB 3AU1B 4HIHA 4M6OH 4DESA 2ODHA 1CCZA 3KPRD 4OGQC 1TO4A 4D94A 2FO1A 2XBTA 2P4AB 4H8PA 3D4YA 3ZHNA 4IHOB 4HUMB 4H4NA 1I3GH 3MRQA 3U6RB 1TQSA 5H94B 2AEPH 3SGKA 3AS0A 2VH5H 4XCEB 2UWEA 4EDWH 1NICA 1I3UA 1MCRA 2WC7A 2EAEA 4WWKC 1EDHA 3GSVA 1XO8A 1FIEA 5C8JB 5KSAD 3ZTDC 4KK9D 3GGWA 5BZWB 3AY4C 3BN3B 1CLZL 4F7CB 2FSEA 3ABLB 4M1GH 4R97B 1I8UA 3VD7A 1I3VA 4EDXA 3DBXB 4UIMB 2FTAA 3SHSA 5KS9E 5EBGA 4PV9B 5T5NG 3ULVL 3FQTA 3G6JE 1IAMA 4MLSA 2B15A 4TYUA 3RPIA 2BVQA 3HMWH 2YMTA 1XVSA 4OVUA 4OZIA 1NANH 3PAVA 4CGTA 4UMGA 3ATEA 3ZBMA 2XXGA 3L48A 3DRQB 4JM2A 2E47A 1NDGB 4TSAH 2PP7A 4V1DE 12E8H 5DRXB 3OSVA 4FLOA 1RL1A 1I7TA 5AVWB 4XPBL 1C5CL 1OO2A 2JXMA 2KH2B 3BUYB 4KHXL 2R0LL 3RTQD 2FX8L 3AXLB 5BZDA 5CKAA 3ILQC 3QWQB 4HOXA 2BLFA 2Z7YA 3O8XB 1U41A 2YAEA 3D39D 4HBCH 4UT6L 2Y1VA 2WINA 2HRGA 3S6CA 4C8XA 1NPUA 5H2BB 4QRSA 3Q3GA 4LSQH 4UT7H 3SJVB 1H6FA 1WBZB 2JSFA 1R0AL 3T1FA 1XGPA 1XDTT 1J8SA 5SWZD 2GYSA 4NWUL 1HHJA 4YC2B 4Z7OF 5EU3A 5F89A 5J3HC 4I0PD 2XIBA 4ESKA 4ADGA 1BYPA 4G8FB 3ARGC 1UG9A 5FV1L 3UEZA 1DQLH 1H3GA 2OMYA 3SDAA 1BD2D 1DL7L 3T6XA 3BKJH 5JA9A 4L1HA 2IALA 4K23H 3M1OA 4MWFB 2IQ9H 3U0PA 3KWTA 4R2GD 4GW5A 4AQ1A 3OJ2C 3ULUD 2XICA 4P8QA 4EI5D 1EHKB 1KYUA 2CBPA 2G60H 3G6AB 5HHNB 3QJHB 3DETC 4NEHB 3VFWB 4LPYA 5D7JA 1L9MA 5C0BB 3LH2L 4ODUB 3RWJB 5EC2A 2JKJA 1UB5A 1XGYH 3CXHJ 3FPYA 4GRLC 3HPLA 2FHCA 1ID2A 2I9LA 1VB9A 2QT6A 2EDFA 3H9HB 3SPCA 1N5YL 5I16B 2CK0H 3ESNA 2B9AA 2CCWA 3U7YL 4NLHA 1G7JA 4U1HB 4NM4H 3BZDA 1LMIA 4Q7DA 1XZWA 4QXVA 4G5ZH 5KBKA 5FGCE 3T2NH 4YXLL 1W0WB 4Z7NF 4XPTL 3LKRA 3SBRA 3VGGA 4NUQA 3V95A 1TZGH 2G9HA 2ZYSA 1TIUA 4EKJA 2OMNA 4LPXA 3IGKA 1NUDA 2UY7A 4FZEH 1A1NA 4K2UL 1NEPA 2VLRD 4ZQKA 3CQFA 3SBWC 4XX1E 3MRPB 1TVDA 1TKWA 3HKZA 3M86A 2VDKB 1CXEA 2K78A 1MUJA 3NZ8A 4BWWA 1VA9A 4K3DH 3EOAA 1PX3A 4PIRF 4JFHE 4E9XA 3BO8A 4P9HC 1P6FA 4OR1A 3NVQA 1XGZA 3WKYA 4NI6A 1HHGB 1R3LB 1XF5A 3H9SE 4IS6A 5DHMC 3BVVA 1S5HB 1OB0A 4U6HA 5F88A 4ZNCD 1U91B 1S8DA 1LEIB 2IDTA 2NY4B 1UM4H 3IWVA 1TJMA 4JFDB 1JZ2A 1INEH 1P7QD 4TSCH 1Q94B 1YEDB 2QLYA 3O9WC 5D9SB 3OZ9H 1MDAA 1S7SB 4N0FA 4F58L 2MCPL 2ROXA 5IHHA 2P8LB 1R75A 1JV2B 4J23A 4G6FB 4ZOCA 4PJEF 3TESA 4I4WB 4YBHA 3FRPA 3PXLA 2PYEA 2VLKE 3U9UB 4AUJA 3AVEA 5D2LF 1IGIH 5FOBA 1PPIA 4FQJL 2OX5B 1PZ3A 1YYLH 2OQJA 3EOYG 3NPSB 4ZUWA 1IC5H 2VO8A 3D9AL 3VCLA 5GGUA 4URTB 1MCLA 2CGRL 4MTMA 5BJTA 1ZVHA 3D06A 2AP2A 4XVJL 5TDNA 1TVBA 1FNGB 2P5PA 2E9JA 4X6CB 3SKNA 4LEXH 4XNAA 4PFEA 4P5RA 5JHAA 4TUJA 3K80A 4GMTL 5EFIA 5D1QE 2J1ZA 5L4IA 4Z7WE 3OKYA 2DJMA 1HNFA 5JMRA 4MJ5B 3MJ8A 5CZKA 2I85A 1JPFA 1N10A 1S7XA 1YEHL 1D6EA 5JQIB 5C6PB 4XMKL 4I0CC 3L3DA 4AWJC 5AOJA 2V9UA 2HWZH 4IM8A 4PP1D 3S35L 1NSNL 1ZSHA 1H15A 4WW2C 3VTMA 2YD7A 1T83C 4NNXB 5IKCA 2JFCA 1MSPA 1A14H 4KNTA 1GZPA 3QFDA 1IGMH 2XWTA 1G9NC 2CLZA 4OLEA 2ICEA 2VL5A 3LPWA 3ZTCC 1U3HD 1KTDA 3UX9B 1CLYL 15C8L 4P3WA 3TEWA 3K6SB 5K5YA 4Y4KD 2AXHA 3PCYA 3ZO9A 1ODUA 5FYKU 5F9AC 4PJ6A 4AVHA 1E6JH 1Z32X 4Z7VE 2EDHA 2WXHA 2N7BA 4JFWA 2BK8A 1UA7A 3ZL1A 4LCIL 4W6XB 3QIWB 3SKMB 4JX0A 3V5KB 5B4MD 3FTYA 2XC8A 4JMNA 3GJEA 2OMXB 2WYHA 4RSVA 3PIQA 5MHSE 1WWCA 3WNIA 5HPMB 5I8EB 4KTDH 3IJ9A 1AG6A 5A16B 5IWLC 1UWXH 4X6EB 1DP0A 4FJ6A 1H6EA 3SE6A 3LHAA 4F93B 1HL9A 4A55A 3Q6GH 3DGGA 4I18B 3TO4A 3HW7A 2W9DH 4PGCB 4WKZA 1IZJA 1NCAL 2OP4H 4AEIH 4BELD 1QVOA 4X6FB 4RMVA 2D9CA 1SJHB 1UD8A 2I60H 2H26B 2GITB 1EJ6A 1P1VA 2CA4A 4PGDB 1F97A 1NGWA 1F3DJ 3U46B 2ADIA 5DF0A 3KD4A 4AKPA 2YGVA 4LRNH 4RESB 3X14A 5JPNB 1E2WA 5AAWC 1MJUL 2R1YA 1GKEA 4L4TA 5LKNA 4P59L 4FXGB 4HPOL 1YAZA 3G5XB 2G3MA 2DWXA 3T04D 3B6SA 1WPCA 1K9TA 1LLAA 2VLME 5CD5C 1I8LC 4EXPX 2W0FA 1JNHA 5FIEA 3IMBA 1B4JH 3B2DC 1N26A 1A3RL 5DMKA 1CI5A 1WWBX 3FH7A 1KB9J 1GC1C 1UJ3C 1VFAB 4HAKA 2YPKA 4UTAH 1IIKA 3DJ9A 2XN9E 3P69A 2VLJD 2PR4L 4P2QD 2B9BA 4NO0B 4XH2B 2NPLX 1GYUA 3X1BA 4OFPA 3C5ZD 1FSKC 4M93C 1J9TA 2JKWA 3BKYH 2Z4TA 4F7TB 1ZS8A 3ES6A 3LZLA 3U83A 2OZNA 1FL5A 1IGFH 1U8NA 3CE1A 2XPYA 2LABA 1II4E 1OK0A 3VNYA 1JZJA 5CUSH 2WXNA 3F58H 5DJAA 1T89A 3WGVB 5HGAA 4N25A 4ZODA 1T80A 1AC6A 3NCYS 4QRRD 2ZCLL 4FE9A 1FF5A 5JOFA 3RI5F 1OHZA 2AJXL 3TA3D 1CIDA 5CSZB 4AQEB 4LLWB 4A2GA 5FF6A 1H5BA 2QR0A 2X09A 3PWUB 2Q5BA 4QWWC 4H7VA 4M8QB 2B16A 2WAQA 1QFOA 3MPCA 1HHKB 2DQGH 1NZRA 2EABA 2WWNA 3M1BA 3R8QA 3R4DA 3CFJA 4B9FA 1MFBH 3VTTA 4IBUA 3JV6B 3OHMB 3A22A 4HJJH 5HJ3A 1AFVH 3ULSA 3VXME 1WT5C 2QVKA 1QRNA 2EE9A 3T0AA 1BOYA 4M02A 1I53A 4CC4A 5F7UA 1R5IB 1UXWB 2YKLL 2AJZA 4NZJA 1GY1A 4QRTB 1AXSA 2VSCA 3G6DH 3IKCA 4IQHA 4DGUA 5F9DC 1GJUA 4HT1H 3BGFC 3U30B 2EQDA 2RFXA 3GM0A 1TZIB 1DVFA 4PGEA 5B7FA 1PD0A 1TYJA 4X7TA 2WNWA 3N91A 4OLVH 4R26H 4UDTB 4PRHB 1CPUA 4AL8L 1UKSA 4XNMB 2R1WB 3ZL4L 3TBYB 5C9JB 4PS7A 4XOBA 1L6XA 3NCWA 4BIKA 2H6PA 1CD8A 3D85A 3MRIB 4E0RB 2JCCE 3P9WB 3C2AL 2P5WE 1GYWA 1XF3B 1U8LA 2EDLA 3VMNA 3Q2CA 3EJTA 4A7GA 2JIXB 1XSKA 2EC9T 4G71B 3E8UL 4PJXB 4FFZH 4H2AA 4L1LA 1MNUH 5T1KD 1L5GA 1PYWB 3EJCA 3CSYA 3BRDA 2GSIA 1GS7A 3WEMA 2VYRE 3SQOH 4WLCA 5KSUB 2IPTH 4L3EE 5GS1C 4I0PC 1YYMH 1YUKB 5GJSL 2B4CH 3N1GC 5FCSH 3BVTA 3MXWH 3D18A 3NJFA 4X6BB 5CN1A 5K1VA 4F15C 4PRPD 3MTRA 4A7QA 3TTYA 4ABVA 2QHRL 2DQJL 4A66A 1QBLH 5IEHB 4OIIH 2Y3NA 4XO8A 4YBLC 3WIHL 3QNXA 4R2GC 4PMEA 4PGBA 2VMJA 3ULUC 1FJ1B 4ODWA 1IL1B 3BP7A 1AKJB 4MXQC 1FFOA 3GQFA 5ITFA 1EBPA 2Y7OA 1UURA 2R0KL 5FECB 3VSTA 4Z3FA 3ESVF 3ZDZE 3LS5H 4M6AA 2OJZL 3SB3A 4WJ5B 4E41B 3GS4A 2Y07L 3V4LA 2H0PA 2IG2H 3MOBL 1P7QA 2VXTH 3OTTA 2DICA 2M2DA 4OT1L 3HC4H 3TIEB 5I73C 4IMLA 3UPRA 4PLNC 2HT4C 5HGBA 4HUWA 1NFKA 1YVLA 1FNEB 2LOEA 1DSFL 4PJFE 3MV8E 3CN0A 3MLTA 4QOKD 4JE4B 4LLQB 3RP1A 3TOPA 4J8QA 3KXFE 1OALA 4Y89A 4PJ9C 2EKJA 4R4BA 2BRRL 4TM9A 3P0YH 1NKOA 5HHQA 1JWUA 1M2VA 2HTLD 3CU7A 1UUSA 3QA3A 4PJGE 4TNWF 5BS0E 3T6QC 3RDJA 3N5AA 4RRPG 4JKKA 2OL3B 3JWNC 1GTFA 3QWNA 3V4PH 4D0DB 5IR1A 1TQCC 3C5XA 3M8OL 5IROA 3D3VE 1VKXA 1BZ9B 3L3HB 5AKVA 1T20B 1F1AA 3QEQE 3ZZSA 2FBJH 3DX8A 4N85A 5F6IB 4AMKL 2CO2A 1CT8A 4OZGB 3HFFA 3QWOB 1JG9A 1FVCB 2QEJA 1DJSA 1UKTA 4NN7B 4RAVA 4HC1H 4X5QA 4WJKB 5FWRA 4DF9A 1OSPL 4GBXD 5A2CA 1G9ML 2CK2A 1GKOA 1JHLL 3PNWB 8FABB 5JW5B 5A3ID 1OPGH 3SOBL 2X28A 4V33A 5IP4A 4NRXA 3ZUCA 2MQGA 3QS2A 4ETQA 4WQOA 1AIFA 4FNRA 3BX7C 2EH8L 2BHUA 3VD5A 4H88H 5DQJB 1HFUA 2XWJB 5B3JE 1OPOA 3NA9L 3LPPA 4QIRA 2IAMB 1OY3B 5EEYA 2HKFH 4LBAA 4PI0A 1JDCA 4R5TA 4PJ7A 1E5AA 3P73A 1OP4A 5JIKA 3BAEL 4LHUG 3QC6X 1URLA 3D2UA 2CKBH 4PMFA 2N4IA 3Q44A 2E7DA 4KPHH 2F1BA 4FFZA 1MELA 5F9WC 3AG4B 5ACZB 3GMRB 5D7SH 1UOKA 2QL1A 2R9HD 5I30L 1CN4A 2VISB 1Z5LB 2I7OA 1DQJB 4HSAC 3LXUX 2B5IB 1MF2H 1UCBH 1VLXA 2FYVA 4QHNA 5DHVH 1JDAA 4UQ2B 2HFEA 3ZOAA 5HYSB 3BKMH 2NT1A 3JWOC 3UG3A 2V3DA 2NQ3A 4OCYH 1XD0A 1MLCA 1TO5A 3MLSL 1LE5A 3MJ9L 2VDMB 3H6JA 4W9EC 1FDLL 3MRRB 5M94B 2COVD 1A7OL 4PP1C 5CJXA 1A7BA 2X9WA 1U8KA 1CLOL 5EU5B 1JPSH 4UM9D 3WLWD 2YSTA 3HHSB 3BZ4A 2QPUA 3OKNA 2C7UA 2EDXA 4FQXB 2WZPA 4S1QL 3SPJA 4YSAA 4FGMA 3EBIA 4KDTA 3VB9A 5D4JA 2JMRA 3CC1A 3GIVA 4Y4KC 2NZ1A 1X5LA 5EDXA 4S1SL 3WJMB 5CFAA 3NZHH 1NCDL 4Y2DC 4JJHA 3V0AC 4NHUB 1RJLB 3LQAC 1E9PB 1OGPA 3SDYL 1L6ZA 5C0JB 5I8KH 4OM0L 3AWGA 4G11A 5F7FA 5B4MC 1SHXA 1AZRA 2WW8A 3EJZC 1NIFA 5JQHC 5JYLA 4PRBA 2IBBA 5AB9A 4Z77A 5GJTL 2NX5A 5EUKB 2WYZA 1MQ8A 2Y7SA 3O2VH 1J1XL 3MV7E 3F04A 4A6YB 2YIHA 4JG9A 3T0EE 5JR1L 2P5EA 2Y4SA 1UEMA 5D6CA 1NMCC 2VR7A 2M8XA 4BFOA 5J9PB 3ZDXE 3QO0A 5JHMA 2EDBA 4GRWH 4MMZA 2R23B 4FTVB 5EUOB 4Z8FH 4FF9A 3V4PA 1TYEB 3P4NB 4UANA 3X1FA 1QACA 3WMPA 3HB3C 4HJGA 5KTEH 4XCCL 1AP2A 3SYOA 3NGBC 1RH8A 2CO4A 2XVGA 5TFSL 1FNSL 3LHPL 3ARUA 3JWDH 2AF2A 4JCLA 2IH1B 4BHUI 5CU9A 3CN2A 4NZ8A 5FO7A 2J2ZB 1BQLL 4XCYA 4HC1A 1YC7A 3OPUA 4TUKL 4CJ0A 3MLVH 2WV3A 4M6NH 1QR4A 4L0YA 3U0WH 3W9DB 2A6IB 4EN3A 2KMWA 3WMQA 1K6QL 3DIFB 1T1YA 3BFQG 2KZ1B 3EOBB 4MNQB 4NS0A 3FN0H 3AG2B 3EO9L 4ODHH 4CL7A 4JFHD 3VXSA 1BF8A 4P9HL 1I1CA 1QMUA 3FCTA 3GMLB 3C5ZC 5L6YH 2BVOA 4WGVB 3CFKA 4NQQA 2CKBA 5GZOD 2EVFA 4JAMA 4MBOA 3EYOB 3IMVA 1NC4A 2YQ2A 3MC0A 3DHMA 4N5EC 2IPKA 4U4IA 2NT0A 3U2SB 3UTPE 2AJ3A 5KYWA 1RJZB 1J8RA 1KB5H 1WBYA 2FUQA 4K8RC 3FQ4A 3QI9A 4D8PB 3SZKC 1U8JB 5CCGE 3ULAB 3TBTB 4JHAH 4MBRA 1ZT1B 1KCKA 1ZWIA 4FJYA 4NXSA 4DVBB 3SPGA 1J05B 4RRPA 4KI5F 2VLKD 3TA3C 2D0GA 4R7XA 2W88A 1GZQA 3K4DA 1OIOA 3ARWA 1FG2B 4YDNA 2GK2A 4FCHA 4XNXL 3W82A 1ILSA 1CXIA 2WXFA 4G2AA 3PHOB 4NO5A 5I1DB 4EDWL 4JFPB 4IDJL 1WIPA 5JUEL 3V7AE 3TASA 1CGYA 1FYTA 4I48A 4DOHE 4CVZB 5I17A 1GYAA 2MTPA 5ENWB 4WUKL 3U9PH 4M1GL 5K93A 1OP5K 4U6XB 3UTSB 4DQOH 4HUUB 5F7EH 3KBEA 4DZ8B 5IOPA 5MENA 4DKFH 4LVOB 1GL4B 3CXFA 4KDVA 4F7PB 1ZE3C 4JRXB 2CXGA 1SXNA 4PJDF 1AHWB 1UD5A 1Y18A 1S9VB 3MI6A 1E8XA 1U6AL 2PTVA 1UOVA 4MNHB 2YBRB 1UD3A 2RQEA 4LHUA 4E2OA 3BI9X 2I07A 5I18H 5DD6A 3CFDB 1UXSB 5CILH 2YGOA 1Z9SB 3L9EA 3GSXA 3TIDB 1AGEB 1HOEA 4OM1H 3IDXH 1FZKB 1QW8A 5EU7E 3JTTA 5ID0B 5A2AA 4C57C 4HPHA 1J1OL 3HPJB 4F9LA 3S36X 1W72A 3BPCB 3BT0A 2VMFA 3KGTA 2FZ3B 1PKQA 3ZE1B 3O6ML 4H8WH 4K3JL 5JHDE 3U4EB 4OKDA 3D05A 1BVKB 1Z3GL 4BWUA 4DP6X 2Z92B 1U3NA 4PJEE 4IRZL 2FHBA 5I66B 3H4HA 2OTUB 4KGLA 5D2LE 2HXAA 2JJTA 5EBLB 1ZHLA 1LXMA 4LQFL 1M56B 4QD2E 4WU7B 3OMIB 2LU5A 2EUZA 4QF1B 2GJ6E 4U6VH 1MRFH 3FH8A 1SXSA 4HPYL 4DP1X 3IDNB 5E7FA 4ZTPH 4Z7UB 1KIQA 5EMYA 2DD8L 3WHXB 5EU4A 3CFBA 3CAFA 4Q9RL 4O00A 1IAOB 4LCCB 2NY3B 5F9JA 1CL7H 1HXKA 3QZWB 4AYFB 1FCGA 2NY5C 2WGNB 2GJZA 4LP8A 3WFDH 4BQ6A 1KB5A 4MAYA 2I24N 4YDLB 4TVPD 3NFNA 1N5AB 3L5XL 2FLBT 5C0GB 2VLMD 5CIPB 4C4KT 2CJSA 2GUOA 3D08A 3ETBJ 3PU7A 3CSFA 1U92B 3T2NL 1AQKL 3DO7A 4PN6A 2E9IA 4MXWH 1RQ5A 4Z3GA 1XR8B 3K2UL 1GAFH 4Q14A 5JHLH 3QEGH 3BESR 3FB6B 5D5ME 4L9LA 5CF3A 3GBNH 4HOZA 1DANU 3K8MA 4X4XA 4A2HA 2BH0A 1NOLA 3V6ZA 2J5WA 1F58L 2H0JA 1TMQA 2O5XH 3BH4A 3L5WB 2BOLA 5EPMB 4ZFZB 1RU9L 1B4LA 5HDBF 1OVZA 5J57B 4ZXBB 2ZWZA 4TRPH 1I85A 5E08H 2ZUSA 2HN7A 3M17A 1HIMH 1B0RB 2HTLC 1KYAA 1RUPH 3C08H 2CDFA 5KS9A 4ES9A 4ADJA 4QKXB 3ZSTA 3IDYB 4QXGL 4KI5C 3DVNA 1NFDF 1Z6JT 3MX0B 3QPXH 3MV9E 1N9PA 2WVVB 5C86A 4R7LA 4GKZA 4PJ8A 4Q2ZB 1UM4L 2WNGA 3EGDA 3ILPB 2VMCA 1MHEA 4NKOA 4TSCL 1LK3L 1MLBB 1S7RB 5DR5H 4V1DA 3OZ9L 1C1EL 4MA8H 2CLRB 4U1LB 1OF0A 1BXVA 5F7KC 1NBYB 1T21A 2WCGA 2H8PB 4CA4A 4ZD3H 5HHXH 4Y9GA 3F00A 4IIQA 4ETYA 3MCG1 3CDCA 5C1MB 4OFQA 1R4XA 3P9LB 3UTZA 5IHWA 3ME0A 5CBEB 4CBZA 1QX1A 5IW1A 1G9EA 1IGIL 3ARQA 2GHZA 4O02H 1V55B 2YAHA 4HHAA 4YBQD 1U58B 3IU4H 4YK4C 4BDVA 5IJBC 1AGBB 4CMHB 4Q9QH 1M71A 2P8PA 4HZLB 5DEJA 1P4BL 3FC8A 1ESOA 3BAWA 3OGOE 4B60A 1GYVA 5I6LA 1R3IH 3KWXA 3ZZQA 3BP6A 5JZ7D 5KZCD 5E03A 4N9OB 3NRPA 2O93L 4X7FC 3E8VA 3GC3A 5FOJA 3LB6D 4HAFA 4LDOB 4JW3A 1CXHA 3UZVB 3V8CA 3WS3A 3DX3A 5IT2L 5FFLA 5FUOL 5L2JB 3PJSB 4GAYB 5L8JB 3MDJA 3VXPA 4YHYC 4JMXA 3F7RA 1AO7A 4JN2A 1D9KB 2V2TA 3FPXA 3QXVA 3OJDB 2JI1A 2HWZL 2V3FA 4MCMA 1PW3A 3QB7C 4FXTA 4Y9CA 3LKQB 3ZT6A 3U36A 4DTGH 5FYJU 4ENED 1P7HL 2P5WD 4ONGH 4ZFQA 3SYCA 2ITEA 3EDEA 4AM0Q 2IADA 1O9ZA 4G1MB 4CSPA 2B1OA 3WNPA 3EUDA 3L3JA 1HHHB 3ARRA 2F8XC 4GQZA 3JVGC 1S46A 3P4MA 3NRQA 4GKNA 1UQSB 2CA3A 2XNAA 4OQTH 4AZ8A 2UX7A 2Z31A 4OZHF 2VDNB 1D5BB 3QDMB 4L3ED 4S10A 4KUCD 3VD1A 5BV7H 2MQ0A 5JHLA 2DYPB 4D3CH 2YXFA 1W80A 1TVHB 3KZ8A 1OARL 4M03A 5J8OA 2P42B 4KTDL 4XWOC 1XSJA 4LOFA 4P46A 1DJXA 3K71B 3HUJB 1XIWB 3UYRH 3QUXB 1X5KA 2BSRB 1GHFL 1XH3B 2DQUH 2PWGA 3Q6GL 4LNRB 4N8UA 4OLWH 2FL5A 1D5MA 4PJ5D 5D7LD 3HN5A 4OU3A 4AEIL 3ULUL 2OP4L 3ARBA 4PRIE 4OGXL 1Q0YH 4DERA 2I60L 3ZE0B 3QQDB 4JQIL 4NFCA 5C09B 3H9SA 4JFEE 3PHQA 1HQ4A 1OD9A 1JPEA 3NCMA 4HJSA 3VFUA 3MGTB 4HWZA 5G55A 4UT9A 5CEZD 1DJYA 3KPPB 4YLQT 1HQRA 3L8QA 3DXAD 3PFQA 4MZIA 3WFEL 2QSTA 4HF5H 1IEHA 2L7EA 1G4RA 2DLHA 5GGQH 4S1RH 1WRFA 2F08A 2GK0A 5C0CD 2VDOB 2UYLB 2XIIA 3QHFH 2YRZA 5IB1A 4Z0BH 2DWEB 1RLWA 1YEJH 3KLQA 1KIRA 1SN2A 4RGMB 3GDCA 4HOWA 3IMRA 4JFZL 4HLZG 1AQDB 3T8MA 3RUGB 4I85A 3KXFD 4JKLA 1EJFA 1WC7B 4WSJA 3ZKQD 3FUKA 4UTAL 2ADFL 4XCNB 2DQFA 5A40E 2EVJA 4PCSA 4KTGA 3TCTA 4A68A 1A4KB 2ZYHA 3BKYL 1QWNA 1FV1A 1YDPB 1PQZB 1T04A 5D1QA 4Z7WA 5GZOC 3MHZA 4AXWB 1EERB 1RERA 2A74A 4YGVB 2O6CA 1RZGB 2VR4A 3ETBF 1IGFL 3QEQD 1MAMH 1MIMH 1QQDB 4HMEA 4TVSa 4LHQB 4JPWH 4J3TA 3HC2A 2VN7A 3C9NB 4YFDB 4CC1A 5CUSL 4LSRH 9CGTA 1QO3B 2A9BA 2ILLA 2EUVA 1BVNP 5DC9B 1R24B 2M1KA 4YGAB 1A4AA 2I7SA 4X50A 1ZIBA 4LSPH 1I9JL 4XBGA 1GS6X 5C0DB 3NJGA 3L7EA 2DLEA 1E9QB 5BXFB 1T4KA 1HAWA 3WEXB 2VSMB 5FUCE 2EEAA 1VEMA 3ECWA 1PLGL 3IJEA 1VFUA 4QJ5B 3W5NA 3ZDYE 3FT1A 3DSNA 1JN6B 2ALAA 2QKIC 2DQGL 3I3EA 5GZND 4Y4FD 3I2CH 4K3EH 4Z7VA 4FFYH 3GSQA 5FYKD 2UXVA 4PVBA 1T1ZB 4HJJL 3BE1H 1DEEB 4N90E 3UAJA 2JELL 1SMDA 3S37H 3FFCE 1E3XA 3MRCA 4A37A 4LLMA 3RI5K 3FQNA 4O58L 2D7NA 2XX1A 3G6DL 3OB0K 3V6FB 5JYMA 5KBNC 3OKKA 4EOWL 4LCYB 3U1SL 4D2NA 3RWEB 1MH5A 1I7UB 3DI2B 3JWOL 2BWDA 5I6PA 4BFIA 2JNZA 3RWFB 5I0XA 2WXGA 2DLGA 2C8NA 3VXRB 4UB0L 4R26L 2JWYA 1E42A 2ITDB 3RG1C 1IGCH 3UBXB 1UZGA 4I9XA 1A4JB 2B1AH 1I4FA 5EEUA 5CBAA 3BOVA 1XD1A 3K0WA 3AC0A 1PNCA 4AIXA 1S7WA 5TE7H 1NPJA 2BW5A 3KJ4C 3AS1A 1XXDC 3AG3B 3MFFB 2Y72A 2FO4A 4KJYB 1FFNB 2BSSB 4R7VA 2H3NA 1PZDA 2GY5A 2VDPL 4XP4H 4XR8C 3S3BB 4GH7B 4LHJB 3ZHKA 3RAJL 5GXBB 3VQ1C 4HWEL 5T1DL 3MRHB 1TETL 3H9ZA 2JE8A 3LQAL 3LXBA 4HHGA 2H47C 1YPZB 2WBKA 1KFGA 5AWNL 1MCOH 4JNXA 2BNRB 3NABH 4YDIH 4HS3B 2DS4A 4Q52A 4KJPD 1DN0A 2XN9A 2CGYA 2Z65C 2X4OB 4M3JA 3WDJA 1WHPA 4OIIL 4ZX5A 4JPVL 4FQ1H 4OKVA 3ROLA 3BQUC 3MRNA 2VUOA 4JRYD 3C87A 3B2PA 1QATA 1UGNA 3X12B 1UVQB 3I6KA 4G8AC 4MQXD 3DLQR 4KUZL 5HDQH 1BP3B 1HSAB 4Z9KB 3VTAA 4Q4IA 2IDSA 1HWGB 1KY6A 4K7PL 2AC0A 3LZFL 4MRCA 5E00B 2DEXX 4NN6C 3CDGB 4IU3A 4YR6A 2VXVH 2MCG1 2IG2L 2E75C 2VXTL 2ZXQA 4ZMLA 3DX4A 3IAGC 3SO3C 1HT6A 3HC4L 2HTKD 1JXDA 1HEJC 2RCSH 2D31A 3AB0C 4RGOL 5AW7B 1RK1B 3BPNC 4JQVC 5T3XD 5I6MA 1WSST 1CFBA 4AX3A 1XGRB 4GG6F 1BA9A 3HJ0A 4KWUA 3W1ZA 2E7CA 5E9DE 2W65A 3JVFC 3LNFA 5D4IA 1WUZA 3JBG7 2ZUWA 1K3ZA 3QCVH 4FFYA 3UYOD 3VXMA 2BVUA 1HESA 4YDKL 3I6LE 2GSMB 5GSRA 1PL3A 5DJZB 3KPMA 4ANUA 1SUHA 3SY6A 2CO7B 4HK3N 3UTPD 3C09B 4N2NA 4JO1L 1QNIA 2A9NH 3D8MA 1MAKA 1M42A 2QQLL 4GO8A 3MZGB 3FH5A 3CZNA 1R17A 3RNKA 4B9KC 2JJSA 2FBJL 1TJIL 1KGIA 4JREC 2AABL 5KYXB 5IVZA 4IOIB 3PQYE 4JO3L 3WFBL 5LGHL 2XT1B 4XBEH 5EWIL 3OXSB 4NB7A 3S98A 1I1AD 2WVTA 5L9DL 4L8BB 3NG5A 2AQRA 2VXUH 7FABH 5MEQA 3AAZA 5GRUH 1OPGL 5ISZB 1NL0H 2DQHH 1OCWH 2A77H 1KC5H 3UP1A 4JZJB 4TNWK 2J21A 1GR7A 1UKQA 3QCTL 3B2UD 3ZHFA 3ZY7A 1TSRA 3ZKXC 1D5IH 2BNQB 5FYJE 3THML 3K1DA 1A7PL 2Q3XA 5ANMB 1MFEL 2W0KA 4RBPH 3QW9A 4YBQC 1K4DB 1QSFE 1CE1L 1H6UA 2NTFA 5FCUH 2UZPA 3K6FA 5KW9L 3O0LA 4JLRA 4ALAH 2XV6B 1BVOA 1ED3B 4KPHL 4AV4A 1XCTB 1E4HA 3W9EA 4L3EA 4N2LA 3BRFA 4OJFH 4AW7A 5JZ7C 5HYQB 3N43B 1KB9K 5C0AE 2X87A 3AXHA 4B7IA 2XZZA 5DEGB 4QXUH 4NQEA 4AGQA 4FQHA 3QIUB 4LGSB 3NPZB 4NDMB 4OD1L 5L7XL 1B4TA 3TT3H 1ZTXE 2X6CA 5AW6B 2N01B 7PAZA 1ZANL 1T5WB 2E7HA 2BC4B 2NNAA 4EUPB 5IUSA 5LXGH 2V2XA 3BHBA 3WTTA 4LSVL 3HNVL 2FT6A 4Q6IC 5DRZB 1FGNH 5BRZE 1LP9E 3CH1A 3CX2A 3BW9A 1EZVX 2XY1A 1X7TA 3WS6A 4HHWA 2XWDA 2J44A 1NM9A 1XGQA 5B8CC 4QO1B 1HOCB 2NYYD 4NRYA 4DP9X 1A6VL 1NGYA 2R4RH 3EO1A 4QXTB 5C07B 1NUFA 2F15A 3IE9A 4UIKH 1VENA 3LZOA 1FCCA 3DRTB 4FFWD 2BIPA 2GIYA 3B8SA 3O4OB 2QELA 4JDEB 5AB1A 4JK0D 3CLWA 1QHOA 4OGZA 4YEEA 2W9EH 1WZ1L 5I24A 3R06A 1X44A 4E9RA 4DFIA 1ZHBB 5L88H 4DSYA 3MV8A 4P23B 3UABA 5JIMA 4KQ0A 3ETTA 3GD1C 1TU2A 2YPLB 2YEZB 4PHXA 3EJRA 2CSPA 5GS2D 4BSVA 1PEZA 2ZX9A 4I2XB 1H0DA 1MCPH 2CHWA 3AWEA 4NRZA 3O6LL 5HVHB 5BS0A 2YOCA 4L4VE 1U8IB 3ZKSD 5FO8B 4PJBF 2NCEA 1H3VA 3PJNA 4N86A 3HC0A 3TS8A 4WW1A 1S7UB 2YJLA 4JY4B 3UTQA 2EDRA 4Z5RA 4MJ6A 3SJVD 3LCYA 1EEYA 3D3VA 1M7IA 3IXAA 4YAQA 3L1OL 2NY5L 5KTEL 1ES0B 1KG0B 3EH2A 3L4CA 5TDOB 3MLUH 2EECA 1ZTMA 3SKUD 1OGAE 1ZAGA 3MRLA 4PJDE 1Z9PA 2ZONA 5DS1A 3GK8H 3F6IA 1GTNA 1DBJH 3MLZH 4PCTA 5F7YC 4GG8A 3ARGA 4NO3A 1KGYE 4EAEA 2PYFA 2XZQH 4K94C 3TBVA 3GSWB 1URZA 2ZKMX 4OV5A 4WFGE 4NIKB 3UJIL 4L3AA 3X3GL 3Q05A 3U0WL 4QGTA 3Q1SL 1A1OA 1PY9A 3IU3A 4BINA 3OL2A 3RU8H 2APXA 4Y16C 1X9RA 2ESVA 2L4OA 1QA9B 5DD5L 3C5SA 1R3HA 1ADQL 3EHBB 4YDJB 1OF2A 4IGBB 4IRSA 3ROOA 4EIBA 2VQ1A 3OMNB 4OLXL 5JIDA 5FYLE 2ZUQC 4XMPH 3DUSB 1IX2A 3MUJA 4JN1H 4KKBC 5FM5O 3VFTB 5IBLD 3TZVA 35C8L 5K9KA 2G2PA 2NR6A 3G9AB 1MWAL 3ARFB 1Y6KR 4U7MA 4XP6L 4WO4B 4JPIB 1D7BA 3DIVA 4IMKC 5E6IB 1U2YA 2FGWH 2XY2A 3RIAF 1D5XA 5AKTA 3W0WD 4K7FB 4M1CD 1YMMB 5EZIH 2KT6A 4WK2B 4B3EA 1DVQA 3MUGA 1PJWA 4YO0A 3MLRH 5EU6A 3MUHL 3SDXF 3BUBA 4ELMA 5GGRB 3IFPA 3OR6A 2X40A 2ZWYA 3F83A 5CFHA 3TJHC 2ITCB 4Y4FC 3ENEA 1SOQA 4Q74A 2NY0C 1FAIH 3HRZB 3TJEL 1NDTA 2AQ2A 1U36A 3GDBA 5IVXB 1AJ7L 1MHPL 2VM4A 3D0VB 3U9PL 2NY4D 4ODSL 5DVMA 2R0WH 2UZYA 4HWBH 2ED7A 1BJ8A 3MRMB 4DQOL 5F7EL 3HG1B 1E5ZA 2HG5A 3ZMNA 3LYRA 4FLSA 3CSBA 3MV7A 4WEEA 1NCNA 3LPOA 2YPVL 2V37A 1Q4NX 2CAKA 5HDBE 2HVBA 3T0EA 4HMDA 5DK2A 3V55A 3BFOA 5I6OA 3K2IA 3HMXL 1OAYL 2O5YL 1GC1H 4ZFOL 5FKPB 2CHZA 4EIUA 5J06A 4FNPA 3WN5B 2X3CA 1E8WA 4KC3B 4CC0A 3KS0H 4PBWD 1SQ2N 32C2A 3QJRB 2FLRT 1V7NL 1BAFH 1NCWL 1SJEB 3BPLB 5E1AB 3GM8A 4ZFFB 4U1MA 1NFDE 4AYGA 5KYYB 3VA6A 3TEUA 4ZTOH 1CO1A 3A21A 2L7UA 1AGDA 1FWXA 3IGFA 1QFWH 3T2PA 3CU1A 1MJ8L 4H8WL 4YSSA 1XF1A 3WNLA 3L4XA 1IKNA 3OQ3B 2CMRH 4OLYH 2VNCA 1PF3A 4WUUA 3U1QA 1FFRA 2JKTM 3QUYB 3O6FB 5T1LA 1O5DT 2W8CA 4LVHC 4YHPA 5GS2H 3DV6B 3IVKB 4JR9H 1S9WA 4YVUA 3IAQA 1T83A 4G8GB 1HSBB 4PJAF 3CTTA 3WLBB 5EBWB 5D72H 3VI4B 3C6LB 3C75A 1S3KL 2VR8A 1I8MA 2MH4A 4GUPA 4AGNA 4MQXC 1ACXA 4H26A 4FA8A 1UATA 3UJJL 4FI8A 1GXEA 1PBYA 3QIWD 5G2NA 4PB0L 3H2QA 3MNZA 2C3WA 1JPGB 3N0AA 3OKMB 4ELKB 3FB8A 2WLNA 2ZWKA 3VFMA 5EEVA 2GBVA 3VU1A 4XP5H 4HV8B 2EDWA 4YSEA 3INUH 2WNXA 1G1OA 4DPAX 1CG9A 1UZ8B 4Z18A 1ZGLA 1OP9A 3HE7C 2HTKC 2ZWNA 3HLAB 3KHQA 3WO4B 1GAFL 2AAAA 3CVHB 1CBVH 4NNYA 3GRWA 3GBNL 4UAHA 3PPSA 4E42A 3TCLB 4U3HA 3QS3A 1XV8A 2O61B 4FYSA 1N18A 1JNLH 5F6HI 5E08L 2Y7QA 2BS9A 3DJSA 3J8F7 4OZHE 5A6IA 5AOIA 1KNOA 3D07A 4GLRH 3P3YA 5AAWA 3IWUA 4F57H 1N7MH 4OBRA 1IV8A 2Z0UA 6PAZA 1P2CA 3B5TA 4Y19B 2J5LC 2K45A 3LQMA 2VDRL 3O41B 2E7LC 4UYPA 3QPXL 4PR5B 3ARPA 3JWNG 3UYPB 1I8LA 3REVA 3STLA 3QUHA 1OAZH 3ALWA 4HGWB 4U49A 4XE0A 1RHHA 5DFVD 5I0ZA 3GMQB 4P4KA 3ML8A 4JBSA 4GAJH 5CLYA 1UJ3A 1I1AC 2WXLA 1F0LA 1QSEA 3P40A 4X5WA 3MACH 2NNFA 4RA3A 2EC8A 2WSKA 3I84A 2EZ0D 2CDGB 1DJZA 3EDFA 3VWKC 5EF1A 4O02L 3EJJX 1CDCA 4NQCB 1OB1B 4NQDE 5IMOA 5EO9B 5JHDA 1HKLH 5DVOA 4LSTL 2XTJC 4YN3A 4N90D 2QQNL 4PJEA 4WAFA 2AJVH 3L4ZA 5D2LA 3UO8B 2XXFA 2FUTA 5AFAA 2Z7UA 2NLJB 2Y1YA 2QJDA 5CSGA 2C34A 4O51A 4PJHE 4XBMA 3MU3A 2K4AA 1S4IA 4NYLA 3IJ8A 3MRBB 1XGTA 2GJ6A 3JUYA 1KGCE 5CLXA 1D2PA 1W8EA 3KYKL 2ZSWA 4L48A 5TPWH 2F53B 1KJ3H 1CR9H 4KO5A 1BECA 2OW6A 3HZ3A 2NCMA 3G9VA 5MERB 2FD6H 2FIKB 2W9LA 4DUXA 2D2CC 4DGWC 5E99H 3PLYA 1UACL 3C6EA 4P2RB 2D7MA 3B43A 3KPNB 4G43B 4JGUA 4R97C 3RL1B 4WHYH 2WXJA 3O3DB 2HLAB 1JP5A 1DLHA 1DQML 3HKFA 4OQTL 3KPSD 3FCSA 2YK1H 4HCRL 4KRPB 2JV6A 3RWHA 1PJ9A 4X6CF 4XZUB 1I7ZB 3FB5A 5GRZA 3MNMA 3CLFL 1BM7A 1OCCB 5JXAL 3TVMD 4XVTL 3TV3L 3HN3A 5FHAH 2GW5A 3RIKA 2FBOJ 1PFCA 2VDLH 1ZD6A 2ZKWA 3FUDA 4HKXB 3OC8A 4G42B 5JIIA 2DQUL 2R51A 3FCBA 1A6WL 1F6AB 3TONA 2X2HA 3T2QA 4DEPB 1IFHH 1GGTA 2VZ3A 3O8XC 2LU4A 4M4RA 5IB2A 1M2OA 5IVNA 1KXQE 1H6TA 1NUGA 2JIXD 2NDFA 3QO1A 2UX6A 2L04A 3MV9A 4M61B 3TX4A 2X4TA 3MBEA 1VF5C 4XNUH 4PGZA 2ID5A 2MWCA 3QJUB 4TVPL 1RJYA 4S1RL 3UPCA 4W9DC 2WANA 4JZOB 1HTYA 1JJUA 4L8DB 1OE2A 1HYRC 4EE2A 3HAEG 2LLGA 1YQVH 2YD4A 4XGZB 3WENA 2ZXEB 4FQLL 5AL8A 4XC3L 1N8OE 1TFPA 3E0GA 1F00I 5E9DD 3EYUL 2Y5QA 3VXNA 3W2DH 4PS4H 3NQKA 1Q9OB 4BFFA 4F7EB 1PX8A 2YXVA 4GXUM 4U6YA 4AI7A 1K5NB 3OGCA 4RCAA 3VGAB 3N50A 4Y5VB 2PCYA 1QLEB 3LY6A 1KIUA 4ONHA 4O5LH 5SWQB 4LDEB 4OD2A 3GPSA 1TTFA 4WWPA 1AD9A 2R2BB 4PTTB 4E68A 2B7DT 2D2OA 4GKSB 1MIML 4YQXH 5IBLC 1PG7W 2D7TL 3ZHLA 3QDJE 3PQYD 1UH2A 2WBJD 2I69A 3FQWB 3O4LE 3DROA 1IM9A 2BSED 2MTAA 4J28A 1A6ZA 4WWKB 3DJRA 3EGSA 4AIZB 3HG3A 2AI0L 3FU7A 3Q2WA 3GZKA 3FU8A 4O2FB 1X6LA 4PJ9A 4PJCB 1PEWA 1G94A 2R69H 5ABAA 3QR2A 4JO4L 4AJWA 1IEAB 5FYJD 5KN5A 3DDFA 3SDCB 3T3PB 5HHOE 1E4XL 1K4CA 2VW6A 3FU3A 3MQIA 2OK0H 3N41F 4XMTA 2DF3A 1VADA 1UTDA 4KAQL 4K3EL 1UOWA 1FPTH 4AGLA 3ESUF 2X9YA 4N0UE 5K1NA 3GMMB 5LJYH 4M8UA 6PCYA 1RULL 2XQ0A 1RZJC 5I71B 2AGJH 3HAEH 2PXYD 4TLSA 3BIAX 2IXQA 3GWJA 2XTLA 4KXAA 2NY4C 1ETJA 3S37L 4BQ9A 2YD3A 1TZOA 4XX5A 1THCA 3CPUA 1N8ZA 1OTSC 4WCYL 1F3DH 2BP8A 3D6GA 5LCVH 4GG6E 1L6PA 5IB3B 1EX0A 3VH8B 2B3IA 2JB5H 2ZOWA 3TFKD 3MRQB 4PRIA 5BRZD 4BCXA 2WQVA 3VXUE 2APTA 4LLVB 4JFEA 3KCPA 5EORL 5IV2B 2IAMD 2QGDA 5IFAH 3ORJA 4X7DC 4QKTA 1JWMA 3HG2A 2FSEB 2KKQA 3IJYB 3ZYJA 1G7PA 4EDXB 3MNVA 1JI1A 2X12A 4PI2A 4PTUB 5E5MA 1HCYA 2BY0A 4CU6A 2F68X 4L2YA 2Q8BL 2C9UA 1Z9LA 2FHFA 3CDYA 4FHKA 2FEDC 4E5XG 5D2NE 3GTTA 2TSBA 5EZOL 2WCPA 5BOZG 3QXDB 5FW8A 5BRQA 4K8RH 2K9UA 1X9LA 1OHQA 5I15H 2E74C 2QPSA 5E24E 4U2ZA 4YDIL 2IAAC 1TR7A 2HG0A 5BZDB 4OAWA 1T0OA 2XU9A 4ZSOB 2ARJB 2KS0A 4NUPA 3TBWA 4OJDH 4Z3IA 4FQXD 2N0MA 4XMVA 1JZ8A 4RAHA 1A64A 1DVTA 1OL0A 1QPXA 1IBBA 4JFFE 3IGUA 4KK6D 4M5TA 3T1FB 4GO6B 3H53A 3RPBA 3V9EA 5HDQL 4Y88A 3M7OA 1HHJB 2DI7A 4DK5A 5EU3B 5CEZL 2PTTA 3NN8B 4Y2DA 1BVNT 3QIWC 4RDQF 4MZ2A 3TPUA 1DR9A 3QORD 2OMYB 5D8JH 2VXVL 4DP0X 4K94L 4G3YH 5E0QA 1WGOA 2OYLA 4WFGD 2YUZA 2H32H 5LBGA 3U0PB 5E23A 2APBA 4AQ1B 2WUBH 4OCMC 4OCLC 1L9RA 2R69A 2D73A 2YA2A 4JPKL 3TWYA 1A6AA 4FNSA 5DJDB 1N3NB 4I18C 1IC7L 5CJBA 4EBQH 1SRDA 1EQWA 1VPOL 1ZT4A 4FTVD 1ZLSH 3SGDH 1T1XA 4XBPA 3HPLB 2E5EA 2VMDA 3O2WL 3QQ9D 4B41A 1EHLH 2GTZA 3BGMA 3O9WB 3S96A 2RHEA 1G7JB 1VFMA 3O2DH 3HAEA 1MCSA 1TDQA 3NTCH 3FFCA 5JO5A 4P3CH 4F8TA 5LAXA 2VR9A 4MNGB 1C12B 1WIUA 1UENA 1Z1WA 2ZIDA 8CGTA 4FXGC 4TLUA 5F21B 2A9NL 2CJUL 3FUHA 3V2AR 3L5IA 4RRPM 1KJVA 5GGVL 5LCVA 1NAKH 1I9EA 1CD9B 2Y69B 5L0QB 2UY7B 2HX9A 3NIFF 5D1XA 1A1NB 4XXWA 4PJBE 4ZQKB 1OAKH 3NP4A 3RVWD 2F54A 1TFHA 3DURA 4KJQC 4MJIB 7TAAA 3OKEA 4MS6A 5GRUL 5FUCC 1LK2B 2DQHL 3B5GA 3EOAB 3GHBL 3GKWH 3KH3A 1IILE 1XAKA 4JVWA 4L3CA 5DGQA 3AM8A 4GP5B 1F3JA 1CFQA 1ONQA 2ED9A 3GNMH 1D5IL 1GA2A 2XACC 1XF5B 3CGTA 2IBZX 4TXVB 4YHLL 4LAQH 3ZHDA 4GXFA 2X4RB 3PGDA 3CFQA 5IFJA 1E7UA 3UG5A 1K5WA 2DIAA 1KJ2H 5FYKL 5LAPA 2C9SA 3IEAA 4ALAL 3EFOB 4N2DA 4CVUA 2KL6A 2F74A 3HZKA 2MCAA 2ZOKB 3BJLA 4N0FB 2NXZD 1COBA 2QPEB 1VZGA 4KKLD 1MI5B 4G9FA 2OW7A 3FRPB 1ZTXH 4QTHA 4QXUL 4D9LL 1J10A 5HGDB 2X2IA 2YLKA 3GBMH 4MJ2A 2OQJB 5LXGL 2PW1A 4OZGF 5GGUB 3EJQA 5BJTB 4MJJA 3SGEH 1AVAA 1FFQA 1KLGA 1TVBB 5DHYB 5L2KA 4OTXH 4TUOA 3QCUH 2WIIA 4OCWH 2ZJSH 4JY6A 2IMNA 2P1YA 4FI7A 4ODTL 4W9HC 3LNIA 4Z0XA 5D6DA 3TURA 3MJ8B 5I8OH 4G6MH 1FZMA 3CDFA 5INCB 1S7XB 2W9EL 3QUZD 1KN2L 4HEME 2ICES 1QTYT 3VFRA 5L88L 2XV3A 4F7MA 3L3DB 4FMFA 3U30C 2Q1EA 3W39A 7PCYA 1E7VA 1BPVA 1AQMA 5KJ7E 1H15B 5GHWL 4B3VA 4LCUB 5IKCB 4JFOA 2NRDA 4PB9L 3VXOA 4LRIA 1GZPB 3L54A 3I02A 3LKNB 1Z9MA 2R56H 1MCPL 5D70L 2ICEB 2VL5B 3CHQA 1R3JA 4YE4L 3QXUA 1TJHH 4E5XA 5EOCH 2BZCA 3FFDB 1FG9C 5AYUL 5FM8A 2OI9B 5FA3A 4Z3TA 1AMYA 5HVFB 2VN5A 3O2DA 1ORSA 3F7YB 3H8NA 5HHPB 2W0PA 3EH3B 4AQ8C 2ZCKH 3FTGB 2AKRA 3RFZA 4OLUH 3RVTD 2J6EA 2AXFA 2ZUVA 5TD4A 3H7BB 2VIRA 4F9PC 1R46A 3UIZA 1VEPA 1ORQA 4K4KA 4Y5XA 3CFMA 4FYQA 5BW7A 2O5NA 3OAWA 1DBJL 3MLZL 1GSMA 4QTIH 3FU5A 4DP5X 1MDTA 4TV3A 5DEFA 1T03H 1MRCH 4HMCA 2PP9A 2O6DA 1MJJB 3X1GA 1SVCP 2V7HA 4U2YA 4AG4H 25C8H 1CICA 3MRDA 2OZ4L 5T3XL 1CGUA 3M6DA 3JXAA 2DIEA 1P1ZA 2XA8H 3MRGB 4FQCH 4U3CA 5E8PA 1BW8A 1AS8A 4X0NA 1LNUB 3DV4A 1QSFA 3CLEL 1YY8A 3EJYC 1J8HE 4UDUA 4KO6A 1HNGA 4ZW5A 3RTLA 4X4ZA 2NY3D 2YA0A 3T0WA 1KJ2A 2F9BT 3WJJC 5FYLH 4L4TB 4PCKA 3DVGB 4JGJA 2EDTA 5C0AA 4PJIB 3LEYH 4QRUA 5AALA 3STZA 1QNZH 1L7IL 1T5XA 1J5OH 2CXKA 3RNQA 4JN1L 5DYFA 1WFIA 2C3HA 3KPRB 1IGJB 2GG1A 3PNRB 5EUOF 3UROR 2W0FB 3ISWA 5LGJB 2IH8A 5FW7A 3QXWA 1M05A 2Y2WA 3RZCD 1JPST 2ADGB 4I1PA 4PJAE 2WBJC 1ECYA 3AREA 1DVUA 4YHIB 1U2HA 4GXVL 2Z93B 3T1WA 3GHEH 4MD5A 3AMKA 5G4NA 1YSOA 2CD0A 5BVPH 4QJ3B 3TBSB 3OB8A 1MOEA 4KHTL 4R0LB 3MMEA 5JW4N 5KSAB 1EXUA 2B0SH 1YJDC 3NIGF 4QRPA 4JPSA 5AOKA 2NNCA 2XKNB 2WGXA 4IBWA 3MYJA 1NCBH 3OHXA 2D3LA 1HEHC 4N2HA 5AG9A 1KMGA 5D1ZD 5TGBB 5DJAB 1NEZG 1V8HA 5SWSE 3CQQA 1TT6A 5GRYA 4JFUA 3RVUD 3PWJB 5AAMA 2MPAH 3IJHA 2IEPA 3K6NA 1UM5L 2PXYC 2BP0A 2R0WL 4HWBL 4WEBL 4XP1L 4E9WA 5IB4A 2P80D 3X3FH 1Q0XH 4NN7C 2WQWA 1JZEA 5FF6B 3RIAK 3VD3A 1E4KC 2G4EA 1JGEB 2NQDA 5DO8A 2FR4A 4PV8B 3RTQB 3QXAA 2BNUA 3K72A 4L4VA 2FX7L 5DWUH 2FEEL 3D39B 2X2YA 2C4FU 1CDYA 1BJMA 3II3A 2C7FA 4QI3A 1MVYA 1QWUA 4ERSL 2D3VA 1L9OA 1N59B 1RXLA 1UWGL 3I74A 2IAMC 3H3BC 5IBTH 2AMUA 5SWZB 1QRNB 4L8CB 1BAFL 2VXQH 4XHQA 3QYCA 3RWDB 1QBMH 1HINH 1OGAA 1YG9A 4NIYE 4PJDA 2GIXA 4I0PB 4P57A 5GS1B 5HYJD 1X7QB 1AHKA 4ZTOL 3BC9A 1AXSB 1BVZA 3IFNL 5EO1A 1HK6A 2V5TA 1SHSA 1EEUA 1VCAA 1CDJA 4JQXC 3RQ3A 5E4AA 4I7ZC 1TLMA 4HBQA 2B5IC 3P3TA 3RY5A 4PGEB 4R2GB 1U8PA 3DNKA 3BFWA 4FFTA 3RL2B 1BQRA 4EI5B 3QFJE 3TO2A 3V4VL 1Q9KA 1CQYA 4JR9L 2GTWA 4BQBA 1XTLA 2XETA 5I2IA 3VFOB 1E4WH 5DO2D 1RUKL 3Q06A 2DLTA 4NQXA 1EAJA 4NPYA 2WXOA 3SYAA 4FQXC 3QRGH 1WA2X 4FABH 2A73A 2E59A 4KK6C 1HYSD 2EDOA 3FONA 4GSRA 4N87A 4P9ML 3CSYB 2O1AA 5LWYL 4WFHE 3KNBA 4K5NA 3P2BA 3WELA 3E38A 2VSKB 3AUVA 3Q2VA 4AQOA 2AEOA 5DFWH 3D18B 2J43A 3AFLA 3MO1A 1TTUA 2JI2A 3BD3A 3G04A 1AI1L 1XIWD 3QUXD 1OAXH 3ZE1F 5SX4I 3POHA 3QNXB 2EIKB 5E0FA 5DQDH 1YZZA 2WZ0A 5EBMA 3ZT5A 2IVFC 1QOKA 3C5JA 3PHSA 1CBVL 4ODWB 3ZMEA 2JQMA 2OSWA 3BP5B 2VTFA 2WLIA 4PSRA 3MLPA 3L3IA 4PW4A 3TWCH 1RZ7L 3EFFB 5A7BA 1DUYA 3O45A 4Q89A 2IH3A 3VRLE 4R5VA 1P7QB 2O5ZL 1NUNB 4W6YB 5DUML 4KO7A 4U1SB 2J72A 3FO1B 3DX6A 3OAUH 4JANA 3ZXAC 2K7QA 4CILA 4Z7UF 5CLZA 5IZ7A 2QQKL 2X4QB 4DKEL 3MLTB 3O4LD 2Y36H 2WTRA 4NOBA 3NSJA 1RK0B 4UTBL 2IANE