1KN4H

Catalytic antibody d2.3 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG ANTIBODY D2.3 (LIGHT CHAIN)
publication title Remarkable remote chiral recognition in a reaction mediated by a catalytic antibody.
pubmed doi rcsb
total genus 42
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4H02
4GT7A 1J05B 2UWEF 5J11C 4GBXB 1QSFE 1BECA 5DRZA 4KMQA 5C09B 5IB1B 1TVBB 3SKUD 3V52L 2BVOB 5C6WH 4C56A 5C0AB 4APQB 1NBZA 1S7QB 3GSXB 4OZIA 4KVCH 2EDEA 3RA7H 5IVZB 2V2TB 3BIKA 4LLMA 4ZAKA 4JFFD 2VR5A 5GQBA 5JOFA 4XHJD 4KTDL 1KJ2L 4CJ1A 1MUJA 5I66B 1D5XB 4PGJA 4P4KB 4K94L 3I6GB 3KGRA 1KJMB 1GPOH 2P24B 1T83C 3PP3K 4IIQA 3CFJB 4XCYA 2NNAA 5SX4H 3D85B 3RDTD 2OMBA 2BOBB 5D4QA 2LU4A 3P9LA 4P2RE 3GHEL 5I1JH 3P4NA 5C07E 1FG2A 1RIVL 4O58H 4LHUA 3ZDZF 4XMKL 1OTTC 3B6SB 4G80B 3MYJA 5E95B 3U79A 4M61B 2DKSA 4P5KA 3DVGB 4OZ4A 3O8XB 5F96L 2BCKB 3C2AH 4PUBL 3S3SA 1TNMA 1R5IA 5CEXA 3KYNA 1C1EH 3SDAC 1FLTX 3E8UH 4NZJA 2X1QA 5JOPD 3V6ZB 4XH2B 5I1IL 4NWTH 4OM1H 5E2TH 4Z7QE 1A7OH 2H6PB 4WGWB 4N8VA 2W0FB 5T1DL 1TNNA 1M6OB 2FSEA 1A1MA 4JE4B 3W2DH 1UH3A 3D0VA 5AYUL 5HI3C 3GSVB 3HMXL 1XF3A 1U8KB 5C09E 4MVBC 3AY4A 1S7XA 1FC1A 1LE5A 3OJDA 4JB9H 5C0AE 1BQSA 1QQDA 4G8GD 3KPNA 4FQ1H 3LIZH 5E8EA 2PTTB 1UXWB 2NYYD 4TSAH 2PR4H 3OXRA 2Y06L 2YN3A 3N0PB 4NKDB 1FNFA 2FO4A 4QTHA 1DUYA 3BP7B 2FGWL 1XIWD 4GRWH 1NC2A 5DVLA 1DZBA 4NRXB 3NVQA 1MWAH 3D69B 1GXEA 3IJYA 1IAOB 4X7EC 1K2DB 4EI6A 1HH9A 2HRPH 4A6YB 1ZKAA 3PV6A 2QKIA 1D9KA 5E1HB 3MZTA 4U1NB 1OSZB 5DFWH 4DN4H 1R5VA 1RD6A 2WLYA 4G3YH 3MCG1 2Q20A 2Y72A 1RUKL 4POZD 1T22B 2DF3A 1REIA 4TNVK 4LOUC 5DJ2B 5CILL 3IU4H 3BMWA 3HZYB 1E4JA 1NJ9B 4PYGA 5ALBH 3WN5B 2NCMA 1ZHNB 3VMNA 2RCSL 4KVNH 4Q97A 1MRDL 4G9FE 4NJ9L 4XAKD 4PJCA 1CZ8H 5JW4N 4LSSL 4X9HA 5GRJH 2VZUA 4OD2B 5JXAL 2M2DA 4OTXH 4IMLB 4UDTB 4LSTL 4HS3B 4NNPH 4PV9B 3OTTA 4MJ4A 1OPGH 5A16B 1ZHKA 1FH5H 2CO7B 5C2BH 1HH6B 5BS0B 4HPYL 4XX1E 3BGAA 4NNXB 3VH8G 3ILPB 3SO5A 2BDNH 2V17H 2IQ9H 5DS8A 4LCUA 4Y16B 1DLFL 3U4AA 2DMCA 2W60A 3MUHL 2Y36H 1KB5A 1WZ1H 3HI5L 4JN1L 5JXED 4UMGA 5D2LF 3VXRA 5HSFA 3V0AC 2DJSA 5C71A 1MFNA 3VDBA 4D0BB 1YMHB 4P9ML 5JW4M 4YJZL 5DQ9B 1LEKA 5JO5B 4NQCD 4YDIH 5ITFA 2AXFB 4Y8AA 5HDBE 4IOSD 1TZHB 4AQ1B 3KPPB 2AV1B 1LE9A 2Z92A 1F90H 2H41A 2DAVA 1EVTC 2DICA 3QCUH 1JHLH 2KBGA 5IQ7L 1Q0XL 5SV3A 1U8IB 2DQEL 1P6FA 3WIHH 4C4KT 2AQ2A 2CIKA 4M6OL 1G7LB 5C0RL 1RJLB 4KJWD 4R96A 3L5JA 1WC7A 5C0GA 4MQTB 1P6AB 1I1FB 1I1AB 1KEGH 3ARZA 3RWCA 4MAUL 1QVOB 1WBXA 1BFOA 4KRMB 4KQ4L 3VRLF 4XVSL 1F3JA 5A43C 1MAJA 3NCMA 4XPGL 3JWDL 5KVEL 5IR1B 1J8HD 4X4YA 2RB8A 2ZKHH 3RPKA 2PXYB 5DK3A 2EDNA 4WDIA 5D8JH 5AD0B 1U92B 5BS0E 1WWCA 3PWUA 2W07A 5F72S 2OZ4A 3ZKXC 1OAQL 1KT2A 3CVHH 4WFFE 3VRJB 3QR2A 3N1MC 2VXSL 2C26A 3NH7H 5MERA 5LVEA 1FVEA 5E9DA 3IDXH 5KSUB 1FCGA 2QSCH 3CFBB 5HHMB 5KW9H 4MYWB 3SKNB 5DO2D 1B88A 4L4TB 4OCSL 3IDGA 4Z7VF 4PRPB 1CFSA 5F8QC 1MLBB 4PJ8D 4U0RC 1CLCA 3CSBA 3UTZA 1LDPH 3PIQA 4YWGH 1IE5A 3PDDA 1E6JL 1SYVB 2IAMD 2QJDA 3QG6A 3O6KL 1L9MA 1X5KA 4G6JL 3NGBB 2IFFH 4HGWB 4MAYD 4Z0BH 2Z8SA 3AVEA 1NAML 4QRUA 1A5FL 5MENA 1L9NA 1M7XA 2LTQC 1QPXA 3REWB 5D5MA 2GJZA 3A0OA 4QF1B 5ICXB 3ZL4L 2ESVD 1UGNA 2WWMC 5H37H 2XACC 4BUGA 1I8LC 4AENB 4X6CB 1NLBL 3SOBH 2W0KA 4WHDA 4L5FL 1FV1A 4NQDA 2H8PB 3WL9A 1A6ZB 4N8VG 1A6WL 1I7ZB 3BD4A 3FB7A 5EIIB 4HS8H 4TPRH 3V6FA 2AJZA 2E8ZA 3QJFB 4BK4A 5J8OA 3RVXC 1JL8A 5EU7C 1MFAH 1I7UB 3V7AG 3AB0C 4LU5H 4ZOAA 1WJ3A 4PR5B 1QG3A 1SEQH 4CU7A 2O5YL 1IJ9A 3IFLL 1D3CA 3FN9A 1BVLB 5ACZA 2EECA 1WTGT 4XCFH 3DUSA 3LQZB 2H26B 3WMSA 2ADIB 2GAZA 3UTQA 5HHME 2H32B 1AGEB 1S9VA 3VMOA 4D9RE 3QUYA 4MXWH 1T66C 3PL6D 3WIFA 2VTFA 5I15L 4KU1A 4NM4L 3HZMA 4PRPE 5KOMC 3KLHC 1OT1A 2JF1A 1KXTB 3L3OB 1N64H 4K8RL 2VAAA 1KPVB 3MRMB 5F1KC 4Z77A 2PUQT 5TQ0L 2FRGP 4IOIA 1KYOK 5B38B 1CICD 4NNYA 4UV4H 3L1OL 3VJ6B 4XPAL 1I7RB 3FT4B 1LO2H 2APFA 4JQVC 3NOIA 1DEEA 2N56A 4HKZB 2DWEA 1OP3K 3BHBA 4TUOA 4FQXA 4EBQH 1LEGB 3TA3B 4ELKA 1N5AB 1V8HA 4JCMA 1BGXH 1U42A 5EC2B 4KWUA 2X4PB 1ETZB 4X6CE 5HVGB 5CBEB 1YY8B 3T1FA 5CCKH 1ONQB 3OGOE 1Q9WB 4XP6H 2XYCA 3C09C 4YHOL 2W9EL 5C6TH 2M8XA 3HMWL 1MEXH 2VLKB 1I3RA 3DMMC 4MQXD 2OP4L 4DAGH 4KKAC 2Z31C 4NSKB 4OAWA 5H94B 2F54A 1RY7B 3PQYA 3ZLQC 3RY5A 3MJ7A 3RTQD 1IBGH 3H9SB 3GO1H 1CD1B 5D1QC 5GSRA 5D2NA 4HFUL 2GK0A 4M6NH 3C60B 4YO0B 2BERA 5SWSD 1J0JA 3K1KC 2WK2A 5DRXA 4ZTPL 2WBJC 2NX5B 1BD2D 1TTUA 1LNUB 3FJTA 4UT7L 4Q9RL 4NRZA 4Y5YC 4K3JL 4UILH 1NFDA 2E3VA 3SCMB 3MLRH 4YXLL 3AROA 4FABH 2N7BA 3SGJA 3FQWA 5TQ2H 4FQCH 3ZKMD 1MHPL 5MI0B 3RL2B 2K1MA 1K3ZA 3AS2A 2F5AH 1UEMA 4ZUWA 2HJLB 5GZND 5L2JB 1ZS8B 4L3EA 1WAAA 2XG5A 1AHWB 3TCXA 4DQOH 3T4YA 2B4CC 1DP0A 1I3GL 2D7QA 4UV7L 2OJZL 4N0FA 3QWRD 3L5WA 1OGTB 2VXVH 1OAXL 2V7HA 5FA3B 5JIHA 1V7MH 3O2VL 1AO7A 2EE9A 4JDTH 4NUGH 3WKMH 3N50A 5EOCH 5L6YL 4Z9KB 3WO4B 4OLUL 5DQDL 3JV5A 4D8PB 4J3WA 3U7YL 4QKXB 4P46B 4KJQC 5IQ9A 2VLKE 1UM6H 1S78D 3CFCH 3CJJA 4LCWA 2VDOH 2P7TB 5J13C 2XKNA 2XQYK 4WWID 1DDHA 3KAAA 1T21A 1NUGA 1SM3H 3H9SE 1I9IH 4A6YH 3E6FB 2WM0A 1MH5A 5TDOB 1KB5L 2E6QA 4XPBH 5IBLC 5HGDA 1AXTH 4Y4KA 5IMMB 1C08B 4PJBA 1MRFH 1NDGA 2NX5E 1AR1C 4R7NA 1MHHB 4DOHB 3MQIA 3LEVH 3LKRB 1D5ZA 1F3RB 4FQJL 4XAWL 1EO8H 3GKWL 5I76B 2F19L 3HUJB 1BP3B 1Q1JH 4D9QD 2JE8A 1L7IL 2AXGB 4I4WA 4JM2C 5JPNA 4XPTH 1U8LA 1T1WA 5IG7A 5F7EH 3GK8H 5I1EH 3ULVE 4OIAA 3MRPA 1JZ6A 2EZ0C 3GMMB 3QPQD 2SEBB 3EOYG 5DJZA 1GAFH 4XNZC 5LBSH 1E4WL 3TNNA 5EU3B 1RFDL 1WCQA 3BT2L 5AUMA 4WWKA 1WBYB 1CK0L 1G6RL 4KI5C 2O93L 3G9AB 4X7SH 1CIDA 2GJ6D 1HHJA 2NR6D 2DM2A 3QDGE 1M05A 1LP9B 2RR3A 2W92A 5CMAA 1JN6B 5H8DA 4EN3C 3BH9B 4PJXB 4UIMA 3L3GB 3X13B 2P8LB 1UWGH 3STZA 1JRHI 4QCIB 3OPZH 1HIMH 2B7DT 5AG9A 1HHIA 4CMHB 4HPOL 1MIEH 4HUMB 3T0EA 3EW3B 5IFAH 3IRZA 1IC4L 1OSPH 4PP1D 2NY3B 1WTLA 1W2KT 1JHTB 3P30L 3DNKA 1DBJL 4MSWA 3FT3A 4LSDA 4I77H 4BFIA 3K7UA 3B9EA 2EIBA 1M1SA 4K9EL 1INEL 4DOHE 5J6HB 4JVWA 5FM5M 1T4KB 3TN0A 4XPFH 2ZSVA 3MJ9A 2RAMA 3HUJE 3GHBH 4N0RA 3LN5A 3QXDA 5EPMB 4R3SB 2DQHL 5C0JA 3W82A 3B5GA 2VQTA 5F71A 3L9RA 2F74B 2QQKL 2ZG3A 3BPOB 3I6KA 3CZFA 1IQWL 4IRSC 1WZLA 4H5SB 5B39B 5IFJB 2OR8A 1N59B 2LVCA 3OKKB 4LDOB 5D1XB 5TJWK 2V5MA 1BZ7B 3NAAH 3IDJA 3SPVA 3B9KC 4OUUB 4U3XA 3PE9A 1W0WB 2DBLL 1GZPA 1I85A 3QWOA 5JIPA 4YE4H 4K55A 3FHQA 5GGTH 5IWLC 5JNYA 2JB6B 3ZMRA 3T0DA 2A9NH 3ULUF 4NQEA 3LKPA 1LP9E 3CFEA 3OAZH 3QDMD 3QDJD 4M48L 1JTTA 4PJXE 5D7LD 2J3SA 3VG0H 1T7WA 1GGCH 4RDQG 4MB4A 3GIVB 1DUZB 2VDPL 2BY3A 2PTUA 4UTAL 5ICYA 4YZFF 3QIUB 3MBEA 2DQJL 3WNKA 3UTSB 4TVPD 5I8CB 1QBBA 1ZVSA 4RMVA 5EO0B 1NDMB 3CDGA 3SGEI 4QHMB 3HE6D 4K7PX 4MLSA 2BVTA 4OGAD 4TTDC 3WFDH 1FNLA 2AEQL 4TULL 4JLRA 1JRHL 4YDJB 4FZEH 3I02A 4WNQB 3FB8A 5KVGH 2MNUA 4I2XB 4ZXBD 1T04B 3ISWA 1M7IB 2J4WH 5D72H 3KXFD 4P23B 1AFVH 3WYRA 3OB8A 3E3QC 4M1GL 2HH0H 2NLJB 5B3JF 3K4AA 3KPRD 5LCVH 4I13B 4YFLF 2A6KA 5IHLB 4H8WL 1PKOA 2EDTA 1GGIL 5DURD 3S4SA 5KTEL 1IGTA 1C16A 2C1OA 4H20H 4NHUB 4WW2C 5M95B 4NO5B 2F53A 2GJJA 1S7WA 2RIKA 3TJEH 2QR0B 3LKSB 4JVUA 4H1LB 1QUNA 3OR7B 3CC5B 4UUJA 1Y6MR 2R1WA 2VDKH 2YRZA 4QOKB 3FRUB 1JNLL 5IW6A 1G7JB 3FQRB 1DE4A 4XNYH 4FNLH 4GW4A 2YEZB 3QIWB 1MJ8H 3U1SH 4XMKH 1WSST 3VXMB 1NKRA 5EUOF 3C8DA 4GO6B 3U0PA 2EKSB 2H32H 1L0QA 5F96H 3GBML 1XH3A 4ELMF 2IALA 4MB5A 3D3VD 2GFBB 2XTJD 1PZ5B 4JG0H 5IJKA 3HRPA 5CEZD 1DEDA 4M6MH 1H8NA 3VXUB 2WUBH 2UZIL 5T1DH 3N06B 3TLRA 5I2IA 4LCYA 4P0DA 2X9WA 5FYJL 5HYJB 1S8DA 3MLXL 2HVJB 5CD3A 3OG4B 3ARGC 2YPKB 1OCWH 4I2XE 1J1XH 4U6HA 3IXTB 4PRBA 4R97B 3WFEL 1FFRA 3WJJC 1FVDB 1UCBL 4K7PL 3ARFA 4Z7NE 3RGHA 5JOEA 4K3DH 2XIDA 1H3WM 2AGJL 4FQLH 3OSKA 2FIRT 5DMIL 3TNMA 2DMBA 3MRHA 3L3DA 2YK1L 1EAPB 2NYYC 3WEXB 2A38A 5DK2B 5GS1C 4DK3A 3GMNB 2Y6SC 3IJHA 4U31A 4IRJB 2YD2A 3HR5B 1H9VA 3DX6B 1A3LH 3W9EA 1UA6L 2LAGB 2XNAB 1KIQB 4S1DD 4QOKE 4WW1B 1E28B 1XIWC 5SV4A 1ACYH 3VW3H 3RL1A 2FJHA 3KVQA 3K2UL 3VFUB 3H9ZA 3C87A 4L8CA 1QFUH 5CILH 2HMID 5DRNA 1A1NB 3HFMH 2QSVA 2J88L 2GT9B 4K3HA 3VXME 4AIXA 4GKZA 2P44B 4KZEL 4OZIF 3CNKA 3H42H 4Y2DB 5DFVD 4N0CD 1NBVH 4Q2ZA 2GITB 2WIMA 1OT2A 3D25B 5FDYA 4HBCL 1F00I 2IBBA 2YUXA 1ZT7A 4CU6A 2CLZB 3VXUE 2BNRD 3GRWH 1OM3H 3ULVH 4KJPD 5BRZD 2AVGA 3BAEL 5SX5H 2HFGH 25C8H 4RAUA 1G6RB 4QHLB 4HCRL 3HI5H 5HYJE 2VZTA 3RQ3A 2R0LL 1QLRA 3B5HA 3K1DA 1RUPL 4RFEA 4Y1AA 5GRZA 5JR1H 5E94A 1HYSC 1MCQA 5L9DH 2DQTL 2CRYA 3TH2T 4P9MH 5D93B 4ETQA 1MELA 2CGRL 4U6YA 5F7DB 5KSAB 3AS3A 4LKXA 3Q5YA 4NO0A 4Q6YA 1ZT1B 4NT6A 4OIIL 4L1DA 4NBYB 5DLMH 4EI5D 2ZPKL 2QQLL 3DX8B 1HINL 2DD8L 3C6LA 2BY1A 4XBGA 5C1MB 1TETL 4Y4FD 3MCKB 3SJVA 1YZZA 1RJYA 1T3FB 2DQEH 2OI9C 5ENWA 2B20A 3FQXA 4XBPB 4YBHA 4MZ2A 2AK4D 4NWUH 5CZXD 2BZDA 4WRLA 5AYQA 2X4RA 2FWOA 1UJ3B 1F02I 1NGYA 5DD1L 1AXIB 4XXCC 3RWIA 1UWEL 4JO2L 5HHOA 5AG8A 4OLWH 5DD6A 3U48A 4PJGB 5LGJA 5KVEH 2CKNA 2G5BA 2HYMA 4DVBA 4ZUSA 3RIAF 1NLDL 2DQDL 4KJWC 4BJLA 2FLRT 1CWVA 1QSEA 2ZCKH 1I9JH 2DIJA 3C5JB 5JQHC 5C0IB 1T0NB 2PCPB 4JDVA 3OKNB 3WLWD 3MNWB 5CGMA 3O6ML 4O02H 3D48R 4LPWA 3RWJA 5B3NA 4DKEH 1J0IA 4R7DB 4O4YH 2ZSWB 1FYTD 1A7PL 3MV8B 4N1EA 3MV11 5J0BA 4N90D 3QUMA 1T2XA 3U9PH 4DCQB 1VGKB 2ICWA 4JRXD 4KRNA 4PRIB 3CLFL 3GI8L 1SHMA 4R4FH 4HFWB 1MCEA 4RGMC 4PJCF 1E27B 2VE6B 4PG9A 5DO2C 1J8KA 3SGKC 1U91B 3DX9B 5TGBB 1CQYA 4ODVH 2ZUVA 2Q86A 4PJ8C 4PJAB 2OTUB 1K3IA 1A5FH 1HEZA 4YXHL 3S97C 2PO6D 5E8DH 3ARDA 2IAMC 5I1AA 4OCRH 1FAIL 3ZL4H 3O6FC 1ES0B 1NUDA 3VGDA 1YMMD 5FDWA 1NLBH 3DUUA 3GJFA 4MAYC 3MRIB 4PJGE 3CXHJ 1CXLA 4QRPB 3V6BR 1S7TB 2FB4L 3OR6A 1D5MA 4KJYB 5E24E 1AH1A 1T2QL 3GMRB 1QKZL 2DM4A 2ZCLL 2NTFA 3M17A 2HKFH 5D7KD 1MJUL 3MLZH 4Y8DC 4X5XA 5B4MD 2QQNH 5FYJU 1R0AL 3CMOL 1ODAA 4H25A 1GYAA 5ESVA 1JZ3A 4U1HA 4P4RB 3MV8E 3DRQA 2OR9L 3SDAB 2LAAA 4PY8J 4HV8A 2BSSA 1MCPL 2ITDB 3TC9A 3ZHKA 3MRJA 4PRIE 5BVJA 5CZVL 3TO2A 1MLCA 1KTKE 3R4DA 4LLVB 4R2GD 2MKLC 5EO9B 1UXSA 5IHUL 2PW2A 5L0QC 1JPTH 2I07B 1B0GB 4JFFA 1A9EB 5CUSL 1DQDL 1ZMYA 3MRLA 3VFOB 3PL6C 3HNVL 1QLFB 1YN6A 1UB5A 5J06A 3C8KB 2EDKA 3SKMB 1VESA 2YKLL 4PJAE 3IKCB 3HCVB 1WCBA 4GMTL 1ND0A 4JZJC 4N1CA 1S7VA 3X11B 2W65B 4L9DA 1B0RA 2IG2L 3RBSA 5FGBC 1D5BB 1CICC 3BQUC 4KPHH 3G04B 2GQHA 1Z2KA 4RISL 1F58L 3RDTA 2OM5A 1CXIA 3MUGB 2LVEA 1NQBA 1KN4L 2VLLB 4QRPE 3UJIL 5JMOC 3U9UB 4G6ML 1IL1A 4YDLB 1JGEA 4X6DA 5C0CB 4Y89A 2DI8A 2XFXA 3RNQB 5I16A 4WCYH 3EYOA 3PWJB 3VI4F 4H1LH 4YPGB 2A6JA 3KR3H 5FKAB 1IM9A 4H88H 4P5MB 4O9HH 4V2CB 3VFWB 1CL7I 1U3YA 4X6BA 2Z8VC 5D2LB 1OHQA 4ORZC 3RTQC 4PGEA 3C5ZB 1DQQB 4JFHE 5D5MF 4K3JH 5ANMA 1TTGA 3FB6A 3LZFL 3ZKQD 2C3GA 5HGGS 1MFBH 1P84J 3HA0A 4LSPL 3J7HA 3OKDB 1JPSL 3VXNA 3V4PH 5TE6H 3ECBA 1S7UA 4OCNC 4IJ3C 1LEIA 1YEIL 4ZSOA 4YHYC 2Y07L 2B4CL 5EBWA 3ARSA 4YGVA 4UOW1 2DQFB 5FYJE 4PGBB 5JHLL 4ALAL 3X12A 3FAWA 3QJHB 1IKFL 2EIEA 4D0DA 5KS9B 1R3HB 3ZKMC 2PYEA 2VUYA 5EZOL 2HJKB 1WBZA 4XXDB 4UNVA 4P2RD 1SEBA 3NFPA 1SMAA 4CRPA 5A2JH 5GZNC 1F11B 5B8CC 3JV4B 5C07D 5L6YH 3HN3A 3ULSA 3CSYB 4OLUH 3U7YH 5CWSB 1C5DA 1KLGB 4ETYA 4PREB 4JKPH 4KMTL 3MXVH 4YBQC 4HIJB 1FFOA 3D0LB 4IS6A 4WUUA 5DJ6B 2E7CA 3X17A 1ZGLB 5FHAL 3E1F1 1HCVA 3P0VH 4GBXD 1JGDB 5GGVH 1WWWX 1S78C 2P43B 5DMJB 4JJ5B 4WI7A 5C09D 2WP3T 1U3HD 5D2LE 3QNYA 2VZOA 4R90H 4MD5A 3P73A 4XNXL 5C0AD 2W9DH 3VXSA 4APQD 1UM4H 3RY4A 2QTEA 6FABH 5C9JA 3QRGL 1VACB 4ODXB 2ZG1A 1UZ6E 5JXEA 5E1AB 3HZVB 4P2QB 4HQQH 5J3HC 3D39B 1CL7L 3HRZA 12E8L 3NA9H 4ZUVA 4Y4HA 4JCLA 4K07A 4NQCA 4P4KD 1DBKL 4AEEA 5IIEA 2VZ1A 5I17A 3HB3C 1RMFL 3KYKL 2ARJB 2WQ8A 5FAAA 1CK0H 2E9WA 4U7KA 5KS9E 3EZ8A 1F2QA 1LD9B 1TTFA 4U0RB 5ALCL 1N8ZA 3Q0HA 4V2BA 3QPQC 3DX7A 4NZUH 5HHNB 4Q9QL 4LAQH 4FG6D 2WWKT 3WHXB 3MGAA 3MRFA 2BSTA 4U05A 2ZG2A 2NXYD 3HAEA 4QTIL 4P2OD 4L3CA 1CF8L 4DGIL 5J7CC 4WI9A 1NBYA 1C5BL 5GIRA 1NFDF 3VA6A 3O8XD 4PLJD 4TSCH 4G9FD 1VEOA 4HUUA 4HPOH 4R8WH 3IAQA 4QY8B 2G60H 1Q94B 2AXHA 5ESQA 2NR6C 2CDEB 4P3DA 2LTQB 4KROC 4LK4A 4U4BA 5I6XB 1IC4H 1RZ8A 3AM8A 2ATPA 4IRZH 2X4SB 4AG4L 3GMLA 4CVWA 5F1SA 3P30H 2P5EA 5JPMB 1AI1H 1CFNB 4XMPL 1G7IB 1WAAF 1CT8A 1YNKH 3MA7B 4UAOC 3SDXF 1X7QA 3GNML 3NN8B 3QUML 2YN5A 4GW5A 3W0WB 1I75A 5LG1A 3AMKA 5T33L 5HJ3B 4DKFL 3HC4H 3T0WA 1ORSA 3AB0B 3D39E 5IVNA 1XF4A 5CSGA 3ZO0A 1P2CB 4HX1A 4JO1H 2CKBA 3UTTB 4NHCH 4ZPTA 3KPOB 3UROR 2R23B 3THMH 1EXUB 5C8JB 1C7TA 5IMLB 2XTLA 4D0CB 3C2SA 3MJ8A 3GSOB 3LCYA 5E5RB 3RVVD 4HG4J 1PG7W 2EO9A 3LRSB 5TDNA 4E0RA 3SKJL 3DBXA 3ZDXE 3WBDA 2DBLH 1IQDB 5MEPA 3STBA 3I2CL 5LGHH 3REVA 4Z95L 1S9WA 2Q6WA 3TCLB 2FATH 2GSIA 1U8JA 4PJBF 5E5UB 4JFPA 1CGYA 3N1GC 3WXVL 2Y23A 3OKEA 3KYOB 4UTBH 5MP6L 1IC5H 1MY7A 2HP4A 5I75C 1N5YH 3BZFA 4MQ7A 2ESVA 1LILA 2C3HA 4O00A 1E4XI 2DQJH 4XRCB 2P5WD 1KTLA 3TIDA 1RU9L 1JGLH 4YHMH 3HKFA 1MVUB 1GIGL 4KZDH 1JRHH 1FL6A 2I24N 3DTXA 3DVNB 3DROA 5EA0L 5FOBA 3L5XL 4XT1C 2AAVA 4ZD3H 3W0WE 3UTPE 4LP5A 1P69B 4M1GH 2YA2A 3HE6C 4JRYB 3UZVB 4OGAC 3W39A 2GKIA 2VL5B 2HT3D 2X1XR 3QH3A 5D6DC 2GW5A 3OXSB 4ZXBC 5D1QB 4XZUA 3BPLC 3QPXL 1NBQA 2HRLA 3MREA 4XGZB 3UTTE 3ARBC 4G5ZL 4O51B 4MMXC 3C08L 2NY0C 2WBJB 5IMOA 5DJDA 5INCA 1NCNA 2FJFA 1JNLH 1SYSA 4Y5YB 1B4RA 4M5YH 3CUPA 3NZHH 1D7FA 3OG6B 3WJLC 4EVNB 5DQJA 1A6UL 4F3FA 2WW8A 2YBRA 5DUBA 4YR6B 5IB5B 1CFVH 1O5DT 4WFHE 5C70A 2L7JA 5E08H 4G8IA 3KNBA 2X10A 1CQKA 4L8SC 3QDAA 4WHTA 1AGFB 4KK8C 3S3PA 5L2KB 2PF6A 2ITCB 3NCBB 3VD4A 3F62A 1MQKL 4I0PD 4WHYH 1AJ7L 1J12A 1G7HB 3BDYH 5FYJH 2AJUL 4NGHL 5HHQB 2XTJC 4I48A 2Z4QA 1JJUA 4ZNEA 4M4PA 3T0BA 3VFMA 3EYUL 3I75B 2ADJA 3FRPG 1QBLH 1E4XL 2AV7B 4LLWB 3RTQA 3VDCA 2R1YA 5FECA 1PD6A 5HHMD 3GMOB 3VFSB 3PGDB 1UACL 5DMIH 5KSBB 5I18H 3IDMB 1L0XA 2P49B 3HNSL 1HHKA 4PRPD 1UWXK 1KACB 4JPWL 4U1KB 1AQKL 3VFRB 4YHLL 3IS0X 1F42A 4QGYA 1WFOA 3FOMB 2IF7A 2AKRB 2EH8L 5E00A 2ID5A 1UA6H 1UYWH 4LASL 4WI5A 1CDCA 5BXFB 1BQLH 3BGMB 5FCUL 3I84A 3EYQD 4F33A 4NN6C 4RBPH 4U6XA 3GIZL 1RHFA 1YYML 3OX8A 5DJ0B 8FABA 1MHEA 4CVZB 3V8OA 4W68A 5DJYB 4G6KL 4JM2B 4QEGA 2R2BB 2V7NB 1ZLWH 3RWFA 5DR5H 1Z0NA 2EDLA 4HXBL 5HYIA 3IDIB 4NRYA 3QHZL 3QEUB 4P57A 4S1DC 1J9CT 1PKQB 3ZT6A 3RX5A 3MOAH 3HZKA 3MJ6A 4YQXH 4KUCD 4HIIA 1N3NA 2VOTA 3DIFB 2HMIC 1GGTA 4I3GA 2DQCL 5L2KE 2OSLB 3GKZA 4MNGB 5D9SA 4W4OC 3BAEH 4M5ZH 1BQHA 1P4IH 5DFVC 5HY9B 2EH7L 3EO0A 1TCRB 4N0CC 3X3GL 4HCRH 3DVIA 3GSNL 4MA8H 1ROWA 4JQXC 4EN3B 2CLVA 3WUWA 3OHXB 5FYLE 5DMYA 1GVIA 4PV8A 4L8DA 4M7KL 3G5XA 1KG0B 3GMQA 2EYSB 4FA8A 1CXFA 4KJPC 1P7QD 2CGRH 3WFCL 3MLPA 4L8BB 1HXYB 4BSVB 1AKJA 4BQ8A 5F9JA 2JJUA 3TWCH 4OIIH 5KSBE 3KPQB 5HHVH 2ZPKH 4U1GB 2R0ZH 3UPCA 3GUTA 2DD8H 3ROLA 3VWJA 1D5IH 3EFDL 3D2UB 2KQNA 3DO7B 3F5WB 1MQ8A 1YECH 4G6FB 5JHDA 4RWYH 4J4PA 4OCWL 2R69L 3MV9A 2E9JA 3QUXD 4DZ8A 1QRNE 4EI5C 2J6EL 2M26A 1A3RH 4OFYD 5H2BA 4Y4FC 3WE6B 4HC1H 3IU3A 4X5WA 4TN9A 3FQUA 1GGUA 2X4NA 4IRSB 1N2RB 3HG1D 1E4KA 3FT2B 4HK3N 1YY9D 1FJ1B 5CZXC 2DQIH 1PKQE 4O2EB 3TYGL 3D87B 3VXOB 4NPYB 1I7TB 3B9KB 4FS0A 2HVKA 5CSZA 4HWZB 1KB9J 3ARQA 1A2YB 4KV5E 4KI5E 4MWFB 4MNGE 2AW2A 1DFBL 2MWCA 4EQ2A 2FGZA 3TBSB 4HJGA 3H9SD 3MNZA 1FBIH 4HKBB 4HIHA 4X99A 1A7PH 1WZMA 3EOAB 3WLWC 4RAVA 4MD0A 3VA2C 5B22A 2NX5D 1T0MA 1A7RH 3P9WB 4KY1L 3E6HB 2R8SL 3LKOB 2HN7B 4X8JB 2ARWA 4JPKL 2C3VA 2HFFB 4TNWF 3QUKA 2WV3A 3SCMD 2VRAA 2E7BA 2CUHA 3TPUB 1U95A 1GH7A 2Z93B 5GHWH 5CEYA 4JHAL 3A67L 1FRGH 3M1BA 1QBAA 2JB5H 5F9OH 1YJDC 1FNGA 3ULVD 1IEHA 3B4NA 4J23A 5GS2H 5INDB 4LQ1A 1CR9L 4AIZA 1MI5B 5IFHH 2J5LC 4JAMA 2APXA 2HT4C 1SVCP 4OLVL 2MQCA 1S3KL 1RURL 4JHWL 1KJVB 2E9BA 5FUCC 3BDBA 4XWGH 1A6TB 3TF7C 3HI6L 2FR4A 3CPLA 1X3DA 4L1HA 3MGOB 3QDGD 3ULUE 4WW2B 2DDQL 5EDXA 1PEZA 2FHCA 2IPTH 4HWNA 3FONA 2PO6C 4PRDB 1OAUH 1FO0L 2ZCHH 1DQML 3QDMA 5D7LA 5H35B 5I1LB 5ITBL 1MJUH 4ZFOA 4KFZC 4N8CL 2HJFA 1F8TH 3DV6A 4PJHB 4N9GB 3C5SA 3QZWB 3WSQL 4LLYB 3RUGA 3VGBA 4KK6C 3P2TA 4XCCH 4NKOB 1HSAB 4LGSB 3PXHA 4U1MA 2G5RA 2R4SH 3RHWK 2FBOJ 4ZS7L 3DI3B 2VABA 5GS0L 3V6OC 2V2WB 2KPNA 5B4MC 5KANI 3F7QA 43CAA 3K74B 5IHUH 3KXFA 1Q8MA 1LHZA 1U36A 2IWGA 3ARGB 1AD9A 2VMFA 1DLHB 3ALPA 3HNVH 4UINH 4HZLA 1EHNA 4X4ME 3CVIL 3S37X 5T1LB 1I8KB 3BGFC 5AAWA 3WJLA 1MI5E 3AC0A 3E3QE 3PDGA 4R2GC 2Q8AL 4N5ED 4ZS6D 1BQUA 2XZQL 1M7DA 4NUJA 2IG2H 5IK3A 4U1JB 3MC0A 3IAPA 5HYSB 3EDKA 2EDBA 4G8GB 4GRLC 4YHPB 4CBPA 2XWJB 1TENA 3LQAC 2VNCA 1YN7B 4MA7L 4RISH 5K9OB 4PRNB 1D6EB 1FDLL 1BZ9B 1ZTXH 5GS1B 1UADC 1BQHG 5JQ6H 1ERNA 1IGCL 1NEZA 4ELME 1I8MB 4LLMB 5GISL 3SQOL 2C1PB 4YHKL 1KIRA 4EEEA 3RX7A 5HVHC 2K7QA 3MO1B 1XR8A 1MUJB 1U8PA 2YWYA 4GAJH 4LSVH 1EH9A 2YSSA 3F7VB 5FK9A 4PJHE 3KDMB 2HWZL 1TJGH 3LKNA 4YHNB 4MD4A 5LAXA 15C8L 3MOBH 1LO5B 1OF2A 4XNMB 2WINB 3OKMA 4P5TD 4PB0H 2JCCB 1BIIB 1I1YB 2XICA 3BP6B 1OP5H 3BWAA 3DO3A 3IT8D 2BRQA 2ZUWA 1OTUD 5DD5H 1P53A 1S7SA 5IB4A 3P4LA 4YHIB 2Y07H 2B4CH 4RMTA 5CEXB 5D7SH 5EZJA 2GTZA 3KYNB 4EDXB 3B2UC 1NCTA 1VPOL 4UQ3B 1OAYL 5EBGA 3K80A 3V79C 2NW3B 4N8VB 1XGTA 2HFEB 5EU4B 2ZUXA 3ILQD 5FYLH 4JFQA 3UBXG 1V3LA 1L6XA 3S37L 3EKCA 1NAKL 4G8GE 3CXHK 3W5NA 4M3JA 2BY2A 4FOMA 4Y19A 1WEJL 1F6LL 4J6RL 5C0BA 1JCKA 2BNQA 3IFOA 4XMLL 1IGYB 1CLOL 4HWEL 4JGMA 4NZDA 2L0DA 3FCTA 2XZAH 1IVLA 4JFEA 5JW3L 3S88L 3E2HC 4Y5XC 4J3VA 2F5BH 2F9BT 1D6VL 1R5WA 2Q8BH 2RGSA 1JWSA 2VWEE 3KJ6L 3R06B 3PWLB 1YEGL 3QIUD 1LO4L 4NQVB 5KG9B 4LSUH 3GSWA 4F7MB 2DQGH 4HHAA 4EI6B 4KKLD 1D9KB 3D9AH 4OF3A 1BJ1J 4K23L 5BRZA 3FO9A 1PJ9A 2BC4A 5F9WC 5F7NC 4UDUB 1CU4H 2R0KH 1RUML 4FQQB 2JCCE 4WO4B 3MMEA 3NIGF 4GBXC 1QSVA 2X44D 1OAZH 1CL7H 4TNWK 2P47B 12E8H 1U3HC 2FCBA 4ZYKA 5JUEH 2O5XL 5FO9B 1CXHA 1CE6A 3B2VH 3BW9A 3MLTA 3HC3L 4RX4D 2X70A 4X6DF 1LVEA 2DKUA 1ZSDA 5EZIL 4DW2L 4JANA 1H3VA 1YC8A 3RAJH 3HPLB 4YK4B 2FL5A 2AJVL 3FZUC 3LH2L 4QOKD 5LXGL 1B6DA 3IFPB 1EAJA 4OIBA 3BO8B 2JJVA 4Q9BA 5E6ID 4Q9QH 4RGMB 1I4FB 3QIWD 2ADFH 2AK4A 4MNHA 5I8EB 3VXMD 4HWBL 3R0NA 5DEGB 3V7AE 3IJSA 3V4UH 2NY6C 2ZOKB 2I9LA 4PJ8B 5J1AB 3OF6A 3JTTB 3BKYH 3ESVF 1XR9B 2IAMB 2NXYC 4P2OC 3VXUD 3O6FB 4NQXA 2CDFA 4NQUA 4HT1L 3SDCB 1HHHA 4EXPX 4PLJC 1L6ZA 4MAYB 5F3BB 4C58B 3BEVB 4OSUL 5HYJD 3BJ91 3FHAA 2HTKD 1CGWA 1KNOA 4L9LA 2I5YL 4MCYA 3L6FA 3VXTB 1CG9B 1YPZB 5T1KB 1AD0A 2Q76B 4WIQA 3ULUH 1BX2B 1MJ7L 1LQSR 5CJQL 1INQA 3PGFL 1FO0B 1GJIA 1RULL 2C4FT 4X4XA 1EEYA 5F89A 3U36B 2IADA 1PYWA 3HR6A 1AGDA 1YEJH 2FEDD 3CK0H 3BZ4B 3F7RA 2GTWA 3MLSH 1UG9A 3NBNA 4IRJD 4HH9A 3SKJH 1T5WA 3IS1X 1KEML 2AJYH 5I1CL 3I2CH 4HUWA 3O3DB 4X6EA 2ZWLT 4JEGB 4PBWD 3S9DB 1XF2A 5HPMA 5GRYA 2B1AH 4C83B 3TJHC 1MFEH 4I3SH 4KRLB 3VXRE 3RVVC 3WKNA 3X14B 3B8YA 3PP4L 4OI8A 3PL6B 4ONGL 2Z0BA 3U0WH 1EGJH 2P8PA 5DD3L 4Y2DD 3IAGC 1A9BB 3PWNB 3VI3F 4LCCA 4HF5L 4PTTB 5I1HL 2JIXB 1EMTH 3V5HA 3DOSA 1OOAA 3GSQB 2PW1B 4Q6IC 4AT6B 3UTZB 1CFTB 2MMXA 3IF1A 3BQUB 2XXCB 5SWZB 3LPFA 5EA0H 4ZFFB 5IKCB 4TVPL 4HDIA 4EOWH 3L5XH 2NY5C 2YXFA 3A6CL 1NCDL 2AQ3A 4Z7UA 3KS0J 2XG4A 1MCFA 5E8OA 5HHPA 5HGHA 3WIHA 3BPCB 3P77A 5F1IA 1YPZE 3WUZA 1QBML 4LPTA 3GJFK 2BNUA 2EEDA 5DEFA 2XRAL 2FO1A 1TVDA 1QR1A 4PJEB 1FV1B 3WL9B 5E2WH 3MSPA 5HI4D 4Z6AT 1I8IA 1LWRA 4J3OC 3R1GL 3PGCA 1ORQA 3MRKA 3MRNA 2HT3C 1QFPA 5JLZA 3H7BA 5J57B 5F88A 4S1SL 1ZLVK 1MPAL 3F58L 1N6UA 3S35H 3QEHA 3P4MA 2B1HH 2FD6H 5SWSB 1U0QA 3BESR 4LPYA 5F1NA 5FUZL 1FLRH 4DFIA 1JBJA 2EYRB 1BD2B 3FO0H 1F4AA 2QHRL 4Q58C 4YHYB 1ZT4B 2GAZB 5ICZB 2OL3A 3O3AA 1IKNC 4JY4A 1SBSL 4RFOL 3VXPA 4QHUB 3FOLB 4W81A 3F8UB 5DVOA 3OAYK 3GB7B 3BZEA 2A83B 4AK1A 2X4OB 2FDBP 4X98B 4BZ1L 5F21B 4HJ0D 5SX4I 2Z35B 1MQKH 4ODWB 4E41A 2VLME 2ZNWA 4R0LB 1FNEA 3SEPA 1J1PL 4O2CB 5DJAA 5CEZL 1HHGA 5E2UL 2CMRL 3ZHDA 5E8PB 3H9HA 5SWZE 2GY7B 5B8CB 1M71B 2ZJSH 3Q3GB 3QULB 4U1LA 1RSFA 4LNRB 4GOSA 1WUNT 2EDRA 3WNPA 4I0PC 5I73B 1DBAL 3HHRB 3MACH 1QSFA 4QXTB 1J88A 1EBPA 4HK0A 3L7FB 1UACH 4JRWA 3VFNB 1JUFA 1RJZB 1AXSA 1R3KB 1U8QA 3A6BL 4GXVL 3HNSH 4NYLB 4PRID 4OF5A 4PJEE 3EOBA 1IT9L 3EYFB 1UJTA 5GGUA 3T65A 1XGUA 3QFJB 3CLEH 4NDMB 4PY8I 4WFGE 4KTEL 1RZIA 1TITA 3LN4A 1YYMH 3MJ7B 1X5LA 5TH2B 3QUZD 5SWSE 5ID1A 3NIFF 3MV7A 4UT6L 1BD2E 2A2QT 1T7ZA 3QHZH 4ZUTA 4PJ7B 1EV2E 3EYQC 3DI2B 3GFUA 4KVCL 3RA7L 3RVWD 1NFDB 1V7NH 3QA3B 2WUCH 3QIBD 1AC0A 2XKUA 4QRPD 1IAKA 1YDPA 2X09A 1RZGA 3TBYA 4WFEE 1F6AA 3ZE2F 5DA4A 3FQWB 2X41A 2BVQB 2CIIA 5K9QI 3S7GA 4YC2C 1HI6A 1P7KA 3IDNB 1CYGA 4ZUWB 4HKJA 5F9AC 1WZKA 1GPOL 4M7KH 3P4OA 5J9PB 4AEIL 5DT1L 3SDXB 1C12A 3WD5H 2EDOA 1JYVA 4CGTA 1J05A 3WFCH 3BYYA 4GBXA 2GJ6B 3OGCB 3SDAD 4KROB 4JFHD 5C7XH 5C09A 4O58L 5IB1A 1TVBA 3TP4A 2BVOA 3Q48A 4Z5RA 3JUYA 4UT9H 5C0AA 4YXKH 4APQA 3EGSB 1S7QA 5IBUB 3GSXA 2XY1A 1JWUB 3SE9L 3C2AL 2V2TA 4OKVA 1EJ6A 2MCPH 3QFJE 1C1EL 1V3JA 3E8UL 2CK0H 1WV7T 3UJJH 3SGDH 2XKNB 3QQ9D 2E9IA 3O3EB 3IFNL 1A7OL 4PRAB 1Y0LB 4PPTA 1U8OA 2J6EH 5I19H 5I66A 1RAMA 3STLB 5F6IB 4P4KA 4HXAL 3W2DL 3I6GA 1I9RL 3KHOA 4LVEA 1JV5B 1KJMA 2P24A 4LBEB 3SY0B 4PJ7E 4M7JH 3QUXC 4R7NB 4JB9L 5JW4Q 3CFJA 2D0HA 4AM0B 4FQ1L 3D85A 3LIZL 2BOBA 4TSAL 4N5UA 4OFIA 1NFDE 3CSPA 4RGNC 4I4WB 5JPNB 3B6SA 4G80A 4JFOB 2XA8H 4M61A 2ZUTA 3DVGA 5IG7B 1YY9C 3O8XA 2BCKA 7FABL 1MWAL 3MRPB 5EBLB 4KQ3H 3WHE0 1SBBA 2HRPL 5DJZB 2Y5TB 4GFTB 1WAAE 4JPVL 5I75B 1KSRA 1OW0C 3SDXE 4RGOH 4XH2A 1ZEAL 4KY1H 2H6PA 4DN4L 1MIMH 4G3YL 5I9QB 2EYTB 2W0FA 1M6OA 2GJ6E 3C5ZD 3UC0H 3GSVA 4FMFA 3Q6FB 4IMKC 1U8KA 3IU4L 3QDJB 5ALBL 1PLGH 1YJDL 4U1SB 1KIPA 4KVNL 4Y7MA 1FL5B 4JHAH 3A67H 1FZJB 1MCDA 2PTTA 4FRWA 1UXWA 4HKXB 3MGTA 1HQ4B 1FPTH 1HN1A 5GRJL 1DANT 4NKDA 4LCWE 3RZCB 2LQRA 2YXMA 3RU8H 2EXWD 4NNPL 3BP7A 2EDWA 3HE6B 3VRIB 1FH5L 4XPHH 5C2BL 4K3EH 4DN3H 1S3KH 5F7WC 2BDNL 2IQ9L 3D69A 4OFDA 4ZXBB 1IAOA 1K2DA 3BPLB 3HI6H 5MI0C 3ULVC 3WS6A 2Y36L 1S7RB 1WZ1L 2Z91B 1BWMA 3ARBB 1ZGLM 2CDGB 4CJ0A 3O11B 1OSZA 1UB6A 2A9MH 2NY0B 3KJ4C 4JDZB 1AHWC 3H7LA 5GJTH 4LFHD 5FKPB 1EHXA 2JJTA 1SJEB 3KPRB 5DJXB 5KOVC 5L7XH 3ZYJA 4C54A 5BVPH 5DJ2A 1ZGLP 3EHBC 4YDIL 2CJUL 1FO0H 5DUPH 1NJ9A 3WN5A 3O4OC 5L8LB 4LVOC 1ZHNA 5GSVB 5E0QA 3LEXB 1ZE3C 4OD2A 1F90L 4IMLA 3QCUL 3WSQH 1JHLL 4HS3A 1JFQH 4PV9A 1KYOJ 2OZ4H 4L8SB 5CP3A 5A16A 3WIHL 1HH6A 5BS0A 4DUWA 2JK5B 1HILB 4LLQB 4NNXA 3ILPA 4QHNB 3ARRA 4DK6A 4Y16A 1KEGL 4B50A 5IVXB 3EO1A 3QDJE 3IXAB 2Q87A 2X2YA 3D3VB 4KDTC 3B9AA 3ZSTA 4D0BA 1YMHA 5JORB 1T1YB 1XF1A 5E8NB 2ZKHL 1MCRA 3UPRB 5JO5A 5ICYB 4TVPE 5FCSH 5IMKA 3BXNB 4PGDB 4M93B 4AH2B 2F8OA 2X1WL 2FX8H 3GEWB 5FYKE 2XZQH 1TZHA 3ZTNL 2AV1A 4X9GA 1CDGA 4MJ5B 2IMMA 5EZLB 5J56B 3CVHL 4Y5VC 4WI4A 4GLRI 4MA7H 1V5JA 3NCEB 4ZMAT 4I9WD 1QLEH 3HI1B 1U8IA 2R2HB 2D03L 1IGCH 2N1KA 4N5EC 4MXQD 4ZS6C 3CFDB 5GISH 5KW9L 1RJLA 3LKQB 3KPRE 4OGYH 1KB9K 4X80L 5K59E 1I1AA 4OJFL 4J12A 3FN3A 4NN6B 2A6KB 1QVOA 1MHCB 1IEAB 2E6JA 5D7JB 2Q1EA 4JG1L 3MLUH 4ZTOH 1LDPL 1UT9A 5GS2D 4YWGL 5I8OH 5IR1A 3G6JF 1P4BL 3QCVH 2PXYA 3KLDA 1T89C 5AD0A 2XN9B 5HGBA 1DN0B 2IGFH 4Z0BL 4OM0H 5IF0B 2IBZX 3F12B 4OQTA 3W0WD 3UTPD 4Z8FL 3VRJA 3S96B 3RVXD 1RIUH 3ARPA 5IVXE 1WIPA 1OD7A 2EC9U 2GYSA 4EQ3A 5HD8D 3SOBL 5GGTA 5KSUA 1XH3B 2DJ4A 3D3VE 4ERSH 3CFBA 1AP2B 1MCSA 5IROC 3SKNA 5CEZE 2VKWA 3PXJA 4P5TC 4UNTA 4HS8L 4L4TA 4LHQB 4TPRL 2BNRB 1MLBA 4ONOA 2P45B 4JZOB 1T5XB 4BQCA 2J8UB 1MFAL 3NZ8B 3WXWL 1BOGB 4F7TA 2P4AB 1VGEL 4LU5L 1SYVA 1SEQL 4N0YH 1CFQB 2H9GB 2EDQA 1JZ8A 2V2XA 5KN5B 3RUGF 5E2JA 1WEJH 4XCFL 2BOCB 4WFHD 4CVXB 1CLOH 1JYXA 2YD5A 3EBAA 3REWA 3ILQC 1KJ3L 4MXWL 1VCAA 5ICXA 1F4WL 4QF1A 1KF9B 3T77B 3KJ6H 4PY7B 4EI5B 1N6QH 3CXDH 1EEZB 1UWXH 4LNVA 4AENA 4X6CA 4ZO7A 1MFCH 1KC5L 4GAGH 2H8PA 4XX1G 1A6ZA 1VSCA 1I7ZA 2NW2B 1ZHBB 1EERB 5EIIA 1JIBA 1V05A 3MRBB 3QJFA 1KUMA 3SQBA 2XN9E 4XVUC 1LO2L 1RZJC 3EO9H 1I7UA 3QIUC 1ZLSL 4C55A 4PR5A 1MCBA 3LY6A 3DXAA 3MLVH 3BKMH 4KKLC 1K85A 1BVLA 1BGXL 1A7NL 1YQVH 2UYLB 2H26A 2O5XH 3LMJL 3LQZA 4S0TD 1QRKA 5F7UA 5D1QD 4LQFH 2X9YA 4CN6A 1QHPA 3OKLA 2H32A 1AGEA 5C6TL 1HZHH 1MEXL 1WT5C 1IM3A 5L88H 1HXMB 2BNRE 4MJ2A 5J1TC 3U2SB 4DAGL 3L3OA 3LH2H 3MRMA 1KPVA 1H3PL 2J8UE 4KC3B 1IBGL 3GO1L 1TIUA 1Q9KB 4HUXB 1FYTB 5B38A 4LVNC 3VJ6A 5ESAB 4WENB 3HMXA 4HWBH 3SHSA 1I7RA 5IOPB 1NMCC 3FT4A 5ADOL 4FFYH 3VFPB 2F58H 4WTWA 4HKZA 4OFYA 3SE4C 4K7FB 4EUPG 3CDFA 4U6YB 5SWQB 2BVUA 5T3XD 2VB5A 3GMPB 4UILL 3FKUS 3AFLA 1IGML 2J5LB 5E6IC 3MLRL 3ROOA 4GSDL 3TA3A 3UEZA 1N5AA 2OK0L 2IQAB 3AUVA 2DYPB 4JFDB 3ZKNC 4FABL 2A1WH 1ETZA 2X4PA 4PJFB 5CBEA 5ACLA 2I27N 1YY8A 3C6LB 1Q9WA 5DRWB 3N1QC 1QFWI 1PX3A 3MA9L 2F5AL 2VLKA 5DMKB 2Y7QB 3JXAA 5ENWB 4DQOL 5FYLD 4PD4K 4NSKA 2PO6B 5H94A 1EPFA 2NY2B 3HE7B 3H9SA 2X4RB 3JZ7A 3T2PA 1CD1A 1XGQB 4YDVB 1YMMB 3L5HA 3QI9D 1KLUB 4YO0A 3HC0B 3C60A 2VXVL 2H3NA 2EDFA 1W0YT 3WKML 5A3IC 5EOCL 2X4UB 2NX5A 3V5DB 3W9DB 2HTKC 1H5BC 4BH7A 5E03A 2QSTA 2ED8A 1LNUA 2APWA 4QRRB 5GJSL 4ZDHA 1FC2D 1QSEB 4F8QA 1UM6L 3CFCL 4LLDB 3SCMA 2X7LB 2IC2A 1BBJA 5K93A 4G43B 5TE7H 5TPWH 3FO1B 3CFIC 2NZIA 3BWUC 2YPVH 1QRND 4Q9CA 1I9IL 1G9MC 3GRWA 4LRIC 4A6YL 3RL2A 3ZDYE 2VUOA 3HLAB 1OL0A 4XPBL 1FYTE 2FEDC 1VFMA 4JM2D 1K8IB 1ZS8A 5L2JA 5DMGD 1AHWA 4Y1AE 1MRFL 3V0VB 4IRJC 5HYFA 1G9EA 4N90E 4J1UB 4ONGH 1Z3GL 1CGSH 2IFGA 3U6RB 3LEVL 4KUZL 2E27L 3O2WH 4D94A 5E6YA 1OGTA 5E5MB 3UO1H 4LSQH 1Q1JL 5FA3A 1JYWA 3ZE0F 2GSGB 4JFDE 4XPTL 4PJFE 3QXVA 3DETD 1ZXQA 4D8PA 4GRLB 3GK8L 4Y2DC 3AREC 3LN9A 4TVPH 4P46A 1CDHA 5GS3A 5I1EL 2AJ3B 5FYKH 3D5OF 3A6CH 4J8RB 1NCDH 2P7TA 1GAFL 5GRXG 4PBVC 4LL9A 5LBSL 2VQ1B 4QLRA 1WWBX 2E7LA 5HVHB 2QLVB 3B8SA 3T3ME 3E6FA 1YMME 1QBMH 2GHWB 3LS4H 1DQJB 1QFWL 1PQZB 3G5VB 4PJ9C 5IMMA 4X7DC 1C08A 1U9KA 2PNDA 5DUMH 3MJ9H 1MHHA 1H8SA 3LKRA 5E4EC 4WU7B 3TM6A 1NH6A 1FL3B 5I76A 4QRRE 1CGVA 3OPZL 1QSEE 1HIML 5D93C 2N7AA 2AXGA 1MPAH 5IFAL 1PVHA 5D7KE 4GRWF 5FUZH 5HI4C 3KPMB 3T4AB 3DSFH 1MCLA 3GMMA 3O41A 1PSKL 3MNVB 2SEBA 4OZHB 2QHRH 5AZEL 4I77L 5FUOH 5EU3A 1W0VB 4RFOH 3JTSA 4QRSB 4IRSD 4N68A 1RQ5A 2P8MB 3ULUD 4P99A 1WBYA 4XPFL 2O61B 3SE3A 4JR9L 3TO2B 3GHBL 3O2DL 1UJ3C 4GG6B 1FIGH 3B9KD 1KTDB 2DQUH 1LP9A 4HLZH 1UXSB 3MROB 5CEZH 1JN6A 2VXQL 3BH9A 5E2UH 4PJXA 3L3GA 3X13A 2P8LA 4QCIA 3H0TB 1DQTA 3CU1A 3NAAL 1VFBB 4HJ0C 1T6VN 1DBAH 3E2HB 4Y5XB 3UZEA 4P2RB 3UDWC 1B0RB 1JHTA 1S5HB 5C07B 4O5LH 5CIPA 1I1CA 4YE4L 5GGTL 2UZXB 2A9NL 1IT9H 3VXQB 1NCCH 5J6HA 3RIFF 3VG0L 1GGCL 3S34L 4PLKD 4S1QL 1CD0A 1N7MH 1IL1B 1KTRL 5B38G 1EHLL 4KTEH 5F9WB 2XA3A 4AL8H 4R3SA 1IRAY 1LO3H 4XCEB 2F74A 2A77H 1MI5D 4PFEA 4LF3B 4H5SA 3WDIA 5KJRL 5IFJA 3WFDL 4UT6H 1U3HB 4FZEL 1N59A 3VWKD 2FH6A 3OKKA 4OZHE 5KVGL 5D1XA 3BUYA 4Z7UF 1YEFL 1BZ7A 5JIKA 1G7MB 3DHMA 3JVGA 3T04D 2J4WL 5D72L 2VDRH 3QP3A 4OUUA 5A2LH 1AFVL 3QUZC 4AQOA 1W0WA 3LB6D 2HH0L 1A6VL 1FN4B 1CS6A 4EDWH 3EYVA 5LCVL 3MODL 1N4XH 3TVMD 2JB6A 4GG6E 1OLZA 1AY1H 3RVUC 3VXNB 1XGPB 3WS3B 4NQSB 3QXTA 4H20L 1U58B 1WISA 2W0PA 3QO0B 4RMWA 3BEWA 3RVWC 1EK3A 1BHGA 1X5IA 3GIVA 3QIBC 3TJEL 1G1CA 5JW5B 1DUZA 1YUHB 4AEIH 2VLJD 5DT1H 4X6FB 2VDKL 2NY6B 3UTSA 3L95B 5I8CA 1BMGA 4QNPF 5EO0A 1NDMA 4QHMA 1TZGL 4XNYL 4FNLL 1IILE 1UC6A 2KL6A 2GCYB 4S1RH 1MJ8L 3KYMB 4YDJA 3U1SL 2NXYB 4WNQA 4P2OB 32C2B 2VSDA 1T04A 4MDIB 1M7IA 3VD9A 3SE9H 4G9FB 3ZTJG 4P23A 1KENL 1C5DB 3MXWH 2NLJA 3ARGD 4JG0L 5MHSD 1TJIL 3L3KB 2VITB 4M6ML 2B2XH 4LLAA 3IFNH 4KKCD 2R56H 2WUBL 3H2WA 5T1LD 1X5XA 4B7LA 4NHUA 4HXAH 3NTCL 1K5NB 1JGUH 1I9RH 1RUAH 4NO5A 2QR0A 4PS4L 3LKSA 4H1LA 3OR7A 3IKKA 1OCWL 3LEYH 1J1XL 2DM3A 3QQ9C 4QOKA 3RP1A 3QNYB 4Z76B 3FRUA 4C56D 5HYQB 1G7JA 3FQRA 3MX0A 2ED9A 3WLBA 2Y6SD 4Z7OE 2YEZA 3QIWA 1CGXA 4ZAKD 4K3DL 2XOTA 3VXMA 4FQLL 4PGCB 2EKSA 3LS5H 4XCNB 5IB2B 5IBTH 7FABH 1KCRL 2WBKA 5L8JB 1MRCH 3VE0B 2GFBA 4IOFD 1PZ5A 2NY1D 5IIEB 4RMQA 5I17B 4JPVH 5DJCB 1A3LL 5IM7B 3RPIB 4YDLC 3ZHLA 1ZEAH 3VXUA 4MDJB 3VW3L 1ACYL 3MUZ1 1CVSC 1FGNL 1MJJB 1QFUL 2YD7A 4Q6IB 5FO8B 5HYJA 1IMHC 2HVJA 3HFML 2YPKA 3DYMA 1YJDH 2OTWB 3MLYH 3SDYH 3IXTA 4DGVH 4M62H 3H42L 3O45B 1NBVL 1M4KA 1FVDA 4K2UH 3V0WH 4MGXA 3TT1H 2MOVA 5DWUH 1NGWB 4YIQB 2P5WB 1FZKB 3C5ZC 3GSRB 7CGTA 1HYSD 4P3DB 4BH8B 1P5VA 4JFZH 2VDNH 4XC1L 3GRWL 2DL2A 3AAZB 4G42B 2G75B 1OM3L 3ULVL 2Q7NA 2QEJA 2HFGL 2KH2B 25C8L 1EAPA 1C5CH 5GGQH 3WEXA 2DWDB 5GGSB 3GMNA 3BRDA 1H3TA 2XZZA 1N0XL 3HR5A 3DX6A 3L7EB 3JUZA 2EXWC 1KIQA 2XNAA 1S5IH 3RKPA 5JR1L 4NQTA 1T03H 4WW1A 1E28A 5L9DL 1IC7H 2CO6B 3VXSE 1IZJA 1T7VA 3VFUA 1T80A 4PRHB 1A1NA 2CJUH 3VI3E 5MEQB 5ID0B 2GT9A 2EC9T 2D31B 2V5RA 1JF6A 5DLML 5HDQH 4G9DB 4LCIH 4Y2DA 1NC2D 2GITA 5JDSB 5KAQF 3D25A 1UM5L 5CJXA 1FFNB 1EZVX 1HNFA 3PNWA 3NCYP 1D9KD 1KBGL 2CLZA 5MEOB 4E0RB 1SJXA 4NWUL 4DUVA 4NKMB 4L29B 3GGWB 5MEPB 3REVB 4AEHL 1G6RA 1XCQB 1A6PA 1PW3A 4QHLA 4WO4D 5F1OB 3RWGB 3UZQA 4OLWL 1NGZB 4XP9L 3NCJH 4FXKB 3RIFK 3ARWA 1OGAA 3FO2B 4NO2B 5F7DA 2AJXH 4OV5B 5KSAA 2ZCKL 3IYLW 2P5WE 3NIDF 1I9JL 1FNAA 3TYFB 4I0PB 1ZT1A 3H3PH 3ZTNH 2WIIB 3EOTL 3LQAH 4O02L 3DX8A 1A7QL 5DA0B 4X0KB 1XGYH 4DKEL 4HW6A 4WU5B 3MCKA 4O4YL 4B41A 2F8XC 2RHEA 2VYRE 1T3FA 3BI9X 4MHHI 1T1XB 2D03H 1C7SA 4XBPA 3O4LB 1YNTA 1ADQL 1LK2B 3VXRD 1ED3B 4HIEB 3DRTB 4X80H 3GJEB 1A0QH 1I9EA 4OJFH 3U9PL 4BZ2H 3OJMB 4PRHE 1ACZA 4R4FL 3FFCA 4JG1H 5EOTB 5M7QA 4PJGA 4MXQC 1NMBH 4NFDA 1P4BH 1O0VA 3O6FD 5EU5B 3EIFA 5DJDB 2NQCA 3SDCD 1F5WA 3C5JA 4LHUG 5HDBF 5C0IA 4JKWA 1T0NA 2PETA 4ODVL 2FJFB 3OKNA 3MNWA 2D9CA 2UUDH 5KZCB 2CQVA 1I3VA 4Z8FH 3C9NB 5I6XC 5FM5O 3C8HA 4LSRL 1BFVH 1JYNA 6CGTA 4TUJB 5E8DL 5DUBB 2A73B 4OCRL 3U0TB 4R7DA 5BOZG 5T1KD 2ZSWA 4HUNB 4YC2B 4BKLB 1J11A 1JK8A 2WSKA 3MV8A 4Y2OA 4F57H 5BZWB 3LVEA 4KKBD 4DCQA 1VGKA 1SJHB 4XI5C 1EX0A 4PRIA 2VZSA 4QT5B 3L3JB 5HD8C 3WXWH 3QEQB 1VGEH 1E27A 2VE6A 2HKFL 5BW7C 3MR9B 4RZCB 3MLZL 4PG2C 2JJSC 1U91A 3DX9A 5TGBA 2QQNL 3OZ9H 1NC4B 1P7QB 4PJAA 3SDDB 2OTUA 3O4LE 4H0IA 5E9DD 2O26U 5D7IB 1B0WA 2R1YB 5I71B 1KJ3H 5IW3A 3U30B 1XF5A 3BX7C 1F4WH 1MAMH 4GLRH 1ES0A 1G7PA 2NXZB 1KC5H 5F44A 2JIXD 3MRIA 5ADPL 2VLMD 1G0XA 1JPTL 1T83A 1RZJL 4QRPA 3BQUD 4OD3H 3WFHB 3QUXB 3EFFA 5SWZD 4C57C 1S7TA 4KH2A 3JV6B 4KJYA 1GGBL 1R24B 2FX7H 4HS6B 1JNHB 3RBGA 3GMRA 4F9PC 5L8KB 1ZLSH 2ILLA 4U6XB 1QFOA 3FN0H 3S5LA 4RGNB 3QISA 2IPKB 2R29L 2G2RB 2V9TA 3HG1B 4KPHL 1A7NH 3LMJH 2B5IC 2KZ1B 1FE8L 5F70A 2AJSH 4P4RA 3SO3C 4DZBB 1NCWH 4YFDB 3SDAA 1K9TA 2VR4A 1HKFA 1HK6A 4P2CG 4HIIB 1DBBH 4YX2H 5E2VH 2ITDA 3Q2CA 4MB3A 2OQJB 4YDKH 3QXAB 4HEME 2X4TB 4WFGD 4LLVA 1H3PH 5EO9A 3QEQE 4PJDB 2I07A 1JHKH 1B0GA 4WCYL 1A9EA 3LV3B 3KR3L 4XNUH 4H88L 3VFOA 4O9HL 1QLFA 4ZNEE 3T09A 4TOYH 3WO3B 3C8KA 5ADOH 1BJMA 3SKMA 1UFUA 3GMQB 3IKCA 1MCNA 3HCVA 4HMCA 3TBVB 5D7IE 3T8XB 2GIYA 3X11A 2W65A 4DJMA 4GG8B 1IGMH 2OK0H 1D5BA 4GSDH 3QUYD 3TO4B 3G04A 1MFBL 2VLRB 3MLWL 3ET9F 3V4PL 1DQLH 4WFED 5TE6L 5C3LD 2IEPA 3QXWA 3VWJB 4GAFB 3MUGA 4UU9B 3MA9H 4CADB 4YAQB 1AQDB 2VLLA 1ZAGA 3U9UA 1HDMA 4YPJA 4E42B 1I1RA 5JHDB 1VFAB 3R0MA 2FBJH 5TE4L 3KJ4B 5C0CA 4GRMB 3FTGB 4NBZB 5BOPA 4DZ8B 4GQ9H 4XNQB 2DIAA 3RNQA 4RGNE 3PWJA 3O4OB 4YPGA 4LVOB 4YBQD 3HS0B 5FKAA 4P5MA 3QDGB 3VFWA 4FQXD 3GM0A 3HG1E 4XC3L 5IB3B 3LPWA 1JZ2A 4G7VH 5DD0L 1A6AB 4MX7B 3T1WA 4JO3L 5GJSH 5EORH 2OJEB 1DQQA 3UBXB 3CU7A 2R4RH 3QI9C 3OKOB 4JKPL 3MXVL 2VZVA 3QFJD 1SQ2N 4X6CF 3D18A 3OKDA 2ATKB 1IGJB 5E7BA 4ORGB 3O9WB 4LMQI 1PY4A 4PJDE 3PQYD 3CH1B 3P0VL 5J3HD 5GGVL 5F97E 2DQFA 4HCRA 4PGBA 5DC0A 1Z3GH 1HSBB 2FNBA 3QJHA 1JGVL 2IH1B 3G6AA 4KUZH 5KS9A 4R90L 2E27H 4X5LA 1R3HA 2W9DL 1H15B 5DTFB 3MOQA 3PDOB 1UM4L 3I3EA 6FABL 2HJKA 1DJSA 3HB3D 3QHFH 3DURB 4HQQL 1F11A 4ACPA 2VLRE 3JV4A 4GKSA 5DMGC 1IGFH 4KAQH 4Y5VB 2NY5H 1B6UA 1OVZA 3I50L 3NA9L 1KLGA 1Z5LB 4C4KO 1U8MB 3G6JB 3L3HA 4PREA 3VD3A 5JHDE 4XP1L 4K71B 4HGKC 4HIJA 3D0LA 4RMUA 3G08B 2K7PA 5DJ6A 3DETC 5T5NF 1QFWH 1ZGLA 4QXWA 4NZUL 4XVTH 2ICCA 1S9XA 2P46B 4KROD 1NSNH 3CPLB 4JJ5A 4KXZI 3I3DA 4GAYB 4LAQL 1PFCA 5ERWA 2JKXA 4HC1A 4OLEA 2AEPH 4JZNB 1AO7D 2YRPA 3FB5B 3I9GL 4XP4H 4OKDA 4TSCL 4NC1C 1VACA 4ODXA 4OLYH 4X83A 4R8WL 5E1AA 2G60L 3HZVA 4P2QA 4LCWD 3D39A 3KLAB 5LWYH 4IRZL 3BE1H 3DJ9A 4AMKH 4U1GC 1AI1L 1MY5A 2ADGB 1H3GA 1PSKH 3DSNA 5EH1A 2DTSA 5AZEH 4RQQB 3C5SB 3U4BH 1YNKL 3GZKA 3JBG7 1A1OB 1RVFH 2ARJA 4P5TB 1QEWB 3FFDB 1U8HB 2UVFA 4U2YA 3UYRH 3K0WA 1UEYA 1UVQB 3QSKB 5IJVB 1LD9A 4JR9H 3O2DH 4PJIB 1DSFH 2BP3A 1IAMA 2R2EB 1FFPB 4MJ6A 3VFTA 1BPVA 1BLNB 3HC4L 3WHXA 2VXQH 3ES6B 4LAJH 4WEBH 4GW1B 4JO1L 4NHCL 3ULUC 3S5LG 3THML 3G6JE 4QY8A 1ZV5A 1Q94A 3CD4A 5K9KB 3H3BC 2CDEA 2J1KA 1CBVH 5C86A 1AC6A 1PDKA 3RWDB 2X4SA 3LDBC 5JPMA 5LGHL 3AXLB 1CFNA 2FATL 1I8LA 1NUNB 1G7IA 2NPLX 2QL1A 4GKNB 4MJIA 3MBXH 1G84A 5EC1B 3MA7A 3VGAC 3EJYD 1XCTB 4UTBL 3NN8A 4F7PB 3O3BB 3T3PE 4PJ5B 3S34H 1IC5L 4NBXB 4S1QH 1N5YL 5JA9A 1A21A 1EHLH 4WHYG 1J18A 1KPRB 5HJ3A 2HTLD 5HPOA 4ENED 1EHAA 1KLFA 3RZCD 3T0ED 1JGLL 4YHML 5BMFH 1TJHH 1ZLUH 1P2CA 4UNUA 5FYKD 3QQ3B 4NZTH 3UTTA 3PWPA 5KJRH 4KZDL 5HDOA 3KPOA 1EXUA 5C8JA 2ZUUA 3B3IB 4PLKC 3TBWB 4F58H 2MPAH 4UI2A 5IMLA 1YEFH 1F4XH 5F6HJ 3JWDC 4D0CA 4LP4A 5DHVB 3GSOA 3I85A 1BEYH 3LRSA 4OCXL 3INUH 3ARBD 4ZD3L 4JM4H 1IQDA 1A6VH 2NY0D 3TN0D 4FN0A 5EG6C 4PJIE 3MODH 1EJOH 4WI2A 5D70H 3VWKC 3MRGA 2VL4A 3KYOA 4ZUUB 2P48B 1B9ZA 3OAZK 4LVNB 2C9AA 3LB6C 5DI8B 1NMCB 1HQRA 2XZCH 4JQVA 3KPSA 3TVMC 4F9PA 4Z7WB 4HWUA 2BFVH 1K4DA 4XRCA 3MV01 2H2PD 3QCTH 4M5YL 4RFNC 5GGRB 1J5OH 3NZHL 1NGPL 1TZGH 1MVUA 5E6IB 4MNQB 2MSPA 3OJ2C 2MHAA 5A2FA 1XEDA 1RZKC 1KOAA 2G9HA 4KK8D 3DVNA 1CFVL 3EJJX 4RMRA 5CLWA 1YEHL 4NQED 5C0BB 5HBBA 5E08L 1KENH 3H6JA 1EUUA 4PJ5E 4NKIH 2CUMA 3JWOC 5C08B 2KKQA 3DMMA 5CP7B 4JRYA 4M1DH 2Z31A 4WI8A 1HNGA 1TJIH 2VL5A 2YD6A 1LP9F 5KBNC 3OXSA 5D1QA 4PJXF 3QG7L 3MBED 3UMTA 3NTCH 1P9MC 2X9XA 4XGZA 4EIGB 2VISB 3BDYL 4LARL 4O51A 4CKVX 2YZ1A 2WBJA 4PS4H 3PV7A 1VEMA 4ZPVB 1H5BB 1EEUA 1HKLL 4OBSA 2V9QA 4ODSH 1QBLL 1YYLL 4KKCC 4LPCA 4MA3A 4Y5YA 5EOQH 2VDQH 1CCZA 4FFVC 2WANA 4EVNA 4FXGB 3SKOB 5DHYA 4YR6A 3MFFB 4M3KB 4NJAH 5IB5A 4XVJH 5I18L 4P3CH 1IGIL 2LFGA 1NCAL 3DYPA 3QQ4B 1KCRH 1GC1C 5D7JD 5FEBA 3NCYS 4HZAA 1AGFA 4X4ZA 1ZSDB 3U83A 4ZAKC 5D1ZB 1UYWL 5L2KA 4Z7WE 3V8CA 1BQLL 2ITCA 4J7RA 1T20A 2XN9D 4S11A 5EBMA 2VWEC 2Q7YB 1FGNH 2YS4A 1JNNH 5IHZB 4MNQE 1KELH 4I0KA 5HHQA 3LSOB 4K8RC 4IOFC 4JFXB 2NY1C 3RY6C 3OWEA 5DR5L 4OZGB 4I3RH 4LDLB 3I75A 1Q9OB 4U7SA 1CD9B 2MFNA 1KCVL 2AV7A 3AREB 4GMSH 4ZFZB 5C0BE 3BUTA 4IIQC 1N26A 1R3JB 2FX9L 1ZANH 5C08E 3MOAL 3GMOA 3WNLA 4YQXL 3WIIL 3VFSA 4EZMA 3M8OH 3PGDA 4PTUB 3J8F7 4W4NA 1R3LB 5KSBA 1AIFB 3IDMA 2DLTA 4P59L 4XC1H 1CLYH 4M5ZL 1P4IL 4U1KA 3VFRA 3MRRB 2ICEB 4PJ9B 3FOMA 2CPCA 1N0XH 3ZYOA 3WFBH 2AKRA 2BHYA 4MA8L 5GGVY 5E4EB 1KCUH 5BXFA 5T5FL 4ZFGL 3BGMA 1J86A 4MMZC 4LEOB 1ZHLB 5BZDB 1K6QH 5DJ0A 5D6CB 4CVZA 5HHXH 5DJYA 1CIUA 4JM2A 43C9B 2R2BA 2V7NA 3TWCL 3VFVB 4I8DA 3RJQB 3IDIA 2HG5B 3G6DL 3PUCA 3QEUA 5HHVL 3ZE0E 2R0ZL 3B43A 1D5IL 1PKQA 4XP5H 4RWHA 5C0FA 1QO3B 1UM5H 3DIFA 3ALXA 5TDPB 1YECL 4RWYL 2OSLA 2LABA 1KBGH 3IVKB 4HUVB 4MNGA 2YMXH 4OV6F 4XBEH 4YEFA 2E7MA 4AEHH 1Q9LB 2KQMA 3OAUH 5HY9A 1XAUA 1TCRA 5DSCB 2XPGB 5SX5K 1A3RL 1WICA 5HPMB 2BHZA 4HC1L 1JTPA 4F7CB 4EN3A 4OZGE 4M7LH 1S9KC 1D9KC 1KG0A 4XP9H 2EYSA 1AGBB 1BVZA 1FYHB 1CDBA 2DQIL 5FHBH 4L8BA 1HXYA 1B4JH 4BSVA 2EEAA 4WO4C 4FQHB 1FVCB 3KPQA 1KXQE 3VD7A 3S98A 3EOTH 3OB0H 5D96C 4FHBD 2GK2A 1BJ1H 1A7QH 3E0GA 2UWEB 4LLUB 1OB1B 5FM8A 3D2UA 4JY5H 4MLIA 5EWIH 3GI9H 3DO7A 5IGXH 1FBIL 4F8TA 1OQOA 1ADQH 2AERT 3S4SG 4Y1AD 4YNYB 3ARXA 4W6YB 1UQSB 3PF2A 4YK4C 1A7RL 2CRZA 4DWHA 1X5HA 3WE6A 5CGYD 5F3HB 2KUTA 4GUPB 4CW1A 3QXUA 4PIRF 5DEFB 2L7UA 4IRSA 3RFZC 2HT4D 1J0KA 1N2RA 1VKXB 3FT2A 2DYPD 2YPLB 4JFDD 1FJ1A 1BM3H 5EUKB 5GHWL 4O2EA 1FRGL 3VXOA 4HJJL 3C6LD 2JB5L 4U3CA 1VHPA 5F9OL 4NPYA 1ORQB 1I7TA 4M6AA 3B9KA 3CX5K 2D7TH 4HWZA 2Q3ZA 4OCYL 3QNZB 3SJVD 3ZT5A 1A2YA 3QUZB 5EN2B 2BSRA 4MWFA 1W72B 2NY4D 3IGAB 5IFHL 2BVYA 3LHPL 4LSRH 4OF6A 4HLJA 5GPRA 2NY2D 5AAMA 3TBSA 5IWLA 3HE7D 3CDCA 5F7FA 4LMQE 3U46B 3SDCC 4XWGL 4HKBA 3RWEA 3EOAA 1XZ0B 4AIOA 5IW1B 4UIKH 2IANB 5JDJA 3QIBB 4U6TA 3E6HA 2IPTL 3LKOA 3VG9B 2PYFB 3K8MA 3U4EB 1EGJA 2HN7A 4QRRD 1OAUL 4X8JA 1QSED 4LPXA 4KK6D 4JKKA 2HFFA 1LGVA 1VADB 3VD5A 2ZCHL 2MJWA 3TPUA 2IH3B 2UWEE 2Z93A 1S9YB 4CAGA 4IEFB 4WY7H 4KKBC 4LIQL 5C92A 1F8TL 3ESUF 4X4MA 1G1YA 2NY7H 5INDA 1JMZA 5F93C 4XCCL 3PHQB 3K3QA 5EU6B 4B5EA 4U1IB 2EDHA 4BSJA 1YQ2A 2R4SL 1BF2A 1KJVA 2R1XB 3H8NA 4M8QB 4Z78B 1A4JB 1IZKA 4ZG1A 2A74B 4JKMA 3MGOA 2NTSP 4WW2A 4RIRA 5ADPH 2YPLE 3X3FL 4WEUD 1RZJH 4UZGA 3RGVB 3UX9B 4PRDA 5FF6B 1L7TL 4K9EC 5ELIA 4GRLD 1ZA3B 4UINL 1GGBH 1DCLA 3HTLX 1JPGB 5H35A 5I1LA 4YBLB 4X8XA 4QNPE 2R29H 4G8EA 5DHVH 2VZ3A 3MV7B 1A4KB 3ARDD 1IEBB 4PJHA 4I0CC 4CN1A 3ZDZE 4N9GA 1FE8H 1Q72L 3QZWA 4LLYA 5IEHB 2XKSA 4NKOA 4NOBA 4XTRD 1ZTXL 1B2WH 5JQ6L 2IANE 4ODBD 2A6DB 1FNSH 5T3ZE 4WJ5A 4B7IA 1IAKB 4PBXA 3TBYB 1H8OA 4PJGF 4E41E 4FFZH 5A2IH 3JSSA 4GAJL 4LSVL 4B53A 3ARGA 5BQ7B 3KS0H 1DLHA 3PP3H 1TJGL 1YEDB 3WJJA 3P4OB 5T1LA 1RI8A 3DWTA 2DIBA 1I8KA 1CVRA 1C12B 5EU6E 3MOBL 4X9FA 3SE8L 3G5YB 3B2UD 3BKJH 4K7PY 4U1JA 4PB0L 1R3IH 5HYSA 3BKCL 2FIKB 2YUVA 3BSZH 3FQTB 3MLWH 2I9TB 4G8GA 4YHPA 2XWJA 5ACMA 4Z5RB 1YN7A 5DD5L 3V7MA 5K9OA 2AABH 4PRNA 1CTOA 1AGCB 5T3XL 1D6EA 2EICA 1BZ9A 5GS1A 1LK3H 2YC1B 1IAIH 4OKVB 3KWWB 5D7SL 3WNOA 5JW4R 1I8MA 4WV1B 5TE4H 2C1PA 5F8RC 3DGGB 2OXGA 3QUYC 1XIWA 2BVPB 5I8KL 3MO1A 4OUOA 2Y5EA 1RHHA 2X89D 1U8OB 2X05A 4CDHA 1II4E 1RK1B 3F7VA 3RY6A 4R0LC 5FYLL 2R9HD 3TIEB 3SN6N 4H8WC 3TZVB 1Z9OA 5TF0A 1U6AL 3MV7E 5CSBA 4XC3H 3KDMA 5DD0H 4PJAF 2OCFD 5DF0A 4ONHB 4YHNA 2VIRB 4ISVB 4JO3H 3CH8A 1LO5A 2B0SH 4XB8A 4XNMA 3TH3T 2WINA 2XZAL 2JCCA 1BIIA 3MUJA 1I1YA 5I73C 3BP6A 3CFKB 5C0DB 2B8OT 4NN5C 1G9MH 4FQXC 1NCBH 2ICWJ 2F5BL 2Q8BL 4TSBH 4V1DB 4FTVB 2UY7A 4YHIA 4LSUL 1NPUA 1KCLA 4KDVA 2DQGL 4EDXA 1TZIB 5KSVB 1K8DB 2UZYB 4XHQA 3GSNA 1IM9D 1U8NB 3D9AL 4UQ3A 1JGVH 5EFIB 4X9IA 2NW3A 2HFEA 5EU4A 1F97A 4QWWC 1CU4L 2R0KL 2XQBH 3I6LE 3K46A 5D2NC 1OAZL 4Z7VB 3UJTL 1GHFL 3FZUD 1X44A 1KIPB 4U49A 5JIIA 3V9FA 2XT1B 4BSWB 5JUEL 3I50H 1P1ZB 1IGYA 2VSCA 1P4LB 3B9DA 2ERJC 3TV3H 2IBGA 3MGTB 3B2VL 4MS8D 4XP1H 1Y18B 1T1ZB 4ONFH 3RAJL 1NFKA 1KN2H 5KVMC 3K8KA 1BVKB 3R06A 3PWLA 2D4DA 2DI7A 2NY6D 4NQVA 3SGJC 5KG9A 4XXCA 4F7MA 4YFLI 5E7FA 2DS4A 5HYEA 2J6EA 1U3JA 2PYED 4MA1B 3GSUB 2VN4A 3T08A 4R4BB 4QXUH 2ADFL 5GZOD 2QADD 3VRLE 1RUQH 2BRRH 3I9GH 1XGRB 1UB6B 1PY9A 2JJWA 4UDUA 3V4UL 2AK1H 4LPVA 4FQQA 4WO4A 4X7TA 2DM7A 5GRVL 3NIDE 3TPKA 1JPFA 3BKYL 4WUUD 1J8HA 4V1DE 3V5KA 4FTVE 4EUPB 1KPUB 1DBMH 4W6WB 5FO9A 4GJTB 35C8H 3U7WH 1G7QB 5J4MA 3F7YB 4O2FB 2HFTA 3HPLA 5I1DB 1BJ8A 4OI9A 4YGAB 5DVMA 2X1OA 3QO1B 2CXKA 1O7VA 4JHZA 3IFPA 3MRCA 2DLFL 3VXSD 3BO8A 4XWOD 1QTYT 5F6IC 3EO1B 1I4FA 3ULUL 4Z7VE 4Y4KC 5I8EA 1H0DB 5DEGA 3SGKA 3S35X 5J6GA 2ZOKA 1UZ6F 3TJHD 1YEJL 4PJ8A 3CK0L 4Y4HD 5J1AA 3K81A 3KPLA 4NFCA 5IMKB 2IMNA 3JTTA 3MLSL 4N0UB 3QZWG 1JE6A 3ZYIA 4D3CH 2H1PH 4OGXH 1XR9A 2IAMA 2AJYL 3QYCA 3O6FA 4FP8H 4DVRH 4ODHH 1INDH 3SDCA 5FA4B 4I9WE 4NZRH 2B1AL 4MAYA 5F3BA 4HEPG 1MFEL 4CMMB 4I3SL 2EIZB 3BEVA 2HLAB 5DDHB 5KS9F 1QFWM 2FYYB 3U0WL 1EGJL 4WUKL 4WWKC 2D0FA 5I9QC 3VXTA 1CG9A 1YPZA 5T1KA 2CRMA 2Q76A 1BX2A 3PHOB 4KXZH 1TQCC 5IV2B 1EMTL 4QYOB 3EJYC 2X4QB 1FO0A 1H3XA 1GRWA 3U36A 2P5ED 4ZNCD 2B5IB 5HYSG 3BZ4A 4H0HB 3SO3B 4EOWL 2ED7A 1W72H 2HTLC 3IETB 3F7PC 5HGBB 4GS7B 4ENEC 4OCXH 3RZCC 3T0EC 4JY6B 4NO3B 3BP4B 3O3DA 5CHNB 3VCLB 3P11L 4C83A 1NMAH 1EO7A 1EFXB 4PRHD 2OL3H 4YUEL 4R4ND 3X14A 2RBLA 3VGFA 2HKHL 1DVFB 4UQ2B 5E2WL 1OY3B 3PL6A 5T3ZH 1A9BA 1UZ8B 3PWNA 3TN0C 1BFSA 4PTTA 4DGYH 4BQBA 4LIQE 4JZJA 1WWAX 4L4VB 2JIXA 4N0UE 1RZKL 4I5BB 3GSQA 4JN2B 1NGPH 2PW1A 4RMSA 4AT6A 1QYGL 1CFTA 1ZVHA 3S35L 5FGBA 1ITBB 4F7TB 1CICA 2B1HL 2FD6L 5IEKB 3OBAA 3BQUA 1T0PB 5SWZA 1FLRL 1NGXB 2V2XB 3QEGH 4ZFFA 5IKCA 3VGHA 5CBAB 3JWOL 3FO0L 2C4FU 3RRQA 1YEHH 3NMEA 4CNIB 3ZDXF 4I18B 2H2PC 3ARUA 4OB5L 2QHLA 1MF2H 1TDQA 5HTSA 3BPCA 4KRPC 1TVHB 4P9HH 1I85C 2ORBH 1QD0A 4UOW0 1IARB 1NFIB 3QG7H 1KJ2B 4S2SB 4PJEA 1T6WA 1YEEH 5I30L 4LARH 3NCFB 3Q1SL 2VC2H 2ZJSL 1HKLH 1YYLH 4F2MA 1OP3H 4D2NA 5TFSH 3QI9B 4PB9H 3T2OA 5IT2H 4M93C 3MBEC 2GY5A 1PG7H 3O4LD 3RHWF 5SWSA 3MACL 5E4IA 4F7EA 2JELH 2C7UA 2EYRA 1GC1L 4Y88A 3SGDI 3DXAB 1BAFL 1BD2A 1IGIH 1NCAH 2OMNA 3AU1A 1ZT4A 2O5ZH 4OZFB 5ICZA 5GS0D 2GUOB 1X5ZA 3OKLB 4QHUA 3FOLA 3LRGA 3CLEL 3GB7A 1IM3B 4L4TE 2A83A 2R39A 4FQ2H 4JO4L 2X4OA 4ZODA 1CLZH 5CAYB 4L4VE 4X98A 3HAEG 1QRNB 2XXMB 2Z35A 4ODWA 4R0LA 4O2CA 2I25N 5D7JC 5KZCD 4ZQKB 5E8PA 2Y9RT 1RK0B 5B8CA 1M71A 3Q3GA 3PABB 3QULA 5FGSA 3MRDB 1KCVH 4RNRA 4PYHA 3P9MB 3QWRA 4LNRA 5ISZB 4HAGA 1MFDH 2FX9H 5T1MB 5BJTB 5T3XE 4MZ3A 1QHOA 5DJ8B 3PG2A 2CLRB 4QXTA 1MNUH 3WIIH 2K3TA 1V7NL 3DECA 3L7FA 2WUCL 3A6OA 3VFNA 1RJZA 3ROOB 1R3KA 4P59H 3FQNB 4NYLA 4U6VH 4A2MA 4HIXH 4NP4L 3EYFA 4KK5D 1U41A 2BMKB 2PTVA 3KLSA 3QEQD 5CJOL 1F45A 2WP3O 1WK0A 5DGRA 3QFJA 3BP5B 4NDMA 3EDDA 5DHXB 5T5FH 4ZFGH 4MCZB 5IJKC 2RFXB 3WD5L 1NC4D 4G6AD 3SDDD 4RBPK 5TH2A 5JTWA 1KULA 1Z9MA 3GBNL 4D9LH 5DZOA 3QFDB 3P0YH 3WNMA 1U3ZA 5C7XL 2H3NB 2XWBB 3DXAE 1QZ1A 2DN7A 1Q0YH 5FO7B 1ZLWK 1JWMB 3G6DH 2KDGA 1EBAA 4PJ7A 4LKCB 4RRPA 4UT9L 4YXKL 4BH7B 2NXZD 3TGXA 4ZDHB 2AI0L 3PJSB 2AEWA