1KN4H

Catalytic antibody d2.3 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG ANTIBODY D2.3 (LIGHT CHAIN)
publication title Remarkable remote chiral recognition in a reaction mediated by a catalytic antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4H02
1YEDA 2WUCH 3PP3H 1ETZB 4QRRD 4OD3H 5GRZA 4C55A 1U8QB 4JY5L 5ITFB 4N8PA 3C6LB 2DQTL 2MHAA 4G7YL 4PG9B 4E9LA 2ZSVA 1P4LB 4OCWL 2JCCB 4QOKD 2VXSL 4PS4L 4D3CL 4MAYD 3L3IB 2HT3D 5EOQH 3SHSA 3ARGA 2OBGA 2W07A 3UTOA 4WEMB 1F4WL 1WZMA 3DVGB 4K3DH 1AO7D 1REIA 2CRYA 1S7WA 5F89B 3BPOB 1UM4H 1S9VA 2A74A 3D39A 4LLMB 4DKDC 1T66C 4Y19E 5M7QA 2Q3ZA 1BIIB 1F4XL 3ISWA 3NH7L 5JHDE 1R5VB 2FGWL 3NACL 4HS3B 3RWIB 2QQLL 5FYLE 1A3RH 1ZVHA 1FV1B 3UTSB 3TC9A 3SDXB 5ENWB 5JOPD 1EUUA 5CEZL 1KULA 4AIOA 1JGDA 2HFTA 4N1HB 4UOW1 1OCWL 2ED8A 3HI5L 4G9FE 1HXMB 1XF5A 4KJQD 1D5XA 3QHZL 5E4IA 5F9WC 3QEUB 4ELMA 2CO6B 4NN7B 4FZEL 4QHLB 1VHPA 1T2XA 2ENSA 3FJTA 5D7IA 5DRNB 5I1JH 5MI0C 4IDLA 3MREA 5GS1B 4Y4HC 4TVSa 9CGTA 1JNJA 4EOWH 5DD1H 5D9SA 1OM3H 5E08L 1KTDA 1MUJA 3HUJE 5IFJB 2D0HA 4MWFA 3H9SD 3C5JB 2O61B 2LTQB 3BDYL 1JPGB 1T0NA 4JVWA 2X4RA 2WBJC 4BA8A 4LOUD 3VXRA 1A2YB 4GS7B 5DJYB 2OL3B 1CGSH 4OZFB 4ODWB 2ZCKL 4C57C 4PJHF 4R0LB 3UTZB 3MUY1 4M7ZB 2L7UA 5EORL 4YE4H 2E7CA 3MNZA 2ORBL 1LO0H 5HPMA 3CXHK 4TPRH 1IC4L 3PNWA 4M1DH 2NXZD 3UXFA 1Z0NA 3N1FC 1KCVL 3QEUA 3PDGA 4MD4B 1ES0A 2JTDA 4NRXB 3VFWB 5IK3B 1RHHB 2EDRA 4Q97A 2AK4B 4YGAB 3OAUH 1HHKB 1UB6A 2E9JA 5GS1A 3LEXA 3QO0A 5FFLA 1KOAA 3U36B 3U0WH 4L3EA 3SDDA 4NYLB 5DUPL 1R3HA 4JFDE 1LQSR 2A73B 2QL1A 4BSWB 3W0WB 2JJSC 5IFJA 4QRPB 3CFKA 3CX2A 3VGAC 4YFDB 2J88H 4GG8A 4NFCA 2ADFL 2KUTA 1JPGA 4HIEB 3RNQB 3W5MA 3A67H 4FRWA 2FECL 1R3KB 4XBGB 5E95B 5KSBF 4Y4FA 5JORA 1A2YA 5DMJB 1V3LA 4IOSD 4HJ0C 4ODWA 2J8HA 2WBJD 3CFEA 3BKYL 4K07A 1A6TA 1JPFB 3UJJL 3FO9B 4UT6H 2VN7A 1WCBB 1WFNA 5T3XH 1N5YH 4DWHA 1UZ8A 4LLUB 4JDTL 3W5NA 5H35B 3FFDB 2R29L 3MBEC 4NRXA 3VFWA 1RHHA 3PDOA 5MEQB 4YHNA 2EDWA 1RUQL 4LSPH 5GHWH 2C3GA 4OSUH 1L7TL 3DYMA 3RTQB 1V3MA 1X9QA 1G84A 2BHZA 1JYNA 4QTIH 1CIDA 4K71B 1FZKB 4PGEA 2V7HA 4L29B 3CD4A 1C1EH 3TEUA 1X5GA 3VXUA 1YUHB 3QZWG 4OF7A 3O8XB 4GRMA 3C60B 1I8IB 2BNRD 6FABL 4ZTPH 5I1CL 3JV0A 1PW3A 3V7AE 2DQFA 5C7XH 2XOTA 4Z7VF 1YQVL 3RGHA 2VL5A 5HHOD 3WUWB 5B4MC 5D5ME 3MRPA 2LAAA 1S3KL 3GSNL 3W39B 2XNAA 3RTQA 4DFHA 1C12A 3DUUA 4J1UB 1S78D 3VXTA 4FG6D 5EBMA 2YD2A 4L29A 4WI8A 5T3ZE 1B0WA 3QEGL 2MCG1 3VGBA 2GUOA 3MRMA 3UTTD 2BHYA 3OR7A 1NUNB 1MJUL 1ZHKB 3MCKB 4ZAKC 1NC4D 1NEUA 1N59B 1QFWM 1EEUA 3M1BA 1LE5B 3IU4H 3N85H 1KN4L 2DJ4A 3MLWL 2YUZA 3PGFH 5HHQA 1YN6B 1CG9B 2D03H 2KDGA 3OG4B 5I18H 2EKSB 4M4PA 3HC0A 1FNGA 4G6ML 2IPUG 1J05B 5C0CA 4UI2A 2KZWA 2NY2C 3CMGA 4MXQC 4FQJH 5TJWK 4PRPB 3HG1B 2JB5H 2E7LA 2V2XA 3VWJA 1YYLL 4HFWB 5KVDH 4WCYL 1FHGA 5DHVH 4TULL 4ALAH 2H1PL 1EGJL 4DUXA 1DQQA 2G5RA 1U8JA 3SGEH 1FC1A 4IIQB 4N0UE 4AENB 4U1LA 3MRGA 4J8RA 3KLHD 5EIIB 4ZAKD 4KQ4H 2WZPD 4ZFGH 3SKMA 2OCFD 4HUVB 3DX7B 2BVQA 2IBBA 2QADD 4H0GA 3S88H 3OB0K 4OLXH 3WFEH 1K4CA 4KKAC 5M95B 4DZBA 4ODSH 3DX9A 5FCUL 2F53D 4YWGH 2WUBH 2WLYA 4WUUD 1Z3GL 3BN3B 3HG1A 1XF3A 2PW2A 1IT9L 1UC6A 1NGWB 3D3VA 3HNSL 2GK2A 2P24B 1T83A 2X9YA 4Q9BA 1KB5L 1NFIB 4KK9D 3CSPA 3FRUA 1VFMA 2RHEA 1UH4A 1LD9B 3WE6B 3BXNA 3RVTC 3P2TA 4XPBL 2VSDA 4OZHF 5F21B 1IAII 1BEYL 4L1DA 3SDYH 2H2PC 1P7QA 2HFEB 1SJHA 5I1HH 4D9LL 4OCNC 3DECA 5DJAB 1QSEA 3ZDYE 3VDBA 4XB7A 3O81A 3TO4B 2XT1B 1CLOL 1WTGT 3MBXL 4OZFH 4GW4B 4JQXC 5D1ZA 5E00B 4H8WH 1BQLH 1G7LA 1HOCA 2A6JA 3RBSA 1EHAA 4Y16B 1RUKL 3KLDA 3CC5A 2GIYA 4P2OA 1HILA 2P24A 1CXEA 1FGNH 1KJVB 2PF6A 5J56B 4NRYB 1X5ZA 3MACL 5EU6D 4LVEA 1TCMA 4K2UL 4QLRA 4G5ZL 2XYCA 2BSSB 3RVTD 4XVUD 4YPGA 3B8SA 2EYSB 4S1DD 5KANG 1SY6A 2AP2A 1EEQA 4K7PX 3MCLH 1KELL 3NCJL 5T5NG 4PJXA 2YD4A 3FZUC 3EFFB 4I2XB 4KROC 35C8H 4QHKI 3O0RL 5GGVY 4XVJL 2IBZY 3MGTA 3NCCB 3BRDA 5IB2B 4GRWB 4HF5H 1EV2E 4M6NL 5DI8A 1VGEL 2PYFB 3PGDB 4IOFC 2IANA 3GBML 5CS7A 2HRPH 4KDVA 5I0DA 4XMKL 2VDOL 1F3RB 2VDPL 2BVPA 3TNMB 3ZLQC 4JLRA 2JJUA 1NCNA 1MH5B 4HDIB 3MLYH 3VFOB 4IHOB 1K6QH 4LGSB 4S2SB 2ESVE 3HR5A 3C8HA 1RZFH 4U1NB 1ADQL 4RMUA 4RMVA 4O58H 1JPTL 4DVRL 4HUXB 1XT5A 1IGTA 3BZEA 4JFYB 2D9CA 2OTPA 4BM7A 4Y2DC 4F3FA 1U95A 1D9KA 3BGFC 4KROD 4LEOA 4HWEH 5IT2H 1N0LA 4HD9A 4OAWB 5JA8B 2Z91A 3LQMA 1WFUA 2I9LB 3SJVE 3HC4L 1MCOL 2FWOA 1ONQB 4XPAL 1MLBA 2CIKA 4ONFL 3DBXB 3NTCL 3LQZA 4NO2B 2VE6B 4MB4A 3VD3A 4ZDHA 1JNLH 5EC2B 1LDPL 4PJGA 1AHWC 2R23A 4DN4H 1S7RA 5C9JB 5T33H 2VWEC 4PREA 1B0GA 2JELH 3F7VA 4S2SA 3OAYK 5DRZA 4QHUA 2Z35A 4ZFZB 3EDFA 4D2NA 4HAFA 2QSCL 1RZKH 1IGML 1NEZA 3ULUL 4IRJB 4I0PD 3R06A 4D0CB 2YHGA 3MJ7B 5BS0B 3CVHL 5DLML 5GSRB 1VGKB 1HH6B 3EO1A 4WY7L 4LRIA 1QZ1A 3U0PB 5K9JL 2ZG1A 1RJYB 1Q94B 2WUCL 1T2QL 1CK0H 3WKML 4OZIB 2CO7B 3MRLB 5GS2D 4M1GL 2UYLB 4HS6A 2EE2A 4EN3B 5TGBA 3O2WH 2P47B 3PGCB 1EXUB 4K7PH 2OJEA 4PJFE 1K8DB 1JZ6A 4NT6B 5HHPB 1AQDA 1N0XH 5ISZA 5E9DE 3GKWH 4RA3A 2Y23A 3LEVH 1ZLUK 1SJEB 1ZLWH 1FGVL 3LN5A 2Y1VA 1OTUC 2EDOA 4CDHA 3DXAD 1UG9A 4L3CA 4NQCD 1A64A 2IGFH 2P48B 1AXTL 4Y1AB 2CXKA 1A3RL 3H2WA 3SKNB 3X3GH 1LP9A 1X5AA 4X6BA 4MNHB 1A22B 3TO2A 4O00A 3SGEI 3KDMA 1KXTB 1RJCA 2FJGA 2UYLA 4I9WD 4KZEH 3VXQA 3VFSA 1PJ9A 1L7IL 1FYHB 2EDEA 4TVPL 1G7QA 2NX5D 2WP3O 4LVNB 1INEL 1F3DH 1VADB 3E2HC 5HHPA 1MAKA 2X4NB 3MLSH 4EUPB 3GIZH 4M6AA 2F54B 1UJ3C 4WI7A 2YUWA 5DD1L 5IG7B 4MD5B 4CAGA 1XGQA 5BJTB 5T1DL 3MUJA 1C08B 1IKFL 4DUWA 1AGFB 1CLCA 2V17L 2IMNA 3QQ3A 5ESQA 3T0ED 3HAEB 1I8LC 3IT8D 3H9HA 3KPLA 2NTFA 2NZIA 4RAHA 4YHML 3P0YH 2FR4A 5D7IE 5SWQA 4I5BB 2GK0B 3D25B 4TPRL 4FOMA 3G5YA 1MCRA 2HJLA 4BFIA 1U2HA 1HKLH 1VADA 1A5FH 5DS8A 3ULUD 3FKUS 2EE3A 4NHUB 4RMWA 2JJTA 3OAUL 4OZGE 4HC1H 3TA3A 2VLRE 4HIIA 4QYOA 3BH8B 2P8LB 1YC8A 3FRPA 1C08A 1WT5A 1ZTXL 1N6UA 5ERWB 2HT4C 4P23B 3KJ4C 2BVYA 5DK2B 5GZND 1CFQA 4HLZH 4Y19B 4NKIH 4ZSOA 3IFLH 3FFCE 2EDXA 5JHDB 2QBWA 2ZOKB 1I9JH 3W2DH 1OTTD 2FL5B 1A9EA 1I9RL 1P84K 4FABH 4ERSL 3PQYD 1NUFA 4AG4H 2H32H 3WL9B 4GRWH 4Y5VC 2Z4QB 1FBIL 4HJJH 3D85B 1P1ZA 3H3BC 4G9FB 4IBLT 1DBMH 5EO0B 4E41E 2XXMB 5L2JA 5GHWL 3SGKA 1I9IH 4YHIA 1D6EB 4D8PB 4Y7MA 4JO1L 4JFFA 4NO3A 3N06B 3BH8A 2UWEA 4G8FB 4UNTA 1J87A 1R24B 1T80A 2V5SA 1RI8A 3PWNA 5EZJB 2PYEA 2XI9A 2DD8L 4LSDA 3HUJB 4AEFA 4PRAA 1W72H 1A7QH 3DVNB 3EYFB 4AIZA 5TF0A 5TQ0L 4TVPD 5LKNA 4U0QB 3QUMB 5I6XB 4X4XA 1OGAD 4PGZA 5C7XL 2EDTA 3A6BH 5CP3A 1K9TA 3QIUD 1OAUL 2E27H 2FGZA 2PETA 4EJ1C 2WAHA 1PX4A 1AY1H 5HSFA 4D8PA 3O45A 2HFFA 4YHYB 1VCAA 3TZVD 3FHAA 3K0WA 4QRTA 3VFRA 1IM9A 3K46A 5CILH 4JFDB 2W59A 1D5IH 1OT2A 3QIBC 3QUKB 1W0VB 1BGXL 2CXGA 3EYFA 3T2OA 4YHZH 2V5YA 1G6RB 3L5JA 4JRXD 5L8KB 3IU4L 5A2FA 1BQSA 1R3LB 2CKNA 4UTBH 3HZYA 1FG9C 1Q9OA 4LVOB 4P99A 1DN0A 1IAMA 1GGYA 3JV4B 4WWKB 2A6DB 4LK4A 3EYOB 2G9HA 2VNCA 4FQJL 1BAFL 3H3PH 2UZIH 1NAMA 5GISH 5FUZH 1ZANH 3DMMC 4KPHH 5FUCC 2X1XR 5D2NE 2XWTB 1U8LB 3RDTC 1DEEB 1DTUA 1IL1B 1Z5LA 2AK1L 1B90A 3E8UL 4JG1H 4KQ3H 1PDKA 5EUKA 4ALAL 1JWSB 4MX7B 5JIHA 5GS0L 3TVMD 2AJSL 5H37H 2OTUA 2W0KA 2Z8WC 3QIBD 4LLDA 1DBKL 1YMMA 3ULUF 1TETH 1YPZE 5C0CE 3VJ6B 2AI0L 2CLVB 3T2NH 1T1YB 5F93C 4ZFGL 1FL6A 4P4KA 5I73C 3P73A 5CD3B 1BJ8A 1CXLA 1R3LA 4F33B 3FHQA 3FOMA 1JFQH 2WIIB 3QJFB 3HS0B 3IDXH 4PRHD 4H26B 3T8XB 2G2RB 2KBGA 3TJEH 3LKSB 1X7QA 4ODSL 5D96C 3WNLA 5C6PB 1SVCP 2HVJA 1F58H 1FVDA 5D5MB 2NY7H 4KRNA 4P3DB 2IFGA 5CCKH 1HXYA 5AEAA 3U9PH 3NZHH 1FLTX 2C4XA 1CXHA 3EDEA 3O2VL 5CJBA 43C9B 2IADA 4EUPH 3LD8B 3P30L 2HVKA 4GSDL 4XNQA 2J12B 5E5MA 3L3KB 3N0PB 4HIXL 3DSFL 4F33A 3CLEH 1QKZL 3QB7C 2DLHA 5FDYA 1ZA6B 3VRLF 5ILTL 3ILPA 4PJ7E 3F6IA 3BO8A 2WIIA 2JIXA 3FO2A 1B6DA 4MS8C 1CR9L 4WI3A 3DTXA 4H8WL 4YFLI 5TE7H 1BQLL 4MGXA 1KGCD 3V6ZA 1MJ8L 4RGMC 3MV9A 4YHKL 1IEBA 1CD8A 1KBGL 2WWMD 1FGNL 4KUCD 4HWZA 2OTWB 4MQTB 1YEIH 4QY8B 43C9A 1I85A 3EDDA 2HKFH 4HUUA 5C0RH 4EI5C 2OR8A 1BF2A 2G5BB 3C2AH 4FQ1H 2C7UA 4M62L 3TBYB 5E6IC 3UBXI 4OV5B 4Z7OE 5IJKC 3HMWH 1DJSA 3H9YA 1LWRA 3HCVB 3U7WH 4MQXD 4N0UB 4RZCA 3WFBL 1SJVA 3EJYD 1R5IA 4M3KB 2BSTB 5I8CB 3VRJA 4UOW0 5JW5A 1RMFL 5FYLH 1H8OA 1NFDB 1HHJB 1U8NB 3O4LB 4JO3H 4KRLB 1EZVY 1FYTD 1BOYA 5IESH 2Q87A 5GS0D 2DWDA 1ITBB 3GUTA 1K3ZA 4PJHA 4GBXC 1MHPH 3QWOA 1A7RL 4BH7B 1UWXH 1ZLSL 5E6ID 1FO0A 5TFSH 3V6OE 1BD2A 3SDCA 4H8WC 5HXMA 3LDBC 3DRQB 2Z0BA 2BSTA 4JCLA 5JW3H 1G1YA 4YO0A 3G6AB 4O58L 3T1FA 1Q1JH 5F44A 5K9QG 2DYPB 3H0TA 1NC2B 4NQSB 1NFDA 1YY8A 1KCKA 1QRNB 4LCWB 3QUMH 4PV8A 3S36H 1TVBA 3WFCH 1H0DB 3EOYG 2VLMD 3IYLW 2NW3A 3RY6C 3O4LA 5DHYA 4F7CA 1KCSL 2AXHA 5INDA 3VCLB 5KSBA 4NKOB 3KR3H 5TE6H 3O3UN 4KJYB 1ZAGA 4ZFFA 1MFEH 5DWUL 4LCIH 2HTLC 1JGUL 2YPVH 1AP2A 1XCQB 1T5WB 2X7LA 3PG2A 1EERB 4OCXH 3HPLB 2J4WH 5I76A 1T7ZA 4JANB 5FB8A 1ROWA 2H45A 3LMJL 4PPTA 2JELL 1NQBA 2BY3A 4MDIB 4BFBD 1I7UB 2CDGA 3CDGB 2HN7B 4CVUA 2YPKB 4N8VB 5BZWB 1DLHB 4HAGA 3BZFB 1BQHG 1FN4B 3JWDL 3NN8A 1G6RH 1XIWB 4LCWA 1QRNA 1BQUA 2AEPL 2VZOA 1S7QB 1HHGB 1WAAF 2PTUA 3K74B 3WJLA 4FZ8H 3EDJA 4PJIF 4RGNE 1T04B 4JZJA 5F6HI 1MFBL 4G8GD 4QOKA 1HE7A 2VQ1B 3BRFA 3CPLB 5GGRB 4CW1A 1RFDH 2QHLA 4MAYA 1B9ZA 3RWFB 3BW9B 4HZLB 5CLWA 1S5HB 1HSAA 4HKZB 4Z7VA 4WO4D 4IS6B 2P5ED 5I1GH 3RA7L 2X9XA 3HMXH 1DLFH 1GPOL 4K8RH 4JPKH 1J10A 1I7UA 3WEXB 3VXNB 2HN7A 2O5XH 5F88A 4KUCF 2ESVB 1B2WL 4YPJA 2NY1C 2X4SA 1G7JA 4NNPH 3HNVH 2VXQH 3BKMH 2BY2A 3M8OL 5JPNA 2IQAA 3S6CA 5MP6H 3H7BB 5F70A 3W9EA 4URTB 3MNVA 5FYJH 5C09D 3X3GL 3G08A 15C8H 4PRNB 3SJVB 3WDHA 3BW9A 4A6YB 5C0AB 2IH3B 2B1HH 3B2VL 4IS6A 1CXKA 4YEEA 1QHPA 1KG0B 1XGTB 2AJUL 1IILE 3GMOB 1KLGB 4LCYB 5E2VH 4I3SH 1XGRB 3OKOB 3F7YB 5E99H 1TPXB 1BZ9B 2D2OA 5SX5H 2V7NA 4G6FB 4YAQB 1OOAA 4NJAH 3L5XH 3VWKD 5IMMB 1QSVA 3TPUB 2OX5A 4GKOA 3GFUA 3SKJH 3TBWA 5F7WC 4MMZC 4OD2A 4ZXBC 3MFFB 1JNHB 2QQQA 3GJEB 4WV1C 2NXYD 3H7BA 4WU7A 4ORGA 4JKLA 4R90H 3FB8B 1P7KB 1EPFA 3RZCC 5C0AA 1IAOA 4XP5L 4OKVA 4W81A 5FDWB 3G5ZA 4PJAF 1NGQH 1E6OL 1IC7H 1EFXA 2NY6B 1HKLL 2F5BH 3GMOA 3ZL4L 5FKAA 1JF6A 4XNZC 3MNWA 5KOVC 3OKOA 4PJFB 2GCYA 4HC1L 2MCPL 3C5SB 1UXSA 4J3OC 4PJ8A 2R0LL 5E9DB 1VEPA 2DBLL 5DD0H 2F8OA 4NZRH 4OLWH 4R96A 3TBTB 1A4JA 2X4UA 4OZHA 8CGTA 5C92A 3MLZL 1RZGB 1C16B 2VLKD 1KT2A 4XNYH 2NY3D 3ZDXF 1P7KA 5DVOA 4YC2C 2E5EA 4LCUB 4AG4L 1Z2KA 2H26B 4WFHE 3WS3A 4AT6B 5ESAA 3VE0A 1H3VA 4O4YL 1OARH 1P9MA 1SYSB 3AU1A 3RVUC 1QBLL 4MJ6A 5HGAB 3LB6C 3EOAB 4RAUA 4L8CB 4ZSOE 3X12A 2XRAH 2ZUSA 4PJCF 4XP4H 2AXGA 3ROLB 2BNRA 4J2XA 4LHUD 5ETUA 1PG7W 3QFJD 2GHWB 2OM5A 5FF6B 2BOBB 3MV8E 4OIIL 1MWAH 4H0IA 2PXYC 5HHOA 4BUHA 4FQXD 1H9VA 5GGTA 5T5FH 1TTFA 1R0AL 1YYML 5D1QC 4LP4A 4YHLL 2HYMA 4JFHD 5D1XD 4KJWC 2LVCA 4LKXA 4DCQA 5GRYA 5IB5A 1K4DB 4WJ5B 4BFGA 3HPJB 1TDQA 4BK4A 1O0VA 2PYEE 4JPVL 1KF9B 3RVUD 4FS0A 1AE6L 5AD0A 5IEKB 1GVIA 2AXJA 2ZUVA 1NC4A 5C2BH 4OZGB 3WS6C 5HHMD 2VLRB 1QBMH 2VRAA 3GSWA 1X4ZA 1ZVSA 3OKNA 4HIHA 4KRPB 4PJEF 1J1OH 1D5IL 3MZTA 2VZ1A 3PJSB 1F6LL 4M93C 3MV7E 5FCSH 5EBLB 1TVHA 5J4MA 4F7MB 3EOTH 3FFCB 3UJTH 3Q48A 4JCMA 2Y5TA 5EU4B 5D2LF 1P69B 1NAKH 2FHBA 3IDNB 4KJWD 1ZA3A 4OF3A 3I50H 5I1DB 1NLDL 5BW7C 4NP4H 5J7CC 2F5AL 4MHHI 5FUZL 4E41B 2XA8H 4JY6B 3NIGF 2QKIB 2AJYH 3MGOB 3F58L 4JJ5B 2BX5A 3RGVD 4PJ9C 1UWEH 2W1NA 3QPQD 1JUFB 1C7TA 4HHAB 3ARBB 1CL7H 3RQ3A 1Q9WB 5EU7E 4JHWH 2MFNA 3ZKXB 2VLJD 3DX6B 2F53A 4F7MA 4RWYH 1I1CA 5IMKB 4YDVB 2X4QB 5GSVA 1T1XA 3IFPA 3OWEA 3MLPA 4FN0A 3TJEL 3PWPD 3ARFB 1RQ5A 5BOZG 5ID1A 4U6XB 1A6AB 1CE6B 4A6YH 3KPOA 1F58L 4WW2F 2Z31A 1HQ4A 5CCKL 1ZEAH 1DSFL 2E8YA 3NCYP 2CUHA 5J8OA 2QKIA 3O3EA 3BQUD 3IB4A 3MRFA 1DCLA 4U4BA 4X6CE 2KQMA 2NQCA 5E70A 1JUFA 4KTDH 5B21A 1MHEA 1X6LA 5SWSE 4XCNB 3EHBD 4YBLB 1UCBH 2ADIA 4AH2A 4KKCD 2VZUA 3MJ8A 2VDQL 5A3ID 3D18B 4Z9KB 1FG2B 3BPNC 1G6VK 4ONOA 1EJ6A 3S37H 3ARFA 4IRSD 3MC0A 4U6XA 5TE7L 4KHXH 4AQ1B 5I1KH 1NCUA 4PGCB 2J5LB 3HRZB 1MI5B 5H94A 2W9EL 3TCLB 4J3SA 5I8KH 3MUGA 3SGJC 5C0FB 3IU3B 1YEIL 3C5ZC 4NBXB 3U2SB 2KQNA 5D2NB 1AKJA 2HKFL 3IKKA 3IDMA 2R2CA 2VUYA 4P49A 1A14H 3CGTA 5BRZD 5JHLH 3HMWL 4TUOA 1AI1L 4HXAH 4JFED 2ZUQB 3U6RA 4RGOH 4X98B 1WBYA 4Y4KB 4JY4B 2R4SL 2GITB 4O2FB 1EGJA 4WDIA 5C0IA 4FTVE 3WXVH 4BZ1H 5CEXB 2FLRT 1CTNA 5ECJE 5C0NC 4FQQB 1KEGH 3MRKB 2Q86B 1NBYA 3CAFA 3VFMA 1GOGA 1A6ZA 1YQ2A 4YXLL 1MI5A 1UWGH 4JO3L 5K33A 4XPGL 3IJSB 2L0DA 3L3GB 5IESL 2Z92A 1A7OH 2H6PA 2ZNXA 1JMZA 3IF1B 3ARVA 4RQQB 3I2CH 1I1AB 2IAMA 3C5ZD 5CJOL 1YEFH 2ZZUT 3AREB 1JWMA 4RRPG 1I8MA 4R7NA 5J1AB 2GFBA 1CS6A 3L5HA 1KIRB 3X17A 5TFSL 3IFOA 4P46B 4Y88A 5I1IH 4QHKJ 4ZUVA 3RWEA 1UVQB 4Y5YC 1HCFX 2XICA 3KG5A 5JZ7C 5KSAB 2HTKC 4L4VE 4M9OA 4F2MA 5IQ7L 3CFDB 1Q1JL 1UQSB 2ARJA 2GY7B 3NCMA 4MNQD 5D7JB 5TQ2H 1MF2L 5CD5C 1JNNL 4PJ7B 3WFCL 3GNMH 5LG1A 2P44B 2X4TB 3TGXA 4XH2A 1J8KA 1QSFE 1J8HA 4YHPA 3G5XB 4TRPL 4NQDE 5TE6L 3FOLA 4RQQA 2DQHH 5C07D 2ZCLL 4LCCB 2YPVL 1OGTB 1GC1H 5CJ8A 3NFSL 4YBHA 4XTRD 1X5YA 3N9GH 5J1AA 3KPRE 4GKNB 4I0PA 4GAJH 4MZ3A 4OCXL 4E42A 1YECH 2EE9A 4KKBC 5L88H 1HYSC 5KSVA 4NO0A 3LRSB 3M17A 3PF2A 4G9DB 4F58L 1YNLL 5JZ7D 5E2WL 3BGMA 3CFDA 3IETA 3C6SA 2O93L 5DURB 1HHIB 1OHQA 3EYQC 2PNDA 4Q6IB 4DJMA 3G04B 1VERA 3BMVA 3IDJB 3LEYL 3T0XA 3D1MC 4JAMA 5TE4H 5ICXA 4CVXA 4GMSH 1Z9SA 3QXWA 4GAGL 3NA9L 4HKBA 2BNQB 1LO4H 4J4PD 4L4TA 2A1WH 1T7YA 5EZLA 1IGJA 3MO1A 5I1GL 5I66A 4X6EB 4QRRE 3HMXL 3SPVA 1A6VH 4X5LA 5D6DC 3WN5B 4NQCA 3CCHB 3JV5A 2YUXA 2ZSWB 3KPSD 4KXZH 1ZLVK 3WFZA 1GSMA 3I6LD 5JDSB 3MTRA 4QOKE 5DO2C 1HHIA 5I8EA 3CLFH 3NZ8B 2ZUWA 5F3BB 1U8PB 4HG4J 5I16B 5ACMA 1AD0B 4MCYA 3X3FH 3QHTC 1MCWW 1AO7E 2LV4A 2NX5A 4NGHL 4NC0B 1HNGA 3BMWA 3VDCA 5FYJL 5EBWA 3KLSA 3I6KB 5HGDB 5I9QB 15C8L 4J6RH 1CL7I 2BNQA 3D2UA 2XTJD 4H20H 3K2UL 4C56A 3B9KC 4X6EA 5KG9A 4NKDB 5E2VL 4I3SL 5BQ7A 2R56H 1OAYH 3T0EA 4I18A 5HYJD 4MZ2A 1U91A 3NBNA 1IZKA 5MHSD 4D9QD 1IGCL 1HINL 3BKCH 1AGDB 2Q8AL 3NPSC 3ZTNH 4X4YB 2OZ4A 5K9KA 4G6JL 3CXDL 3QCUL 5IFHH 3DGGA 4OUUA 1JTPA 4U7SA 3T09A 5F1NA 2FEDD 1GAFH 4JM2D 4RGNB 3H9SE 4K8RC 3I6GA 3ARPA 2WLZA 2R2EA 4XB8A 1ED3A 2WWKT 4CVZA 3B9AA 1XGUA 4F57H 3RX8A 2G75A 3QULB 3PWUB 1WC7A 2F5BL 3QDAA 4KJPC 3V4PH 2JB6A 3UO1L 3O6KL 3LHPH 4HK0A 4YDJA 1HIML 3RX7A 5ID0B 12E8H 2I24N 1YEGH 2D9QB 5FK9A 5IHUH 3FTGB 3DIFA 1NKOA 3IXTA 1OLLA 4GQ9L 5FGSA 4X7DC 1XGPA 4KMQA 4RFNB 3QNYB 3O6FB 5DD0L 1Y6KR 1XCTB 3AXLA 1AGDA 4XGZB 5D70H 4APQC 3PQYA 5EUOF 2ZOLB 2VISA 4RIRA 5E8NB 1MLCB 2APTA 2ED9A 4H5SB 4M1CC 1A1OA 3JTSB 3AMLA 4AJ0A 2FD6L 1QBAA 3OSKA 4PJDF 3Q3GB 3GB7A 4G8IA 4HPOL 3UX9B 5AYQA 43CAA 1LK3H 3MA9H 4JZNB 4YK4B 1QVOA 1QFWH 5DRWB 1GXEA 3BP7B 3H42L 2W0FB 3QUZD 1T5XA 2CKBA 4JM4H 4M48H 4BFEA 1S7XA 2VXTL 1E4XH 3MMEA 3O2DH 3ULVD 1PEZA 4OI9A 4P5TB 2MQ3A 1SBBA 4IJ3B 4R9HA 4XPHH 3G6DH 1SYVB 1OGAA 1BVKA 4R26H 4ODTH 3P4NB 4O9HH 5T5FL 5DQJB 3REVA 3SKOB 3PL6B 4M7LL 1BBDL 3KYKL 3QIUA 3QZWB 4NPYA 4RAVB 5IB1B 4OQTA 5CEZE 3AS3A 3HE7B 2LU7A 4R97B 4UOJA 3TZVA 1PQZB 1WEJL 3FB6B 4X6DF 3DOSA 3R0NA 5D72H 4XXDB 5FA4B 3STLA 1KEMH 5HVHC 5MENE 1DVFC 1U92A 4UIKL 4WNQB 1I3UA 1FCCA 4MDJA 4U6YA 1I3VA 5HHOE 4HGWB 3C2SA 1JGVH 5C2BL 3PHSA 4JRXA 2EH7H 1QBML 3WJJC 3SCMB 4Z78A 4NRZA 2YD5A 5L0QB 5CJQH 5E1AB 1AD9B 4EDWL 1J5OL 3PP4H 4GJTB 2V2WA 1WZ1L 5L8JB 1YZZA 3D48R 4HIJA 3UJTL 3UTTE 5EC1A 1FAIH 3KXFD 4L8SA 3LN9A 1CFTA 5GGQL 5IB3A 3OJDA 4JKPH 2ZPKH 4MB3A 5I30H 3I50L 2PO6C 3ARXA 2F15A 3VU2A 3PE9A 2ENYA 3HZMA 4GMTH 3LKQB 4BQCA 4P4RB 4Z7UF 3VD4A 5KTEH 2EXYD 3P9MB 1SY6H 2H41A 1N2RA 2GTWA 4O02H 2BRRL 1OAQH 3GIVB 4JM2F 1KYOJ 2OMBA 3UAJC 4MD0B 5IJVA 3LAFA 1UZ6E 4GRLA 1IC5H 1WWAX 3BHBB 4P2RE 4F80A 4JDZA 4GW1B 2I07A 3U4EB 5F3HA 4K7FB 4Y8DC 4LHUG 4M6OL 5INCB 3MV8B 3RPIB 5TH2B 1ZS8B 2VUOA 5I19L 3R1GL 2MKLC 4PGBB 4NZUH 1IFHH 4OF6A 4X9BA 1D6VL 1MJJB 4M02A 4RRPA 1DQMH 4KZDH 1FNEA 2BNUB 2PO6D 4OLVH 1MHCA 3O9WA 4KXZI 1WAAA 4OCSL 1M7DB 4Z7WA 3FO0L 4PJIA 4P3CL 3IDYC 2DQUH 3GIVA 3RUGF 4ELKA 4WUUE 5KS9E 3UAJD 2RCSH 4LP5A 5LQBH 5JO5A 3V4VH 5ADOH 4CN1A 2GI7A 3JXAA 3UTPD 1OSZB 2IPKB 4Z7QF 5INCA 3I3DA 2FSEB 2Y36H 3V0WH 4BZYA 3FMGL 4XRCB 3MV7B 1JTTA 4ONGL 3U0TB 3ULVF 3REWB 1NGXA 4JFQA 1UXWB 4UQ2B 3HE6A 5I75C 4NWUL 2BSRA 4JPIB 2V5TA 3W9DA 3OKMB 2HLAB 3TV3H 1CXFA 4JGMA 4LARH 1E4JA 4ZO9A 1HHHA 1W0WB 4LF3B 1FPTL 3ZT5A 2YA2A 4J3WA 2DM7A 1CD1A 1M05A 3FQTB 5I8KL 3ES6B 5CBEB 5J13C 1NMAH 2R0ZH 4JN2B 3QI9B 1ZGLM 4N5UA 2EEAA 2BMKB 4ZYKA 1FNLA 1FJ1B 3U1SL 4PRDB 5C6TH 4J23A 4XC1L 2PUQT 4NDMA 1ZOXA 5JTWA 1RIHH 1F3DJ 2FX8H 5JHLL 2VXVH 3WHXB 3GJFB 1S9KC 5EU6E 1A1NB 1XH3A 3U0TA 3V0VA 2DLTA 5IEHB 1IE5A 4DGYH 3T2QA 3VXOA 1EO7A 1FYTA 1F3JB 4U6VL 2WSKA 2ATKA 2ITCA 3JV6B 5T1MA 4QF1A 1FVCA 3F6LA 1CE1L 5E5UB 3T65B 1Y18A 2H8PB 4TUKH 3LZFH 3KNBB 3ARDD 3WLWC 5I2IB 3GI9H 2OR9H 2AJVH 2R1YA 1DE4B 4PP1C 4CKVX 1ZGLA 1M4KA 3UZVB 1TTUA 5CWSA 5DDHB 1VFAB 3VRIA 4KAQH 3I2CL 1OW0A 3BE1L 1BJ1H 2R1WB 4X6CB 2H3NB 2JLLA 2EYTB 5EN2A 4JO2H 4PJAA 1V7MH 4UT9L 3WHXA 3H9ZA 4PJBE 4MJ5B 4MXVF 5SWSB 1A1MA 3LPGA 5GGSY 5BCAA 3QUYD 4Z8FH 1F8TH 3JV6A 4DOHE 1QFWI 4R2GC 5C0BD 3RJDA 1QFOA 3KNBA 4N0YH 2EXWC 3O3BB 4X7CC 3D69B 4JKKA 4P2YA 2FO4B 4PP1D 1BVZA 5JOEA 3R4DA 4ZD3H 1BF8A 1IGYB 3AAZB 3EO9H 4XBPB 3RNKB 4PV9B 2ICWA 1FL5A 4ZFOA 4NC1C 2XG4A 2R4RH 2NZ9D 3N9GL 1UEMA 2AQ3A 4Q2ZA 4HWUA 3QUXA 1QUNA 3X13B 4A2MA 4MJ5A 3B4NA 2DDQH 3I02A 4F7TA 1JBJA 4CADB 3KLAA 3TT1H 4GXUN 5AWNH 1RVFL 4G8GA 4PJCA 1KACB 1FZOA 5IVXF 4LSRL 3ARGC 1HH9B 4FTVB 4XMPL 5D93C 2LAGB 3RKDC 3WXWL 4WO4A 5I1EH 2P5EA 1ZHNA 3R0MA 2AABH 3V2AR 1S7SB 5SX5K 1UM6H 1U8MA 4OD1H 3D0VB 4LIQH 3IJYA 4PV9A 5GPRA 2QHRL 1LO3H 2IALA 2DQGH 4ZTOL 4UDUB 3VXPA 5GGUB 4JHAH 1A6VL 5CKGA 2OL3L 5CIPA 4F8TA 3IJHA 2QJDA 4JDVA 4EKXA 3I75A 4NJ9L 4L4VB 2APBA 2VWEE 5FA3B 2FIKB 4R4BB 4PJEA 4ZUTA 3HI1B 1GC1C 3DV6B 5JXAH 4PLKD 4P2QD 1MRDH 1S7SA 1OWRM 4JO4H 1QSFB 1AC0A 1A3LH 3DXAE 4NQDB 3DJ9A 4Y5XA 4X0KA 5AG8A 1YNKH 1U8IB 3S96B 1CFVL 3IFNH 5D2LA 3VWKA 3DUSB 1EEZA 4DKAA 4XNMA 2XZQH 3RI5K 1NSNL 2DLGA 3N50A 2GTZA 1RUPH 2NNAA 3KPRB 3CDFA 2NLJB 3NFPB 4I9WE 3C6LD 5MEPB 1OAYL 3QIWB 3UYRH 1EHLL 4EIGB 1BFVL 1N7ML 2VZSA 4L9LA 2CMRH 2YD9A 4EXKA 1ORQB 2R8SL 3SDDC 3BPLC 5EPMB 2CR3A 4NUJB 5CP3H 4N0RA 5FO9B 4KMTL 2D7MA 3MR9A 5HJ3B 3BIKB 4PRIB 1DQLL 5BV7B 1MFCL 1OAZL 4JFXB 5JMOC 2QEJA 1ACYL 1NCWH 1QLRA 3FB7B 5D71L 3C9NB 3MLUH 4ZO7A 3RHWK 4OQ1A 2RGSA 1GAFL 1PKQE 1WV7T 4ZQKA 1IEAA 4Y4FC 5IW6A 4QNPF 5EFIA 4YDKH 2B5IB 1BM3H 1V05A 4WI5A 3VXRD 2R0KL 2DRUA 2AV7B 2G60L 5B8CA 3UTQA 3G5VA 1HDMB 3PWJB 4QXUH 3KPMA 3V4PL 4PGDA 1X6NA 3K80A 3LHPL 1KN2H 4WW2A 3B5GA 4DEPC 1EO8L 4QRRB 4U6HB 5ACZB 1LE9B 1LEGB 5IVZB 1CGXA 4XPFH 2RR3A 3GJFH 4M6ML 4U1SA 3FT3A 3ULUE 2O5YH 5D70L 1DUYB 4L3ED 4PRIA 3RL1B 3WIFB 4LU5L 4U1IB 2DICA 2AKRA 4KH2A 4MA7H 4MQSB 3FB7A 2RQ8A 4Z76A 1S9XA 1KPRB 3BP4A 4LLQA 1XR9B 5SWZE 2GJ6A 4MSWA 1HSBB 3I9GL 1NUGA 1VSCA 4UB0H 1CICB 1JZ2A 2YEZA 4QHNB 2R0WH 1RZJL 3MA9L 4FFVC 5FM5O 2CK0L 4D94A 5BVJA 5ACLA 4C54A 3T77B 5CEYA 4KVCH 5HGHA 3SDAB 5IIEB 1E4XL 4U6HA 4FQXA 1JZ4A 4NZDA 4ZS7L 5GXBB 5DTFA 3VGDA 1QA9A 1JHKH 2AK4D 5IR1A 3EGSA 4BSVA 5D1XA 4LVHC 1WK0A 4KVNL 4XPHL 3G6DL 1Z6JT 3ORJA 1RJLB 2AJ3A 3W0WD 1YY9C 4QRPD 3T4YA 4DW2H 3NCFB 2D31B 2UVEA 1DBBH 3TIDB 4TTGA 4M9PA 1HSBA 1YN7A 2VAJA 3IGAB 2DTSA 4I77H 1X5LA 3H9SB 3U83A 3EYVB 1OB1A 5C70A 1NGPH 5EU5B 4GG6F 2XZCH 3C8DA 4YIQB 5D72L 4YFEA 1NCTA 2GT9B 2WIMA 1PSKH 3SDAA 5HYQB 3MYJB 5HDBE 4NKMB 3I3BA 3PDDA 2W9DL 1JGVL 3FB5A 3RTQD 1EMTH 2E7LC 1A6WH 1GH7A 4R7DA 3VWJC 5F9WB 4NSKA 4Z18A 4CUCA 5CJQL 3MJGX 1XGYH 3NIDE 3GMLA 4IM8A 5MI0B 5HDQL 1T21B 1MIEH 2AGJH 1QPPA 3PP4L 4JGUA 4Y4HB 5FV2A 3C60D 2YSSA 5KOMC 1MFDL 1INDH 2EC9U 1FAIL 2GJZB 2JCCF 5L9DH 1EHXA 2N7AA 1NCDH 4ODXA 5EU5A 4JKPL 2ZPKL 5I30L 2OI9C 2EYRB 4NQVA 3RGVA 1CLZH 3QH3A 4GMTL 7CGTA 1CXIA 1L9MA 1BX2A 2Y06L 2WBJB 4LPWA 1JIBA 1JWUA 5IP4A 5DJZB 4V2CB 1LILA 1SY6L 3D0LA 2VLJA 5HI5C 2YBRB 4O02L 1E28A 5I15H 3K4AA 2VIRA 3OPZH 1P4IL 5CHNA 3P0GB 1T83C 3GM8A 5K9OA 2X4OA 2EDYA 2DAVA 3SDXF 4N90D 25C8H 3ARRA 5IM7B 4PLNC 1T1WB 4CNIA 3WNKA 2Q1EA 3HI6L 3HB3D 2GJZA 3CSGA 5DEZA 1A4KA 2VLLA 3OKKB 3SO3C 3VGAB 3MGAA 2P43B 1DQML 3BWAB 3DYPA 3FL7A 1RIVL 4KZDL 4Z0BL 4QRQB 5F9OL 4YQXL 2ICEA 4YBQC 5EOTA 1FO0H 2K7PA 1MEXH 1D3CA 5ICYA 5D1ZC 5MENB 4P9HH 4PRHE 3U4AA 2DQUL 2HLFC 4P2OC 1KSRA 4PRPD 1M1SA 3HG1D 2RCSL 3MUZ1 5ADOL 1OP3H 3F12B 1ODAA 2CRIA 3MBEB 1I1YB 4L1HA 4NUGH 2IBZX 4EEEA 4FMKA 2Y36L 5MEOB 5JNYA 1CTOA 3LN4B 5BV7H 2GSGB 5LXGH 3PXJA 1AIFA 1QQDB 4WU5B 4PJIE 5CP7B 2W0PA 4RCAA 3UTTB 1FFNB 3MPCA 5DMKB 3HLAB 3LQAH 1QSED 3KWWA 3TBVA 1BVLA 5FV1L 3W11D 1FLRL 1R5WA 3V6OC 2YD3A 2LU4A 2VTFA 4Z7NF 3WDIA 2A83B 1U8HA 4QRSB 2C26A 1JN6A 4HS8H 1KGCE 4I1NB 2R0ZL 1FSKC 1A6UH 1WTLA 3PHOA 4LSTL 1Q9KA 3GSXA 4FQLH 4WFFE 5TF1L 3EYSH 5HGBB 1EEYB 4ODUB 5I0ZA 2FX8L 1C5DB 2IFFH 4P2RB 1V5JA 1Q72H 3JWOL 5EU3B 2DLFH 4FQCL 1H8NA 5E6ZA 4DGYL 5MERB 2VDNH 1QQDA 2D7PA 4U33A 1BLNB 3DX8A 4LQ1A 4PTUB 4RMQA 3QPXL 2C1OB 4U1KB 5EZOL 5JOFA 5DT1H 1ACZA 3TO4D 1KJ2A 1O5DT 1AQKL 1F4HA 4HH9B 4ZAKB 3TH2T 2R1XA 1D9KC 1H5BC 5E94A 2GQHA 1MCJA 2WQRA 3RL2A 4QHMB 3PV6A 5EO1B 3VFNA 3DO7A 3P11H 5CBAA 1G7HB 3B3IB 1ZK9A 3SY0B 4FQIL 2UY7A 1TJGH 2AXFA 2VABA 5D7LE 3CDYA 4H88H 3FO1B 1FYTE 2IAND 2NY2B 4WUUB 5KS9B 4OGAD 2W60B 4MAUH 3WD5H 3VGFA 2DTML 3AGVA 3TT3H 1OQOA 1N5AB 3RVVD 1KTLA 1YNTA 3NCYS 4UU9B 5D6CA 2F74A 3BP6A 3QDGA 3CVIH 4OGXL 2EDBA 1MY7A 5IF0A 1XF4A 5C8JA 5EUOA 4WHTA 4AMKL 3OKLA 3WIIL 3VI3E 3QRGH 1T2JA 3HNTL 4U49A 3G6JB 1KCLA 4D9RD 3EO9L 3VA2C 4E5XB 4PJDA 1FORH 2FBJH 5GGVH 4ETQB 1SEBB 1UB5B 1CDBA 3L3JB 4M43H 5IW1A 1B0RB 4PP2B 3TH4T 3NCEB 2DLEA 3GMRB 3O6ML 1M71A 5E4EC 2Q8BH 2MQCA 4G42B 4KY1H 5EU6B 5CLTA 5AWNL 4Z0XB 3SE8H 3O3DA 2V6HA 3ZE0E 2C1PA 3L3OA 3E6HA 3V6FB 4YNYA 5ESVB 3NFNA 4J4PA 5DMIL 4ZUSA 4YXKH 2N56A 4Z77B 1BQHB 3QWQB 2HJKB 4HX1B 5I1EL 2PTTA 1U8OB 2BJML 4JY5H 4LIQL 3FQNB 2DQTH 1G7IA 4F37K 4G7YH 1F6FB 1LO3L 3KPSA 4PTTB 2VXSH 4X6DA 5KN5B 4PJCE 4PS4H 4D3CH 1NL0L 3R8QA 1DDHA 1S7VB 2AJZA 1F4WH 4MCZB 4JZOA 2FNBA 2ERJC 3TF7C 4LLWA 3QP3A 4PJBB 5LGJA 3BZ4B 1G9NH 3NH7H 2FGWH 3NACH 4C4KT 1TLKA 2QQLH 4FNLL 4DOHB 1U58B 5ISZD 1IVLA 1UKQA 2CDFB 2W65B 4IRJD 3BP5A 2VITA 4OZ4A 5FHAH 5IB4A 1U8OA 4KV5F 5BS0D 4LPXA 2L4OA 4XP1L 1OCWH 3HI5H 1NBZA 4YR6B 1A3LL 3QHZH 5GIRA 1RUMH 4PTTA 5DD6B 4KROB 1KB5B 3CH8A 4F7PA 3MRQA 2DIAA 4JFPB 5C09E 1DN2A 1I9EA 5GGTH 5DJ0B 2P5WA 1JHTA 4EN3D 5EIQA 5E08H 3V7MA 4JFOB 3O6LH 1TQBC 3UYRL 4KI5C 3SO5A 1OL0A 4N0FA 2JJTC 3LOWA 4JM2A 3TA3C 3BDYH 2J8OA 2Y7QA 3QJHB 4AEEA 1Q8MA 4WW1A 3TN0C 4XCFH 1RV6X 3P77A 4HV8A 2NMSA 3AS2A 5DJXB 1WT5C 5ICZB 3BIAX 2Y6SD 3SE9L 1DANT 1Q9LA 5EORH 5T1LB 2FHFA 1SHMA 2HH0L 2ORBH 1FFOA 1S9YB 2YN5A 1IC4H 4X7EC 4YDKL 3L7EB 2VXUH 1KCVH 4Y1AD 4X7SL 2J1KA 3VG9C 1BWMA 2ZWLT 2DN7A 5DK3A 1FDLL 4Y2DB 1IEHA 3D5OF 3BGFB 4JFPA 3LY6A 3L3DB 2LU3A 3ALWA 3OXRB 2NR6D 4ZUWA 3VMOA 4N68A 3WFDL 3P4MA 5F9JA 5GGSA 4JFOA 5GJTH 1JV5A 1BP3B 1QLEH 4EQ3A 4G8EB 4X80H 3JVGA 4UDTA 3QEHA 2ADFH 2H9GA 1B4RA 4HKXB 4KI5D 3RUGA 2FH8A 3ULSB 5LGHL 3FQUA 2D7OA 2B39A 3MLTB 4X6FB 4LSUH 4R4NC 3DURA 3QCTL 1AHWB 4R3SA 3VXSA 2QR0B 1X3DA 3BKYH 2V2TB 2XPGB 3RJQB 4MA7L 4MJIA 1NAML 2VDML 5B38G 1BIHA 1NDGB 3TBSB 4LKCA 4N0CD 4JDTH 5HYSA 4X4MA 4DKFH 2R29H 2ED7A 3U9UB 3DXAB 1V3KA 4U1HB 2VLKE 1N8ZB 1WLHA 2R0WL 4HK3J 2X09A 5JQ6L 1UKSA 1L7TH 4F9PA 3OXRA 3WIHA 1RZ8B 3QDJE 4KDTA 2W38A 4IEFB 1EUTA 3FONB 3BEVB 3ZKNC 1E27B 4F7EB 4EBQH 1JHKL 1KC5L 3MLTA 1F11A 5F1SA 5IMLB 1I8KB 1QO3B 2F58H 1LO5B 4JFFD 4R4ND 3BIBX 6FABH 2MOVA 2CD0A 3FQRA 3FT2B 5I1CH 2J2ZA 2XN9E 4HMEA 2DMCA 4P23D 2K7QA 1M6OB 4NO5A 1GZPB 1DBBL 3QFJE 5DYOA 1YQVH 4XX1G 4Y19D 1YJDL 5AZEL 1TJIH 3QNZA 4OLEA 4KUZL 1NBVL 1H15B 4JQVC 1PKQB 5JHDD 5HI4C 1S3KH 4I77L 5I17A 3GSNH 1A8JH 4KK5C 3ZE1F 2VC2L 2XQYK 5FO8B 4HT1L 4H1LB 3A0OA 3UCRA 5FYKL 1JHLH 4H25B 3AFLA 5HHNA 3FQXB 1ZSDA 3QEGH 4M61B 2ZG2A 2YMXL 2FJHB 1MJUH 1ZVYA 1EMTL 4NQXA 1DANU 1FL3B 3KXFA 4LLAA 4O2CA 1IM9D 3LIZH 3P0VL 4Z5RA 3E2HB 3FT2A 4OZIF 3O41B 2IH1B 1SJXA 3J7HA 2A77H 3MLWH 1AFVH 1JF1A 3CVHB 4EI6B 1MIEL 4M8VA 2YPLA 1FZJA 1UJ3B 2XY1A 1TNNA 4G6MH 3STZB 1INDL 5L9DL 1PG7X 3MA7A 4D0BB 5SWZB 4HULB 1NCDL 1NJ9A 4OCLC 4P4KC 5HI4D 4GUPA 4H1LA 1FAKT 2XKNB 4W6WB 1PZUB 1YYLH 4WCYH 4ZOBA 1MCFA 2H1PH 1UH2A 1EGJH 1G7PA 3OPZL 4XC3L 3FN9A 4U1JB 5T1KA 1YJDC 1I3RB 1UYWL 5I1LA 25C8L 5DQ9B 1ZT4B 3RWDB 3Q6FA 1EK3A 2M8XA 3V9FA 3BESR 4JFDD 1MQ8A 1LEKB 1T20B 5IBLC 1KLUA 3FAXA 2X1PA 4P57A 3QQ4B 3OG6B 3LKPA 1WBZB 5FCUH 3DROA 5EA0L 3KJ4B 1IAIM 2MKWA 3O4OC 5IVXA 5FYJU 1Z3GH 4DK6A 4KK6C 1KFAH 1IT9H 1BFTA 2MPAH 3HNSH 5F7DA 1VFBA 1I4FA 1OD9A 2IQ9L 1MEXL 4LPTA 2P7TA 4WWKD 4CN6A 3JSSA 4DZ8A 1OT1A 4OI7A 2A6KA 4X5WA 1BFOA 4XZUB 1MCHA 2YC1A 3PWPE 4XPBH 1M7IA 4Y5VB 2FZ3A 3GHBL 1KENH 5HY9A 5H2BB 1ZT4A 3ARZA 1I85C 3FN0L 4D9LH 4PY7B 4S1RH 4NUGL 3QWRD 3DRTA 4V1DB 3DYOA 3S4SB 1EZVX 2Y9RT 3MBXH 5LXGL 4QWWD 1ND0B 1TZIA 5FYKD 4GW5A 3J8F7 1EAPB 1RUKH 2UUDK 1GZQB 1QR1B 5CUSL 4RSVA 1JGLL 2HWZL 4KK6D 1KPVB 3GGWA 5EG6C 2JIXD 2DWEA 2APWA 2CLRA 4G5ZH 2BY1A 3KJ6H 5DJDA 2FRGP 2XQBL 4QRUB 3WUWG 5L2KA 2XWBB 2PCPA 1L4IA 2NY4C 1CN4A 5GS2H 3QXVA 1KELH 2XXCB 1A7NL 3NCJH 5T3ZD 3ARDA 2HJFB 1Q72L 1PG7H 2DLFL 1CT8A 1CDHA 3HZVA 5KVEH 2P45B 5F97E 3ROOB 3SDCC 2ADJB 1U3HA 4RDQF 5BRZE 3O0RH 3WLBA 4XVJH 4MQ7B 4Y0GA 4U1MA 4JFEE 2VN4A 3QIBB 3UPRA 2AEIT 4M6NH 4BUGA 1VGEH 1JZ8A 3GBMH 4HQQL 3CH1A 4XMKH 2IPTH 3E0GA 2VDOH 3I84A 5ANME 3RVWD 3TIEA 4P5KA 3KYNB 3HUJF 1AGBB 3V79C 4PRHB 5CSZB 3QUYA 1HZHL 1ZT7A 5C0BA 2A6IB 1HI6B 1EJOL 3VA6A 5E8PB 3QXDB 3RWHB 3WD5L 3BDXA 1ADQH 2HJFA 4L8DB 1BHGA 3MOAH 1LVEA 3DMMB 4P3WA 3LQAC 3RPKA 5J6HB 1JPTH 1L0YA 5IOPA 8FABB 4DVRH 4NQEA 32C2B 3MOBL 2R2BA 3RDTB 1QTYT 1K2DA 3L3HB 5J9PB 1L6XA 1BD2D 1F2XK 3SDCD 2IPUK 5J0BA 5DVMA 2MQ0A 4TNVK 2C3WA 2EICA 4XPAH 4ZOEA 4ONFH 4IMKA 4NNYB 3NTCH 1PLGL 4MNQE 3T3ME 4ODHL 5I73B 1ZHBA 1F97A 2HFGL 3QRGL 2P8MB 1I7ZA 3WJLC 2RFXA 1C5BL 3IXAB 3O4LD 2DBJA 2FX7H 3JBG7 4JZJC 1D5MA 1NFKA 4W6XB 5GGVL 3V5HA 1X5XA 1U93B 5H8DA 4MAYC 2HT3C 4OTXH 2VDKH 5D96B 4LEXL 1KPUA 2WK2A 5AG9A 2OJZH 3OXSA 4YHOH 2CIIA 5C07E 5K9QI 3SE4A 1KJMB 3RWJB 5JW4M 2QSCH 5DFVD 8FABA 3L5WB 1IGMH 5C0DA 32C2A 2BDNL 2ATPA 3ULUH 3B2UC 3LRHA 5E2JA 5J9PA 1RJZB 1OLZA 3ETBF 4KTEH 4NQUA 3GSOB 3VW3L 2VZVA 4DN3L 5IHBA 3CVHH 3SE8L 5DLMH 1MELA 3U79A 4NNXB 4LSQL 4WY7H 1T3FA 5EO9A 3KPQA 3OR6B 3WNOA 2DYPD 3AB0C 1NC2D 1Z9LA 2XV6B 4Q9RH 1T2QH 2SEBB 1QRND 4LCWD 3WKMH 1NGYA 4M1GH 4KJQC 4I48A 5GQBA 4UUJB 1IM3B 1VFUA 2FEEL 3QEQE 2X41A 3QQNA 4W70A 2FB4H 1OF2A 4XI5C 1J86A 4R8WH 2PKDA 5E0QA 2X2YA 4GG6A 5D7LB 5DHVB 4RGMB 2BOCB 1BJMA 4JRWA 5B38A 1KNOA 3MRJA 3L5IA 3BH9A 2GKIA 1TMCB 1FGVH 3B2UD 4P2QA 3RAJH 4QXWA 4JRYA 4YDIL 4HMCA 5D5MF 4EI5B 3UEZA 1G9NL 1I3GL 2EIZA 4LOUC 5E6IB 1AXTH 1U8KA 3GMMB 4ZNEE 3L1OL 1ETZA 2XKUA 4ZMAT 1XIWD 2CKBH 2ITDB 3DPBA 5FHAL 1U8QA 3H8NA 5IBUB 1Y6NR 1LNUB 2NXZC 5ITFA 3P40A 1UT9A 3C6LA 1L7IH 3L7FB 4PG9A 3GJFK 4TVPH 1P4LA 1RUML 2JCCA 1OP5H 1INEH 3GSRB 3VXMB 5GRVK 4XI5D 5DHVA 3L3IA 1UENA 5GGTL 3BEWB 3DVGA 2YD7A 2E9BA 4PJ5E 2J7LA 5F89A 4LLMA 3O6LL 4NZTL 5T1DH 1OSPL 5D8JL 1IKFH 3S3SA 1BIIA 3FQWB 4GBXB 2V17H 1R5VA 4HS3A 3RWIA 3CFIC 5BXFB 2P8PB 1HCVA 3GHEH 4PJ8C 4XCFL 1FV1A 3UTSA 5HYJE 5J6GB 1VKXB 2ESVD 3SDXA 5ENWA 4YHMH 5MHSE 4PR5B 4D9QE 2BVUA 1KTKE 4QO1A 2VDRH 3LDBB 3GSVB 1NEZG 1HXMA 1T89A 2VXUL 4Z7UE 2EDKA 3HZKB 3HR6A 5F1IB 1KB9J 3GSRA 4QHLA 4M5YL 5A16B 5DRNA 3OAZH 4KRMB 3SJVD 3T04D 3VGEA 1QEWB 5DUMH 1G9NC 3RI5F 5C0AD 1WBXB 3OGCB 3AVEA 3E1F1 1A6PA 1P9MC 5GJTL 1QLEL 1NFDF 1S5IL 1ZTXH 1EFXD 3MV01 4X80L 4G6AD 3C5JA 4GBXA 3VI4E 2O61A 5DJCB 1OTSD 4LSUL 1WZLA 4G6FD 5DJYA 2OL3A 4OZFA 4PJ8D 2EC8A 4R0LA 3UTZA 4TSCL 3M45A 1I9RH 1F4YL 3QNXB 3UDWA 2BCKB 4ERSH 5JW4Q 2YRPA 2ICES 3T3PE 2XTLA 1FBIH 5DC4B 3RHWF 4KC3B 2NW2B 4LMQI 4MD4A 4DKFL 5J12C 5IK3A 1BPVA 4ODVL 2AK4A 1HHKA 3RUGE 1S78C 3OGCA 1XEDA 2XFXB 3U36A 4JO1H 4NYLA 4AM0B 3ESUF 4FG6C 3OV6A 4G6KL 3F5WB 4EVNB 2EDNA 2A73A 1H3WM 4GKZB 5C09B 3ZDYF 4BSWA 2BFVL 3W0WA 4QRPA 5F6IC 5DGRA 2NY6D 4UV7L 4OLUL 4Z7QE 2DD8H 3V52L 3QSKB 4HIEA 3RNQA 2AEQL 4EBQL 3BWUC 1R3KA 4XBGA 2XZZA 2F58L 3BD4A 2B4CL 4X4ME 2UV3A 5TQ0H 1AXIB 4NHCH 1JPFA 2CDEB 1YDPB 3FO9A 5IFAL 1WCBA 3RBGA 2W91A 4LLUA 4D0DB 4MA8L 5C0GB 5FYJE 2CR6A 3CFJB 1TJIL 5H35A 1DZBA 1JRHL 3FFDA 1KIQB 5MEQA 1JGEB 1OAUH 1P2CB 2NY1B 1IGFH 2Z9TA 3GMQB 1IAKB 4GAYB 3VFTB 4X9GA 1A3QA 4WHYG 1FZKA 1JHLL 1UCTA 1I7TB 5DZNA 4OT1H 1YUHA 3O8XA 1D5ZB 4MNGE 3C60A 4OI8A 4CRPA 1BJ1J 1BGXH 4FHBD 4QCIB 2QQKH 4DQOL 3KLHC 4XHJD 2HG5B 1I8IA 3LIZL 1S8DB 3VD9A 2A77L 2B20A 4K55A 1AFVL 2QADC 2O5ZH 2AJXH 2XWJB 3FRPG 3WUWA 1KIQA 1DBJL 2WBWB 2D4DA 1TITA 2VR9A 4LBEB 4F15C 5DZOA 3W39A 2VKWA 4K3EH 1BAFH 5ALBL 1DR9A 3HAEG 4J1UA 4ZXBB 3MROB 2VLKB 4KK9C 2IF7A 5DSCB 4WV1B 4OFYD 4L8BB 1TZHB 2AK1H 3E8UH 2DM4A 1IRAY 1MNUL 3QDJB 3RZCB 2Z31C 5TDNB 1OWWA 5GS0H 1ZHKA 4QCIA 4K9EL 5E8DH 2AJSH 3GO1L 3MCKA 4DGIL 4POZD 4UZGA 1DBKH 1GHFL 1N59A 1LE5A 5FXCH 2AI0H 4W6YB 2QQNL 4XNZB 4KRPD 1YN6A 4YX2L 1CG9A 2D4FA 1P7HL 2EKSA 1GGCL 3OTTA 2XN9B 1CFNB 5F7EH 4LHUB 1XZ0B 1J05A 5CZXD 5A2LH 3QFJB 3KS0H 2Z93B 5HYFA 4I3RH 1Y0LB 3FFCD 3TYGL 1DL7H 1ZT1B 3EW3B 4PRPA 2XZAL 1KFAL 2MPAL 1EBPA 1BREA 3O2VH 4HFWA 1P6AB 3BX7C 5TDNA 4YC2B 3MJ6A 4IDJH 3P30H 2Z31D 2EIDA 1KCRH 4IIQA 4RNRB 4GSDH 4XVUC 4AENA 4E41D 1KENL 3DO3A 1WVZA 4S1DC 3DV4B 4O51B 5EIIA 3QDMB 4HIXH 4QGTA 3WO3B 3DSFH 4HUVA 1VPOL 3DX7A 4S1RL 1QKZH 2OSLB 5C3TA 4JHZA 3ARBD 5ILTH 4I0KA 2J8UE 2YZ8A 1CR9H 4KFZC 3UBXB 3D9AL 1MJ8H 4PJFF 4MLSA 4TUJB 4C83B 1NGWA 1RIUH 4YHKH 2PXYB 1KBGH 1U42A 1NFIA 4U0RC 5D1QB 3DSNA 3STBA 3IDIB 4BKLB 1WCQA 1YEEL 1LD9A 3WE6A 3ARFD 4G43B 5GGRY 4U1GC 3KJ6L 4M62H 3RWCB 4JR9L 2KZ1B 4ODBD 5ADPL 3DV4A 2HFEA 3QDMA 2E9IA 4DVBB 1CFSB 2E6PA 2IAMC 5DJAA 3VMPA 5C08E 3WFBH 1AKJD 1GJIA 5HVGB 5BOPA 2F9BT 4U05A 2E7HA 4HFUH 3TO4A 1CDCA 2CGRL 1PG7L 4GW4A 5KVEL 4XWOC 1RMFH 2MJWA 5E00A 3UBXA 3V5KB 3CNKA 4Y16A 5JR1H 1U41A 2C3VB 2H32B 4PB0H 5DMGC 5JXED 1KJVA 4M93B 3DNKA 3P3YA 4BKLA 1YEJH 4HJGB 4JFZL 4NRYA 4Q6YA 5EH1A 2IPTL 2EO1A 5I1AB 5F7YC 4Q9QH 2BSSA 1A7RH 5KSUB 2DQDH 5I74C 1MI5D 1PYWB 2Q3AA 1ZLSH 3PWPB 3V5DB 2EYSA 3MRCB 1FZMB 4KWUA 3TWCL 2GAZB 4XCYB 2DQJL 3VFGH 3BYTA 2IAMD 1FNFA 2APVA 5JIIA 3MOAL 1N26A 4I0PC 1W72B 5FIEA 3CX5J 3EFFA 5CMAB 4I2XA 5IW3A 4JPWL 1MVUB 4XWOD 4PJ9B 3ZHKA 1PX3A 1KCSH 4X4ZA 5AZ2L 2Q76B 5IB2A 2RJMA 1RHFA 5C0JB 2PYFA 3PGDA 4OZGF 1IKNA 5DMGD 4DTGL 1TQCC 4OFKA 5BMFL 2A9MH 2C9AA 5KBNC 1QBBA 5C0BE 5DWUH 4JN1H 1JGUH 1T0PB 3TNMA 4BQ6A 2X42A 1FIGL 2B7DT 3AY4A 3E3QC 4HUWB 5L7XL 1MH5A 3V7AG 2FX7L 4HDIA 2OS7A 1BBJB 1HK6A 1J8HD 3VFOA 4IHOA 4CU6A 5K59E 3MRCA 3LMJH 4J7RA 5E8EB 4OTXL 2VDKL 1ORSB 2FCBA 4U1NA 1NBQA 2OZ4L 2BK8A 4OB5L 2OJZL 3ARED 4N1CA 4YHOL 4AYFA 3QG7L 3JWDH 4HUXA 1QFUL 4JFYA 3RWGB 4P5MB 2AEPH 2PW1B 3K1KC 4KTEL 5DEFB 4HXBL 1RD6A 3ZYOA 4NO0D 4OAWA 5KSAD 1CQKA 2Q76A 4LGRB 5BRZB 5AAMA 2I9LA 1L6ZA 1MFBH 4TYUA 4JFEB 1ONQA 4I4WB 5D7JD 3DBXA 4Q9RL 4NO2A 2VE6A 5FOBB 4TOYH 4IOIB 4HUWA 5A2IH 4XNXL 1F4AA 2D7TL 5EC2A 5ANMB 1BBJA 1LK2B 1MAJA 3BPNB 5BO1H 2FB4L 5AYUH 1NGZB 3RA7H 4JG0H 5C9JA 4BH8B 1GPOH 3GSUB 4R8WL 2WANA 3P4OB 4S0TD 4ZFZA 4ZPVB 2N7BA 4L4TD 4NM4L 3HC3L 4IRJA 1B2WH 4D0CA 4LDLB 3C5ZB 4NC1E 3RAJL 3MJ7A 5DHXB 5BS0A 1GGBL 5GSRA 1VGKA 1HH6A 4UT7L 3T0EC 4I18C 1AGCB 3U0PA 1RJYA 2FJFB 1Q94A 3M8OH 3OB0H 4WFEE 3CU1A 5F9DC 2O26U 2VKXA 3U46B 1EH9A 5DURD 4KKLC 2CKBL 4GXUM 1WWCA 4OZIA 3MRNB 3G9AB 2DLIA 4GG6E 3MRLA 5DMYA 1NPUA 4EN3A 2P1YA 3B2VH 1KV3A 3ALPA 3PGCA 4MNQB 2Q6WB 3TNNB 1EXUA 2XIDA 4F37F 3ULUC 1K8DA 2AJUH 4NT6A 3D39E 3O3AB 5DUBB 4CJ1A 4XAKD 3RP1A 1IZJA 2BNQD 3MLXH 3D2UD 4XNUL 5DQDH 3EYUL 3C09C 1SJEA 4C56D 4OQTL 2I26N 3X11B 5C07B 5B39B 1TCRB 4X5XB 5GZNC 4GXVL 1S7UB 4Y1AA 3GHEL 3V8OA 3SKNA 1OTTC 4ELME 2BVOB 4LQFH 4MNHA 2ZCHL 1VEOA 6CGTA 3RKPA 4GKSB 4KKLD 4Y5YB 1HQRB 1TIUA 2VDRL 4XP5H 4MVBD 3UYOD 3ZHDA 1J11A 2YK1H 1E6OH 3NABL 1TXKA 4XX1E 2QSVA 3ZL4H 1NCBL 3QEQB 1G9ML 2X4NA 3EIFA 4EUPA 3THML 2MCPH 5DUML 2F54A 1F00I 3ZDZE 3BGAA 5IG7A 4MD5A 3OKDB 2R0LH 3VXRE 1L9NA 5BJTA 2DBLH 1MJ7L 1TCRA 3B6SB 1AGFA 2XKSA 4UTAH 2C3XA 3OQ3B 4MMXC 1J0HA 4KHTL 3BD5A 3Q6GL 3MLZH 3HAEA 1VACB 5DRXB 1IQWL 1NDMB 5C0EB 2E6QA 4Y5YA 4N8VG 4I5BA 2GK0A 3D25A 1DUZB 4L3EE 2QSQA 3BN9D 3QIUC 4O4YH 3EJZC 1DFBL 4RBPH 1KTRL 3OX8B 1QBLH 4NHUA 1LEIB 3TZVC 5IKCB 2FHCA 2X1QA 3QG6B 2P8LA 3PWLB 5ERWA 2AERT 1ULVA 1B6UA 2H2SC 4PJ7F 4P23A 4PJ5B 5CZVL 5DK2A 4HEME 1HNFA 1WICA 4OIIH 4Y19A 4XP9L 5CZKA 4PG2A 3WO4C 3V8CA 4QTHB 1R0AH 5JHDA 4OF0A 1YYMH 4OLYH 4UAOC 2ZOKA 1I1FB 5TDOB 3WBDA 5F1KC 2FL5A 4NHCL 3O6FD 4YHLH 4YGVB 1G9MC 4TSBH 5HYJB 3EFDL 3WL9A 5FKPB 2Z4QA 1NCAH 2VO5A 3D85A 3GSQB 5ELIA 1II4E 3RVXD 5FO7B 4G9FA 3W0WE 3C87A 3LKRB 5EO0A 1IGFL 1LMKA 4LSSL 4LDEB 4JPVH 3VXUE 5HD8C 3EJZD 4Z7UB 2FYYB 4L8SC 4TQEL 1AE6H 1D6EA 4XXCA 1AJ7H 5M94B 2OLDA 2VAAB 4FQHB 4G8FA 1G0DA 3JTTB 1R24A 3L95B 1GIGL 2ID5A 3PWLA 3QXTA 5EZJA 4OT1L 3Q5TA 1K85A 4KK8D 4WUKL 3OAYH 2H2SD 3QA3B 3HUJA 4PB9L 3TVMC 3QRFM 3DVNA 3MJ9L 4QTHA 2QQKL 3B9KB 4P5TD 2HMID 5DK0B 4YGVA 3QUMA 4GRLC 2FATH 3LV3B 2O5ZL 3B9EA 2AJXL 3AMKA 4PBXA 3LKRA 4X99B 1NLDH 2IBGA 4K3EL 4K23L 3NPSB 3HE7D 5HD8D 4WTXA 1JK8B 2E9WA 2F5AH 1T6VN 5K93A 3ZE2F 3F58H 1MCPH 4OJFL 3O9WC 1X5KA 4JFDA 3S97C 4ONHB 4ZUUB 3QUKA 1W0VA 3LS5L 5E8DL 1ZLUH 2Q7YB 1G6RA 3LKOB 1MCNA 4PGJA 1KJ2H 4UINH 3L9RB 5FM4A 5F7NC 4GRLD 1IQDB 2X5PA 1JF5A 1BMGA 3JV4A 5F7EL 4WWKA 2A6DA 3EYOA 4APQB 1OAKL 4I3RL 4B53A 1Q0YH 1K8IB 4G7VH 1DL7L 2BHUA 1AH1A 1DSFH 2WWMC 3HE6C 3K2MC 1EAJA 4MXWL 1DQDL 2XWTA 1T22B 1U8LA 3KPNB 2EIEA 5C1MB 5FECB 5J89A 1DEEA 4M7KH 1IL1A 4XAWH 1JWSA 3QWRA 4MX7A 2X44D 3X14B 3O9WD 1SEQL 4IDJL 1JP5A 4K94H 1KCRL 1PKOA 3PIQB 1XF1A 4CMHC 1W8NA 4MNGB 4MQXC 3VJ6A 2CLVA 1T1YA 3PABB 3EJYC 4BJLA 4LLYB 4K3HA 5CD3A 1L0QA 3IDGB 2VDQH 3HG1E 3QQ9D 3D3VE 2WINB 1TJHL 3QJFA 3HS0A 4H26A 3T8XA 2G2RA 3LKSA 4APQA 4EDXB 1QYGL 5D5MA 1MAML 4ZFOL 4P3DA 4UIMB 5DJ6B 3T4AB 1MY5A 1RIUL 1JYVA 4DGVL 2XA3A 5F96L 2W9EH 5GS0C 1E4WL 3KPNA 3HE6D 1QLFB 2EIBA 3LKNB 3R8BB 3KHOA 1PZ5B 4IMLB 4UQ3B 1QSEE 5IHLB 3BSZL 3WFHB 1AI1H 1QR4A 3L3KA 3EO0B 1Z0MA 2JE8A 5HVHB 1OW0C 1JE6A 1DVFB 4O2EB 2R4SH 1ZA6A 4HFUL 3MQIA 3RFZC 1PFCA 4OM1L 1X4XA 4OBSA 3BVNB 3MRRB 1CBVH 3MV7D 4YXLH 5JR1L 5GJSL 4MA3B 4XPGH 4PB0L 3K3QA 4DFIA 1RK1B 2DOCA 1QLFA 2OTWA 1MCBA 4QY8A 3CK0L 1YEJL 2DQIH 4DK3A 3PHQB 2LFGA 5CJOH 1F6AB 3CUPB 2G5BA 4OBRA 4LGPB 4Q9QL 3TBYA 2VDLL 2DQDL 4OV5A 4PJXE 3QCVL 4QT5B 1CVRA 5E2TL 2PO6B 3EO0A 4QXGH 5AAWA 1GOHA 3HCVA 4N0UA 2DL2A 3QI9D 3MRIB 2YWYA 3VFGL 3PP3K 4XVSL 5I8CA 1MWAB 5I8OH 5IQ7H 3EOBB 2I25N 3QUXC 2IANE 1MF2H 1JNNH 1N6QL 1KCUL 1HHJA 2J8UB 1U8NA 1R3JB 3CJJA 1S7TB 1I7RB 3MRBB 3SKUD 2UY6A 4TRPH 4WTZG 2YA1A 1OVZA 4OFDA 5LAXB 2GSIB 1ZWIB 2A9ML 5C9KA 1BECA 2A9NL 2ZCLH 4N9OB 4JN1L 5DR5L 4WO4C 3NFSH 2AW2A 5EOCH 3TP4A 4BH7A 5FYKU 3EZ8A 1EVTC 5LBSL 3BUYB 3PWVB 3O11B 3FCTB 3OKEB 1K5NB 4D9RE 4F58H 3DRQA 4X7TB 1YNLH 1ZHLB 2GYSA 5E2WH 3G6AA 4CMMB 3IDYB 5C08B 2DYPA 1NC2A 4NQSA 5IV2B 3QUXD 1H0DA 1R3JA 4DKEH 4XWGL 3CMOL 3KPPB 1NKRA 5DD5L 1I7RA 4Z7WF 3VCLA 5FUOL 4OLZH 1XR8B 4NKOA 3B83A 3LEYH 4TNVF 1AGEB 4PJGE 4KJYA 1ZWIA 4GAGH 3NA9H 4NCC2 4TOYL 3U4BH 3QXUA 1XCQA 1T5WA 2OK0L 4MYWB 1RSFA 3FN3A 2I60L 1HEZB 3L6FB 4CU7A 5I75B 3HPLA 5JDJA 3SQOL 5BO1L 5AYUL 3ALXA 3NIFF 4JANA 4JG0L 1V8HA 3S5LB 1CD9B 4RWHA 4NN5C 2ZJSL 4MDIA 1UM5L 4Y5XC 3CDGA 1WWBX 2YPKA 1GGIH 4N8VA 4OFVA 5BZWA 2WMPA 4U3XA 1DLHA 3VWKC 3BZFA 1FN4A 3GRWA 4Q0XL 1XIWA 5J13B 1S7QA 1HHGA 1KUMA 3VFUB 3ULVH 3FT4B 3CSYB 4LHQB 4TTDD 4WEUD 4Q7DA 1T04A 2NXYC 3M07A 4NGHH 4L9LC 2VQ1A 1FE8L 3CPLA 5GGRA 2CLZB 4XCCL 1S9WB 4FTVD 3E6FB 4FMFA 3RWFA 4HZLA 1S5HA 4KI1A 3CZFB 4HKZA 3K2UH 5ISZE 1HEZA 3U48A 3VH8B 5B3JF 4RFEB 1VESA 1OPGL 3JWDC 1PY9A 5LJYH 3V0AC 1H3PL 3RIAK 3WEXA 3VXNA 4WIQA 3MLXL 3QDHA 3MYZA 5DQDL 4P2CG 2WV3A 5B8CC 2ESVA 3QFDB 3OHXB 4E0RB 1IGCH 1LP9E 1HINH 3MRDB 2Q8AH 1B4JL 4WW2C 1DQJB 2N4IA 4G6JH 1CGUA 3CXDH 3QCUH 3OMZA 1P4BL 1LGVA 1D5BB 2NY3C 4JREC 2VERN 4QXTB 3ZT7A 2J6EA 5AUMB 1EIBA 4LQFL 1S9WA 4PRNA 3SJVA 4OFIA 4A6YA 2AV1B 1RZIB 3CZFA 4FFZL 2IH3A 1CD0A 3GI8H 1JYWA 3SN6N 4L3AA 3TM6A 4R2GB 2YK1L 1KG0A 1XGTA 2X70B 1KLGA 1QSFD 3UO1H 3O6KH 1EX0A 1MQKH 4G80B 4LCYA 2WQ8A 1HIMH 1XGRA 3F7YA 2Y07H 5LVEA 1BZ9A 4YAQA 5A2JH 4GQ9H 5IMMA 1RZ7L 5IVNA 3TPUA 1FVEB 4OCRL 4HKJB 5T5NF 5IHZB 4UTAL 3CIQA 4FQXC 1YEDB 3MFFA 3QIWD 1Q0XL 1JNHA 3MLRH 4YDLC 1D5BA 3GJEA 5JIKA 4QEGA 5D1XC 3FB8A 2FD6H 3HRPA 5LWYL 4NCC1 2AV1A 4KI5E 1ZV5A 2MHAB 4X6CF 4LRNH 2ZSVB 4HPOH 3NGBC 4PRID 5FDWA 4LHJB 4LIQE 3ARGB 5D7SH 4HG4K 3H42H 3ZKSD 2APXA 2XG5A 5D93B 1CFBA 4ZS6D 1S7WB 4PJFA 2CJUL 2GJ6D 2VXTH 1S9VB 1LHZA 3C5SA 2A74B 3D39B 3H6JA 5CGMA 1XFPA 4NN6C 5E9DA 1LDSA 3TBTA 2ZUTA 5F7UA 1PEWA 5J3HD 3CDCA 1RZGA 2Y5EA 1C16A 2D7NA 4M7LH 1BBDH 1JGDB 3KYKH 4OLYL 1RY7B 2DL9A 1XF5B 1D5XB 1B88A 4TSBL 4LCUA 1WSST 2XQYG 2H26A 4LSVH 2R15A 4ELMB 1K3IA 4ENED 4AT6A 1NCAL 1WEJH 3WNNA 1G1CA 5D7IB 4JFFE 1SYSA 3MREB 4JGJA 4PD4J 2UWEE 5GRJH 3BKJH 5D9SB 2KPNA 4UIKH 1EO5A 5HGAA 4HWNA 1KTDB 1MUJB 3EOAA 5I71C 4J3VA 4NOFA 1CICD 4L8CA 1AJ7L 4MWFB 3ROLA 3OGOE 1RULL 3RGVC 3H7LA 4GAFB 1T0NB 3QPQC 2X4RB 4HSQA 5FF6A 1IAIH 1JI1A 3SDAD 3QHFL 3VXRB 2BOBA 2B1AL 2Z8RA 4HPYL 4YUEL 4EDWH 5JUEL 3MNZB 1J5OH 5HPMB 4M8QB 3PNWB 1WZ1H 2DKUA 2FATL 1FIEA 2YKLL 5E8OB 1ES0B 5GGQH 1K4DA 4WJ5A 1UB6B 4OFYA 3LEXB 3QO0B 2YUVA 1BFSA 3HPJA 3TH3T 4L3EB 3SDDB 2PR4H 3BPLB 1R3HB 1MCCA 3CFKB 1TVDA 2B8OT 3BQUC 4GG8B 5E2UL 5IEKA 1T66D 2BRRH 4OZGA 1YA5A 4W4OA 1YEHL 2VLRA 1MIMH 1MCPL 4Y4FB 5JORB 3IDUA 5E6YA 3CFEB 1A6TB 2B2XH 3PJSA 2HKHL 4M6OH 5EBLA 3EHBC 1WFOA 4NWTL 4M8QA 2ZKHL 4BZ2L 5I19H 1KJ2L 3FFCA 1UZ8B 3R1GH 4KKCC 4UINL 5A3IC 5HDOA 4DEPB 5E8OA 1D6VH 4PYGA 5EU4A 3VGGA 3TCXA 3PDOB 3IDNA 4YHNB 3TESA 3INUL 4IRSC 1G0YR 5I1DA 4Y4HD 1F2QA 1SMAA 1F13A 1Q0YL 2A0LC 2MWCA 4G7VL 4HWBA 4OCSH 2V7HB 4PGEB 4ZO6A 3FO0H 3MSPA 4P3CH 5FM5M 1J1PL 4E41A 4JY6A 1IBGL 3I3EA 3VXUB 3MGOA 4JJ5A 4GRMB 5HVFB 3S9DB 4M7KL 1YMME 5FGCE 4XAWL 1YEKL 5LCVH 4MA1C 4OKDA 4HHAA 3ARBA 3JWNC 4K94L 1Q9WA 2I27N 3BZDA 3DX6A 4WTZA 2DQFB 3SE3A 3FMGH 5IMKA 2VL5B 4YDVA 1D7FA 4ONGH 2X4QA 3MRPB 4HUKB 3MV11 2XNAB 4NWUH 4UNUA 5IWLA 1C12B 3DUUB 4GFTB 5JA9A 1CE6A 1A6AA 4LVHB 3VXTB 1H3XA 5EBMB 2I5YL 4NC2B 3LS4L 2A0LD 1FPTH 2GUOB 1C7SA 3MRMB 5CEZD 1X5IA 3OR7B 5FYKE 4TSAL 1IGIL 3QAZC 3U1SH 4XC1H 4HJ0D 3M1BB 3WV0A 5MEND 2OP4L 2Z8SA 5HHQB 4XCNA 2ZP0T 4FXGB 1JYXA 3V4UH 3HC0B 1FNGB 3EJJX 1ZXQA 5JXEA 1YPZB 5C0CB 3D18A 2D0FA 1FG2A 3MV9E 4U6VH 3MFGB 1KYOK 3MBED 1P5VA 5J11C 1CE1H 4WEBL 2DIBA 1KXQE 5IGXL 1TNMA 2V2XB 1CBVL 3VWJB 4PGCA 3HRZA 3HFML 2X05A 4K94C 3TCLA 5C0FA 1P5UA 4L4JA 3IU3A 1DQQB 3U2SA 1U8JB 1NMCC 3K4ZA 5D2NA 2DQIL 3BISA 3GBNL 3BE1H 4XTRC 4U1LB 2CQVA 3MRGB 4J8RB 1GL4B 1T0MB 3SKMB 4UT9H 4WHCA 2OI9B 4FXGA 4QXGL 2BVQB 4X98A 4Y4KA 4JY4A 4HCRA 1K4CB 1YPZA 2GITA 4O2FA 2JKXA 5B4MD 4DZBB 3DX9B 5CEXA 1WQVT 5FHBL 5I8OL 5EIVA 2P46B 3P4LA 1XF3B 2PW2B 4P2RD 3UZEA 3D3VB 2VH5H 3N1PC 4FQQA 4PJHE 3MRKA 2Q86A 5IROA 3MODL 3IJSA 3FRUB 3L3GA 2BXZA 3BXNB 3QDGD 3IF1A 5JW4R 5E7FA 4EZMA 4J4PC 1BD2E 1I1AA 3AREA 1P7QB 1ZLWK 2BP3A 2V5RA 1T03L 3O2DA 1SJHB 1T0MA 5EOCL 3SO3B 5C3LD 1KIRA 1QSEB 4P46A 3D6GA 1NFDE 3UPAA 1UVQA 4F9LA 5KSAA 3O4LE 5D1ZB 1RVFH 1G7LB 1HOCB 2A6JB 1UQSA 2NY2D 4MXQD 5KSBE 4LSRH 3CC5B 5D7JA 4P2OB 1HILB 4PJ7A 4XMPH 4ETYA 2X89D 1WISA 3S34L 4DKEL 2X4TA 2YWZA 1JZ3A 3WXWH 3HN3A 3G5XA 4OLZL 4PFEA 3CZJA 4M5ZL 1P53A 2DF3A 2VSCA 4AY0A 1EBAA 1NMBL 4LCCA 2XTJC 1OGTA 2QHRH 3U4BL 5DA4A 4YPGB 4LPUA 4ZTOH 4GKNA 4PLJC 1C5CL 4RISL 4LCWE 1QRNE 4PJXB 2OL3H 3LRSA 4G9DA 4C4KO 4G3YL 1GGIL 4KKAD 2ZG3A 3MGTB 4NJ9H 1U3ZA 5ALCH 1AC6A 1FSKB 2YZ1A 4Q6IA 3ULVL 5DI8B 3QXAB 3G04A 4ZO8A 3S7GA 2IANB 2F19L 3IDJA 4Z7VE 2FEDC 5E7BA 4JM2C 2BVPB 2NYYC 5IBTL 2HAZA 4JLRB 3WIHL 1M7XA 2EEBA 5DEGB 3DI2B 2H2PD 1CFVH 4N8CL 1R6VA 4OM0H 2ARJQ 3HR5B 1NSNH 4PLJD 5JOPE 3U7YL 3WN5A 3CCHA 1A7PL 2I9TB 4EQ2A 1IGTB 3BZEB 2ZSWA 1NLBL 1EHLH 3V6OA 5E1HB 5CINL 3RX5A 4F3FB 1U95B 5JDSA 1BFVH 1D9KB 4LEOB 1N7MH 1H5BB 1KJ3H 1MCKA 3NZ8A 2R8SH 2Z91B 3OJVC 5F3BA 1U8PA 3QXAA 5I16A 1AD0A 2P5WD 4KMTH 1UA6H 2FWOB 1DQLH 2DJUA 1MFCH 1MLBB 2CIKB 4RBPK 1OAZH 3JVGC 4M3JA 5L6YL 3LQZB 1A9BB 1ACYH 5D71H 1MPAL 4UV4H 4ZDHB 5JQHC 3I6KA 5HGDA 2NYYD 1JTOA 4PJGB 3GZKA 2R23B 5DEGA 1TTGA 1FH5L 2DI8A 3GI8L 4AEIH 1S7RB 2R0KH 1UZ6F 4O5LH 4U2ZA 4PREB 1B0GB 3F7VB 2G60H 5DRZB 3KS0J 3QUZC 4QHUB 2Z35B 4LAQL 2OXGA 1JCKA 4NKDA 1MQKL 2I9TA 1NEZB 3ULVC 1EO8H 2Y07L 3R06B 3FZUD 1H5BA 1FQ9C 3ZTJG 4F9PC 1QNZL 4M6MH 5GS3A 3EO1B 3UJIH 5GRWA 5IQ9B 4KDTC 4LU5H 5C0AE 4X4YA 4IOFD 4X9IA 3TJHC 3WKNA 4HUMB 1A9BA 3MLRL 2VYRE 4HS6B 5TGBB 1GGUA 4LPCA 3I9GH 4S1QL 5E4EB 2OJEB 4LRNL 3BJ91 4NKQB 4XMLL 3ARSA 5KS9F 3VXSD 3QULA 1AQDB 1RZJH 3PWUA 2VJXA 5T1LD 2CK0H 4HMDA 2DQEL 2ICWJ 4MJID 5ISZB 3DI3B 5D7SL 3LH2L