4BH8A

Crystal structure of germline antibody 36-65 in complex with peptide gdprpsyishll
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
DISMTQGTSSLSARLGDRVTISCRASQDISNYLNWYQQKPDGTVSLLIYYGSRLHSGVPSRFSGSGSGTDYSLTISTLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDKTYSMSSTLTLTKDEYERHNSYTCEATHKKSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTI-ARS MURINE GERMLINE MONOCLONAL ANTIBODY 36-65
publication title Adjustable Locks and Flexible Keys: Plasticity of Epitope-Paratope Interactions in Germline Antibodies.
pubmed doi rcsb
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2013-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bh8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bh8A01
4GKSB 4OFYA 4PREB 4Z7OE 1CXFA 3HE7B 3QDGB 5IJVA 4JZJB 1RUKH 4L5FH 4PJIA 5CCKL 1H8SA 3SE8L 2W65A 3QQ9D 3MLVL 1DBBH 5I0ZA 4XCEB 1AGDB 3Q6GH 4P57A 3NCMA 4W68A 3TBWB 1F58L 1T1XA 2VDOL 3UTPD 2A9MH 4HEME 4PFEA 3FFDA 1JGEB 3H0TA 3STZB 3TP4A 1TDQA 1D6EB 3TA3B 4BSJA 5DRXA 3FAWA 3H9SA 5SWZD 1N5AA 2W91A 4QOKB 1IEBA 3GM8A 3VFRA 1OLZA 4PJHB 5LCVH 5IFHH 1RI8A 1MAML 4Y88A 5I8EA 1UM5H 2EKSB 1A0QL 2AJ3B 4PD4K 4S2SA 3G6JE 4RAVA 5C0EA 1R5WB 2BNRE 2VLME 3MLUL 5IFAL 4JJ5B 1WBXB 5SV3A 3L5IA 1IGMH 3QXWA 5SWZB 5DHXB 4X6FA 2GJZA 4M6NL 5DS8B 4HUXB 4PRHB 5EPMA 2OL3H 3DV4B 5GIRA 3I75B 4MA3B 1U3HB 3LDBC 3UAJC 1OVZA 1AXTH 4JCLA 1WWAX 4P48A 3MOQA 1SQ2N 4FQXC 1C12B 1N6UA 2EEDA 2PR4L 1JNHA 4Q6IB 3BRDA 2Z35B 5GGVH 3QCUL 1RPQA 1L7IL 3D0LB 3GJFK 5EO1B 5GZND 1UJ3A 5L6YH 3RL1A 1EK3A 2YUZA 5MEND 1MLCA 5B3JF 2YPLB 4U1KA 5DK2B 3NPSB 2DB8A 3X12A 1QPXA 1VFUA 1JPFB 3AS0A 1CT8B 4OIBA 3SOBH 4X7TB 3DX6B 1AD9B 5H35A 2PYEB 4FQJH 4MJ6B 4LCYB 4M93C 1ZLUH 4NNYA 4GG6F 5CGMA 5CCKH 2I9LB 2VABA 2JCCF 3D39D 3LN5A 3LD8B 3LHPH 3MLVH 1RURL 3V4UL 5FAAA 5CJXA 3QEQB 1BD2A 5BRZE 3DIFA 4LFHD 1A1OA 4MCYB 3GI8L 3VXMB 3TIDB 1VGEL 4O4YL 1I7ZB 4GXUM 1VKXB 3EYFB 1AGBA 4ZOAA 1LNUB 1Z9SA 4D8PB 3ISWA 1HKLL 4QHUA 1S7UA 4P5TD 5F6HJ 3SO5A 5EU6A 2VN4A 3FZUC 1MAMH 2ZOKB 4YO0A 5C6PB 4FQXA 4ISVA 1HCFX 4U6XB 2CIKA 7FABH 1S9WB 4JM2D 1FC1A 3MLUH 1CICC 3FOLA 2Z93B 3L5HA 4JPVL 3PDDA 4N8CH 5DJDA 1G1CA 4OQTL 1I9RH 1UWEL 3ZTNH 3EDKA 3JWOH 5FYLH 1J8HD 2FBJL 2GSIB 1E6OH 1ZANH 3UYOD 3VGBA 1EHXA 4M6OL 4JM2B 2IC2A 4BUHA 5C0DB 4M61A 2X1XR 1CU4L 4WHTA 4LU5L 4AT6B 3PJSB 3FQRA 3IJYA 3L7EB 3MTRA 4MX7B 3FQTA 4IRSB 5CHNA 3QG6A 4HJJL 1RUMH 4WI4A 1E4KC 4JPWL 2XWJA 1KGCE 3HMXA 2EH8L 3O2VL 2CMRL 4PJBF 5FYJD 4E0RB 1GGTA 4NO2B 3SJVA 4PLJC 3RUGF 1F3RB 2BVQA 3O6LL 5F44A 5DJYA 5DEGA 2Z8WC 5ESQA 1HE7A 4HXAH 1G9EA 3NMEA 5IQ7L 3QJHA 3IU3B 3OKMA 1RURH 4L4JA 5BXFB 4Y5YC 1BIHA 2F58H 2DN7A 1ETZA 1MFBH 4OD2A 4RGNB 4NKIL 1C16A 1CICA 4YDVA 3U0TA 5H37G 4CADA 3BKCH 2FR4B 1KLFA 5T33L 4Z7UE 4O4YH 3DVGA 2UUDK 5JLZA 1NGPL 2AJUL 4PJ5B 4RFEB 1YEKH 1IZJA 5FA3B 2R0WL 3CNKA 3FB6A 3A0OA 4MA8H 4X80L 5CMAA 1BIIA 1JZ8A 2X1QA 4H8WL 1OGTA 1WC7A 4YPGB 3MODL 4KXZH 3QEHB 2OXGA 3MR9A 2EYTB 4RWHA 4P2RD 5EDXA 2MOVA 3U7AA 4YZFE 4MAYD 3O4OB 1E4KA 1JV5A 4MXVE 5ABDE 2Y25A 4FQQA 4O51B 5D5MB 2A74B 1FNGB 2FBJH 1DBJH 2XWBA 4ELMF 5BVJB 2NNAA 1WBYA 4JVPA 1LK2B 4F7EA 3UJIH 1CU4H 4QHKJ 2A6KB 2X4TA 4OLZH 3DGCR 4Y1AA 12E8H 1XF5B 4PB0H 4YXLL 4JFEA 2GIYA 2BHYA 1N0LA 3RNQB 2ZOLA 3GGWA 4YFDB 1J0HA 5DD3H 2I24N 5IBTL 4PR5A 5ICZB 4Y5YA 5T5NF 4N8VB 1F11A 2FEDC 3O2VH 1X44A 4WO4B 3RWGA 3ARYA 4X6DA 1A7PL 4PTTB 2WINA 3VXOB 3O3EB 3MCKA 2APVA 4JRXA 1FRGH 4D9QE 1ZSDA 3HCVB 3I6KB 4O00A 5MEPA 1YA5A 2GJJA 4NFCA 4ZFZB 4JY4A 4X5LA 3PWJB 4OV5B 1NDGB 4XCCH 1UZ8A 1MH5B 3QFJE 5F9OL 1DVFC 1Z0MA 4MA7H 3ULVD 3I6LD 3GM0A 4JKLA 3HE6C 4S1SH 5AZ2L 1M7DB 5GGRA 2IANA 3ZDYF 3C5ZA 4MXWL 1DLFH 1RZFL 3UZQA 3QIUD 2I07B 2X1WL 3EYQD 2VLKD 5LXGH 4JFFB 1Q94B 5DRZA 1P2CB 4LCWD 1ZHNB 3UTSD 1XT5A 1RFDH 5B22A 4G9FE 4CKVX 4H8WH 5DYOA 2WUBH 3O9WD 5I1HL 3U82B 4NRYB 4U1LA 1TJGH 2GJ6A 2VLKB 3GBNH 1NBZB 2DYPA 2CDFA 5C7XH 4OQTA 5FYKD 4H20L 5L88H 1CS6A 3O3AA 4I4WA 5D72H 1P4IL 4FN0A 4GW4B 5DMJB 5MEOA 2VXQH 4CNIB 2DAVA 4WI5A 2RCSL 2HKHH 3OKYA 3D85D 2ICEA 3S34L 3HUJB 4L4TE 4H8WC 5CZXD 5IVXF 1U8OA 3PDOB 3U6RB 3KJ6L 4JFDD 2RIKA 4ZUUB 1HK6A 1JWMA 3QZWA 5J6HB 1MNUL 1WF5A 1DN0A 2BC4B 4P23C 4OAWB 5I17A 1JMXA 4AK1A 4L3EA 1NKRA 3HE6A 1VADB 4FZ8L 4Z7UA 1FVCB 5IQ9A 5CJOH 4YHMH 4P4KB 4N0FA 4NQCE 4PGDA 1JPST 4KKLC 4DGIL 1MFEL 4IIQB 3IFOA 4KDVA 2R1YB 4X9GA 4FFWD 1ZS8B 2HYMA 5SV4A 5JA8B 2AKRB 5CILL 4NBYB 5EORH 3UTTA 3OX8A 1NQBA 32C2A 5K9OB 1QLRB 4ODSH 2MHAB 4D2NA 5E8OB 5ITFB 1NCUA 2ZP0T 1GRWA 5JHDD 5GISH 5IBLC 3X14B 3BMWA 3Q6FB 1JGDB 3WFHB 4LLQA 3V4VH 1U36A 1FP5A 3QR2A 4KK6C 3HLAA 3HNVH 5BZWA 2NW3A 5EBWB 5ID0A 5I1HH 3C5JA 4KK8C 1GJIA 5D6CB 5AD0A 3NA4A 4Z0XA 3B2UD 4JDVA 4YHKL 4LLUB 4CVXA 4PRAB 1A1NA 4OF8A 3TCXA 1P5UA 3AFLA 3IS1X 1G7QB 4P23A 1IGYA 2XOTA 2D4FA 3SBWC 1A22B 4RCAA 5EU4A 3QO0A 4POUB 4JFPA 3WN5B 1QLFB 5TE4H 1DUYA 2JKXA 1TITA 3QFJA 4AH2A 1H8NA 5IB3A 4Y2DC 4MHHG 4QO1A 5KSUB 2HT3D 2VLJB 1OCWH 1Z5LB 4JFOA 4KRPB 1EVTC 3I9GL 4HWBL 2YKLL 1YN7A 1JFQH 4MQ7A 4TPRL 3CPLA 3UO1L 1QFWL 1EPFA 2DS4A 3QG7H 4MD5B 3ARFB 1ZVYA 4AYFA 1A3RH 5GRUL 5TE7H 4DGIH 3G6DH 4UTBH 1SY6L 3CX5J 4GLRI 5HHVH 1N8ZA 4EUPG 5HHOD 4EQ3A 3UROR 5CILH 5DFVC 3VWKC 1T0MB 2V5SA 4J8RA 1F6LL 2UWEA 5DQJB 2EDBA 4L4VA 2WUCL 1Q9LA 2EDYA 3Q1SH 4NDMA 3GDBA 3ZTJG 1MI5D 1S5HB 4MB3A 5DMKB 1F4WL 5EZJB 4Z9KB 2DQCL 1IM3B 4QXGH 1IVLA 3SBWA 3QNZA 3HAEB 1OW0C 5FHAH 4JHAL 3L3KA 3RX7A 1O7SA 4PYHA 5CEYB 5SX4H 2HAZA 5AAWA 1K2DB 1FCCA 2EDRA 2IAMC 2NY4D 1JNLL 3ALWA 4S0SD 3B9EA 4XPAL 4XP4H 1FNLA 4CU8A 2IPKA 4G5ZH 4OD3H 1IM9A 4HD9A 1Q1JL 5EOTB 1A6TA 4KK9D 4KVCH 3KLAA 2HMIC 3BYYA 1Q9WB 2VWEE 1NDMA 3L3JB 4NYLB 2BVYA 2NY6C 4RZCA 3V7AE 5KVDL 5EFIA 1FNAA 1TXKA 3WIHH 3K8KA 3MRQA 3FCTA 4GKNB 3MOBH 1BGXL 2P5WD 4RX4D 5F70A 4G6JH 3ZYIA 4RRPG 5ICYA 1Z9MA 3RDTC 4L29B 1FL3A 2GT9B 1MWAL 3UC0L 5ID1B 2MCPL 4PRBB 1KJVB 4GMSL 1U8HB 4ZXBC 3QWOB 2G2RA 4CMHC 5GSVA 3WFZA 5LVEA 4HPYH 1ZHLA 4PJDE 3VWKA 2H1PH 2P5WB 3C87A 4TPRH 3N06B 4PIRF 1P7KA 4LARL 3F7YA 1I3VA 5DC4B 3V95A 1NC4B 1KN4L 1I85C 3A6OA 3MCG1 1MSPA 4DAGL 2EO9A 1H5BA 1NCAH 1SY6H 3TZVC 1OW0A 2VB5A 3FHQA 4PRIE 2J4WH 4JREB 1S78D 2IAMA 3VXUB 4BFBD 5IJVB 3WKML 1F4WH 2GI7A 4MQXC 4PJIB 1P84K 3RL2A 4Y16D 2DQCH 2W65B 3W9DA 2I9TA 2YEZB 2XIDA 3KLHD 4P57B 2JJSC 1T1XB 4NZJA 4KKNA 2FEEL 5FF6A 5E9DA 5JW4R 3FFDB 3H0TB 3TLRA 5IEHB 1JWUA 4Z7NE 4HQQH 3OBAA 2DLHA 3H9SB 5FM8A 5FGSA 1N5AB 4QGYA 2BP3A 3AUVA 1IEBB 4OF6A 2DLTA 4JPIB 5I8EB 1TJHL 4MWFA 2Q3AA 1KN2L 3OR6B 4NM8H 1L0XA 4PLKC 4RAVB 3G04A 1HEZA 4MNGE 3BD4A 2JB6A 3T0WA 4IBLT 2AJXH 4CDHA 1I85A 4X6FB 1HYRC 2GJZB 3WIIH 1MWAH 3UC0H 5EPMB 5GIRB 4GMSH 1KPUA 1FE8H 1BM3H 1C08A 3UDWC 4YGVA 4LEOA 4P5TA 4BH8A 4HUKB 3GBMH 4ODVH 3BP5A 1K85A 1JNHB 4QRQA 4PJ8A 4P5MA 1AGCA 3VE0A 4HWBA 2XKNA 4ZNCD 3RWHA 1X4YA 5D9SA 4MJIA 3ROOB 3I6GB 3BPNB 4IRJC 3GKZA 2NY3C 1UB5A 2A6JA 2LQRA 3PNWA 4JO2L 1JYNA 2QR0A 5C6WH 5B4MD 1F8TH 1ACZA 2Z0BA 4U1KB 3X12B 1OP5K 2JJSA 2QQQA 3AMKA 5FO7A 5CEXA 2B20A 2QSQA 5T3ZL 4WGWB 1WCQA 1TZGL 3VFMA 3HZMA 5H35B 1MCRA 1SVZA 1N6QL 1PLGL 3M17A 1YNKL 3K2MC 4NNYB 1XAUA 2VABB 3ZZ1A 4FTVD 3IXAA 1P7HL 4KROB 4HIIA 1T7XA 2Z8SA 3KYNA 3WIFA 3RVVC 5IKCA 1BD2B 3KNBA 3DIFB 1HXYA 2P8MA 1ROWA 2EIBA 4ZUTA 2VZSA 1A1OB 5I8KH 1QBLL 3S36L 4YEFA 1AGBB 1T66C 5T3ZE 1JMZA 5DI8A 5DR5L 4QHUB 1S7UB 3UDWA 1NUDA 1YY9C 3LDBB 5EU6B 3P9LA 4FQXB 4HFUH 1KN2H 4ISVB 5J13B 2CIKB 1BZQK 1B9ZA 4BQ8A 3QPQD 3SEPA 4XAWL 3RU8H 3FOLB 4Q9QL 1DQJA 2BFVH 2NY2D 5DJDB 1I7TA 4HMEA 4XCFH 1XZ0A 4XHQA 2XI9A 2WV3A 5IBUB 3T0ED 5E99L 5FK9A 4MXQD 4GRLC 4M61B 2AVGA 2C3VA 2DBJA 4WHTB 4C55A 3FQRB 3V2AR 3IJYB 1X5FA 5DT1L 4KTEH 4NQEE 2EDOA 3FQTB 2VITA 4M93B 1T2QL 1ZMYA 3BKMH 4ZUSA 5CHNB 4LLMA 3QG6B 4EI5D 5KBNC 1WAAF 5GS1C 2XWJB 1Y18A 3S4SG 5JMRA 5I19L 1KACB 2ATKA 2QADC 4MAUH 3SJVB 4HBCH 4W4OC 2BNRD 2VLMD 4OB5H 2BVQB 1R0AH 1MCJA 4JRWA 1N7ML 5DJYB 5ESQB 4U49A 5IP4A 1N6QH 3V4PL 3QAZC 3QJHB 3G6JB 2NR6C 3OKMB 5KSVA 2PCPA 4XP6L 3OKOA 4KXZI 4LVHC 3QQ3A 1CICB 4M7JH 2A6DA 4YDVB 3U0TB 2DD8L 4CADB 4AQ1B 3GFUA 1QBLH 1J0KA 4WWKC 2X4PB 1YEFL 4FFVD 4HWEL 2NY7H 4PJCA 1DSFH 5L8LB 4R2GD 3KYOB 4XVJL 4JFHE 3ZKQD 4AQOA 4GRLA 5IHBA 1BIIB 5FYLD 1OGTB 1WC7B 1RIHL 4QTHA 3LEXA 3MR9B 3SE9L 4W4NA 1AHWA 4U1IA 5IVZA 5IHZB 2H26B 2AAVA 5ESAA 4GKZA 1JV5B 3NTCL 4C54A 5GS1A 4S1RH 4NC1E 3QIUA 2BK8A 5M94B 3HC4L 1ZXQA 5F7YC 5D5MF 5BRZD 2XWBB 4MLIA 5IB2A 4Q97A 4W4OA 2NNAB 2R0ZL 1WBYB 4LCWA 3UPRB 4F7EB 2AXFA 2X4TB 3QPXL 4Y1AB 5TPWH 1WITA 5DT1H 1R6VA 4UBDD 5IGXH 4HWUA 1H3TA 2ZOLB 2OS7A 4XTRC 4PR5B 3MRBA 3NACL 4Y5YB 3F7PC 1F11B 2VR5A 4AIZA 2R29H 4X6DB 2D7TH 5C3LD 3TV3L 1FO0L 2WINB 3B5TA 3MCKB 4JRXB 4WWKA 4XVTH 2DTML 4AY0A 4G8GA 1YYMH 5ADOL 1X6LA 4FMFA 3VGHA 1X5LA 1MIMH 1UZ8B 4JHBA 5DURD 3CFJB 1AXIB 1JZ4A 2VDRL 4WTWA 5TDOB 4RQQA 1J10A 2DICA 5GGTA 4J3VA 5GGRB 5E2UH 2DD8H 2IANB 5B38A 3C5ZB 1HZHH 1KIUA 3O41A 5JOPD 5CZKA 3K7UA 1KGCD 5DRZB 2X05A 1CZ8L 2WM0A 5EO9A 2KUTA 4KGJA 4P49A 4ZUWB 5DYOB 1KTRL 3WFCH 1IGIH 2FJFA 2V2WB 3SE9H 1ED3A 4KGLA 4U1LB 2GJ6B 4PJ9C 3S88L 2CDFB 3DROA 4NJ9H 1A7RH 4R90L 2UY7A 3NTCH 1TMCB 4HC1L 3O3AB 4I4WB 4X6EB 5F93C 5MEOB 4HK3N 5E2VH 1DVFD 5CGYD 2R0ZH 2DIBA 1MJ7H 3O6KH 3MV8A 2HP4A 4P3DA 4LDLB 1S7RA 3DNKA 2DKMA 1KSRA 4FZEL 4WDIA 1M4KA 1U8OB 3BP7A 3CLFH 2MJWA 4JDZA 1JWMB 3WUWA 4DZ8A 1DVFB 3NACH 2DQUL 5I17B 2ORBL 4LSSH 3AGVA 1U8KA 3UBXA 3HE6B 3NCYP 4Z7UB 2PETA 4H0IA 5GS0H 2HFFA 2E3VA 2YK1L 4N0FB 4PGDB 1I9JH 2WAHA 3MO1B 4IS6A 4AENA 1XCTA 1LK3L 2UZIL 3IFOB 1AJ7H 4QYOB 4ACPA 3MCLH 4DTGL 1UZ6F 1SMAA 1G0XA 3JTSA 2VDRH 1INEL 5GRVK 3INUH 2NXZD 4QNPF 2R23A 4XP9L 2CUHA 4KY1L 3OX8B 5SWQB 2E8YA 2IQAA 4PJ9A 4PRPE 32C2B 5F7LB 2LVEA 4ZPTB 4Y2OA 4EIZC 3KPSA 2DI8A 5I75C 4YWGL 2Q86A 5FUCC 4LLQB 3RY6C 2Q76A 2ESVD 3FFCA 3W0WE 2XN9A 2JK5A 1LEKA 1KIPA 3HLAB 1MAJA 5DVNA 3VRIA 5BZWB 2NW3B 5ID0B 5HHMB 3JWDH 5CJ8A 3C5JB 4D9QD 5AD0B 2P43B 4OJFH 1QRNE 4Z0XB 2WWKO 5GGUA 1MCPH 1QACA 4JDVB 1U0QA 3MC0A 1OAZL 4GS7C 3ZE0E 4CVXB 1MI5A 3S88H 1A1NB 4K7FB 4XAKD 4R90H 4RISL 1DBAH 4LLWA 1IGYB 4P23B 3BT2H 2IMNA 1MHCA 1GOGA 4LHUA 5AEAA 5EU4B 5EULV 1KCRL 3MJ8A 1PKQE 4M4RA 2EH7H 1OAKL 2VYRE 4N8VG 3TBYA 4JFPB 1J87A 1R5IA 1DUYB 3ES6A 1PG7H 3A6CL 3JWDC 4U1HB 3WNMA 1FFQA 3D1MC 4YDIL 1E0OB 4PP2A 3OKNA 3QFJB 4AH2B 5IB3B 5DGRA 3WS6C 4G6MH 4M9PA 3BPCB 5ACMA 5I1JL 4X99A 4Z7VF 3EOBB 4G9FD 4JFOB 1EFXA 5FCUH 3TVMD 3NBNA 5T1LD 3IJSA 4MQ7B 4Z0BL 3BI9X 3CPLB 3TPKA 1A2YA 2DQIL 4LL9A 3P3YA 1FO0A 2DWEA 4KK8D 5LBSH 5DUPL 4AEIL 4W6XB 1C7SA 3WL9A 4JN2A 2APTA 3MJ9L 3TM6A 1J0IA 2Y7QA 1OTTC 2B39A 4Y4HC 4WTZA 1X7QA 1IKFL 4G9FB 5I15L 4KHTH 2J88L 4CUCA 1N8ZB 5LQBH 1N64L 1H3GA 5SX4I 3VGDA 1INQB 2H9GA 4J8RB 2UWEB 2ERJC 3MRPA 4L4TD 4WEUD 4L4VB 1INEH 2GY5A 5JXED 1Q9LB 1ZV5A 4NDMB 1K8IA 3DRQA 1KLGA 2CDEA 2YD6A 3X3FH 3MUZ1 2A2QT 5F72S 4JG1H 3ZKSD 1A9EB 2FLBT 5I8OL 3DV6A 3GKWH 4OZIA 4NWTH 1KXQE 1TZHA 1OD7A 1OY3B 4Y2DD 3QNZB 1X5XA 1YMME 4NUGH 3KYMB 3L3KB 1Q0XH 3G08A 2EYRB 4NQCD 5DSCB 3T3MF 3BEWA 4NSKA 1ADQL 2C26A 4H1LH 1IM9B 3WS6A 4Y2DB 3NFNA 4FQHA 4TTDD 3KLAB 1BOYA 1MELA 1N4XL 1NDMB 4KHXH 3NCEB 4JN1L 4HC1A 1ZLUK 1U8MA 2W1NA 3ZYOA 4YBHA 1OAKH 4UT6L 4N1CA 1CFVL 1IC5H 5DD6A 2NYYC 3CSPA 3A6CH 5ALCL 1FL3B 4ZPVA 1X5ZA 4Y4HA 5EUOA 4DGVL 4HKZA 2HJKA 5C6TH 1RK1A 4QHKI 3J8F7 5GSVB 4LSUL 1ZHLB 4WIQA 5EOCH 2Z91A 3VWKB 1FNFA 2KH2B 4EDXA 4NN6C 4PRPA 2ZNWA 4Z0BH 5M95B 3VD7A 3SCMC 1P7KB 3RFZC 3F7YB 1J7VR 3PV7A 2WZPD 5KANG 2IFFL 4POZC 3OAYK 3OXRA 2Y4SA 2O5ZL 2IF7A 4U1MA 4DJMA 1FSKC 4PGZA 5FGRA 3ZSTA 2DKSA 2XTJC 2DKUA 2NY6D 4C4KT 4OF3A 5L0QC 3DBXA 5DJZB 4ONGH 5DFTA 3C8KA 2IAMB 5E6IA 1I9IL 3VFUA 1NH6A 1T5XA 3QXDA 2Y06L 4BZYA 3MRKB 4X9BA 3RDTD 4HCRH 4PJIF 3RL2B 3W9DB 2I9TB 4NT6A 4ZFGH 2A0LD 3JXAA 4KI5F 1QVOA 3UPAA 2NY6B 4APQC 4YIQA 1PKQA 5F9DC 2CIIA 5FF6B 4PB9H 2FD6L 2V7HA 5E9DB 3OTTA 3WHXA 3A67H 2XZAL 1QBML 1MFAL 1JWUB 3RDTB 5DWUH 5JXAH 2AJZA 1ADQH 3KPLA 1BZ7A 1YECH 4ZXBB 2BSED 2W07A 3HI1A 4CMHB 5IB5A 35C8L 1N4XH 3BHBB 5JR1L 5F7UA 2DLIA 3TJEL 3RP1A 3G04B 3SY0A 4DKFL 4NZDA 5FHBL 5E95B 4ALAL 5BOZG 2WP3O 5A2LH 1PQZA 3TZVB 1KPUB 2HFEA 1C08B 3V6OE 4AIXA 1M71A 4LEOB 4BH8B 5ERWA 5HD8D 4YXKL 5D7LD 3BP5B 3PWPE 4QRQB 1V5JA 3SGEI 4LP4A 3G5ZB 4P5MB 1AGCB 3VE0B 2XKNB 3G5VA 3RWHB 3S96A 3VRLF 5D9SB 5FECA 1G7MA 4MJIB 5I1DA 3PNWB 1UB5B 2A6JB 4M62L 2J5LC 2QR0B 1AI1L 1YEGH 1YMMA 3QHFH 3MJ9A 2O5ZH 1BEYL 1ERNA 5K59F 4AL8H 2FEEI 4OBSA 4PLKD 3VFMB 3ULUL 3HZMB 1CR9H 3HAEG 2F8VA 3ZKND 4V2BA 3M17B 1P6AB 2Z8VC 2VZVA 2Y06H 4CRPA 2NY1C 1G0DA 2HVJA 3Q5TA 2DWDA 4NHCL 2PN5A 3I3DA 4NKDB 5GXBB 4XVSH 1K6QH 2PF6A 3KYNB 3VH8G 3F8UB 5IKCB 4GAYA 2KBGA 4L8CB 4GH7B 5I74C 5D1XC 4ZUTB 2ZCKL 3KPOA 2FD6H 3LIZH 4OCNC 1D6VH 2VQ1A 2XZAH 4JQXC 1LO2L 2B5IC 3EO9H 4FFZL 4P2OC 4P9HL 3ULUE 4LF3A 5HYSA 4TUJA 2P24A 1HSAA 2L7JA 3P2TA 5C2BL 2EYSA 4PRID 1N6VA 2RB8A 2YC1A 2J8OA 3ECBA 3N1GC 3TJEH 4DZBA 4CW1A 1I7UA 3V0WH 1RAMA 1H15A 1W72H 1DQJB 5DLMH 5JA9A 5HDLA 4IRJB 4ALAH 1I7TB 2NY3B 3B2VH 1G6RH 4DN3L 4HS8L 1XZ0B 1MWAB 4QRPA 1BECA 1JP5A 1QD0A 5FK9B 4XVUD 1FLRL 4YXKH 2C3VB 3VJ6A 3WNOA 3G6AA 4Q0XH 1NEZA 3GIZH 4FQIH 3HNTL 5T1DH 3BGFC 3T65A 1U3JA 1CDIA 2VITB 2O5XH 1CGSL 3CUPA 4EOWH 4PS4L 4ZUSB 5EU7E 1BQHG 4KMTH 4ZO8A 1FH5L 2BNQA 1Y18B 1LP9E 2ATKB 4M43L 4KMLB 5J11C 1BEYH 4NFBA 5F7EL 5D1XA 3SGKC 4PG2C 2IBZX 1I1AA 2BOCA 4JQXA 4GOSA 2P5EE 3ULUH 3KPRA 5I8CA 4NO5A 4QKXB 1P53A 1RQ5A 4U3XA 5F1NA 4L3AA 2JIXA 2GKIA 3SDXF 5C08E 2XQYG 4GRMA 1LO3H 4NC2B 4NHCH 3QA3A 2ITDA 4RBPH 1S7XA 4BQ6A 5KSVB 2PCPB 3FQWA 2C9AA 2I27N 5IK3A 4HFWA 2ZG1A 1YQVH 2A6DB 2DTSA 1N0XH 5CUSH 5T3XD 3EYSH 3MMEA 5IW6A 2R9HD 1RK0A 4PJEF 3ULUC 3ZKXB 4PJCB 1JGUL 3FRUA 1LO2H 4P9HH 2DMCA 1PG7X 1QBBA 1UXWA 1PSKH 1HH6A 3ZE1E 2VXSL 4GRLB 1OD9A 2ZWLT 3PWPA 5DJ8A 4E41E 1UA6H 5C2BH 4OFKA 4QTHB 1AR2A 3O6ML 5TFSH 3LEXB 1DQDH 1MQKH 5FYJU 5I1LA 3TWCL 4BFIA 1AHWB 4U1IB 5IVZB 3BN9C 2C1OA 4QF1A 3IKKA 5ESAB 4GKZB 1A6PA 5GS1B 4EN3D 4DN3H 2PYFB 4XNMA 2QADB 4HS8H 5MERA 4M7KH 3UBXI 4P9HC 5AYUH 2DJ4A 2NR6D 3U7YL 5IB2B 3SGKA 1VFOA 1WUNT 1IGTA 4PG2A 3MNZA 1JUFA 4H0GA 3OHXA 3RVWC 2AXFB 3UP1A 4N9OB 3UEZA 3BFOA 5EU7C 1YEDA 4Z18A 1DL7H 4NQXB 4YHOH 4PS4H 4M7LH 3ETBF 3JV4A 4GMTH 4U0RC 4HIJA 4LVHB 3LKOA 2HRLA 4M43H 1XIWA 5FGCB 3DMMC 4AIZB 5C0AA 5TF1L 4X6DF 3X11A 3T2QA 3ZKMD 2PW1B 1IMHC 3RKDD 4K55A 4WWKB 1HH9A 2A9NH 3SDCA 4G8GB 4RAUA 1U8IA 4ODWA 4JGJA 5C0BA 2NX5E 1ZT1A 4QGTA 1IT9L 5E2TL 3I02A 5F1IA 4TTGA 5CEZE 3EFDL 1ULVA 5DHYB 4RQQB 1K8DA 1T1WA 4O58H 4NQED 1CQYA 5B38B 1GC1L 1TJIL 4J3UA 1JGUH 2HT2D 3LZFL 5CGTA 1Q38A 2DM4A 5EO9B 3OWEA 4JY6A 4EBQH 3PWVA 3PQYD 1GOHA 4WU5A 3LEYH 3S7GA 2FJFB 3AS1A 4NOBA 4LSQL 3UCRA 1ED3B 4K94L 3T2OA 5EOQL 4PV8B 2FX7L 5F88A 3LAFA 1FNEA 3DROB 1RHFA 1RUQH 5B3JE 1AE6L 3DMMA 2FSEA 3NCBB 4TNWF 4OIAA 2P5EA 3WFDH 1JHTB 3MV8B 1PW3A 4P3DB 4HGKC 1S7RB 5C08A 3EYUL 4NHUA 3AREC 2WMPA 3BP7B 2UVFA 4GG6E 4JM4H 5CEZH 2IPUK 2JCCE 1HN1A 2EEAA 3O81A 4JDZB 4JFHD 3WUWB 4DZ8B 1I8MA 1RJZA 2FDBP 4HKXA 1BF8A 1U8KB 3UBXB 3CFIC 3SKMA 3I3EA 2HFFB 4Y4KD 2ZUSA 5E94A 3MRGA 2B0SH 1YPZA 1IGJA 4IS6B 2DBLL 2FZ3A 3FKUS 5ENWA 4XB7A 4AENB 3LEVH 4V2CB 4F3FB 1K5NA 1UWXK 4YHNA 4HT1H 1IT9H 5E2TH 3RKPA 1TETL 4MZ3A 3CC5A 2HJLA 2JJWA 5F3HB 4ERSL 2CXGA 4EI6A 4AEEA 2R23B 3PP3H 3WO4C 3DO3A 3DVFA 4MCZB 4PJ9B 3HMWL 4JKMA 4YH6A 2NXYD 1GC1H 3SDDA 2F8XC 3LZFH 2Q86B 3QI9C 1QFUH 4F80A 1KBGL 1GIGH 2Q76B 3GHEL 3G9AB 1YNLH 3FFCB 2XN9B 3T0XA 3NCJH 1SM3H 2JK5B 1PFCA 1LEKB 1KIPB 3VRIB 4N0UE 4XCYA 1U3ZA 2XQBH 3MOAH 3DXAE 3H9HA 4K94H 2DM2A 5EOQH 2YPVH 3ZT5A 5TQ0H 3MV9E 5FA4B 1IFHH 2IQ9H 4OZ4A 1DP0A 1GC1C 4LLWB 4PJBE 1A6VH 1MHCB 1WFNA 3RUGE 4LHUB 3MJ8B 2AV1A 4YX2H 4LPVA 4RGOL 1JGVL 1R5IB 1VACA 5JZ7D 5GS0D 2NTSP 2YOCA 3K1DA 1AGEA 1A4JB 3TN0C 3OKNB 4K94C 4ZAKC 5I1KH 5EA0L 3T1FA 3CXHK 4X99B 1AGFA 1EFXB 1RMFH 4XC3H 3IJSB 4PJ7A 2DMKA 5IIEB 1WK0A 4YUEL 4XWOC 1A2YB 2X89D 1FO0B 2DWEB 2QQLL 2J7LA 4F57H 5ANMA 5T5FH 2D7MA 2BY1A 1SVCP 3WL9B 4JN2B 5I75B 3QNXA 2BSRA 1MREH 3QI9A 1KB5L 4JR9H 4MZ2A 5LKNA 2YWZA 3U9PH 2AS5M 2Q8AL 3PHOA 2LAAA 1TETH 3VFWA 3C2AL 4I9WE 3MRPB 2GYSA 2UWEF 4WI7A 4ERSH 1CD9B 1DEEA 1K8IB 4HAFA 3DRQB 1FHGA 1SYSB 2CDEB 4GS7B 3PABA 5BS0A 4F9PC 2V7NB 3DV6B 4OZIB 2PXYC 4G6FD 1TZHB 4CJ1A 4U6YA 4UIKH 3UYRH 3ARVA 4ONFH 4ELME 3GHEH 2CRYA 4NPYA 5ESVB 4XPHL 3G08B 3BWAA 4JY5L 3BEWB 4NSKB 3WHE1 2VLRE 2ED8A 1S7VA 4LAQL 3TN0A 3U0WH 1HYSD 4ZAKA 3H8NA 2I60H 1XGRA 1WV7T 1YEHH 3E6HA 1DQLL 3S8WA 4MNHA 1GYAA 1U8MB 4R96B 1UKSA 4OCYH 1ZK9A 3QZWG 3W2DL 3U4AA 1A14H 2OZ4A 2XICA 1MF2L 3W81A 5IW1A 2YS4A 4ZPVB 2E9BA 4Y4HB 5EUOB 2HJKB 1QSFE 1RK1B 3D2UA 3NZ8B 2DIAA 4AEHL 5EG6C 3W0WD 2Z91B 1MJUL 2ERJB 2FATH 3EGSB 2G75A 4PRPB 2OM5A 4TSBH 1QFWM 1QRND 3ZDYE 1D5IH 1TTUA 4UT7H 1FORL 4F9PA 3HC0A 4Q74A 3DSFL 5K9QG 2VL5B 2VISA 4U1MB 4C56E 2P45B 1KB5H 3ULSA 4YQXL 3QULB 1GSMA 3MRNA 1ORSB 2Q8AH 4CU6A 1I4FB 3VFTA 3C8KB 3AVEA 2OR9L 1L9MA 1FVEA 3VFUB 3MXVH 1T5XB 2LV4A 4QEGA 3MV9A 4IOIA 3ZE2F 3QXDB 4LSTL 1MCNA 2EXWC 1B0WA 1FAKT 4J6RL 4Z7QF 3V8OA 4OTXL 4NT6B 4QRRE 1U91A 2QSCL 2V17L 3V79C 1T3FA 3EYVB 3QRGL 4DK6A 4YIQB 5JHLH 4X7SL 1PKQB 4JZNA 3GMNB 1MCHA 2K7PA 3VG0L 2VKXA 1ZHKA 4JGMA 1TIUA 1DCLA 1WWCA 4I2XE 4NKOA 3WHXB 1QSZA 4ZS6C 5D7KE 2LU3A 3SCMD 4LQFH 3CSYA 5IVXE 2C3GA 4M48L 1ORQA 3QUXC 2AJZB 3KPLB 2GITA 4H1LB 1OTSD 3HI1B 1R3HA 4W6WB 5IB5B 2CH8A 4JO4L 4LHJB 1HDMA 4NN6B 2WW8A 4NZUH 4M1DL 4LRNL 1M7IA 2Q6WA 2Y5TA 1P9MC 3VGGA 4BQBA 1PQZB 3BP6A 1FSKB 3B9KC 2HFEB 3DUUB 4RA0C 2XTJB 1M71B 4APQD 5L0QB 3GMLA 2J6EL 1KLUA 3BQUC 4M5YL 1MJUH 4CVZA 5EIQA 1CGWA 4UNUA 5D8JH 1QR1A 1CLOL 3G5VB 4HBQA 3S96B 5DJ6A 5JW4N 1C1EL 2DQHL 5FECB 1G7MB 4GSDL 4OM1H 3RZWA 3GNMH 4XNXL 1FORH 5I1DB 3BD3A 3BH9A 2G60L 4APQB 1HWHB 4ELMA 3VW3L 2QSTA 4WUKL 1YMMB 1A6AB 2YBRA 3U36A 4YQXH 5LWYL 3S37L 4ZSOE 4K3HA 3ILPA 3FB8A 1TQCC 1LDSA 2OR9H 4KQ3L 4G7VH 2EDNA 4G80A 3BIKB 3QUXA 2OBGA 4MDIA 4LSTH 2L7UA 4N90D 1QQDA 3WDHA 2DWDB 1ZOXA 1JWSA 1YUHA 3MGTA 3MBEC 1RJCA 1UCBL 4GAYB 3DGGB 4JQIL 2HG5A 2AGJH 5TQ2L 4YHPA 3VG0H 3KPOB 1P7QA 2VQ1B 3LPFA 3WDJA 4ZO7A 3S6CA 1P9MA 1JRHH 2ENYA 4OUUA 3B9KA 4H26A 4WTXA 5HYSB 5E1AA 4TUJB 2P24B 3OKEA 2X4UA 4GFTB 2EYSB 2DQDL 4JO4H 5GGQL 2ED9A 2YC1B 3ECBB 5D1QA 4DZBB 4CW1B 1NGYA 1DQML 1I7UB 4EUPA 1H15B 1SYVA 2WWMC 4XZUA 4K8RH 1F42A 3L3OA 4LRNH 2E27L 3EOAA 3NZHH 5F7HA 5C0CE 3IKCA 2J5LB 4Z77A 5EOCJ 4LNRA 1ZLSH 1CE1L 4WW1A 1NUNB 3IDMA 4QRPB 1QO3A 2B1AL 2ZCHL 1T7YA 2ITCA 5IVNA 4R0LC 2J6EH 4M5YH 3G6AB 3ARBC 2QKIA 3BEVA 1F4YL 1CL7L 4LCIH 3QUZC 2A77H 4KRNA 3CUPB 4R26H 3FB5A 1C1EH 2RBLA 4TRPH 4DN4H 1NUGA 2NY1B 4XNXH 2WBJA 4P2OD 1ZLWH 2BNQB 3IFNL 3MBEA 1SBSH 3MFFA 1A7NL 4EN3A 5I74B 4I2XA 4JJHA 5D1XB 1I3UA 4K2UH 3HR5A 5LWYH 3S37H 1FQ9C 3L3IB 1TVHB 2BOCB 5J1AA 1BFVL 2X1PA 3MNWA 3EOTL 3KPRB 5I8CB 4NO5B 2B5IB 3B8YA 4D0DB 4P2OB 2JIXB 3KJ4C 3OKDB 2W92A 4R8WL 1L6XA 1XH3A 2FHFA 3RWFA 4ZODA 2UUDH 4GRMB 2X4SA 5GSRA 4G3YL 1NBQA 4RRPA 1MEXL 3QIBC 3FQWB 3H42L 5IK3B 4JQIH 2ZG2A 2P8PA 4TSCL 5IW6B 1LO5A 2R4RL 1RK0B 2NLJA 4KKCC 4HH9A 3RHWK 3RIAK 5FUZL 1J86A 4PJCF 4L3CA 3FRUB 2H8PA 4OSUL 4YE4H 4B7IA 1KG0A 1UXWB 1J1PL 4R0LA 3PWPB 4RMRA 1BX2A 1UACL 3F58H 3PGFH 5GGQH 3ARBA 4FRWA 2B4CH 5I1LB 2QHRL 3BGFB 4BFIB 3V0AC 2ADJA 2C1OB 1EO8H 4QHLA 4PUBL 4LVNC 5KZCB 5MERB 4ZSOA 3BESR 5D7IA 1W0VB 1IGTB 3MNZB 4MS8C 1WCBA 2KKQA 3OHXB 3WS3A 4HUVA 3ALXA 1MCFA 1F4YH 5HPMA 4UTAL 1YEDB 3MA9L 5IV2A 1J8KA 2F5BL 5J9PB 3JV4B 3RI5K 4BK5A 1IC4H 3QIBA 1GHFH 5I2IA 4PV9A 4HIJB 3KR3H 1A7NH 3TO4D 3LKOB 1XIWB 4WVRA 1PGRB 5JPMB 5DD0H 5C0AB 2YWYA 1C5DA 4V1DE 1CIDA 5F1KC 1XCQB 3X11B 1FIGL 1BFVH 1KFAH 4DGYH 1HH9B 2V5YA 3D6GA 2K3TA 3KS0H 3BN9D 5IHLB 2R4SH 1U8IB 1B6DA 5EWIH 4ODWB 4R7NA 5C0BB 4QOKE 5EU5A 1ZT1B 3QEGL 2FX9L 4G3YH 4WENB 3DLQR 5F1IB 3QB7C 3H42H 3FQXA 3VWJD 1K8DB 1T1WB 5B39A 3M45A 3RVWD 1CLZL 4OUOA 3IDXL 2NY0D 4U1GC 4Y4KA 5FUZH 1NGQH 2BXYA 3CLEL 3H7LA 4ZNEE 2J8UF 1DE4B 4PRHE 1FZJB 1OF2A 3DO7A 4JY6B 5KVFH 3PWVB 2I5YL 1UACH 2ICCA 4I0PA 4WU5B 1UFUA 1BOGA 1AD0A 1CWVA 5D7SL 4OCWH 3WLWD 3L5WB 1DBML 1FIEA 3GSQA 3OJDA 4S1DD 5F88B 4X4ME 1LP9B 1FNEB 1OT2A 3O4LD 4PUBH 5T1KD 5EZIH 1OAUL 3U7WH 3RGVD 1NCBL 2YR3A 2YPLE 3RJQB 3TH4T 4X7DC 3DMMB 2OJZL 2FSEB 3O3UN 4OZHF 2P5EB 3BYTA 3O2DA 5CJQL 5FKAA 3U0PA 2W59A 1I1CA 3K8MA 3NIGF 3QUYD 4KK5C 2PTUA 5C08B 4NHUB 3OF6A 2DI9A 1IGFL 2DM3A 4L9DA 3VA6A 3LVEA 5DVOA 1I8MB 3RWDA 3VXQA 4E41D 3QEQE 1U8LA 5CKAA 1RJZB 5MI0C 4HKXB 3K0WA 3SKMB 3C60D 1FIGH 4OQ1A 3RWJA 3HFML 3VXME 5E94B 3MRGB 4MA1C 5BVPH 5SWSA 1WZLA 1TPXB 4FQLL 1YPZB 3TNNA 1IGJB 1U8QA 2OTWA 5ENWB 2UZYB 4E41B 5ITBL 1MJ8H 1L9NA 1K5NB 1J0JA 4KAQL 5D6DC 3ROLA 3TGXA 3THMH 2RGSA 1KJ2L 2R2EA 1NC2A 4J3WA 5BW7C 4OFVA 4JG0H 1KPVB 2JELL 1Q0YL 1WISA 4EI6B 5HI4C 4KDWA 2EIDA 2MMXA 3WFBL 1QYGH 5J1SC 4BA8A 1FFPA 3ARED 5C9KA 5JDSB 1T04A 1RIVL 3CXDL 3CLEH 5AWNH 3MV7E 4LKXA 1OGAD 2O5YH 2VXTL 1I1FA 3VFVA 1BP3B 1KB9K 2OTPA 3S4SA 4XCYB 5D7SH 4F8TA 3W11C 3AREB 2Y9RT 3H9HB 4FP8H 4J1UB 1D3CA 4OLVH 4TQEH 3GRWL 2NX5D 1Q72L 4OZ4B 4F37F 1HXMA 3K1KC 4PTUA 2YPKA 2YUVA 5CEZD 1INDH 2XFXB 4KJWC 1DFBL 2AV1B 3VFNA 2NZ9C 1HQRA 3RWCB 4TVPH 1FYTD 2R2HA 1F45A 3VD4A 4XI5D 5D6DA 2ZPKH 1B0RA 2R8SH 4WCYH 5HHNA 5JUEL 1AGFB 4NM4H 4G9DB 1T4KA 4FS0A 5CP3A 3PIQA 1RU9L 4PJ7B 4G8EB 3WO4B 4AZ8A 2I25N 2AJVH 3MUHL 4M1CC 1N5YH 3N85L 5KVGL 3AY4C 4JE4B 5ANMB 1IEAA 4JHWH 1XGQB 5JIHA 1YEEH 4XH2A 3QNXB 4PJ5E 5HHXH 2BSRB 2W9LA 3QI9B 5ITBH 3CDGA 4LGRB 1KENL 1F90L 5FEBA 1KEGH 3PHOB 3VFWB 4NQDA 1VESA 3GMQB 1A3LH 2D0FA 4BFEA 1DEEB 5F7DA 4N5ED 5DRWA 5E2JA 4E42A 1RIUH 1J05A 2ZKHH 4UAOC 5C07A 1AKJA 1R3JA 5BS0B 1W2KT 2QHLA 1RIVH 4OZIF 3CVIL 4U6YB 3V6FA 3P4LA 1R3LA 4K23H 4LASL 1RUAH 5F97E 1YMHA 4ZS7L 4HULB 5KN5A 1OB1A 3IRZA 2AW2A 4NPYB 1J0YA 2FB4H 1RJYA 3D3VD 3P0VL 4IMLA 3BWAB 1ZWIA 5DEZA 4G7YL 1S7VB 3TN0B 3QIWD 3PXHA 4ZAKB 3GRWH 3CFBA 1XGRB 3LKNA 3E6HB 4IRZH 4MNHB 4M1GH 5HDOA 3EZ8A 4B5EA 3AY4A 3S37X 2V2TA 1L0QA 2ADFH 5A2KH 3GMPA 4QXTB 5IW1B 1GVIA 3CSGA 1CFQA 5EUOF 4QRSA 5E8DH 1NCDL 3D2UB 2D03L 1SJEB 2PXYD 1K3IA 2AK4E 4BZ2L 1J5OL 5IESH 3VI3F 1ZEAL 3KPPA 1FJ1B 4NO0D 5JORA 2G75B 1LO0H 4H5SB 3N1QC 3DXAD 4TULH 1FGVL 3MV7A 2BDNL 3CMOL 2BRRL 1EZVY 1FZMB 1GGCL 2PXYB 1NPUA 2VERN 2VISB 5HI5D 5KOVC 4MJ4A 4XBEL 1JZ7A 3O2WH 4MHHI 3ULSB 3ZHLA 2JE8A 3MRNB 1F90H 1KJ2A 3O6FD 3HG1E 3DXAB 3VFTB 2XXCB 1FVEB 2GUOA 4JKPL 5J3HC 5JNYA 3MV9B 1YN6A 4QHMA 4B41A 3VXSE 5EC2A 4HG4K 4NJAH 3LS5L 1U91B 3BMVA 4YDKH 3RUGB 2IALA 1T3FB 4UQ3A 3CVIH 3FO0L 4JZNB 3CZFA 4JDTL 1NAKL 1ZHKB 3GSVA 1IKNC 4EVNA 4NKOB 4QHNA 3RVTD 3CSYB 3ZSSA 2KZ1B 4LNVA 2F5AL 3ARDD 3CDCA 1OSZB 1ORQB 5AZEH 4ZD3H 3GK8L 3KPNA 2F8OA 2GITB 2X4QB 4EKXA 4OLUL 1R3HB 5F1OB 3QRFM 1ZTXL 4OZFA 2WBKA 1EJ6A 1YNTA 3MLWL 5I18H 5CIPA 1HDMB 3FB7A 3RTQC 4I9WD 1P4LA 2CJUL 5IMKA 1SEQH 3BRGC 2XWTA 4RBPK 1EXUA 2PTTB 4OCMC 5BZDA 5GJTH 1M7IB 1EGJA 4XHJC 4Z95H 3MYJB 2Q6WB 2Y5TB 3IYLW 4I3SL 3OZ9L 3BE1L 3H2WA 4IMKC 3BP6B 3CX2A 4OLXL 4PLOB 1KCSH 1NCDH 1UZ6E 3EOYG 4NN7C 4L8DA 4KZEL 3OKLA 1U8PA 1KLUB 1IARB 4G42A 3QWRD 5FCSH 4WTZG 3WJJC 3CSBA 3H3PL 4MVBC 4CVZB 5I71B 2ID5A 2HTLC 3AU1A 2HT4C 4QNPE 3WV0A 5DJ6B 2VLRD 3MROA 5CINL 1FGVH 4Z7WA 5DTFA 3Q5OA 2C3HA 3VMOA 1J1OH 2DQJL 1GGCH 3BH9B 4ELMB 4P46C 5IHUL 3BPLC 1I1RA 3U36B 4CMMA 3O11B 3LS4L 2E7CA 5ADPL 1KB5B 3QWQB 1IKNA 1Z0NA 4NCC1 1CGVA 3RWEA 3FB8B 4OM0L 3IDUA 5JW3L 4G80B 3QUXB 5KTEH 4MDIB 5KJRL 3V6BR 1PX4A 4F58L 1QQDB 4TOYL 1QSFD 5HHQA 4PGBA 1JWSB 1IQWH 3MGTB 4A2LA 4YR6B 3RTQA 4JDTH 3S9DB 2HG5B 4MJ5B 4X6CE 4YHPB 1P7QB 1XGUB 1HINH 4OGYL 5DC9B 1JF6A 3SE3C 1QSFB 3JWNC 4TNVF 4WY7H 4JFQA 2Z31D 4U2YA 3RNKB 3HNSL 1FGNL 3RVXC 4OUUB 4IMKA 1HKFA 3B9KB 3MRHA 2AK4A 1GPOL 5E1AB 3OKEB 4C56D 2X4UB 1KIRA 1QSEE 1ZTXH 5JPNB 2VLJE 4Z7VE 2A6IA 3BQUB 3MLWH 3IDNA 3WJJA 3WNNA 3SQOL 5I30L 5D1QB 4ESKA 5K9JH 3GBLA 5DQ9A 1NGYB 2FIKA 1HHGA 2AQ1A 5FM4A 3F65A 4EUPB 1SYVB 4XZUB 5FUOL 3L3OB 4LOUC 3EOAB 2R0LH 3IKCB 4LGPB 3GSXB 4QRRD 4EDWH 4I3SH 4Z77B 4H25A 4P46A 2BVTA 4WW1B 3OZ9H 1JPGA 5CFHA 3IDMB 4Q9BA 4OCXL 2B7DT 3HG1A 5C0ND 1IEHA 5DO2C 5D7JD 1CGXA 4O2FB 4E9LA 2QKIB 3BEVB 2LU4A 5ILTL 1S7QA 3H6JA 3LKRA 1DQQB 1B4JL 2EE9A 1CF8L 4N1EA 4DQOH 2WBJB 3IF1A 1CGYA 4X9HA 3F12A 3L1OL 4P3CH 3QDMD 3MBEB 2LVCA 2FNBA 3MFFB 4FQ2H 5DD5L 5IHUH 3MZTA 4I2XB 1FV1A 2FLRT 3JVGC 3LS4H 4G6AC 4XPFH 1TQBC 1V3LA 1WFUA 1FFNA 3MNWB 2K7QA 4OM0H 3SE3A 2VDLL 3T3ME 1Z9OA 5KJRH 5E5MB 3OR7A 4K3EL 1XH3B 4W6YB 3RWFB 4TOYH 3WJLC 2XA8H 5GSRB 3QEUA 4PD4J 3QO1B 2BMKB 2P8PB 1HHHA 1J1XL 4NUJA 1LO5B 4NKQB 4OGYH 2NLJB 3QUZD 4HH9B 3EDDA 5GRWA 4HGMA 4L3CB 2H8PB 1KG0B 2FJHA 5C09D 3HNSH 4K8RD 1JIBA 4KRPC 4R0LB 1KTDB 1VA9A 2ARJA 3O3DA 5FDYA 2O61A 3MLPA 3ARBB 3NFSL 3B43A 3SDAC 1B2WL 1CL7I 3QUZB 3DARA 1G7LB 2ADJB 4XP5H 1WSST 1X4XA 3SKOA 4M03A 5EB9A 4XWGL 3HAEH 1I8KA 5CD5C 5HY9A 4ZSOB 3PP3K 1MFDL 3JVGA 2K9UA 1NFIB 2WSKA 4LLYA 1WCBB 4I77L 4RMUA 4OIIL 1T03H 4D0CA 4HUVB 1AO7D 5HPMB 3HPLA 5EZLA 5H2BA 2F54E 5ILTH 5BCAA 2HRPL 4HKJA 3KJ4B 4KKCD 4PJAA 5IV2B 1RHHB 2BSSB 4P3WA 4DFHA 4KKAC 4PJIE 2OR7A 3WJLA 4Y7MA 4KI5E 3TYFA 3LRSA 3MSPA 3QIBB 4X6CA 5I2IB 1WTLA 4PV9B 4LEXL 2WK2A 3TF7C 1WFOA 4UZGA 1C5DB 3WKNA 3E8UL 1GXEA 2ILLA 3MBXL 2CK2A 5C0CD 2CR3A 1M05A 2F53D 2VQUA 4HF5H 4JQVC 1QSEA 3H9SE 4R7NB 5L2KA 4Z7VA 3KYKL 5J0BA 5EU5B 4PJXA 5EBMA 5IMMA 3C9NA 1HILA 5LGHH 4MS8D 3I85A 5HYSG 4TSAH 5FO8A 1A5FL 1F4XL 3QH3A 4IOFD 3C60A 4NGHL 4OZGA 3NCCB 4GT7A 3HZVA 3U1SL 4LVNB 4EXKA 1PY9A 2JJUA 4Y4FC 3GI9H 4LPWA 1Z3GL 3B3IB 1SJHA 3VI4F 3QJFA 1OF2B 3UZVB 4K7PH 5DEFA 1OTUD 1L4IA 5DMIH 1NANI 4MNQE 4PJGA 1BOGB 1T89A 1AD0B 4O9HL 4DKEH 3CK0L 1EX0A 3IU4H 5DMGD 3UJTL 5HGDA 4YHZL 3BW9A 1NMAH 4XXCC 3DX7A 3VRLE 4QWWD 5HYQA 4JRYE 4LSDA 5CAYB 2XYCA 1J88A 4NNPL 1F3DH 1NEZG 4LHQB 3T4YA 3KHOA 3ARRA 1TTGA 3EW3B 4GLRH 4U3HA 4WNQA 1OARL 5K59E 4JREC 4JFZL 4YHIA 4UU9B 5FKAB 3U0PB 3RZCC 1AQKL 4ETQA 2A83A 4MQTB 3QUKA 4OIIH 5HHPA 4WI6A 1IC1A 3RIFF 4O5LL 5I16A 4JQVA 4KI5C 1A9BA 4OLYH 1M7XA 3AC0A 3FO9A 1M1SA 4BSWA 1T22A 3RWDB 3VXQB 1U8LB 3W39A 1G7PB 1MHPL 1BD2E 5F89A 1KCLA 5ECJE 1RY7B 3E8UH 4NP4H 2R0KH 2HH0H 4U1GB 5SWSB 2A73A 4OCRL 1NSNL 3TNNB 2EDTA 4KKBD 4Y4FA 1YPZF 1U8QB 2OTWB 4PP1C 1JZ2A 5L8KB 3WHE0 4KJQC 4WUUA 1FZKB 5EU6E 2R2EB 3FT3B 1XF2B 3VFOA 4HMDA 4RMSA 4XXCA 1F4XH 2WQ8A 1NGXA 2X42A 3QDGD 3HMXL 3O0RL 2WQRA 3VXNA 3RPIA 1U8JA 1FFPB 2ZJSL 2VO5A 4I5BA 4ODXA 4HUWA 4LKXB 1Z3GH 1MRDL 1CG9A 4NO3A 1V3KA 4GW5B 4OGAC 3LB6D 1I1FB 3CU1A 3MFGB 4V1DD 3ZDXF 3VFVB 3RZCA 5IT2L 4FG6C 2D7OA 4XMLH 3C6LC 5HYJA 2F54A 3S4SB 4O9HH 1CLCA 3UJTH 1UJ3C 3TA3D 3BPNC 5E70A 4HPOL 2AERT 4S0TD 4Y5VC 1MRCH 5I76B 4G6KH 1MVFA 3UJJH 1BVLB 2W60A 4QOKD 2EZ0C 2VR9A 4V1DB 1J11A 1HXMB 5JW5A 4PTUB 2YPKB 5MI0B 3NIDF 1FBIH 3SJVE 3CCHA 4QRUA 3IFLH 3WLBB 4JFZH 4X83A 3ESUF 4KTYA 4QCIA 1AQKH 3K4AA 5J06A 1HQRB 3BDXA 4MA1B 5D4QA 3FL7A 5I1GH 1UH4A 1GAFH 3ZL4L 3D3VA 4L8SC 1BJ1J 2R69L 4KROC 3SDXE 1DZBA 4PRHD 4P9MH 5CJXC 1EHLL 1O7VA 1U3HD 1B0RB 1OWRM 1U2HA 5IVOA 5HHNB 2M1KA 3I50H 4PPTA 3BDYL 1NCWL 3KS0J 3PIQB 4PJ7F 1QR4A 4XNQA 2AXJA 3LH2L 2VDML 4CVWA 4KUZL 4LVOC 5TGBA 1EO5A 1RZGB 4OLWH 15C8H 4PJEE 1IEAB 4XH2B 4HKBA 3CMGA 1U92A 3ARGC 2DLEA 2YPLD 1D7FA 2XZCH 3CDGB 4MNQA 1T5WA 4F33B 2W0FA 1CDYA 4HX1A 5J13C 1YEIH 3C6LA 4KJWD 3TJHD 2OXHA 1BQLH 4JRYA 2PYED 2X7LA 7CGTA 5F8RC 2KQMA 5F7DB 1RZJH 5DRWB 1EH9A 4GUPA 3TH3T 2H2PC 1F4HA 3C08L 3HMXH 3RAJL 1J05B 4E42B 2VXUL 4Y5VA 3V6ZA 5C07B 2YD3A 1AKJB 5GJSL 5E8NB 2DL2A 1A4KA 3PL6C 2CGRL 3MUGA 2VC2L 3QEQD 2DLFL 2Y36L 4IHOA 1R3LB 2DQEL 3SO3C 1TVBA 1YMHB 2NCMA 3FRPG 5KN5B 1OB1B 5IT2H 1T83C 1D9KC 1RJYB 3UTQA 3VXMD 1HSBB 3U46A 4Y1AE 4IMLB 3BRFA 1PZUB 1ZWIB 1JHKL 4JFEE 4X0KA 4L8SA 3SE8H 4FFYL 1RZJC 3E2HC 1RZ7L 4HK3J 4XB8A 3CFBB 4TVPD 4U1JA 1QTYT 1RJLA 2GK0B 1F58H 2AK1L 2VDOH 2P47B 5FKPB 5TE6L 3LKNB 4X6DE 2GTWB 5GGVY 3EYOA 3S98A 3PWUA 4U7SA 4JRXE 2EDWA 4GKOA 2V2TB 4Q2ZA 3GMPB 3P73A 3ZL4H 3ARQA 2G9HA 1CFQB 3ARGA 3DETD 4QRSB 1H0DB 2IH1B 1A64A 1A0QH 4S1QL 1EHLH 3HZYA 4MB5A 3OAYH 3OJVC 4Z5RA 5IFAH 1CYGA 3BDYH 3KPPB 1NCWH 3U4EA 1KCUL 5JORB 4GAGL 5TH2B 5DJXA 2BY3A 1MCOL 3MZGB 2IANE 1UWGL 1VPOL 3PF2A 3QNYB 4IRSD 3MV7B 4LSRL 4M6NH 4UAOB 2GCYA 3PL6A 1NBVL 4KTDL 3KYAA 3IETA 2QQKL 4PY8I 1T83A 2PR4H 1D9KA 3KDMA 3WFEL 1KJ2B 1UEMA 1DBKL 3QCUH 3WDIA 2ZUVA 4UV4L 1L7IH 3P30L 4Y19A 2AI0L 2GUOB 4LGSB 3SE4C 4M4PA 1YN6B 4QHMB 3MXWL 2GJ6E 4HK0A 2BJML 2R2BA 5EC2B 2Q7YA 4AM0A 3MUY1 4NN5C 1FNSL 2IALB 2IGFL 3VFPA 1ND0B 1E4XL 3CZFB 3DVNA 5E00A 4RGND 1J12A 3GSVB 4URTB 1ZLWK 5ALBL 4QHNB 3CFDA 5MEQA 3SDXA 1AQDA 3MRCA 1JHKH 3LQAL 4M6ML 2VDPL 4D0BA 3KPNB 3HI6L 4PJ5D 5ACLA 3V4UH 3KXFA 4WI3A 3S3SA 1YNTB 3FHAA 5D71L 4NCC2 5HGBA 3TBVA 5CIPB 5I1AA 3FB7B 4L3EE 3ARXA 3FMGL 3RBGA 3GI8H 1KCVL 1P4LB 5J8OA 5TDNA 1VGEH 2ZUWA 5IMKB 4PJEA 1KNOA 1S8DA 1Q8MA 1UVQA 2XWTB 3T77A 4DCQB 5BZDB 5GRZA 5J3HD 2X4OA 1HKLH 1YQ2A 3CVHL 1H9VA 1OP9A 2ZCLL 3ZHKA 4M5ZL 4OD1L 5I1CL 3FOMA 1PYWA 3OKLB 5C0JB 1U8PB 2OJEA 4R4NC 4G42B 1UXSA 1WFTA 4Z76A 1CGUA 3UTTE 3GJFA 3AU1B 3C5ZC 4JPVH 3TBSA 4GAGH 4BQ9A 3SE4A 1Q9KA 3QQ4A 4OQTH 3IDYC 3B83A 4N0CC 2VE6A 1MCOH 2BNUA 4M8VA 3MROB 1UWEH 1VPOH 4GRWF 4Z7WB 5DTFB 2EXYD 1CFTA 4UV7L 3BH8A 5HXMA 5KSAC 1RVFL 2F15A 2W0LA 3CH1A 1TFHA 3C6SB 5K93A 5B8CC 4M6OH 3R1GL 4WO4D 2AXGB 5HGGS 3L3HA 4CMMB 4AEFA 4LU5H 1XEDA 1NMBL 4U2ZA 1A6UL 3RWEB 4K7PX 4A6YL 4H88L 1FN4B 5HHME 4ZOBA 1TZIA 3P30H 4M6AA 4HJJH 4ODHL 1OAQL 1T1YA 3V5KA 4JPWH 4UOJA 2EH8H 2CMRH 3ILQC 1UH2A 3LKSB 4PGBB 5ISZA 5KANI 1VGKA 2FGWL 4HLJA 3RTQB 2NMSA 3O6LH 3V0VA 3LV3A 2OSLA 3TO2A 4AMKL 2ZUTA 3TFKC 3D48R 1G9ML 2HT4D 3PP4L 1IC7L 3DX9A 4JFQB 4KFZC 5IQ7H 1LWRA 5E03A 4JFFD 4P2QA 3HI6H 1QFPA 1KPRA 2AK4B 2JLLA 4NN7B 1KIRB 1PEWA 2CKNA 2A6IB 4NKIH 2H32A 5D71H 3IDNB 2VDKL 5KG9A 5FB8A 2HA1A 2FX8L 3VRJA 3VXRA 2Y1VA 5DQ9B 4RGMC 5FGBA 3WEXA 5T33H 1HHGB 3BUTA 1EO7A 4X8JA 5E6ZA 2CLRA 2YSSA 2Y07L 3VXSD 1NGPH 4MD0A 1EEZA 2AJUH 5KSAA 2YD9A 3KAAA 5B8CA 4H25B 2R0WH 4P46B 5L2JA 1JPGB 4X80H 3CFEA 3BPLB 2ZCLH 2CKBL 3IJHA 3LQAC 4NZTL 4X4XA 4NC0B 4M5ZH 5C09A 3HG1B 3MODH 4OD1H 4HIHA 3BAEL 5INCB 3GMOB 3OKKA 5DK0A 3EHBD 1D5BA 2UWEE 4X9IA 1MY7A 3MLZL 4L4VE 4J4PC 4LLAA 3VXSB 1BBDL 3RJDA 1S7QB 2IADA 3LKRB 3C09C 1P84J 4ONHA 4UV7H 3HA0A 4F7PB 2ICWI 3RVXD 5ACZA 3F12B 2YD7A 3VCLA 4DVRL 2AP2A 5GZOD 3IXTA 1FV1B 5AAMA 4JEGB 2Q7NA 1NMBH 3GB7A 5F3BA 4LKCA 1FFNB 3ZYJA 4YXLH 4P4KD 1JHLL 2D31B 1AO7A 4JPKL 2WIMA 4ODHH 3S5LA 1T20A 5IBTH 1DANU 2JJTC 2YUWA 3NN8B 5JQHC 1G0YR 4N9GB 2Z92A 3QEUB 1RZ8A 2BVPB 1A7PH 1X6NA 1PJ9A 4WI9A 3EJZC 2M26A 3LQMA 4LIQL 2NTFA 1U95B 2FHCA 1EAJA 1KEML 3E3QE 2FECL 3OXSA 4ORGB 1IC7H 1N3NA 2FJHB 1NBYA 2F53A 1DEDA 4CJ0A 5F9OH 3WUZA 3R4DA 1F6AA 2ARJB 2Q1EA 3BKJL 3O3DB 3RVUD 4QXUL 2VDNL 2HN7A 5AZ2H 2VDKH 4HJ0D 4PYGA 5CSZA 5HI3C 4G6AD 1R3IL 4J4PA 4MXWH 1JCKA 4ETYA 5F7NC 1RZFH 3QFDA 4GBXC 4LDEB 5D1ZA 1GGUA 1UM6L 1G9MC 2BVUA 3TT3L 6FABL 1I8KB 3CVHA 5HY9B 3QDJA 3O8XC 3GSNL 5D7IF 5C0IA 4YPJA 1TQBB 3T1WA 4LLYB 4JLRB 5TF0A 4I0CC 4D0CB 4W81A 1UB6A 3MLZH 3MGOA 5EZLB 3ZE2E 2P8LA 4HKJB 4M3JA 3QSKB 5I9QC 4PJAB 4Z7QE 2JJTA 4H20H 1CE6A 1X5JA 3LN4A 1P4IH 4NQUA 1V05A 3TYFB 4X6CB 2VLJD 4KRPD 2RCSH 5GS2H 3S34H 1M6OA 5E9DE 3SDAD 3CH8A 2X40A 4TUKL 4WHYH 3KJ6H 1JI2A 4A6YA 3ARFD 4AG4L 3JV6A 3BO8B 1QSEB 3MGAA 5L2KB 3I2CL 4Z7VB 1MNUH 3QQ9C 4RMWA 4M00A 1G7HA 4PJXB 5IMMB 3C9NB 2PO6A 1A7OL 2ICWB 4FZ8H 1HILB 5C0FA 1BHGA 3SDAB 3T3PF 4KQ4L 5FO8B 1DLHA 1DJSA 3E3QC 4GG8A 1MFEH 4GBXA 3GMRB 4OZGB 1KEMH 4X8XA 3HZVB 3SDYL 4EJ1C 4DFIA 4DKAA 4LP5A 4KKAD 3L9RB 3O8XA 1SJHB 1EBAA 1MVUA 1UADC 1PD6A 3QHTC 3QJFB 5IMLA 1U41A 4RFOL 4OFPA 5A3IC 5MP6L 3BW9B 4YBQD 3DX7B 1PKOA 4XRCA 4LPTA 5HYQB 4MJIE 3HE7A 2C1PA 1H5BC 1UM6H 5FYJL 3T4YB 4WNQB 4L9LC 3UTOA 3HI5L 2CKBA 4YHIB 1J8HE 4ETQB 1BFTA 2A83B 3QUKB 5HHPB 3VH8B 4YHKH 4YFLF 5EIIA 5I16B 1JGEA 3HHRB 5GZNC 3LPGA 1A9BB 1D6EA 3B5HA 4ZTOL 1K4DA 1ZA6A 3FO9B 5A40E 1KIQA 5EUKB 1V7NL 1T22B 5F7FA 1CFBA 3GJEA 3MQIA 4PJHA 3W39B 3IGAA 5F89B 5JQ6L 2EKSA 1UWXH 3N9GL 2AJ3A 1IAOA 4R6UA 2J2ZA 3ARZA 5FXCH 2XG4A 2X5PA 4JJ5A 2A73B 1WBXA 3B9DA 1X5AA 4Y4FB 1NC4D 1OP3H 5SWZA 4FA8A 1I1YB 3WD5L 2X1OA 4WUUB 3DV4A 3I75A 3I9GH 2IMMA 1A7OH 2YKLH 4HWBH 2VXVL 3VFOB 3UO1H 1QFWH 5JIIA 4OFYD 3VXUD 3OV6A 4WFHE 3MLYL 1NGXB 3MX0A 2GQHA 5GRUH 3FO2A 3G5XA 3VXNB 2XRAL 3GO1L 5J56B 1U8JB 4I5BB 1ITBB 4HUWB 4FOMA 4XGZA 4JO1L 1BAFL 4L9LA 3B6SA 1CG9B 2E6PA 4P5TC 1FCGA 1PVHA 4NO3B 1BQHB 3RZCB 4PJ8C 2WUCH 5HYJB 2F54B 2EDJA 2EIZA 1OAXL 9CGTA 5HGHA 3DX6A 4HWNA 3V5HA 4P2RE 3H9SD 5MENA 3X13A 3TCLA 1OL0A 2Q3ZA 2B2XL 5JW5B 4JHAH 5A16A 5TDPA 5GRJL 3CCHB 3HI5H 4QRUB 3GSNA 1O0VA 1HWGB 1A6ZA 4QCIB 4JGUA 5DVLA 1JNLH 3K4ZA 4XPAH 5DRXB 4LSPL 1IILE 1Q1JH 3BWUC 3VFRB 3PGDA 1ZVHA 3D39A 4ZTOH 1LNUA 4S2SB 4LCCC 3ULVL 2D7PA 5KVDH 1HQ4A 2JB5L 5C0EB 5CKGA 3ZDZF 5JQ6H 4FG6D 4XNQB 1S5IL 1Y6KR 1BGXH 4U6XA 3N9GH 1S9WA 3MJGX 2D9QB 4M7ZC 4KDTC 3R0MA 5DZNA 2MCPH 4PJCE 5B39G 5L8JB 3DPBA 2O26U 4HKBB 1BJMA 1U92B 1TCRA 1KJ3L 4MNQB 1T5WB 3UTZA 2J1KA 2W0FB 5CLTA 4HX1B 3VDCA 4DW2L 3C6LB 1LILA 4RIRA 4JFXA 4JM2A 3PHSA 3VGAC 4LARH 1UJ3B 4JRYB 2X7LB 4AT6A 1NGZA 4HIEA 3RL1B 3PJSA 1MLCB 2VTFA 3L7EA 1KN4H 4Y5VB 3V6ZB 5FYKL 4DAGH 2XRAH 1C7TA 3FT2A 1OSPL 2AQ3A 4R7DA 5CS7A 4LVEA 3WSQL 1A4KB 2OMBA 5ICXA 3MUGB 4KROD 3MRFA 4JO1H 1J8HA 4IHOB 1T2JA 1BD2D 1TVBB 4BH7A 4HDIA 2OYPA 4KZDL 4NO2A 4LCWE 3SGEH 4UINL 3WKMH 3U46B 1ZT4A 3LN5B 4L8SB 2XPGA 4O02L 1S3KL 2E7LC 4LCCA 3OG6B 5EU6D 5GGTL 3UAJD 4H0HB 1RJLB 4NQSA 1VEPA 4FQXD 5FYKE 4OCSL 5FGCE 2H2SC 5BXFA 4JFYA 3EYOB 4LSVL 2ZNXA 2D3VA 4LVOB 3ZYZA 1QKZL 4KDTA 4G8GE 2NPLX 3P73B 4Q2ZB 2H2PD 2FH8A 2MQ0A 1FYHB 1PG7W 4KJYA 4K71C 2G9HB 3ARGB 4YO0B 1NL0L 1TJHH 5DJCA 2V9TA 1AC0A 4D9RD 1FFOA 1VEOA 3T08A 4Z5RB 3U4EB 2DRUA 5DJXB 1WICA 2IPTL 5BO1L 3BZEA 3ZKXC 2EYTA 4U6VL 3DYPA 2GCYB 3G9VA 1AR1C 3PL6B 2MQCA 3CFCL 4HIXL 2J8UE 2VJXA 3P4NA 3SO3B 3IETB 1KJ3H 1WJ3A 5JIKA 3SJVD 5I1IL 2JTDA 2GAZA 1JNNL 1D9KB 1LD9A 1FNGA 3KDMB 3BZFA 2V9QA 1UYWL 5D93C 1AHWC 1GGIL 4Y8AA 4Y19B 2QL1A 4P2RA 3NGBC 2DLGA 3E2HB 4HK0B 4JO2H 4MAYA 2R2BB 2R1XA 2AABL 2Q7YB 2E7LA 4AM0B 3QIUC 3RNQA 4JKWA 3EYQC 3FZUD 3KPTA 3VFPB 1EAPA 1AY1L 2V9RA 5T3ZH 3IRPX 4F7TA 3MRIA 1D5XA 1A7BA 1TZGH 3DVNB 4OZHE 5JHDE 1BREA 2P46B 5DEGB 1CICD 4KZDH 3MV8E 3NIGE 1PLGH 3CFDB 1BVKA 1NFDA 1YNKH 4PTTA 5MEQB 3VXOA 3SDXB 1AQDB 3O3EA 4HH8A 2D2OA 3VDBA 4D0BB 3HCVA 3I6KA 2DM7A 3OPZL 3K2UL 1P4BL 4O02H 2GTZA 2WLYA 4ZFZA 1S3KH 2CRZA 1ETZB 3KXFB 4OD2B 5GGTH 1C16B 3TBVB 2AJYL 5I1AB 3KLDA 2EDLA 4OCSH 1MH5A 4ZYKA 1JNJA 4U1NA 4K9EL 1XGTA 5DQDL 5TDNB 3S36H 4PJEB 3DVGB 1KNOB 1S8DB 3WO3B 4JB9L 5CZXC 2CK0L 5JLZB 5DR5H 3WYRA 3FB6B 1YYLL 5CMAB 1JPSL 1ZGLM 4JFFA 4PLJD 4IDJL 1CVRA 1JYVA 1P2CA 2OJEB 3T0VA 1ZHNA 4Z76B 4XAWH 5KW9L 4UT9L 4Q9QH 3GJFB 4Y1AD 2F19L 1Q9KB 1CK0L 4JFED 1G7JA 2VE6B 2IPTH 2BNUB 2XT1B 3QUML 4FQQB 3TESA 1CFTB 3STBA 3BH8B 4Z7WF 2N7BA 2VLKA 4NN5B 1W8NA 3KPSE 4OV6F 5E99H 4FFWC 4HIXH 1JTOA 2YD1A 2BOBA 1NAML 3P9MA 5HDQL 1E4XI 5GGSY 3UTSA 3L3HB 1T6WA 2R15A 1CBVL 3FFCE 1VFAA 2XN9E 4EXPX 2EC8A 5DGQA 2AJSL 3O9WA 4HZLA 3A6BL 4JFEB 5HGAA 4CNIA 4JRXD 1E4JA 1T2QH 2NY5L 1TZIB 2CO6B 4PBVC 3GGWB 1T1YB 3V5KB 1JPTL 3SPVA 1MI5E 2KL6A 5I19H 1LGVA 1EEQA 2HFGL 3RWGB 5ISZB 1S7TA 1VGKB 3BUYA 5D96C 5K9QI 2HWZL 1ZE3C 3V0VB 4TN9A 3LV3B 1KYOK 1TNMA 3SGDH 3TO2B 1NJ9A 3D85A 1N7MH 1QP1A 1ZSDB 2E7HA 2IAND 5MEPB 3C5ZD 5EZOL 1FVCA 4KI1A 4JY4B 3V4PH 2IH3A 3B2UC 4P99A 4JFDA 4P2QB 4XP6H 1EJOL 2H32B 4X5XA 4WW2A 1WZKA 3BXNA 5FB8B 3VXRB 3VRJB 4XBGA 3WEXB 4OT1L 5F21B 3IDYB 4X8JB 5I0DA 3GHBL 1YEFH 2CLRB 4XPTL 4HWEH 2YSSB 1CDCA 1QRKA 2GJ6D 3LKPA 2J8UA 3BGAA 4MD0B 2DYPD 5KSAB 3NAAL 5B8CB 4XVJH 5L2JB 3CFEB 2FEDD 1CQKA 5FUCE 1JPSH 3IJHB 4X4XB 2D7NA 2HT3C 1OQOA 1RIHH 3RGHA 4X7EC 2COQA 3X14A 3OKKB 1NCCL 2UZXB 1T0NA 3AMLA 3TFKD 4BSVA 2DYPB 1CK0H 2EEBA 2GEEA 2W38A 2IADB 4K9EC 5K9KA 4CAGA 3N0PB 3NH7L 4J2XA 3BKYL 4ONHB 4OZIE 3HC4H 4OZHA 5ACZB 5JHDA 3VCLB 2E5EA 1G7QA 2ICEB 4L3ED 3HE6D 1CBVH 3QPXH 2DQGL 3GB7B 5F3BB 4LKCB 2AJSH 4UOW1 1QNZL 4N0YL 2AQ2A 5DHVA 1IBGL 5E5RB 2W9EL 2XQYK 1E28A 1T20B 2XY2A 3MLRL 3QZWB 1DN0B 1JPTH 5IFJA 4C4KO 2Z92B 3P0YL 1F3JA 5GRVL 4FXGA 4L3EB 4S10A 2LE9A 4K3JL 4IDLA 5DJ0A 4JVWA 4WI8A 5IQ9B 3TV3H 1FO0H 4RGMB 1BBJA 4O2EA 3UTTD 2DTMH 2H6PA 4OZFG 2NTFB 5CSGA 5E2WL 5ADOH 1EZVX 2NY4C 5EZOH 1UH3A 4Y5XC 4DUXA 2NY5C 1TLKA 1NBYB 5EUOE 3CDYA 4CN4A 1FDLL 4KK9C 1EERB 4PRDA 1F6AB 2FO1A 1EJOH 1JGLL 3UTTB 2R56L 2HN7B 3VI3E 2XKSA 5CSZB 3TIEA 3MLXL 1U8NA 5HHMD 4J3OC 3B5GA 3C09B 5DDHA 4MDJA 1IAMA 1BPVA 1BQUA 3JV5A 1RUKL 1S5HA 3BZ4A 1CZ8H 4L5FL 4U05A 3CVHB 4P23D 1U2CA 1LMKA 3QDJB 4LCUA 2C7UA 1DBBL 3KPQA 5HHOA 3Q6GL 5BQ7A 3EJZD 2A9ML 5F6HI 2XZZA 1UB6B 4KKLD 3K8LA 1HOCA 4PJAF 2VNCA 3ARWA 3QFJD 1CE6B 4HC1H 3QUMA 3WXVL 2EO1A 5LCVL 5IFHL 4X6CF 1SJXA 1ES0A 1NAMA 3QO0B 5KS9F 1M6OB 4HAGA 2YMXL 3P0GB 4FZEH 4A6YB 4N0YH 5DUML 4Y5XA 1NLBL 1H3PL 1IGML 2IBZY 3JV6B 1HHIA 3MLRH 2C3WA 5IBLD 2DQUH 5EBGA 2ORBH 1S7WA 1G7HB 4LMQE 2FBOJ 2DQFA 2OL3L 4PJXF 4U3CA 4KK6D 1YN7B 3KLHC 4FTVE 4K3JH 3NABL 4HUUA 1AXTL 2X4NA 1WIPA 1DLHB 2YK1H 4L4VD 4GG8B 2P5WA 4RX4A 4GBXB 1LK3H 2UZIH 4OZGF 2C4FU 1ACYL 1CDUA 4GQPH 5L6YL 1AC6A 4DTGH 1A3QA 1S9VA 1FL6A 3O8XB 1MVUB 1G7IA 4D94A 4JVUA 4WU7A 5IMLB 2XTJE 1QLEL 1JGLH 5KAQF 4PJGF 1QBAA 1QHPA 4XP9H 4KY1H 3SOBL 5KSBA 1A1MA 2OI9C 2WANA 5I9QB 4FQJL 5A2IH 3GSUA 3VXUA 5CWSA 2C1PB 4YWGH 1IM9D 3U2SA 1MFNA 5DRNA 4K3DL 2J3SA 3LHPL 2L4OA 2YEZA 2CKBB 1B90A 4PJFA 5E6IC 3T0EE 3EBAA 4GO6B 1CXEA 2IPKB 5GS2D 3I3BA 4LLVA 1OAZH 5EIIB 1FPTL 1A6TB 2P48B 4OKDA 5IEHA 4RISH 4Y16A 1IRAY 1JE6A 1K4DB 1ZA6B 5D2LF 3IAQA 1KIQB 4RZCB 4NQVA 5EFIB 3WXVH 5B4MC 3GJEB 1KCRH 3IGAB 4JPIA 5DFVD 5AUMA 3VWKD 1QFWI 3MRQB 3FCTB 4CVUA 3OR6A 7FABL 1IAOB 5A3ID 2WBWB 2YMXH 5ICYB 4YDIH 4N8CL 5DUMH 4XNYL 3VGFA 1NLBH 1H3PH 3UX9B 1I9RL 2G2RB 5F1SA 3ZTNL 3JWOL 5I1JH 5FYLL 5J1TC 3QP3A 4ZUVA 3OJ2C 5DXWA 1E6OL 1ZANL 3NABH 2IAMD 5F7KC 2DQIH 3H9YA 3P77A 5DUPH 5GHWL 4AEIH 3FO2B 3G5XB 3S36X 3MJ9H 1H5BB 1ACYH 3HZKA 2HMID 4XGZB 1IKFH 3QXUA 5F9WC 3ROOA 5I15H 3I6GA 1RUML 4DOHB 2J88H 4L9LB 3B6SB 4QRPE 1N64H 1KTKE 3S3JA 1QLEH 3M1BA 5E9DD 5FYLE 3QPQC 2EIZB 5HGHB 4YBLC 3DI2B 3CDFA 2D0GA 3V5HB 5I8OH 2NY2C 5MENB 2R2CA 3X13B 3TCLB 4ZXBD 4HXAL 4KVNL 2BNQE 4K3DH 5F7WC 5A16B 5TDPB 3T0EC 4GW1A 3GSNB 4MXQC 2F58L 1MFBL 1A6ZB 4YLQT 1U42A 2GSGA 3KPRE 4NOFA 3BKCL 1FPTH 5CSBA 1KXTB 3PGDB 4J12A 5C0RL 4EI5C 3D39B 4MWFB 4FTVA 3TZVD 3MLTA 4JN1H 1YEKL 2ADIA 1UC6A 1HQ4B 1HEZB 4MA8L 2VZ3A 1TENA 1ONQA 2JB6B 4UT6H 1CFVH 4PJ8D 3AAZA 2GFBA 2VH5L 4NCDA 5ALCH 2ENSA 2YRPA 4MQXD 4MJID 4DGVH 4POYA 1H8OA 3UPCA 1WT5C 4XNYH 3HKFA 2W0PA 4YGVB 3EDFA 1Q9OA 1TCRB 4P5TB 4LSUH 4FXKA 3UTZB 5HYEA 3F5WA 4PJ8B 2G5RA 1DBJL 2OL3A 3RQ3A 4RIRB 4JFXB 3UJIL 1NGZB 4HIEB 5I66A 5KAQG 4OLZL 5GHWH 4JANA 4XCNA 12E8L 4PB0L 2IFFH 2X09A 2ZUQC 4FFVC 3FT2B 4R7DB 5J6GA 1K3ZA 5ICXB 4CN1A 3MRFB 4R2GC 5DD3L 1J8HB 5JOPE 5FO7B 5CEXB 3T0EA 5I73C 4BH7B 3DX8A 4HDIB 3JWOC 4TNWK 1I9IH 1MCDA 4M3KB 5F7MC 4ZFFA 1FRGL 2N4IA 1ZT4B 1XMWA 3IXAB 1T2XA 4HIIB 4EI5A 5LJYH 2XPGB 3WIFB 4LCCB 3KNBB 4KVNH 1HXYB 2P8MB 4LPXA 4NQSB 1N59A 3K46A 4XCCL 3G6JA 3WBDA 3L7FA 3OL2A 1I1AC 4JFYB 5C0AE 2BNRA 2H45A 4MA7L 1QBMH 1MFAH 4WFHD 2DDQL 2AV7A 4RMQA 4S1SL 4M7ZB 5DK3A 5DI8B 1B4RA 4IRJD 4UBDC 1CDGA 2NY3D 1DLFL 1WT5A 4WHCA 3CAFA 2X4PA 4KJYB 2APWA 1FAIL 1C8PA 5C0RH 2VOTA 35C8H 5C0BE 5GQBA 1KT2A 3P9LB 5CBEA 5JR1H 2W9DL 5DJCB 5LXGL 1F2QA 1MOEA 3QDHA 4HZAA 1FFRA 3KYOA 1FFOB 3OAUL 1RFDL 2H3NA 4DKFH 1PY4A 3VGAB 1C5BL 2WUBL 5FHBH 4P4RA 3BZEB 2VH5H 4X6BA 3VXTA 3LQZA 1TJGL 3GBNL 4IJ3C 5IHZA 2H26A 5E4IA 5C7XL 3P4NB 2ZSVA 3VI4E 3RVVD 1H3UA 5ETUA 5L88L 5C9JA 2BY2A 2GAZB 2YXMA 5D72L 2KQNA 2VIRA 4JAMA 1LD9B 3BZFB 2VXQL 2H2SD 1QUNA 2HKHL 3VMNA 3UPRA 4LLMB 4NRZA 4P2RB 1T66D 4M62H 4MAYB 2IBGA 2R1XB 1AI1H 3OAZH 1YY9D 4LQ1A 4MQSB 1IAIM 1EIBA 1EAPB 5BRZA 4F7TB 3MRIB 1D5XB 4OI9A 4HLZG 5EBLA 2ESVE 1BVKB 1NFDB 5CJOL 3D18A 4N1HB 4YHML 4OI8A 3O45A 5FFLA 2QJDA 2Z9TA 4K71B 1AR1D 1BF2A 2GTZB 3OKOB 4EEEA 3CXHJ 5JW4Q 1XIWC 3QQ3B 4GRLD 3JUYA 4XAKE 5HDBF 2ZCKH 4ZYKB 3CFJA 5CGYC 4U1NB 1XGTB 4BKLA 5EORL 3SDCC 5TDOA 2MCG1 2DDQH 1A8JH 3FN9A 4FFZH 4XT1C 1YPZE 3RY5A 4ODSL 5C92A 1JBJA 1FAIH 3SN6N 2QADD 2W9DH 5GISL 1WIUA 2DJUA 3OAUH 5D93B 3V4VL 4ZUWA 3HNVL 2VZOA 1C5BH 3NGBB 1G7JB 2V2WA 5H94A 3QIUB 3JSSA 2BOBB 3P9MB 3C2SA 1CI5A 4LCWB 3R8QA 3UTSB 3AB0B 1FLRH 3SGDI 3ZDXE 5LGKA 1A02N 1VFAB 4X6EA 3HNTH 3O9WB 4HZLB 5HGAB 5T3ZD 2XACC 4I1NB 1CGSH 4WWKD 3DURA 2NXZC 4G8GD 5E0QA 3K4DA 5TE4L 4F7MA 5KVMC 1FH5H 3MRBB 4HS3A 2ATPA 3SPVB 3F7QA 5IR1A 5KOMC 4I0KA 1HHJA 1S7TB 3BUYB 1DDHA 5GS3A 1C5CL 5F7EH 3NIDE 4WRLA 2EIEA 1REIA 1WGOA 1OCWL 3RWIA 1DVFA 1Z9LA 3KHQA 4XMKL 1NJ9B 3D85B 3ZLQC 3SQBA 1JFQL 4OFIA 1T0PB 1F5WA 1KV3A 4XX1G 1S9KC 3QG7L 2IH3B 1CDJA 4JFDB 2V6HA 1A3RL 5TE7L 3MO1A 3G6DL 4UTBL 1WBZA 4QYOA 3MLSL 2CUMA 1URLA 5HHVL 4X5XB 4WW2B 3BXNB 2Z8RA 1NMCC 4XBGB 4PJ7E 1VDGA 3O41B 2X2YA 4B7LA 1TPXC 3GZKA 3Q1SL 3LKPB 2J8UB 5ANME 5SWQA 2RQ8A 4XTRD 1ZT7A 2VXSH 3BZDA 1NCTA 4ZPTA 4QXGL 1BFSA 5E7BA 5EIVA 3O6MH 2YRZA 4QRTA 4RFNC 5FHAL 4A2MA 3TVMC 3NVQA 3TWCH 5A43C 3MV8D 2EDFA 4DK3A 4XPBL 5C71A 1T0NB 4BSVB 5K9KB 3FRPA 4WFFE 4XP4L 3SDDC 4WGVB 5BS0E 4G5ZL 4OD3L 4OZHB 5D96B 5SX5K 3U7YH 3VXPA 4F8QA 3MV11 5JHDB 4KVCL 4K7FA 2BSTA 5GPRA 4RA3A 1T7WA