1GIGH

Refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFLLISNGVHWVRQPPGKGLEWLGVIWAGGNTNYNSALMSRVSISKDNSKSQVFLKMKSLQTDDTAMYYCARDFYDYDVFYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined three-dimensional structure of the Fab fragment of a murine IgGl,lambda antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA HC19 FAB (LIGHT CHAIN)
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1993-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gigH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gigH01
3L6FB 3PGCB 3CFEA 5BVJB 3C8KB 2J6EA 1XZ0A 2O5ZL 2WNGA 3HR5A 15C8L 3OKDA 4U0RB 2LQRA 1BX2B 4PGDA 5HHXH 2PN5A 2GJ6E 2H32A 5FUZH 4K3DL 4DN4L 3QIUA 3SE9H 3O2DA 1U8JB 3WKNA 5C0NC 3UTQB 1FNSH 2HJLB 4Y5XA 3E2HB 1NCAH 5MEND 3KDMA 1NBYB 4BKLA 5I1EL 3LN4B 4N8CL 1TENA 3C9NB 3OHXA 1NAKL 5ADPH 5A2IH 1R3JB 5J1AB 5C9JB 2K7QA 4OF3A 5E8PB 1KTLB 5IESH 3HG1D 2B1AH 4GKSB 5GS0L 5I16B 3Q6GL 2DQCL 3CFJA 3QPQD 2QHLA 2P8LA 2X1PA 1JUFA 5C0JB 1X3DA 4Y4KB 2XZAL 2ZOLA 3TJEL 4G7YL 1EV2E 4KU1A 1NGPH 4UILL 4L4VD 5FV2A 1IGIH 1WBXB 3C5JB 5KS9B 5GSRB 2QR0A 4LOUD 3D85D 5D1ZC 4PRDA 1ZGLP 4O5LH 4TOYL 5ILTH 2VZTA 2WUBH 5T3XL 3I84A 5L9DH 4I0PB 2WMPA 3D0LB 4OFKA 1IGYA 4LL9A 3TBSB 5BW7A 1XIWD 1K4CA 1M05B 2XY1A 4RQQA 3N1MC 4NKQB 2ZG1A 3IETB 2H6PB 1UFUA 3L3IB 3ARPA 1JP5A 1OARL 3QDME 1LK2B 5E8DH 3ULUE 4HKXA 4O9HL 1AR2A 1ES0B 3SJVA 4U2ZA 1MJUH 1F4YL 2MNUA 3KXFD 5DXWA 4ZFZB 1T7XA 3DUSA 3V6OE 5IEKA 1KN2H 3S96A 2BNRE 1X5ZA 4KUCF 5B4MC 3IFNH 5L0QC 3ZDXE 3ARFA 1P9MC 4IRSC 5TDNB 1D3CA 2VH5H 4P2QE 3RNKB 2DLEA 4WJ5A 1B88A 2NY4C 3DARA 3FAWA 4WU5B 2FEEI 4L4TE 4GG6B 2HFGH 4JANB 3D3VE 4Z0XB 1C5CH 5K9KA 1NAMB 3EW3B 4PJ8A 3CU7A 5HVFB 4PJCE 2VDLH 3Q3GA 1U2HA 4W68A 1RUQH 5KZCD 1P1ZB 3KGRA 3HS0B 3THMH 4KHTL 2V9RA 4AEEA 3MOBL 5BO1L 5F7YC 1MHPL 5EZOL 4Q6YA 5EU6E 1ZLWH 4JPVL 4OCRH 2HKHH 4IOIB 4O02L 4GBXD 1Q1JL 3LKRB 3WE6B 1E6JL 4L4JA 2AW2A 3CMOH 4XP5L 1YEJH 4LLDA 3GO1H 3DNKA 3T77A 3T2QA 2VQUA 3NTCL 5DGQA 1QFWM 2VLLA 1FG9C 4G3YH 5JORB 2VLKD 2GTWA 5DK2B 1XGRA 2C3VB 1OY3B 3Q6FA 4YPGA 2BVQA 1WCBA 3PWLB 1LP9F 1MCDA 2VO5A 3QQ4A 1JZ3A 3LPFA 1TPXC 4PJ9D 4TUJA 5IQ7H 1RJLB 4XNQB 4PP2A 4KRPD 3TVMB 2W0KA 4HKJA 1S9XA 1S3KH 3IYLW 2BK8A 1FFNA 4NGHL 2AJZA 2PO6A 2B2XH 3C09B 5BS0A 1A3RH 5CEZL 3PV7A 1U92A 2R0ZL 1RAMA 5C6TL 5DRZA 3I75B 3O4OC 1WFOA 2G5BA 2DMCA 3O0RH 4HPYL 4U1LA 1T7WA 5FO9B 3C60B 1CXHA 2V2WB 3ARBC 1ZHNA 4L8BA 2FIRT 2QQLH 3P4OA 1CGUA 5C8JA 3MGAA 1OQXA 4EUPG 1JZ8A 2O5XH 5CKAA 3QXTA 2JTDA 1F45A 1DBJL 5GJSL 4CAGA 4OCRL 4NFBA 1Z9OA 4OGZA 4WEBL 1CR9H 3FHAA 4Z76B 4WI2A 4KDWA 4ODWA 4L8SB 3HNTL 3FONA 3THML 2VLMD 2Y7QA 2H2PC 4M7LT 2OMBA 3AREC 3O6FA 5FCUL 1PQZB 4OLZH 1CGSL 1NQBA 2XZQH 3EDJA 3JWDH 5GGQH 5KANG 43C9A 2X1XR 2WLYA 5JMRA 1RVFH 2A9NH 5I9QB 2F8VA 1D5XA 2GAZB 4R8WH 2GI7A 3T0WA 5ISZE 2G75A 4K7PL 4ONHA 4Y4FB 4ENED 3Q5OA 2DQTL 1AGEA 1A3LH 1I85C 1P69B 2ICES 1LDSA 2AJUH 3OKNB 1ZGLB 3RWCB 1JYNA 3AM8C 4I2XA 4HJJH 1Z9LA 2FIKA 5LCVL 3AU1A 3WNPA 5GQBA 4O9HH 1B2WH 1WTLA 3TN0A 4C83A 5CZXD 5LQBH 5MERA 1KFAL 4OCXL 3P0VH 4R4NC 1T6VN 3BGMB 1MY7A 2JJVA 2DD8H 4RWHA 1U8MA 1CICD 2PW1B 3HB3C 3ZLQC 4JKWA 1IAIH 3CVHL 4ESKA 2ZKHL 1G7HB 2VYRE 4XP4L 2ZUSA 1BM3H 1RUAH 3DHJA 3SDCA 1NGPL 3WD5H 5HHNB 5GS1A 4Z7WA 4LP5A 4HWBL 4ZQKA 2XNAB 3CVIL 1EJOH 3IDNA 1JNJA 4KVCL 1F3JB 2XYCA 3H2WA 4CVWA 1CIUA 3LN4A 1S9VB 5HYQA 3KJ4B 5E2WL 1IGJA 3OXSB 2EYSA 3B9DA 4HUUA 3FMGH 3SE8H 3BP5B 1I8KA 4M6NL 3MGOA 1U8HB 5FHBH 2JIXB 4N9GB 1HSAA 2JJSC 3L95A 2VDML 1T21B 1Z0NA 5IVXA 2AV7B 5I8KL 4QKXB 3PXJA 1J12A 4CN4A 4M6MH 3NFPA 5HXMA 2Z35B 1UZ8A 3HUJB 4ZYKB 3FZUC 3K0WA 2YC1A 4DUWA 1XFPA 4ZO9A 3G6AA 2DQGL 3FB8A 1B2WL 5IJKC 3F5WB 4HKBA 3G5XA 4O2EB 4L8DB 1Z3GH 4K8RH 2B5IB 4TQEH 4XGZB 3RUGA 4RQQB 3RAJH 1BWMA 4FQQB 1IEBA 3OXRB 5DSCA 5T1KB 2AJVH 3JV5A 3VXPB 1C5BH 4OCNC 1NAML 1VFUA 3TO4A 2FEEL 2GJZA 4EUPB 4IMKA 1AI1L 3JTSA 5F3HB 4I0CC 1QQDB 3EO0A 3ZKSD 4OTXL 1H3PL 4JKKA 3BN3B 4OV5B 1MJ7L 1BEYH 7CGTA 4XBEL 2ICWB 4F37F 4M5ZL 4YHIA 3OG4B 5FDYA 4G8GE 2C3GA 2ZP0T 1AIFB 2RBLA 2WBJA 3BPOB 4D94A 1I9JL 4MJ6B 5K9KB 5HHOA 5I1IH 1JTTA 3PWNA 5ESQA 1D9KA 5I1GH 3WFDH 3MCKA 1EBAA 2VC2L 4AQ1B 3GMLB 2NY1B 3O4LE 3V6FA 3RQ3A 1V3LA 4AEFA 3SEPA 4CMHB 2CR6A 1S9WB 4XT1C 5D9SA 4XNUH 4O58H 3TNNA 1JGDA 3LPWA 3CFBB 5GHWL 4LF3B 1NC2A 4Z8FL 3LKRA 1KCRH 3QEUB 5HGBB 3WE6A 2ARJB 4OLYH 1LD9A 1IBGH 1W8OA 4JFZH 2R0ZH 1OAZL 3DETC 4CU6A 4OCYL 2NX5E 4OFVA 4MMXC 3MV8B 3G6DH 3UTZA 2BJML 2JK5B 4Z6AT 1INDL 4F9LA 3T77B 5LCVH 4OQTL 2GUOA 4Z7VB 2DKUA 4XMPH 5HDOA 4Z7WE 3V4VL 1QOKA 5EBMB 1K8DA 2X4TA 5DDHB 5D1QA 3ZKMD 5C7XL 1RZ7L 1ZHLB 5JLZB 3F6LA 1P7QB 4PTUB 5I2IA 3IVKA 1J88A 3QUKB 4BK4A 2BHUA 2MKLC 2Y07L 4ZOEA 5CJQL 1IQWH 2X9WA 1M7IB 5CEZD 4WGVB 1FFNB 5A2JH 3NTCH 1NFDE 2HT3D 5CEYA 4RA3A 1MF2H 1UXSB 1CLOL 1G7IA 1QA9A 2VXQL 3V5KA 5BS0B 1I9RL 5TF1L 2WQ8A 5D72L 5IG7B 2IAMB 5C07A 5TE4H 3GSQB 3BWAB 1KPRA 4HK0B 1ZS8A 5LGJA 3WKML 1T20B 1JPFA 4MJ5A 2CKNA 1VADB 5C07D 8FABA 1PJ9A 4E0RB 3X3GL 1QEWB 1T3FB 3K8KA 3KLDA 1TIUA 2F53A 4UT7H 4ZFOL 3BKYH 3MBEA 2YMXH 3GI8H 4UOW0 3RGVA 3MLXL 4AIXA 5C0GB 3VGGA 1YYLL 1OSPH 2VSCA 3P77B 2A74B 4OF6A 3OB0K 5BRZD 5CJQH 4ZSOE 4GRLD 2FGWH 1UWEL 5DMKB 4OI8A 1HI6B 4WDIB 1A1MB 3VFOA 4UNVA 3EYFB 2AQ2A 3VRIB 4HCRA 1PKQE 4YHMH 1BREA 4N1EA 5GSVB 3VXSB 3MBED 4NUJB 1N64L 3B9KA 3CK0L 1HH9B 2EYTB 5E4EC 1VEPA 4PJDE 1DVFB 1FC2D 3OKDB 1AGEB 5GGTL 3OR7A 1JFQH 2MQ0A 4JO1L 2DQEL 5T3ZD 2A6KA 2FIKB 2YHGA 3PP3K 5DC0A 1OD7A 1F5WA 2RIKA 2HJLA 3P4LA 3VA6A 1K85A 1TJIH 1UG9A 2C1OB 1I7TB 4PRHD 3RWFB 1RZ8B 2FJFA 4YDJA 4LASH 5C9JA 1YEGH 5HVWA 5I1IL 2C26A 3GDBA 1QBML 2DIBA 1KLUA 3EGSB 4HULB 2CR3A 3CVIH 5D70L 3IFLH 1WV7T 1PKQA 2IGFH 3T0EE 4GRMA 4LASL 4YBLC 2I5YL 4ZOCA 4OZ4A 4Y4KA 3UCRA 1RUQL 1CDYA 5DRWB 1QLEH 4NM8L 3UJTH 3BVNB 3O4LB 5CCKL 4FQXC 4LSPH 1XGQB 2XNAA 5AZEL 5JHLL 2DQEH 4L5FL 3LS5H 1GOGA 3VH8G 1FVEA 3W9DB 2VLKA 3UO1L 1XT5A 5E2VL 4PLJC 3DMMA 4U1NA 4WNQB 1OLZA 3FKUS 4MD5A 5I1LA 2Q6WA 1BMGA 1IEAB 4LHJB 1A47A 2VDNH 3MV8E 1JF6A 4LCYB 4WTZA 5DVOA 4PJXE 3VXMD 3CFCL 3B5GA 5C92A 1HH6B 3V8CA 1F13A 5HTSA 3S96B 4WIQA 1MFBH 2XTJE 4O2FA 5IB2B 4JPWL 2EDWA 1K9TA 4ELMA 3C2SA 4L4TA 3HMWH 3SPVB 3UEZA 3MNWB 3BGFB 3FB5B 3EYUH 4IRJA 1LP9B 3TBTA 3U6RA 3DV6B 1IGIL 3QAZC 4WHTA 4XGZA 5MP6H 5FA4B 1B0GA 2JELL 3X3GH 4ZO7A 1UT9A 1B3JA 2APBA 4EI5C 5D7KD 3AB0C 1CDJA 4P99A 3V0VB 3WS6A 3GIVB 2BY0A 3P9WB 2Z91A 2XWBB 2GJZB 2YD5A 4EUPA 3Q1SH 3TT3L 5D1XC 4JZOB 1F02I 3ZE2F 1B4JH 5EIIA 1B9ZA 3RDTC 3WFHA 2AI0H 2BVTA 4G8GD 1M7DA 2EH7L 3BKCL 3FB7B 1I9RH 4QHUB 3LDBC 4OUUA 4B7IA 4XCCH 5HHVL 4LRIA 4HG4K 1JFQL 1U93A 4H1LG 4H0HB 4N0YL 2CRIA 5ITFB 1P4BH 4NKDA 2K7PA 3BFOA 3IDMA 1QFPA 3JTTB 3MRHB 4K3DH 3SCMC 5BW7C 1P4IL 4OCXH 2Q7YA 2NZIA 4PJ5A 5GS3A 2NY5L 4F2MB 5D7LB 1P7HL 4YHML 2BVQB 1HHJB 3MRFB 2NY0C 2BZDA 5TE7H 1AKJD 3TFKD 2EKSA 1JWSA 1JHKH 5CEXA 1VERA 4PP2B 2F54B 1GGBH 3O6ML 1X4YA 3WFZA 4IMLA 3FOMA 1DQDL 3MACH 3QFDB 3I6LD 4A2MA 1FO0H 1SM3L 2E9WA 4C4KO 2GKIA 4UDTB 1WWAX 1CD1B 2L4OA 5DJ2A 3VU2A 1GAFH 5EUOB 4BFBD 3FOLB 3CSBA 1Z9SA 3PP4H 3MOAL 4J1UB 1I9IL 2PYFA 4ONGL 4OLWL 1TZHA 2V17L 2V2WA 3TT1L 3BKYL 3GKZA 5IVXF 1K8DB 5EZIL 1EHLH 1CVRA 5I1GL 3RUGE 4FQIL 1HYRC 3W5MA 2RJMA 3EO1A 5CD5D 3SDCD 4NKOA 5KTEH 2E7LC 2GCYA 1NL0L 1NKRA 4P2OD 5EZOH 4MCZA 3IDIA 5IBUB 1EAPB 1JWMA 4Z95L 1R5WA 2VLRB 3MRBB 4KUZL 3U0WL 4WHYH 3V5KB 1CGVA 1H3PH 3FFCE 4A2LA 3DGGA 4LCUA 3IDUA 1ZHBA 3UZQA 5I71C 1QHPA 3MLWH 4H8WC 5C07B 5HPOA 3OV6A 1ZS8B 4G43A 5SX5H 1I1YA 1MCEA 1YQVH 2CSPA 5E5RB 1RHHB 4TRPL 2UZXB 2PXYB 1MFEH 3CX2A 1A7OL 3UJIL 3QEQD 2DQHH 4R7NA 3REWA 3NCYS 1IARB 3VGEA 4XHQA 4AJ0A 4ZUSA 3O3EB 2F53B 1G9EA 1A7BA 2HKFL 1T66C 1NEZB 1RV6X 2I27N 3CSGA 4RFOH 2ZPKH 4Y4FA 4M43H 1RMFL 4NQED 2XQBL 3S36H 1H15A 4RGMC 5FKPA 1VENA 2OTWB 4I5BA 2ERJB 3UBXG 1RUPH 1F8TL 1NFDB 2FL5B 4APQB 2MFNA 5EC1A 4XI5D 3O6LH 1HI6A 3F58L 1H3GA 4PJXB 4X7FC 4UV4H 2Z93A 2X42A 3LRSA 1UVQA 4PG9B 1IMHC 3ARRA 1DVFD 3VXSA 4XC3L 2HJFA 5KJRL 3S4SB 1RZJL 5DJYA 2DDQL 2X4SA 5DVNA 3AAZA 2GJJA 4LLQB 3ILQD 5HHOD 1HHHA 4G7YH 3N85L 1IAMA 1YPZA 3OR7B 3VFSA 1SYVB 2DBLL 3STLA 4NKMB 1A9EA 4XBEH 1VB9A 2D4DA 5D6DA 5BO1H 1G6VK 3ULSA 1NC4B 1OT1A 4HWUA 4J7RA 3FO1B 1N7MH 3DSNA 4GKNB 4QHMA 5C2BL 4GS7C 5FGRA 1TZGH 3GSXB 4ZXBC 3FQNA 5DURB 3GJFA 1I8KB 3MRJA 4JKPL 1WFNA 3C08H 1QRNE 4U6YB 1AD0B 3QHTC 4U6TA 3S5LB 4LCWE 4MQSB 5DEGB 5F93C 3MR9B 3E6FA 3RY6A 4ELME 3V5DB 1CDCA 2H2SD 3P40A 4DOHE 4W81A 3WJJC 1KT2A 1OGAA 1LEGB 4N0UB 1L0QA 4Z9KB 4BA8A 4OZIA 3O3BB 4GW5A 5D7LE 3PIQA 2ZUWA 3GBNL 3QIWC 4WUUE 1WAAF 5GJTH 2P5WA 1UCBL 2YZ8A 4PRDB 1XGUA 1QYGH 5JR1L 1ZANH 4I0PA 4OKVA 4FZEH 4JM2D 5I15H 1IRAY 1RIVL 4KPHH 3AVEA 2VKXA 5AD0A 3MRIB 1DANU 1BD2B 1AHWB 2VOTA 1T22A 1INEL 5IVXE 1MHEB 1SHMA 2OSLB 1FZOB 1KBGL 1RZJH 3T0EB 4S1SL 3QEGL 4UILH 1J87A 3Q5TA 5IM7B 4AT6A 2NXZB 1JNNL 5KS9E 1ZWIA 4AH2B 5DFWH 4P23A 2AGJH 1J8HD 4TUKH 2FDBP 3JWNC 4H88L 3QJFA 1YEGL 2FLBT 1VESA 2VE6A 1PG7H 2IQ9L 4IRSA 4GFTB 4ZUUA 2UZIL 2DWEB 5DHVA 4HUWB 4HBCL 3U9UA 5JXEA 3PL6A 4KTEL 3NGBB 5ESQB 2LV4A 3RTQD 2DJUA 1AGCB 5HI4D 5EUKB 1KTDA 4J3TA 3OL2A 1KFAH 1FNSL 4KJYB 3LQAC 4Z7WF 4ZG1A 2KKQA 3GMQB 3MLVH 4P5TA 5EIIB 1YPZF 4RNRB 3VGAB 3SBWA 1K2DB 1UYWH 4QHUA 2UUDK 2COQA 3QEUA 2I07B 2ARJA 4KGJA 4QRRD 4GG6E 3V7AE 3CDGB 4C4KT 5ITFA 4LLDB 2ZG3A 1L4IA 3BIBX 4WFGE 1NBVH 2X2YA 5ANMB 5EO0A 3MRHA 4NN7B 5D7LD 3RVVC 4QXTA 4RZCA 4ACPA 4PPTA 5EBMA 1UM6H 3VD4A 3LH2H 3MJ6A 3V52L 4AIZB 5B38G 5HGDA 4XPFH 5C0AE 1AO7B 2EKSB 4E42A 5CWSA 3TPUB 4KKNA 2X1OA 5EZIH 3Q5YA 1JNHB 5KSUB 3TVMA 3L5WB 3WS3B 3GIZL 2EDLA 4ONOA 2V17H 4Y19E 5SWZD 3FOMB 3QFDA 4GUPA 1K8IA 4UIKL 1NMBL 4RISH 1ED3B 3SQOH 5EUOA 1ZA6B 1KPRB 4PJFA 3VFMB 1BAFH 5HY9B 5TE4L 3RVTC 4MJ5B 2LTQC 3O6MH 2YD3A 3ZDZF 3BXNB 1IM9A 1QZ1A 2M2DA 5IIEB 2NTSP 1T3FA 1G1CA 2B20A 2Z8RA 1FL5B 4I18C 4HCRH 4Y19D 1NUGA 2NXYC 4MXVE 5DZNA 5IB4A 4L8SC 1CN4A 3DX7A 3O0RL 2XICA 3O6KL 1EAJA 4XPAL 1P4IH 2A74A 2H32H 3PDGA 2DQHL 4BFEA 5T1MA 4QYOA 4Z77A 3R8BB 1J0JA 5T3XE 1FHGA 2G2RB 4G43B 1U6AH 5D93B 4I3GA 2A0LD 1C7SA 1Q0XL 1GH7A 1FV1B 1KJMB 4L9LA 4KUZH 3U0WH 4XP9H 3EBAA 4X8XA 5DUML 1Q94B 2MCPH 3AREA 4BH7A 1WZ1H 4BFIA 4JFYA 3RI5F 4PGCA 5CGTA 1JZ2A 3GKWH 1KJVB 1NL0H 2APFA 2HG5A 5EZLB 1NMBH 2VZVA 4OZFA 4LAQH 2AERT 3BPCB 5IW6B 5KVGL 1V3JA 1WK0A 3UYOD 2OTWA 1E6JH 3GSNB 3QUYC 3DLQR 4BK5A 2V9TA 5KN5A 4OLWH 4CDHA 4N9OB 2ITCB 1GPOH 5JPNA 1J5OH 4LPUA 3WN5A 3RU8H 3NPSB 2P7TB 4UQ3B 1EZVY 4YDJB 1LO0H 4X5WA 3S37H 1E4XH 4PV8B 3W0WB 5CHNA 1KLUB 3IJYB 5F1SA 3KR3H 4GH7B 5EO9B 4KZDL 3T4YB 1GGCL 2JCCB 4UV7H 4G8GA 5DHYA 1QRND 2Y25A 4HF5L 3Q2CA 1YPZB 5DYOA 5C9KA 2WINA 3KYOA 1S9KC 4BYHA 1S7TB 2FEDD 2OCFD 2VQ1B 4B0MM 4D9QD 4F7PA 1A64A 5DRNA 1BJ1J 5JHLH 1OGTA 2E7CA 4FMKA 4JFDA 3GSXA 4NOBA 1NBZB 3DMMB 1U3HA 1ORSB 4Y5VA 1A6UH 2FZ3B 3BP5A 2Q6WB 4U6YA 5K9OB 3RL1A 4LPYA 4ZNEA 4AK1A 2O26U 4XMLH 5F9JB 4F15C 2C3HA 1HSAB 1QVOA 3L95B 2G9HA 4JVUA 5ILTL 4AEIH 3ZSTA 3DPBA 3NH7H 4UQ2A 4KK5D 2NCMA 2P5EE 3QEGH 4JRXD 3BRFA 1A6TA 1BIHA 2J88L 3VFWA 4Z0BL 5FB8A 4XPHH 5FUCC 4MDJB 4BUGA 1RFDH 4MGXA 1IQDA 4L8DA 4IRJB 1JTOA 5HYJD 1BD2D 2R56L 2P47B 4UOJA 2W0LA 1CFSB 3U7YH 3IDYC 1TTFA 4K3JH 5DSCB 1T22B 4CUCA 2I9TB 1UCBH 3MJ8B 1CVSC 4MAUH 3QRGL 3ALXA 2EDJA 3INUH 3ROOB 1VKXA 1FNAA 1BFOB 3FQXA 4JRYB 3CXHJ 1WBYB 4NDMB 1VGEL 1TCRB 3HI6H 3OJVC 2DD8L 5HYJA 3MLUH 4YEFA 4LCWB 3UO1H 4YQXL 3JBG7 1AR1C 4G80A 3PWVA 3UROR 3VFTA 4FFYL 4YAQA 3L7EB 4HUWA 3PL6B 2IBGA 4KDTA 2H2PD 5T1KD 2GSGB 2ORBH 3MJ7B 1W0VB 3HI5H 3D39D 2WWMC 5A16B 3UAJD 1CLCA 3TZVB 5FA3B 1LO0L 4PJGF 5ENWA 4ZUVB 4OIAA 4PRBB 4MVBC 4UTBH 3IFLL 3KPRD 2DBLH 1VFAB 3DBXB 4F8TA 4X9HA 3WKMH 2JF1A 3EJYC 1JIBA 2RB8A 3ZE0F 2ATKB 3VRJB 3GMOB 2ADIA 1EO5A 4EDWH 1TQCC 4XPFL 3PQYA 1BFVH 3FTGB 4KKAD 4PJ5E 3SKJL 3REVA 4QHNA 4PJ9A 4HWBA 4R6UA 2XN9E 1WSST 4K23L 4QRSA 3WXVH 2BSTA 4DN3L 1CICC 1A5FH 5D1QC 1N6VA 2D4FA 4L1DA 1QSFE 5C08E 1G0YR 1F3DH 2C9AA 4R2GC 1ZLSH 2YKLH 3WS3A 5IBUG 4MA7L 1CZ8L 3CVHA 4LIQE 2JCCE 4PP1C 4WO4D 1UYWL 2XG4A 1Q0YH 4OCYH 25C8L 2ENYA 1R0AL 1T1XA 3UTPE 4J23A 4DCQB 1IBGL 3H9SD 3BWAA 4HK0A 5LGJB 1JF5A 3BT2L 3SGEI 4KTYA 3QIBD 3BPNC 25C8H 2X1QA 3P4NB 5HDQL 5DZOA 2VL5A 4JPKL 1CQKA 1EXUB 1CL7I 1OM3L 3D18B 5HYFA 3PUCA 3C6LA 3DX7B 4TYUA 4OCMC 3NCMA 2JB6A 4QF1A 3U0TB 4B53A 5EO1B 4KZEH 1FNGA 1XEDA 4HZLB 5DR5L 2NY3B 5HPMA 5T1MB 1PGRB 3MZGB 5E6IC 4LQFH 4WWKD 4C59B 1ZGLM 4C54A 1DN0B 4PJXA 5BVPL 2Z93B 1FBIH 1KCUH 1BEYL 5EDXA 4WDIA 3VFOB 2EXYD 3T3PF 1CLOH 5DD5L 4GRWE 5HI4C 4H8WH 4HPOL 3AM8A 3PP4L 4NHUA 1EERB 5DJ8A 1MRFL 5HD8C 4PGEA 3V7AG 4MB5A 4WUKL 4QGYA 3T04D 4OZFB 4CJ1A 4X4YA 4WI5A 3BPCA 2NY1D 4DZ8A 5BV7B 5BRZB 3JV6A 4IS6A 1ORQA 3ZYJA 1DQML 1VFBA 3VI4E 5B39B 1UKTA 1QR1B 4AIOA 4AG4L 3OWEA 5FYJL 1UH4A 2PYEA 2X4RB 2R2EB 4OD1L 2DQGH 2DQJH 2C1OA 4ZSOA 3AGVA 5F7HA 1P4LB 3X13B 4X5WB 1IAOA 3KAAA 3NIGE 1OW0C 4YQXH 5JOPD 2VABB 3OF6D 4M6ML 5D1XD 4EXPX 3OPZH 3TN0D 2ESVE 1L0YA 3WNKA 2IG2L 5DWUL 3TP4A 2AJXL 2QSTA 3N1FC 3SGJC 1I8IB 1R3KA 4NM4L 5DHYB 4Y4FC 4LEOA 4XAWL 4FQXB 4CMMB 5FM5M 2OJZH 2F8OA 1J8KA 5CGYD 1SVCP 1UB5B 4NYLB 3RY4A 3QUMH 5DQ9B 3X11B 2OK0H 1PG7L 5DRWA 5LKNA 4OZIE 5E8EA 4G9FD 3LVEA 4PJGE 2HLFD 3BVNA 3O4LA 4GW5B 3QIWD 3HCVA 2JB5H 3M8OH 1EFXD 5EB9A 2XT1B 1JYXA 3STBA 3QG7L 4KMQA 2MQ3A 5F1OB 1FNHA 3HC3L 4X7TB 1W72A 2H1PL 3WEXB 2Y23A 4J3VA 1F3DJ 2VLME 4U1NB 2DDQH 1N5YL 3UX9B 3PWJA 5ITBH 5DHVH 1NFKA 4U3CA 5GGRA 2P49B 1CE6A 1PZUB 3CXDH 1B6UA 3L3KB 1VACB 4PR5B 4E9LA 2CLRB 3RWEA 2J12B 1KJ2A 1DEDA 4TNWK 2ZJSH 2WW8A 3QISA 3LN5A 1DUZA 1Z3GL 1F6AA 4JZJC 1YPZE 3GNML 2NY4D 4JFOA 3SJVD 5IMOB 5IB2A 3ARYA 1W0WB 4OGXL 3TYFB 4PREA 2R29H 4NRYA 5DD1L 3TO4C 4HJJL 1FCCA 4KKBD 2HKFH 3KLAB 5JW4N 3ECBB 4JFQB 5L2JB 1AGCA 4Y2DA 4QWWC 3PGFH 4XCEA 2UWEA 2P24A 1OP5H 2OL3A 3A6OA 4MAYC 3HMXL 1X5HA 5DJXB 5EWIL 4RNRA 3EFFB 2I24N 4JRYA 5ALCL 1X5XA 5C0FB 5LGHL 1QO3B 1O5DT 1ZVHA 3PWPE 3T0XA 5GRVL 3DVNA 4WFED 5KSAA 3OAUH 1A14H 1R3IL 1GZPA 3MFGB 2GT9A 1JPTH 4JJ5B 5CZKA 5T1LD 3PWVB 3VXNB 1M6OB 3D39B 5FV1L 4FFVD 1J7VR 4NZJA 1EO7A 1YN7A 5FGCE 1A22B 1JHTB 5KSVA 1CDUA 1NMCC 5GRWA 4Y2OA 4K7FB 2BSSB 3PQYD 5J1TC 2IH3B 3W11C 1I9IH 4ONGH 2R69L 3HAEB 2P8PB 1FAIH 3SDXB 4ETQA 3OKOB 5E1HB 3L3HB 3QCVH 3B3IB 4P23C 4OZFG 2BRRL 2HAZA 3JV4B 3PHQB 5KAQG 3V8OA 3QUXA 1K8IB 3A67L 4IMLB 3CLEH 3CSPA 5DA0B 2EDRA 1P84J 3VI4F 1QFWI 2AJSL 3IU4L 4NO5B 1RZKC 2J2ZA 3U79A 4JO2H 3CK0H 3VFMA 1J18A 1RMFH 1SBSL 5F9OL 4G6AC 2OJEB 1MCHA 1S3KL 4ONFH 1JI1A 3K4AA 1PSKL 2NY1C 2ZNWA 3V0WL 4N0CC 1A3LL 4LFHG 1B4RA 2VDRH 2W9EL 3NIFE 1P4BL 1P7KA 3UJIH 1WC7B 4MCZB 2CKBB 3IDIB 4ORGA 3SE3A 2E7LA 4XTRC 2DI9A 4JFEB 3QUZB 4WRLA 3U30C 3VD9A 2CDEB 1TETL 4HH8A 1DBBL 1T1XB 1D5ZB 5HGHA 5EA0H 4QCIB 4UT7L 1RZJC 4FN0A 4FS0A 4LPVA 3BSZL 1OP5K 1MFCL 3OKMA 1CR9L 4YHKL 2DICA 3IKCB 2VXUL 2JELH 3GIZH 5F96H 1EHLL 4PJHB 3GSRA 3UDWA 3I6GA 1DP0A 4OGYL 5I9QC 4L4VA 5ACZA 3OQ3B 1T83C 2Y06L 4NNXA 1IGTA 3O11A 4NJAL 4X6CF 4KK6C 1QLFB 3F65A 3MUGA 4EVNA 3NACL 2NTFB 4R7DB 2FX7L 1VSCA 2VLJD 2Y07H 1AH1A 4FQJH 1DN0A 3ZMRA 4UMGA 3O2DL 1J1OL 3VCLB 5IBLD 4ZUWB 3GB7A 1JCKA 1KN2L 3V6OC 4LSSH 3HC4L 5JA8B 1H5BA 1MFDH 2NY5H 3EJYD 1E4WH 4NQVB 3IAQA 5EO9A 4G7VH 2IANE 3KWWB 2A73A 5DJYB 3G6JB 1J9CT 1Q72L 5IWLA 5E1AB 1U41A 1DLHB 5TJWK 4FXGA 1SYVA 4LKXB 4Y5YA 5C1MB 4EXKA 4BJLA 3CAFA 1EJ6A 4PG2A 4JG1L 4YFLI 4LMQI 4KMTL 4NZUL 5TH2B 2ED9A 5E8NB 1NC4A 3MJGX 1LEIB 3RTQC 2P42B 3EHBD 5CSGA 2Z31B 1A6ZA 1EK3A 5DRXA 2OQJA 5EOQL 4JPVH 1G6RL 2X6MA 1CFQB 4G9FE 3SCMD 3QQ3B 4I77H 4P46D 4M7JH 1TQBB 3P9MA 1AD0A 5F9JA 2DM3A 2BNQD 3QIWB 2AJYH 5CJ8A 3OJMB 3EYOA 5C09E 2XA8H 3EYUL 3HAEH 3TBWA 4JY4A 3MV11 3V5DA 4HWZB 1XCTA 3LY6A 4Q9RL 1KENH 3QUYA 1T0MA 3DYOA 3VWKA 4YNYB 2LABA 3DVFA 3KS0H 1YEHL 4LCIL 4YBQD 3QT2A 5CINL 5BRZE 4KRPB 3TVMD 2VH5L 1AHWC 5IK3B 4HIIA 5DT1H 4BZ1H 2VISB 1CFSA 4TTDD 3G9VA 5K93A 1DQQB 5CAYB 4L8CB 4HS8L 2H6PA 2B4CC 4GSDH 2UY6A 1MVUA 3GRWA 1MNUL 4P46C 4FA8A 1T1ZB 3VGDA 3KLHC 4WW2B 1VACA 4YHNA 3H6JA 3IDGB 2PR4H 2Q8BH 4O2CB 4V1DA 1RD6A 1BP3B 4WUUB 1FO0A 1T89C 4QOKE 2V7NA 5BXFA 1KGCD 5HI3C 4HQQL 1MIEH 4WFHD 4WU5A 2ARWA 1CTNA 2EC8A 5IUSA 3FRPG 4Z7QF 5IFJB 1OAYH 2BNUA 2HT2D 1S7SA 4YFLF 3NIDE 1EEUA 3VFRA 1MCCA 5JOEA 5D1ZB 1MHCB 3PWPD 3HI1A 1MQKL 1UCTA 5FA3A 1BQHA 2I9LA 3N85H 3ILPB 4G7VL 1QFUL 1TJIL 1QO3A 2W60B 3OSKA 5I73B 4YDIL 1T1YB 5IR1B 5T5NG 3VRJA 3CVHH 3MJ9H 1CQYA 2F53E 4BM7A 2WUCL 2HTKD 4RCAA 4LPWA 3PQYB 1XGTA 4XAKE 4FQJL 4KKCD 4Q2ZB 2DQFA 3WUWA 3P0VL 3REVB 5C7XH 2YEZA 4XP6L 4PS4H 2OL3L 2NW3A 1CDIA 3QPQC 1A3QA 4D9QE 4YGVB 1YEKL 2H2SC 4ERSL 2CUMA 1QFWL 3ARDC 1A0QL 3G6DL 3SDXA 4OT1L 5CWSB 4TUJB 4ETQB 1LO2L 1YY9C 1IKFH 5DTFB 4JFZL 2VIRB 1JNHA 5KSUA 5C6WH 4QRRB 3L5WA 1AKJA 5CZVL 1FN4A 5D5MB 4NO3B 1VA9A 1JHLL 4EIZC 4TSBH 4JFHD 5FM5O 5F88B 3FT4A 5EA0L 3MRNA 1UJ3C 4NRZB 4KK9C 1YY8A 1GGIH 2VXSL 3GBML 5C8JB 2H3NB 5FGCB 1EUTA 1IT9L 1I7UB 4IM8A 3K80A 1PZ5A 4M9PA 1SY6L 1WWWX 5IV2A 2BVPA 3NMEA 1FDLH 2JB6B 1BLNB 3U0TA 1ZLVK 4XNYH 5L2KB 2GW5A 5LXGH 2JIXD 3NCBB 2X44D 3U46A 4OCWL 1JZ4A 2DMBA 2VERN 4Z77B 3MRDB 3TA3C 3TIDA 1TJGL 1MCPL 1JGVH 1EUUA 4J8RA 2ICCA 4KJPD 2E9JA 5FHAH 4D0DB 1QR4A 2OZ4L 4D0BB 4CADA 3GJFH 2EC9T 1VPOL 4AL8L 3ZE2E 5IVOA 3T3PE 3DO3A 3F8UB 4DEPB 4PJ9C 3C09C 1G9NC 3IFOB 5J7CC 3RAJL 4GRLC 4Z7OF 5B38A 4BH7B 4GRWF 2LVCA 5BMFH 1XR8A 3I6GB 4I9WD 2A6IB 4XMPL 3MCLL 3MQIA 1NGZA 5DD3H 5EZLA 3RI5K 1XGPA 1CCZA 4XNMB 5DLMH 4QOKD 3RWCA 3S6CA 3C5ZB 3LSOB 3TM6A 3QDHA 4OLYL 5CP3H 4PJAE 4XPGL 2W0FA 4R96B 2VDQL 3DGCR 1Q9KA 3KXFA 4MCYB 2W59A 3H42L 2MMXA 3DV4A 1MUJA 3GJEA 4JN2A 1A1NA 3DSFH 5DD6A 1AXSA 2GSIA 1LO5A 3WN5C 2VXSH 1A8JH 4FQHB 3IJYA 4CKVX 3MLSH 4ISVB 3FMGL 1KNOA 4PRAB 1N6QH 2Y1VA 4G8GB 4XP1H 4F33B 5DS8B 1HKFA 5CJBA 4RWYL 4O02H 2FHBA 4R3SB 2A6JA 3WCYA 3UPAA 4LSUH 3JVGA 2HA1A 2HRPL 4LSQL 2E5EA 4N0FA 2IALA 1D6VH 5D96B 1PLGH 5D8JL 5GS2H 5H35A 5B4MD 1AGBB 3MO1B 3J8F7 5KSBF 1OGTB 1W72B 5F6HI 3HE6C 3GNMH 1IGJB 3C8HA 1U95A 3BAEL 1LHZA 2ZSVB 3LB6C 4PS4L 1NCTA 5MENB 5DT1L 3WJJA 3PWJB 4BZ1L 4IRZH 1U8HA 5EOTA 3ZKND 4ZFOB 4DKAA 5CIPH 3GMPB 3QDGD 5HYSB 2MPAH 3L3KA 1XCTB 3EHBC 1KENL 2YK1L 3QWQB 4M4PA 4I0PC 4WHDA 1DUZB 5AYQA 3JWDC 4BSWB 4ZD3L 5C3TA 3QULA 1FL3B 3ULVF 3RPKA 3I2CH 5I8OH 2FR4A 4DGVL 4PJFF 3KDMB 4HAGA 4B41A 5BS0D 4UBDC 1Q9OA 4WWKC 4JLRB 1NLDH 4P2OB 5EOQH 3S97C 4Y2DB 5E8PA 3EFDH 4GKSA 1W2KT 3SDDD 4WUUD 5GS2D 2ITDB 4LRNL 5L0QB 3AB0B 4M6OL 4WW2A 4M7ZC 2FJGB 4LIQH 3JTSB 5JW3H 4P5KB 1MWAA 2EYRA 3OB0H 1G84A 2XZAH 4IRJD 1QBMH 3RWGB 1NKOA 3WD5L 2W1NA 1HCVA 3GSUB 4RRPG 2ICWA 4RX4A 2AV1B 5IF0A 4U4BA 4QEGA 2BNUB 4DVBA 1WJ3A 1F4XH 4YEEA 3CUPA 3TPKA 3DYMA 3VFPB 4E41D 4F9PA 5K9JH 2GSGA 3OMZA 4KHXL 5DJZB 3BUYA 1PAMA 4K7FA 3H3PH 4M1GL 1JV5A 5DD0H 2DL9A 9CGTA 1AFVL 2XZCL 1N4XL 2HP4A 5F7LB 1JF1A 2IBZX 4DN4H 4LCIH 4S1DC 4LCWD 1NCDL 2FBJH 4MZ2A 5KZCB 3JV4A 4OJFL 5FO8A 5GGRY 3DUSB 5CEZE 1TJGH 3F7VA 5IR1A 1G9ML 1IC4L 2O5ZH 5LAXB 3LIZL 3PDOB 4K2UL 1G9NH 3UMTA 1XGTB 5I6XB 2Z9TA 2IF7A 2KL6A 4LQFL 5SWZE 3QO0A 4I77L 4PJ8C 1JGEB 4R8WL 2Z8SA 4FQ2L 4U1JB 5F6IC 3RX5A 2NW3B 3E3QE 3OZ9H 5DDHA 1VFOA 1UB6B 2DQDH 4FG6D 2AXFB 3D3VA 3SOBL 1ZHLA 3EDDA 1L7TH 1CDGA 4HX1A 3VFVA 5FCSH 2DLTA 2VKWA 3AXLA 1YECL 3D3VD 1REIA 5F9AC 1F58H 5E5UB 1Q1JH 4GLRH 1MCOL 4P3WA 4NO3A 3K8MA 5IG7A 1FJ1B 4X6CE 1K3IA 3FT4B 3C2AL 3O4LD 1Q72H 4M93C 1YNLH 3DROB 1BOYA 4PGBA 3OKMB 4UT9L 3BP6B 2XFXA 4KWUA 4JFFA 4XVTL 1SJEA 3DRQB 3A6BL 4HAFA 4PJHA 3L3JA 1FE8L 4JFFD 3WXVL 4S1RL 4QF1B 5EBGA 2FECI 3MJ9L 4NSKB 1UGNA 4UDUA 2B2XL 3F7RA 3QWRD 4J8RB 1A1MA 4MNGE 4RMTA 2CK0H 3ARED 4ZUWA 2IQAB 1I7RA 4P3DA 1OB1B 4GXVH 4L8BB 5I66A 1BVKB 4RIRA 3B9AA 2Y6SD 4BQBA 2R2HA 3GSVA 1HXYA 2O93L 3OAUL 2WUBL 5T3XH 5L9DL 2UVEA 4GMSH 2IBBA 2C1PA 5I1AB 4HS3B 1MIEL 3CMOL 2E7HA 5GRZA 5BZWA 3BJ91 4NZTL 3TCLB 5L2KE 3SGEH 4KQ3H 5EWIH 4C58B 4NP4H 1MCNA 3CSYA 5E8NA 2VAAB 5T33L 3KPRB 3MGTB 4KK8D 4NT6A 4ZSOB 1A6ZB 3VXUD 5EU7E 2Y7QB 1UM5L 1PFCA 4GS7B 4QGTA 2FO1A 1NLBH 5EU3A 4PLOB 3LZFH 2GTZA 1PKQB 4NWTH 5L7XL 1LGVA 4HC1A 3O8XA 4Z7NE 5C09A 1T83A 3PJSA 4FTVA 3QH3B 4BSVB 1NCDH 3KHOA 1YNKL 1UB5A 3TBWB 3HC0A 4ZFFB 5DQ9A 3X11A 1JGUH 4HXBH 4MD4B 1JYVA 5CJOH 3ZKMC 3I3DA 4B7LA 5I74B 5DD0L 4JO3H 5E4EB 3ZDZE 4YDKH 4JY5L 2BVEA 1HN1A 2NY6D 2VB5A 1MREL 4P2RB 2F58H 1NMAH 1AGBA 2F54D 6CGTA 1GSMA 4NRXB 1N2RB 2GITB 4U7MA 3FQRA 5CGYC 2VISA 5FYLL 1RU9L 4MD5B 2ZUUA 2QSQA 4PJEB 3NH7L 3BGMA 4L8CA 3TN0C 5F7EL 4O00A 1JN6B 1U8MB 3LRHA 1GIGL 3QG7H 1NGWB 5GGRB 4JZJB 4X9IA 5SWZB 5T3XD 1BBJA 4RWYH 4LIQL 1BF2A 3MNVA 5I76A 3VG0L 4ZODA 3QHZH 3MYJB 5GS1C 4OZGE 2CLRA 3VH8A 2V7NB 4I3SL 4YBLB 3MLSL 2NXZC 3E2HC 5BXFB 3EOTH 4JFOB 3B83A 2XZZA 4N90D 3KPQB 1OAUH 3UYRH 3KXFE 3TYFA 3TBTB 3B8YA 5FYJE 1WFTA 4JY5H 3BGAA 3UBXA 4BFGA 1S7SB 4OKDA 1BOGB 5EU4B 1U8LA 3HE7B 2EIBA 4ALAL 3CD4A 1HEZA 4P2OA 1WTGT 3KLAA 1T03H 4HWBH 4LLVA 1KXQE 4IRSD 4XI5C 4ZD3H 2VN7A 3ARGB 1DBML 1YNKH 2B0SH 2UWEB 2JIXA 3GFUA 1K5NA 4LOUC 5DUPH 1V7ML 1J8HA 4UV7L 2NXYD 3WFHB 1W8NA 5DJXA 5DD3L 4GW4B 1I9EA 4NWTL 4D8PA 5JIKA 5D7JB 3FQWA 2A9MH 3D85A 5FUCE 3MBXH 4I48A 2MKWA 3MMEA 2IPUK 4H5SA 3S37L 2Z35A 3HUJA 4ZYKA 4HK3N 1XIWC 3BDYH 5HHXL 5IROC 3KPLA 3EIFA 3IGAB 3WUZA 3VXNA 15C8H 3CUPB 2DQFB 5E08H 1F90H 4F57L 4P9ML 1H8OA 1YMMB 3WFCL 2NNAA 1JHTA 3P3YA 2BSSA 3VG9C 1ZK9A 5JZ7D 5F1NB 4BQ9A 1LO3H 1XGYL 4MMZC 1T66D 4CDGC 1DUYB 2P8PA 2X09A 2HT4D 5DTFA 1Y18B 4W6WB 5MEPA 5DK0A 1IT9H 1JYWA 2JB5L 4XP1L 5F3HA 1QQDA 3EO0B 3PHQA 3W2DL 1LNUA 4ELKB 1GGIL 4GRWB 2ZNXA 3RWHA 1U9KA 2P5WE 4MLIA 5EOCL 5FM8A 3RDTB 3OKLB 4J1UA 3U83A 1YQ2A 1AY1H 4F3FB 3QR2A 2X4UA 1KTRL 3P0YH 5INCB 1SEQL 4YIQB 5JW4Q 5JHDB 4MVBD 1FPTH 2AXFA 2D7MA 3D3VB 3EO1B 2IFGA 4JB9H 4JJHA 1T4KB 2FJHB 5EC2A 5IV2B 1WBZB 3BQUA 1QSZA 2BX5A 1BLNA 2F5AL 1T7YA 3P4MB 3MCLH 1JGDB 3OKEA 5HHQB 4UAOB 3UZEA 5JDSB 4XRCB 3TIDB 4J12A 5HGBA 1WWBX 2CUHA 4N0CD 3DMMD 3IU3B 1FYTA 4HPYH 1D5ZA 4NBXB 5IHBA 3SQOL 5GZOC 3P9LB 4JPIB 4PGBB 1A3RL 3K2MC 4IDJL 1NUDA 5CEZH 1I3GL 4JFFB 4PJEF 4UZGA 3N1GC 1CFNB 3O3EA 4NGHH 2EE9A 4Z7OE 4NJ9H 4F9LC 1CF8H 5JQ6H 3GSRB 2X89D 3N0PB 4WV1C 1JTPA 4JFED 4R2GB 2RQ8A 1WZKA 2BDNL 4JHWL 4NFDA 4XNMA 4G42A 2J8UA 1CIDA 1DBAH 4R97B 5DUBA 2WLZA 5EC1B 1UEMA 2VR4A 1NDMB 3EYSH 3NCYP 4Z5RA 3IXTB 4K2UH 2VSDA 4KKCC 3VDBA 1X5KA 3LRSB 5F71A 4ZNEE 5TFSH 3VCLA 3S36X 4YGAB 4PYHA 2DYPA 3D2UA 2HJFB 5I71B 1S5IL 1RJYA 4PIRF 2R0LL 2XACC 4GJTB 3MZTA 4E0RA 2X4SB 3M1BA 2W65B 4JQIH 2FHFA 4RIRB 1H5BC 3O2VH 2HFEA 1MHPH 2DBJA 5E8OB 5LWYH 3SDDC 3NFSH 3MBEB 5C0AA 5K59E 1U42A 3RTQB 3H3PL 5EFIB 1Q0YL 2NY3C 5IWLC 4EDXA 1A9EB 1OPGL 2ADGA 4U0RC 5E2JA 3BZFA 5D2LB 5K9JL 2VXTL 4MJIB 2DQUL 1J1PL 3B9VA 4WI6A 5B21A 3LEXB 3MGTA 2IQ9H 2UY7A 3RGVC 3W82A 4E41A 3ULVD 1G7QA 2OI9B 2OR9H 2Q3AA 2X5PA 5DMKA 2V5MA 3G04A 2WIMA 2E27H 4JZNA 1U95B 3CXDL 1ERNA 4JKLA 4XWGH 4D3CL 4X99A 3LD8C 5KVFH 5GSVA 3DX8A 4Z7UB 4MHHG 4CW1B 4NUJA 3P73B 4YXKL 2GHWB 5CILL 4DFIA 2HFFB 4HDIB 1BFSA 3W11D 4MA1B 3FL7A 3LKOA 1J1XH 4HWZA 2ADJA 3EOAB 1U3ZA 1B0RA 5FO7B 3D5OF 5FOBB 5FAAA 4I4WB 4XXCA 4NRXA 3ZT6A 3FQRB 4Y88A 1I7TA 1OAYL 1MJJA 3FO9B 4P46B 1FZMB 1WICA 3GI9H 4X9GA 3KNBA 3EGSA 4YHOL 4LHUG 4JE4B 3BO8A 1NMAL 5SWQA 3H9HA 1Z5LB 1FZJA 1BGXH 4KXZH 4PGJA 2GEEA 3AS0A 5I76B 2Y5EA 2PTVA 5BZDB 5F72S 2DQCH 5F70A 1S9YB 4F7TB 4OFYD 4HXBL 1FO0B 3H9SB 3MLPA 3RBSA 3VE0B 4DJMA 1TZGL 3V95A 1RK1B 3R8QA 2E6PA 4JDZB 1V7MH 4NO2A 2VUYA 4JAMA 2YRZA 1KYOJ 4IRSB 4FABH 3T8XB 3H7BB 3TNMB 3NFNB 5IFJA 4K3JL 2EDKA 3QWRA 4EOWL 2APTA 4PJCA 4ORZC 3UYPA 2Z8VC 1AD9B 3QCTL 4JR9L 5I19H 2Y6SC 2CJUL 4ODUA 4PJEE 1WZLA 3UYRL 3HPLB 5K9QG 2WIIA 3QWOA 1U2CA 3BE1H 4WI3A 5GRXG 4F7MA 1ZT1A 1HH6A 1K4DA 3HB3D 3MMEB 1FCGA 3LKQB 3U36B 1CWVA 2HWZL 3SKMB 5L88H 3MNWA 5ANMA 3O6LL 5EO0B 1RUPL 5D1ZD 3MROA 3RZCB 3QO0B 3FCTB 5HVHB 4NQSA 4I3RH 4NWUH 4G6FB 5HGDB 3K2UH 3WO3B 5F1NA 5JTWA 3RY5A 1UACH 3TC9A 5I1KL 2X7LA 3O41B 2IEPA 4GBXA 3CU1A 4FTVD 1ZXQA 4EEEA 1A4JB 2P5EA 4ELKA 5DO2C 1E4WL 3OG6B 3PQYE 2LU4A 2BCKB 5L7XH 2E9BA 3O4OB 5INCA 5JHDA 3N1PC 1NMCB 1KLGA 4WI4A 7FABH 1BPVA 1T2JA 4LPTA 2PF6A 5L8LB 1OWWA 1QG3A 3TH3T 3GHEH 2DLFH 4CN6A 3B6SA 2W9LA 5T33H 3ZHKA 3VJ6B 4OD3H 1BFTA 1JWSB 1D5BB 5BS0E 3CH8A 2FNBA 32C2B 4GQ9L 1D5MB 3U46B 1KG0B 1UWXH 2G2RA 1EZVX 1U3HD 3IU3A 5E6IB 2PW2B 1L0XA 5DJ2B 1I1RA 1MY5A 4HJGB 4JRXB 2DOCA 1DZBA 4ZPTB 4D0BA 2Q76A 3BUTA 4L3ED 4P3DB 4XP9L 1DBBH 2EDXA 1TFHA 4D9RE 3RIAF 3TESA 5LGHH 1YEIL 4YK4B 2AK4D 5ALCH 1HXYB 2A6IA 3I9GL 3TV3H 1J05B 2PYEE 5JDJA 1YUHA 3K4DA 4PD4K 4FFYH 2YSSB 4FQCL 5MHSE 3C5ZA 3VXQA 3WJLA 1RUKL 2VLRA 3MRBA 3TCLA 4Y16B 2WWMD 3UAJC 4NHCL 4NO0A 3UPRB 3VD7A 1OVZA 5I8CA 5FYLD 3OGCB 1IL1B 4JM2A 1EEYB 4PTTB 1I1YB 1CK0H 3UPCA 1HHGB 4QTHA 4XBGA 3RZWA 2X4QA 1C16B 1RQ5A 2PTTB 5ESAA 2N4IA 3OAYH 1X5YA 4QOKB 1OOAA 3QH3A 1INQA 2WINB 3KYOB 1MQKH 4TUKL 5SX5K 2XOTA 4UIKH 2A6JB 4MAYD 2V2XB 2Z4QA 4LHUB 5AUMB 1ZLWK 1Y0LA 4F7CB 3NAAL 2VDKL 2PTUA 3DETD 3R1GH 4HJ0C 1DQLH 4S1SH 1RZKH 3JVGC 2J88H 1YECH 1N59A 5F9WB 4KRLB 2XI9A 3NBNA 5JNYA 1EFXA 1UVQB 4PG9A 4RBPH 3V52H 1NBZA 4ZS7H 3GUTB 4LMQE 4P57A 2HWZH 1C12B 3OZ9L 3HE6A 4XVJH 2H41A 2ZSWB 3P73A 4MD0A 1NBVL 5EOTB 1DQJB 3AAZB 5EU6D 1QVOB 3C8KA 4HMCA 4PGZA 4KK5C 4L3EE 4OM1L 5HYSA 1ZTXH 3MNVB 3NVQA 5ADOL 1OHQA 3QEHB 2KZWA 4PGDB 3BRGC 3PE9A 2H45A 1KV3A 2XN9B 1YEFL 4RMQA 1A6TB 4YBHA 5BJTA 1YJDC 5I1DB 2C7UB 2FEDC 1KB5H 3OGOE 3UTQA 1KB9K 3MRMB 3KPQA 1TZIB 5F8RC 3AS3A 4NQTA 1JGUL 4DKFH 5IVZB 1RULL 4P46A 3SKOA 2OR9L 3FFDA 1U8LB 3HE7A 3KNBB 5D6DC 5GGUA 3MBXL 4NN5B 4GG8B 3UJTL 2DQUH 4HHAA 1K3ZA 4W70A 3TIEA 4CJ0A 5DUPL 2I9TA 3G5VA 1K5NB 1UM5H 3GGWB 4KK6D 3NFSL 4X5XB 4GW4A 4D8PB 3AROA 4RAVA 3GSNH 4Z7UE 2BOCA 4D9LH 2EYRB 3TEUA 1Q9WA 3VE0A 4H8WL 4YXHL 1PYWB 1U8OB 3PIQB 5FFLA 3JWOC 2GQHA 4OD2B 1UH3A 3HG1E 5IFHL 3L7FB 5FUOL 1R5VB 2NZ9C 3BP4B 5I18H 5SX4H 2EICA 1A9BA 4JO1H 1RK0A 3IETA 4G8FB 5A16A 1I1AA 1YY9D 5E9DE 3HPLA 3H42H 3IJSB 4HKXB 3S35L 2XQYK 4AQOA 4A6YA 3UTSB 4KROC 2XQYG 4ZFZA 3VFGL 4MB3A 4NUGL 3ZTJG 3AS1A 3VXUA 1XR9A 2Z0BA 3B43A 5ISZA 3PDOA 1ZV5A 1RPQA 4HV8B 1WFUA 2F19H 3MV9B 3ARDA 5TDPA 4KKAC 1I75A 3FCTA 4CGTA 4IRZL 4EI5B 1FE8H 5C09D 4GAYA 5JO5B 2AKRB 1LDPH 4QHNB 1YYLH 1I3RA 4J3WA 5D7IA 5KANI 1J1PH 3RPIB 1WEJH 1B6DA 3KVQA 2FJHA 4GAGH 1AQDB 1SBBA 5JXEC 4NQDE 5IP4A 2R8SL 5AYUH 3QUXD 4ZDHA 3WIFA 5LWYL 2NLJA 4X4XB 2VXUH 4WUKH 1FIGH 5DQJB 4J4PC 3GBLA 1K2DA 4RISL 2LTQB 3QNZB 1LO4H 2N7BA 1FRGL 4TVSa 5IROA 2YPLD 1MAKA 4WI8A 1GL4B 5GRJL 1UQSB 3SCMB 5F1KC 3GBMH 1URLA 5KJRH 1NJ9A 2C3VA 3K1KC 1QLRA 5FYKU 2HYMA 2NY0B 4MQ7B 5T5FH 2DJSA 3Q6FB 4YPGB 2LFGA 1QBLH 1G6RA 4H25A 2XKSA 4XX1E 1FO0L 5D1QD 2J8UB 2FHCA 3QFJD 2AJZB 2PO6B 3NIDF 1SJXA 4UDUB 5HYIA 3C8DA 2HVJB 3TLRA 3GK8L 4Q74A 1NCBH 3NABH 4JO2L 2UWEF 1AGDB 3TVMC 4KKBC 3VD5A 3MRPA 3CLEL 4NO0D 4OZIF 4XMKL 4LLYB 2FRGP 1S7RB 5ERWA 1OB1A 4M1GH 3RUGF 3BXNA 1A7OH 1S7QB 3F62A 1CT8B 2OMNA 3QO1B 2A9ML 4N5EC 5HHVH 1P5VA 1G7PB 4Q6IA 4XCCL 1YDPB 2B0SL 5D2LA 3B4NA 1QR1A 4HIEB 1FDLL 4EI6B 3VW3H 5C0CD 1TDQA 2XKNB 5JIHA 3KPRA 3FT3A 1EEYA 3OKYA 2D7OA 1IAOB 3RL2A 5MEQA 3PWPB 4F58L 2D0GA 5I8EA 3VXRB 3BP7B 2RCSH 1KCVH 4I3SH 2WBKA 2GTZB 4LHUD 4CMMA 1LEKA 1M71B 3VG0H 4HQQH 1OF2A 1GZQB 3HE6D 4R0LA 3TCXA 3DIFB 1JHLH 3MA7A 1F3RB 3MACL 5IW6A 5L6YH 3S37X 2KPNA 3NZHH 5DJDB 4OLVL 4X4ME 2OR8A 1GGBL 5EBWB 3H3KA 2IMNA 3CFIC 1IGFH 4TVPD 5JPNB 3B5HA 3DUHA 4C83B 4JO4H 3WN5B 2P7TA 4NQDA 2QKIA 2HLFC 4XZUA 1LK3H 3W0WA 3WMSA 3EZ8A 3MREB 3QIBA 4XWOC 4HS6B 3PGCA 3KPNA 4OZHB 1JK8A 3GMNB 3QEHA 4YDIH 5DEZA 5BZDA 3C5SA 3BMVA 2A83B 3FZUD 3SE8L 5EH1A 1DBMH 2FATL 1E27A 1RK1A 4KJPC 1FFOA 4HBQA 43CAB 4KUCD 1XH3B 4X9BA 4ZXBB 3ZKNC 3DO7A 5CSZA 2G60H 5DC4B 3C9NA 3OHXB 1WGOA 3OXSA 3PV6B 3EJZD 1KEML 1QSFD 5C08D 2FZ3A 4JREC 3FQUB 2CGRH 4LAJH 4PJHF 4S0TD 2P24B 1HSBA 4POUB 3GMMB 1T0NA 4LRNH 4JFXA 1Y6KR 2VQTA 3EFDL 1R3HA 4X6CB 4F7MB 4GO6B 3D85B 2KBGA 3LKQA 5F7MC 4CN1A 3DECA 4I0KA 1PYWA 1RZGB 1HCFX 3C5JA 4HMEA 5KS9A 3CFCH 3BHBB 1QRKA 4MDJA 1CLZL 4YO0B 1IC7H 3KPLB 2FD6H 4LDOB 1IQDB 1IEHA 4X98B 4PB0L 2VLJB 3V6ZA 2J3SA 3D0LA 3M45A 4MJ2A 2UWEE 1FSKC 3QYCA 3G5YA 1I1AB 3ARDD 1T5WA 5JXED 1KC5L 3WIHL 2EDTA 4R4FH 1CXLA 3TH4T 2WP3T 1MI5E 5DJAB 4UNTA 5C71A 1VPOH 4A6YB 2QADD 1LK2A 3OKOA 3PGDA 3CMGA 1AQKL 3L3HA 4MNGB 5AZEH 2IANB 2ZOKB 5FYJD 3G6JE 3TO2B 1H0DB 1CXEA 2E9IA 3WIHA 3LZFL 1LNUB 2AEPH 1EO8H 5IHUH 1A7RH 3CX5K 1EHXA 3DI2B 3OKLA 3MV9A 4FTVE 1JL8A 2NY6B 4OLVH 4PJDA 1YN6B 3HLAB 1LE9A 3MJ7A 1ETZB 1MCOH 1KIUA 3V6FB 3Q3GB 3LRGA 5EC2B 1MHHB 1BECA 3E1F1 3IF1A 2CKBA 3LV3B 4PY7B 2OYPA 4WFFE 3BPOC 1N6QL 1A6PA 3ARBD 4I8DA 4PJ5D 5D9SB 3ZTNH 3RWDA 4P2YA 3MV7D 4QRUB 2H9GA 3ZHLA 3WBDA 2Q7NA 3BH9B 3O3AB 5JPMA 2OTUA 2X40A 1NCWL 4CMHC 1FYTB 3TA3B 4NN7C 1IZKA 1I3VA 3GMOA 5B8CB 1NGQH 2GUOB 3U9PL 3N06B 5I30L 1OTTD 2KQNA 3IKCA 2VL4A 4P59L 4OQTH 4PLNC 5I0DA 5JORA 5KW9H 2IPTL 4PJ9B 1QPPA 4MNQE 2E6JA 3O3DA 5C70A 2X70B 4LLAA 1P7QA 4AMKH 3IVKB 2EDOA 3QUKA 5T1DL 1YUHB 4P2RE 3CVHB 3A6CL 4OIBA 5IB5A 4E5XB 1RIHL 4QRQA 4Z5RB 1MCPH 2AI0L 4OFYA 1A7QL 4OLXH 1KPVB 3QXWA 1J8HE 4U3HA 4U1LB 2X4QB 5AWNH 3SDDB 3C60A 4LFHD 5DMIH 3HFML 4CU8A 1CLYL 1EXUA 4V1DD 1OSZB 5T5FL 3ULVL 2WM0A 2JKXA 5D72H 3RGVB 2XG5A 4FXGB 5EOCH 4LKXA 1EBPA 3MRKA 1WF5A 1Y0LB 4MS8C 3TO4D 3S3JA 4JHZA 4CBPA 4MDIB 4UT6L 5EN2B 4NPYA 5TE6L 3DUUB 2DLGA 1MFAH 3L1OL 5F9DC 3KYKH 2XA3A 4E41B 1MCQA 2CDGA 4NQXA 5JNYB 3G04B 1MIMH 2NMSA 4H26A 3HE6B 4PJIB 4DTGL 4LSRH 5JIIA 5GPRA 4JQXA 5DD1H 4RAHA 4ODHH 3B9KB 4NHUB 3KS0J 3L6FA 2ZCHL 4F8QA 3UP1A 3L3OA 4L3AA 5JHDD 2VLJE 4P5MA 3ESVF 3EYOB 4Z7QE 1ZVYA 4RGND 4BQ6A 4YHYC 4U1HB 1N4XH 2OL3H 4IS6B 5KVMC 4FQXD 1T0MB 4YLQT 1I8MA 3EOAA 5EBWA 5I8KH 2F19L 2NY2C 3ETBF 2R56H 1TVBA 2ED7A 5D7KE 3U1SL 4I4WA 1DN2A 3QJHB 4O5LL 4U33A 5C2BH 5E4IA 1MI5A 4BKLB 1DCLA 2C5DC 2E7MA 3O8XD 1IAIM 1YYML 4PJAA 3BX7C 2AEQH 3SGJA 1HYSC 2J5LC 4JFDD 1KF9B 2B1HH 5HYJE 3CFJB 4LEOB 1FZJB 1DTUA 1I3UA 4XMLL 3CJJA 1A14L 2YBRA 3OR6B 4WU7A 4O2CA 5HDBF 2YUVA 3EAKA 4Y4HD 5GZND 5IESL 3GSWA 4P4RB 1T6WA 1Q9WB 4Z7UF 5FUOH 4F7TA 4Z7WB 2VZOA 3B9EA 4KMTH 1FFOB 2YA2A 4K9EL 5CD3A 3QHZL 1BZQK 4OLEA 4NO2B 5L2KD 3DSFL 4N68A 3QPXH 4FXKB 3FRPA 1HOCB 2AJVL 3R0NA 5FECA 3MLTB 1MSPA 1QNZL 2EYSB 1LK3L 3VFRB 1F8TH 1IGYB 5MI0B 3HNSH 2Q8BL 2BRQA 5I1LB 5J6HA 4XPGH 4ZPVA 3EO9L 4DVRL 1T0NB 4XNXH 1RU9H 4JFXB 1UH2A 3S36L 3SKNA 5IQ9B 4M03A 3GHBH 3JZ7A 4QT5B 3ILPA 1CGWA 2P8MB 3AUVA 3PG2A 4DFHA 2DQTH 4DKFL 3HNVH 2OM5A 3DURB 4PD4J 4JM4H 4OF0A 1U8QA 4L3CB 4MJID 1MFEL 5FHAL 3HE7C 4NKIH 2AK1L 3WUWB 2X4OA 5IB1A 5FDWA 2APVA 4JANA 3I3BA 3QI9D 4ODHL 4PRNB 4OM1H 5IMLB 1QTYT 2G5RA 2XA8L 3V0VA 4G5ZH 1FORH 5I1CL 4MAYA 2CLZA 1N5AB 2R1YB 4KQ4L 4G6AD 4FQPA 2DAVA 4LLUB 4JZOA 2IWGA 4M7JL 4LPCA 4MNGA 4ZDHB 2IANA 3EFFA 4WFFD 1CICA 5EU6A 4QRRA 2D7TH 4S1DD 4FFVC 1I4FB 1GOHA 2EE6A 4JRYE 1FN4B 5D5MA 1X5GA 5IW3A 5F88A 1MF2L 3IS0X 3QUYD 2O5XL 1GZPB 4QNPE 1UQSA 4JJ5A 1M1SA 4XAWH 4GMSL 1AR1D 4NZUH 5SWSD 1YN6A 3D39A 5CKGA 3CPLB 3PWNB 1ZT4A 4WFHE 1RZIA 4XBPB 3CX5J 5ICZB 3MV7B 3V6BR 2V2TA 3Q48A 3T3ME 3MRFA 3LV3A 4TTGA 3T2NH 1ADQL 3V0AC 4YE4H 2YD4A 1ADQH 3X14B 1RIHH 3G08B 1E4XI 4Y1AB 1V3MA 4HKJB 5E56A 2Q86B 3CFBA 3RVVD 3A67H 4QRRE 2VJXA 1EA9C 3V5HB 5E6IA 1TNNA 3RWJA 5DRZB 4WV1A 1BQLH 2OZ4H 4B5EA 5HHPB 2XRAL 3ULUD 1RUKH 4Z7VA 5FO9A 5M7QA 2A6DB 2ESVA 4U1IB 3U0PB 1BFVL 2UZYB 3BQUD 4X6DF 5IGXL 4NKOB 1XR8B 3KPMA 3QO1A 3KYMA 3TV3L 4X0KB 4KGLA 1HQ4B 4MJ4A 1E4JA 5KSBE 5KS9F 1EAPA 2D3VA 4RBPK 3SDYL 1KN4H 3CLFH 1C08B 3ES6B 2VZ3A 2OX5A 3ORJA 4ZOAA 3WNMA 5H94B 4GW1A 1QUNA 4HIJB 1N6UA 1FG2A 4EI6A 3HPJA 4FMFA 3D6GA 3FONB 2IAMA 3ZTNL 2B4CH 1MELA 1EH9A 5HGHB 1KPVA 2PXYA 3CH1A 3MOAH 1WEJL 2XWTA 3SDDA 4XVUC 4JDVA 1HHGA 4FQHA 4QTHB 4XBGB 1C5BL 5A40E 2ZUYA 5H8DA 3B2UC 3WYRA 1VADA 2FWOB 1A1OB 1G1YA 2V5SA 3ULVE 2YXFA 5E2UH 2R4SH 5I75C 3T4AA 1JZ5A 4HUKB 4DEPC 3ZT5A 4NNXB 5I1HH 3IDXH 5C0GA 1BBDH 3O11B 4GRLB 1IAKB 3P77A 1CDBA 2KDGA 4R90H 1KJ2H 2D03L 5EPMB 3LKNA 3SKUD 2ZJSL 4QRTB 3AU1B 3VGBA 1YMMD 3FAXA 1G7LA 2Q8AH 4N0YH 2XZCH 4N5ED 1NCCH 3LCYA 2PYED 4H26B 5MERB 1GRWA 4YHPB 5MENA 5E6ZA 2AP2A 3S4SA 1YEHH 2OBGA 2VDOH 3KWWA 4ZFOA 4MD0B 1HH9A 3GMNA 5IFHH 4FXLA 4S1QH 1U8NB 3SHSA 4I1NB 1L9MA 4OF8A 4PJ7A 4XXCC 5ACMA 1UWGL 2OXHA 4M62H 4NKMA 1TXKA 2BNQB 3GSOB 5I15L 1E27B 5HGGS 1ZEAH 2IPKA 5GS1B 3E6HB 1U91B 3IJHA 3WHXA 1OAKL 1JPTL 1A4KB 4Y5YC 3QNXB 1AGFB 4D0CA 4KJWC 2B1AL 3PV6A 3FQNB 1U3YA 4PJAB 1C5DB 4JPWH 1NAKH 4FQ1H 3UTPD 3MGOB 3RVUC 4L3EB 3G5VB 4S11A 3KPOA 3DRTB 5GGVY 3IXAA 4GQPH 3MR9A 4OZ4B 3WIIH 4ZAKB 3SE9L 4RAVB 1LEGA 4P2QA 4OZIB 1EX0A 4GSDL 4KDTC 5IB3A 4TVPE 4PJGB 3UTTA 4ZFGH 1MJUL 2EIDA 1D5IL 2UV3A 2AV1A 2Y5TA 5IF0B 1BQSA 2YRPA 3L7FA 4HD9A 3LKPB 3MLTA 5B22A 3EOYG 2VAJA 2VLRE 2YD2A 1MCIA 5K59F 5IK3A 2FGWL 5TGBA 2EDHA 1UENA 5CINH 5KOVC 5DJZA 4R2GD 4ODXB 1R6VA 5I17A 4TN9A 4X80L 4POYA 4G8FA 5TQ0L 1DEEA 3TJHD 5DJAA 3IDJA 1JF1B 1T2XA 3HZMB 4LCYA 1FZOA 1IAII 4JFPA 5H2BA 3IDGA 4AT6B 5D8JH 4BH8A 4EKXA 1ZWIB 3D87B 4LSTH 4AH2A 3VWJD 2W38A 1P6AB 2IGFL 5HJ3B 4TUOB 4NQEA 5F7KC 3N9GH 3HZVA 1A6VL 4L3CA 3QUXC 5DR5H 3VMPA 1VHPA 1F6LL 1N8ZB 1QSED 2DWEA 3BPLC 2RAMA 1YA5A 3U6RB 2QJDA 5FDWB 5IB1B 3DV6A 3BEWB 4OGAD 1ACYL 1TQCB 5FA4A 1H8NA 1J1XL 2H8PB 3C87A 1V05A 3VRLE 1EMTL 1NGXA 1V8HA 2NZ9D 4IIQA 5HGAB 2Y36H 4Q58C 1X5FA 3GIVA 4CNIA 1AQDA 4LDEB 5IHLB 3MUHL 2I9LB 5CBAB 4LKCB 1E6OL 5EU6B 2QADC 4QRUA 2JE8A 1X6NA 4NQCB 3WIFB 5T1LA 1GGUA 4OIIL 5DQJA 3S4SG 2CRZA 1JNLL 1NC2B 3QNZA 2Y9RT 5DFVC 4FNLL 1KTKE 2XN9D 3CDGA 1A2YA 3IS1X 1ZLSL 3S98A 4NKDB 2HTKC 1A5FL 5SV3A 1P6FA 5FGBC 1UWEH 4X83A 3TWCL 2Q7YB 4AIZA 2R1XB 4YGVA 3FT2B 4X6EA 2NY2D 1Q9LB 2K1MA 1J5OL 1FYHB 1HHJA 3TPUA 5I2IB 4OSUH 2E8ZA 5KG9A 4P3CL 1N0XL 2APXA 2F54A 1M7IA 2UYLA 4XP5H 5FYKL 4XPBL 3CZJA 4P3CH 1U36A 2DQIH 4G9DB 4DGIH 1ED3A 4Y4HA 1GOFA 3KPPA 2C3XA 2DF3A 5ALBL 1PW3A 1MEXH 4UTBL 4NC1C 3FOLA 1GGYA 1MCLA 2VZUA 2HTLD 4KHTH 1KIQA 4NRZA 3FN3A 2ESVB 4U1IA 4LLYA 2J1KA 4C56E 1IM9B 5TF1H 3NCJH 4O51A 1SMOA 3KPMB 5IW1A 1ZAGA 4JG0H 4QRPB 4I0PD 1RY7B 5IB4B 1U6AL 4GKZB 1IQWL 1C08A 5BQ7B 5ID0A 5I1AA 2QLVB 2P5WD 5BZWB 4U6XB 4NBYB 5L2KA 1GVIA 4GXUN 5H94A 3MV7E 5BV7C 4R4FL 3UJJH 2R0WL 3MLYH 2P43B 3CSYB 1E0OB 1HINH 3BZ4A 1OD9A 1RIUL 4PJDF 2MHAB 4POZD 3MYZA 1ZHBB 5E94B 5I1KH 2M1KA 3L9RA 4MQXC 3INUL 4XCNB 3PABB 1CTOA 2F53D 4KTEH 1A1OA 1Q94A 5LBSL 4XP6H 1B4JL 4HC1L 4MLSA 4WCYL 1IE5A 3QCVL 3RVXD 3MXWL 4NCC2 4GRLA 4YHLL 3MA7B 3O45B 5KSBB 4R0LC 3LSOA 2GK2A 2A6KB 4PJBB 5KN5B 2EIZA 1KBGH 1JMXA 4K3HA 1SEBB 1KEMH 1OQOA 4KTDH 2NR6C 4X6DB 3FB6A 1YC7A 3LH2L 5I19L 1CU4L 4EN3C 1RZ8A 4PV8A 2FJFB 2QKIB 3RVWD 4YBQC 4AM0B 2D7PA 4MS8D 2DIJA 3QDMD 4V2BA 2NW2A 4G9FA 3NPSC 4JZJA 4ZS6D 5F3BB 3F7PC 2W9DL 5SWZA 3HI5L 4P49A 5E03A 4Y5XC 1KEGL 2ZUQC 1IFHH 5CFHA 2DIAA 1PKOA 2AJXH 3MV8D 3QIUB 5DF0A 3I02A 2A0LC 5CD3B 3CFKA 4Y2DC 3CZFB 5HYSG 1UZ6F 1BWWA 1JVKA 3MJ9A 3WNNA 3P11H 4GKNA 2HN7A 2J8OA 1R3JA 4JO4L 5J1AA 4YR6B 1MPAL 4M7ZB 1LE5A 3GJFB 4HS8H 4LLVB 5A2FA 2QBWA 4WNQA 3VXTB 4AG4H 4HBCH 3I6KA 1XCQB 3EOBA 4LDLB 5ACLA 3FQUA 4K3EH 3VXUE 3QDJB 1HSBB 5DJ0A 4QY8A 2XPGA 3KPOB 3C60D 2BC4B 2EXWD 2AJUL 4OQ1A 4KI5D 1MAML 1CYGA 4H88H 3WV0A 4Y19A 3BKMH 2VDMH 3QXDB 4C56A 3HUJE 5E6ID 5IB3B 3RVTD 1WBXA 1CU4H 4D2NA 1KUMA 1BJMA 3D25A 3HR6A 4AZ8A 4H1LH 4L1HA 1KCVL 4O2FB 2Y5TB 1U8QB 4GAJH 3K46A 4ELMB 1I1AC 3EOTL 4XPHL 4F58H 3FB5A 2CO7B 4DOHB 2AJ3B 2ATPA 3NZ8A 3VWJC 3BKJL 3GKWL 3U4EA 3ZHDA 5I17B 4HLZG 1ZANL 5IMLA 1FH5L 3T0ED 4QXGL 2VITA 5M95B 2WBJD 4UNUA 2CLZB 3VGFA 3T09A 1G6RH 4LSVL 3WDHA 1DBJH 5GJSH 4JFPB 5F7EH 3QUML 3ROOA 1VKXB 4HG4J 1BFOA 5LBSH 4BH8B 2DL2A 1DFBL 3IDYB 5IEKB 1R3LA 1A6UL 1MWAB 1DE4B 4P0DA 4NM4H 3BW9A 2PNDA 4P23B 4JPKH 3IDXL 4JHBA 1PD6A 4GOSA 4OUUB 2M8XA 3CC5B 1XF2B 4U05A 4YHZL 5F7NC 1N8ZA 5HSFA 2RR3A 4HWEL 2ICEB 2HLAB 3FRUA 5DHVB 4JKPH 3ULUF 1F00I 3NABL 2DJ4A 3VFPA 1KB9J 3UXFA 2O61A 1OAXL 2I60L 2NY5C 4J4PA 1NCNA 1ETZA 1T4KA 3T2OA 5GGSY 1HIML 4G6JH 1KTDB 1MHHA 1WBZA 3B8SA 4XTRD 4PY7A 1NC2D 3O2DH 2P48B 1AJ7H 1A7PH 2Q86A 5CLTA 3W0WE 3TZVC 1OGAE 3QUZC 1ZVSA 2I07A 4K7PY 2AXGA 5ALBH 5KTEL 3MODL 4FQCH 1CL7H 3TA3A 4LARH 4KQ3L 4OAWB 3NOIA 1PX4A 4QXTB 4ZTPH 4J3SA 1AO7D 1KIRB 5DK2A 2HKHL 4IDJH 3HRZA 1UB6A 3KYMB 1T04B 1UM6L 2BSTB 3MXWH 3FN0L 2FB4L 4WEBH 5J3HC 1RJLA 4QXUL 4LP4A 3LKSA 1S9XB 3F7YA 4JGJA 4NCDA 4GW1B 4GMTL 4MA3B 3SO3C 1P2CA 1S5HB 5D6CB 1ZE3C 3DGGB 4H0IA 5C0BB 1AO7E 4Y16C 4FNLH 1S8DB 2YXMA 2YUZA 4XCYA 1VGKB 2BMKB 2M26A 2XWTB 3DX6B 3H7LA 2R0WH 4MNQB 4LCCC 2NYYC 3VXMB 1SJEB 3DRQA 1EDQA 3L3JB 3QI9A 4HCRL 1G7MB 4AENA 3RTQA 2UZIH 1OARH 2VC2H 4ZTOH 4U6XA 4U6HB 4MJIA 2VZSA 4ODTL 3T1FB 4Z76A 4MDIA 1FZKA 4URTB 3BZ4B 5E94A 2IAND 4I5BB 3BJLA 1MH5A 1HKLH 1NSNL 2IPUG 1G7QB 3SQBA 3WSQL 1MEXL 5B3NA 1G7LB 1UACL 3MLZH 4JZNB 3O6FB 3VXSE 4XPBH 4AEHL 4GAJL 4LSTL 4DUXA 3DX8B 4TSCL 2YRLA 5E08L 2BOBB 3VWKC 5HI5D 1CXKA 2GAZA 3OBAA 5I74C 4HIXH 4PGCB 5BVJA 1L7TL 1TQBC 2R2HB 1LVEA 3AY4A 5TQ0H 4X4YB 1MCWM 2BXZA 4MXQC 2BSED 4LVOB 1RSFA 2C1PB 2ADJB 4EUPH 5DJCB 1A02N 3WHE0 3M17A 3STLB 4KY1H 1B0RB 4JQVA 5GJTL 4EJ1C 3ZL4H 3GMRA 1V5JA 3IJHB 3WHXB 3EYQC 4MJIE 1MPAH 3QJHA 3QNXA 4D0CB 4FQLH 3CXHK 3VMOA 2J8HA 4PJIE 1MI5B 2GJ6D 1DSFH 2YPKB 1FYTD 4HMDA 4IHOB 1N3NB 5E2VH 3RWIA 2L7UA 1KYOK 5F3BA 1MRCL 2JCCA 1Z5LA 3I6LE 4PFEA 1JE6A 2VDPH 5DEGA 4OGXH 2NX5A 1FVDB 2YPLB 4BSJA 4M6NH 4WW2C 4MD4A 2BXYA 4G8EA 4MWFB 3KR3L 3QZWB 4KZDH 4ZQKB 3CFKB 5GSRA 1HHIA 2L7JA 3RY6C 3ARGC 3RIAK 2W0PA 4KVCH 4RMSA 5FGSA 1QPXA 3KYAA 4X7TA 1HOCA 3LKPA 4XH2A 1FH5H 1N2RA 2GITA 4JFDB 1YNTA 5GGSB 4MNHA 2VTFA 4HUUB 1U3HB 1JNNH 3TBSA 2QQNH 1GC1H 3BKJH 3BZEB 5DQDH 2R23A 3STZB 4HUVB 4M6OH 1GC1L 2CO6B 2CKBH 1JN6A 1NEUA 4WO4C 1T21A 5CD5C 2WIIB 4AEIL 1XIWB 3MLZL 4YPJA 2OSLA 5IJKA 3T0EA 1RIVH 4KPHL 3RWEB 3PDDA 3VH8B 2X05A 2MCPL 4I2XE 1EHNA 2BY3A 5TDNA 1XAUA 1JWUB 2GFBB 2BP3A 3SKMA 3QQ9D 2IADA 3MRCB 1CI5A 4RMRA 4R26H 3GBNH 4ZUUB 4P2OC 4R90L 4ZO6A 1HILB 1BOGA 1NAMA 2X89A 1I1FB 3DJ9A 4LVNC 1B0WA 4IMKC 4WWID 2VITB 5IMKB 5CLWA 4IIQB 2QQKH 4P48A 1ITBB 4NC2B 3VXPA 3HZYB 4K7PH 2VN4A 1Z0MA 4EN3D 1MFAL 3L1OH 4P23D 5DJ6B 2A9NL 2DQJL 4OV6F 1NGYA 4JVWA 4LSPL 3FQXB 4NZDA 2EDBA 1G9MC 4NDMA 3QDJE 4YDLC 3PNWB 4OZFH 5J56B 1XF2A 3OX8A 5JOFB 1OPGH 1A6WL 4W4OA 4TSAH 5E2TL 1E4XL 3TH2T 1JGLL 3AFLA 1D6VL 1I1CA 2F15A 1R5IB 4XNZB 5JZ7C 2J4WH 3L5XH 3LQAL 3RVXC 1SVZA 3QB7C 5D70H 5AZ2H 3VXOA 4GXVL 2GYSA 3RDTD 1XGRB 3SDYH 5E0QA 1IC5L 1W0VA 5FYKH 4BUHA 3MV7A 2KH2B 5ICYB 3RHWK 1WCBB 3PWLA 3QQ4B 3UZVB 4YWGH 3QDAA 2VXQH 1CL7L 2VDOL 5J1SC 1WCQA 2ID5A 3S9DB 5DEFB 3WDJA 4MXQD 4LF3A 1HKLL 1NSNH 4MXVF 4KDVA 4G9DA 1LD9B 3CFDB 4Y4HB 4UI2A 4XXDB 5IFAL 2ATKA 3V5HA 4HJGA 3MV8A 4WCYH 1Q0XH 2G5BB 3K74B 4MYWB 3BISA 3QBTB 5HY9A 1KJ2L 2D03H 3SGDI 4FFZL 1OL0A 4PRPB 4OIIH 3T2NL 4X0KA 1P7KB 4Y1AD 5C0BD 4UINL 3P4MA 4I18A 4PLJD 1UJTA 1UXSA 3K2UL 5IJVA 1P2CB 1OSPL 1S5HA 1F58L 3VI3E 4ODWB 4TRPH 1BQUA 2V5RA 4MA7H 1YQVL 2D31A 4MNQD 1JGVL 1U8PB 1N26A 4M93B 3SY0A 2F5AH 2P45B 3OJDB 4TVPL 4HIHA 1BAFL 3U30B 2CDFA 1YEEH 4N1CA 4K23H 1PQZA 5F44A 4JB9L 4QXGH 43C9B 5EZJA 2B39A 1FGNH 3D18A 4CVUA 1ZA3A 5A43C 3LIZH 4OTXH 3MODH 1IAKA 1AI1H 4Y4FD 2YD1A 3HHRB 2FBJL 1PEWA 1RJZA 4YC2B 1WIOA 1XF4A 4X7SL 4KVNL 5J12C 3HNVL 2E7BA 3IFNL 4XHJC 3VRIA 5DMJB 2A1WL 1QACA 4P57B 3RBGA 4PRIB 3IAPA 2DI8A 1S7WB 3V4VH 4F7EA 1Z6JT 1J11A 5IBTH 5GGVH 1CFVL 4LU5L 1A0QH 3NCFB 5DJ8B 5TE7L 4LVEA 4PGEB 4M00A 5CS7A 5A2LH 4X8JA 3WIIL 2GK0B 5DYOB 4PJ7B 4PY8J 1BX2A 4EDXB 4OF7A 5GHWH 1FGVH 3TGXA 3NN8A 5C2UB 1F6FB 3L5JA 2PYEB 2X4RA 1UM4H 3IDNB 1FVCB 1G7JB 2WP3O 2X9YA 3SDXE 5IVZA 2QSVA 3LAFA 5T3ZH 4H1LA 1S9VA 3FFDB 4ODVH 2HN7B 1P4LA 5GGUB 2D0HA 4R4BA 4RFEA 4Y4KC 4Q7DA 1C5DA 3CNKA 3VXTA 4HHAB 3TIEB 2D7TL 3U7YL 2AS5M 2Z31C 2XPGB 2V7HA 2BC4A 3B2VH 5D2NB 4FQXA 1UWGH 1JUFB 5C0JA 2AV7A 1FORL 4ZAKA 3LKOB 5IOPB 2BOCB 3RIFK 4G8EB 4MWFA 4KK9D 4NC1E 2LAAA 3QZWA 1HE7A 1UZ8B 1RUAL 4F9PC 5J11B 2YC1B 2QQNL 3FB8B 2WV3A 4FZEL 1HNGA 1ZT7B 2EH8L 3DX9B 2AJ3A 2ATPB 3V4PH 5GGSA 1UA6L 1GIGH 3ESUF 5FUZL 1MJ8H 5EG6C 3RUGB 1RUML 3FFCA 1DBKL 1IEBB 4KRPC 4WY7L 5D2LF 4Q97A 1FSKB 3QEQB 1OGAD 5EIQA 3IDJB 4Y0GA 3HZMA 4EIGB 2K9UA 4PJAF 3SJVB 2NY4B 2B7DT 1DE4A 3BPLB 2ZG2A 4OF5A 2R9HD 4NQUA 3MLYL 4OZGB 1XR9B 3LN5B 3D9AH 4NQEB 2GFBA 5ISZB 4X7SH 3OAZH 3CC5A 2O5YH 2EEDA 3KLSA 1HNFA 4JY6B 3HKFA 4NNYA 3H9YA 4EZMA 4FHBD 2DTML 4YAQB 3VFTB 2QHRH 3ZDYF 1DDHB 4GAYB 5AEAA 5JO5A 4Q9RH 2RCSL 1EGJH 4PJXF 1JPSL 4DGYH 4PJ8B 3MCKB 1KJ3H 1X7QB 1CXFA 4NN6B 3ULVH 4XCEB 1HWGB 4ODUB 2SEBB 4G6FD 3AS2A 4LRIC 2BDNH 5F1IB 4NQCA 3FJTA 2HT2C 5T1LB 4TSCH 4U7SA 4OLXL 1QSEB 3KJ6L 1AC0A 1KCKA 4P4KC 4AEHH 5F7FA 3G5ZB 5T3ZL 1U93B 1MAJA 4P9HL 4OSUL 3AMKA 3E3QC 3LMJH 2JCCF 1GAFL 3IDMB 1P5UA 1NC4D 2P44B 3MROB 5T5NF 4M3JA 1SM3H 3HMXA 3H0TB 3VG9B 4XMKH 5DUMH 5AG8A 4RGNB 4N8VA 2DTSA 5JLZA 5D7LA 2R1XA 5JW4R 4O4YL 1BZ7A 3GK8H 3EJZC 4K9EC 4YE4L 5GGVL 1HXMA 2EO9A 4DZBB 3BD4A 4FP8H 3BH8A 1P7QD 1ZOXA 1CBVH 3QUMA 1A4JA 2UVFA 1I8LA 5B39G 1CD1A 4IOFD 4HH9A 3KPPB 4GBXC 1S8DA 4O58L 1YC8A 3MRNB 3MRPB 1VGKA 1TZHB 2BCKA 1JPFB 2OJEA 4MNQA 4W6YB 1CGSH 1MLCA