3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
4JHVA 1GS7A 2BZ7A 1PZAA 4DP4X 1ET8A 1GR7A 1KGYE 5F7AA 1NIAA 2QDVA 1GY1A 3EH4B 4HCFA 1TEGA 4YSTA 4AI7A 3DTUB 3CG8A 3OQRA 4A2DA 4YSPA 2IDTA 3AW5A 3NJKA 1FA4A 3U25A 5TK4A 2YAMA 4GP4B 5B7MA 1XB8A 2BW4A 2HRHA 4A2FA 2LLNA 1ZIBA 1JOIA 4YSCA 2W8CA 1PY0A 1E30A 1RKRA 2FNWA 3T6XA 1ID2A 1PZCA 4DP1X 1L9RA 3BQVA 4KOCA 1SFHA 1WA0X 2IDSA 3RYMA 1PAZA 5I6LA 3G5WA 2DWTA 3OMIB 2VW6A 1ADWA 1ZV2A 2PPFA 1ILSA 1CC3A 3V9EA 4KOBA 4BDVB 2IWEA 3PAVA 2GBAA 5PCYA 4M4RB 4YSDA 2ZONA 4A67A 1KBWA 1MZZA 1SNRA 4E9SA 2BP0A 4WTQA 1OE1A 4F2FA 1BAWA 2CJ3A 4G70B 3TBBA 2HRGA 1E65A 1NIFA 2Q5BA 4HHWA 4P5SA 2EINB 1ZPUA 1A4BA 4YVUA 3S3DB 6PAZA 2YAQA 1ZDQA 4UF7C 4BXSV 2MRYA 5F7BA 4AZUA 2VW7A 4KNUA 2ZOOA 3ASNB 1JZFA 3CDZB 3EHBB 5B3SB 2VMJA 2XLLA 1PLCA 2GIMA 3ZDWA 3SBQA 1ZDSA 1AZBA 3NJIA 4RH4A 4CSPA 2PP7A 3FYEB 1RZPA 5E9NA 1JXFA 4HHGA 3D12B 2DYRB 2XXGA 2H47C 5AZUA 5D4IA 2PP9A 1FWXA 4BWTA 1NIDA 3S8GB 4KO9A 1CURA 5A7EA 1HFUA 2BP8B 3TBCA 1ILUA 1JERA 2XV0A 4Q89A 1JZGA 4E9VA 1MDAA 4BK5C 4HIPA 2PLTA 3CVCA 2H3XC 4E9WA 2TSAA 3FPXA 5I6KA 2Q9OA 3UACA 1A4CA 1MG2C 1DYZA 1NIEA 3AZUA 5B7FA 1OCOB 4MFHA 3X1BA 4BDVA 3PCYA 2EIJB 4KO7A 4BWUA 3HB3B 4E9XA 3N55A 1X9UA 2R7EB 2FQEA 1AOZA 4N4YB 4NB7A 3NJHA 3S8FB 2XX1A 1AZUA 3V9CA 2ZXWB 5D4JA 3EH3B 1OF0A 3SBPA 2GHZA 5LDUA 1SDDA 3ZIYA 1BXAA 4YSEA 1NICA 4FAAB 1OCCB 3NSFA 3QJRB 3X2QB 1GY2A 6PCYA 1J5DA 1L9SA 3IEAA 2I7SA 3CVDA 4YSQA 1BXUA 1I53A 2YAOA 1L9QA 2GC7C 4GXFA 1BQ5A 4G7QB 1J9RA 1OV8A 3QPKA 2AVFA 2QDWA 3CDZA 1AQ8A 3FSAA 4YSRA 3ABMB 2IH8A 1IUZA 4FA7B 1NWPA 2IH9A 2X87A 4GP8B 1PLBA 4Q8BA 1AIZA 3AY2A 1PF3A 1MZYA 1W6WA 7PCYA 2UXFA 1OOWA 2GSMB 3NSYA 1YLBB 2GI0A 1NPNA 1IBYA 2CUAA 2QPEB 3AG4B 2BP8A 5B7EA 3TASA 1AS6A 3H56A 3TU6A 1BQKA 1AZCA 4AX3A 1A65A 2MTAA 3MX0B 1X9RA 2XXFA 3NP3A 1IC0A 1JZIA 5AFAA 3PXLA 3FU7B 2PPCA 2J55A 1BQRA 2VSMB 2PP8A 2X88A 1KCBA 3T6ZA 2XUWA 3FQ1A 1A3ZA 3WI9A 3C75A 2E86A 4A2EA 1HAWA 1JVOA 2XWZA 1TKWA 4UANA 3WKPA 4E9QA 5I6PA 1N68A 4M3HA 3TA4D 2BWIA 1JZEA 4F7KA 3JTBA 4E9RA 3CZUB 5I5IA 3X1NA 5B1AB 3PAUA 3IN0A 3FSWA 1AACA 1J9SA 3FSZA 1M57B 4DPAX 1V55B 1URIA 3PPSA 2I7OA 1J9TA 1TEFA 4X4KA 3H4FA 3UAEA 3CVBA 3FPYA 1VLXA 2XV2A 1NDTA 2W88A 5EHFA 4E9YA 1IKOP 1PLAA 1A8ZA 3T9WA 1JXGA 1KDJA 4YSSA 2TSBA 2OJ1A 4DP2X 2OCCB 1RCYA 3NP4A 2BO0A 4P5RA 1FFTB 1BEXA 2FJSA 2J57A 2FWLB 3S3BB 2Y1AA 1JXDA 5ANHA 2IDUA 2PPEA 1JVLA 4AKQA 3WG7B 4QKTA 1WA2X 3NJFA 2NRDA 1M9WA 5B1JA 2WSDA 1ET5A 2OV0A 3ASOB 2AZAA 2FQFA 1W8EA 4A66A 3UADA 5D4HA 4DP8X 1DZ0A 4KO5A 1E5ZA 3WIAA 4DP5X 3KW8A 1KV7A 3NJNA 2VN3A 3FYIB 4HAKA 1GW0A 2IDFA 2YAPA 3FU7A 1GS8A 2ZWNA 3T6VA 1WAEA 3FT0A 1PNCA 1E67A 2YAHA 5I6MA 2HXAA 3QQXA 4A2GA 2HLEB 3ABLB 3GYRA 5B1KA 4E9TA 2P80D 1NINA 2HX8A 1PNDA 4NAJA 1EHKB 3WNJA 4YSOA 3QJUB 2P80A 2BHFA 1ASOA 2FQDA 1V10A 2AANA 3X1EA 4HALA 5I28A 1KBVA 1OE2A 1XB3A 2JXMA 3ABGA 1EZLA 1V54B 5I5MA 1AANA 2EIKB 4BWWA 4YL4A 2N0MA 2WO3B 1TU2A 1SF5A 3NJMA 4PCYA 4CSZA 2CBPA 3IN2A 1AS8A 3FQ2A 5AKRA 1F56A 2GC4C 5B1JC 1SHWA 3EH5B 4G7SB 4KNSA 1B3IA 3OMAB 1UATA 2FT7A 4KO6A 2I85A 4ZK8A 5IY5B 2FT6A 2HX7A 2JFCA 5PAZA 2UXVA 2DV6A 1NZRA 1L9PA 1QHQA 2AFNA 1OCZB 3QJVB 2CALA 1BXVA 2J56A 2Y69B 4KNTA 4DP9X 2FTAA 4YVNA 3HEIB 3OD3A 3JT2A 3OM3B 1A4AA 3FS9A 2BW5A 1XMEB 4GYBA 1W6LA 1AG6A 4AKPA 1CYXA 3FU8A 4NERA 1HAUA 1KYAA 3NSDA 1GYCA 2FQGA 3GXUB 4F2EA 1J9QA 2R7EA 1AZRA 3NYKA 1GSKA 2VM4A 4DPCX 3L45A 2AZUA 2VM3A 1WS8A 4JHUA 2HX9A 3N2JA 1CUOA 2WO2B 3OMNB 2UX6A 2YAEA 2A3TA 2PPAA 3FQYA 2XV3A 1PMYA 1SHXA 2CCWA 5TK2A 3AG3B 3UABA 1ET7A 4GP5B 4W9ZA 3AG1B 2BZCA 2IAAC 2IDQA 1CYWA 3EF4A 3WNIA 1AAJA 2JKWA 3NJJA 1NTDA 5FC9A 3FSVA 5I6NA 2HZHA 9PCYA 4GY4A 2UXGA 1RZQA 2DWSA 2RACA 4ENZA 4G71B 1BYOA 4DP7X 3UGEA 1SDDB 3NT0A 4W1TA 1ASQA 2XYBA 1OCRB 3PLYA 3KW7A 4HCIA 4DP6X 2YARA 4K9JA 1NIBA 4L0PB 1ASPA 3BVDB 2YXVA 3QJSB 3X1GA 3NJLA 1M56B 2CAKA 2DY2A 1ETJA 4DP0X 1JZJA 1NWOA 2DYSB 1SJMA 4UAHA 3MBWB 2BWDA 4EF3A 1AG0A 1E5YA 4PAZA 4WKXA 4YSUA 3DKHA 2QT6A 2UX7A 1J5CA 1IBZA 3S3CB 1AZNA 1SFDA 4AKOA 1KDIA 4TXVB 3NSCA 2VSKB 3NJGA 1AS7A 4G7RB 1JZHA 3IBOA 1WS7A 3UAAA 3DIVA 4BXVA 2YXWA 1NPJA 1ZIAA 1PZBA 3SQRA 3SBRA 3WKQA 1PCSA 2H5UA 1T5KA 1KCWA 2IWFA 5I6OA 4HZ1A 1OE3A 2YQBA 4QLWA 2PCYA 4N8UA 3ZX1A 4HCGA 3T6WA 1QNIA 3QJTB 1AR1B 2BP0B 2B3IA 2QPDB 2PPDA 7PAZA 3H4HA 2UXTA 3GDCA 3PAZA 1L9OA 3IE9A 2GB2A 4YSAA 5I5JA 1GS6X 1SF3A 3ZBMA 4A2HA 2XU9A 4DPBX 1WA1X 3QJQB 1QLEB 2IWKA 1R1CA 2YAFA 3AG2B 2VW4A 3ERXA 3T71A 1N70A 2EILB 2FT8A 3ABKB 5B1BB 2PCFA 5I26A 1BYPA 2XX0A 2XVBA 1L9TA 2B08A 1MG3C 3FU9A 3X1FA 4A68A 8PAZA 2J5WA 4G72B 2EIMB 4JKNA 1XB6A
chains in the Genus database with same CATH superfamily
2WBJB 2P8LB 2BZ7A 5CBEA 3GBLA 4QNPE 3EYOA 2MOQA 1AC0A 3CLWA 5LG6A 2YPLD 2Y1YA 3BN9C 1TEGA 3HZ3A 1WLHA 3QG7H 2WTPA 3O0RL 4LBAA 5LG1A 2IDTA 1GOHA 5ISZD 3IBEA 4XP6L 5JPMB 2CCVA 5F1NB 3A0OA 3QJFA 4F1SA 3CFJA 3EGXA 3FONA 1UYWL 1ID5I 4NKIH 3U7WH 4GB9A 3SGDI 1DJHA 4MA1C 4JO5A 2FH8A 3DRQB 4PG2C 1F8TL 2EH8L 4HJJH 4ZT1A 2J5LC 1UQSA 2VRAA 1MHCB 3AC0A 4G6KH 4NRZA 4WV1B 2JKIS 1YC8A 5GS0C 4X8XA 2WMPB 5DHDA 3UP1A 4GAGL 2HH0L 5JYMA 3QRFM 2QQNL 2NYKA 4LLMA 1UWGL 2MCPL 5LLIC 5FA4A 5PCYA 5H4YA 2VZVA 5IFJA 3KYOB 4ZS7L 3W9DB 1KN2L 2XKNB 3BGAA 3QH3A 1NDMB 3NVQA 4MS6A 4FQCH 3GEFA 4BINA 4X6EA 4PB9L 5HHMB 1JDDA 2IEPA 4R8WL 3W39A 1I7TA 2VIRA 4OI9A 3HLAA 1OCWL 5D2NC 1XFPA 3EGDB 1UB5A 2B3RA 4DWHA 2N7BA 2RFXA 2VDRH 2OZNA 1KBPA 4NZUL 1F97A 1Y07A 4CUCA 3CBJB 4AVJA 4WO4B 4FQQB 5EU7C 3O2DL 2JCCE 1GMEA 4OM1L 2Z92A 2X42A 4Y4FA 1YAIA 3VQ1C 4Z3JA 2W38A 3JUYA 1GOFA 4N2OA 5E8DH 3CFBA 5HGDA 4KTDH 3OXSB 3TVMC 3EHBB 1AGFA 3D3VD 3AU0A 5HHOE 4XCYB 3GTTA 1E3ZA 5EZLB 4S0TD 1FYTD 2Z7WA 3GHPA 1ZDSA 3NJIA 1OALA 5CP7B 4FFVD 1Q90A 4ERSL 1N4XH 3WIFB 3FFCD 1U2HA 2ZKWA 1NL0L 5E9DD 4KZEH 1GZPB 4L37B 3ZDXB 2BRQA 1G9NH 3RE0A 1PD6A 2PF6A 4PI2A 4TNVK 3FOMB 1DN2A 1Q0EA 3T0DA 4BRJA 3VG0H 3KPSD 4CC1A 2KBGA 4ODXB 1DJGA 3PWNA 4Z18A 5MEQA 4YK4B 4H1LB 4KHXL 2W65B 3OV6A 1NCOA 4XMWA 4HLZG 1XL6A 1VFUA 3UACA 1QRNA 5IQNA 5ADOL 4JFDA 3Q6GH 4NN6C 4BDVA 1Z7JA 3ZHNA 3FQ4A 2Q8AL 1V5JA 5MI0B 2BIHA 1CE1H 3SOBL 4MTMA 1DJSA 2KC0A 2XNAB 4LSSL 4PW3A 4DOHB 1HZHL 3UBXG 1BA9A 2XQYK 2UVFA 3A6BL 1IGJA 1FC2D 4IBSA 5DRNB 3U79A 3QNFA 3NUKA 1YECL 4Y5XB 3IGKA 2A99A 4Y1AA 1RPUA 3HHSA 2Y22A 2E9BA 4P3DB 2WVVA 3CFKB 1HU8A 4ODVL 4P4RB 3N1FC 4MJ6B 2PYEB 2MJWA 3RVVD 3CFNA 2J6EA 2DBJA 4UMGA 4M6ML 5GGUA 2QDWA 4UZSA 2DL2A 2Y7QB 2IH8A 4KTEL 4P23A 4IOSD 4JY4B 5JW4M 2Q76A 4KKBD 4JM2F 2OKMA 1CIDA 3FBQA 4MXVF 4ATWA 5AW3B 3RWHB 4P2RB 3IDMA 5DWUH 3L4WA 2AQNA 1G7MA 3KYNA 4RDQG 5TFSL 2CUAA 4AYEC 1FZKA 2BP8A 1OGAB 1JRHL 4N0CD 2HKHL 3FW6A 3MNVA 3EFDL 3TZVD 4OLEA 5C9JB 3MRCA 3EIFA 5IESL 5C70A 4OLYL 4DCQA 3QWRD 1EUUA 4W6XB 1N0LB 3DI2B 2Z31A 5HYJD 1P5UC 2KZ1B 2WLHA 3NFPB 1E0OB 2F08A 4UBDC 1A1NB 1G4RA 2QV4A 2XN0A 3AREC 3Q01A 3TA3C 4MKTA 1FVCA 4MJ2A 1JUFA 3E1ZA 1EXUB 4F8OA 2IXQA 3HBQA 3BPNB 2W0PA 4FP8H 3RIKA 5HHNA 4OLWL 1HAWA 4KXZH 1KYOJ 1CD9B 2E56A 4PP2A 2YMXH 1CLOH 4XMUA 1RHHB 4QAWA 3RI5F 2AJ3B 4NQCA 4UNUA 4CMMB 2FECI 3CC1A 2Q6WA 1MPAL 5CR1A 3OKNB 5FGCE 2HT3C 5EN3A 4X4KA 3P3TA 3KL3A 4I3RH 4JRYA 4ZBJA 3GMRB 3JV5A 2HT2D 1YEKL 3S3PA 4A7GF 2XPGB 3V4VL 1PLAA 4GUQA 1E43A 1Q0XH 3ZDZB 1BQUA 1AIFB 5KOVC 4HS6A 2X1QA 3AABA 3GSQB 4FQXC 2V3FA 5C07B 5DJDA 3EBIA 2Q7YB 1D9KB 3TFKC 2BO0A 1E8YA 4L9DA 5HDLA 1TVBB 3JV6A 1EEZA 2FO4A 2OLDA 4XXWA 4KY1L 4BQ6A 5I0YA 4M93B 4X0KB 4YDKL 5C71A 1P7HL 5HYSA 5B38G 4U6VL 3CXDH 1EWHA 5D72L 5D1ZD 4NO3B 2DDQL 3PG2A 3L6FB 1VGKB 2D3JA 5DJZA 4ZFZA 1HJBC 1JGUH 2VMCA 5EOQH 3OC5A 5IT2L 1X5XA 5ANMA 3QJFB 3CFJB 3DV4B 3EGXB 3EDKA 3ARDA 3I3DA 3IT8D 3BKJL 5DSCB 1RIHL 3PP3H 5BS0E 3MRDA 1PGRB 3BAWA 2J8UE 1HKLL 1UQSB 4GSXA 3H9SD 2Y06H 5MERA 4C4KO 3WNJA 1EHKB 5L2JA 1LTXA 1WFOA 3GINA 1UXSB 4WVRA 1IAOA 2AQSA 1FO0A 2CO6B 2DW5A 4L4VB 5T3XD 4KPHH 5IOPB 2GITA 2V7HB 4FMVA 4LLMB 1UGKA 1X7SA 5FA4B 2X6MA 3NAAH 2FGZA 4L5FE 4LHUA 5C0ND 4FQ1L 1KBBA 3D0VA 4TSBL 2A6KB 4RQQA 3GMOA 1OP3K 2Q3AA 2XI9A 3IFOA 3AB0B 1MIML 2IWGA 2H1PH 5FGBA 1NKOA 3RFZB 2H2PD 1GVIA 1I7TB 2VIRB 4LARH 4QHUB 3HLAB 3LKNA 1DVFD 3HAEG 1BF8A 3H2PA 4FXGC 1DL7L 1S5HA 4HS8L 3LS4L 4NX0A 2RFXB 4XVUD 3D4ZA 4KNSA 5E0FA 2QHLA 1I85A 1UATA 5KSAC 1R47A 2MCG1 4NC0B 4F8LA 5JHBA 2E7MA 2DTSA 2ICEB 3M88A 3V95A 3CFTA 3ZKXB 3E7JA 4PR5A 4E41D 5D7IF 1CBVL 4FTVA 1NCTA 4WWID 2KUTA 2QKIC 3CFBB 2VDLB 2CDEA 3TO2A 1BEYL 1EAQA 1R0AH 1N8ZA 1G6RB 2JWYA 2UY7B 3DV6A 3HI6L 3R06A 4OW6A 1DQQA 1AGFB 5T5FL 2ZKYA 1A4KB 2J88L 4OF0A 4OIFA 3IAGC 4QXTA 1JNNL 4TNFA 4DUWA 4PJGE 3BP5A 3QUHA 3SODB 2QQKH 3QDMD 2DQCL 1HHGA 4N3UA 4DQOH 1A4AA 2HN7A 2R2HB 1RUML 2YPLA 3SY0B 2BNRE 3LH2H 3GKWL 4MBRA 3AWGA 1AXIB 3FU8A 1LO0H 2DLGA 2DQIL 2I32A 5ISZA 2RHEA 5DD6A 3MROA 3CDFA 5H2BA 4FRWA 3K3QA 1U58A 3D06A 4JDZA 3O4LE 4S1QH 4UM9B 1TJGH 1H5BA 2YPKB 2G75A 1CGSH 2LGNA 4O2EB 4IMKA 2VDLL 2EDYA 1CD1A 1QFOA 3OKYA 1G6RL 1JNLH 1WAPA 3IDYB 4M6OH 4S0HA 4ENED 4ZOBA 1QRNB 2KQMA 1VFOA 3AS3A 4IRZH 4PRDA 1NCDL 2V3DA 5HHVL 4F8PA 1M2VA 3MXVL 1MCRA 1T5WA 4PB0H 1DEEA 5FO7A 4JFPA 3VI3E 4L48A 3ZPDA 2J1ZA 3VA6A 4X0NA 3ZE2E 4P49A 1MCEA 35C8L 1SYVA 4M7KH 3VD9A 1HSBB 4FA6A 4H8UA 3B7UX 2DMGA 9PCYA 3DURB 4ZTOL 1IGCH 2PMZA 4YUEL 4ALAC 1NBQA 5IB5A 1MAKA 3QI9B 4B9PA 2R0KL 1DQMH 3TBTA 3HHSB 3MV8B 3V5HA 2OK0L 3GSWB 5FIEA 1NCCL 1WDAA 5A2CA 3L1FA 1TCMA 2WVVB 4JG0H 5GHWH 4K9JA 1G1YA 4N2AA 3CK0L 2EACA 4XC3H 3UL4A 4PCSA 4OUUB 1KFAH 3WKYA 4GQPH 1XEDA 1D7BA 4LCCC 5L9DL 4MQSB 1MFCL 4FJ6A 3MUGB 1T6VN 3MUHL 5M94B 5JOFA 2DJ4A 1JZJA 1KXQA 1EEYB 1GHFL 2Q76B 4J3OG 3D3VA 4PAZA 4WKXA 5F3FA 1XCTA 2NY1D 1GYVA 2VLRE 4QY8B 4U31A 2J6WA 1FYTA 3VGFA 3N5AA 4GRLC 4AYMC 5JPNB 1YN6B 2Z6FA 3NJGA 5FUCC 1MRFH 4KUCF 5AW5B 1ZLUH 1VPOH 3FFCA 4HUKB 3DOSA 1FZKB 1TJXA 2MSPA 1QPKA 4JFOB 5E9DA 5AVXB 1TZ8A 4F33B 3RWDA 4MRCA 5BNXD 4HF5L 4MAYB 4POZD 1VEPA 2ESVE 8CGTA 1K5NA 3JTTB 4WLCA 3VD5A 3GJFA 3KPSA 2VKXA 1ND0A 3UBGA 3C8KA 4F57L 2HFFB 4TVPE 2Z31B 3H6JA 3PHSA 5DO2C 2FHBA 4LPYA 4N8UA 1C5CH 4NQEB 2WXOA 2XTJB 4ELKA 4HIXL 5I1EL 5H37G 3D18B 1XH3A 2JCCF 5IJDC 1E4KC 4KUCD 4TS6A 2IXQB 2MH4A 1D6EB 3TF7C 4AEHL 3GDCA 4JDTL 4GSRA 1BPVA 2VRKA 1VADA 1IE4A 3QO0B 4KXZI 4MA7L 4YSAA 5BUPA 1CFVL 3FH5A 3BAKA 4JJ5A 3TNMA 4IKLA 4BFEA 2X4QA 2VW4A 2HPTA 1OAJA 2V8MA 1ZY9A 3G9VA 3NGBC 3F7YB 4KMTH 1AQMA 4UT7H 2C34A 2IAMB 2QVMA 4XX5A 3ARDC 3WIHA 4JRYB 4IBUA 3L3KA 5I0DA 2V2TA 4ODTL 4LCYA 4C47A 1FAIL 2FJGB 3FUJA 1JPFA 5F8RC 5HPMB 4XBGA 2X6VA 4GUCA 2PO6C 4JGJA 4NPYB 2ZF9A 5JIIA 5JTWA 3NIDB 2DWDB 2CRZA 5DJDB 1KTKE 5HHOD 3OLDA 1RZIB 4IOSA 3NK4A 2V5RA 5CO1A 3TESA 1EEZB 4I3GA 1TR7A 4YLQT 4FABH 2H26A 4GQ9H 4EQ2A 4PJXB 3DUUB 2W8CA 1E30A 1TQCB 1QSZA 2E8ZA 4MAUL 1ID2A 5B3JE 4RAVB 2O93L 1OAQH 3VWJB 3VFSB 4HIEA 3CQFA 1ADQA 4Y16A 5L88H 4Y2OB 4JKMA 4K3GA 1TF4A 4H20L 5GJSL 2RTTA 3EW3B 4HKXA 4TQIA 5GGQL 3CCHA 4UAOC 3TZVA 3DIDA 4G5AA 3BSZL 2XG5A 3PWPD 3MRDB 1QA9A 4JM2A 3ESOA 5K39A 3DI3B 3HZYA 2IJ0C 5HYJA 3IYLW 3MJ9A 5ENWA 4LLAA 4FCAA 4WU5B 5MERB 2XA8H 4AGOA 4ZUSB 2EEXA 3C6LD 5ECJE 2APVA 2WXRA 5CZXC 3DVNB 1C5BL 1B2WH 2HRGA 3MRBA 4MA8L 4MNGE 4EI0A 3MJWA 3NCMA 1FN4A 3DO7B 1NIFA 4CVXA 3PGFH 3NCJH 1BZ7B 4W9CC 2J4WL 4LHUB 1E50A 2YAQA 3GMOB 3V7AG 1BF5A 4WI6A 4KH9A 3ZTJG 4JHAH 3B37A 1CLYH 4UCFA 4HJ0C 2NY0D 1S5HB 2OMWA 4JQIA 3VO0A 2CLZA 3DA0A 4OZIE 3GB7B 3QR2A 4QRUB 5CSGA 5J1AB 4PJ5E 4OCNC 3JQOB 5I23A 4MDIA 2OL3H 2PP7A 1RZPA 4WO0A 1TZAA 5D4IA 3EJPA 4DKDC 3U4BL 5A7EA 1DQQB 1AYOA 5DC2A 4B3EA 3D8MA 4QXTB 3BP5B 3N41B 4XMPL 1HHGB 2WANA 2XZQH 2F74A 2HN7B 4LSQH 1H15B 4BK5C 4S1SL 3SPJA 2IFFL 2Q9OA 4A7GA 4PRBA 1HZLA 1PQZB 3AZUA 1CLZL 3X1BA 1W16A 3CZSA 3QHZH 2JKXA 1U8QA 3HB3B 4G80A 5CP3H 1JGDA 3EYSL 4H5SB 4ZQTA 4UB0H 2VGLM 4TUJA 3RWFA 2FX9L 3ZHLA 1H5BB 1KLUA 2JQZA 4J3SA 2W60A 5CJ8A 1VHPA 5CN1A 5FKPA 3OKMA 4HK0B 1RJYA 1YUKB 1NAKH 3H9SA 2VR7A 5IKCA 3OJ2C 3VM5A 4Y5VC 1A7OL 1TETH 4ONFH 4RFEB 4YGVA 3AITA 4JFPB 4HZLA 2GHZA 4PGDA 3UBXI 3PDGA 2JIXB 2QBWA 1SYVB 3S8WA 1KB9K 3ZO0A 3TH2T 4P5MA 3L9BA 3GHEL 2FX8H 4FFVC 4YHPA 4E0RB 3P9LB 1F58L 2ARWA 2OTUB 5IB5B 2EO9A 2V5MA 1MCKA 1UA6L 4IOIB 3GM8A 5JORB 1QO3A 4KRLB 1DVFA 3V5HB 3FSAA 4D9QE 1O75A 2XFXA 3GZOA 3SKNB 1I1AB 4XP4L 2PW1A 2BZDA 2NX5B 2G5UA 1KTDB 3ET9F 3LEXB 1IIKA 4N85A 3S98A 1QSFD 3C2SA 2C5DC 3EJQA 1NEZB 3Q2LA 2GSMB 3PWLA 4GO8A 5DS8A 3MCLH 4MB1A 1KB5H 1YLBB 1HIML 1C12B 1WBXB 3SE4A 3UTSE 5C08B 3WDIA 1FL6A 4D7PA 2OX5B 3K6SA 5JOFB 2V17L 4FF9A 1CK0H 2J8UF 4YHYB 1A6VH 2YEZA 4K9EH 3WY1A 4EAEA 1XGTA 3MX0B 4TF4A 4GIAA 1I1FA 2B1HL 4NCDA 1MW3A 5IQMA 3QDMA 4XBPA 4CC4C 5F89B 3I6SA 4J39A 4X50A 1B9KA 3ZZSA 2XETA 3BE1H 3QCVH 3LZFH 3MJ8A 5E9DB 4KKLD 3CSYA 3IJEA 1BZ9B 2WXHA 5D7IA 4NXKA 4Z3GA 5J13B 1K5NB 2F5AL 5BO1L 5FAAA 5EF1A 5BS0D 4XH2A 1TKWA 1CXHA 4J6RH 3RZWA 3SSGA 1ND0B 3RVVC 3WY4A 5DEZA 3C8KB 2Y07L 4JRXE 1JZEA 1EGJL 1XCXA 1YNKH 1DVUA 4DIXA 5HY9A 2ATKB 2KPWA 3K6FA 4OTXL 4XVJL 3A4FA 5EORL 3RY6C 2I5YH 2Q8BL 4Z8FH 1M6OA 4IDJH 4KKBC 4OSUL 4AENB 4G8IB 4PN6A 4XC1H 5J9PB 1AKJB 1HOEA 1WBZA 4ETQB 5C2BL 4LQFL 2CA3A 4JJ5B 5EHFA 3ESVF 1LE9A 5D93B 4MJ4A 4K8RC 3TNMB 3OAZK 3JWNH 2TSBA 4ZX4A 3TBVB 4YX2L 2AQ1A 3QORA 1S7TA 3G6DL 3K6NA 4HXBL 4BFIA 5I17A 2FWLB 2XYCA 2IPTL 4OCMC 4JG9A 4D9LL 4GXUN 2YUWA 4LCYB 1ZLSH 4FNPA 4Z7QE 4EIGB 1HK6A 3T0BA 1FDLL 4Y9FA 4QHNB 3V6FA 2BMKA 5TF1L 1R3HA 3ASOB 3FRPA 4FQJH 4B0MM 4JPWH 4FNUA 1U36A 1SN2A 5D4HA 4G6MH 3UYOD 2CM5A 4PVMA 2B1OA 2DQ6A 2FAUA 3NPZB 3ZQWA 5EULV 1E5CA 1WAAE 3ILPA 4QI3A 2H26B 3VI3F 2F8XC 4M4RA 4CJ0A 4K5PA 4FQHA 3FTWA 4PJDB 1ZJAA 3ZE2F 3IMUA 2Q0ZX 3QUKB 4RETB 1JZ3A 2WLLA 3PUCA 5A2FA 3ABLB 4NWUL 4Y16B 1B88A 4GW4B 5JXED 3ZE0B 4UDTA 4ESKA 4QHMA 3HPLA 3O4LD 1L3NA 4NUMA 2VMEA 1S3RA 2HT2C 2LFGA 3HPJA 3ARGA 3BSHA 4GIPD 3PE9A 3VD3A 3JVGA 4OLZL 4ZODA 5INDB 4B9JA 5E2VL 4C56B 1QA9B 4JM2B 3T0XA 5ACZB 3HZYB 1EZLA 5HYJB 1JBJA 2EIKB 5ENWB 2C26A 1CB4A 1KACB 1DQVA 3JWOH 4ACTA 1DBAL 2BFVH 1THAA 3WUWA 5J6HA 5E5MA 3UJIH 5B8CA 1ETB1 1VA9A 1FNGA 1FN4B 2D7OA 2WBWB 1VKXA 4NHUA 3W56A 4Q2ZB 2OYKA 3ZUNC 4CVXB 3FQRA 3K7UA 5SV4A 2XSKA 3R1GL 4UQ3B 1DBMH 3OKDA 5D1ZC 3DOIA 4Z78A 3BPCB 3NZ8A 1O9ZA 2ZXAA 2E7LA 2ATAA 5BW7C 2E6PA 4H0IA 4YFLF 4AC4A 3FT2A 3WSQH 3T2LA 4UOZA 5K1VA 3FC8A 1WUNT 1L9PA 2AJXH 1QEWA 1QHQA 1KN4L 3BH4A 4TQ8A 3FN3A 3LH8A 3ZE1E 2PKDA 2E9JA 4RMVA 3FUNA 5L4JA 2JCCA 5DFTA 4YVNA 3W0WE 2ENQA 2OMNA 4GW5B 3KPQB 3CFUA 2H8PA 4XN7A 5IFHH 2C9AA 3RDJA 1UVQA 4G6AD 3BDYH 1GC1C 3ZL4L 2B7DT 1AHKA 5HHOA 5LBSH 1C16B 4G8EA 4LEXH 2NUTA 3P2BA 2R7EA 5DD5L 3ARVA 2WZAA 4PD4J 4AGQA 1NLBL 1OK8A 4CVZA 2AS5M 1W2KT 3N43B 1XHHA 2CZNA 2H6PB 2VM3A 1ORQA 1KUMA 3MGAA 2GYSA 3HI5L 1HWWA 4JZNA 5C09E 1CUOA 3L3OA 3VH8B 4PRBB 5IB1A 1XF4B 5D6DA 15C8H 1U8QB 2QTVA 4HJGA 4L8SB 4AG4H 1X4XA 5SWZD 1YEIH 1CTOA 5IHHA 1FCGA 3AG1B 3KJ4C 3VM7A 2VE6B 4EXPX 4F9LA 3BKCH 3ETSA 3U1SH 3OKMB 5CD5D 1W72H 3SE4C 2GTZA 2UXGA 1AI1H 4L8CA 4APQA 5JHDD 3L17A 4G71B 1MOEA 4YGVB 5D71H 4BCZA 3AROA 1Q1PA 3FTVA 1NUDA 3OLIA 1S78D 2ZUVA 1HYSD 2WXNA 4K73A 1EJ8A 4L0PB 4L3CB 4BH8B 4ICWA 2P5EE 1YC7A 4YHPB 3PPEA 1QZ1A 4XNQB 3F5WB 5C0CE 4TULL 2J20A 2NTSP 1S7WA 5KVMC 4HIHB 2VLJE 4YIQB 1KIUB 4XPBH 5DRZB 5B3JF 4WEEA 1NWOA 2XFXB 3VI4E 1KIRB 2ITEA 1HWHB 1IEBA 5SWSB 1RP9A 3WU1A 1DDHA 1JK9B 4RIRB 1NMAL 3WXVH 4N8CH 1P6FA 3C8DA 3PWLB 4AKOA 3MODL 1YYCA 1QD0A 1VZIA 2C9RA 2WC7A 4JLRA 1JZHA 1OK0A 3N0AA 4G11A 2XICA 1FL6B 4ABWA 3VW3H 2QZ5A 3G6JF 1ACYH 1JGVL 4OFPA 4XB7A 4YE4H 4EN2A 5FW6A 2YEZB 1XGTB 4R84A 1IQWL 2HLFD 1T4KA 2XC8A 4ZMTA 1I1FB 5DMIL 5DMJB 4R7NB 3PHQA 3WO4C 4QO1A 1B4TA 1OE3A 1R33A 2XWEA 5KYWA 4TRPL 1H3VA 3ZKSD 3ZTCC 4B9ZA 4N8VB 3WFZA 2B59A 1RFDH 1H19A 3HR5A 5D8JH 4A2LA 1QSEB 4OD3H 1PKQB 2O5NA 3CBRA 3MACL 5D7IB 4M3JA 5DZLA 4XH2B 1L9OA 2ZSVA 4RRPA 3SDDA 4Z0XB 1JF6A 1A47A 4BZYA 5CXPA 3M1OA 3I6GB 5MEPA 4OZIF 3ERXA 2NY7H 1H0DA 3ZYJA 1VDGA 5CZRA 3MLSH 5KVFL 3V0WL 1FH5H 2GJJA 1M9SA 4R3SA 1TQSA 1IAMA 2XVBA 4XP5H 1DBJH 3O3UN 8PAZA 3B2MA 3MBED 4OJFL 3GSXA 1JHLH 1IC7H 1WBZB 2HJKB 2NY1C 3MBXH 1AXTH 1KLGA 1S9YB 2J8HA 2EZ0C 2X1XR 2O72A 3NG5A 4AJVA 1Q72H 3EH4B 3VNYA 1T0NA 2JKRM 1FVEA 3QORB 1S7TB 3D52A 4H8HA 3U25A 4POZC 1IJNA 4DW2L 5I17B 5DD1L 3CN4A 1K2DA 5F3BA 4R4NC 4YR6B 4PJ5D 4L2LA 4J3TA 5FWQA 3RWIA 1NMBL 2HFGH 1QSFA 2Y2WA 4O9HH 3GZKA 3QJOA 7CGTA 3ZKND 3FCSA 2E3VA 3BQVA 4PY7A 3FRPB 4KOCA 4JEGB 3MMEA 1I8IA 1JD7A 2DWTA 1J05B 2YQGA 4WKZB 3MXWH 5FR3A 2O61B 3D2UB 3EOYG 1NBZA 3STZA 5L6YL 1SEQL 4XP6H 1A2YB 4M4RB 3LSOA 5ICYA 3LB6C 1WISA 4HAGA 3O6FD 1XAUA 2AJUL 4ZMNA 4OCLC 5IHUL 5DZPA 2DLFH 2I07B 4HG4K 5EIQA 4G9FE 3U4EA 2EH8H 2N01B 1KG0B 1WFMA 2YKLL 3ESNA 1R3JA 5FGRA 3HPJB 3S34L 5BS0A 3ARGB 3WS6C 5LCVH 4TQEL 1XR8A 2J8UA 3GM0A 3RL1A 1A4BA 1DQDL 2BVQA 2EEAA 3UZVA 3D39B 3CXFA 2QQNH 1XIWB 3V6OE 2MCPH 4HSAC 5DUML 1JYWA 3TNNB 3NPSB 2NY6D 4WTZA 1KN2H 5FV1L 2VXSH 5E5MB 3COOA 3HRPA 5KUMA 5E0QA 5G2NA 3SOTA 4NHUB 1KTBA 2ZYRA 4E5XG 3FQRB 4U1LB 2XLLA 4U1NA 4Z78B 4GSDH 3VCLB 3MC0A 3NZ8B 1GRWA 3KNBA 4YO0B 3DTXB 1UJ3A 3FT2B 4GS7C 4NAQA 3ML9A 5TQ2H 5LDSA 3BP7B 3ZRSA 5DVLA 3QULA 4OM1H 1KCVL 5HDQH 2BDNL 3V0JA 2R8SH 4PMEA 2XQ0A 3QEQB 3BFWA 4IGBB 4YHNA 2JCCB 3ULUD 3DSNA 4XAWH 5B1CA 3B2DC 3ZZLA 4F9LC 5FK9B 4U6YA 4RFNB 3IU3A 3SCMC 3UTSD 1BJ1H 2H8PB 1ZXQA 4HQQH 2XQBL 5F44A 1QBBA 3C6LC 4PGCB 5ID1A 5LXGH 1E5AA 2DQGL 5BV7L 2BIIA 1A6WH 2F0CA 3EYFB 1IT9L 4E9XA 2NUTB 4PJGA 3PHOB 1NL0H 3F6IA 2R7EB 1FLRH 5TGBB 4CSSA 1X7TA 2DQUL 2BNRA 5D2LE 1JCVA 3RWCA 3EBGA 4JZNB 3RUGE 3HC4H 1OW0C 1KELH 3L3OB 5F9OH 5IB1B 1DANU 2A73B 2NNXA 1RIVL 2NTFB 4GQRA 2HA1A 1UT2A 5JXEA 2NY0C 3O4LA 4KHXH 1G5GA 4UTCA 5LDUA 2HMID 4HGMA 2X4NA 3CDCA 3DRTB 5I1JH 2CUHA 4JRXD 1E3FA 1K6QH 1OGTA 1QI3A 4PW9A 5FGSA 5AEAA 1J5OH 2NSXA 1KULA 1JFHA 2Q8AH 3EGSA 4Q6KA 1I3VA 1A3RL 2G3NA 5DK3A 4YSQA 2P5WE 3UAFA 2FJFB 3LHPL 2CDGB 2GTZB 4OZFA 4R83A 4QUOA 5DR5L 2NQCA 1ZVSA 2WQUA 3VI3A 4LSSH 4APQB 3JSSA 2EE2A 1A7RH 4CU8A 5D96B 1IUZA 3AWEA 5EOCL 1R3KB 3SE6A 1UCBL 2FVNA 3QFDA 4Q8BA 2FEJA 4LL1A 4Y2DC 3K71B 4ZG1A 4DN4L 5D7JD 7PCYA 4H1LH 4OKVA 2EDFA 1USZA 2H3NA 4MMXA 3K4DA 1WAAF 1RZKL 1XH2A 4HIIB 3D05A 5EUKB 4RMWA 1OLLA 1D2PA 3NJVA 1V05A 3VRIB 2EDDA 2VRQA 5EUOE 5CM1A 5LKNA 3I2CH 5C0GA 4CW1B 2PETA 5AW4B 4M6MH 1KCUL 4J23A 4U49A 3RZCB 5T1KA 3E2HB 2UZYA 4DPRA 4KTEH 4CILA 4EUPB 3RNKA 1ZLWH 4I0PD 3II1A 4JLRB 4X4ME 1LO4L 5I9QB 3GSUA 1MJJA 2VSMB 3S5LG 3UTTE 5GGRB 1A6UH 3KD4A 4K7PX 2WN3A 5TFSH 1ZGLA 1OOAA 1BWWA 5FYKL 3GIZH 3S4SA 2XWZA 3PHQB 2HKHH 1MVYA 2ZXEB 4K2UH 4Z7VA 4HUUB 3EFDH 3FTZA 2BY0A 3IN0A 3SKUD 4PJ8B 1R75A 4OLYH 2ESVA 3HR5B 2NY4D 5F8QC 4JY5L 2ICWI 2IQ9L 1Z0NA 2VT0A 3TJPA 3WNMA 4XNYL 4O58L 1QYGL 3SDDB 1TJIH 1ZANL 3V7MA 4NGHH 3EOAB 1H3WM 1UZGA 2GSIA 1FGNL 5EPMA 4UQAA 3KHOA 3ZE1F 5IIEA 5MEPB 5FO9A 1DSYA 4YSSA 4YAQA 5JHDA 3QHFH 5CN2A 4Y2DA 2OXHB 3BAXA 4R3SB 4UILL 5HVFB 1IKNA 2ZNXA 3CZLA 5D55A 1AHWB 1QFWM 4KUZL 3ZKQD 2J57A 3HNTH 4XCNB 4GPVA 2ZNWA 3GSXB 2VL4A 1IGIL 1NCUA 5ANHA 2YFNA 2PPEA 5GZOC 1DP0A 1TO5A 3CUPA 5EBWA 3QEGL 2G4GA 3WGUB 4AKQA 1ORSA 2J21A 2LTQB 3B2VL 3G5YA 4BFRA 1PFOA 5FGCB 4ZPVA 1YEKH 2M8XA 3PNRB 2OV0A 4KKPA 1ODUA 1FVEB 1RULH 1YY8A 2AZAA 3OKOA 4WFED 5T3ZD 3BLPX 1CICB 1W8EA 4LSUH 4DZBB 2P8MB 2QTEA 5FOBB 5F3BB 3W0WD 1A6AB 3L08A 1OEZW 1SY6A 1NMCC 3RWIB 2HCZX 4KKAD 3HN3A 3SKOA 3TYFA 4JE0A 1E28A 1DBKL 4NFBA 5ICXA 4DVRH 5D1XC 4PYHA 2AJVL 4KY1H 1S7XA 1BFOB 1K3IA 2C9QA 2WWMC 3V4PA 2WUBH 4BQ8A 3MMEB 4WW2B 5LHDA 1P2CA 3ZW3A 1HHIA 5KG9A 1WCQA 3B2PA 3CU7A 1RUPH 3MTRA 3MA9L 2AANA 4PSRA 1N5YL 3US0A 4AMWA 2IGFH 3VJ6B 3LSOB 3BHBB 5GRJH 1EZVY 5C09D 1HOCA 1KBVA 1U6AL 4LGRB 4MJ5A 2GBVA 3OF6D 4LSRL 5DI8A 1II4E 1NCIA 1UJ3C 3BKJH 2AAVA 4G6FB 3NIFE 3T8VA 5TDNA 5TE4L 2HKFL 1XGQB 4S2SB 1DCLA 3L95B 3M46A 3IGAB 2GC4C 4BFJA 2R0ZH 1ZTXH 2J8UB 2UY6A 3OMAB 4C83A 5T1DH 3ZL1A 3KS0J 4P59H 3VI4F 1BDYA 2I85A 2ZWSA 2VNCA 4IMLB 4OU3A 4H40A 2ZAIA 4GKLA 3CHQA 3PGDB 5JYLA 4MNGA 3WY2A 3NFNA 5C92A 2Y7NA 4LKXB 2NYYD 3MBEA 1OCZB 1UG9A 2CALA 3FO1B 1OP5H 2P5ED 4HUWA 4JANA 4JGUA 4DP9X 4JZJA 4NQSB 4D0CB 3UC0L 4DESA 5FHBH 5CJQL 1CDGA 5B39G 5C0CD 3QJZA 4Q6IC 3Q2CA 5CBAA 3LQZA 4Y2NA 1AG6A 1CFTA 2DQJL 1CDJA 4FQPA 3HE6C 3S88L 3BGMA 2EVGA 3GUFA 4HUXA 2V2WA 1T5XB 1RUQH 3B6SB 3Q5OA 4OZIA 2VN6A 3KPOA 5BVJA 1ZSDB 4OAWA 4DGWC 4LESA 4PJ5A 3FU5A 1BV8A 3CMOL 3NZHH 2HRLA 1BEYH 2QLYA 3S5YA 3MOBL 1E5BA 4R4BA 4U6YB 3IU3B 5T5FH 1DQJB 1JF1B 4JHUA 2V2XA 3QG6A 4HFWA 4UDUB 3CN3A 2AEPH 4GIOA 3CWGA 2ZE0A 3DBXA 4I1NB 4MS8D 1PYWA 3ATFA 4EBQL 3FH7A 4YDNA 2CCWA 3GKWH 5TK2A 3UABA 1IC1A 3BAJA 2J5LB 2CHXA 2DEXX 2BZCA 4JO4L 4LLYB 1IBHA 2BNRB 4HBQA 4UMSA 1AGEA 1H6TA 2KI6A 2JI3A 3UO1H 1KGUA 1U92B 3FULA 3O6FA 2A6DB 4KK9D 1CGXA 3RGBA 4X5QA 3SPHA 2ZP9A 2DWSA 2IH1A 3BWAA 4IIQA 2VDLH 4M1CC 3AXLA 2AJZA 5CCGE 4QMEA 1G6RH 3BC9A 1TQTA 4GSQA 5F7DA 4ZUWA 1VCBC 3W3BA 4TNVF 5DCCA 1NCDH 2OYLA 3KW7A 1OGTB 3O8XB 1JN6A 3VMNA 1M7UA 3EGSB 4YDLB 4LRIA 2OR9L 1CE6B 3QFJE 4V1DE 3IDNB 4J3XA 4G6AC 4YNYA 4FS0A 1D5IH 3VFOB 3ZE2B 4F37K 3O6LL 2A2QT 2DD8H 4HWNA 4ZTOH 4YUEH 4B9GA 5GS0L 3LKSA 3EOBB 4HMEA 3QFDB 4BFBD 3IDUA 3GRGA 1IM3B 1SMOA 2F7QA 3MJGX 3Q48A 2ADIA 1NCCH 2F53D 2RCSL 5FHAL 1J0IA 3MZTA 3NSCA 4PLJC 3IK2A 4QD2E 2FE0A 3TCTA 1IM9B 3WN5A 1KPUB 1NPJA 3ESPA 4Y7OC 5CJXA 3WFEH 5L9DH 3ULVH 5C0GB 3Q3GB 3LOWA 3QQNA 3L81A 1A7PL 5T1KB 1DEDA 3ZGIA 4NDMB 2IF7A 2Z91B 4HFUL 1JXJA 1IKFL 1PEWA 4EOWH 3UTSA 4XPGH 3RNKB 2YQBA 2K70A 1NLDL 1N59A 1SJHB 1TJMA 2G2RA 5K9OA 2H1XA 3P40A 4YHLL 4OVUA 1MNUH 3GSUB 4IK7A 5BXFA 4J3UA 5KYUB 1AFVL 4JHWH 2VLRB 1S78C 3RWJA 2C4FT 3H4HA 1HYSC 1SDYA 4FMFA 2GB2A 3JV4B 1JRHI 3T2OA 3EBAA 2XU9A 3GLDA 1G7LA 5C0BE 3T09A 2MCMA 2RAMA 2J6EH 3N42B 1BBDL 1R1CA 3UTZB 1U8NA 4MZIA 4G9FD 3QDGD 4X5WB 1YG9A 2ESVB 2W0KA 2X0WA 3QQDA 4U1IA 1SLXA 4L05A 3X1FA 5CU9A 4OJDH 4JRXA 1Q38A 1AY1H 4HIXH 2EXWC 5K9JL 5I74C 4AYSA 4DZ8A 4LF3A 4OZHB 3K8LA 5EPMB 2APSA 4JDTH 2E27L 4RAHA 3N3EA 5IIEB 3LEVH 1QASA 4GEJA 3WOVA 1U8KA 4GG8A 4YAQB 4F9PA 1KC5H 3MBWA 1MWOA 1AD0B 3WFHB 2HLFC 3QYNA 1JL8A 3D30A 3QAZC 4CRPA 3EG9B 4QTIH 1D5BA 4JFFE 2KYIA 1ZIBA 5D7JA 5E6YA 5BRQA 3VX1A 3W9EB 2ICCA 5EWIL 3G5YB 4UV7H 1MN4A 2E46A 3P02A 3GSNB 3D4YA 5D2LF 2G9KA 5ABAA 5DRXA 4FULA 2P4AB 2X4TB 2ENSA 3RUGF 1Y1UA 3MV11 5LGHH 3H6AA 1MFVA 3R7QA 3AT0A 3TYFB 3POHA 3IJ8A 3MGOB 2EE0A 3S37L 5HHQA 5C97A 2BSDA 5HD8D 4I0PA 4P48A 2GUOB 2K3HA 4OIIL 2VDOB 4O02B 3V4PB 2KS0A 5DS2A 3O45B 2F5BL 1TJHL 3LRMA 1HHIB 2CJ3A 1ROWA 4R0LA 1WAAA 1U8MB 3T4AC 3AU1A 4Y4KD 1P5UB 3GSNL 3IMRA 3KHQA 4HHWA 4KJWD 3NZUA 4X7FC 5DGQA 3VD1A 3BGFC 3L3JA 4H20H 3EO1B 4MJ5B 2BC4A 3TA3B 4UF7C 5D7SL 1T3FA 2CO2A 4GI6A 3FQXA 1M7IA 5I6XB 5F7BA 2BIPA 2XZAH 4AEIL 3ASNB 1CGVA 3RX5A 3T1WA 4POUB 3G6JB 4XMLL 5E2UH 2UY6B 2P5WD 4O02L 5EUOF 2GIMA 3SE8H 3O0LA 3ZTDC 5C0JA 3QQ3A 4MA8H 5EDSA 4EZMA 2VZ3A 1R19A 2VZUA 2KMWA 4PJIA 1JXFA 3RGVC 2XXGA 5HJ3B 2FEDC 4MNGB 3IPBA 1UZ8A 1X44A 2OMUB 4JM4H 3P11L 4J3OC 4OH2A 2UYLB 4KY2A 5A2IH 5KWYC 5EO1B 2APTA 4BELD 3LXBA 5E6ID 4JZJB 2I24N 2ZUXA 4FQXB 3IDJB 2KZWA 4G1MB 5CBAB 5C6TH 5B21A 1CFTB 1WFUA 3KLHC 4R9HA 3OKLB 2WP3O 1A4CA 3KWVA 3EO0A 4HUXB 3BD3A 3VXOA 3L8QA 3P30L 3U6XS 3PCYA 4OZIB 4RMUA 4NO5B 4M00A 5BVJB 3W0WA 3MUY1 3VDBA 3WTVA 1U8IA 2QADD 3NCXA 2DTML 4KU1A 3KEDA 3SDCD 5CMAB 2ZX7A 3WAKA 4JG1H 4LRIC 1X7QA 4B27A 4GW1A 2IALA 2X2YA 1T89A 3QQ4B 4LBEA 1LO5A 3MA7A 4HFWB 4GAFB 1NOFA 2X9WA 4ZPTB 3DBXB 4MD0B 1PYWB 3GHBH 3A6CL 4S1SH 3SBPA 3VG9B 4DKFL 4N0UE 5EU5A 1CU4L 1NICA 1EK3A 3TXAA 3CXHK 1E6OL 2BJMH 1HX0A 5E00A 3FL7A 1BLNA 1J5DA 5C09A 5FDWA 1VFBA 3OF6A 4FKHA 1MFEL 5ICZB 1L9QA 5AOMA 4L8BA 1BGXL 4PBWD 4DEWA 3BWAB 4PRAB 4Z76A 2YK1L 2ATPA 4UQBA 4OQTA 4ZUWB 2XWJB 4OUOA 1L0QA 2HTLD 3OAUH 3ULUC 3V4UL 5J11C 3F62A 2Y3NA 4UV4H 3APFA 1NCGA 2UXFA 4P99A 4EE2A 1FE8L 4FXGB 3GKZA 1LEIB 5C0FA 1ZGLM 3GHEH 3G5ZA 4H25B 1F2QA 2D4DA 4WJG3 5I73C 3V5KA 5KSAB 3BRFA 3LKSB 4LIQL 4KFMA 1UA6H 2EADA 3RNQB 2P5EA 1I4FB 3SHSA 4YOKA 4QYOA 3B5HA 2O26U 4YHZH 2ADIB 5C0CA 3FJTA 4KGLA 4AMKH 4U7SA 1LXMA 4UTBA 1KJMA 2VAJA 3KLQA 5AYQA 4O2CB 3WN5B 3VI4A 2HMIC 3BPOC 3V0EA 1KT2B 2QSCH 1KY6A 1CJYA 1NGXB 3G7TA 5DU7A 3NIFF 2V17H 2VDNL 5TDPA 2X4RA 3N1GC 4OCSH 4FFZL 1A9EA 3O2VH 3S36H 3GXDA 3TYGH 3IVKB 1N26A 4E9RA 2WLIA 3CZUB 5HHXL 3KJ6L 1NFIA 2B1HH 1FUNA 2G2RB 3F7VB 4JN2B 5K9OB 3BIAX 3H0TA 1IIIA 4RZKA 5BXFB 2MEJB 3BO8B 4ZW8A 1URIA 1KJ2B 2DAVA 2BVPA 3C60D 3OAWA 3V52L 3RWJB 2GEQA 1AHMA 3WLWD 4KC3B 2EICA 4U3XA 2DQEL 4L4TE 4LHJB 2HRPL 5D7JC 2J44A 1WC7B 5DJXA 4AQOA 3MRQA 1UD2A 3SYCA 2F5AH 4LPCA 3FT3A 5JO5A 3FN0L 2GK0A 3T0WA 1KLFB 4DP2X 1FFPB 2OCCB 4U1IB 1EGJH 3BIKA 4IRSA 1I31A 2C4FU 2F7OA 5JOPE 4NJ9L 3O9WB 4PJCE 4XVJH 1KEMH 1E4XL 2WQRA 3IJHA 1JWMB 5F97E 4LP4A 4X6FA 5DZVA 2XY1A 4LF3B 2EVJA 2D73A 5K9QG 1KJ2L 3DDGA 2D3NA 4QRSB 1O7SA 4G5ZH 2VQUA 1MFUA 3TIEB 1WIUA 1EHLL 1G9MC 2PTTA 1PKOA 2CIIB 1HS6A 2R4RL 3HNVL 2WQVA 3HRZB 3B9KD 3KW8A 3PJLA 4LCCB 4NO0D 4AEFA 3RJQB 1QBLL 2L7QA 3LNGA 5T5NG 1JWUB 3N1QC 4OCRL 4LLQA 4H88L 5FUOH 3O4OC 3U6RB 3QUGA 1R17A 3DX0A 4D9LH 2APWA 2JV6A 2P7TA 5DHVA 3BUDA 5C3TA 4ALAL 4PS4H 1FDLH 2P5PA 2OJEB 3MRPA 3GLAA 4OGAC 4GRLB 1GIGL 4NHCL 5I82A 3EYVB 2Q3ZA 4D0DA 5CEXB 2ZXBA 1FFNB 4AQ8C 3DUHA 3KMDA 3K8MA 5ABZA 3WAJA 1GPOH 1G7QA 5JHLL 3UFIA 4LPWA 1OLZA 4BA8A 5HDOA 5GZNC 2XQYA 3I9AA 5DF0A 4R0LB 2ODHA 1QR1B 3EJSA 3WIHH 4CSZA 1NA8A 1EHAA 2NXYD 2DN7A 2GBUA 4O5LL 1WZMA 3IDXL 4GLRH 1T22A 1AJ7L 2R0WH 5KVGH 4P57B 3L16A 4ZK8A 4C4BA 1I75A 2JFCA 3N40F 4G9FA 4OLZH 1UWEL 2DV6A 3X11B 1LNUA 5CWSA 2XN9B 3H55A 5DUJA 2XWTB 2EIZB 2IOOA 2OP4L 2BSTA 4X8JB 5T1MB 1RIUL 4KKAC 1RVFL 1JI2A 3QFJD 5DJCA 3V6OA 3QIBD 1QWUA 4V1DD 1NGWA 3QQ3B 2DBLH 3CX2A 3MRFB 3QEUB 2ITCA 4N90D 4Q52A 5IZ7A 2JJSA 4N1EA 1ADQH 3BWSA 1UZ8B 1ZVNA 5K59E 4AGLA 1GYCA 1UM6L 4TSCL 1IBDA 3MUZ1 4UTAA 1J9QA 4NNXB 3TIDA 4JB9L 2CMRL 2TRYA 3ARFC 5JMRA 5I8OL 3FO9B 2NNAA 4ZAKD 2Z8VC 3D34A 3MJ9H 3CFEB 3L4VA 3I9GL 1T21B 4NEHB 3EO0B 3ZVVA 4YL9A 4XXCC 1RUKL 2LV4A 2IBZX 2PPAA 2WTRA 4PRNB 4JDEA 2X70B 1SN5A 2XV3A 1ZS8A 3DHMA 2Y7OA 4G8FA 5ETUA 4XP9L 4H44C 3AT9A 4KQ4H 1BQHA 1CYWA 4HLEA 1O7VA 4GW1B 4OLUH 2Z4QA 3SY6A 2X89D 1CN4A 1KCSH 1LO5B 2CXKA 3B43A 4GY4A 4ZTEA 3BT2L 1GSMA 4LCIL 1YVLA 1UM5L 4L4JA 4UAOB 3DHPA 1EBPA 1MDTA 2NYYC 5ILTL 1FO0L 1QBML 5EU5B 3PLYA 5D2LA 4Y4KA 2MMXA 1XTMA 3GLEA 1RZJC 2ADGB 4LSTH 1MELA 2WM0A 3RUGA 1K5WA 1XEUA 1VFBB 2ZXGA 32C2A 1DJZA 5ALBL 2EYRB 2PXYD 2D2CC 3QZOA 3X1GA 5C0AE 2VR8A 4MX7B 2AK4B 3SJVB 1I1YA 1JPSL 1U91A 2CU9A 4UAHA 1A7QL 4EF3A 3LKPB 4P4KC 2E6JA 5F6IC 3CHRA 4U1MA 2P5WA 3BUIA 3TV3L 1UADC 4J27A 4MDJA 3B7TA 1IBZA 4JN1L 2NW3A 4W9IC 2EXTA 4KK5C 5C0FB 3RVTD 1MW0A 2F9BT 1TEYA 3DMMC 5J56B 1PZBA 3DJTA 2QV2A 3SN6N 4JFFD 5BOJA 2BX5A 3EDJA 5E6IA 2Y5TA 4J1UB 1ZHLA 4KRPD 5FECA 4KKRA 3LYRA 1E2VA 4ZYKA 2VWEC 2PWGA 2VLJB 3HMWL 5EUOA 1QR4A 3VI4B 3F8UB 4A7VA 3GC3A 5LGJB 3MODH 2V37A 5IB2A 2QPDB 2PPDA 3MRNB 2HT4C 4BFNA 3RX8A 1UD5A 1OF2B 1I9RH 4HGKC 4IRJD 4PRPE 4X4MA 5IBLC 1E42A 2X7LA 3SDAB 2WLIB 3UTTA 1LK3H 3JWNE 1BD2E 4XVOA 1B6DA 3FO0L 3VXQA 5FKAA 2WTOA 1MG3C 2VOTA 5I0ZA 4TRPH 1I1RA 3BVXA 1UOKA 3EYUL 1XCQA 5CN3A 3FRUB 2ZKHL 4B5EA 5CGYD 1WSST 3EH2A 1XZ0A 4Y5VB 3MACH 5IF0B 3TJHC 2TAAA 3FT3B 5F7AA 5JO5B 2GK0B 1PX8A 4U33A 3CJJA 1XF5A 2EJ1A 2WXJA 3BIKB 4IRSB 1TENA 3RL2A 4HIJA 3O11B 5IMLA 3KE0A 5KVFH 3DK2A 5I8KL 1CFSB 1HXKA 4X6FB 3QXUA 4PWEA 1CMOA 4NT6B 4KKQA 5DC0A 3FHEA 1T1YA 1I9JL 1DVZA 1OAZH 2XVLA 2DYPD 3BP6A 1LMKA 1TVHB 1IB5A 5JUEL 2YEVB 3G5WA 1MVUB 2E74C 2OMXA 4WWPA 2VW6A 1ADWA 1ZV2A 1IC4H 4UU9B 1P7KA 3RTQD 1M71A 1VF5C 2YR3A 4XODA 5DD1H 4A67A 1G0XA 2BRRL 1K9TA 3HG3A 1JF5A 3MNZB 4P9HH 1NMBH 5KBMA 4HHAA 4J8RB 5IEHB 2YD7A 4F2FA 1FNEA 2OBGA 1Q94B 1IO4C 1L0XA 4JFHE 2D8KA 5DJYA 3C6EA 1IAKB 4YVUA 5EC2B 5I8EA 2AXFA 1GCYA 2BVYA 1G7QB 3HZKA 4LXFA 1J5IA 4QRQA 5AVWB 4UOW1 2LHAA 4WIQA 4AGPA 1FIGH 4PLOB 1SEQH 4ONHA 8FABA 3C5ZC 5L6YH 3HI1A 4BSWB 4AZUA 5D1QC 3ZMEA 1K8DB 2C1PB 2ZUQB 1NFAA 3C60A 4P05A 3RVUC 4JFUA 1D2OA 1JZFA 3MFFA 4JO2H 3GS7A 2HJLA 5B3SB 5CEZH 4WWKD 1T22B 1FGVH 2NT1A 1JGLL 3DX8A 4JPKL 3KG5A 2DIBA 3FU3A 1AZBA 3S34H 1KGJA 1A02N 5AAWC 4G9FB 5FF6B 4FDWA 1FWXA 2I9LA 3IDGB 5EFIA 5EMYA 1BECA 1V7NL 3ZYIA 5JNYB 3S8GB 2K45A 1EJOL 1EO5A 4WNJA 3Q05A 1WZ1L 3L7EA 3L2LA 2R15A 1RURL 3PHAA 1FHNA 5DJCB 4PJ7A 3OLGA 2VZOA 1MDAA 1AR1C 1A1OA 3U0WL 4I18C 3IKCA 4UUJA 5HD8C 2MNJB 2EUXA 5E8EA 1AYRA 5DK0A 2IPUG 3ZT5A 1DYZA 1OCOB 3WTYA 4WJ5A 4NYLB 1NGQH 3GFUA 4W81A 3B9KA 3QXAA 1ZHBA 4KJWC 1EPFA 4BSVA 4OJYA 2R39A 4FL4C 4DGYL 2A6IB 2BDNH 2RQ8A 4B3VA 1ROCA 5BOZG 1HDMA 5I66B 3IFNL 3GWJA 2AAAA 2OSXA 5AUMA 2WLZA 6TAAA 3V9CA 4K8RL 5I76B 3JTSA 3MRRB 2Y2YA 4W9FC 3C09C 12E8H 4Q0XH 4JQXC 4NM8L 3VXMB 1ZS8B 2HFEB 1JG9A 4UT9A 2FBJL 1UWFA 3LPGA 2DM7A 4CJ1A 1GYUA 3MLYH 1BQHB 3PNWA 4HOXA 4XB8A 1IT9H 2Z4QB 3DARA 1BYNA 4PJCF 3L2NA 4CN1A 4U1SA 4JAMB 2F7RA 3BJ91 1OB0A 3KVQA 2MCAA 1O6SB 1UACH 2IC2A 1U8PA 5E4IA 4XWOD 4KROD 1KTLB 2KLSA 3MLVL 3DIFA 1T66C 3K0YA 4UM8A 4WHYG 5E6IC 4RMRA 3OHXC 3LRGA 4X99A 3SYAA 5I1CL 1AIZA 1RIVH 2F54D 2FIKB 3AY2A 5MEND 3S3SA 3E38A 4WY7H 1BBJA 3RUGB 3PWUB 1F42A 2DQDL 5E95B 1JIBA 1ZWIB 5ITFB 1U21A 5J1TC 3K0WA 2V9QA 2YWYA 3FH8A 2PWEA 3VFNA 1A3RH 5JOPD 1I1YB 2X2JA 1U91B 3ZMNA 1MCFA 1YN7A 2JELL 2QADC 1BG9A 1S9WB 2N4IA 2EC9U 4JQIL 3SDCC 3RDTC 3H1ZA 3QFJA 1IGML 1FL3B 3QIBA 2J8OA 3NP3A 2WQAA 3KXFE 4M29A 4PJFF 4V1DA 5TQ0L 3I85A 3MJ6A 3FU7B 1UCBH 4RFOH 1I8MB 3SGKA 1BVZA 3CZKA 2WNGA 1GAFH 2YC1B 1OTSD 3QNXA 3D5OF 2A0LC 3T1FA 3QUYD 2X88A 3UZQA 3T77A 2XUWA 4X5RA 5I2IA 4DH2A 4U1JB 3MRMA 5HI4D 3QUZD 4OF8A 1EV2E 2ZP0T 3C75A 2E86A 4CVUA 1CDHA 1ZHLB 1DJIA 1L6XA 3C5JA 1IILE 4ZAKA 4MB4A 4I2XA 3UTPD 4JK0D 3MV7E 2JK5B 5EUOB 4JO1H 4Y19E 1AACA 2BSSA 1JV2A 1M57B 3D85D 2OMYA 2HTLC 1QQDB 4AYGA 4YHML 4N6RA 4PIBA 4Q14A 1FPTL 2XV2A 2Z3FA 3BQUC 1DQLL 4G83A 4BKLB 5J6SA 4H1LG 2VDKL 4XBMA 4I5BA 4MA3A 3UTTB 1IL1A 2YXFA 3E9UA 1TQVA 4HIQA 4QGTA 1G7IB 2J1WA 3VMPA 3VXQB 3KJ4B 1LK2A 3LTVA 1GC1L 5CILL 5ERWA 3R19A 3Q5TA 2N0KA 1CDYA 4HH9B 2H32B 3H3PH 1NAML 2Z9TA 5C0BA 4A6YB 1JXDA 2ICWJ 4TUOB 4J4PD 3QXWA 1TTCA 1XZ0B 2O6EA 5K59F 5F9AC 2YKKA 4PTTA 4EUPH 1GJWA 3P4NA 2FZ3A 2GCYA 4Y9GA 1ZANH 2PXYA 4N2MA 2A4CA 4LOVA 1BREA 4E42A 2W59A 5DEJA 1WWWX 5IJVA 4G8GD 4XNUH 5I1GL 5K9QI 4HIJB 4OZGE 1GYAA 1T03H 3EOTH 4UILH 4HXAL 3RB7A 4KUZH 1C1EH 4XP1H 2L7JA 1PNCA 2AKRB 2YAHA 5KANI 1IGIH 2H4EA 1T1YB 4IU2A 4QHLB 3R8QA 4A6YL 2OTWB 2P80D 2JQMA 5DFWH 4AGNA 3QEGH 4I77H 2IVFC 4XNAA 1EXGA 3B2VH 2QMKA 1IJ9A 4JFFA 3OLEA 3WLWC 1JZ8A 4GG6E 1M71B 5C7XH 1WPCA 3Q43A 4P46D 1HH6B 3FB8B 1BJ8A 5BZWA 1ZV5A 1G1KA 5I16A 3V9FA 2MHAA 2X09A 3NCWA 5EEWA 3MRJA 2EDRA 4HEME 5EU4A 1DBKH 2OM5A 1E9QA 3CHXA 3OB0H 4H7VA 3T0VA 3NJMA 2AJVH 3MYJB 1A22B 5HJDA 4XCEA 4FXTA 2CBPA 4M9OA 2OQJA 3MLUH 4J3OF 2ALWA 4MAZA 2BY2A 5FM5M 4DVBA 1L3WA 1SHWA 3IB4A 4IRJA 5DJYB 3F00A 2NR6D 2QL1A 2D0GA 1Y18A 3J8F7 2C3XA 4FQ2L 4HC1L 5IY5B 1N5YH 3ARBD 3M8OH 4ONHB 8FABB 5PAZA 1G9NC 2BVOA 3HI1B 3DGDA 3VTMA 1F4XL 2VQ4A 1E8ZA 4LSRH 5E2JA 2GJZB 3V6BR 1YNTB 3I02A 5IMOA 1J8RA 1U8HA 3RY5A 1BLIA 1M1XA 1A14L 3DX8B 2JH2A 5D9SA 2FTAA 3D6GA 4AC2A 1KWKA 2HP4A 4X80L 3VGHA 1DE4B 1IV8A 2CRYA 1UD4A 5C0AD 1NC2B 3TV8A 5BRZB 3AXIA 3W82A 3VWKD 4ZO9A 1SYSA 2R29A 1HAUA 1O9VA 4ZD3L 1B0GB 3L7EB 5FW7A 1WUZA 3ARTA 1XH1A 4U7MA 2BS8A 4KJQD 4M4PA 4IJ3B 3WTSA 3NABL 4RISL 5BZXA 2WZPD 1PD0A 2BY1A 2X1WL 4UUJB 3WKMH 3EFOB 1TYJA 1OO2A 2VXUH 3FQTA 5E8EB 2VISB 3UC0H 5IOKA 1X5IA 2X6AA 4K71B 5CJQH 2DYPA 3IMBA 5DLMH 4WJ5B 5AB9A 4F5CE 3S88H 1OSEA 4TOYL 1JPST 3RTQA 3UTOA 3KYKH 3DX6B 1BAFL 2NY2D 3KM1A 4BSVB 3DBSA 2BLFA 1VZHA 3IJYA 1MHPL 3KEHA 4F8QA 4W4OC 1QFWL 3FSVA 1W15A 4IRZA 4MSWA 4XNZB 1FCCA 4JL2A 2VAAA 4QGYA 3WEOA 2WWKO 5BRPA 3MOBH 4I9XA 3ZDXE 1BYOA 1X5FA 1CXIA 4L5FH 3AAZA 1P7BA 1U8OB 2E7CA 1HI6B 2OXGA 3QIBC 4KVPA 3H9YA 2YPVA 4EBQH 4AXWA 4U6HA 5EU6B 3T6QC 1T83A 3BVDB 4AJYV 4JPSA 5KW9H 1F0LA 4L1SA 3U30B 1XWVA 4ZTPL 2OCFD 4U1SB 4U6TA 4N0UA 4KMLB 4MWFA 1OQXA 4XBEL 5DUPL 4NN5C 2BP5M 1W91A 4WNQA 4WUUE 5IVNA 5SX4H 4ELMA 4P3CH 3ARQA 1MNNA 4JZOB 1DFXA 3BWUF 3E8UH 1FSKC 5IBTH 4WWKA 2YGNA 2PCXA 5INCA 1GJUA 5I0VA 5F3HB 4AQ1A 5BOPA 3WV0A 4L9LB 4M7LL 4LOUD 5HI3D 5C6WH 3MRGA 1YUHB 2L7EA 3LRSA 3UAAA 4KK8D 2OR9H 4QRRD 3CSFA 1X4YA 1W0WA 2A7BA 4N0YH 4LSVL 3SQRA 1MI5D 2FYYA 2H5UA 1MHEB 1OPOA 1T1XB 4GS7B 1C8QA 2E9WA 2IWFA 2R2CA 5HYFA 2PYEE 4NKOB 1MCWM 1E9OB 2ITDB 4WSJA 3HA0A 2A77L 2O6PA 3DSFL 1UD6A 2PCYA 1HTYA 5AOZA 4MMYB 2X4SA 3T1FB 5HXMA 4IJTA 3T77B 3T6WA 2B3IA 4K7FB 1HJCA 3EJCA 3SCMB 3N91A 1BSIA 2V9TA 4LLWB 4YXLL 1P4IL 3US9A 3PDOA 3L9EA 2YD2A 3F84A 4GRMB 1OSPL 3U36B 5F7LB 1NEUA 2IWKA 3INUH 2DF3A 2CNYA 2PXYC 4TUKL 4AL8C 3CZFB 3HG4A 4HK3J 1B0RA 3LN4A 1JV2B 2OJZH 3ZU8A 1WT5C 4JFHD 1LILA 3BKYH 4JHZA 4YHLH 1MFDL 4N2GA 1DJXA 2XRAH 3ROLA 2EKSA 2W94A 3L54A 1J18A 1WWBX 1NC4D 2B4CH 1ZK5A 2NXZD 5AW6B 3T0EC 1FRGL 4I5BB 4K5LA 1KGYE 1IL1B 1NIAA 4DJMA 3LPWA 1A6ZB 3OQRA 3GEWB 5EU3A 1Q0YL 5E8NA 5TK4A 3VVVA 3KLAB 4G6JH 5C0BB 4KRPC 1UXLA 2F54A 2JB6A 1X5JA 4NSKB 1RJLA 4E36A 2VLKB 4G42B 2GKIA 1M7DA 2YRZA 3P4NB 2FZ3B 1ZT1A 3T6XA 4F2ME 4LLDA 2XXCB 1F1DA 4X98A 3MSPA 4Y2DB 2BIMA 4KZDL 4PJCA 3RYMA 5IJVB 1ZHKA 2W0FA 3TCLB 3D69B 2PPFA 4ANWA 1THCA 5AKTA 2Y5QA 4YFEA 1QTPA 4XZ4A 4LOEA 3M17A 3WJLA 1FHGA 3FB6B 3G3LA 4IU2B 4K3EL 4NKMA 1FZOA 3E6FA 1GGYA 1F02I 1T1ZA 1OARH 3VD2A 2AXWA 5C07E 4WUKL 4CNIB 3F58L 1INEL 4I4WA 3ZUCA 1HCYA 3QUZA 2VUOA 5GS2H 2OMZB 2BXYA 3E6HA 4NQVB 4TVPH 4LKCB 5CGYC 1S7QB 4Y5YA 3CDGA 1O7DE 1OT2A 5A6MA 6PAZA 1RJZA 2VM9A 5I16B 4F8NA 3QUXD 2XV6B 3BRDA 4ORGB 1DUZB 3MRJB 3QNYA 1LD9A 1U93A 3WHXB 3S37H 3D85A 5TE7L 5FO8B 3FK3A 4LPXA 1WHOA 1KCLA 4OIIH 3R4RA 4P0DA 4HGWA 1R5WB 3GXFA 3NCYP 1TJHH 3VGEA 4DO5A 2WINB 3OAYK 2R1YB 3U0PA 3QWOB 2WKGA 3NTCL 4TQPA 4GEIA 3KAAA 3GSNH 2FD6H 1YMHB 3U4AA 3T2NH 3CXHJ 5A40E 2XWRA 1FFQA 2NLJB 5D7SH 1LDSA 1CURA 2EIBA 4L4VE 3MLRH 5BMFL 4JM0A 5IMOB 1IEHA 2D3VA 4ZDHA 3TO4C 4J4PA 1YYML 5TPWH 3WN6A 4MJJA 4CAGA 3FTUA 1NGZB 5L4MA 3KPNB 1BMGA 2XWXA 4KTYA 2VDOH 3HG1D 4O02H 3V4PH 3WNOA 4X7SL 1JJUA 4M43L 1KJVB 1SYSB 4GMTL 1EX0A 2EIJB 3OG6B 4MQXD 5KOMC 5E23A 5E6SB 3GMLA 4JQVA 3AQZA 1NM4A 3P11H 1J8SA 5AG9A 3S8FB 3ARSA 2RA1A 3CAFA 2OMTB 4X4YA 2WJ7A 3G6AB 3KR3L 4URTB 1BIIB 1T7XA 2YMTA 2G3MA 4PHZA 1T2QH 1NMCB 3EH3B 3SBWC 3OC8A 5CP3A 3GO1H 1E8WA 2VR5A 3WLBB 5D1XB 4I3SL 1J10A 3P30H 2WCSA 1OB1A 3IJYB 5KVEL 2BK8A 4N2CA 3MR9A 1KIPA 4QXUL 1W0VB 4G82A 2Q10A 1BXUA 4Y19D 1UUNA 1I53A 2YAOA 4MSWB 3N1MC 4GSUA 3MLWH 2GC7C 4G7YH 4G7QB 4GINA 5E8OA 5AZEH 2WGNB 2GHWB 4MD4A 4L3FA 3UBXB 5FDYA 5F7EL 4HJIA 5LJYH 1GZHA 3SQOH 3SKJH 1USQA 1ZK9A 4HUNB 1XDTT 4BQ9A 1N5AA 2NR6A 4N8PA 4U6HB 1QLEL 4X5LA 3WJJA 1AQDA 2R9HC 1JGEB 2A9DA 3DGGB 4OZGF 1CU4H 5KAQG 1IGYA 1NJ9B 4ANXA 3N50A 1U3ZA 4KHTL 3ARBA 3NA9L 2EDXA 2D03L 2HVKA 4J3WA 4N0UB 5I30L 4ZMLA 3L9RA 4NPJA 3QIUC 3TN0D 1AS6A 1MFEH 2W9EH 3CTTA 3OG4B 5EZIH 1QUNB 2YD1A 3DHJA 5BUAA 3FAXA 4AX3A 4LCUB 5INCB 4LHUG 1U8LB 4B53A 3R8BB 2BSED 3M86A 4D94A 1KB5A 1KXVA 2XZCL 3NCFB 3BUBA 1J0YA 3EO9L 4Z9KB 3MRGB 5C0AA 4GG6F 4R26L 4N3TA 3NJXA 3LV3A 3S3JA 3VWKA 1Z9LA 1QLRA 1N6VA 2IPUK 4ONOA 2OW7A 4PP1C 1YMMD 3JUZA 3MV8E 1W0WB 5HVHC 4Q6IB 4Q9QL 1A3ZA 4XCCL 4ZFGH 1QX1A 4CVWA 2OTPA 1N2RA 5ES4B 2F15A 3K8KA 5E5UB 2VH5H 3HE6B 1H3PL 2WZPA 4X8GA 2BWIA 5G5DA 3NACL 4EDXA 3RWEA 3KGTA 1HHHA 3LIZA 2F1BA 2O5ZH 3BH8A 3PV6A 4EDWH 4XWOC 4NUQA 4XPTL 4F37F 1Q1JH 5AW1B 5T1LD 4Y9EA 1QEXA 4XNMA 5CEYB 2YD8A 4FFYL 2WBJD 3UIZA 3PDOB 1QNZH 2CD0A 4B60A 1E4HA 3NFSL 5DVPA 1HL8A 2A74A 3D0LA 5C0RH 3WD5H 1BZOA 2E7BA 1Z5YD 2AV7A 3HG2A 3IF1A 3TS8A 1IFHL 1RCYA 2O6CA 5DFAA 1OAYH 2IH3B 3ZRCC 5IEKA 4DTGL 5JQ6H 1NH6A 4GKSA 4PRPA 1P6WA 4JREC 3ROLB 2EKSB 2YQ2A 2IDUA 3HZMB 1DLHA 2BWQA 1BD2A 1L0PA 4ODWB 2DQEH 1FZMA 2NUPB 4KGJA 4DGVL 1ET5A 5LUMA 1A1MA 2CLRA 1Q9LB 2A6JA 2Y24A 3QUYC 4NQEE 5CD3A 4TL4A 4LDCA 3V0VA 1A0QH 4L4TB 3QUZC 1DZ0A 3FN0H 1E5ZA 3O41B 1B4JL 3HG5A 4NUJB 5F0PB 3RP1A 3BEVB 1MFAL 2JB6B 4NN7C 1INDH 2YAPA 5LQBH 1M7DB 1PDKA 1S8DA 2O6FA 1VZGA 1WAEA 1ZT1B 5HHMD 4GUPA 1KGCE 4JFWA 3JT0A 3BMVA 3QA3A 1CDBA 2WXLA 4OCXL 3AT8A 2Z8SA 5B38B 1KJ2H 4PJCB 3I50L 4Z7OE 4CU7A 4I1PA 3THML 1ASOA 4XOAA 4QHKI 4UZGA 4XCFL 4WO4D 3ZDXF 3GS4A 3HNVH 3WFDL 4O00A 2P28B 1RZ8B 3UG3A 1LEGB 1V54B 1K4DA 1KJ3H 1YSOA 1FZOB 4LRNL 4NKMB 1TU2A 3E6FB 4OCRH 5GIRB 1RK1A 2GSGB 1BVKB 1N6QL 3EHBD 2FATH 2YEQA 4QDGA 4PCYA 1VGEL 1XD1A 4ALAH 5H4ZA 3GXNA 3CVHB 3EH5B 3BT0A 4G7SB 1B3IA 4Y9CA 1GIGH 2BOLA 4UQCA 2ZX9A 1FNSL 4X9HA 2FT6A 3DETD 4HKBB 4PJFB 5FB8A 4PV9B 4N0FA 2MIZA 2BCMA 2DEWX 3OR7A 3EJRA 1LEKA 2ZCLH 4NNYB 3UPRA 2SEBB 1XCWA 3TEYA 1BXVA 1BX2B 3L5HA 3OVUB 1HQ4A 1T6WA 4OD1H 3HAEB 1NC4A 3ES6A 1AXSB 3WL9B 1UOVA 3IDXH 1AJ7H 1MCNA 2JJUA 4KXBA 2LVEA 2KT6A 1CYXA 4F58L 5E08H 3CVHL 3A4EA 5A1AA 4RCAA 4YDJA 4LEOB 1F1GA 2AXJA 3M7OA 2UZXB 4FZ8H 3UP6A 1YEEL 3TJEL 3BZFB 3PU7A 2AXHA 1UWEH 1V8HA 2CDFA 4P46C 3GI8L 3U9WA 4MMZA 4HOMA 4EI5C 3NH7H 2JB5H 2F8VA 2XN1A 1GSKA 1OWRM 2VM4A 4M5YL 4DPCX 3UYRH 3TFBA 1ACXA 4X7CC 5C0DA 3SDYL 4PGEA 1RIUH 4GXVL 5GRUL 1RVFH 2WPGA 1X4ZA 3P54A 3N2JA 3OMNB 3QAZB 4O51A 1H6EA 3GTVA 5IK3A 2R23A 5J1SC 4FLRA 3GIVA 5F7KC 3GMLB 3U7YL 2NR6C 2PYED 4W9ZA 3WJJC 5KYXB 2WWOA 1VIWA 3BP4A 4KI5E 2GIYA 5HYQA 5CFAA 1FF5A 4K3JL 3VFUA 5T1JA 4Q58C 4PU2A 4EZLA 3G5XB 4M7LT 3LS5H 2DH2A 4PGBB 3APDA 3M1BA 5I8OH 3Q13A 1PSKL 1M42A 4OCYL 2VC2B 3I9GH 4FOMA 3GD1C 3RJOA 4P2RD 4KXDA 1TZGH 3NCBB 5C9KA 4RMTA 3HE7C 3KYMB 1K72A 3QUXA 1TZIA 2R1XA 3VWKC 2MWCA 1OGAD 4M8QB 3T4AB 5M95B 3ULAB 4EN3C 1YEHH 5CCKH 5E8OB 1EDHA 4MD4B 3OMZA 1RK0B 3B1UA 3PJSA 4K9EC 5DQDL 4DP0X 2F8OA 3BGFB 1MJUL 3WTXA 2WXMA 4XPFL 4ADIA 3ILDA 3WMSA 1N5AB 5K1NA 3T4YA 5ILTH 3CLFH 1QBMH 2YSTA 4OLXH 4IS6A 4WQOA 4PVBA 4LNVA 3KYAA 4N1CA 3F12B 5K9KA 3TBYA 3H2QA 3R7RA 4BXVA 2YXWA 4AM0A 5ALBH 1IC5L 1KYUA 1ZA6A 5GJTL 3N06B 4AH2B 2DMKA 3RGVB 3IXTA 1JPSH 4M9PA 5KSBA 4DQAA 3ECVA 4NQQA 4C54A 4U1GC 1SMAA 5EO9A 3V5DA 1QP1A 2NW2A 2H9GA 5AKSA 1EXHA 3UH8A 1S9XA 3KXFA 4F8TA 3MFGB 4LL4A 1ZLEA 1NCBL 1SVZA 3IE9A 2W9LA 5FCUL 1SLUA 5AOKA 2OPCA 5F88A 5HGHA 3UYPA 3MRHA 3UJJL 2WXIA 1Q9WA 5IM7B 3BH8B 5C07D 3DVGA 4KXCA 4GO6B 5E7FA 1D9KD 4IBTA 1MRDH 4OQTH 1YEDB 1YA5A 2ICWA 2ZAHA 4XGZA 3ABZA 5SWQB 4EZJA 4MCZB 1BG1A 3MV7A 4MVBD 2X2IA 3HJEA 4Y19A 3O3DA 4ZO8A 2WBKA 2A74B 2XVKA 3IJ7A 2RR3A 4A2DA 3VGAB 4QPEA 3IF1B 4G43B 3C5XA 4HWEH 5IEKB 1T7VA 2FJUB 2R1WB 4XPAH 43CAA 1MXDA 2V4LA 2VITB 5GGSB 1U8CA 4PRPB 4BUGA 3I74A 4X9IA 4J2QA 3FO0H 2VXVL 1KGIA 4UTBH 4F27A 3GNML 1BD2B 3H7BB 1Z3GL 2CKBA 5CINH 1A7NH 2ZKHH 3MV9E 2QVTA 3BLBA 2DLEA 2QELA 5BUGA 4L4VD 1UUSA 3FDWA 3MGTA 3TN0A 3WNPA 5J11B 1EMTH 3JWDH 5ESQB 2C1OA 3GTNA 4AMXA 3TEXA 3WNKA 2XIIA 3MLXH 4WU7A 5HGAA 5DUBB 4IEFA 2BSEA 3LMJH 2G9HB 2EE3A 1PDKB 1S8DB 1YDPB 2Y6SD 4M5ZH 4MJHA 1YYLL 1I7RB 1E4XI 1RH8A 3JWOC 1SNRA 4O4YH 5KBPA 4E9SA 3HS0A 1CZ8H 3MPCA 1TMCB 2BP0A 3BD5A 1IMHC 5F0LB 4B9CA 3KWXA 4EO5A 4WI9A 1E65A 1YPZB 1PJ9A 2FH6A 4Q56A 3WTTA 2P49B 3TL5A 3PABA 3ULUL 4IKIA 2DQFB 2VABA 4U1KA 1ZLVH 4L0YA 1Y1DA 3BUYA 3BVNA 3EDEA 3S3DB 4JFZL 5IQ7L 4CKVX 1GH7A 1RK1B 1RD6A 2V5YA 5DA4A 5E99L 5T1LA 2CO7A 4GG6A 3OPZL 2YD9A 5LCVA 1SHSA 2P8LA 1B0IA 1E8XA 3UEQA 1R4XA 3GSRB 5CU5A 3UIYA 4HEMA 4PJDE 2Q86A 3EJYD 5JOEA 5JPMA 2CK0L 3HBZA 5F1NA 5AZUA 4LAQL 1SXCA 3ZE0E 3LN5A 1AE6L 1BM7A 4UM9D 3UPRB 2HWZH 4Q4IA 1HL4A 5FV2A 3SGDH 3ZQXA 5JW5B 1MJ8H 3DRQA 1HQ4B 2CR0A 3O6ML 4C56E 4HIPA 1MHCA 1QRND 4WV1A 5F1OB 4PJ9A 3CVCA 4RZCA 1E9PA 3F05A 1OPGL 1UOWA 2WMPA 4MXVE 4I1RA 3O2DA 3IGLA 1IBFA 2VXQL 3ULVD 4KO7A 1UTDA 2X4UA 3SGJC 2F8IA 1DVQA 4MMZB 4ZOCA 5IB4A 3LAFA 1NDMA 4JPIB 4IQHA 3S6CA 1BZEA 5C0DB 3QI9D 1KXHA 3QCTH 1PZUB 2ZUYA 4UIKH 3WHE1 3WEAA 1MCPL 3FAWA 3MV8D 4JHBA 3EGDA 4JG5A 5D4JA 4FEIA 4BQBA 3ZIYA 1SJEA 1AKPA 2ZUUA 4QWWD 4BZ1L 4WDIB 4WO4A 4WRLA 3BCDA 4OFVA 1AR2A 3Q8FA 2V3EA 1UKSA 4ZO7A 1B9ZA 3L3HA 3FRPG 1OAUL 4DGYH 4F5CA 4NO2A 5E1QA 1WHPA 4ZXBC 3OXSA 1XF3A 1QRKA 3MOQA 5AAMC 4MZ3A 4XX1E 2D4FA 5FS5A 4FA7B 1G9ML 4U4IA 1PLBA 3ZTNH 1AGDA 1NSNL 2K0RA 5CP7A 1PF3A 4Y89A 1MQKH 1F3DJ 2ZJSL 3MI6A 3WIFA 2N3JA 3BAEL 4L37A 5T8IA 5KBNC 5KSUB 2HYMA 1VESA 4MAYD 4MQXC 3PJSB 3U48A 2CO1A 2YIHA 3T08A 4UTAH 2ZT9C 1X9RA 3S7GA 5KN5B 3MLVH 4Z7OF 2W65A 2Z31D 3LKRB 3T3MB 4NQED 5DQJB 4XVTL 2XTJD 3GMMB 5KJRL 4WUUA 5K9KB 2XBDA 2ZWKA 3FB7B 2XXMB 3WUWG 2PP8A 3WDHA 3EFFB 4MHHI 3W11D 3IJSA 1QKZH 1ZA6B 2XNAA 1RMFL 1GGCH 3KPMB 2B5IB 3MLZH 3IXTB 4HJ1A 4P9ML 4AVHA 1JVOA 2AXGA 3OXRB 1KGCD 4N2LA 4CADA 2I26N 2ENYA 5EO9B 1XGUA 4NKDB 4C59B 2YRBA 2IAMD 4WTXA 1QVOA 5T3ZL 4BZ2L 2H9GB 3SPIA 3LD8C 3ARFB 4JRYD 4Z7NB 1S9XB 3UAJA 1ZD6A 2NNFA 3KXFB 3S2CA 2VR9A 4BSJA 4P4RA 5SWSE 4MJ6A 2PYEA 5JXAH 5F88B 5SX5