3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
b'CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
4DP9X 1RZQA 2QPEB 4HZ1A 3AG1B 4AKQA 4Q8BA 2FT6A 3TA4D 1JZIA 3ASOB 2BP8B 3FQ1A 1B3IA 4E9RA 1NIEA 1SDDB 2E86A 5E9NA 3AG2B 4P5RA 2EILB 2XXFA 2IDTA 1MG3C 2UXVA 3BVDB 1W8EA 2BW5A 3ZIYA 3D12B 1OOWA 4DP0X 1A4BA 1WS8A 2IH8A 1OCRB 2B08A 2CCWA 3UAEA 4FA7B 2J57A 1ZPUA 3QJUB 2ZXWB 4DP8X 1MZYA 1PY0A 2DYSB 2H47C 3DIVA 1E5YA 1CYWA 1ZIBA 1BAWA 1PMYA 3FSVA 1I53A 4A2EA 1IBYA 1JZHA 5I6NA 1YLBB 3MX0B 4DP1X 1V54B 4HALA 4M4RB 4PAZA 4A67A 5I6PA 1WA2X 3G5WA 1ET7A 1AOZA 3WI9A 2YQBA 1ADWA 4DP5X 1PNCA 2W88A 4G72B 2VW6A 4HIPA 2AZAA 1BEXA 3H56A 4YSPA 3TBBA 1W6LA 1XB8A 2X87A 4HHWA 5FC9A 3ERXA 4Q89A 4AKOA 1A4CA 2H3XC 3HEIB 2MRYA 3GDCA 3N55A 2RACA 1AS7A 4AZUA 2PPEA 1WA1X 1EZLA 3JTBA 3SBPA 1URIA 3AZUA 6PCYA 4GP8B 3TBCA 3QJSB 5F7AA 4AX3A 1JOIA 4G7RB 1J9RA 4YSDA 2FJSA 1SJMA 3SBQA 2IDSA 3FYEB 5I28A 4YSUA 3S8GB 1M56B 3NJHA 1E30A 1J9SA 2FQDA 4WTQA 2HLEB 2TSAA 4BWTA 7PCYA 5AFAA 1PZBA 1HAWA 2FT7A 2HRHA 3QJVB 3S3DB 3S3CB 4BWWA 4CSPA 2PPFA 2UXGA 2Q9OA 2PP7A 2ZONA 9PCYA 4RH4A 1OCCB 1A65A 2BP8A 4E9SA 2QPDB 2R7EA 2YAQA 3FQYA 2W8CA 3X1GA 1XMEB 1MG2C 4ZK8A 4UANA 2BHFA 2OCCB 2MTAA 2PCYA 2GC4C 1A8ZA 1AZCA 4YSTA 2XUWA 3FPXA 2EIMB 5TK4A 1PCSA 3IBOA 1XB6A 3S3BB 2LLNA 3GYRA 4GXFA 4KOBA 3T6XA 2GSMB 3KW7A 5F7BA 5I6MA 4A2HA 4G7SB 1AZRA 5I6OA 3S8FB 5I26A 1NDTA 1JZEA 1PAZA 3UGEA 4QKTA 2NRDA 1AIZA 2XYBA 1CURA 2YAMA 4G70B 4HHGA 4KNUA 3ZBMA 1JZGA 2PLTA 4WKXA 2IWEA 2CALA 2P80A 2IH9A 3FPYA 4DP6X 2XV3A 4YVNA 1IC0A 4GY4A 1L9SA 1BYOA 1ILUA 1KCBA 1N70A 2GBAA 1NPJA 3T9WA 3AW5A 5ANHA 3X1EA 4CSZA 1TEGA 2R7EB 5D4JA 3QJTB 4L0PB 4JKNA 1PLAA 2XWZA 4YSSA 4A2DA 2WO3B 3QQXA 4E9XA 2PP8A 4UAHA 5AZUA 2PCFA 2VM4A 3X1NA 1KBWA 1V10A 3H4HA 3IE9A 1ASPA 3QPKA 2VN3A 1GSKA 2YAOA 5PCYA 5A7EA 3NP4A 4BWUA 2GC7C 4YSAA 4DPAX 1KV7A 2FTAA 4AKPA 5I5MA 1BXAA 1AS6A 3WG7B 2BWIA 4F2EA 4NAJA 2HRGA 3RYMA 1EHKB 3V9CA 2IDFA 1QNIA 1W6WA 2BW4A 4TXVB 3FU8A 3WIAA 5AKRA 3PAVA 3UACA 1NZRA 2IAAC 1WAEA 1NIBA 3AY2A 1X9UA 3NJGA 1NTDA 3NP3A 5EHFA 2FQEA 2DWSA 1TKWA 4G71B 5B7EA 4BDVB 1PNDA 2BZ7A 4E9VA 1JXFA 1NICA 1OE3A 1JZFA 2GHZA 2VW4A 2QDVA 4HCGA 1BQKA 2ZOOA 3ABKB 2J55A 3OMNB 3EF4A 3OD3A 1GYCA 3UABA 2AANA 3SBRA 3FU7B 1T5KA 4F7KA 2YAPA 3BQVA 2FWLB 2UX6A 1FA4A 7PAZA 2DWTA 3ZDWA 4YSEA 2IWKA 2EIJB 4A2GA 4KO9A 2IWFA 2DV6A 2DY2A 3NJFA 1GW0A 1ASQA 2CJ3A 3NSDA 4K9JA 1PZAA 1SF3A 2AFNA 2I7OA 3FSZA 3CVDA 1ZIAA 3NSCA 2JFCA 1OE2A 2FQGA 4DP2X 1KGYE 1BQ5A 2UXTA 5B1KA 2H5UA 1JERA 1J9QA 3X2QB 2HZHA 1WS7A 1AG0A 2Y69B 2YXVA 2DYRB 1PZCA 3MBWB 3NSFA 4N4YB 5B7MA 1PLBA 3KW8A 1OV8A 4F2FA 2XLLA 1DYZA 1L9OA 3FS9A 2QT6A 4A68A 1AG6A 2XX1A 4YSQA 2XV0A 1SHWA 4PCYA 3PLYA 2JKWA 4KNTA 2WSDA 4KOCA 5I5IA 2CUAA 3WNIA 4DPCX 3WKPA 1ZV2A 1FFTB 2XX0A 2PPDA 3CVCA 3NYKA 3QJQB 1AACA 4GP4B 2J5WA 4A2FA 2YXWA 1V55B 2PPAA 2OJ1A 4BXSV 4X4KA 1E65A 1IUZA 8PAZA 1F56A 1GS7A 1ETJA 1A3ZA 6PAZA 1KDJA 1SFDA 3JT2A 2BP0A 1FWXA 3FSAA 1BYPA 1HAUA 4UF7C 2X88A 2IDUA 4BDVA 1QHQA 4HCIA 4HAKA 2BWDA 2PPCA 2HXAA 3ASNB 1GS8A 2B3IA 2EIKB 3SQRA 1BQRA 3WNJA 1M9WA 1NIFA 1HFUA 1SF5A 3NJMA 2XXGA 3FU7A 1J5DA 3EH3B 4W9ZA 2XVBA 5I6LA 1R1CA 2N0MA 3DKHA 4AI7A 1ZDQA 4E9TA 1ILSA 2AVFA 3NT0A 3OMIB 4G7QB 3NJJA 3HB3B 1GS6X 3NJIA 1CYXA 1ET8A 2UX7A 1CUOA 4NB7A 2XU9A 3T6ZA 1AZUA 2TSBA 3QJRB 2ZWNA 3T6WA 3FQ2A 3ZX1A 1J9TA 1SNRA 2P80D 4DP4X 1CC3A 3IN0A 3U25A 4BXVA 2GIMA 2CBPA 1ASOA 1UATA 5PAZA 4ENZA 2HX7A 4N8UA 2A3TA 4M3HA 1OCOB 3CZUB 1PLCA 1BXVA 4FAAB 3PAUA 5B1JA 1A4AA 1RZPA 3TASA 1L9QA 2BP0B 1NWOA 3NSYA 3GXUB 4JHVA 3FT0A 1ET5A 1JVLA 1MZZA 3NJLA 1AS8A 4EF3A 4YL4A 1IKOP 1L9RA 3PAZA 3X1BA 3CG8A 2VSKB 2YAHA 1E67A 1RCYA 1ZDSA 4YVUA 3CDZA 3N2JA 2QDWA 3TU6A 3H4FA 4DP7X 4DPBX 3OMAB 1PF3A 5D4IA 1NIDA 1SFHA 2XV2A 1QLEB 1JXDA 1VLXA 4GYBA 4MFHA 1NIAA 2YAEA 1BXUA 1TU2A 3ABGA 2GI0A 3AG4B 2JXMA 3ABMB 2Q5BA 3EH5B 1MDAA 4GP5B 4E9WA 4QLWA 2WO2B 1J5CA 1L9TA 1AANA 4KO7A 3T6VA 1GR7A 2I7SA 1RKRA 2CAKA 5TK2A 5B7FA 5LDUA 2AZUA 1JVOA 1N68A 3NJNA 5B1JC 5B3SB 3L45A 2FNWA 1KBVA 4YSOA 3UADA 1JXGA 2YARA 1GY1A 3ABLB 4NERA 3FU9A 5B1AB 3PPSA 2YAFA 1AAJA 2HX9A 3WKQA 3UAAA 1AQ8A 3EH4B 1SHXA 3NJKA 2J56A 4KO6A 5IY5B 1GY2A 1M57B 4E9QA 5B1BB 1E5ZA 1KCWA 3AG3B 4W1TA 4JHUA 1OE1A 4BK5C 1AR1B 1SDDA 4P5SA 1AZNA 2VM3A 3CDZB 2GB2A 2BO0A 4HCFA 2Y1AA 4E9YA 1DZ0A 5I6KA 3CVBA 5D4HA 1WA0X 2HX8A 3OM3B 1OF0A 3FSWA 1NWPA 1AZBA 3PXLA 2IDQA 3PCYA 1ID2A 1NINA 2FT8A 1KYAA 2I85A 1XB3A 1JZJA 5I5JA 2VSMB 1KDIA 2EINB 4YSRA 3V9EA 3DTUB 2UXFA 1L9PA 1TEFA 1IBZA 1OCZB 2FQFA 2PP9A 4KO5A 3OQRA 1X9RA 2OV0A 3IEAA 2VMJA 4A66A 3EHBB 3C75A 3IN2A 3X1FA 1NPNA 3FYIB 4KNSA 2VW7A 2BZCA 3T71A 4YSCA
chains in the Genus database with same CATH superfamily
1QUNB 1CWVA 5CR1A 4JHAL 5GS2D 2X70B 3EH1A 5DEFA 5AVUB 1KIUA 3ZHLA 3Q13A 1OSPH 3NAAL 3NIDB 4X2UA 4FHKA 3T3PF 1I1FA 3WKMH 4NJ9L 3SKNA 2PMZA 5ABZA 1A1OB 1MW3A 3BHBB 5F7KC 4O58L 3QEUB 1BPVA 4RGNC 5DHYA 4XNQA 1BWWA 4A1RA 1KULA 1S5HA 1J8HD 3PQYA 4X0KB 4KUZL 2RJMA 4MJ5B 3IDGB 3GJFA 4HXBL 4X5RA 1XGUA 1THCA 4FZEH 1GW6A 3EADA 4J23A 5KYUB 3AY4A 4HUXA 1GGIL 2CCWA 2NY6D 5BJTB 4QYOA 4TVPL 3VFNA 3QEGH 4NO3B 5KYWA 3DO4A 1MZYA 2QEJA 1VENA 2WAQA 4I5BB 5IJVB 3ARQA 3FCTB 3HI5L 4NM4H 4PJAF 3DBXB 1Q9WB 3MUHL 4CVXB 5IR1B 2FHCA 4YHKH 1I1YA 2AQRA 3MNDA 3GNML 4PJ5E 1CL7H 1SJHA 2D7OA 3EOBB 3HPJA 3LYRA 2QPSA 1BQHG 1BJ1J 1DVFB 3DX8B 4A67A 2BFGA 3X3FH 2QL1A 2UZXA 1YVLA 4P9MH 3KLHC 4HIHB 4MS6A 4IBWA 2V6HA 5FK9B 1N5YH 3H3BC 4HJGB 4LOFA 3D50A 4M5TA 2XFGB 4E9LA 4OIIH 3BEWB 4J6IA 2EVJA 4LCCB 5DEFB 4R4FH 1VPOL 4WFGE 3U1PA 2JB5H 3QS2A 4PCKA 4PWEA 3SKNB 1TQCC 2I25N 3C9NA 3KJ6H 2ATKA 5BRZE 1WA1X 1EZLA 3KYMA 1UM5L 2HPTA 4NXSA 5DHYB 2J6WA 2YHGA 4H0GA 3PQYB 5EA0L 1QTYT 4QXGH 1QR4A 4HFWA 2PF6A 2WTRA 4S1SH 4HWNA 2JJWA 5DR5L 1XGUB 1EMTH 4PJHB 3QIWC 4PS3A 5GGRB 5FX3A 1UJTA 2IGFL 5I30L 1CD9B 4PGEB 4YSUA 4QYOB 1ZSDB 3UZVA 3CIQA 1GGBH 3CD4A 3D0VB 1SXNA 2VDOH 3NACH 1ECZA 5BUAA 3T0EA 2K3HA 4AQ8C 4LSVL 1C16B 3F7KA 3RGHA 2JKRM 4HG4K 2ZONA 3COOA 4KUCF 2VR9A 1GAFL 2VC2H 5EU5A 3DV6A 5JUEL 4IBSA 3HPJB 3MOQA 5DFWH 4Y16A 1G9ML 3UEZA 3CFJB 2NUPA 2UZXB 3AUVA 4X50A 5F1NB 3S5YA 4EE2A 1A6WH 4R2GD 5D7LD 4ZK8A 1TQBB 43C9B 1OXYA 1MFCL 3RKPA 3JV6A 3HKFA 2CG9X 4XPAL 2D73A 1RERA 2C3WA 1U8IA 3MFFB 1QLEL 3QJHB 4R7DA 3WUWA 4LCIL 4CU6A 1IGCH 5D2LA 3TPUA 1QWUA 4X7EC 4A2HA 4K9EC 5MENA 2LLLA 4JPWH 2VRKA 1SLWA 3GBNL 1Z9NA 3CK0L 3T2NL 4QWWC 2P7TA 5T3ZL 3SDYH 2FVNA 1KXQA 2YAMA 3EO9L 4ODVH 4HHGA 5DTFA 3HNVH 4UINH 3UZVB 1X4ZA 2VT0A 3PWJA 4TTDD 3ZTDC 2DTML 5IB5A 3BGFB 2Z93A 3BXNB 1UA6L 3BRGC 4YUEH 4GY4A 1F4AA 1NC4A 4G1EA 4MS8D 1P7BA 3C5XA 1OTUC 4PGBB 1MIEH 5EU5B 3DV6B 5J12C 3X1EA 4FN0A 3FTWA 3J8F7 3A6CL 5FM8A 1MVFA 2VDNB 3ZDYF 3D9AH 3QQXA 1D5MA 5AB9A 5IW3A 5FOJA 3CWGA 3JV6B 4F9LC 4XP5L 1XGTA 4IW4C 1X7SA 4DO5A 3N04A 2OMYA 3QIBA 4FI7A 3NJVA 3WUWB 4HJJL 5DVPA 1JBJA 3FUHA 4J28A 1GSKA 3B37A 3NEOA 3NP4A 3INOA 2YUVA 3ARGA 2DDQH 3G5YB 3QCVH 4MJ4A 5FKAA 4AEFA 3WDHA 4GNKB 5MENB 3VFRA 4GUOA 2O5XH 1IGFH 1OK0A 4GOSA 3G6AA 2CPUA 1NL0L 2P7TB 4FQ1H 2WGXA 2O30A 3CFNA 2WJ5A 4BQ6A 4ETYA 1MSPA 5DTFB 1NCJA 5A16A 2VN7A 4J4PA 2MTPA 5GS1C 2OCJA 2QADD 4MA8L 4XX5A 1YEGH 4ZX4A 4CDHA 2XNAA 3QFDB 2IFGA 4G1EB 1NC4B 1KTLA 2WV3A 3DXAE 3ZVVA 4FA6A 4F5CA 1FVEB 1UURA 1Q0YH 5I74B 4KK9C 5ESVA 1IC5H 1X44A 4RX4D 5D5MF 1VFBB 5HJGA 3QWRA 1EIBA 4JVPA 4P2CG 3Q1EA 4R7LA 2NSQA 4NQDE 1D5MB 4Z3TA 1AH1A 1RUQL 3VI4B 3CH1B 4PJ5D 1K5NA 2AQ3A 3UABA 4MVBD 4GG8B 3CMGA 1JHKL 1UZ6E 3F58L 3QIBB 7PAZA 1VGEL 2WLYA 2WJ7A 3GLEA 5DRNB 3RQ3A 3C2AH 2ZOKB 5CN1A 3ARGB 1BJMA 5EUKA 3VWKA 2X6BA 5AW7B 2JELL 1A7QL 4WFGD 1Q4NX 4GW4A 2P45B 4ODUB 2AF2A 3G6AB 3K8KA 3OG4B 4OGQC 1DQLH 3WFEL 1A14L 3OKOA 4LVNC 2AFNA 3FSZA 5I82A 1QRNB 2AMGA 4U1SA 3DO7B 4WK4B 5A16B 4M7JH 4M1DH 4WI3A 1JERA 5LN4A 1OO2A 1X5KA 1FYTD 3RI5F 4WNQA 2YRLA 1KIPB 1P5VB 1P69B 1Z9OA 3C09C 4U1NA 3WNLA 1NGZB 3CXHK 3LNEA 5SWQA 4FP8H 1Z9SB 1G9NC 4JKPL 1J10A 5EU6A 5ICXB 2A0LC 1UOVA 4OIAA 2WOYA 3C5ZB 2VXUL 5DQDL 3PJLA 4RNRA 3U2JA 4PLKC 4BE6A 2J1YA 3HAEA 3QUXD 1OKEA 3CPLA 3E9TA 4PJ8D 4W9DC 4PRPE 5D1ZC 3H9YA 4DPCX 5IREA 1MHPH 3N1PC 2ARJQ 2DQEL 3CVCA 4EOWL 5F6HJ 3S5LB 1KGCD 2P5WA 2MPAH 2L7EA 2WXNA 1NAMA 4LL9A 4QXUH 3VWKB 4X4KA 3OJMB 3N85H 4GW4B 3MV9E 4NWUL 5CHNA 2CJTA 2XA8L 4P23C 3EDKA 1BBDL 5KYXA 3ZZ1A 4ZMXA 5B38B 4HF5L 4ANXA 3GSWA 2OSLB 4XN7A 5DZVA 3NIGE 1DJHA 1D5ZA 3BP5A 4P59L 4EI5D 2X89A 2BSTA 1ZHBA 5I73C 2ZSWA 5G2NA 1QRKA 5HVGB 4XE0A 1RULH 3BWAB 1EAOA 3LEXB 4IOFD 3RI5K 4KK5C 4PBVC 5D7IA 5KS9E 3ATFA 2ICEA 3BZEB 4U1NB 3JVFC 4XBGA 2EDLA 2DICA 5SWQB 1JPST 1SVZA 1AKPA 3NJJA 5GHWL 2CKNA 5EU6B 2O61B 1F3JA 1WAAE 4RNRB 1TT6A 2BJML 5HGAA 1W15A 5LQBL 4MD5B 5CSGA 1UH4A 2ZAIA 3HAEB 5C0BA 4JGNA 1QSEA 1DQDH 2NYYD 3KMDA 3FQ2A 2VE6A 4JFYA 3ZX1A 4WUKH 3VH8G 2AXGA 2YBRA 3O6FC 5EOQH 4JHWH 1DO5A 3U25A 1W72A 3APDA 1N0XL 2W65B 2ZG3A 2WWMC 4HK0B 4MNHA 3RWCA 1FH5L 4D3CH 3UJJH 1ZJBA 3FRPG 3T8XA 4MZRA 4PQXA 1RQ5A 1Q9KB 1E4XH 1MHEA 4KK6C 5T5NF 5B8CA 3I3DA 4GSDL 2WBJD 4FADA 1Z32X 3ECBB 4N25A 2V8MA 3CMOH 3FB5B 2AEPH 5KYXB 1I82A 3QHFH 1LL1A 3BUPA 4I0PB 4IDLA 4B7IA 4U31A 2OL3H 4EF3A 2HMID 3MLWL 5GSRB 2R4SL 3LKQB 1Z9LA 4AZ8B 1D5ZB 3BP5B 1BF5A 1KCVH 1ZHBB 1AGDA 2BSTB 3MOAL 2ZSWB 3VGAB 4LSRL 5FA4A 1IEAA 4Y7MA 4F8OA 4QHKJ 3V0WL 1FVDB 5E6IA 3U83A 4Q4EA 5D7IB 2VCOA 3ZMEA 5I17A 3RX8A 1EFXD 3CC1A 3HI6H 4F1ZA 3UGUA 1FBIL 4GXVL 3KWWB 1V3MA 3DXAD 3V79C 2GI0A 2DWEA 3ABMB 3W0WA 2O4EA 2OMTA 5HGAB 2RH0A 4KROC 4XHJC 5C0BB 1L9TA 1QSEB 3KL0A 4ZS7H 1PD0A 2N7AA 2VE6B 4JFYB 4HMDA 2AXGB 2YBRB 1VB9A 2P8PB 4KRMB 3QUKA 4DEPC 4MNHB 2KS0A 1IBGH 4UV4L 2PXYD 1WTGT 5AKVA 3T2QA 4OZIE 1NANI 4N1HB 5B8CB 1S3RA 2A38A 2F54A 4W9HC 2Y7QA 5FO9A 3RIKA 4HJ1A 2CHDA 2JI3A 4GRLC 3IYLW 1MH5B 3HRPA 5HHNB 3ESUF 2RMNA 2NY4D 1AGDB 1OAZL 3AG3B 3JWNC 4W1TA 1WBZB 3FF7A 3T04D 5JOFB 2Y6TE 3WXVH 4YC2B 4PWFA 2Y1AA 4PHXA 5IIEA 1DZ0A 5DEJA 5J9PA 3CFUA 1TCRA 3ARSA 3OM3B 4H88L 1OAYL 2P4AB 3VFWA 4QGTA 4BFEA 2C7UB 2H3KA 3UTTA 4QLRA 3VFTA 4HCRL 1MCBA 3FTSA 2J71A 5B39G 5ITBH 1CGUA 4PGJA 4NSKB 1IV8A 5JHAA 3NSXA 3GMLA 1BA9A 1JGDA 5A40E 1RZ8A 2H9GA 2SODB 1ZOXA 5CN2A 1J12A 3ZE0F 2AXHA 4BCXA 1X5YA 2EABA 2PYFA 4XNYL 2V5MA 4XPTL 1D5BA 3FHEA 3IN2A 3GXMA 4FG6D 2DQUH 1MFEL 5B3JF 3MBXL 4GQ9L 5C0GB 2F54B 5I23A 4YGVB 1N18A 1XV8A 3MMEB 2Y7QB 5EBMA 3QXWA 2APFA 2QPEB 5I8KL 2XZCL 3MV9D 4NGHL 4KX9A 5IMOA 1U8OA 3E3QC 3RIAF 4BZ1L 1GPOH 1KPRA 4KAQH 3UX9B 3RVTD 3NBNA 3I50L 4OF0A 4E9RA 5C0AB 1NIEA 4IRSC 1BWMA 4H1LG 1G9NL 1FLRL 2BIHA 4JFPA 3BVDB 5DC4B 1YNTA 5J9PB 5FDYA 2FL5B 3N1QC 1UWGH 4PJEE 3MGTA 1IRAY 1UADC 4KDTC 1CICD 3UCRA 1NOLA 2EJ1A 2VQ4A 3VFTB 4ZFGH 4TUKH 3DGCR 3VXOB 2KZWA 4K3DL 3RAJL 2KZBA 3ARTA 1QTPA 5B22A 3MSPA 3FO2A 1E9OA 1JGIA 3REVB 1ZIBA 3MLUL 1BAWA 3GMLB 4Z7VE 4PJ7F 1RZ8B 2H9GB 4IYKA 1CGYA 1CIUA 3DRTB 4DUWA 2Q10A 5TFSH 4KGJA 4TSBL 2PYFB 3T3PB 2UWEF 3QUYA 1D5BB 3G5WA 2QSVA 3NRPA 1ADWA 3FQUB 1FRGH 5I0YA 5I5RA 3IDYB 4PD4J 3ARWA 4C83B 3EO1A 4IJ3C 4LT7A 4UILL 2BNQA 5EBMB 1CXEA 3V6OC 2F1BA 2WYIA 2ALWA 1U8OB 3TZVA 3IMVA 1KPRB 4O5LL 3RIAK 1T83A 4Z7QE 1EEZA 1A7BA 1ADQL 2XQBH 4MJIA 3AZUA 5LO7A 4XCCH 2CE6A 4PJAB 3V95A 5E5LA 4R26H 3KLAB 2MCPH 4JFPB 4NP9A 3V4VA 4BBWA 2ZOTA 4FTVA 1CQKA 4F7MB 4JM0A 2C26A 1YPZE 1AY1L 1IE4A 5I16B 2OMVA 2XC8A 5I1IH 1AJ7H 1H0DA 1OB1B 3DVGB 4XCEA 5L88L 3ECWA 1D6VL 3BLBA 4K3EH 2F1AA 3FO2B 4M1GL 5C0IA 3HS9A 1A7NH 1PZBA 1HAWA 4XCNA 4WO4A 1LILA 4X99A 5EO1A 3RVVD 1KEML 2ADFH 1EZVX 5F96H 4EAEA 2JKIS 1OANA 3AACA 3QUYB 4X7TA 1A65A 5I6XB 4OT1L 4OCRH 5I9QB 3RIFF 2DQHH 3LXUX 1YNKL 2Z4TA 3GXIA 3QUML 4K94L 2VR4A 3B6SA 5L6YL 4GIOA 1FN4A 3C8KA 2AI0L 2H6UA 5BVPH 3EO1B 1MWAB 3TBTA 4WENB 1DHKA 4QT5B 2GAZA 2R1YB 1SOKA 3BEVA 1YY8B 1DJSA 3KLLA 3V0EA 4PD4K 3TZVB 1RUKH 4I1NB 5G4OA 1XB6A 2FLMA 3PV6B 4H26A 1EEZB 4OFPA 1MOEA 4IKJA 4MJIB 2GFBA 5EOCH 1LM8V 5EPMB 1JPGA 3V4VB 4U6XA 4X9FA 4FJ6A 3MV7E 1AXSB 3CN3A 4F2ME 5LGJA 3GXFA 5D2NB 2BSRA 5TDPB 1RH8A 4XCEB 3H0TA 2ETWA 1USQA 3SPVA 1JZGA 2IWEA 4GAGH 1XIWB 3B5TA 3IDIA 4IGBC 3D39A 4R0LA 2NR6A 4WO4B 2C8NA 4HYTB 1IE5A 4X99B 4K5MA 4XP9L 1HK6A 1OPGL 1BYOA 2ZWKA 3AGWA 2FX7H 2Q2LA 5FOBA 1UFUA 1GH7A 4LQ1A 4TSAH 4B9JA 3IFNL 4NNYB 3QXAA 4G7VH 4M3KB 3RIFK 3IFLL 3KPQA 4NT6A 1NCWH 3B6SB 3LMJL 3C8KB 4S1QH 3FH7A 4P5TD 2KUTA 2EDKA 1DO6A 3TBTB 2CK2A 5C07D 2YGPA 1G6RL 2J6EA 1FHGA 2EDWA 3BEVB 4RSVA 3QIUD 4OIBA 3IETB 5SWSE 4CJ1A 4MNGA 1ASPA 1R3IH 2WZ0A 1B4LA 2VIRA 3TBSA 3PWLB 1J86A 2BOCB 2Y9RT 1JPGB 3UO1H 5CN3A 1AS6A 1NEZG 2X12A 3BPNC 3LIZL 5E5MB 4D9RE 3BKCL 5IBUG 4D9QD 2VDQL 2NDGA 3L3IA 3ZE1F 3HG0A 2R2BA 2YSSB 3H0TB 1JF6A 3SPVB 3ZDYB 4CNIB 1KG0B 4GI9A 4YE4H 3WO4B 3WIAA 4HGMA 4MB4A 4K15A 3IDIB 4R0LB 1OP3K 1P4BH 3T5WA 1FZMA 4HULB 3LZNA 4YBLC 2NYZA 4OUOA 3MLVH 4U4IA 5DS1A 1E50A 1NCDH 1RJCA 4U1JB 5KVDH 4WUUE 1QRND 4BEIA 1FNSH 4JQXA 1IBFA 3ZO9A 1P6FA 4XP1L 4XP6H 2XQYG 3ET9F 3KPQB 4JM2A 4MCZB 1BXXA 4UT6H 3S7GA 4CN1A 1O6TA 4EIGB 1ZLVH 4V1DA 3PUCA 1A9VA 1THAA 2FWLB 3H2WA 1NCBL 4AMWA 1CXFA 2DWTA 3GXPA 4X6DF 3ARFC 2ATAA 1ZK9A 4YSEA 4YHYB 1D5RA 5HBBA 4PRIE 1B2YA 3TBSB 2CO1A 5KSAD 2NXYB 1KELH 3FO9B 1OL0A 3C5ZD 5CZVH 1B2WL 2DY2A 3QI9A 3S36H 2VZSA 4K9JA 5CCGE 2Z7UA 2PCXA 3AREC 5IBTH 4ALAH 5D5MB 3L3IB 3GS4A 1JNLH 3U0WL 3QO0A 3DUSA 1XH2A 3ME0A 3EYSL 2OZ4A 3ARDB 1M42A 2ZNXA 4L3EE 2O26U 2PO6A 2YRBA 4L8DA 3ZU8A 1FZMB 1O7SA 4JHAH 5D1QC 4PS8A 2WN2A 4NIYE 4BH8B 3H9SB 1OV8A 2B4CC 3NAAH 4JM4H 5IW1A 4XGZA 1Y1UA 3Q48A 4ETQA 3AM8A 4S1DD 2CRZA 4PRAB 3UZEA 3IU4L 2C9AA 3U4KA 4GLRH 4MCMA 3AUWB 3KDMA 4UQ2B 4QPEA 1KNOA 2V17L 4BFGA 4KUZH 3CDGA 3WNIA 5FYJL 4V1DB 4HXBH 5J13B 2XN0A 3QJQB 1MY5A 1O0VA 1O7DC 5F7WC 3LH2H 1GGIH 1FL6A 2XVGA 3BAJA 4RESB 4XXWA 4ZX3A 2EVGA 2BSCA 4TVPH 3RWIA 1WO2A 3US9A 3LZLA 1T03L 5KSVB 3CU1A 3HI5H 1GS7A 1ETJA 4PJ9B 3QI9B 3GBML 1CGSH 1BD2E 3DJSA 1TTCA 1RUMH 4A55A 1S7TA 3GNMH 5DJZB 3V0AC 4RBPH 3ME0B 2HXAA 3MV7D 3T0BA 4Z77A 3NCJL 1KGWA 2LVEA 2EYRB 2NXZD 2ZWSA 3NIGF 4LPXA 4KDWA 4PPTA 4BFJA 5C71A 1OD7A 5AD0A 2FRGP 5DD3L 1LP9E 5CZXD 2B16A 5IW1B 4XGZB 4I0PD 5EORL 5KS9F 3HE6D 4KPHL 5D7JC 3UTSA 5IVXF 1FIGL 2AABL 2DLHA 4EN3D 2OTUA 1UM5H 2DWDB 4K7PY 4FQIL 3BQUB 3KDMB 5E9DE 1KNOB 3LN9A 5EA0H 2R1XA 4OQTA 3CDGB 4D94A 1PKQE 5DR5H 2CO2A 2G0LA 2LQRA 4ZOAA 5I8EA 1SOXA 5T1JA 2IGFH 3CZGA 4ZUUB 3IK2A 4P07A 1ASOA 1FH2A 2YLHA 3K6SA 3F04A 4OI9A 1UJ3C 3NGBB 4OR1A 4R97C 1J5OL 4U0RB 1XGQA 3JWNG 4M3HA 3CZUB 2G3NA 4ADJA 5SWSD 2JKLA 2NTSP 4FAAB 4RZKA 1RZPA 3K6IA 3KVQA 3FMGL 1L4IA 2V0AA 1E8YA 2C1PB 2G3XA 2WCSA 3NTCL 4FQ2H 5JUEH 2ZOWA 3MN8A 1XHHA 1G9MH 2AJZA 3B9VA 4D9RD 1T5WB 3MU3A 4ODSL 3X13A 4KMQA 3EBAA 1URZA 1SOQA 2DQCL 2EICA 4FX5A 4KH9A 3CDZA 1MFCH 2E8YA 4XPAH 1A1NB 3KPOA 4DPBX 2WZ5A 4S10A 4Z76B 1QLEH 3R4DA 5BQ7A 1XH0A 3UTSB 4NZDA 2J2ZA 4WI4A 5D7LA 5JXED 3IMUA 2MNUA 2OTUB 4KKBD 5EDSA 4GP5B 4GEIA 1P84K 4RFOL 2ZAHA 3EDJA 4WCYL 3GBNH 4BUQA 2VUYA 1JN6A 4WUUD 3T6VA 3MRBA 1BQHA 4DNLA 3IB4A 1RKRA 3EO9H 1UWXK 3MJ6A 4GUCA 4TULL 1R3JB 3RGBA 3K6SB 2EDRA 1TVHA 2D3VA 3HW7A 2R0WL 4GEJA 2DTMH 5IT2L 3S9DB 3OL2A 1XGQB 1E28B 4OZIF 4Q9CA 1CLYL 1UA6H 3VWJD 4Z5RB 3PPSA 3QULA 4YR6A 3UG5A 1AAJA 2SEBA 3C60D 3WIHL 1IL1B 3K7UA 4HD9A 1BLNB 2B20A 2EKSA 4UOZA 1SDAB 1BM3L 2ORBL 3A6CH 3B2UD 3X13B 4J3OF 1ML0A 2WUBL 4JREB 4QRQB 1HZHH 3P3SA 3CDZB 2QZ5A 3HRZC 4XP5H 2GTZA 2YR3A 4HEME 4E9YA 3KPOB 1WHOA 3O2DA 4Y9FA 4YDNA 1U3JA 4I8DA 5HGDB 2HLAB 3FH5A 4HJJH 4JFFE 1TMQA 4L3ED 3PXLA 4PRDB 5CJQL 1ZGLM 2IPTH 3ZMNA 2XDHA 2E8ZA 1L3NA 2EUWA 3SOBH 3WXWL 1AI1L 4PGDA 1IB5A 3NDZE 4LLMB 5IHLB 1SEQL 1P53A 1RURL 4ZFOL 2XPZA 1YMME 3DTUB 4FHBD 4NQXB 1I1RA 5T1LB 1JN6B 1NL0H 5AQ0A 4KRPB 2AHIA 3MRBB 1AOHA 1BQHB 2Z31A 2NY7L 1OIOA 4A66A 4YFLF 3NK3A 1GIGH 1TVHB 5B3NA 4ECNA 4EZJA 2B2XL 2D2CC 4MA8H 2WLJA 5FO7A 2HUHA 4EN2A 1QQDA 2HVJA 1WGOA 3RNKA 2SEBB 1A6TA 3NN8A 3T71A 1CGXA 3CBKB 1JD7A 1LO5A 1VADA 2N1KA 2DZEA 3CVIL 3HE7B 4NDMA 4WWKC 5ALBL 3RPIA 3VXRA 5IMLA 5J3HC 1BD2D 3DDFA 3WU1A 3PWVA 1ZVHA 2M1KA 1A47A 1GC1C 5EF2A 2C9PA 3AG2B 1LE9A 5DRXA 3SKOA 3TCLA 3ZE0B 2CU9A 1WH0A 1HZLA 1Z66A 5A1AA 5I15L 1RK1A 4RMVA 5ANMB 5FAAA 1HC1A 4LFHD 3PFUA 2B08A 2YJLA 4PGDB 1WSST 3VFOA 4XN9A 4POYA 2JELH 1A7QH 4YXLL 3CZLA 3DIVA 2DYSB 3MNWA 5F3HA 1QBMH 2GJZB 4WHTA 3SDDB 2G3MA 1FZJB 3SODB 4DPRA 5SX5K 3PWUA 3LRLA 2Z31B 2XKUA 5GZND 2X3AA 1P7QB 5TE6L 1HN1A 4HS3B 2BERA 2NYKA 3CGTA 3FC8A 3MUZ1 4G6KL 3MRNA 4V11A 5FO7B 2YQBA 5BRZA 1QQDB 3BPLC 3FCSA 4WJG3 5BO1L 1H15A 5GGQL 3RNKB 3ZUCA 5GS0D 1IO4C 1A6TB 2JTYA 2DLIA 3H56A 1LO5B 2NCEA 3RPIB 1VKXB 3VXRB 4JKPH 5IMLB 2C9SA 3PDOA 1EBAA 2KQNA 3CVHH 2IFFL 2A1WL 2PTTA 1I7UB 1UB5A 4KY1L 2VXUH 5DQDH 3RWHB 1QG3A 5AW1B 2JWYA 3S34L 4UCFA 3BUQA 3ZDZE 3ZT6A 4PJ7B 3TBCA 3LN5A 4Z7QF 3VD4A 1LE9B 3SKOB 2DQEH 1VCBC 4Z3FA 3DV4B 4EOWH 1OF2A 2F8OA 4G7YL 4NAMA 2UWEB 1RK1B 1MRCL 1N6QL 1YY9D 3ETBF 1ITBB 2ADIB 3PHQA 3QUXA 4FS0A 1FL3A 2AJUL 3PHOB 4U7KA 5AWNL 1VZIA 1I1AD 2D9QB 4X8CA 4NWUH 3PXJA 1H8NA 2NY0B 5F3HB 1RL1A 4WEMB 5C0RH 4QTIL 2D7TL 2XA8H 4WHTB 4FXKB 4YDKL 2G5BA 1BBDH 2FT7A 3PWUB 4CSPA 5D55A 1M1SA 4A7SA 1ZAGA 3V4PH 3ARBA 4HF5H 4DVBA 1SXSA 5TGBB 1DEEA 9PCYA 5EDXA 1RZFL 2FEJA 3QZNA 4E9SA 4OFKA 2YAQA 5TQ2H 3MRNB 1QSFD 3MNVB 3ZRCC 3I6LE 2YMXL 4JJ5A 4ZPTB 1U93A 2W60A 3FCSB 4JZNA 5DGQA 1H15B 3ISWA 3I74A 2WSPA 4WY7H 4NYLB 1HL9A 2EIMB 5GHWH 2J1WA 3PDOB 2VZ3A 1J0IA 2JCWA 1PCSA 2B3RA 2PTTB 1TYEB 3S3BB 3J7HA 1R0AL 1UB5B 2XRAL 4OD3H 4JAMB 2BJMH 4N8CH 4ATTA 1A21A 4E68A 5I6OA 4GG6F 4XN2A 4UBDD 1M05A 1UT9A 3TJPA 1SPDA 1OF2B 3L4YA 4KQ4H 1MCEA 1U9KA 4K9EH 1N0XH 4Y2OB 1FH5H 1WFUA 4QRUB 1I85A 2IJ0C 1TQVA 1HDMB 5T1DL 3W11C 4J12A 2KT6A 2CBQA 2OTWA 4GSDH 3WIIL 4JFFD 2OYLA 5E8EB 3EYQD 2JQZA 3H6AA 2JIXD 3PHAA 3TURA 1TTUA 3FFDA 1YZZA 1L9SA 2WGNB 4FYTA 1YMMD 3KH4A 2IOOA 3MLWH 2R4SH 3IMSA 4BK4A 3AW5A 2LABA 2WBJA 4NCC2 2A74B 3MYJB 2I5YL 5IV2A 1KY6A 4LSRH 4N8PA 4BV1A 4F91B 4JJ5B 4KTGA 1U93B 3V0WH 4JZNB 3TPKA 1IQDA 1LYQA 1E8XA 2QMJA 5FCUL 1FBIH 1FSKB 1MCSA 1YN6B 2F6AA 3RE0A 5BMFL 3Q8CA 4APQD 2BXYA 2XQYK 4PJDE 3IXTA 1I7RA 4Y4KC 3VNZA 3NQKA 1EFXA 2QVTA 3BO8A 3Q3GA 3QGVA 3ESNA 3FB7B 2VL4A 2WNGA 4UV4H 1EQWA 4PSRA 4TVSa 1W6WA 3LHPL 3QWOA 2R69L 3PAVA 4WK0B 7CGTA 3BUIA 1ICTA 1T4WA 1IEHA 5AOLA 4NQDA 1WAEA 1NIBA 3HTLX 5DEGA 2AAAA 3QCUH 3FFDB 4TLUA 4A7VA 2PXYA 3O2VL 4X6DA 2X0WA 1N9PA 3F3HA 2HKFL 2JK5A 1HYRC 4JR9L 4PP2A 1WITA 5I8OL 4DGWC 1OAZH 2F5AL 3AMKA 1X6NA 2XWCA 3P73B 5KANG 2ZXCA 3N9GL 3EF4A 4Z7NB 3LCYA 3ARDD 3LH9A 4MHHI 1ZT4A 3C08L 1RY7B 5DZJA 4GBXC 3TT3L 3ZMRA 1VF5C 3JZ7A 3DSFL 1IGJA 3BQVA 4X9BA 3GPSA 3ZE1B 3RZCB 4I87A 1GC1L 2OQJA 3V0VB 3K1DA 5I1CH 3IXTB 4HCRH 4UM8B 1I7RB 2LU4A 2OSWA 1OGTA 1SY6L 3CHXA 4IIQC 4P99A 1Y0LB 1YJDL 3BO8B 3DMMB 3NJFA 4D0DB 1GW0A 1E42A 2R15A 1BBJB 1UM4L 3TFKD 3GI9L 1VAHA 5HYSG 1F0LA 4QJ5B 5C08E 4ZODA 1HNFA 1T3FB 1Z0NA 5FYKU 1EV2E 1SXBA 5DQ9A 1PBYA 4MBRA 1J8KA 3DRQA 3C6SA 3QWOB 3TGXA 3UFIA 4Y4FC 5HYEA 4OFDA 3O3UN 3OKYA 5F44A 1J9QA 4NQDB 4DAGH 5DEGB 1N12A 4PRPA 3QDJE 5I8KH 4N3UA 3UBXA 3IDXH 1MPAL 1EXGA 2NNAA 3B7TA 4X6DB 4ZQKB 2WXIA 3U30C 1P5UB 1DANT 2JK5B 1EZUA 3FS9A 2HP4A 1XF3A 3ROLA 3I50H 1G0DA 4X6EA 2W1NA 5AG8A 1ZTXL 2XV0A 1PZDA 2W0PA 2CRIA 4RISL 2WXQA 3LD8B 5CP3A 4YS4A 4KOCA 1G9NH 1FLRH 1HHIB 3VG0H 1ZMYA 3BI9X 3WFHA 1RAMA 1ZT4B 2J73A 5D7EA 2YEVB 4M8VA 4JQIA 3FRPB 1IGJB 1TVBA 3D3VB 3I6LD 4OBRA 5ACLA 4GP4B 3CIAA 3ALPA 1JK8B 1KCKA 4YXHL 3C6LA 2MOVA 1OGTB 3RAJH 5L4MA 4J3VA 2JKTM 1IUZA 4U1IB 3MLUH 1AQHA 3UXFA 1IBBA 4NQCE 5DD1L 4OY9A 4LLVA 4TSBH 3QYMA 1FO0H 4MZ3A 4L5FL 1B90A 5KS9A 1KJ2B 3OKDA 2FK9A 3PYCA 3DRQB 4DUVA 3C6SB 5DRZB 4CC1A 3T1FB 4NQSB 1SOSA 3WJJA 2IQAA 1KB5A 2AQ2A 4XTRD 2FBRA 3RGVC 3L3JB 3VYOA 3EF7A 2XXGA 4PRPB 4PRBB 3UBXB 3GLDA 1FFQA 2NNAB 1SJVA 4K7PX 5DC0A 1QFHA 5BV7B 5C3LD 4XNAA 5KVDE 5C1MB 1VFAA 2EAEA 3OKMA 5E8OA 1LP9F 5DHEA 3ROLB 3J07A 4XBPA 3KWTA 5DS2A 1FCGA 1ADQH 1MJUL 3GHBL 3OKLB 1Z2KA 1CUOA 1NCUA 3MCG1 4OF8A 4HWBL 1AO7B 1Y6MR 4HAGA 1AY1H 2E7DA 4AOFA 1N7ML 1XVSA 1JPEA 4XN1A 5GQBA 1DVUA 3GRBA 5L88H 3RPKA 5FF6A 4ES9A 5DD6A 1D6VH 4K23L 3LQMA 3WS3A 3KNBA 5PAZA 3NIGB 4PRHA 4OBSA 4RDQF 4M1GH 3D1MC 3X14A 5JHDB 4YHNB 1ZLEA 5C2UB 2I07A 1H3PH 4LLVB 1KEMH 1BVKB 3VMPA 4LCYA 2R51A 5KS9B 4J8QA 1MZZA 1FZOA 3OKDB 3X17A 5IVXB 1AS8A 3BP6A 4G8GB 2V5TA 1KIQA 3X1BA 1KACB 1KC5L 1BFTA 1XF2B 1YNKH 4AC4A 3IGUA 4J39A 4TUUA 3U82B 5L6YH 1A6PA 1KB5B 4KKPA 5ADOH 1QSVA 3LKOB 1RZJC 4KV5E 5HDRA 5F7DA 2OMNA 3ROOB 4RRPG 5B39B 3LJ3A 1UG9A 2Z0BA 4DVRH 4Q6IC 5GS3A 1VFAB 2F7IA 3NA9L 5E8OB 2Q0ZX 3CVHB 2GCYB 1BIHA 2Q5BA 3HR5B 4BHUI 4OZIA 1DBBL 1UUNA 4IBLT 4DO4A 5K1VA 1TFHA 4TOYL 2ZCZA 1K8DB 4XX1G 5CZRA 3WN5A 1GR7A 2NLJA 1ZK5A 1OTSD 3HG1D 2JKXA 5EF1A 4J27A 5I0XA 4TVPE 3Q7JA 1KCRH 5DD6B 1B0WA 4APXA 1NCCL 3KNBB 3BAWA 4PRHB 4DSYA 2C34A 2DEWX 1E8ZA 1KB9J 3X14B 5MEPA 2QQLL 3M88A 3QZLA 4MCYA 4WHDA 5HD8C 4HGKC 1U2CA 5D6DC 2I07B 5JR1H 4XP9H 5T1LD 3QG7H 4J3TA 1OPGH 1LHZA 2W80C 2HJKA 2IH1B 1DUYA 2LU3A 2OLDA 1FZOB 1HSBA 3E6HA 2PWEA 3IFNH 4QAWA 3BP6B 1ZCRA 3NJKA 3K2UL 3WMQA 4H1LB 3BVWA 3LMJH 1OE1A 5C08D 4EI6B 3DETC 3A6OA 2IPKA 3SSGA 5FM4A 2V2XA 1TENA 3JWNH 2C4FU 2KYIA 1INDL 2V9TA 4KU1A 4RMQA 3JV5A 2G75B 2RCSL 1NQBA 1NSNL 2ICES 3FUDA 3K80A 3MRKA 3GS0A 3QDJD 1BREA 4ZTOL 3UYPA 2AQPA 4BZ2A 1S9WB 3TJHD 4S0TD 3RNQA 2N56A 3LIZH 5ILTL 4IRZA 4MA7L 4MWFA 1JZ3A 3WN5B 2YKLH 4OF6A 1GSMA 3BKCH 1ECYA 3S88H 2VDQH 2ZX9A 1R24A 2VMJA 3V8CA 5FHBL 3WDIA 4APXB 3DK0A 4Y5VC 5F7UA 3VQ2C 1FZKA 2EEBA 5MEPB 4DN3L 2CBMA 3HS8A 4R4BA 5K9QI 5KVFH 4NN6B 5D96B 2VZ1A 2HJKB 2VDLB 4B96A 4KDVA 5FA3A 3W2DL 1HSBB 1NLBL 1WPCA 2FB4L 3AS0A 1HL5A 3E6HB 4XO5A 4NQCD 4Y4HA 3V5HB 4DKEH 3WY4A 1JZIA 4Z78A 4XP1H 2M8XA 1U21A 3BX7C 4HUMB 3EOYG 4NO2A 2IPKB 1MG3C 4HISA 3NCYP 3STBA 5JIIA 2LAAA 2B5IB 1K2DB 1KXVC 4KKZA 1NCBH 1MJJA 3SGJA 1OOWA 1XL4A 2IH8A 5HYQA 1YSOA 2J57A 4HJSA 5C9KA 4KJWD 3ULSA 2C9QA 4JFHE 3UYPB 2NY2C 1F6AA 3KPPB 1QKZL 3EYOB 1HOEA 1B2WH 4MQ7A 4M93C 4KKCC 4IMKC 1HQ4B 1PMYA 4KKAC 4NXKA 3PGDB 5T3ZE 4AEHL 2F7QA 4TNVF 2ENSA 1XGYL 3R4RA 4A2EA 5J1TC 1HKLL 2WXHA 2CUMA 3PY9A 1R24B 3MXVL 5KSAA 2Z6FA 1UGNA 3EYSH 3MRQA 3DHMA 3NCMA 1NEUA 2O5NA 1N6UA 1FZKB 1OD9A 5HJDA 3N91A 4MA1C 2ZF9A 4DP5X 4XAKE 2DYPD 4NNXA 4JZOA 4UQBA 1FGVL 1U8JA 1V3LA 5FA3B 4MDJB 5GS1B 2HA1A 3QORD 1KEGL 5H35A 2WP3O 4Y4HB 4P46D 2MRYA 3KXFE 2X4TB 1VDGA 2QKIA 3WN6A 1ZS2A 2V17H 1PKOA 4FQHA 1IAII 2OMUA 1VEMA 4NO2B 5FYJH 1WUNT 5F7AA 2ZP8A 4RWYH 4KZDL 4GJTB 2G4GA 2GIXA 1MJJB 2JJTC 4ZFQA 2FH6A 3HIZA 4P5MA 4E0RA 3S8GB 5EBLB 2X10A 1T03H 1F6AB 5L7XL 5JIDA 1T2QL 3UOAB 3GBMH 4L4TB 3HZKA 3KZ8A 1PX3A 4PY8J 2CIKA 1RZIA 4TNVK 1HWGB 2Q9OA 5F9DC 2V9UA 1A66A 4ABQA 3MV8A 3N42B 3NCJH 2QPDB 4U49A 4YXKL 3QK0A 4YHLL 1XCTA 3U79A 2LT9A 4Z7QB 3FOLA 4TVPD 4HUNB 4G9FE 4M7ZC 3BP4A 3IKKA 3D4ZA 5DD3H 3PG2A 1NMCC 2R9HD 4DGUA 4ZQTA 2Z8VC 5H35B 4KPHH 4HU2A 1CDJA 4F2MA 2WW8A 1FIGH 2AABH 3OX8A 3S0PA 4UOJA 2E9BA 3O8XA 3NZUA 3ZUNC 4JFDE 3VDAA 2QKIB 4FQIH 4DGYL 1NGQL 2DQMA 1NMBH 4FQHB 1INEH 1AZZC 5IBUB 2XCMC 3KPLA 3EO0A 3PJNA 2N59A 4PJIF 3RJDA 3ILDA 3SD2A 4G70B 4P5MB 3BD5A 1T7VA 5DDHB 1DZBA 1MCOL 2W59A 3LZPA 3HB3D 4Y2NA 3LDBC 5F1KC 1IC7L 2TRYA 5IW6A 1A5FL 3FMGH 3FT9A 3SB3A 1IJ9A 1RZIB 3IKCB 3NTCH 4UOW1 4JDZA 1N70A 5J8OA 1AQMA 5ERWA 5EBWA 4YQXH 4P2OC 1SHMA 4KZ0A 4RIRA 2H0EA 2X3BA 3MV8B 4Y2DC 4ODSH 2DQCH 1PLAA 4GG6B 2AQSA 1K4DA 1WUZA 2WO3B 3BLKA 3EGXB 3QNFA 3KGTA 4NM8H 2QGEA 4UAHA 5BW7C 3BP4B 2EZ0D 5CSZB 3OKKA 1UD4A 2YD7A 3X1NA 3DUUA 4F2MB 3BVTA 1IKNC 1ZWIB 4BELD 1GVIA 4FXGC 3O8XB 3LXBA 3B9KC 3MRFB 2JI1A 2HWZL 4RFOH 4AKPA 2BMKA 5I5MA 4JG0H 1JUFB 1HSAA 1X6LA 2ZKHL 3EO0B 3QEQD 2ITCA 4FE9A 2DF3A 2D4DA 3RYMA 4ICWA 2XIDA 4TULH 4NFBA 4Z7WE 4YZFE 1ONQB 1SXZA 2R0WH 3CFDB 3GMPA 3HVNA 3RZCD 4WUUA 2YUWA 2ZIDA 4MXQC 3ZN6A 1CLYH 3JV0A 1JSYA 4F8PA 1B6DA 1S2EA 4FXLA 3DMMD 2WKOF 3NJGA 3HC0A 4JFHD 4JDZB 4N24A 1HQRA 4KTDL 3V4LA 1X5IA 5EBWB 1LD9A 1QACA 3B34A 1BM3H 2ORBH 2Y2YA 4Q6KA 4RIRB 3MNZA 5L2KB 3VWJA 3TEUA 1M6OA 3V2AR 4PRIA 2K9UA 3C60A 5FIEA 1G43A 4AT6A 1E7VA 1K5WA 4FFWD 1NGYB 2NZ1A 1CFNA 2IANE 3DUUB 1ERNA 2F9BT 3SGKC 3OGCB 4XAKD 1VIWA 3WXWH 3CBJB 4TRPL 1MVYA 3ILQD 1SEQH 3U4EA 1RURH 5EOCJ 3HZYB 5TH2B 4ZUSB 5IM7A 3MRMA 1EZSA 2BCMA 2EYSA 1FNAA 2F8IA 2A6KA 2WANA 4L3EA 2X4QA 1D6EA 2FIKA 4KJQC 1HSAB 3KXFD 4PG2A 4AW4A 5JPMA 5DJAB 2CLVA 2NY7H 4WRLA 3VE0A 1XO8A 2FO8A 2GK0B 5A2BA 4RRPM 4WW2C 4KROB 4QRRA 1DN0B 1P4LB 4P05A 3MC0A 3GMPB 3TIDA 1T2JA 2B2XH 3N06B 3L2NA 4ZW3A 4YHML 3RWGB 1OW0A 1UEMA 1HHHB 2DN7A 1IQWL 3LZQA 4HU8A 4LRIC 1AG0A 2HFFA 3CVIH 5E9AA 3HC0B 1LD9B 2A77L 5GPRA 1G5AA 4N5ED 2K8MA 3MNZB 3CHRA 4XOBA 3U6XA 2X1WL 1YUKB 2XX1A 3LXAA 3AXIA 4PRIB 3BYTA 3CXDL 3VDBA 1BZ9A 4GRLB 5LG1A 4AT6B 4PIRF 3TN0B 1FFTB 4IU2A 4KZCA 4UIMA 4U1MA 1CFBA 3P1VA 5I15H 2OXGA 5EG6C 4OZFA 1KB3A 4GI8A 4KX7A 2LOEA 4P48A 3S6CA 2PPAA 4XODA 1MKFA 3FDWA 1TU2B 4FL4C 3U4EB 4YXLH 3SJVE 1BZ7A 1CT8B 4K7FB 4E41E 5I1LA 2IMNA 5IZ7A 1R6VA 1JGEB 3SKJL 2A6KB 2X4QB 2FIKB 1PQZA 5JPMB 2IPUG 4JFDD 2GY7B 1I8KA 5CEZL 4FTDA 3VE0B 4XN5A 1G7PA 4KVCL 1AO7D 2GYSA 1JZDC 3M45A 1LP9A 4QRRB 2D0GA 3VTMA 4JK0D 4GAYA 1U0QA 5IB2A 2PPCA 4ZAKC 3ASNB 3TTYA 4G6KH 1Y07A 1TLMA 4RGND 3RL1A 3TWCL 5DSCA 2K6YA 1KPVA 4YHIA 1HL8A 4U3CA 1NIFA 4OD2A 3VB8A 1F41A 5E9DA 5JHDD 1FP5A 1KFAL 1LWRA 4HH9B 5ITFA 5BCAA 2EEXA 1DQQA 3KPRE 4AQ1C 3QUZB 1OT2A 2QFRA 4OJFL 1C9SA 2E59A 3IMWA 5D7SL 2J25A 1D3CA 4YHOL 4KY1H 3G6DL 4PVLA 4G8GD 5E4EC 2J44A 2VXQL 2QHRH 3QVAA 3Q2VA 4X6EB 5F21B 4WWOA 2UX7A 3B2VL 1QA9A 4NB7A 1BZ9B 5EC1B 1J8RA 2DJSA 2ZWNA 2VR8A 4G7YH 4IU2B 1CLOL 1MRCH 2OXGB 1PG7W 5GGTA 4OZFB 2GIMA 4TNGA 2XV6B 3QHTC 2VZVA 1WQVT 2AJUH 5DS8A 5FUOL 4WNSA 2BVEA 4HUVA 3KLHD 3AB0C 1DUZB 2W9DL 3FUMA 2K9FB 5I1LB 1R33A 4G8EA 1OCOB 5ICUA 2D7TH 4IS6B 4FMVA 3ZE2E 4GKZA 3UTQB 1PQZB 1QFPA 4AYGA 5EF3A 3O6LL 1I8KB 1AFVH 3D8MA 3V5KB 1YNLL 1MCHA 4UV7H 1E6OH 1I1AA 1NH6A 5JOPD 4B97A 3CE1A 4NN7B 1DFBL 5IJDC 4R4NC 3CG8A 1EHAA 4L1TA 4H5SA 3EAKA 3RL1B 4XMTA 2HTLD 2YMXH 4FC3E 4YHIB 5GGRY 3QQDA 5KBKA 3E2HC 5C0CE 3WEBA 1D5IL 3QIWD 1DQQB 4PRNA 2A6JA 3HNSL 4NZJA 3UPRA 2RQEA 4LNRA 1NIDA 1JPSL 4LEXH 1EGJA 3CHSA 1X9QA 3NSJA 3FQNA 1EXUB 4M48H 4XOEA 1R0AH 4OGZA 3DX4A 1EJ8A 1E40A 1FI8C 4IJ3B 1F2XK 1YQ2A 3Q8FA 3PPEA 1QA9B 3KWXA 3B3IB 3DVFA 1KJVA 1WZAA 2DMHA 1AANA 4NQEE 4P4KA 4PS4L 1R3HB 4HC1A 3FT2B 2AGJL 4Z3EA 4Y0GA 4N0UE 2QVKA 2OMBA 1EEUA 1UH2A 4M62H 1ED3A 1N68A 2DLFH 1JYVA 5T1DH 1KTKE 4WVRA 2VDPL 4U33A 5TE4H 4HUVB 5AVXB 3WIIH 1T80A 4Q2ZA 2W0FA 2IAND 4G8EB 1EJFA 4RVBA 4NERA 1TPXB 2VNCA 3FU9A 4TQHA 4GKZB 1QYGL 2GK2A 4AM0Q 4N28A 5C86A 3OB0K 4HEMA 1J88A 1EJ6A 4XPGH 3IJEA 5E4AA 4JGUA 3SDAA 4JFFA 3H55A 3MJ8A 3P11L 5IMKA 3IDNA 2I5YH 4C4UA 2QTVA 3BUBA 4FULA 4ATWA 2P3YA 4JRWA 2BIIA 3VX1A 3QQDB 1OGPA 2XWBB 4HIJA 3VCLB 5FCUH 2A6JB 4B5EA 2GUOB 1DDHA 1WA0X 5BMFH 1NFDE 4H8HA 1VFMA 1DFXA 3L2MA 2W95A 2M2DA 4FG2A 3M8OL 1I9EA 1NINA 1O5DT 3BWUC 4QJ3B 3GSVA 4ES8A 4P3CL 2DMCA 3L6FA 3D6GA 3QDGA 3V9EA 3DPBA 3TIEA 1JZ4A 1KJVB 1PZSA 1L9PA 1OARH 4APQA 1J0HA 3QQNA 2FWSA 4WLCA 2OL3A 1SQMA 1ED3B 3RWEB 4XI5C 3N44F 4JN1L 3C75A 4MZ2A 4D7PA 2R69H 4Q2ZB 4TQEH 2W0FB 3GRGA 1NPNA 5A7BA 1I4FB 1QEXA 4OGAC 4HOXA 3RFZA 1R75A 3KE0A 3UC2A 1JV5A 4FFYL 4Y9GA 2X4UA 1Y1DA 3O2VH 3H2QA 3SJVD 1UVQA 3HC2A 4E41D 3IJEB 3ZTNL 2YPLB 3AG1B 4JFXA 1OM3L 4F7TB 4JR9H 1N8ZB 4HJIA 4ZNEA 2WWKO 5IMKB 3IDNB 2F5AH 2BP5M 2BP8B 4JPKL 5HY9A 4YJZL 3IU3A 1XL6A 1IARB 2A9CA 3N9GH 4G3YL 4HIQA 3MHZA 2MKWA 4N86A 4HIJB 1F4YL 3C08H 5E70A 2MCMA 5F3BA 3TT3H 5HYJE 4LPYA 4PREA 5D7KE 5T33L 4ZFZA 2ICWB 3DSFH 5GGSB 4UQAA 1MQKL 2YFNA 2E56A 1YAIA 5AAWC 1HILA 2WXJA 4QHLA 3LS5H 1GC1H 3U1QA 1OAKL 3NESA 3KPRD 1SY6H 3EZJB 3QDGB 1HCZA 3DPBB 4UIKL 1J5IA 1YAZA 5EH1A 5EN3A 4PJFF 4Y9CA 4NFCA 1UM4H 3SDCB 2R8SL 4KK9D 3QNZB 2Y0SA 6TAAA 3B56A 4K7PH 1YLBB 4F58L 4LCWE 3TA3A 3GMQA 3VACA 3JV4A 4HDIB 2G60H 4W4OA 4NUMA 3IDJA 5DUBB 1MFDH 4JUSA 4JKMA 3BPNB 3F65A 1BFVL 5KSBF 3RFZB 2EC8A 5FUCC 1JV5B 2X4UB 1R3KA 1IGYA 4NKDA 2V2WB 4HIPA 1MPAH 3O3BA 1UVQB 2K3TA 4UDUB 3VRLE 4M03A 3DGGA 4JFXB 1NUNB 4U3HA 4BFBD 3KYAA 2XTJC 3HEIB 4G6JL 1ZTXH 1UC6A 4RISH 4AENA 5HY9B 3IU3B 3BIBX 1I3GL 1H6FA 1QUPA 2ALAA 4AH2A 1SXAA 4GP8B 4YBLB 3AY4C 2Z7YA 3F5WB 4PREB 4ZFZB 35C8H 4G7RB 1V8HA 1HILB 4L9LA 4QHLB 1MHCA 1X3DA 3J27A 5BVJB 2XACC 5C0CD 5AW2B 2Q8BL 4BSVB 3RTQD 1ACYL 2DL9A 2WLKA 4ADGA 1TZGH 1DBJL 2IBGA 4L29B 3WE6A 3ARFB 2RALA 4UT7L 4JPQA 1KXHA 5DJ6B 3WFDL 1AR1C 5IF0A 4TNEA 2E3VA 2P52A 3DECA 2A0LD 1TQBC 5LCVA 1KYOJ 4NQED 3MRLB 3IDJB 2AJVH 1NANH 4PLKD 1JPFA 2H2PC 3X1GA 3FRUA 3D0LB 5D1ZD 3D2UA 5IGXL 5EFIA 1R3KB 3BH9B 2KKQA 1IGYB 1IC4H 4PJIA 4YPGB 4M6MH 3BJLA 3MACL 2JI2A 2OKMA 3T77A 5H37G 4WV1B 5DZPA 3JWOC 1ID5I 2A6DB 4ZMOA 3P3RA 3AT0A 2Y1VA 3GM8A 4G82A 1MJUH 3B7RL 3GHBH 1I3UA 3E3QE 2P5PA 3O3DA 4P23D 3DOIA 1RUAL 4HWBH 5DZNA 1QI3A 3U2IA 3KGRA 4HMEA 1N7MH 4L9LB 4OCSL 1S7RA 1BEYH 3NRFA 4Z9KB 3T0EC 4FI8A 2H6PA 4K23H 2X6UA 1QLFB 2VDRB 2E6QA 5DO2C 4PB0H 1IGIL 3VI3E 4U6VL 1X5FA 4KK5D 3WE6B 4OD1L 1N3NA 4OJDH 4Y16C 5IF0B 3QA3B 2HVKA 5E4IA 5GRJL 4CW1A 1TIUA 2EDNA 4QTHB 1KC5H 1JXKA 3F8UB 3WTUA 4L1DA 1JPFB 4PJDA 3FRUB 1W0WA 3EOTL 4N2KA 5DMKB 1DTUA 4PJIB 3S4SG 3O6FD 2XJLA 4LVHB 1DJIA 1QO3A 2FJFA 5K33A 4WK2B 3UZQA 2WWMD 3T77B 5C0FB 1F11A 1V10A 4GRMA 3V0FA 5KEZA 3MJ9A 5IG7A 1DQVA 3S37X 1JCKA 1BVOA 2VN3A 5PCYA 1CFVL 1DBBH 1E27A 5L2KD 5FYJE 4TOYH 3O3DB 3IFOA 5HYSB 3ULVC 4JNXA 2WKOA 3U6RA 5JHLL 1DCLA 1XBRA 2OA9A 1OAJA 2YD8A 3GSNL 2G3ZA 2EACA 1S7RB 5JYMA 4UZGA 1F1AA 1ZS8B 4P2QB 2CD0A 4ZO7A 4JHZA 3SE9H 5HYJD 1NCCH 1SN0A 4ODWA 1BQLL 4Z7WF 3NJXA 2QQLH 4ISVB 2ED7A 5I74C 2DQGL 2EQDA 2XBZA 1NZRA 32C2A 2FO1A 3CZFB 4A2MA 4ELKB 4N1CA 4NO5A 1I8MA 1X9UA 4JN2A 1H6EA 2HVKB 1UJ3B 1JDCA 1KZYA 4CW1B 1JHTB 3K2UH 3MLXL 5E6SB 2Z92A 4MXVF 1ZLUK 4KROD 4XHJD 2VAAA 5DHDA 1EWHA 1W0WB 3QIBC 5HVWA 1KCLA 4G80A 1J48A 5E8PA 5T5FA 2ADJB 1OOAA 3UZQB 4F7KA 3O3AA 2EE6A 1INDH 3ARGC 1MQ8A 2EXYC 1XDTT 4L1HA 1U6AL 2QGBA 2RCSH 4C58B 1NSNH 4ZMNA 2FE0A 1II4E 4Z1PA 4ZTOH 3CFMA 1XR8A 3WFCL 3SE3A 5IEHB 3IFOB 3F7QA 3WEOA 5ILTH 3KCWA 4MA7H 5FO8A 3T0VA 3VGGA 4J4PC 3B9DA 2R29L 3HMXA 2EIBA 3A0OA 5D1XE 3QDJA 2H7WA 4MSWB 5FHBH 2R4RL 5GS0H 5L8JB 5LKNA 4DP2X 4EQ3A 3IAGC 2BY2A 1KV3A 1DE4A 2H5UA 3KYOA 4OLZL 3UBFA 4M9PA 32C2B 3W37A 1I8MB 4JN2B 1TZIB 5BZZA 4NKIH 5HHOA 4HAFA 2AJXL 3OLGA 3W2DH 2FB4H 3NSFA 5F71A 3QDMA 1KYDA 2Z92B 1OAUL 3VFUB 5JQ6L 5IHZB 4NBZB 3L48A 1NFKA 1EHNA 1KTCA 3QZWA 4LCUA 5T8IA 2I9TA 3PABA 2JSFA 4XC1L 5I5IA 5E8PB 3S96A 1BFOA 3CLFL 4NQCA 3O3AB 3VWKC 2FBJL 4OGYL 2IIJA 3RDTB 5HI5C 4LLDA 1KCSH 4KGLA 4KZEL 2YXWA 3HUJE 4Z7AA 3N6YA 3NPZB 2OJ1A 1LMKA 1QKZH 2VR7A 2ZWLT 3JWDC 1AE6L 3MCKB 2RB8A 1FVCA 3VFPA 4AEHH 4CDGC 2OS7A 3GSOB 4ZZKA 1HKLH 4FOMA 1BYPA 2H32H 4XBEL 3QPXH 1U92A 2GJ6A 2BIQA 4TSCL 5AVWB 3G6JE 3O0RL 4LAQL 4HUKB 4IRSD 1QFUL 3REWA 1OSZA 5DJ0B 4UT6A 2EIKB 5GGUA 3CUPA 1M9WA 4EBQL 1GHFL 1Q0XH 3G5VA 5IB4A 5HHOB 1FGVH 4MDIB 3VGBA 3GK8L 2N0MA 4AI7A 1KEGH 1ZDQA 3TNNB 3QDMB 3OMIB 2J12B 2Y2WA 3QR2A 1QR1A 4JRFA 3QFJD 2E4FA 2LFGA 1MAJA 4OZGE 2Z7ZA 2BC4A 2DYPA 4JRXB 3ZT7A 5C09B 3IF1A 3MV01 2I9TB 3PABB 4WWKB 3POCA 4HWUA 5IOPB 1YEDB 5IEKA 1XBDA 4KZDH 1BFOB 2BNRD 5EU7E 2Y07L 1SNRA 4AQOA 2P80D 2GABA 3KPSE 4LLDB 2JF1A 2A9ML 2PTVA 3LPPA 5K1NA 3RUGF 4N8UA 3ZXAC 5L7XH 2W91A 1BXVA 4NHUA 43CAA 4HPYL 2ICCA 4K2UL 5CLWA 1FVCB 1HH6A 1XEUA 3VFPB 3OAZK 1JWUA 4UNUA 4R7NA 5GIRA 4JHVA 5IQLA 5FYJD 5F8RC 1OP5K 1U92B 2GJ6B 3D30A 4IEFA 2P1YA 2VLJB 1ZLWK 3L3KB 1UXLA 3MJ7B 1AMYA 2ICEC 1OSZB 2G2NA 3REWB 3ZKNC 4HETA 4ZFFB 2I9LA 5GGUB 2VDNL 3CUPB 3KLSA 3US0A 2UUDK 3G5VB 3IJHA 3LZRA 2E7BA 3SYAA 5IB4B 1C7SA 3KAAA 1PF3A 5J1AA 1N59A 1JHLH 3A67L 4JLRA 5CF3A 3LRHA 1ZHNA 4X6CF 5D1QE 3CBRA 3V4UL 3SOTA 3BPLB 2BC4B 5E1QA 1B0GA 1NGQH 1WFTA 3D85B 3EH5B 3IF1B 4U6YA 4XPBL 5GRWA 5BZWA 3WEXA 3L4CA 5DFAA 4OF3A 5HVFB 2RBLA 4OAWA 3E80A 5B8CC 5IQNA 1NC2B 1P1ZB 4GRWF 1UGKA 4YHPB 3Q8BA 5AW0B 3QUHA 5CWSB 2NY5C 3UADA 1MCOH 4TUOA 3GPEA 2ZCHH 2PTUA 1T1WB 2YLKA 3ABLB 5IROC 3VG9C 1AKJB 4NHUB 3OR6A 1R19A 43CAB 1HH6B 5B1AB 3SY0A 1JWUB 2BY1A 4E36A 1KJ3L 4M5YL 3OZLA 3POHA 3EH4B 4QNPE 4YC2C 4QRSA 1BVLA 2QELA 5D8JL 5E6IC 2WLIA 1EUUA 3QT2A 1O6SA 1R3LB 4FLQA 4DOHB 3LRSA 5L2JB 2PWGA 1AZNA 3IJHB 3AQYA 3NH7H 3QJFB 5J6HA 2CDEB 2F61A 3IGKA 3E6FB 4PJCE 4FERA 3MKGA 3SPGA 1MCPL 1MAMH 1WT5A 4ZPVA 1FNEA 5LGHL 1KYAA 1AGEA 2HWZH 1B0GB 3KYNA 4U6YB 5BZWB 3BKML 2HH0L 3O4LE 3SPIA 4IGBD 3TYGL 2K45A 2E7MA 2D7PA 1IAIL 3G04B 3MRJA 5BRQA 4PJ6A 2ZKHH 3SPHA 2VMEA 3LQZA 4XWGL 4MASA 3T3ME 5DVLA 1ZT7A 3KPNB 1QNZL 4JDVA 5TF0A 3AJ7A 4ZMWA 2FHFA 3ZHKA 4H2CA 1OK8A 3QEHB 1A3LL 3KBPA 1BAFL 4OLXL 4GO8A 2H26B 1IGTB 2YA0A 4KXZI 4QOKE 3OR6B 5ADPL 1EVUA 1BSIA 4ODTL 4FF9A 1CXHA 1MFBL 1TVDA 2DKUA 1GZPA 4KTDH 1RU9L 2EO1A 3ASOB 4XC3L 3RKDC 5E2UL 1JFQL 4P4RA 1G5GA 3LRSB 4PJFA 1HHGA 4J2XA 1S3KL 2VLRD 3BLPX 1OP5H 2ERJB 4WFEE 2OMWA 2UXVA 2BW5A 3D12B 4ZSOE 3L5WA 1F8TL 3N44B 2AVGA 4P5KA 4UUJA 2X05A 2CSPA 2EKJA 4TRPH 4ZPVB 1PU0A 1TTBA 1WS8A 2EEAA 4JW3A 3UAEA 4WU7B 1AGEB 4QHUA 3U36A 1T7YA 3KYNB 1FFNB 4Z7UE 3MRJB 2X1XR 3MRRA 2Y7SA 2VQTA 3LQZB 2AW2A 3SPCA 4NZTL 3MXWL 1ZT7B 3OPZH 1YEEH 2JNZA 2OFQA 4ZXBA 3MAWA 5KW9L 4RGMB 4Y4KB 3JWDL 1PAMA 4M4RB 4LSUL 3IDYC 1NGPL 3VFSA 1CS6A 3KXFA 3NFNA 2X6VA 1IQWH 1QVOA 3VXUE 2B0SL 2UYLB 4PJBE 4YE0A 1TNNA 1T6BX 2BVOA 1JTPA 3K5RA 3N0AA 4N6RA 4YSPA 1HHJA 2A77H 2DM3A 3VB9A 3ERXA 4K5OA 2XPYA 1FFOB 1OSPL 2COVD 4HPOL 1CGWA 3CXDH 3ULUF 2XTSA 4PJFB 1PZ3A 1DDTA 5JPNB 2OMWB 2QSTA 3ARED 4KXDA 4WW2F 2HPOA 2HRPH 2FJSA 1XF1A 3K4DA 3L5WB 2IDSA 4UUJB 4P5KB 4N3TA 4WI0A 2NT0A 2Z34A 5C3TA 4FZEL 5KSBB 4QHUB 5ENWB 2VJ8A 3U36B 5DLLA 2ED6A 4QCIA 3ZQ9A 3SKJH 4I1PA 3MRRB 1VACA 1FNGB 5D1QD 1JK9A 3QUYC 4PBDA 5CEZH 4XCYB 3SYCA 2DQDL 1EFQA 3OHXB 4G9FA 1CFTB 5DC9B 4NM4L 4ZXBB 1AC6A 1WBXB 1B4RA 3FTYA 1WEJH 2JCCF 3RWDB 3VNYA 4E2OA 3EYVA 1JI1A 3BKJH 2QQQA 5L4IA 2P5EE 3VFSB 3AU1B 4EJ1C 3SE8H 3R0MA 3NFNB 5DHVA 4JFDA 1QVOB 2DBLL 2FO4B 3IJSB 2A6IB 3TZVC 4GT0A 3MFGB 1PZ5A 8FABA 2DTSA 2MTAA 2BVOB 1N5YL 4N6RB 1T83C 2J8UE 1M2VA 3UJTL 1HHJB 4YSTA 4XX1E 4OIIL 5D7SH 1DQIA 1CLVA 5TK4A 2ZYIA 4R4FL 2BHYA 4FYQA 1RP8A 2VXQH 2RTTA 4BINA 1AC0A 2AK4A 5AVVB 5JW4R 3B2VH 5FW6A 2ARJA 5SWZE 3KJ6L 3KJ4C 5D2NC 1A25A 3P9MB 5FFGA 4LASL 5FM5O 3BIAX 1MAKA 1S7UA 4JE4B 4JKLA 4A39A 5AZ2L 3MROB 4FQLL 4WI0B 3TH4T 2KDYA 5AKTA 4WO4C 1A6VH 4XOCA 1OP9A 4KVNL 3QQ4A 4QCIB 4NC1C 1VACB 1Z7JA 1GGBL 2UY7A 2IH9A 2X4OA 3O6LH 1HESA 2BRQA 2DI8A 1T0PB 2NY5L 1YNLH 3BGAA 4ZOBA 3OR7B 5D7JD 1DFBH 4X4ZA 5HHXL 3PXHA 5ANHA 4A6YB 3VGFA 3EOAB 3IS0X 4P2QD 2N7BA 1EDYA 3IRZA 4FKHA 2VC2L 5DHVB 5HDWA 1U41A 4WEEA 4YL9A 2PWFA 1FG2A 1RFDL 3HBZA 1SYVB 2PP8A 1D5IH 1PZ5B 1W91A 4PJXE 1H3GA 4L23A 4QOKD 5EC2A 1ZTXE 4F7CA 2ITDA 1SDYA 1KT2A 4Z7WA 2VLME 3GO1L 2AK4B 4HKZB 1OVZA 2VDMH 3QIWA 4LF3B 3T2PA 1KV7A 2LV4A 3M46A 1M7DB 3QRBA 1LNUA 1OSYA 4FHJA 4EUPH 2AGJH 4XMZA 2YQGA 1I8IA 4L1SA 3WO4C 1NKOA 3NFPA 2KH2B 2FX9L 3V9CA 4AXWA 4AQ8A 4NWTL 3SDYL 3VRJA 3WMPA 4QRFA 5CFHA 4WFED 4R0LC 2NR6C 1AHWA 4TXVB 3QO1A 1M71A 2YEQA 3EGSB 5A2AA 3DX7A 2F5BL 3GWJA 5H37H 3VO0A 3TOPA 4UINL 1QYGH 3G5XA 2UY7B 5HDBE 2DLEA 2WVVA 4OI8A 4L5FE 3SZKC 1HWHB 4R5TA 4NJAH 1MHHA 3Q2WA 3P11H 2HJLA 2IANA 3RA7L 1T7ZA 1ETZA 1F4WH 5BS0E 4J2QA 1ZHKA 2CDFA 2W38A 5KG9B 1XF5B 2VXSL 3ABKB 4WWPA 3CC5A 1FG2B 4JFVA 3P3TA 1MXGA 3D9AL 4XMLL 4YHYC 2B9AA 1T5KA 3VA6A 4P2RA 2NXYC 2DMBA 3VXUD 5EC2B 4F7CB 3M8OH 2Q6WA 4Z7WB 2E7CA 3AQXA 1U8HA 1H8OA 3LQAC 4P3CH 1XZ0A 4N6QA 4I3SL 5E1IA 1CIDA 5K39B 4G8FA 4A37A 1EEYA 3VD7A 1LNUB 4Q6IB 2ATPB 2DDQL 3FUFA 4HS8H 4YAQA 4BJLA 2VUKA 4B3EA 3A23A 4K3JH 4NRYB 4AXWB 4FQ1L 3JSSA 5ID1A 1A1MA 3HAEG 3LNDA 4JN1H 4XZUA 5GRVK 2ZG2A 4FCHA 1AHWB 4ZMZA 2X2YA 3QO1B 1TLKA 4W70A 3NG5A 2V5YA 3DX7B 1CXKA 1ANUA 3V5DA 3S8WA 3VD9A 4RAVB 4JM2C 2DYRB 3ZTNH 1OM3H 1TQWA 3BWUF 4F2FA 2EDYA 2XLLA 4ZX5A 2C1OB 4CMMA 5A6MA 4S0SD 1ETZB 3GEFA 4JPKH 4N2MA 1IC5L 1ZGLA 1ZHKB 5AVZB 4G3YH 4FQXA 3NIFE 3PLYA 1F4YH 2WSDA 2N1TE 2CUAA 4DCQA 5T33H 1NPUA 2P5ED 4NRXA 1BDYA 4P2RB 1MCIA 4BH7A 4ZS6C 4OUUA 3WNPA 3HLAA 3JBG7 1CPUA 1IX2A 3QI9C 1DCEA 1OAKH 5E24E 3SQOH 3V52H 3GBLA 4ZW8A 3VMNA 4LMQI 1XZ0B 4YK4C 3EXLA 2XN9E 4JRXD 1VZGA 6PAZA 5IQ7L 2G9HA 3WAKA 4PTUB 4F58H 1KGUA 2PW2A 1UYWL 3G9AB 1DL7H 3KPRA 2K4WA 5SWZD 5ID1B 5J3HD 2NY1D 1DQLL 1QHQA 3B9AA 2PO6C 2BWDA 2BDNL 3WENA 1BFVH 2EH7L 2J4WL 5EEUA 5DO8A 3WFBL 3ZZLA 1S7VA 4AQAA 1RK7A 3KL5A 3P9LA 2DBJA 5F7LB 5GRZA 3EFOA 2XVBA 3UZEC 1MWAL 5ABDE 2VAJA 1HH9A 4X5WB 1CLCA 1QI4A 2B15A 1TSHA 3FONA 4YFLI 1VFUA 1D9KA 5E6YA 2OCFD 1HJBC 1GS6X 1I3GH 4JRYA 4N0RA 2PYED 4KXCA 1JMXA 4L37A 2G30A 5BZDA 1FL5A 4LBEB 1ZE3C 1BZQK 3TNMA 4DCQB 3KDPB 4XXWC 5JW5A 2BSED 3T6WA 4NRXB 4J3UA 4QI3A 4BH7B 2VXVH 3NGBC 3UMNA 4U0RC 4OUUB 3B9EA 2JTDA 2VKWA 3RP1A 5MI0C 1RHFA 3BCFA 5C7ZA 1MJ8L 2WNXA 2HX7A 5IVZA 2MPAL 1Y7VA 3LRKA 1DBJH 2G9HB 4UT7H 2VLMD 3NUKA 2E27H 4U7SA 2V37A 3WFDH 4J1UA 4TLSA 5T1KD 2PW2B 5C0CA 3OF6A 3RTQA 1PPIA 4BZ1A 2WKGA 2NY2B 4KX8A 4OM1L 1JTOA 3CFEA 5GZOD 4M93B 1JP5A 4OFYD 2P8LA 3GC3A 3JTTA 1IM3B 2VSKB 1CB4A 2EYTA 1E67A 4XPHL 4AQAB 3H9HB 3GHEH 3TEYA 3P9LB 3W81A 1IAOA 2Z9TA 3EFOB 4KQ0A 4NQEA 4ABVA 3D4CA 3MACH 2OXHA 1JYXA 1HH9B 5KZCB 3FONB 2R39A 3L3HB 4GYBA 2WINA 5E8NA 4PY7A 1D9KB 1MFMA 3L4VA 4HZAA 4MA1B 2VO8A 3RUGB 3K6DA 4WI6A 4LE8A 4JRYB 2UZYA 1P9MA 3U6XS 2GITA 1ZVSB 3GIVB 3TNMB 3RU8H 3D33A 3V0DA 4CJ0A 2Z0UA 5DURD 5BS0D 2I7SA 3MUJA 4OCSH 1TZOA 4CSSA 4Z0XB 1TO5A 5B3SB 4YZWA 2YD0A 3FXIC 3PL6A 1Q0EA 1IGIH 5IVZB 3ISYA 1CTNA 2BSSA 1S78C 2P46B 5KJ4A 3TCTA 3UJJL 3ARZA 4BGLA 4OD1H 5IQOA 4J1UB 4L4VB 5GRJH 3CMOL 1F45A 4X6CB 2R2HA 2DJMA 2FYYB 1Z9MA 1NFDA 2JJUA 3CFBA 3CFEB 2J56A 4GFXA 4KO6A 4QHNB 3GJFK 1M57B 3JTTB 3K0YA 4IOIA 4ZMLA 1ADQA 4QNPF 2H3NB 4PGCA 5FYLH 1I7ZA 1PCXA 2EYTB 2J43A 1AQDB 1JDAA 2XWDA 1KCWA 1IAOB 4AMXA 2NW2A 2YZ1A 4KFZC 4DEWA 5HXMA 1XEDA 4LNVA 5FLVA 4GRWB 3MR9A 4BA0A 2J6EL 2WINB 1MCNA 4PY7B 5HHPA 3WTYA 3HI6L 4H7VA 1CFVH 4XAWL 4KRPC 1WFOA 4Y1AE 4M7ZB 2VH5L 1TTRA 3F05A 2OJEA 5CFAA 1NMCB 2AMUA 2GITB 5EN2B 2NY3B 3KBFA 3BD4A 3VFOB 5JHLH 1L5GB 3W5MA 3GSNH 4FZ8H 4G9DA 5DVKA 4LEEA 1W0VA 2RR3A 3O3EA 3JTSA 1LLAA 2WYZA 3T3MF 4LO9A 5EO0A 1BQLH 1TO4A 3QUMA 2FJHA 5LAPA 1CTOA 1IBGL 2B1HH 2V7HA 5CKGA 2DQGH 3L3DA 5D2LF 1V3JA 1JJUA 1KGJA 3IJ8A 4KNSA 3SKMA 1EBPA 3AS2A 3WNNA 2ENJA 2IF7A 2DJUA 5CEXA 2L8AA 3MLXH 3CFBB 1YEFL 4Y4KD 4XN4A 3KEHA 4BK8A 1XGPB 3RPBA 3H53A 5AAMA 3ULVF 3P02A 4PGCB 3DJZA 4PI0A 4WTXA 4BE5A 2IDTA 4JFSA 4P2OB 4Y19E 2OMZB 1F2QA 4HK3J 5F7EH 1HHKA 4H4NA 4DP0X 5HHPB 4JS7A 3F84A 4LCWA 3O6KH 1IAIM 1GYWA 4HUUA 5HHME 4JGJA 4P57A 3UBGA 1IM9B 1GZHA 2Z31C 5JORA 2OJEB 3HR6A 2QJDA 3RY6A 1HYSC 4MA3B 4RQQA 2VQUA 3E8UL 1U8LB 4FXGB 5I1GH 3O3EB 2ZKXA 2D03L 5EO0B 4TV3A 2R4RH 4WEUD 3FT3B 1DQJB 3QUMB 4F24A 4OZHF 3HS0B 4KY2A 4OLZH 1BW8A 1BVNP 4GAAA 1M4KA 4GBXD 3SKMB 4B50A 1G6RA 1WF5A 5DMJB 3JZYA 2AJXH 4TM9A 3V7AG 2Y3NA 4CBPA 5ISZB 5CEXB 5I0ZA 3AAZB 5KUKA 3DLQR 3TO4A 1OAUH 1JF1B 3HPLA 3DX9A 5JQ6H 3D09A 5AYQA 5IJBC 2DMGA 1FNLA 1BMWA 2PPEA 5L8LB 4OFIA 1EDHA 4PM1A 4XC1H 4O02B 5DJCA 2GBUA 2MQ3A 4JFEE 2YMTA 2PKDA 1JOIA 2FBJH 2UZIL 1N2RA 4OGYH 1GYAA 2DKSA 4AGPA 4NOBA 2NY0C 4MBOA 4HS6A 3Q06A 2N0KA 4KZEH 1KLUA 4HUUB 1XFPA 5EB9A 4Y4FD 4P57B 1QBLH 2OJZH 3RWFA 5JORB 2NTFA 1AE6H 1DVQA 3BAIA 3OSKA 3MO1A 3ARPA 4RQQB 4KI5E 1L9NA 1SMDA 3CH8A 5DZLA 4JDEA 3ZGIA 1UD3A 4BFIA 3AXHA 1D7FA 4XBEH 5IP4A 3N3EA 3NZ8A 4TSCH 2BY0A 5TFSL 4LAQH 1F4HA 3O0RH 2FLRT 1QFUH 1IT9H 4NAQA 3S4SB 4F7EA 4NO0A 3VXSA 3QNXB 3NEXA 4EBQH 2A73B 1GHFH 5ID0B 1G6RB 4WW2B 2NNCA 4M8UA 3GK8H 4JVUA 3TXAA 3TO4B 4M1CC 2VWEC 3DX9B 2F7OA 3L17A 3I9GH 1B9KA 3GMMA 1PYWB 5D9SB 4X4YA 3CDFA 2GSMB 4UM9B 2XKNA 4KDTA 5C70A 1MCRA 4MKMA 1XCQA 5HJBA 3VXQB 3VI3A 4U3XA 2Y07H 4OQTL 1CJYA 1XXDC 2P24A 2R27A 3QUXC 3VD3A 1T21A 1N2RB 2JCCB 3UAJD 2MCPL 4H20H 1UB6A 2WKLA 3LKSA 2NQ3A 3MLTA 2APWA 2A9MH 4HS6B 3SE4A 1SBBA 3PWPE 4RZCB 2F74A 1PTZA 3BSGA 5IFAH 3IGAB 1AJ7L 1LO2H 2PLTA 3ARBC 3RGVD 4HPYH 4K2UH 2P80A 3MO1B 4YVNA 2A74C 3DURB 2ZOUA 2NX5D 4BFIB 5AOZA 4FL4B 1A7NL 1MWOA 2EUZA 1G7LA 3CFKB 4KKRA 3GBDA 4PCSA 5E03A 5KYNA 1UHVA 4ODBD 4F7EB 5CD3A 1J8HE 1H3WM 1V7MH 4NO0B 1T5XA 3TP4A 3VXSB 3VXME 2VDNH 1FSKC 5KN5A 4Z7OE 5CCKL 4TYUA 2WM0A 1FDLL 3IDMA 5AZUA 1KLFA 2BIMA 3D52A 4IOFC 3EH2A 3A67H 2PCFA 5BVPL 3O45A 3BAEH 5JIPA 1QFOA 4OJAA 4PV9A 3IE9A 4QRTA 2ESVE 4N1EA 4EDXB 1RUKL 4XPBH 2JB6A 2ZPKL 3GXDA 5H4YA 4OZ4A 2TRHA 1I85C 4G43A 3FQRA 2P24B 4XNUL 2B77A 1T21B 3U1SH 2ROXA 2OBGA 2FEDC 2YFOA 3DX6A 2WOBA 3MLTB 2QVFB 2YD5A 1QNIA 4L2LA 3W9EA 5T3XL 1UENA 1R17A 1NGWA 4Y19D 3LKRA 4O9HH 5K93A 1IZJA 1A3RL 5CEZE 3O9WD 4GQRA 2WBJC 4LB8A 1KJ3H 1XGRB 4FLRA