3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
molecule keywords Azurin
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
1AZUA 1J9SA 4E9TA 1ZDQA 3N55A 2MRYA 5I5JA 2QDWA 1BEXA 3X1GA 3UACA 1KDJA 1JXFA 1VLXA 2FJSA 4TXVB 1AR1B 1HAWA 4KNUA 4YL4A 3FSAA 5D4JA 1KBVA 5TK2A 1J5CA 2Y1AA 3KW8A 1L9SA 1KBWA 1WA1X 3S8FB 3PLYA 2ZONA 5AKRA 2VN3A 2UX6A 1EZLA 4G7RB 2JXMA 1NINA 2PCYA 1PAZA 1J5DA 2FTAA 1NWPA 4BDVA 1AZCA 1KCWA 1PZBA 2BWIA 3EH3B 1BXAA 3X1BA 4A2HA 1L9PA 2BWDA 3WG7B 2B08A 1HFUA 1KGYE 4DPBX 4DP8X 1OF0A 1PF3A 2PLTA 4GYBA 2I7OA 3NJFA 2JKWA 3TU6A 2VSKB 2VW4A 5I6MA 2OV0A 3PAVA 4E9XA 6PAZA 4FAAB 4G7QB 1SHXA 1ILUA 2FT7A 2FQGA 4A2FA 1OE3A 3GXUB 3V9CA 3X2QB 3JT2A 5AZUA 3WNJA 4EF3A 1NZRA 2GB2A 2YAEA 6PCYA 2P80D 4GP4B 2DWSA 4YSQA 2TSBA 5I6PA 4G70B 5B3SB 3OMNB 4GXFA 1XMEB 1IBZA 4JKNA 2YXVA 1ET5A 1PCSA 3DTUB 4HHGA 3S3BB 2DV6A 3CVDA 4X4KA 3PXLA 1OV8A 1L9QA 1SFDA 2GC7C 1JZHA 3MX0B 2Q9OA 1BXVA 2VM4A 2FT6A 2HRGA 2XXGA 3NJHA 2B3IA 4DP5X 2J56A 1MG2C 1SNRA 4HCGA 4NAJA 3HB3B 3FSWA 4PCYA 4HCIA 4ZK8A 4L0PB 1ZDSA 1OCCB 2IDFA 1CC3A 3UAAA 2CALA 3TASA 1JZFA 1BYOA 1ET7A 4YSPA 4F2EA 2PCFA 4YSUA 1TEFA 3FPYA 7PCYA 2RACA 3T9WA 3NSCA 4YSDA 1NIDA 1RCYA 2EILB 3DKHA 5B1JC 2UXGA 2BHFA 2XU9A 3PPSA 2VM3A 3IBOA 2VSMB 4KOCA 4QLWA 1CURA 1JZJA 4G7SB 4A68A 1SJMA 1X9RA 2PP9A 1E67A 4N8UA 3OMAB 3X1NA 1ETJA 4AZUA 3ABLB 2X87A 4DP6X 2UXFA 1N68A 4HCFA 1ZV2A 2BW5A 2DYRB 4JHVA 2XUWA 3NJMA 4GP8B 5I5IA 4BWUA 1ZIAA 3CZUB 5I26A 3U25A 1ZPUA 3CG8A 2HRHA 1ASQA 1CUOA 2HX9A 2BP0B 2UXVA 1KV7A 2PP8A 3BQVA 3CVBA 1URIA 3WNIA 1AZBA 3H4FA 1FFTB 2CJ3A 1AG0A 2DY2A 2XXFA 3NP4A 1FWXA 4YSEA 5I6LA 5I6KA 5B7MA 3H56A 1BQ5A 1OCRB 2HX7A 5PCYA 3EHBB 7PAZA 5EHFA 1PNDA 1PLAA 4HALA 4E9VA 1ZIBA 4UANA 4QKTA 1IKOP 1ASPA 1WA0X 4CSPA 3T6XA 4E9YA 3T71A 2ZXWB 4KO9A 2XWZA 3FS9A 1NIAA 2IDQA 3OQRA 3AG3B 1AAJA 3DIVA 5B7EA 1NPJA 2AVFA 3QJTB 5B1BB 2XLLA 2HX8A 3UABA 1PY0A 1BAWA 2BZ7A 4P5RA 1XB6A 1IUZA 1IC0A 2WO2B 1GS7A 3AG1B 4DP9X 4DPAX 1M56B 3T6WA 3ZX1A 1I53A 4DP7X 4BWTA 2HLEB 2CUAA 5A7EA 2R7EB 1TEGA 3QJQB 2E86A 1E65A 3UAEA 3ERXA 2JFCA 2YAQA 3D12B 2IWKA 1PZCA 3NSDA 4DP2X 1JVLA 1OCOB 3GDCA 1NIEA 1TKWA 2FQFA 3N2JA 2Q5BA 1KCBA 2X88A 2TSAA 4UF7C 2EIKB 1YLBB 2IDSA 1A8ZA 3FQYA 2YAPA 2GC4C 3NJIA 2I85A 2XV2A 1NWOA 1BQRA 2CCWA 2ZWNA 2GHZA 3X1EA 1AS6A 1A4CA 1PZAA 8PAZA 3NYKA 3EF4A 4BXVA 1SDDB 3HEIB 1IBYA 1GS8A 1W8EA 3UGEA 3CDZB 5I5MA 1R1CA 2DYSB 2OCCB 2QT6A 4WKXA 2J5WA 1J9TA 4K9JA 2CAKA 2CBPA 3PAZA 2PPDA 1QHQA 3NJGA 1GYCA 2FQDA 2A3TA 3NSFA 1MDAA 3QJSB 2VMJA 1AG6A 5F7AA 2AANA 1FA4A 2IDTA 1M57B 5E9NA 4KO5A 1RKRA 1X9UA 3NT0A 1CYWA 2XV0A 3WKPA 1KDIA 1ET8A 2GBAA 1JERA 2FWLB 1RZPA 3NSYA 2YAFA 3ABKB 2BZCA 4YSOA 4DPCX 1SHWA 2DWTA 3IN0A 4BDVB 3ASOB 2PPFA 2I7SA 4A66A 1J9QA 3RYMA 3ABGA 4KNSA 3FPXA 1BQKA 4W9ZA 2GI0A 3FQ2A 4BXSV 3AZUA 3IEAA 5D4HA 3FQ1A 4DP1X 1NIBA 2N0MA 2BP8B 2R7EA 3WIAA 3TBBA 2AFNA 2PPCA 4A2GA 1BYPA 4YSRA 3FT0A 3KW7A 1AANA 2EIMB 3NJKA 3CDZA 2IH9A 4HIPA 1AS7A 1OE1A 4BWWA 4YSAA 4Q8BA 5TK4A 4MFHA 1F56A 2AZUA 2XX1A 1GS6X 2BO0A 1WAEA 5F7BA 1N70A 2GIMA 2IH8A 4YVNA 2AZAA 2YAHA 1BXUA 5I6NA 4HZ1A 1GR7A 2NRDA 3QPKA 3C75A 3FYEB 1PNCA 3H4HA 4PAZA 3SBQA 1E5YA 1V54B 1UATA 3UADA 1JZIA 1OOWA 1AZNA 3FU7B 3G5WA 3QQXA 1GW0A 1SDDA 3EH5B 3OM3B 2UXTA 3NJJA 2HXAA 2YXWA 4A67A 4UAHA 2H47C 4JHUA 5D4IA 4M4RB 3FYIB 1XB3A 3S3CB 3AG2B 1E30A 1AS8A 1AACA 2LLNA 4A2DA 1JXGA 3FU7A 5B1AB 4BK5C 2H3XC 1SFHA 2XYBA 1L9TA 3T6VA 5B1KA 5AFAA 1MZYA 2PPAA 3ABMB 1TU2A 5I6OA 1ILSA 1NICA 2YAMA 3AG4B 3EH4B 1XB8A 3MBWB 2QPDB 2PPEA 5LDUA 2H5UA 3L45A 2W8CA 1E5ZA 2FT8A 1A4AA 1DZ0A 1JVOA 5PAZA 1OE2A 1PLBA 5FC9A 1M9WA 4DP4X 2EIJB 4AKPA 2IAAC 4FA7B 4E9WA 2VW6A 1JZGA 1PMYA 2BP8A 4AI7A 1AZRA 3S8GB 2IDUA 2YARA 4N4YB 2VW7A 1NTDA 4CSZA 2EINB 4NERA 2WSDA 1GY2A 4ENZA 1A3ZA 1JXDA 4NB7A 1PLCA 4KNTA 1A65A 3X1FA 3FSVA 3CVCA 1B3IA 4M3HA 2FQEA 1KYAA 1QLEB 1MZZA 2FNWA 2WO3B 4Q89A 1V55B 4AKOA 4YVUA 5ANHA 5IY5B 1JZEA 3BVDB 4E9SA 3S3DB 1JOIA 1EHKB 2HZHA 1OCZB 1ADWA 3WKQA 1J9RA 3AW5A 1L9RA 1V10A 2PP7A 3QJVB 4G72B 4WTQA 3PAUA 2XVBA 4A2EA 4E9QA 4AX3A 4G71B 1NPNA 1AOZA 2XV3A 2Y69B 4GY4A 4KO6A 1QNIA 4KO7A 3FSZA 1WA2X 1MG3C 4RH4A 1GY1A 4W1TA 3ZIYA 1L9OA 4AKQA 1W6WA 3SQRA 2YQBA 2XX0A 3QJRB 2OJ1A 2J57A 1WS7A 2QDVA 1GSKA 1NDTA 4F7KA 3GYRA 5B7FA 1WS8A 1ID2A 4YSCA 2J55A 4KOBA 3TBCA 4DP0X 1A4BA 3AY2A 2BP0A 3FU9A 2ZOOA 3NP3A 3OMIB 1HAUA 4F2FA 3SBRA 2UX7A 1ASOA 1NIFA 1RZQA 1W6LA 4HHWA 5B1JA 2QPEB 1DYZA 4YSTA 3T6ZA 3IN2A 1SF5A 4P5SA 2IWEA 3OD3A 1T5KA 2W88A 2GSMB 2MTAA 3QJUB 9PCYA 3JTBA 1AIZA 3WI9A 3ZBMA 5I28A 1AQ8A 4E9RA 3NJNA 3V9EA 2P80A 2BW4A 3TA4D 1CYXA 4HAKA 3IE9A 3FU8A 3NJLA 2IWFA 3SBPA 3ZDWA 4YSSA 1SF3A 3ASNB 4GP5B 2YAOA 3PCYA
chains in the Genus database with same CATH superfamily
1J9SA 1H3TA 3WFBL 4JY4B 1MUJB 5A6IA 1HHJB 3FTGB 5I18H 2VJ8A 5AB2A 1ZT7A 4P9HH 4BJLA 1QRNA 3B2VL 2D8KA 3D8MA 4KNUA 4ORGB 5IHBA 3EXLA 3FSAA 5D4JA 1KBVA 5AAWC 3RX5A 4CKQA 5F1OB 3IGAB 4P46C 4WFEE 3CVIL 2YEZB 4X6FA 1KTDA 4I2XB 3D25B 1M7IB 2WBWB 3Q05A 2OX5A 4B0MB 2H2PC 4JPSA 5IJKA 3MBEA 1FL5A 4AYEC 4HWNA 2OYMA 3X1BA 5BW7C 2ZD0A 1LNUB 1UYWL 1DBML 3ZQWA 1KIPA 1KIRA 2ROXA 4PD4K 1X6NA 1MIEH 4DP8X 2BVPA 3EBIA 3VFNB 2EDTA 3G9VA 1UWFA 1REIA 4GW5A 5C0FA 1H0DA 4XPBL 5EU6D 1T3FB 1ZS8A 3HZVA 2IQAB 3BXNB 5DT1L 3TJEH 3BRGC 4XO9A 3KPQB 1BG9A 4Z5RA 1KJMB 4UM9A 5HHNA 1AKJA 4WK0B 1TITA 1KJ3L 4J4PA 5IR1A 4F7PB 4CN1A 2HTLD 1NFDE 1I1AD 3VRJB 2N3JA 3A24A 4QTHA 1QO3B 3ELQA 4BQ8A 4XMUA 5B3SB 5HI3D 4BFIA 2JB5L 3DI3B 1QVOB 3RKDC 2WLIA 4GBXA 3QIBD 3MRCA 2IGLA 1F45A 4XWOC 2PXYC 4GIAA 1FNAA 2P24B 4HGKC 2OMWB 4C4UA 2VDQL 3V6FA 4WW2C 1D6EB 1D5BA 1HSBB 2XA8L 3LSOB 2R23A 1WBXB 3GC3A 4RWHA 3UTZA 5JPMB 2BY0A 1IL1A 5JA9A 3ULVH 1JK8B 1UJ3A 5HHOB 2ZXCA 4J2QA 3V10A 1ZDSA 3H2WA 2YD5A 4FI6A 3PGFH 2CIKA 2X4TB 3K72B 1SOXA 3BP4B 3APNA 2A99A 1MCKA 2YUVA 3EOAA 5AYUH 1BM7A 4J8RB 3ROLB 2VERA 1MHCA 2QQLH 5D1ZC 1AZZC 3KDMB 4M48L 1DJHA 1KLFB 3BC9A 3FC8A 2NW2A 4L3EE 3UZQA 1FG9C 7PCYA 3GMRB 1QPKA 1WSST 4Z7UA 3JUZA 3QRFM 2WTRB 5D5ME 1U8CB 3K0WA 4OR1A 2P8PB 4YX2H 2NUPA 1IBGL 2H45A 3O2DH 3CGTA 4XGZB 1MLBB 3PPSA 3DSFH 5JHLH 3VXUB 2UY7B 3DHPA 3GNMH 1KGCD 4JFFD 1XF2B 5AWNH 5FA4B 3GI9L 2BSTB 1HH6B 1VFOA 4M5YH 1MREL 2CA4A 4XVOA 1ZV2A 1ZJAA 4L3EA 4PRIB 1Z66A 3NQKA 4HAFA 1WF5A 4HZLB 1E9OA 3AREA 4QXTB 3ZJAA 1BA9A 1RUML 5H37G 5MEOA 4UOW1 2V17L 5C0BB 2YPLB 3U4BH 1EPFA 1MN4A 1QATA 3RZCC 3CZJA 4KY1H 4AL8C 4Y1TA 4O51B 4LAQL 1X9QA 1FVCA 2JJTA 4XMXA 1JFHA 1Q0YL 4OLUL 4HZAA 5DHYA 3VSTA 3WJLC 1CBJA 4EUPB 1NA8A 2HX7A 4K55A 2BHYA 2Q20A 3LEYL 2X4UA 4RGNC 3B9KA 4I0KA 1EUUA 1ASPA 1E40A 1RZGA 1WA0X 3OKOA 5T1LA 3T71A 4M5TA 2ICWB 1OAUH 3BUDA 3E6FB 4PRDA 4R0LA 4LOFA 4HHAA 5HHOE 1F4WH 5FB8A 1INQA 2ARJB 3BWUC 4HUUB 3O4LB 3SHSA 4LLYA 2VR6A 2WLZA 4U6XA 2HX8A 1X5MA 4LKCB 5BS0D 3EBGA 2AAAA 5AOJA 4AGMA 2GG1A 1CDYA 1PJWA 3E2HB 1FN4B 3GI8H 4YDVB 4DP9X 3IMWA 4DPAX 1M56B 5AD0A 2J4WH 4B7LA 4M1CC 2AI0H 3FO0H 5BOJA 1XTLA 5EO1A 2CUAA 5FLVA 1BFTA 4L3CB 2PCFB 4AXWB 1ZMYA 5JHDE 4ODXA 1MCCA 4MXQC 4ZUUA 5FDWA 4U2YA 2DI7A 4XMLL 4OGYL 1P6AB 3U1QA 2KDYA 4N1HB 2JWYA 5GS0D 2ZQKA 5CEYA 1E9PB 4ZDHB 1B0WA 1SY6A 2V0AA 3BKML 3DK0A 2IDSA 4YDNA 2BSEA 4OQTH 2YLKA 4U1HA 2YAPA 1YNKL 2GC4C 2XJLA 3LEVH 4KDTC 2BVPB 5T1KB 2JQAA 2HT2D 1ANUA 1SZNA 1TEYA 2E7BA 3Q0HA 4IMKA 2WZ6A 1X7SA 2ATKB 2Y1YA 4NCDA 2KZWA 3RL2B 5T3XD 3WFDL 2CR3A 2ZCHH 4WO4C 3TT3H 5L0QC 2PXYA 1HHHA 1B0RB 1BDYA 3QJOA 1MCBA 1U92A 3GIZH 1YEDB 4LPCA 3ZHLA 4P07A 2P46B 3LPFA 3E1F1 4N2LA 4FMVA 4O9HL 3VWKA 5B3NA 3QCVL 1P7QA 4PRID 3DYMA 4DQOL 4YZFE 3TS8A 1XF2A 5F7AA 2RFXA 1UB5B 4GSXA 1E3FA 3KPPB 2E75C 3FHAA 3MRNA 1BJ1H 2XRAH 2Z31D 5ALCL 2X0WA 5T3ZD 3QIWD 1FPTH 5EOTB 5CEZL 3WSQL 1HQRB 3OQ3B 4JE0A 3U9PH 4KJYA 2D7PA 3T0BA 3TX4A 1CLZH 4ZUSA 5KVEL 5KYNA 1UA7A 3B3BA 4CVUA 1OM3L 5KSAC 5CCKH 2AJZA 2DBLL 2DWTA 1YJDH 4ZW5A 5IMLA 1XSIA 4BDVB 2OR7A 1AQDB 4Q9RH 3FCUB 1J9QA 1GGIH 3GSNH 3HE6D 2XKSA 2QSTA 3PRZA 1E42A 4J27A 3CIAA 4RGND 2CO7A 2XC8A 3OGCB 1TETL 4N2KA 2PW1A 4X8JA 3IEAA 3FOMB 4OZFG 1I8KB 2ZUQB 4FLQA 3W2DH 3DX3A 1AXTL 1C5BH 2GBTA 4LMQI 4XOAA 3MNDA 4RRPM 5JXED 1PZDA 3VI3E 1DQTA 3IXTA 1OWRM 1CTNA 5AAWA 1AS7A 2A6JA 1CGWA 2EEXA 4QRTB 2AZUA 3NFPB 4L5FH 4PJ5D 5IWLA 2WBJB 3MRPB 3ZY7A 4PR5B 4EUPG 3RG1C 5KN5A 1F4WL 3MUJA 5JDSA 1Z5LB 4X8XA 4Z1PA 1INQB 2ARJA 4W70A 2ADYA 3CDFA 2MHAA 4OLWH 3C75A 3FYEB 1MWOA 3KPTA 3MJ7B 1JK9B 3QZWG 4GRLC 3U4EB 3H3BC 1TLMA 4HETA 4Z3TA 5FW8A 3BZ4B 1Z7JA 5J12B 3GSOB 4BA8A 4FEMA 3STLB 1U8PA 3CFQA 2L7UA 2VO5A 3EH5B 3QUMB 1N59A 2O4EA 4KY1L 1WEJH 4RFNC 4PJ7B 2ITCB 4FQXC 4EOWH 3BPLB 5LG1A 1YEEL 4Z7WE 2EDEA 3QYCA 4KKBD 5CBAB 3L4YA 3S2AA 3VB8A 3U7WL 2H3XC 3K4DA 4OGXH 2PPAA 2Q3XA 4EN2A 2HYMA 4N2CA 4HJTA 5I1IH 1N7ML 4IRJC 1HKFA 3BGFB 2H2SC 3B8YA 1EHNA 1CLOL 3UROR 1INEH 2OA9A 4I2XA 4MD0A 5LO7A 1QYGL 4E0RA 1H8OA 1HZKA 5CN2A 3CDGB 1PX4A 5F6IC 5HYJA 5A2LH 4DH2A 1N2RB 2WUBH 4MA8L 3KCPB 3RKDD 5IJCC 4ODUB 4XNMA 5EEUA 3RILA 1PLBA 3SDXE 2X1XR 5HHXL 1BMGA 4L37B 2WN2A 4UV7L 4MXVF 5AKSA 2HH0H 5AD0B 1EEZA 4J8QA 3VXUD 3VGEA 4PEEA 3LNFA 3L4UA 2HVJA 1ZGLP 4LLAA 3QB7C 3VI3B 1NFAA 3SYAA 4MB3A 1CT8A 4UQ2B 5C7XH 1NTDA 2XKNA 5DK0B 2EINB 3HE7A 4PIBA 1VPOH 1S5HB 2R29L 1NFIA 3WIIH 2RALA 4BE5A 2OI9B 4OF3A 4ZO6A 2F0CA 2WY3B 4JCWA 3RX7A 4HUWB 5F9OH 1B3IA 3ESPA 1KYAA 4TVPL 4KRPC 2FNWA 4U4BA 2EDJA 3D30A 3CQFA 4NI6A 2B2XH 2FWUA 35C8H 5IB5B 4QHKI 3RJOA 1MFAH 2C1OB 4YS4A 3BVTA 5I8CA 4FMKA 3W57A 2BNRB 2PYEE 1EWHA 1NCIA 2I24N 2OMWA 4GMSH 4YGAB 3VFSB 2VN5A 3H55A 1AP2A 3TONA 1T2QH 5GRXG 5H2BB 2XIBA 3JWOC 5CLTA 3ZSSA 2P44B 5E9AA 5HYJE 3VSQA 1P1ZA 5JNYB 1YEWA 1TVHA 5AZEH 4QF1B 5C0EA 1QZNA 1E4KA 1L3NA 2DQHH 4PTUB 5DD6A 5E8EA 4AX3A 1U8NB 2J6WA 5DK2A 2Y69B 1MCPL 3QUKA 4OCYL 4KO6A 2WTOA 4MBRA 3ZE2B 4FADA 3QUML 1RK7A 4YC2B 1XGQB 3NEXA 1WWCA 2X4SB 4UDUB 4UIMA 5ID0B 5D96C 3SQRA 3BCFA 1E4HA 2OJ1A 5F9JA 3EFDL 2OKMA 2VDKL 3GBNL 3GZKA 4AEHL 5FUCC 1G7IB 2ED6A 4KMLB 1X5ZA 2GUOB 4QRSB 2MCMA 1TXKA 3O2WH 4RAVA 3MV9A 4AYFA 5IMOB 1J5IA 3DTXB 1QFWH 4F33A 1A4BA 3FH7A 1PD6A 3EDKA 3ZYOA 4O4YH 1KIPB 2QSQA 3KLKA 4JO1H 3K80A 1A9EA 4M4RA 4FKKA 4NUQA 1G7PB 4PLKD 2VLRD 3C8DA 4M1DH 4XNMB 1J9CT 3FB7A 2E56A 1VRSA 5KVDE 4P5SA 1FLRH 3OD3A 1MQKH 2BRRL 1I9IL 4JL1A 3D18B 4PREA 3UIYA 1UWXH 2O6FA 3GMNB 3QJUB 4PJBF 5TQ0H 1HC1A 3IJSA 1KTLB 2VZOA 1P2CB 4HOWA 4DAGL 3BVNA 4JDVA 2NY7H 2WXKA 4OD1H 5DZLA 4HFUL 2DLGA 3O3DA 5E9DD 3OLIA 1QRNB 2FLBT 4LLQB 1CVSC 2IWFA 3O8XA 3RVVC 2CK2A 2NYZA 4LIQL 1YYLH 3WO3B 4BUQA 1D5IH 5DMGC 4ZZFA 3LHAA 3PCYA 3R0MA 3T8MA 2XWRA 2GK0A 4XCYA 3RTLA 4NP4L 4EVNA 3HS0A 1T03H 4ZTPL 1PQZB 4XP5L 3PWPA 4AG4H 3GB7B 3PJNA 1P7HL 3RVWD 3A6BH 4TXVB 3RFRA 3S0PA 2XWBB 2GJRA 3QT2A 5EN2A 3ALWA 5TK2A 5LAXA 1XCWA 2YGQA 5HDQH 4OZGF 3OG4B 4J4PC 5E8NB 1C16A 2FGWH 2VN3A 2VSDA 4MJHA 5F0PB 1QBLL 4R4FH 4RMTA 2QVKA 4AJWA 5CN3A 1QR1B 2V3DA 3TURA 4N90E 5L4FA 1IQDB 2C9VA 4XMZA 1BJ8A 1J5DA 4MSWA 4P3CL 2UYLB 2PTUA 5C09E 5C3TA 1WEJL 1LQBC 3QIWB 3HZVB 5KVGH 3U0WH 4JR9H 2PNDA 3L3HB 3VFGH 3JQOB 2WWNA 3SDDA 5TPWH 2B08A 4M7LL 3CV5A 3T0EC 2UZYB 4NO0A 1QEWA 2ZF9A 2CQVA 1HTYA 3L5WB 3OHXB 3TU6A 5FGBC 4Q9QL 5DHEA 1PPIA 1T2XA 4XBGB 5DWUH 1SHXA 5K5YA 3ZKXC 1LMIA 3G6JE 3IFPB 3VFMA 3X2QB 2V9UA 5CZXC 5FGCB 4ERSL 4D9RE 2YPLD 2FWSA 1HXMB 5AOMA 4ZD3H 4NQQA 2WXIA 2VXUH 5A1AA 3PWUA 5IV2A 3RWEA 1GYWA 4GXFA 1A6TB 2DTSA 1YY9D 4JFDB 5C0GB 1ACYH 4JO4L 4NM4L 4WK4B 1PCSA 2Z92B 1PKQE 2ZWSA 3QULA 4OV5B 1F4YH 1VGKB 4JM2B 5AALA 1L5GA 2NQDA 2HRGA 2IDCA 2V7HB 4MQXC 1E28B 5I30H 2Z9TA 4N2BA 2F1BA 3C12A 3GKZA 4PLKC 4U3SB 3V7AE 5BXFA 3FRPB 4OD2B 1ZHLA 4NS0A 4EBQH 3U2SB 1UOKA 1BVOA 5EEYA 2CUHA 1KLUB 2BDNH 4HS6B 4A7UA 3L4XA 2ZZUT 4FTVA 1L7TL 4K3DH 4LSSL 4KAQH 4ATWA 4PRAB 3SD2A 1OCCB 2JNZA 1F42A 4AQ1B 1J8HD 1MVUA 3SKNB 2CHXA 3GJEB 5A2JH 4PJIA 4XCEA 4K7PX 4TNWF 3IDMA 3M7FB 5LNDA 5CUSL 5EZOL 2BZDA 4DWHA 1J1PH 3BEVB 3FPYA 4GAYA 4OM1H 4ZS7H 4FQJH 4QWWC 4Q56A 2Y4SA 2QTEA 4KC3B 2BVEA 5J9PB 3Q6FA 2ITDA 5I8KH 1EFXB 1SHMA 1EA9C 4A6YH 1AFVH 3IBOA 2VSMB 4JDTL 4KOCA 3WJJC 3APMA 3OC5A 1V3JA 5J13C 1GOFA 5CD5C 4M3JA 1PD1A 3ZDZB 1DCEA 4XZUB 5GRJL 2EXTA 5CWSA 4P2QA 3QDMD 4DESA 3AU1B 4UNIA 5EOQH 4WFED 4JHVA 1T1XB 4J3OG 4OTXH 4QHMB 4MYWB 5KJ7E 1K3ZA 3B9KC 3CSYA 3UBXG 4DCQA 4NRZA 5C0BD 2XG4A 3FQRB 1T04A 4TSCL 3KLDA 4JK0D 2NNAB 4GAJL 1XH3B 1OSZB 1S7RA 4Y4HC 1AO7B 1NAMA 2W95A 2QGCA 4K5NA 3VXME 2DWEA 4R26L 1YUKB 1XMWA 2BNUB 1F3JA 5PCYA 4BKSC 2YD2A 3H53A 4JHAL 5IQNA 4F3FB 4D94A 4Z7NB 3QPXH 5BRZA 4PJHA 1V7NL 3VXQB 3KL0A 4QKTA 4A7SA 1UKTA 1CGXA 2CHNA 5IFHL 3EYUL 4H26A 4LVOC 1RD6A 1DN2A 5D1QB 3OQRA 4HD9A 3QFJE 3ZT7A 4Y1AE 3DIVA 2LABA 3EZ8A 4DEWA 4LHUA 6FABH 4LMQE 2G60H 2LAGB 3CSPA 5CEZD 1CTOA 3UABA 4PJBE 3PWLA 3CFKB 4TNWK 5EU3B 5T1MA 3SQOH 2IMNA 4I18A 2V9RA 3H9SD 2QHRL 3TO4B 1WZ1H 1SJXA 3TO2B 1GIGL 4PVMA 2VDQB 3BUBA 5TH2A 4BZYA 5LQBH 3TFKD 3LEYH 1LWHA 3UX9B 3SKMB 3VWKD 2Y06L 4AQOA 2MH4A 1C16B 5BZDB 3T2NL 1QRNE 2HSIA 4CW1A 3BT0A 3JZYA 4DP2X 4IKLA 4ODTL 1F90H 3EYSL 3SO3C 2XZCL 3U9WA 5F44A 3UEQA 3WLWC 4NKOB 5LBSL 1DN0B 5BNXD 2HKFH 2YPVA 4LCIL 4PGBA 1Z9SB 3DURB 4OIAA 2J43A 4P4KD 2EE6A 3BFWA 3CX5J 4HLZG 4J28A 3L9YA 1U92B 5DD1H 5KBNC 3L4TA 4BRJA 5K39B 4PV8B 4BFRA 3AQZA 3Q1SL 3QUYD 1BQRA 1U8IB 2J20A 5AYTA 4AYDC 1W91A 4P2OC 1SDDB 4HOXA 4Z7AA 1OT2A 3SIKA 1BX2A 3NBNA 1W8EA 1HKLL 1WFOA 1ZT4B 2NY3D 3RZCA 3KYAA 1S78C 5F6HI 4C8XA 3QWRA 2X12A 4KH2A 5ERWB 3DSFL 2W65A 2JJVA 2BSCA 3FTSA 5D7JC 3BRDA 4Z95L 3ZDXE 2X6CA 4L18A 1SEBA 3EGSA 5AB9A 5D7KD 3W0WB 1O6SB 3LIUA 4MGXA 2A3TA 1KCUL 4YDVA 4X99A 3ZL4H 4LSRH 5AZ2L 3FL7A 3DV4A 3O9WC 2XG5B 3OR7A 1C1EL 4AXWA 4R5VA 1C7TA 3BSGA 3EYUH 3X3GL 3EYFB 4DK3A 2V2XB 1WGVA 4KJPD 3IGFA 3V6BR 1BYNA 3BKCH 4QHMA 3QO1A 5ESAA 2YAFA 4GG8B 3F7VB 4ONFL 2ZOKB 3QXWA 3KH4A 5EC1A 4JFOB 3ULVL 3OAWA 1XIWD 4OM0H 1P9MA 3LQAH 3Q9PA 2WQSA 3Q3GA 5KW9H 4X9IA 4U31A 5D8JH 3CHQA 5E6YA 1BECA 5F7WC 3T3PB 4QHPA 3TT1L 4A38A 5A2KH 4E9LA 3I75A 5IHWA 2IQAA 4AQAA 5T5FH 3QXAB 3PXJA 2H3NB 5IB3B 5C2BH 1S7QB 1MWAB 2CO6A 3TV3H 5D2LA 5IQ9B 1I4FA 1RVFL 1ZE3C 5L2KE 5MEQA 3CZSA 3TBYB 4H88L 1CFNB 3VG9C 4KDVA 5ADOL 3AGVA 4MA7H 4L0ZA 3O3EA 5I1JL 2AERT 3NUKA 1GS6X 4TNVF 5I8EA 3L3IA 2IH8A 5IHZB 3OTTA 1MCNA 3ZTJH 2WSKA 3KS0J 2WIIB 1TQBC 4GKNA 2W60A 3HFFA 1W72B 3LKPA 2V2WB 1VFMA 3SBQA 3ESOA 3L7FA 2JB6B 4O5LH 3IGAA 3TBVA 3NCBB 4BQ6A 1YN7B 1CD1B 2B77A 2UZXA 2HFEA 1AKJD 3FU6A 4KQ3H 4LSPH 5F1SA 5H4YA 4ZS7L 4DZ8A 2J44A 5DR5L 1J0KA 3E3QC 1K8IB 4FJ6A 4UAHA 4OUOA 4MKMA 4JHUA 1OAYH 2E6PA 1WCQA 4H20L 1GXEA 4XP9L 3FYIB 3JV4A 4QRAA 3G5YA 3POCA 4FKHA 4P99A 5JW4M 5KYYB 3VI4E 3LN4A 2AW2A 4X99B 2OR9H 1NEUA 3BUTA 5HGHA 2R9HD 2NY3C 2W94A 4Y5VC 4ZSOA 1KB5L 4X5QA 3BUYA 3ABMB 3W11D 3II3A 1P5UB 1OD9A 5IK3A 5J13B 3WE1A 3MBWB 1JYWA 1DUZA 1J05A 4XODA 1F8TL 3VFVA 4OZGB 4X9YA 5KBKA 5IM7A 2X4OB 2P4AB 5C09A 4I0CC 3N3EA 3U30B 1U41A 4K94C 4UTBL 1ORSB 1UG9A 3MRGB 4PJGE 3MRFB 1KCKA 3VDAA 3ARGC 2PCPA 3CSTA 3Q43A 4E9WA 4Z7VE 5E56A 4V2BA 4MA3B 4QXTA 4LSRL 2K3HA 5IHLB 2FYYA 2WWKO 3B3IB 3DXAA 3R06A 1CDJA 3KYKL 1J8HA 2IH1A 5TQ2H 4I85A 4FE9A 1A65A 4YDJA 1HH9B 4HUXA 4JFFA 1LO4H 4QRBA 4ALAH 2CDGB 2YO3A 2WO3B 4OLXL 3ZDYB 4WHYG 3FT2A 4CC0A 1QHPA 3DSNB 5CZVL 1E5CA 1S5HA 2XVGA 4W6YB 1LNUA 3CXHK 1N3NB 3Q1SH 3B6SB 4G6KL 2ZKWA 2YN3A 2QEJA 3ZQXA 4NN7C 5HI4D 3FQNA 1DEDA 1FCGA 4ZMOA 2GK0B 4XCYB 3UYRH 1LDPH 3AW5A 1EXUB 1NAKH 5IBLD 3WTUA 3HLAA 2XVBA 2YXMA 4OB5H 4PP2B 3B83A 2AXWA 5IQ9A 1AOZA 1M6OB 5DC4B 4H0HB 2ZNWA 3S96B 4K94H 5KBPA 5FYJH 1SM3H 3D06A 3BUQA 2QBWA 3I50L 3IK2A 1J0JA 3QDHA 5BRZB 5IJBC 1IEHA 3ULSA 3HPJB 4YN3A 4W1TA 4AKQA 2AQ1A 3GDBA 2K45A 3MLZL 3LN4B 3ARBC 4YWGL 5E24E 4HXBL 3ARBB 3GSRB 1RJYB 2A1WL 2OP4L 3B9KD 3QPXL 4QCIB 1LTXA 5EO0B 3PGCA 1LVEA 3SDAB 1JHLL 3J2PA 4KOBA 4UDTA 5IGXL 5MI0B 2P24A 4JRYE 5IEHA 4M93B 3CLEH 3EO0A 3EYFA 5FGBA 3LPOA 2VITB 4X7TA 3D6GA 2NMSA 2IV9A 2C9AA 2HJKB 1W0WB 1E7VA 1LO3H 3FDWA 5GRWA 2MQGA 2WVVA 5TDOB 1CLZL 4TTDD 2A38A 3QCTH 2AJYL 1IFHH 1BG1A 4ZFOL 3TEXA 3LZPA 2MOGA 4JO8A 4BYHA 5GZOD 3BZ4A 3BO8A 1A4KB 4PN6A 4HYTB 1RIVL 3V9EA 1U3NA 3OBAA 4JZOA 5HI3C 3UTSB 4QRUB 1I8AA 4M56A 2QFRA 2WJ5A 3TBYA 1A3LH 5T1JA 3CFDA 2D31A 2HT4D 4JG0H 3F62A 1RP8A 5DD0L 4N68A 1CJYA 4RWYH 5EEWA 4ONHA 3JVFC 4FQ2H 5I5JA 1H19A 3FO1B 2HRPH 2CLRB 3ZE1B 3AB0C 2C1PA 2XFXB 1E9QA 3X11B 1ORSA 2Y1AA 3EUDA 5CIPH 5ISZD 2VN4A 5D8JL 1F3DH 3ML8A 3OB0K 1B4LA 3SPHA 1GA2A 1QEXA 1G9NC 1KJ2H 5I73B 2IANE 1U93A 2NNCA 4DUVA 3X13A 1ROWA 3U4AA 3MLRH 4HPYH 2BDNL 2C26A 4NNPL 1VZIA 3K6FA 2G4GA 5DEJA 4DGIH 2G4EA 3PY9A 4WENB 1FZKB 3QISA 2H26A 4JQVA 4P48A 2JCCB 3AABA 2QKSA 1DLFH 4IRZA 4PJ7F 5GGRY 4F9LA 3RZCD 1CDIA 4AVIA 4NYLA 5ADPL 3RU8H 5DTFB 4QCIA 1Y07A 3S5YA 3FH5A 3RIKA 5LG6A 3RNQB 3HMWH 1WBYA 2XN9D 5TTRA 1PD0A 4XB7A 1T66D 5ELIA 1C5DA 3V9CA 1EERB 3O6ML 5ENWA 5FKAA 3MOBL 4AZ8B 4FABL 5TDNA 1NZRA 3HCVB 4OZ4A 2O5YH 4BZ2H 3ARBD 4BZ2A 3VI4B 4PJGA 1C08B 1G7MA 1ORQB 2ZPKL 1PIFA 2WQWA 4WJKB 5HHMD 1I8LA 1DQLL 2BOBA 1M7DB 4MDIA 1R75A 3CVDA 3FT4B 4Y16C 3U82B 3C6LD 3QWQB 1L9QA 4IEFA 3LZFL 4BGDA 5HSFA 1QW8A 1W0VB 5JXEA 1BXVA 4POZD 5F3HB 3BVUA 2NNAA 2FLMA 4NNYB 4M6ML 2ORBH 3L3IB 2QSVA 1FZJA 1G9NL 1F18A 5J56B 1SN2A 3RIAF 1IQDA 5IFJA 4WUUE 4TTDC 1JGUL 3DX6B 5E6SB 2BVQA 2G5BA 3QK0A 1JNNH 4HJGA 4UWQB 5KVDL 1QBAA 2YSSB 2DICA 4TPRH 2BIQA 1FO0A 2G75B 2BSSB 1EFQA 1JI1A 3H9SB 4O02H 4Y9FA 5DVKA 1BQHB 3PDOA 3ZMEA 4C56A 4WW2A 3RVVD 1Q0EA 4UB0H 4R8WL 5EN3A 2J12B 3REVB 1VF5C 3AFLA 2D7NA 3QEGH 5CBEA 2RACA 4FG2A 4LSQH 1QSFA 4X83A 4DPRA 1WTLA 4NUMA 3OAZH 3LRHA 4EKJA 1IEAA 4AEFA 5IJVA 3V6OC 3CH1B 5H94A 4E41E 3HBQA 3QEQA 3ARFB 4Z23A 4GQ9H 3MBWA 3G6DL 2LE9A 1R3KB 3MRIA 5IVZB 3I3DA 5GS0C 4FFYL 1I3GH 1SVCP 1MHPL 4P4RB 2BW5A 4YK4C 2VLRB 3EOBA 5DTFA 1WAPA 4A7GF 5C6PB 3E1ZA 2CRIA 5E0QA 5I5IA 2NY4D 4Y19E 1ZHLB 3U2SA 5FK9B 3TTSA 2Z91B 4DO6A 2QQNL 2WN3A 3CVBA 3GJFH 5E99H 2GSIB 5T1DL 3KPLA 3A5VA 2L0DA 4X9HA 5D55A 1D6VL 1K2DA 4MJ6B 4AEIH 2X70A 3VNZA 3IMUA 4Z76B 1BQ5A 1R4XA 5HD8C 5JQIB 3T4AB 43CAB 2XOTA 1FZKA 1J18A 2BNQD 4P46A 5EHFA 1TUPA 2HTLC 5CZXD 3QSKB 4AV4A 3TEZA 1MCHA 1O75A 2VXVL 4JVPA 2R4RH 4MNGA 5ECJE 3ULVF 4Y2OB 1UD2A 1JWMB 3I9AA 3WSQH 4Z7UF 3FS9A 4R84A 2A9DA 1W72L 3TCLA 4G7YL 4PUBH 2FSDA 5J06A 1HOEA 4N8VA 1IAOA 1NPJA 2BIPA 2YD8A 3N40F 5B1BB 3V0FA 1NUFA 2WZPA 4CW1B 4JRFA 2AEQH 4EI5A 1N5YL 1RPQA 2ZE0A 2KZBA 4WWOA 4URKA 4GXVH 4NO0B 4IIQC 4GI8A 4P5TC 4APQC 2PWHA 4AQZA 5ACZB 4OVVA 4BUGA 1C5CH 4G8IA 2PYEB 3QUZC 4IKKA 3WE6A 4AL8H 1RU9H 4XXWA 1RAMA 4FHKA 2FQFA 5CHNA 1H3PH 5KSAB 3GMOB 3OAYH 1XF3A 2LU7A 4Z7NF 2AK4E 5F9OL 4I77H 5SX5K 3KLAB 3GSWB 3LIZL 5KANG 1OKEA 3A6CH 4NXSA 1JK8A 4PLJD 5HHOA 4K3EH 4HIJA 4XVJH 3RAJL 4GIOA 3NVQA 4EI5C 5I74B 4N2OA 2X2IA 1CF8L 4XI5C 5BMFL 2ARWA 3IFNH 4WCYL 1MCWW 1XZ0A 4KKCC 5T3XL 1MHPH 4OW6A 1KGJA 2C3VA 1BW8A 3TFBA 3AXIA 4JQXC 4N87A 3EF4A 5D71H 5TDOA 1UB6A 1PS3A 2AXFA 2BIOA 4Y9CA 1LP9B 1BVKA 1YJDC 4MCZB 5FHAL 4ZD3L 5I5MA 4TLTA 4ZQKA 2QQNH 3CSYB 1MFDL 4X5PA 4FNLH 2MPAH 2DQCH 3LPGA 4Q0XL 3IDNB 5L0QB 4HH9B 4ABVA 2PPDA 1IEAB 1UM6L 3MJ9H 2WXMA 1IEBA 4CNIA 4HCRA 1WK0A 1TCRB 3BIKB 1MRCL 4FNPA 5I75B 2Z7YA 3GMLB 2Q76A 3O45B 5IBTL 1EXHA 1FIGL 1EO8L 4FQPA 5AVZB 3UCQA 3QUGA 1KCSH 4OF7A 4KTEL 3F7QA 3LHPL 5C3LD 2B1AH 1OGAB 1HHIB 4F2MB 3GSNB 1UD5A 3TH2T 4HSAC 1SHWA 3PNRB 1S7QA 2NY1D 1A1OB 3VXSE 2NXZB 1XGZA 3ASOB 4D8PB 2VQ1A 2C5DC 4NO5B 4TQPA 3V0VA 2LTQB 3HHRB 5KVEE 3PS6A 3FPXA 1JBJA 3II2A 3BMVA 4I3SL 3JWNC 3PP3H 4LAQH 4BXSV 5AG9A 1T6WA 3WV0A 1DE4B 2EABA 5CJBA 2YA1A 1XX9C 5D4HA 1IAII 1XT5A 5C08A 5FA3A 1HJCA 1WHPA 3G5ZB 3WIAA 1SEQL 1FL3A 1WZMA 5I6XB 2W92A 5FCSH 5IT2H 5DUJA 4P46B 3IETA 2W60B 2YRLA 1KLGA 4TSAL 4WUUD 5I16B 1TO5A 3MRGA 5I19H 1DUYB 4JM2F 3QIUA 2WOYA 2XX1A 1WV7T 3HC0B 2BO0A 4TQIA 2R0WH 4YVNA 2AZAA 2GIYA 4YMPA 4WIQA 1MHCB 1MIMH 4M5ZL 5I6NA 5FFLA 1U91A 5HTSA 4B6ZA 1HQ4A 1I4FB 2WP3T 4LRIC 2OBGA 2WMPB 3RWHB 4K5OA 4OBRA 3Q01A 4NP9A 4M5SA 2DEXX 2MIZA 3M88A 4KZ0A 3G6AA 3W37A 2CDFA 1CK0H 3ECQA 3ILEA 1SQ2N 3LKRA 5D7JA 2WQXA 1EHLH 4HJ0C 5E8PB 5FO2A 4JLRB 2K1MA 1A6AA 4OUUB 3OM3B 5DFTA 2GYSA 2UXTA 2GITB 1I8LC 2VLME 2ZOKA 5GXBB 4LEOB 5FYJE 4XVSH 5LNEA 1MQKL 4CMMA 1U8JB 1A9EB 4M4RB 3ZTDC 1J87A 3NIDF 3S3JA 3UTTA 1AXSA 2R51A 1JGDA 4PVLA 2CWRA 4X6EA 4YDKL 3GM8A 1Z0MA 2XYBA 2VXTL 2YUWA 2Z4TA 4O00A 3TVMB 3T6VA 3JV5A 1YA5A 4GKSB 4WJG3 1FLTX 1NLDL 3U6RB 1QNZH 2Z1KA 1TKWB 1VGEH 4OI7A 1DN0A 1L4IA 3TPKA 3GPSA 1WWWX 4JRXB 5T5FA 1OM3H 4M7KL 1E5ZA 2W8CA 4F93B 3MUGB 3IJYB 4XVTH 3MA9L 4G1MB 4P59L 1I1YA 1JWSB 4F8NA 3V2AR 1IM9B 1KOAA 4EMZA 1KYOJ 4IOIA 3VTTA 1T5WA 4YPGA 3UP1A 5IOPA 2H6PA 2AHIA 4KU1A 1FFPB 2VRKA 1EVTC 1VHPA 2NLJB 2IAAC 1Q0XH 4WI8A 3TEYA 3KD4A 3EBAA 3FN0H 1TZGH 2VZTA 3HG2A 4P9ML 4H88H 3I75B 2W0LA 5FW6A 4N4YB 3UZEC 2X6AA 1CGSL 3OL2A 5GIRB 2APSA 5IIEB 3QAZB 1JTTA 3TBWB 3QEHA 1IGIH 4KV5E 1S9VB 3H3PH 5F7KC 4WW1A 1EAOA 5EORL 2CGRH 3U0TA 1KIQA 4P57A 3FF8A 3KPSD 3TWCH 4I1NB 3BO8B 4N2DA 3D3VD 1EJ8A 2NQ3A 5AVSB 2JKXA 1EAPA 5FO9A 1N5YH 3QXDA 4S10A 4ATTA 4ODVH 3U36B 3AITA 2DWDA 1EHKB 4FXGC 4WDIB 1OCZB 3SJVA 4IK6A 4N2GA 3OKNB 3K2KA 5IGXH 1J9RA 1MVFA 5C08B 1V10A 4Y4HA 2KUTA 4ISVB 4D0DA 1ZGLA 3EUUA 2XBTA 3H2QA 3JWNG 3GS4A 1JN6A 3I50H 3TOPA 5DQ9A 5L2JB 2FUTA 2O93L 3EJTA 1OPOA 4LEOA 2X4UB 2BNRD 1AD0A 1X5LA 4JFDD 4JG1L 3ZR5A 5FYJL 2VLKD 4RCAA 1SMOA 3HLAB 3BP4A 4Y4KC 5FLUA 2EEBA 3OKDA 1A6WH 2VC2H 3BIBX 3F58H 1UVQB 2Y7OA 5HGHB 4N9GB 4NX0A 4R4BA 4ZAKB 5MENA 3SGKC 5F9WC 1LM8V 2BP0A 2LLGA 3AB0B 2ED8A 2JKJA 1YDPA 2Z8WC 4DKAA 1TCMA 4F2FA 2Q7YB 1P1ZB 4LT7A 3LRGA 4G6JH 4NSKB 1ED3B 1Y1DA 4HKJB 1I1YB 1JWSA 1QLEL 4X8CA 1RY7B 2RFXB 2H2SD 3QCUL 4K71B 2XJKA 1T5KA 3QRBA 3FXIC 4IDJH 4XXCC 1XEDA 4TRPL 5B1CA 4TRPH 3N04A 4G6KH 4DUWA 4HUMB 3SKNA 1AQ8A 1FZMB 2HVJB 2HJKA 5CJOH 4F7EB 1XQ4A 1YG9A 5HGGS 1UFUA 2Z93B 3IPFA 3V4VA 4B97A 5FFOA 2XACC 3C60B 3S36H 4B3EA 2XQBL 1ZLEA 1LGVA 4GRWF 4N8CL 4QLRA 2OPCA 1LJMA 1UOLA 2EXSA 2J2ZB 4AQEA 5TQ2L 3UBXI 2B1AL 3KPLB 2BVTA 5F7UA 1BD2B 2XA3A 4RGNE 3NIGE 4MZ2A 3TO4A 2D4DA 4TUKH 3EH1A 3CU1A 3PL6B 2ZNXA 2PYFA 3B4NA 3ECVA 3N0AA 3S35X 5MI0C 1PG7X 4WI7A 5EO9B 4HJIA 5IQLA 4KRPD 3K74B 2L7JA 3PQYB 2D7MA 2OX5B 3SZKC 5C0AE 4LSTH 4FG4A 4D0DB 2YJLA 2PCYA 1EXUA 1OP5H 4X6FB 1OAYL 4RNRB 4E5XB 1FFQA 4JFOA 3K6IA 4JX0A 3RTQB 1BPLB 5C92A 2PR9A 3EH3B 3UC2A 4K7PY 1BVNT 4HQQH 2X6UA 5E9DB 4NZUH 3LKOA 3V9FA 4B53A 3MLXH 1ITBB 1OZTG 1X5YA 3NCYP 2JKWA 2QQLL 2DWEB 3KPMB 1L6XA 2WIMA 4UINH 3QZLA 3RWFB 4U1IB 3RB5A 5A7BA 2X4QA 1M1XA 3KXFA 3FFCB 3OB0H 3GXUB 2VQTA 4JY5H 4QHKJ 4FX5A 1MJUH 5LGYA 2W0KA 3L81A 3FU3A 2VR3A 4NIYE 3N1MC 3FHQA 2DWSA 4B50A 2QR0B 3BAYA 3IXAA 1PEWA 2TSBA 4HKJA 2Q87A 1U3HA 3GTVA 2V2WA 1F0LA 2C7UB 3QG7L 3MLTB 3NCYS 2VTFA 5FK9A 2JI3A 3UH8A 1WO2A 2E9GA 4R96B 3O2VH 1P1VA 4PRPB 5LGHH 3MRPA 2FT6A 1QFHA 4K8RC 2B59A 4IRSB 4UT6A 1QTSA 3O3UN 3OKDB 3OR6A 4HF5L 2FWOA 5CSZB 3DX2A 3TPUB 3DX1A 2N7SA 2LGNA 3EJUA 5F1IA 4JREC 1P5VA 5EC1B 4I9WD 4OCWH 1A6PA 2F5BH 1EJFA 2K8QA 3GWJA 2ICES 3B34A 4QXGH 5JZ7D 1FNLA 5DFVC 5J8OA 1AGDB 1DL7H 1E5BA 3AS0A 4RESB 1IE5A 1RHFA 1ZT7B 5AVYB 1A2YB 4XVUD 4F8QA 3MREB 4HSCX 1CGVA 4FXKB 4Z0XA 2HLAA 1QSVA 2JH2A 3CSGA 5C0AB 1M7UA 4NO2A 3ARED 1YPZB 5KUMA 5AOIA 1BD2D 1JAEA 4R7VA 5EOTA 5I2IA 1ZA3B 2H9GA 3H9SA 3QNYB 3C60A 4JQVC 3NCFB 4U3SA 3RUGF 5BXFB 3M1BB 1FDLL 1CDBA 3WFBH 1DVFD 5AW3B 4NQXA 4OQTA 2DQDL 1EANA 5EDXA 3UPRA 1JPGB 2JJSC 2WIIA 2VJ0A 3P54A 4DP6X 1HJBC 4IGBC 2NSMA 3GSUA 2A83A 1S7UB 2H1LM 3NRPA 4BFOA 1JMXA 3BAEH 1C7SA 3DYOA 3NJMA 2DYPB 1MAML 3CZUB 2I60L 2HFFA 2K9FB 2BP0B 3ATDA 3V4PL 4LASL 4KMTH 3O9WD 1FI8C 1G1KA 4RMRA 3MBXL 1HNYA 1WIPA 1BZ9A 4KH9A 2P5WE 3W9EA 2Y0SA 2R0LH 3H56A 4L4VA 2D7TH 3PWNA 4OZIA 3LNGA 4EIUA 3E3QE 1E4XH 1UWGL 3NDZE 1GMIA 1MREH 2E74C 1PNDA 3MACL 4OAWB 1T66C 1MWAH 4NBXB 4OFPA 1E3XA 1TR7A 1SUJA 4HEPA 1G5AA 4XMPH 3T6XA 2XWTA 1QRKA 4TPRL 1OGAD 1M1XB 2BPBA 5KSVA 1HHGB 1WZKA 1JGUH 3DTDA 1ZRUA 2FBOJ 2VXQA 4Y16D 3IAGC 1SDYA 2VZVA 5DJAA 4X6CA 4IBQA 1U33A 5F96L 2VMEA 3UYPA 3FW6A 3MLUL 4HPOL 4TOYH 1GIGH 4FYRA 2MKLC 5E51A 2HLEB 1J5HA 5A7EA 5E4AA 2EECA 3LV3A 2WXFA 4L4TE 2JKTM 1F3JB 2QADC 1CFQB 3D12B 5GS1C 4UNUA 5B8CB 3GDCA 3GLAA 4XP4L 1UZ6F 5D7LE 2YWYA 2IQ9H 4N25A 1PJ9A 2C3VB 3HG4A 3G5XA 3TC9A 1P4LB 4JG9A 4I18C 5I17B 1FVEB 2FECI 4MQ7B 4RGNB 5DF0A 5EBMA 1D9KD 2F7QA 3FT3B 4TULH 1A8ZA 2EADA 1TQSA 5DHYB 3A6CL 2IPUG 2J25A 1KEGL 5JHLA 4Q6KA 4JFQB 4JO5A 5HYQB 3X1EA 5F21B 3AU1A 3HC0A 4NC1C 3ETBJ 2XZQL 2ZCLL 3Q1EA 4HT1H 4KHTL 3CN3A 4OTXL 1JV5B 1AQMA 2EDXA 3RNKA 5BV7H 1GS8A 1TJIH 4DN3L 4D0CA 2ADFL 1R1CA 3FRPG 1X4YA 4TSCH 3WNMA 4K71C 4XVTL 4S1RL 5ECGA 3BFOA 4XP6H 4I1PA 4IU2A 1JJUA 3DPBA 3VX1A 1MCJA 4XP9H 4BGLA 3VFRB 1NUNB 5DRWB 4GG6B 5DS1A 4UINL 3PWNB 4WTZG 1KN2L 2DI8A 1CE1L 1CIUA 1HINH 3GMRA 3GINA 1YUHB 2E8ZA 4FL4B 2VXTH 1W72H 1S5IH 2B9AA 1RKRA 1X9UA 1AC0A 2NUPB 5KSUB 3TJEL 2BY3A 4B5EA 3WKPA 1KDIA 1TZIB 4QOKD 2R4RL 4FQ2L 1JWMA 3ZIMA 3NPZB 5G5DA 3IRZA 3UYOD 3WIHL 4LSSH 3QUYB 2DJMA 4PJ5A 3QIUC 4RDQG 5LCVA 3KPRA 5IG7B 1O9WA 2DMKA 2VLJA 3BWAB 2B2XL 2BP3A 5DJYB 1JMZA 3RY6C 3F64A 3UDWA 3P9LB 1QFOA 4LVOB 1JDCA 5EBWA 3B2VH 3OPZH 4JFYB 4P2RE 3CFMA 3FT0A 5LXVA 3CFNA 4MD5A 3IGUA 2F9BT 1R19A 3CMGA 2ADIB 5HVFB 4G8FB 2RHEA 5JDSB 3B7RL 1UXSA 4M6AA 2B8OT 5D9SA 1WAEA 4N8CH 1UOWA 4P2QB 1KTCA 5F7BA 5F89A 3G6DH 3V4VH 2FL5B 3RGHA 3K8KA 2AABL 2GBVA 1LK3L 3D69A 5E8DH 2YC1B 3N85H 2YRBA 4AH2A 5A2IH 3ZE0B 1TZOA 5LBSA 2APXA 4PAZA 3B9KB 4UT7H 4PRHE 2Y2YA 4HKXB 3PG2A 1J1OH 4YPJA 3UADA 5C0FB 5IT2L 2W9DL 1H8SA 5GGRB 3QQXA 2HRLA 2IOMA 3BXNA 2YD0A 4KGJA 3HS0C 2ATAA 2YLHA 1TPXB 4XI5D 5LBSH 5KVGE 3QAQA 4P3CH 1UM5H 4GQZA 3U7WH 2QQKL 3MRJB 1C8PA 3Q48A 2ESVE 1OZUA 4LBEA 2VC2L 1A6WL 3F58L 2GW5A 1GOGA 4LDCA 1UWXK 4PRBB 5LAXB 4Y19B 4FNTA 2WQAA 4J6RH 4U7MA 4K15A 1XB8A 2WBKA 1U3HD 4PJXE 3L45A 5L4JA 4P49A 5F0LB 5KN5B 4G43A 1G7QA 2F74B 5CGYC 3EIFA 5DZAA 2C9PA 3CJJA 4UOJA 2QFPA 1S8DA 4P06A 3AC0A 1Q1PA 4S1QH 2A0LD 3MJ7A 4GXUM 2HT4C 1AOHA 3U0PB 1WFNA 4UZGA 3UZVB 5BUPA 4P2RB 5KEZA 5FYJU 3SBWA 1G87A 4RAUA 2VH5H 2YARA 3VFPA 4G8EA 5IQ7L 3DIDA 2WHVA 4FRWA 4GUPA 3ECUA 4NP4H 3TWCL 4PJCF 2Q86A 2BSED 4R0LC 3EOTH 4WSKA 4XBPB 3SOBH 1MCWM 1YYLL 2WNGA 5FS5A 4YX2L 4M3HA 3WN5C 1JTOA 4E41D 1H3PL 3QA3B 3KLLA 3WHXA 2IPUK 2I26N 4M9PA 2CKNA 2RQ8A 5KVMC 1SN5A 3O41A 3PUCA 3RZCB 4ABQA 1K3IA 3IDYC 2AJ3B 4BSWA 5J11B 5DJYA 4M48H 3DOSB 3WENA 4E42A 4KKRA 4PV9A 4TLUA 4LP4A 1ECYA 4R90H 2IH3A 1H6EA 2VC2B 3WKQA 5C3IA 4XRCA 5BPPA 4K0OA 3HN5A 3MLVH 3REWA 4OCNC 2IALA 1HK6A 2WXJA 4XO4A 5EFIB 2NNXA 2D3LA 2YQGA 4W81A 4DKFH 2CLVA 4DQOH 1BSIA 3QUKB 3US0A 4JHZA 4FTVB 4HD5A 4LRNH 4YDJB 4B27A 5JA8B 1RUKH 2V2XA 3S5LB 3S9DB 5J1AA 2MCPH 3D9AL 4N0CC 4YDKH 4U0RB 1YAIA 2Y7LA 2ADFH 5JW5A 1KTBA 1M2VB 1KB9K 5B4MC 4OJEH 2QPUA 4MCYA 3OV6A 3GF8A 2G30A 1CYGA 2PWFA 5I75C 5IIEA 3NP3A 2IAMA 4OFYD 4BA0A 1ASOA 4NQEA 4DN3H 5E99L 1RZQA 1XSJA 2WUCL 4HHWA 4Z3IA 4M6NH 3P77A 1G9MC 3SGDI 4V1DD 1D6VH 3QC6X 3NFSL 1XF5A 1N5AA 2NW3B 3FUNA 4KVNH 2L7EA 2FJHA 4WEBL 5D7EA 1KC5L 1TJXA 4FFZA 3ARDA 3BVWA 3ESUF 5HBBA 5MEQB 1XGPA 1ZWIB 3ETBF 3ZBMA 2OZ4H 3VU2A 5I28A 1UT1A 4TKWA 3EADA 3WIIL 5JIIA 4MWFB 1P4LA 3IJSB 1MJ7L 2OMUA 1ROCA 4ZQKB 1I7ZB 1CLYH 3FU8A 3HMXA 1J12A 1IM3D 3ZDWA 5AAMA 3ZRCC 2ZUSA 5F7NC 2YAOA 1NFIB 3KWTA 2CO4A 1N10A 4HBCH 4MB1A 2ICCA 2L7QA 4GQ9L 4GSQA 1OAKH 2Q8BH 3VFTB 4XGZA 4Y9GA 3X1GA 5IF0A 1PW3A 1BWWA 5CP7A 1A02N 5D72H 3ULVE 4AITA 3CPUA 1FGVH 2YMXL 3SDDD 4YO0A 1KULA 4JN2B 2EDNA 5D1XB 1KPVA 2PCXA 1J5CA 1QLRB 5K9KA 3NZHH 3DJRA 4E42B 1P5VB 3LTVA 4WEUD 4YIQA 3KJ4B 1RV6X 3DX9A 1FYHB 1ZVYA 2P42B 2Y1VA 4X6BB 3WS3A 2YFNA 3U0WL 1IC7L 5KVGL 5CGTA 3PE9A 1YVLA 4Y4FD 2XI9A 4M02A 4BDVA 4ZMQA 2BS71 1G6VK 3O0LA 1G9ML 2PYFB 3HKFA 4OF5A 1L9PA 3CHXA 5I71B 5EUOF 3UJTL 4F37F 2NLJA 1GSMA 2KL6A 1NFDF 4ODHH 4PS7A 2I7OA 2WXGA 2F19H 5GSVA 1MOEA 4QXWA 4KKBC 2JKRM 4M61A 4HU8A 5HYJD 3V5HB 1U3YA 3V4PH 1UB5A 1P7KB 3ZT5A 3KJ6H 4F58L 3PHOB 1DUYA 2EDYA 2FQGA 3D39D 3QQ4B 4H25A 2Z4QA 3MRRA 2XQYG 3Q3GB 1A6UH 5DJ0A 2O5YL 2VL5B 4HS8L 2EH7H 4G9FE 5LBGA 4Y4KD 4JQIA 3PF2A 4FQXA 3U4EA 4QUOA 1I7TA 2FZ3A 3BPNC 3ZQ9A 2E47A 3PXLA 4DF9A 1DVFA 3QWOA 3HR6A 2BRRH 3UJJL 5F89B 4JRYD 4R4FL 4GEJA 3VFOB 1SJEA 5DRNB 4A7VA 4OUUA 1EV2E 1NEPA 1ZHBA 1JPEA 3QIUD 2WP3O 4I48B 3CFJA 3VWKC 3IWVA 1MG2C 1OQXA 3HNVL 4ENEC 3V4UL 2VLKB 3WGVB 1GCYA 1V05A 3MDJA 2AQRA 2ZCKL 2HLAB 2NY5C 1RJLA 3ZKXB 5BO0D 4Q9RL 4H8HA 2WCGA 2EUZA 3RB7A 3A4EA 2FWOB 2I9LB 5CSZA 4PB0L 1OSYA 1ZVHA 5BOZG 3P2DA 1TEFA 4OT1H 4I7ZC 3SDXF 3EYOA 3WY4A 5FCUH 1KEML 4BSJA 4EI5D 4RLDA 3GJFK 3LKQB 4EDXA 5KYYA 4ZMWA 2B5IC 4QNPE 3BP5A 1EEYA 3FT2B 4TUOA 1UQSA 1UKQA 3SDDC 2JLLA 1BIHA 4WZ9A 3HI1A 1JHKH 3ARXA 4XZUA 2PP9A 5FUOL 1IAIH 1CLCA 1A25A 3O4OB 1A6ZA 2X87A 3MLWL 4ZUVA 5TGBB 2ENPA 2BJML 1NDMA 4G2AA 4EKXA 2A5UA 1TJIL 4O4YL 2V7HA 2CPCA 4NRYB 2J8UA 5HYSB 1XZWA 1LP9F 1ZHNA 4UBDC 3UP6A 2NCEA 3CG8A 2J88H 3ML9A 5I71C 3K71A 3APDA 5D2LB 3NAAL 3MRFA 4GI9A 5ICZA 3GIZL 2EIZA 4FQHA 3PHQB 4KKCD 5J6GB 1S7XB 4O2FB 2ZOUA 2XPGA 4MD4B 4MA3A 3MUUA 1QKZL 4U6VH 5FF6A 5I6KA 3T3ME 4DOHE 1ZD6A 1H0DB 2LW3A 4UT9A 4PJFE 3NABL 4RETB 1NCWH 2KH2B 1ORQA 2M8XA 3OXRA 1IIKA 1MCFA 1F4XH 5FAAA 4L9LB 2R4SH 4MNHB 1SUHA 5DVOA 1MKFA 1WYJA 4MAUH 3RVTC 1TTGA 3TJPA 3FOMA 4ZFOB 3RTQD 2R15A 5CEYB 4PTTA 3RVXC 2CXKA 2VLKE 2P7TA 3S4SB 1TVBB 2A0LC 2DJSA 1V3MA 3K2UH 4M8VA 4TUKL 3ARWA 4HS6A 4UMSA 5MERB 5DRZA 1K5NB 4BSVB 4XRCB 2R83A 4YO0B 2NY6C 1E8WA 4QI3A 3VD3A 1A9BB 4BK4A 4LLMA 1FSKB 4ENED 5DC9B 2A2QT 3ERXA 2X4NA 4EUPA 5C7XL 4HCRH 2N0KA 1AJ7L 4ZUTB 1NIEA 1BXXA 3TBWA 4LHUD 4N3UA 3SDCC 4W9FC 1NQBA 3ZUCA 2ALAA 2BH0A 2DKUA 3GFUA 3PWUB 5SWQA 1KIQB 2X88A 2TSAA 3OG6B 4PD4J 4UTBA 5K39A 1N4XL 1LQSR 1WBZB 2P45B 4EIBA 1QSEE 3FUJA 3HBPA 4GOSA 1DVUA 5B38B 3SD5A 3AREC 3JWNH 4PRPA 3N9GH 4L1HA 3T0ED 5BVJB 3W39B 4M61B 2VABA 3MJ6A 1IKNA 2A83B 4F58H 3A6OA 4J6RL 4CVXA 4Q97A 4IIQB 3P4LA 1DVFC 1KXHA 3CDZB 3WY1A 5DEGB 1G9MH 1CICC 2ZX5A 1NCUA 4S1DD 5INCB 1GC1H 2B0SL 3VXRE 1JNHA 2JJTC 3O2DL 2EDQA 1IQWL 2UWEA 1XDTT 1QACA 3NJGA 1NBZA 2HPOA 1LEGA 4JG1H 4UQIM 1XGUA 1VACA 3MRKA 1PKQA 2MQCA 2R1YA 5C0AD 4PLOB 3RNKB 4OCRL 3B2DC 2G5UA 3ZE1F 2M26A 4EIZC 4BHUA 3QIBB 3RVUD 2NR6C 4ZW3A 2YSSA 2OR9L 3IDYB 5IBTH 5E6IB 3SPGA 2JMRA 1JPTH 2E46A 3K81A 1ZHKA 3JVGC 5I2IB 2Z64C 3UTSE 3ISRA 5C0JB 1ZLWH 4WEEA 1MNNA 3ABKB 1DL7L 1D5IL 2ZPKH 2VWEE 5T5NF 3V0DA 3FO2B 5IROD 2PTTB 1ETZB 3K5RA 3HPJA 1LILA 4N8PA 5HY9A 1D6EA 1RZGB 4DP1X 3NABH 3RVXD 4V2CB 4K7FB 2BP8B 1E4WL 4LIQE 4HKZB 2QVIA 2PPCA 3T2LA 3LNDA 5EU4B 5H94B 3OKLB 4I0PD 4AH2B 4NUGL 4QPEA 2MNUA 4PGZA 1J86A 1P9MC 4IKNA 4DEPB 3H3PL 2R27A 1IGIL 4Z77A 4P5KB 2NY6D 1FHNA 1XAKA 3M17A 2EDDA 4H2CA 3T08A 3L17A 3ZO0A 4LRNL 2QADD 5IVNA 4W9LC 4C56B 2DIJA 3ZDYE 1UCBL 2W9EH 4D9RD 4GRLB 3ZR6A 2X4PB 4PRNB 1NCNA 4Y4FA 1INDL 1HH9A 4HUXB 1DE4A 3LKSB 2QZ5A 1G7IA 5E94A 1Z5YD 5KBMA 1RUAL 1I3RA 2W5PA 3L4VA 1G7JA 5EU7C 2OW6A 4G80A 3ZYZA 1PSKL 1MCPH 3A3YB 4J3OH 5FA4A 4FI8A 4ONFH 5HHPB 5MHSD 2BC4B 4Y19A 5GQBA 4JFFE 4B7IA 1QZ1A 5D4IA 1G0XA 2WBJA 5F7DA 4O9HH 4XCEB 3TO2A 3VMPA 4J1UA 5KYUB 1AACA 1XFPA 4Y4HD 2CBQA 2CJTA 4AUUA 4Q2ZA 2X4RA 3BAIA 4XOCA 1YNTA 4WO4D 2Q76B 3F6LA 3MLZH 3OPUA 1P5UC 4KK8C 4XTRC 4YWGH 3D2UD 3RWHA 5JQHC 2R2CA 3SOTA 1GVIA 3EH4B 3KLHC 2DQIL 3ARZA 1C1EH 3GHPA 3K6DA 1N6UA 3MNWB 4LEBA 1YY8B 3V4UH 2H5UA 2AXFB 4WU7A 1T4WA 2FECL 4NQXB 4ANKA 2MNJB 5IMKB 5PAZA 1IFHL 3TIEB 4JHWH 3NRFA 1RZKC 1YN6B 4WTZA 5T1DH 2Q86B 3IFOA 3RVUC 4MVBD 2NZ9C 3MCYA 4ELKA 4DP4X 5CR8A 1YEFH 3P30L 3PL6D 5MEND 4PJAF 5IKCB 3BLKA 4ESKA 1BHGA 4Z8FL 1ERNA 1QSZA 4L3EB 4TL5A 3BZFA 4P2CG 3QDGA 3G04A 2Z92A 4X7EC 4H25B 1HNFA 4MD5B 4PSRA 2IPTH 4FF9A 1IRAY 2O5XH 3FULA 5IROC 3E9TA 3BDYL 2WCPA 2ZUXA 4WQOA 1HHIA 1V55B 2QQKH 3F7KA 4IOFC 5BCAA 3X3FL 2OMZA 2I32A 4Q9QH 3SE3C 5IY5B 1HEHC 4FMFA 2KERA 4XPHL 4KX8A 5LQBL 3QWRD 2APTA 3E38A 2WO4A 5C0IB 4DZBA 5EU6E 4DO4A 5IVXB 5KSBA 1MXGA 3K6SA 1M7IA 2EDRA 3NJVA 2OMXA 5JHLL 4FZEL 4IRSC 4LKXA 4KKZA 4NQDE 4LOEA 1BZ7A 4LSVH 4PJ7E 3LS4H 4S2SB 5K9KB 1NCDL 1RJLB 4JB9L 4AM0Q 1WA2X 2FCBA 3RBGA 4CC1A 3X17A 1II4E 2EE3A 3CZLA 3L9RB 1EZVX 1EJOH 4X5WA 5IP4A 5FM8A 4AE0A 2VXSH 3BPOB 4PRHD 5B7FA 4DGYL 3QQ9D 2GTWB 1DFXA 2QGEA 3B7TA 3ZZQA 2ORBL 2DWDB 5D6CA 1MAMH 2ICWI 1OW0C 1YEIH 5DD5L 4AK1A 2DQCL 4JPWH 2JTYA 4BCYA 2Y36L 1QSED 4J3XA 1CFTB 4DVRH 5BRPA 3JYBA 3QI9D 2UX7A 5EBLB 1IGMH 3EAKA 3ZLQC 1FVEA 2ZKHH 4JQXA 4J39A 1AD9A 3O6MH 1J88A 4Y5YC 5TE6L 1OALA 1BQHG 3CFEA 1DJZA 1MHEA 1ESOA 3CHSA 3IFOB 3QDJB 2QV4A 3OPZL 4XMWA 1M6UA 5TQ0L 1IT9H 2ZOLA 2NXYC 4N6RA 2FX7L 3KVQA 4B9YA 4HC1L 4KJQC 4NQEB 3I9GL 4HKZA 3NA9H 4RBPK 3TA4D 3GSWA 1RSFA 4UM8A 1TQVA 3LEXB 3IKCB 1AYRA 3SBPA 4PP2A 2AKRB 1CDHA 4XO5A 4Y8AA 3AJ7A 3FTVA 3EGXA 3UMTA 3WIHH 5L8JB 1UUSA 4WLCA 2MRYA 1KMGA 3K2IA 3PL6C 3OC8A 3QNYA 3VUAA 4FNRA 1HESA 4KZEL 1JXFA 3VCLB 3CNKA 1U8LB 3MA9H 1OXYA 3C5SA 4P59H 4PG2A 4XNQA 1HAWA 4JDZB 2NTFA 1M71B 2K78A 4BFGA 1EAQA 4XPBH 1FFPA 3TT1H 5DUPL 1HE8A 4GXVL 2H1XA 5FV2A 3UERA 5IREA 1KZYA 1CICB 3R18A 3FB6B 5GJTL 5CEZE 2UX6A 4FQJL 3TEUA 2F53E 1U93B 3GEFA 5HDWA 4FS0A 1NINA 1AXSB 1JGDB 1XSKA 2QVTA 4LEEA 4JDEA 5FYKE 1CVRA 1MFBH 4JG0L 1OAXL 1AZCA 2MHAB 4OCXL 4CJ0A 1FORH 2UV3A 5HGDB 3FB5A 1F41A 1FG2B 4PWHA 3C5XA 4MMYA 4TVPH 5I0VA 3WTSA 3BDXA 4QHLA 4GG6E 3C87A 3HB3D 3PWPB 4NN5B 2WYIA 3W0WA 3SY0A 2JJUA 2OCFD 2VW4A 5IB2B 2CBMA 35C8L 1I85A 1IBDA 4MWFA 4PS4L 3MGOA 2BSRA 2F1AA 1B9ZA 2FT7A 2J8OA 4FFZH 5FKAB 3RA7H 4GUPB 4AZ8A 1HOCA 4GO8A 3JT2A 1VEOA 2XYCA 1GYAA 4LO9A 5E6UB 2PTTA 3N1GC 3ATFA 3QR1A 2WANA 4P2RD 2D4FA 3K6OA 1CFVL 3KGTA 4QGYA 4FG6D 1BP3B 5FWQA 2VLRA 1E9PA 3EOBB 4G70B 4L3AA 4EZJA 3OMNB 5FYKL 1LO3L 1SVZA 2OMTB 2EH7L 3QQ9C 2FEDD 1NCDH 4P3WA 1YNLH 4XNAA 4X80H 3WD5L 4HXAL 1TMQA 3U6RA 3V0EA 4F33B 2FVNA 3MX0B 4NKIL 4C56D 2IGFL 4FP8L 3QDGE 5F88A 3U6XS 2WUBL 4PJXB 3WUWB 1YEGH 5FX3A 3NN8B 1QSFD 2Y23A 2GIXA 5D6CB 1M7XA 4C83A 1FL6B 2ICEA 1RL1A 4A39A 3QDJD 1INEL 4HJEA 2CUIA 5ISZB 4L9LA 2CLVB 4O02L 5CWSB 4XC3L 2G2RA 4YH6A 1F86A 1XGUB 3LKRB 2HWZH 5C0EB 1PFOA 2EAEA 2ATPB 3MCG1 4GQRA 1FIEA 5A40E 4YSUA 2BVOA 1DCLA 5E4EB 3X11A 2F53B 4XNXH 1QBLH 2BCMA 1D9KC 4KDWA 3FU5A 3VWJD 1A5FL 1RCYA 4V1DB 4Z8FH 3NZ8A 2DQJL 3L1OH 1LK2A 4YLCA 2ZXDA 1OWWA 1WD9A 3X3FH 3GSVA 1RZIB 3W5NA 1IZKA 2B9BA 4G7SB 3MJ9L 4ALAL 2ZX9A 2X9WA 2BSBA 3CVHA 2YC1A 1V3LA 5IW6A 2DI9A 1QA9A 1N68A 4P05A 1IM3B 4HZLA 2VKXA 3A4AA 5SWQB 4N2AA 4K23L 4NYLB 3N6YA 5I26A 3IDUA 4ONOA 1GC1C 2WBJD 3MRCB 2HX9A 5CZKA 3V52H 1EZVY 2DQ6A 3QHTC 3KBEA 3ULAB 3GMMB 1I9EA 4AEEA 4IHOA 4MBOA 4NT6B 4UTBH 3H4FA 1JE6A 3PWPD 4PI0A 1YMMD 5JUEH 2X89A 4JFDE 4E5XA 1AIFA 4YSEA 4XTRD 2GTZB 5HJGA 4KKAD 1F5WA 1LE9A 2EEFA 5DJDA 1FUNA 3H8NA 3EHBB 3U1SL 4NBYB 1PLAA 3AACA 3OKOB 5DJ6A 5JLZA 2F7PA 1JNHB 5F0MB 4AT6A 2BM3A 2EDOA 3D4CA 4ZUSB 4NNXB 4BKLB 3O2WL 1G7HB 2PN5A 4FG6C 4J8RA 5CCKL 1IEBB 1SJEB 4A63A 2Y5TB 4OI8A 5ISZE 4W9JC 4XWOD 3BZ5A 1AQDA 4M00A 4U3CA 3U9PL 4PJXF 4EXPX 2RCSH 3BPNB 4K8RL 3ENEA 4MNHA 2H3KA 1NGYA 3FFOA 3QIWC 5JPNA 2F8XC 3ZX1A 2FH8A 4YHYB 2OSWA 1QFPA 4X50A 4AGQA 1SXZA 3DLQR 3RX9A 1FYTA 2HJFB 1XAUA 2KI6A 2ZXGA 3IDIB 2K6ZA 2JFCA 1N3NA 4NPYA 2H32B 3NK3A 5D7SH 4V1DE 1KLUA 3CQPA 2CGYA 1AMXA 4MNQE 3WFDH 3KVPA 5DVPA 4Q58C 5DLML 5HDBE 3VG0H 4RZCA 1CD1A 5DXWA 2ARJQ 1PU0A 4EBQL 5B21A 3KPMA 3GSVB 1PL3A 3OXSB 1BOYA 3P40A 2Y9RT 4FTDA 3CC5A 1FBIH 5TFSL 3HHSA 4S0HA 4ZFQA 4U1JB 4M7LT 4QRQB 3NJIA 4P5MB 1B90A 3V4PB 2I85A 1JHTA 3K4AA 3INUH 2CG9X 5EUOB 3TN0B 2XN2A 2Q8AH 3MODH 5IBUB 3D4GA 3MREA 4AMKH 4WFGD 4XMLH 1IBYA 3L3DB 3F7YB 5EZOH 4A37A 1JHLH 4NC2B 2DYSB 5C0RL 2ZG2A 1O0VA 5IEHB 1KBGH 2CIKB 2X4TA 3K72A 3NIFF 2ODHA 1QR4A 4OZGA 5LWYH 2R2EA 5HHXH 1NBVH 1HIML 3L5WA 3CFBA 4GO6B 2P43B 3QZWB 4DGYH 5DWUL 2GTZA 5ESVB 3WEAA 1AG6A 3FO0L 5EUKA 1BV8A 5EIIA 4YIQB 1HNGA 1JPTL 4G5ZL 2NQCA 4LPVA 2J2ZA 3AS2A 5HHPA 1PAMA 2YBGA 3KH3A 3LDBB 2PO6A 1H6FA 3UJJH 4TVUA 1JERA 4PJXA 3W82A 3WUWA 2ENQA 1QR1A 1CU4H 1GOHA 3LHPH 4RDQF 3X12B 3IN0A 3O6KL 3PIQB 3LB6D 1N4XH 4L5FE 2HKHH 4PWIA 2FJHB 1N0LA 3FUDA 4XNBA 4M9OA 3ARDB 5CJOL 2HVKB 4RMWA 3F8UB 1KT2A 2A74B 3NCMA 4FQQA 4F7CA 3WFCL 2VDRL 4L8DB 2EEAA 3MC0A 4LL9A 3O6FD 1N6VA 4K7PH 5C0BA 4NXKA 1EEQA 3EJZD 2WV3A 3CDZA 3MO1B 5T1KA 5IEKB 3NZ8B 3E8UH 1Q9WB 1WRFA 4FNLL 1G94A 2XY1A 3FO9B 3RI5F 3EO9L 5FYKD 4PJAA 4R83A 4GLRI 4JGUA 1S7UA 4K7FA 2AABH 4CBPA 2CZNA 5FYLE 3Q2WA 3WEXB 1FAIL 2NRDA 3FT4A 1UUNA 2R56H 4R3SA 1PIGA 1K9TA 1T7ZA 2YEQA 5E1AB 4LHQB 4NAMA 4U0QB 2OMNA 5JYLA 1T7XA 5KSBE 2O72A 1JZIA 1ZA3A 2H9GB 5J1AB 1ACZA 1CE6B 2EH8H 2ZWLT 1FDLH 1VCAA 5C08E 1JD9A 2GI7A 3PV6A 4CSTA 3UPRB 2DBLH 1W8NA 1JSYA 3U9UA 1NCWL 3HB3C 3MX0A 3ZKMD 3QDGD 2EDMA 5IMMB 4AQEB 4AYID 1SOKA 3HG5A 5F9AC 3C5SB 2KQMA 1ZA6A 1ZGLB 4MQ7A 4YDIH 5ALCH 5EBMB 4JHAH 1K6QL 3I6LE 1UC6A 3BUPA 1BAGA 3BP6A 3RA7L 5HD8D 1T21A 3UTPE 1S7WA 1S78D 2ENJA 5DGRA 3RWJB 2YAMA 2VZSA 3WTVA 3QQ3A 3SCMA 2C34A 3ZZSA 5GRUH 2Z4QB 3MRRB 3WMSA 1TVHB 5JIHA 4QKXB 5FO8B 3VGDA 1BAFL 1SEBB 5EORH 4U6HA 1BM3H 4KUCF 4PH8A 3BPLC 4MKTA 3T77A 2LVCA 2Z31C 3JVGA 4FLRA 3NFSH 3TYFB 1AQHA 1C5DB 1CG9B 2AXJA 3VI3F 3Q7JA 3D39E 2NR6D 5FM4A 3FQUB 2VDOH 5IOPB 4ZO8A 2HN7A 3WLBB 3HIZA 1TVDA 5F97E 1QO3A 1Q94B 1RIUH 5E2TL 4Q9CA 4AI7A 5I9QB 2BSDA 1XBRA 2EE0A 3SJVD 4KZDH 5FEBA 3US9A 1QFWL 4BH7A 2WLIB 3EDEA 1BIIB 4X0NA 4NB7A 4OIIL 3TH3T 3ZKQD 3SCMC 5I1JH 2EVJA 1AY1L 4UM9D 3FSVA 4A6YL 1T20A 4PJBB 2IPKB 3RL1B 4OQTL 2AJXH 1DDTA 1QLEB 2EO7A 4L48A 3X13B 4Q89A 3GHBH 5C0ND 4DERA 5EN2B 1A7RL 1YMHA 5ID1A 1OY3B 3K0YA 3ULUF 4E9SA 4UDTB 5IFAL 4LKCA 4H5SB 1B3JA 2EIDA 1DTUA 3SJVB 1FNFA 2MOQA 1J8HE 4MS6A 5KAQF 4QTFA 1O6SA 2CDFB 1TFHA 2BNQE 4LCYB 1WCBB 1MHHB 5E2WL 3PABB 4LSTL 4WNQB 1RULH 1QNIA 4OBSA 2IXQB 3LS5H 3D09A 4CN6A 3OR7B 4Z7VA 5TDNB 1MG3C 4GQQA 4XBPA 2FEEL 3PP3K 4B41A 4BBWA 1DQQA 3QFJD 4ZFGL 1GTFA 2J57A 4V11A 3OKYA 3U83A 3WHXB 3ZE0F 2OMBA 1IKNC 4XX1E 2FLRT 3ARDC 3GRWH 4WV1B 4Z7NE 5DFWH 4BFNA 3GSQB 4N8VG 3T4AA 5BZWB 2Z7WA 4DP0X 3NCXA 3QNXB 4OZGE 4UAOB 4OFDA 5E2UH 3Q06A 3VFOA 4LZKA 4UNVA 4Y1AB 1HKLH 2YUZA 1XGTA 2R0LL 3K1KC 4PWJA 4APXB 5C07D 4G7VL 1Z9SA 3SYPA 1SF5A 2HKHL 1YRKA 2VAAB 4IGBA 4GBXD 3QEUB 4QRFA 1QVOA 2IWEA 3MRBB 1SEQH 4M62H 1F4AA 2UWEF 2FBJL 4BELD 1BPVA 1SLVA 4GNKB 4Z3FA 4MX7B 1Z9LA 2QTVA 3HI5H 2VDNH 3GSRA 1MLBA 4ODTH 2NTFB 1OB1A 4LKXB 3PJLA 5JHAA 2HKFL 4LCIH 1CO1A 1P53A 3LNEA 2VLJB 5EU5A 1CFSA 1AP2B 1YEGL 2GSGA 4MA1B 1KCRL 1U2HA 2AAVA 1NOAA 1CXEA 3PNWA 2DQDH 5C07B 4ZXBA 1QX1A 5JHMA 1WVZA 4Z3JA 3HA0A 1S3KH 1ZEAL 3SO5A 4PRPD 3IAQA 4HXAH 3BEVA 3KW8A 1YEHL 4BV1A 2HKAA 1IVLA 5FYJD 4EN3A 1UVQA 4GW4A 3P9WB 1CTMA 1G5GA 3L3OB 2BS8A 3UG4A 1JGVL 5HDQL 3HPLA 4U7KA 3KHQA 2I07A 4EO5A 2G2RB 2XWDA 4OD3L 1FO0L 5DRWA 4BH7B 1KCWA 3O11B 1CXHA 3VXRB 1PZBA 4BK8A 5ESAB 5LWYL 3A4FA 3BUYB 1HX0A 4QWWD 3NG5A 5B3JE 3GMPB 1HFUA 2GABA 1JIBA 3VXMD 1S4IA 3MQIA 4WSJA 4DGWC 1RPKA 3UTQB 3FFDA 2D03L 1P7QB 3EJYC 1A3RL 2VSKB 3F2LA 5I6MA 1XCXA 3KYMB 3NEOA 4LSPL 4R2GD 5DJ2A 2N56A 4G7QB 5DYOB 2NY7L 4QXUL 5FDYA 2HUHA 3HMWL 2CO1A 2DM7A 4JUSA 4M7JH 4GAJH 4O58L 2DQTL 3CVHB 3QQDB 3MV11 3VFMB 4EF3A 4NQCE 5CCJA 1FFOB 1UHVA 1UASA 2ATKA 1CGTA 1KJVB 2OTUB 1Q4NX 1HS6A 4ANUA 5EBWB 1WCBA 2AMGA 2Q7AA 5IROA 5CLZA 3GSNA 4NC1E 1ZY9A 3UCRA 1XCQA 3SDYH 2PO6D 5I1HH 2GAZA 2X40A 1P5UA 4TSBL 4AEHH 3W9DA 1WIUA 3T3PE 3IDGB 4CC4C 3GRWA 3EJPA 12E8H 3IMRA 3TN0A 2J5LC 4LCCA 4CAGA 2VDRB 3QJZA 4JRWA 4J3TA 3GLEA 2ZG3A 3VVWA 2J56A 1SNRA 5JQ6L 4DUXA 3AAZA 2LFEA 4PJFA 4PCYA 3DJZA 4KVPA 5GRVK 3Q2LA 3WS6A 1VZHA 2IPKA 4G8GB 4L0PB 5AKTA 3UL4A 5H8DA 3RVTD 4HQQL 5KOMC 5DD3L 2IDFA 4Y2LA 1D7BA 1A14L 2XWTB 1SMAA 5AL0A 3VFRA 2Y22A 3GJEA 4X98A 3BH9A 5K93A 3M7OA 1ET7A 4UQEA 4MRBA 2ED9A 2IADB 3P3RA 5ISZA 3ARGA 4F9PC 1I7UB 1NIDA 4PHZA 3TL5A 4L8BB 1TLKA 3WFHB 3DXAD 1NLBL 2WLLB 2VYRE 4ZO7A 4M1CD 3AMLA 1FZJB 5D2LF 3LD8B 1OARH 1UH4A 3OLDA 3I6KA 3DMMC 4NZ8A 1FYTE 4XBMA 4XO8A 4K3JH 1DQQB 4YDIL 2ESVB 4LL4A 1RK1B 1S46A 1I3GL 3BJ91 2D7OA 3BVNB 4RIRA 3RWGB 4DGVH 5GIRA 2P8MA 3B2PA 4X9GA 3SPCA 4F7CB 1OSEA 2WINB 3RY6A 3MLYL 3S88H 1OB0A 3RI5K 2P47B 3ME0A 2FSEA 4HJ1A 3OSKA 1UM4L 5F7EH 1VFBB 4POUB 5KJRH 5CBEB 2UXVA 2EVFA 4U1NA 1OOAA 2XXCB 2TAAA 5AG8A 2NSQA 5E5LA 3NP4A 3MUGA 4MAYB 4MA8H 3SDXB 5B7MA 4Z0BH 4U1SA 3T2QA 3WDJA 4WUKH 4MTMA 5I1GL 4HG4K 4L37A 1D5MB 3VD0A 3D85B 1YYML 2Z31A 3UJTH 2ZOTA 2OSYA 1JWUB 1ZIBA 3H7BA 4XNXL 3VXTB 3SGEI 3B7SA 4HC1A 4CSPA 4RFEB 5IR1B 1AR1C 3DVNB 4XMPL 1N9PA 2WYTA 2XV6B 3K2MC 3IAPA 3OR6B 3CWGA 5MEPB 1F02I 5EEZA 1NCHA 3TPUA 3UO1L 3NQIA 4AYMC 5GS1A 1MW2A 3CZFA 1EGJA 3PFUA 4OZFB 4PV9B 1BAWA 2JKIS 4L4VD 4Z77B 4FQHB 3W3BA 1FC1A 1MSPA 5CZRA 2DLFH 3T6WA 1LO2L 5HVWA 2NX5A 2GUYA 2OMVB 2XKUA 1AHMA 2QV2A 4H8PA 1BFOA 4UZUA 3A6BL 4R4BB 1DQLH 4TNVK 5DJCB 3CPLB 2I60H 1PZCA 4RAHA 1N59B