3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
1MZYA 4JKNA 2YARA 3OQRA 1CC3A 2GIMA 2YAPA 2ZWNA 2IAAC 3HEIB 3NJNA 4EF3A 1ASQA 2HX9A 2BZ7A 2AZAA 2Q9OA 1BXUA 1GR7A 2VM4A 3PXLA 3UADA 2TSBA 2FQGA 1YLBB 3S3CB 1SNRA 1J9SA 1UATA 1XMEB 2YAOA 4X4KA 1ET8A 2BP0A 4GY4A 4GP5B 1L9OA 4M4RB 3WNIA 1AG0A 2FJSA 2CALA 4YSRA 2PPDA 3UAEA 3QJRB 4DPCX 3AW5A 1AZBA 1WA1X 1ZDSA 4N8UA 4W1TA 4NB7A 1NIFA 2J5WA 3NP3A 2NRDA 4Q89A 3PAVA 2QPDB 3AG4B 2FQFA 2GI0A 2GSMB 3D12B 2XYBA 4G71B 5I6PA 4DP4X 3TA4D 1A3ZA 1KBWA 2B08A 5B7EA 4A66A 2VW6A 3TBBA 6PAZA 3ASNB 3GXUB 3TU6A 3X1GA 2UXTA 3T6VA 4YSOA 7PAZA 3ZIYA 5IY5B 3NSFA 4YSDA 1EZLA 1TKWA 4AKOA 1GYCA 4JHUA 4QLWA 2ZOOA 2UXGA 3NSDA 4YSPA 2X87A 3NP4A 1QHQA 1WAEA 3QPKA 1ILUA 3SQRA 1NICA 1AANA 1OE1A 2OV0A 1SF5A 1IC0A 1W6WA 4BXVA 1PCSA 2GC7C 4KNSA 5B3SB 3NT0A 2FWLB 1PLCA 4GXFA 4W9ZA 5PCYA 4MFHA 3FT0A 1J9QA 3OMIB 2FQDA 4DPBX 2CAKA 4HCIA 1AZRA 1L9QA 5F7AA 1ASPA 4BDVB 1AOZA 1KDJA 1BEXA 1NIAA 2AANA 3JT2A 4FAAB 5I6LA 1X9RA 2XXGA 3PAZA 5AFAA 1OOWA 2DYRB 4Q8BA 1BXVA 1JVLA 2R7EB 4G70B 2IDUA 3IN0A 1E5ZA 2XV0A 2QDVA 2BW4A 3JTBA 3NJHA 5A7EA 1AAJA 2BP8B 3NJIA 5D4HA 3BQVA 5LDUA 2GHZA 2DY2A 5I5IA 3T6XA 2UX6A 1MG2C 5I6NA 4E9RA 3RYMA 3ABLB 3H4FA 2JXMA 4YSSA 1KCBA 1AZCA 4YSUA 4BDVA 2PPCA 3PCYA 5I5JA 2JFCA 1GS7A 1NPJA 4YVNA 2XX0A 3AG3B 2P80A 2QT6A 3ZBMA 3AZUA 3L45A 2H47C 1SFHA 1BQKA 1JXGA 2R7EA 4DP5X 4HHGA 3ABGA 4AZUA 3SBPA 3V9CA 1HFUA 1PZCA 3NSCA 1KYAA 1CYWA 3OMAB 4RH4A 3WKQA 2XXFA 3FPXA 1JZHA 2BP8A 2VSKB 4HAKA 1A4BA 1RCYA 1WS7A 4WTQA 4AI7A 5PAZA 1PMYA 3AY2A 3S3BB 1RZPA 2H3XC 3EH5B 1ET7A 1URIA 2I85A 2FT8A 3SBRA 1JZGA 4DP8X 4A2EA 1AZUA 1ZV2A 3FPYA 1A4AA 3QJTB 4KO6A 1L9PA 2CJ3A 4BWUA 1E30A 1FFTB 2XVBA 5B7FA 4E9TA 4YSQA 3KW8A 1MG3C 2IDSA 3FQ2A 4FA7B 2IWKA 3X2QB 4PAZA 2HXAA 2CUAA 2CBPA 4WKXA 1ILSA 4GYBA 1M57B 3FSWA 1OF0A 1NPNA 3FU8A 1J5DA 3FSAA 1IKOP 1QNIA 9PCYA 3DKHA 2DWSA 2BWIA 2WO2B 2PPAA 1RZQA 2J57A 4KO9A 1A4CA 3IEAA 2FTAA 1NTDA 5D4IA 2PP7A 1KDIA 3T6ZA 4CSPA 2XV2A 3MBWB 5E9NA 1RKRA 3EHBB 1I53A 4YSAA 1QLEB 1VLXA 2BZCA 2VN3A 2UXVA 1NINA 4YSEA 3CG8A 3X1NA 4UAHA 4BXSV 1SHXA 1KGYE 4F7KA 2J56A 3G5WA 1ZPUA 2Q5BA 4L0PB 1JOIA 2PPEA 1ID2A 3BVDB 1JXFA 2EIMB 2XU9A 1NWPA 1AR1B 1OE3A 3IE9A 2LLNA 2BHFA 1OV8A 2B3IA 1GW0A 3PAUA 1PLAA 1AG6A 4YL4A 4KO7A 4P5SA 2FQEA 1KBVA 2CCWA 1EHKB 1J9RA 3NSYA 3TASA 2GBAA 1OCOB 2IDQA 2ZXWB 2XV3A 3EH4B 3WI9A 3UAAA 4E9QA 3CZUB 4N4YB 2DWTA 2HX7A 2XWZA 1V55B 1FA4A 2ZONA 1IUZA 1JERA 2UXFA 5B1BB 2YAEA 2P80D 3CVDA 3S3DB 3FSVA 3PPSA 1JVOA 1SJMA 4HHWA 2MRYA 2HX8A 1JZIA 5TK4A 3S8GB 1JZFA 3AG1B 3EH3B 1XB8A 2IWEA 1AIZA 4HALA 3ERXA 1BQ5A 1TEFA 1PLBA 3NJGA 3EF4A 4UANA 1FWXA 1PZAA 1V54B 2IDTA 2Y69B 2HLEB 3NJMA 2E86A 1E5YA 8PAZA 4A2GA 4E9VA 1PF3A 1MZZA 1GS8A 3WKPA 5I5MA 1WS8A 1SFDA 2RACA 1OCRB 1AS6A 2QDWA 4A2HA 1GSKA 3N2JA 5B1JC 3QJQB 2N0MA 4G7SB 1M56B 1AS7A 1CURA 1KCWA 1PZBA 3X1FA 1AZNA 4A2FA 2PP8A 4YSCA 5I6OA 2HRGA 4HCGA 2PCYA 1AS8A 4HCFA 2XX1A 1AACA 4BWWA 1NIBA 1E67A 1ETJA 1BYPA 4DP0X 3X1BA 2WSDA 3CVBA 4NAJA 2IH8A 1NIEA 4DP9X 3U25A 4HIPA 2XUWA 4UF7C 2DV6A 2EINB 2OJ1A 1HAWA 2VW4A 2I7OA 1A65A 3IN2A 2EIKB 4G7QB 1BAWA 4GP4B 7PCYA 2OCCB 4KNTA 4DPAX 1F56A 4ENZA 1NWOA 1ET5A 2WO3B 3OMNB 1NDTA 3QJSB 2A3TA 1CYXA 1GS6X 4YVUA 5AKRA 4E9SA 2W8CA 2VMJA 1TU2A 3FU7B 5B1KA 1J5CA 2VW7A 3DTUB 3UACA 1XB6A 4A68A 1OE2A 4TXVB 5EHFA 4AKQA 3GYRA 4DP6X 3T6WA 5D4JA 2W88A 4A67A 4JHVA 2I7SA 5ANHA 3ASOB 1J9TA 4KNUA 5FC9A 5I6MA 1ZIBA 3SBQA 4NERA 3FSZA 1SF3A 3UGEA 4ZK8A 4BWTA 4F2EA 2H5UA 1SHWA 2AFNA 2AZUA 2HRHA 3CDZB 3ABKB 5B1JA 1IBZA 2FNWA 4QKTA 4KOCA 2IH9A 5B1AB 3MX0B 2GB2A 2YAQA 2YXWA 4DP7X 2BW5A 2MTAA 1KV7A 3GDCA 3IBOA 1L9SA 3ABMB 1ASOA 3FU7A 3FU9A 3WNJA 1N68A 1BXAA 3ZDWA 5I6KA 4KO5A 1NZRA 3NJFA 3X1EA 1L9TA 4E9WA 1DZ0A 1ZDQA 4M3HA 4PCYA 1PNCA 1BYOA 2DYSB 3AG2B 1A8ZA 2YAMA 3H56A 3V9EA 2Y1AA 3QQXA 1CUOA 1JXDA 1GY1A 1B3IA 1HAUA 2IWFA 1NIDA 3C75A 2X88A 2PCFA 5I26A 3FQYA 3WIAA 1GY2A 1IBYA 2PP9A 2YQBA 1JZJA 2EILB 3PLYA 1OCCB 1DYZA 3NYKA 3CDZA 4E9YA 3DIVA 3ZX1A 1W6LA 2EIJB 4DP2X 5I28A 1SDDB 1L9RA 4AKPA 3FS9A 1N70A 2GC4C 1ADWA 3T71A 3QJVB 4K9JA 1R1CA 3NJLA 1AQ8A 5B7MA 1BQRA 1WA0X 3H4HA 2VM3A 3S8FB 1JZEA 3OM3B 2XLLA 4BK5C 4P5RA 2HZHA 3HB3B 3OD3A 4A2DA 5F7BA 3NJJA 1E65A 4G7RB 3UABA 3FYEB 3FYIB 1M9WA 1PY0A 2QPEB 2YAHA 2YAFA 2BWDA 1OCZB 5TK2A 4E9XA 1X9UA 2IDFA 2TSAA 4AX3A 1T5KA 2AVFA 2VSMB 3QJUB 4CSZA 2BP0B 3TBCA 3T9WA 2PLTA 1SDDA 3NJKA 1MDAA 3FQ1A 4YSTA 2FT6A 1PNDA 2FT7A 1ZIAA 3N55A 1PAZA 1TEGA 4GP8B 2YXVA 4KOBA 1V10A 3KW7A 4DP1X 6PCYA 4HZ1A 1W8EA 1WA2X 2BO0A 3CVCA 4F2FA 2UX7A 4G72B 5AZUA 2PPFA 2J55A 3WG7B 2JKWA 1XB3A
chains in the Genus database with same CATH superfamily
3RDTA 3VXUE 3D33A 1PFOA 2O1AA 1JN6A 1YYLL 3DURA 4WKZA 1TUPA 4OJDH 2Q9OA 3PXLA 4HUCA 2VUYA 3HBGA 2MEJB 3IDGB 1U95A 2FQGA 2YBGA 4WI0B 5E2UL 3GZPA 5F0JB 1S7WB 2AMUA 2I5YL 3DX9B 2CHXA 5AVYB 5ERWA 3QUZC 1GZHC 1X5KA 3MLRH 3DV4B 4QRPE 5EZJB 3WNIA 4N25A 5DHVH 3PNWA 4K23H 3US0A 4R8WL 2AJZA 2DKMA 3QJRB 4HZLB 4XMUA 3RBSA 2CJTA 1MCBA 2Y1YA 4YHML 4NEHB 4PJ5B 4KMTH 3REWB 3DXAE 1F42A 4QTHB 5A2CA 2ZX6A 4FTVA 4EI5A 1GOHA 2FQFA 3SGEH 4PG2C 3H42H 1WE5A 2WIIA 2ZYIA 3KGUA 4LLMA 3QG6A 2VRQA 3RZCB 5DEGA 1ZK5A 4N8CH 1MQ8A 3TVMD 1KOAA 2GCYB 5K1VA 1I4FA 5AVZB 4DKFH 3MV7B 4QHKJ 3PNRB 4AM0Q 4GKOA 3GGWB 2ORBL 2BSBA 3DECA 1QR4A 4HS6A 5SWSD 5AD0A 2DMCA 3ZQWA 4BZ2H 1BECA 1YY8B 4NZFA 2ZWYA 1LO0H 1WAEA 2ZP8A 5TFSH 3V4PL 2Z3FA 3S36L 3NFSH 4AJVA 1MJ7L 1ZT4A 4XE5B 1ZT7A 4K3DH 3PDDA 1QFWI 1EXGA 3BN9C 3OMIB 3P0YH 3B6SB 3FAXA 3MFFA 3OKLB 3CFBB 4XXCC 4HCIA 2F54D 2VITB 4L3EA 2ATAA 3WXWL 5IP4A 3TNMA 1WBZA 5DHEA 1VSCA 1IGJA 1NIAA 2HVKA 3ARQA 1EBAA 3BZEB 4E9LA 4H25A 3QHTC 1S9YA 2EEAA 5KSBE 4PGEA 3US1A 3KYOA 2J71A 4XPGH 5EF2A 3RFZA 2D31B 5T3ZL 4XRCA 4YHNA 3VWKC 4L29A 4PJIF 3EDJA 2MCPH 3M1BB 1M7DB 3IMVA 3RAJL 5D1QE 1FJ1A 1IAIL 5FKPB 4UNVA 1AD0B 5F7EH 1JGUH 2QZQA 1CFNB 2BK8A 1PFCA 2EP6A 3MTXA 2XETA 3EG9B 5JZ7D 4Z8FH 3OXRA 5CKAA 3GSXB 3L5IA 4UQ9A 5DYFA 5IHUL 4G8IB 4PJ9B 4PBXA 1A7RL 4NN5C 4O2FB 1LNUA 4PJ7B 2DM4A 1GGIH 5DMIL 4CKQA 3DRTB 5F6HI 5I6XC 4TLKA 1WITA 3MRJA 4JFXA 2J20A 3ATAA 3BPLB 4X7FC 3MRCA 1ACXA 2NTFA 1Q9KB 5DMYA 1L9NA 1OM3H 4P9HH 4KBPA 3ULVF 2GABA 3ZTJG 1IQWH 3UTTD 1ICTA 1AQMA 2CKBA 1OB1B 4YHIB 1KTKE 4ONFH 1PZCA 3NSCA 3OMAB 2TRHA 4HOXA 3WAJA 3BX7C 5JHLL 4O58H 3QFJE 2BP8A 3QXAA 1YVLA 4FZEH 3EJCA 2HG5B 4BFOA 3FOLA 4J2XA 5FA3B 1RUAH 1A7OL 4MD0A 4MDJB 2ZG1A 4YDNA 1C1EL 2DI9A 2JKRM 3Q6FA 3DBSA 5I1KL 5C09D 2DQGH 1KCLA 1PLGL 1R3LB 1IM3B 3K1KC 4H20L 5F9OH 2EIZB 3DTXA 1E42A 2YN5A 3CMOL 5CEZH 4GKLA 2CLZB 4JO3L 3NIGB 1OPGL 4BWUA 1I8LA 3QDGA 3N44B 4OCSL 5B7FA 3WKYA 1WF5A 4MSWB 1JPTL 3T8VA 4FA7B 1Z5HA 5HHOD 1F3JB 3TEXA 4O51B 4K8RC 1NAKH 2D03L 5IQ9A 5C8JA 4J1UB 1JIBA 4U1IA 4ZDHA 1NFAA 4OLVH 2WWOA 5KANI 4LLWA 4NQVA 3GM8A 4EN2A 1MCLA 3WY4A 2ZG2A 1EO8L 2GIYA 3G9AB 4KMLB 2J57A 4LEXL 2WTRA 1DBAL 1TTGA 3GSRA 1D5ZB 3IEAA 4LRNH 1H0DA 4UWQB 5IOPA 4W9JC 1SUJA 3U9PL 3TJHD 2CLVA 4NKIL 3HIZA 1TQUA 4OZGA 4ZTPL 4RVBA 2OSLB 1OWWA 2YGNA 4LEBA 3OR7B 2F8VA 4TUKH 1JNLH 2Y2YA 4YHPA 3X13B 3VSTA 2UWEA 4IK6A 5CWSB 3O4LE 1W0VB 3B7RL 4PLKD 1V27A 4PJDF 3LKOA 1M3IA 5FHAL 1T0NB 3EBGA 1OAZH 5FK9A 1CLZL 1ZPUA 1EGJL 3QARA 1CE6B 3S48A 3T77B 3ULUE 1A9BA 1DN0A 1YNLL 2A77L 3QHFH 3I75A 3WLBA 2YQ3A 1RLWA 1HQ4B 2UVFA 3M1CA 1N3NB 1E9QB 2QMKA 4PRPA 3RWEA 1TFHA 4J27A 1OE3A 4GIPD 1LEGA 3OZ9L 3ZE0E 1KGWA 3FFCD 5KW9L 1VADB 4JFEE 4XWOD 1CGTA 1PDKA 1E8WA 4MMYA 5C0FA 4GFTB 1T4WA 4IBYA 3PWJB 2ICWB 5IB5A 1ZGLA 4L5FH 4R7NB 2WKOA 4KRPC 4P4KB 2WXHA 5T3XL 4WO4A 1GIGL 3STBA 4EPSA 3ALXA 3QEUA 1XR9B 2GPZA 1B4JL 1CD1B 2WVUA 2XJLA 4YDIL 3V6ZB 1AO7E 5BVJA 5F7MC 4HIHA 2XWBA 4ZUTA 1P2CA 3UMTA 4D0DB 2XPGB 5EOTB 2YMXL 3KR3H 1P5UC 3FHAA 1NSNL 4NQED 2R83A 3DX0A 2E9BA 1BZDA 1TYRA 3CVDA 3TPUA 2FSDA 3STLA 4ES8A 1T04A 4Q74A 4PQXA 4GI8A 5D7LD 3RGVC 3D18A 2WN3A 3VFPB 4J4PC 1YEDA 2YC1A 2F74A 4UT9H 2WLHA 3PABA 1U6AL 1PZAA 3EH1A 3UADA 2JELL 4S2SA 1YG9A 5IVXA 3VCLB 3GHEL 4OFVA 3NDYE 1AXSA 2VXSL 3LEYL 3U7WL 1Y0LA 2VMCA 2QSTA 4KKLC 4KQ3L 4WFGE 4JM4H 5C0BB 4Y2DD 4HP5A 5C3IA 1OW0C 1FO0H 2JKJA 3LX9A 5GISL 3FB5B 4LHUB 1GYWA 1T89A 2HKHL 3GKWL 1XH3B 1SN5A 4WTZG 3VGDA 5KG9B 4WFEE 1I9JL 1NIBA 1XHHA 3LD8C 1ETJA 4O00A 2X1PA 5JOFA 3Q2WA 5EMYA 5EZIH 5GGTH 4X42A 1KJ3L 4I0CC 4CGTA 2ZG3A 5A16A 2EINB 2O5ZL 2YD3A 5CP3A 2X4TA 1QWNA 4BA8A 4GIAA 1M42A 1RERA 3OZLA 5KJ4A 1PY9A 1Z5YD 5IVZA 2I7OA 3EJPA 4DKEH 4KROC 4XNXL 3SE4C 1W72B 5IROC 1WC7A 4XBEL 1P7HL 3S3SA 4MXVE 3RL2B 1J8HB 4EZLA 12E8L 4MTMA 4ABQA 3FN0L 4LRIC 2O61B 4NHCL 3QJSB 2QFPA 5ID1A 4MLIA 2YD2A 4G8FB 5EN2B 2KI6A 1CI3M 1CYXA 4XCNA 3T3MB 4G6JL 4MA8H 1HOCA 2NY2B 3CZLA 1FL6A 3U0TB 1NKRA 3CQFA 4QRTB 4WU7A 4Z0XB 1ETZA 4ZS7L 4HDIB 2HSIA 1EX0A 1TJHH 1QSED 1YEWA 1QX1A 1OLLA 4B41A 4FNPA 5B8CA 4BSJA 1N8ZB 5L2JA 1H3TA 5EHFA 4F33B 3QCUH 4HWEH 1MH5B 5C08E 4RFNC 4YLCA 5GIRB 3KNBB 3ULAB 3T6WA 1KIPB 1R0AL 5FM8A 4FGMA 3W56A 3D6GA 4XP1L 3QNFA 5CJXA 4AGLA 1IZJA 1RZ8A 4HPYH 2EDLA 1BM3H 1XQ4A 3O3EB 2BRRL 3P11L 5F89B 3ZHFA 4S1RL 3QQNA 3D25A 4P23A 1IGCL 4HEMA 1MCWM 4KOCA 3UYOD 5F0LB 3RZCD 1TVBA 5E2TL 1BX2B 5GS2H 3WJMB 1AGEA 1RZGB 4OBSA 4EUPG 1OAUL 3QI9C 3NK4A 3QJHA 1Q94A 1N68A 4CSSA 4LOFA 5CXPA 1T6WA 3CMGA 2IH1A 3QSKB 3X1EA 4WY7L 1J05B 1ZANH 3OHMB 3HE6A 4N8VG 4PLJC 3J8F7 1JF1A 2DRUA 4XMLL 1U30A 3GSWA 3ES6A 2YAMA 1MCIA 1JNJA 3RDTC 4KQ0A 4PJXF 1HSAA 4JDTL 4ZAKB 1UCTA 3SGDI 2PCFA 3KPQA 2YUWA 5I26A 2MOVA 5E6IB 2KZKA 1IBYA 2XTJE 4KXDA 1YPZE 1MPAH 2XJKA 3CHSA 4QT5A 3PLYA 1GOFA 2XBDA 3N41F 4GKSA 2ADFL 2IWGA 3BJ91 5TE4L 2ZKHL 4HAFA 1G6RB 1KTCA 3D30A 4TTDD 3MRIB 3UMNA 1L5GA 5HYSB 5IWLA 2XG4A 2H6OA 5CEZE 3BUDA 4OF0A 4Z78B 3MRNB 2P24B 1SLXA 5SWZD 2WSKA 4LCWA 3D48R 4ODTH 5INDA 1BJ1H 4JFZL 2VO5A 3KJ6L 4ZMZA 5H94A 2QVKA 3WSQL 3T0EB 1C5DB 1BG1A 3L3KB 3MV9E 3FRUA 2O5NA 4EI5C 2KPNA 3GXTA 2UZPA 4ZUUB 5C7XL 4XXWA 1A3QA 1I1YA 4E68A 1RJLB 2OLDA 3K6IA 3SYAA 5DXWA 3HC0B 4YHKL 1QTSA 5LBSA 4ZUVB 4BFGA 2D7TH 2A5UA 5C0AA 2HLAB 4N2EA 4ZO8A 3H85A 2QQQA 4IDJH 1YEIL 5JW3H 4R5VA 1FCCA 4ONGL 1JPFB 5DK2B 1JXJA 3AREB 2PWHA 2ADJA 3HZMA 1U8OB 2AJ3B 3BKML 1FNSL 2Y6TE 4TVPH 1MI5E 5GSVB 4JQIA 5EH1A 3MFGB 5EO9B 1WCBA 4JFWA 5CSZB 1WWWX 2AXHA 5DWUL 2JWYA 2Q7YB 1S7UA 1FG2A 2P48B 3NAAL 3V52H 3BDBA 5E6UB 2MQGA 3BAWA 4YOKA 4DUXA 4L05A 3BGAA 1JAEA 4K3JH 4LBAA 4QHUB 4R0LA 2ENPA 1PZ5A 1KGUA 3P0GB 1HYRC 2CDFA 4NT6A 3HAEA 3R1GH 1BXUA 2EDBA 4B0MM 2TSBA 1N67A 3BGFC 3CIQA 4CNIB 1GHFH 3RFZC 4QRRB 3A6CL 1YN7A 4Q2ZA 1OGTB 3FQRA 3MCLL 2PTVA 1IM3D 2CALA 2OMVB 4LOUC 1WAAE 4JFFE 4UM9A 1X44A 3RL1A 1CLYL 1J1XL 3ECBA 3FQUA 4LSQH 32C2A 4OGYH 4IGBD 4DETA 2B4CC 4L5FE 2F5BL 4HYTB 3GMRA 4L9LB 3EZ8A 2HTKC 3FTUA 1Z7JA 5TJWK 4YBLC 1MNUL 1D5BB 3EYSH 2XYBA 4QMEA 4EN3B 5I6PA 4ZMNA 4DP4X 2NR6A 3KYKL 1I9RH 3FQ4A 5IBTL 3V0WH 4MJIE 4B53A 4GB9A 2V2XA 1NDMA 1U8NB 5F1KC 3VFWB 4Z7NF 3X1GA 4HH9A 5B3JE 3CJJA 4EE2A 1NEPA 2YRLA 4JY6B 4QOKE 3FCBA 4WAFA 3ZIYA 5GSRB 3VU2A 1ROCA 4HEPG 1TKWA 4AKOA 3QQDB 3Q2CA 3L6FB 4PR5A 3F7VB 3NP4A 1T0PB 4KDVA 4AK2A 1KIQA 4OZHB 3DROA 4JHAL 2JV6A 5DJ0A 4Z7VA 2ITDA 5T1JA 2GC7C 4KNSA 5JDSB 3MSPA 2ZCHL 1JPGB 3BPNB 4Q0XH 4D9QE 5AB9A 5C1MB 5D7SL 1YECL 2I5YH 5FWQA 3PWPA 5FWRA 5E2VL 3DJRA 1WRFA 1U93B 4R8WH 1AD9A 1INDL 1S5HA 2QSCL 2VERN 3PQYE 5JQ6H 2QPFA 4KZEL 1D5IL 4JO4L 4YHMH 4MKTA 5F96L 1I8LC 4JZOB 2IXQB 1PZ2A 2MOQA 5IB4A 5HGHB 2DLFL 1D5MB 3D39E 5I8EA 1U8CA 2WCSA 2PYEE 4A04A 2BIPA 5EEWA 4LBEB 1TQBB 5KAQF 1ONQA 3MNWA 2R69A 5CCJA 4JDEA 4P4KD 2B14A 4MGXA 3T0VA 1PZSA 4JM2F 4FKHA 4BD4A 5AOKA 3GDBA 1EEZB 1PD6A 4EO5A 5I9QC 5CJ5A 3V4PH 1AZCA 3ESUF 3S36H 1BF8A 3U36A 4U1GB 1GS7A 2GUOB 1YSOA 4P99A 4XC3L 3GK8L 4MZ2A 4E5XB 1EJFA 4MNGA 2APXA 1JXGA 4OY9A 4XGZA 3U30B 1I8AA 2OBGA 1EDYA 4OT1H 3BP6B 3NEOA 1E0OB 2C7FA 3WXWH 1CICD 1CYWA 1BD2A 1ZXKA 3ROOB 1XTLA 5FGCB 3ARBD 1QKZL 4W4NA 5DJYA 2OMWA 5ETUB 4TS6A 4WUUE 3U2IA 3OL2A 5I76B 4H8PA 2D0HA 4AI7A 1CFTA 3MDJA 3PWNA 5GJSH 3X12B 2W92A 3QISA 4NN7C 5SX4H 5DJXA 4GW5A 1I3GH 3GHPA 3KXFE 3DVFA 3MYZA 4M1CD 5IQ7L 3F04A 3RAJH 5E8EB 2D2CC 5J3HC 1Z2KA 1XAUA 1CXKA 1ZV2A 4XNBA 1XMWA 4Y88A 4JKWA 5C0RL 2BNRB 1NL0L 2XKNB 5D4QA 5IHUH 5TPWL 4JGUA 1JZDC 1JHKL 1Q9WB 1UWXK 2XOTA 3PGFH 4L4TA 1UM4L 3FJTA 4ZX6A 4WO4C 1KN4H 3QORA 4YO0B 5IJDC 4L23A 4FEMA 3KL5A 3OZKA 4OLYL 5MP6L 3NCBB 4HIQA 4AQ8A 4HJSA 2Y07H 4B3EA 4CU7A 4MKMA 4HK3N 1PG7L 5C0IB 2DWSA 1RZKL 2WO2B 1G1KA 1J8HD 1DQJA 2N7SA 3KBFA 2AAVA 4HJ0C 3G04A 4HIXL 4J8RB 4UNUA 4KK9D 3AB0B 4QI3A 4MA1C 1CT8A 3S0PA 2UYLB 3FC8A 5M7QA 1JZ6A 4HBCL 4ICXA 2NY2D 3ARPA 3S96A 2J72A 1Z3RA 5TDOA 3L3OB 4JFYA 2R23A 3HNSL 2ADYA 3BVNB 3A6BL 2VSCA 4Y5YB 4XE0A 2VZVA 1A7OH 2YZ1A 3AXLB 1LQBC 2IVFC 4BJLA 1C1EH 3LS5L 3ESMA 2F1EA 5I1KH 2FYYB 3L4WA 1QR1A 3L4VA 4H20H 5HHQB 2C9RA 4FNUA 5I75C 2P8PB 3IKCA 2J8UB 4BELD 3CMOH 4JO3H 4L0PB 4OCSH 4M61B 3HPLA 1Z6JT 1OGSA 4CMMA 3B8SA 1HL4A 2W1NA 3OKOB 4F7CB 4GBXB 4MHHG 2OTUB 3RKDD 2V7NB 1O6TA 2HTLD 4TVPE 5K39B 3HZYA 2D03H 3SDCB 1P7KA 1SXAA 1FVDA 3ORJA 3P3RA 2WWKT 4FDWA 4ODUB 4JRXA 1GW0A 1EO8H 4ZUWB 4Q4EA 1RK0A 2DN7A 1DBAH 4TUJB 4B9CA 5IK3B 4Y4KA 3N3EA 4G1MB 5BO1L 2VDQB 4FFYL 1KTJA 4FG2A 1D2OA 4OM1L 4RAUA 2IF7A 4FMFA 2NNAA 2YJLA 2EDDA 1G5GA 3JZ7A 3QDJB 3RWFB 2F6AA 4ZTPH 5T1DL 2FWUA 4RQQA 2HX7A 1KGXA 2XWZA 4F93B 3QVAA 3P4NB 1H5BB 3I02B 3D3VB 1CF8H 5B8CC 1UHVA 4GRWH 3AQDA 2VYRE 2PO6A 4HIEA 1AC0A 1IBGH 1T7YA 4BQ9A 3GBNL 3IS1X 1EGJH 3B5GA 3KVDD 1NGWA 4ISVA 5CJXC 5H35B 3T0ED 4CSTA 1YNLH 1MZZA 4WI9A 5MI0C 2A77H 3ARZA 5D5MB 3HMXL 4YGVA 3UJJH 4RFEB 5E4OA 4M43L 4RWHA 5KYYA 3Q8CA 2Q20A 2C3XA 2P3YA 3MBXL 4P23C 3QJQB 3U6XA 3GRWH 5C2BL 2NQCA 4G9FD 4RCAA 3SKOA 4YR6A 2QL1A 5J6GA 3AXHA 3TYFB 4NLHA 5JORB 5BZXA 1R3KA 1LP9F 5I6OA 3P4OA 3RPIA 4Z3GA 1FFNA 2YMTA 1SJVA 1EZSA 2IPKA 4QTFA 1CLCA 4HCFA 4LEOB 1U2CA 3L4UA 4NQCD 3S5LB 3RZWA 1G7PA 1GIGH 2DWEB 3HE6C 3VI3B 4Z7WB 1B4JH 1JGDA 2A74B 4YDIH 2E9IA 1UOLA 1A7QH 3C6LB 3O6FA 5FLVA 2AEPL 1BVOA 2ZKXA 5AB0A 1U8IA 4LSPL 2YMXH 4L8SB 5CSBA 3DGDA 3TCLA 1NSNH 4DSYA 1LK2A 4MB1A 2VDNB 3ZHDA 4Y7OC 4F15B 1U91A 3K72B 1OB0A 3NIFF 3V7AG 3WFDH 1O6SB 3P40A 5IWLC 1YQVL 4YVUA 1U6AH 1FG9C 3MLSH 3SPJA 2JELH 4XN2A 4OZFB 4QNPE 2DTML 4MJ5A 3GHEH 1R17A 2W65A 2Z0UA 2VXSH 2H8PA 2GK0A 3LEYH 4QRRD 2XQBH 3TIDA 3JTSB 3U7WH 4A68A 5K59F 4CGUB 3RNQB 2O93L 2JNZA 1OE2A 4L4VE 3X17A 2VOTA 4ZW5A 3RUGB 5CD3A 3LXCA 4U31A 4XXWC 3UC0L 3MROB 5GISH 2O26U 3X11B 1SMOA 4Z1PA 5I6MA 2ADGB 1NBZB 4P2QA 3AWGA 5E9DB 5DFAA 1SF3A 2LV4A 4F91B 2FH6A 2H5UA 3D0LB 3DUHA 4FEIA 5E1HB 3RVXD 3CDZB 3ARFB 3RWJB 4LPYA 2WLZA 1G5AA 4EN3D 4BKTC 3QZWB 5JNYB 1IQDB 3TM6A 1AJ7L 3BH8B 1LMIA 1T5XA 5LGYA 1XF5B 5L8KB 2XG5A 2CHNA 3VGAC 2GBUA 1KNOA 3FUHA 4GG8B 4XNXH 2BRQA 5I6KA 2OXHB 1MWAL 1NMBH 2D9CA 1L9TA 3MGTA 3NCFB 4YEFA 3ME0A 1WH0A 2Z4TA 2X1XR 1ZDQA 4HKBA 3SDAD 1J0KA 4R0LC 1NC2B 1PNCA 1WQVT 4NHCH 4M6OH 4F3FA 3NN8A 4GAGL 4QHPA 3ZN6A 1CGVA 3DOSB 5JPNB 4G6JH 1QLRA 3DV6B 4KPHL 3JZYA 5ESQB 4ZS7H 5C07B 4ABWA 5IM7A 3ULVH 5KJ7E 4LSUH 4MNHA 2EUVA 1MFVA 4H40A 3LCYA 1OCCB 4BQ8A 3TN0A 2ZKMX 3QAQA 3L4TA 4FFZA 3HN5A 3QULA 1MHHA 4HUMB 3S97C 5FYKH 1ACZA 1BPLB 1R0AH 2A83A 5DMKA 3FSOA 2DQHH 2X70B 4YZWA 3H4HA 2IV9A 3EJYC 2FNBA 4P5RA 5I1EH 5EUOA 4UUJA 3P11H 2BRRH 3QQ3A 1N0LB 4QXTA 4S1RH 5HDBE 1FCGA 1SJEA 5M95B 1QFWL 3F7QA 5E2TH 3HG1D 4TF4A 1Y6NR 2ZCLH 3II1A 2XN9D 4GINA 2NR6C 1IFHL 4BV1A 5I2IB 1DE4B 3VVWA 2EVFA 2AJUL 3PFQA 2B15A 1GZPA 5D1QB 2E47A 9CGTA 1F90L 1WGOA 3DPBA 4Y1AD 3RVVC 3IJ7A 1KLUA 1RU9H 1YQ2A 5ABZA 2GJ6D 1QSFE 4HW6A 4XMLH 2LTQC 3NCYS 5C0CA 3MCYA 4JFOA 1NUNB 4JDTH 3VXRE 1TEGA 5C0DA 4OLXL 4KOBA 2BOLA 4NRYB 4HG4K 2C8NA 4X6DF 2WXMA 4LSTL 1RVFH 1FE8L 2I25N 2X6CA 3VXQB 4UOZA 2ADFH 3BFQG 2C1OB 4I1NB 3JVFC 5TE4H 3NQIA 4JFHD 4OM0L 5E23A 4L3CB 1QRNB 1T5WB 3NZSA 3RLSA 3VD5A 1MZYA 3CXHJ 2YARA 2BXYA 4LPTA 5DD5L 1MN4A 1I7UB 1UUSA 2XWCA 1QBAA 4JFZH 3SYOA 4LLAA 2VM4A 3KJ6H 1XIWA 2A4EA 1YLBB 2Z31A 3AS2A 2A9CA 4HGKC 2FL5B 3QXDA 4ZFZA 3MBEB 1J9SA 1P6FA 4ELKA 3VFRA 3AMLA 4JQVA 3C8HA 4QIRA 5C7XH 2AGJL 2Q7AA 2MKLC 2PPDA 4S0TD 3QYMA 1QLFA 1ORSB 3U9WA 1XCTB 4X5XA 2BNRD 1SQMA 4X7DC 1ZHLB 1C16B 2AK4A 1S7XB 2PWEA 1YEIH 1KB3A 3FDWA 1EMTL 4ONGH 3HMXA 3VWJD 3CC5B 1CGSL 1CU4L 4U2ZA 3HZVA 5EU7E 2E3VA 4Z0BL 3JWDL 2X4PB 2PCPA 1MFBL 4LLYA 4BZ2A 3HBZA 3BSHA 1OZUA 3ARGA 4N2LA 3FT2B 5DWUH 4FQJH 3NAAH 2FSEA 3BT2H 3FZUC 4WHTB 3SY6A 3ILQC 4PY7A 4RAVA 4GRWE 3FF8A 1G7HA 3QEQB 3QUZB 3L08A 4AZ8B 1GYCA 3F12B 3L3DB 3BYTA 2APBA 3MV8A 3KBHE 4JB9H 1DLFH 5K69A 2Y7SA 1R4XA 5ABAA 3TYGL 4UU9B 2YD5A 5GGVL 5FEBA 3E6HA 1VFMA 1HZLA 1NOFA 3FN3A 3HG3A 3MUZ1 4GXFA 1HWWA 2JKTM 4U6HA 3T0BA 3QJZA 3V6OE 1FGVL 4QR7A 4BINA 3CK0L 4MNQA 2GTZB 2WGNB 1GJIA 1V3MA 3MXVL 4DKDC 1CLYH 2ZOUA 1JHTB 2AANA 5J1SC 2R8SH 1TJGL 5LGJB 2F5BH 4Q8BA 1YUKB 4GBXD 5JYLA 1HH6B 2R7EB 3B9DA 3KYAA 4MXWL 3F7KA 4YDKH 1R5WA 1LO3L 2BW4A 1DFBL 2EXYD 5KSUB 3QORC 5GS3A 3CNKA 2YR3A 4PJAB 4PRIA 3V7AE 4AQ8C 3BQVA 1H9VA 2ZICA 3EADA 1YYCA 1SLWA 1O7DC 2WBJA 3U0PB 4J39A 1MFDH 4R26L 1AFVL 1UZ8A 1K2DB 5L2KB 2Z35A 1EJ6A 4X6BA 3AT8A 4PFEA 3EDDA 2ARJA 3RX8A 3FKUS 4HFUH 2KQNA 3EOBB 3FRPA 4HAGA 2H3NA 5LXVA 1BMGA 2V7HB 1ULVA 5D70L 4P2YA 4JHAH 1QW9A 4DT2A 3M8OH 3H0TA 1JUFA 5AL0A 1EUUA 1MAML 2N3JA 1N18A 2VLRB 3NZUA 1GZQB 4Z95H 3SPVA 3MLVL 4ZFFB 4PMFA 1BVLA 1WD8A 5AW6B 3VWKB 3P30L 2CK0L 4PJEA 5E2VH 3V4VL 3KPRA 5FPIA 2IFFL 4NO2B 5I0WA 2VCOA 4ETQA 3WKQA 1JZ3A 1INDH 2QSCH 4N90E 5LG1A 2F61A 1F4HA 1BBJB 3QFDA 4YL9A 1K4CA 2XACC 4C56B 1RIVL 3RJQB 3RWDA 2VLLA 4N0YL 5PAZA 3AY2A 3B7TA 3I6SA 4M5YL 1T7ZA 2F53A 4NN5B 2DLFH 4Z9KB 4ODXB 5F9JB 2FT8A 4DNLA 2YEQA 5JO5B 4DP8X 5I6XB 4RGOL 4PG9B 4XVUC 4I4WA 4MMZA 1UT2A 4H26B 4ZPTB 4K94C 3L3GB 4BZ1L 4PW9A 2Q76B 4UZGA 1NOLA 3P3TA 4MJ6B 3LZFH 1Z9MA 4RESB 1J1PL 4Y4KC 1HEJC 4ALAL 3OG6B 5HDQL 4M8QA 1ZLDA 4XVTL 4Z7OB 5SWQA 2WLYA 4APQA 1YEEL 4P49A 1XSOA 5EO0A 2Y5TA 2IANB 5AZEL 3ZUCA 3FSWA 1NPNA 2P43B 3GJEB 3GMMA 4NKMA 2OZNA 4MAYA 2DM3A 5EEZA 4JL1A 4XC3H 3W0WE 4N68A 5IKCB 2WYHA 3D2UD 4XMVA 5E95B 3PUUA 1FZKA 1JV2B 1QACA 4KO9A 5CD5C 2GI7A 1GKOA 3CHQA 4IOSD 1G7IB 4FJZA 2VAAA 3ZDYE 3MRGA 5FYKE 1LILA 2VLKB 3QO1B 4AWJC 1M71A 2ZOKB 2EEXA 1AR1C 1QKZH 1MVYA 3C8DA 1QPXA 3WHXB 3VXUD 1I1AA 4QXUL 5E9NA 3W5MA 2YD8A 3C5JB 1I53A 2FWOA 2R4SL 3O3DB 1QFPA 5AG8A 5JYMA 3OHXA 3ZKND 3EJZD 4LXFA 3BVXA 2P5EA 1T1YB 3UZEA 5HYEA 2IIJA 5IB3B 2R1XB 4YHOL 3L8QA 4QRPD 1FNGB 4MQXC 3SO5A 1OGPA 1QZNA 2UY6A 4M3KB 1R3JA 4X6CB 2NZIA 3BPCB 1AE6H 1CFVL 3MRLB 1JOIA 4P5KB 2PPEA 2Z1KA 1KN2L 3N91A 4IIQC 4CA4A 2LU3A 3EGDB 1JXFA 1JHKH 3GS4A 3GZOA 4EDWL 3D4ZA 3DXAD 3SZKC 4OIAA 3WNLA 1ZVSA 2LU5A 1WFOA 4ORZC 4QXGL 3ZDZF 4OLYH 5MP6H 1OV8A 4ELMF 2B3IA 1XZ0B 1UXSA 4ZNEE 1L4IA 2C7UB 5CZKA 5BVPL 1N6QL 1PG7H 3ZTDC 4ODHL 1N2RB 3H9SE 1N64H 3F6IA 4HIXH 1NC2D 1M4KA 1ZWIB 2N1KA 1RJZB 2YPLE 3TASA 3S9DB 4PGDA 1PYWB 2EUZA 2CXKA 1T20A 3KAAA 4QRUA 1BZ8A 2BM3A 5C07D 2G3MA 3HNSH 3FUKA 2QQLH 4DKTA 5CBAB 1BFVH 5AYUL 4UDTB 4RGNC 4R4NC 4BIKA 1ANUA 4NZUH 2WXRA 1MCPL 2WZ0A 3VJ6A 1CCZA 4BYHA 1T4KB 2DEXX 3B2DC 1DSWA 1OTTC 2NZ9C 1WZAA 1O7DE 4PJGB 2AXFA 3IDUA 4UANA 3OSKA 4FQXC 4Y4HD 3BFOA 3ZE1E 4PWHA 1FO0A 5GGUA 5C0EA 1GS8A 3NDZE 4P46D 2Y06H 4AG4H 3F7LA 3WEXA 5D7IF 3VXPB 2D7QA 4JPIB 1UXLA 4IU3A 4G7SB 2KKQA 4PRDB 1NH6A 3G08B 4MD5A 1PZBA 3VFSB 3O8XA 2XDHA 4MCYB 4PJ8D 5GGTA 3IGFA 5D1QD 3MRBB 2H2SD 4WW1A 1TU2B 4QHMB 3WN5C 3ZYIA 1P5UB 2PCYA 4NQSB 5F88B 1AS8A 4OV5B 2X5PA 3VNZA 4MLSA 3I9GL 3GI9L 1KENL 2O30A 4BSVB 1GPOH 3RGVB 5BRZA 5D7EA 5T1KA 5FDWA 1Z3GL 2A9ML 3S7GA 4Y2OA 2J43A 2WTOA 3DX8A 4K7PL 2B9BA 4YPGA 2NY5L 4LDEB 5DLML 1RMFL 1CIDA 5T1DH 5DD1H 3K0YA 4QYOA 4IQHA 2AJSL 5GGRA 5E99H 5IW1A 1RZKC 3TN0C 2VN4A 3KGRA 3PV7A 4UDUB 1RIUH 1AXTL 2A3TA 4JRFA 4NUPA 4OCRL 3MRKB 1N59A 2NY4D 3QO0B 5T1MA 1YNTB 1E8YA 4E9SA 4JG9A 1BQHA 1MNNA 2H0PA 5JR1H 2Y7QB 3LTVA 3QFJD 4N85A 1UTDA 3BN3B 3APNA 1P1VA 2DF3A 2ATPB 2YN3A 4TKWA 3LD8B 4M43H 1IV8A 4LGPB 5KEZA 5L6YH 4RLDA 3TIEA 3MBXH 3OSVA 3N1MC 4U6YB 4P07A 3ZT6A 1ZE3H 3L7EA 2WLIB 4HLEA 5HD8C 3DMMD 2I7SA 4KNUA 3V0IA 3IWUA 2BNQB 2NUPA 4KROB 5DJDA 1PJWA 2NNRA 1CMOA 5C9JA 4KY1L 3STZA 2HP4A 3JV0A 4FQHA 4MA7L 3V0AC 4X6EB 2OTPA 1A4JA 1E4XI 4JFTA 3QK0A 1M1XA 1S9XB 3ABMB 3ILPB 4LSPH 1MCDA 2F9BT 4HX1A 1KZQA 5BCAA 1U8QB 2BOBA 3K0WA 3LNEA 2I32A 3KLLA 2QGEA 3QUMH 3QUZD 4A1RA 3EHBD 3Q9PA 1QA9A 4W9FC 4PS7A 4RDQG 2BVQA 5IGXL 5GRVK 4HBQA 3T4AA 3IMUA 3MLZL 3E2HC 4RFNB 1A7PL 1JXDA 1BVNP 2F7IA 3BRGC 3V5DB 3KEHA 3I9PA 2DTMH 1T0MA 3KVQA 3LNIA 4UT7L 3KBEA 1I3RB 2YA1A 4AGNA 1XIWC 1F58L 2Z31C 5F3BB 2WQRA 1MCKA 3BVTA 2DQJL 4NHUB 4TUUA 2ILLA 4JQVC 3NIDF 2PWGA 5DMGC 5BZDB 4J3OH 3DX6A 5I1DB 4JDVA 3O4LD 1A14L 3RY4A 3UC0H 1Q9LB 3OKMB 3QI9B 1R3HB 1U3NA 1JGEB 2FBOJ 5FECB 4HJGB 3VA2C 1ZSHA 3R8BB 5MEOA 2BSRA 1NC4B 4WW2F 3MMEB 1YHPA 3AAZA 3L2LA 1E5AA 2AXJA 4A7GF 2J1KA 2YAHA 4Z7UF 3RDTB 4UNTA 2AV7B 2XCMC 3GEWB 1MRCH 1TETH 3D39B 3QUYC 1ADQL 1JN6B 2WWKO 3DURB 4WKZB 3VFUA 1ZD6A 3ARGC 4TUOA 3BN9D 1U95B 1MWAH 1Z1WA 4FQ2L 4JFED 1RAMA 2VSMB 3AJ7A 5ERWB 5ACZA 1HINL 1SQ2N 1OP3H 1BFSA 4GAGH 4AVJA 1E3ZA 2AJZB 1TZIA 4AGPA 2EE2A 1OIOA 3DX3A 4Y5XA 4BFJA 4GPVA 1AO7D 1W8EA 1GYVA 1N10A 3ARVA 4U6XA 5FUOL 2MNJB 3FFDA 2UX7A 1FNFA 3FUIA 4JRYE 4XHJD 5EZOL 1FLRH 3NOIA 5IT2H 4FTVB 4EI5B 5HHNA 3RVTC 2N4IA 5GS1A 3GD1C 2WIIB 1VIWA 2XN0A 4LLMB 3QG6B 4I48A 3NRPA 1MIEL 2FLBT 4FRWA 1NAML 5DEGB 5KYUA 4C56D 1A1MA 4J12A 2AZAA 2AF2A 1RUML 4NAQA 1I4FB 4OF6A 4AIZA 4A6YA 1SNRA 1TYEB 1MEXL 1UATA 3R19A 4HS6B 5AD0B 1R5IA 5JIHA 3TT3L 1GGBL 3LB6C 1O9ZA 4QUOA 2CIIA 4ACTA 3TEUA 4WFGD 4WDIA 1IFHH 3TV3L 3KXFB 5KS9A 3GSNL 1ZT4B 4N8UA 2AJUH 1QLEL 2ZIDA 5ICXA 5K9OA 1F90H 1B90A 2WBJC 3U0WL 1A2YA 3WFHA 3RG1C 1CDUA 4BFEA 3HN3A 1PZDA 3MFFB 5FFGA 4NS0A 4GSQA 2GTQA 4L3EB 4WJKB 4CJ1A 2UUDK 4M8RA 4A66A 3VI4A 2Z6FA 2HCZX 1Q1JL 5GS0L 1IGJB 2HVKB 5E4EB 2EEBA 4U1LA 1QBBA 4H25B 4M62H 1S9YB 3BGFB 4YXKL 5FGRA 3KYOB 1EVTC 3RFZB 1EZLA 4JCWA 4XP5L 3CTTA 4YHNB 2VLKD 2W9LA 5B39A 4L29B 4X4XA 4CC1A 1B0IA 3LQZA 2YD0A 4IJ3C 5TQ0H 1NFDF 2H1PL 3MJ9L 5I8KH 1FJ1B 1I3UA 5K5YA 3BWAA 4HIJA 1P69B 3K6DA 5PCYA 4MFHA 1YEJL 2X1WL 5JMRA 1E9PA 4QRBA 3IDNA 4K8RD 1ZA6A 3LZRA 4Y5VA 1LNUB 2NT0A 4K5OA 2ZXGA 4Y9CA 2WXNA 4X9GA 1RUQH 2N01B 2RQEA 4GO9A 5E56A 4NPKA 3DGGA 4PEEA 1ERNA 3MRJB 4JFXB 3JQOB 2DEYX 2IQAA 1BEXA 3MRCB 5C08D 2BIHA 2NTFB 4MMZC 5B4MC 3PAZA 2EDOA 1A25A 3C5SA 4XMXA 2E27L 3JWOH 3WAKA 4W9CC 5SX5K 1Z9LA 2CPUA 2CKBB 1MW2A 2IDUA 5IB1A 1YEKL 1MFCL 3Q2LA 1LD9A 2QQNL 1X6LA 1MFBH 1H8NA 2P46B 4APQC 3N40P 4I87A 4PD4K 2BP8B 1F6AA 3NTCL 4NPYA 3ZGIA 3BI9X 3LPOA 2KDGA 2GHZA 3FOLB 2DY2A 3LH2L 1X9LA 1X5LA 4MD0B 2CLRA 2VT0A 5LBVA 3Q6FB 3VFGH 4ZW8A 2OYPA 2ZYRA 3BVWA 4PS3A 5A6LA 3SYQA 3TYGH 1IAIM 3DTXB 3LQAC 4H7VA 5GGVH 2JFCA 1NPJA 1I1AC 4UOQA 4PPTA 2VXUL 4BZYA 4PJCA 3OHXC 1FGVH 2XTJD 3TEYA 3OKYA 3CK0H 2RHEA 3FCUB 3UZEC 1LL1A 1A0QL 5KANG 1NCHA 2XIIA 5IBLC 5LGKA 3GUTA 4LOEA 4F9LA 3NA4A 1XGZA 5C8JB 3MXVH 2WSPA 4OKVA 4U1IB 4ZDHB 1JZ8A 5CEZD 1RCYA 4LLWB 4NQVB 1TJGH 5BO0D 3LPWA 4KRPD 1BAGA 1T3FA 4YAQA 1QBML 2WTRB 2NX5A 4OCXL 3GSRB 2ZUSA 4Q58C 5HGBB 2NY0C 1H0DB 5D2NA 2J6EL 3SYPA 3MV9D 5IOPB 1LO3H 1R46A 5G55A 4NWTL 2X2UA 1AZUA 3U9UA 4G1EA 3VRLF 4TVUA 2V2TA 1Q1PA 3WIHA 4BKSC 3X3FL 5CJOH 4OZGB 3PJSA 3BSZA 4E9TA 2OR9L 4YHPB 3AGVA 4FI6A 3RGVD 5KZCB 2UWEB 3QJFA 4J4PD 4D0BA 1KJMA 4NNYA 3FTZA 1CF1A 2JJTA 4HMCA 3D85D 1GC1C 3LKOB 2X0VA 3O2WL 3EYVA 4KVPA 2APSA 5D70H 2HKAA 3IPEA 2P4AB 3CLFL 1HCZA 5FK9B 1ADQA 1MI5D 4W4OA 1MAMH 5ENWA 2DBJA 4B97A 1CDYA 1F11A 1DN0B 4NN7B 4OFIA 3ZE2B 3TJEL 5DHXB 4KKLD 4BH7B 3FUMA 2CK0H 3I75B 4GXVL 3V4VH 3WLBB 4L4JA 4N0CC 5DC4B 2IFFH 1Y6KR 1S6NA 1P53A 3MR9A 3RWEB 4PRPB 2PP7A 2VR3A 4BCYA 4CSPA 1LEGB 4KHXL 2CBOA 1CDHA 3C2SA 4YIQA 1IC4L 4AJYV 4Z76A 1PDKB 3OJVC 4MMYB 5C0FB 1YZZA 2MIZA 4M5YH 1I8UA 1XL6A 4KTDL 5IB5B 1ZGLB 2QR0A 4J3SA 3FN9A 2VQUA 1RH8A 4OJCA 4WO4B 2BXZA 2MKWA 3MRHA 3N50A 3QEUB 2KYIA 4RGOH 2I9TA 5I1GL 2XWDA 2XN2A 5BVJB 1UWEH 4HIHB 2BNQD 4ZUTB 4KROD 6FABL 1T03L 3O8XC 4JFFD 3ZDXF 2ZCZA 4W93A 3ATDA 4O4YH 4BZ1H 1S9KC 3Q48A 1P9MA 3MUJA 1QEWA 3U83A 1J1PH 2Y2TA 3EJQA 3TPUB 4ALAH 3AM8C 3STLB 1T04B 4MA1B 4XVTH 5LAXA 3M7OA 5EOQL 4X8JA 3D18B 5AZEH 5KSAA 1YEDB 2YC1B 2F74B 3FH8A 2FX8L 1RP9A 2JJSA 4H8VA 3PABB 5LNDA 1L0XA 4YFLF 4S2SB 2X89A 2P44B 4MJID 5IVXB 2PR4L 4NM4L 1I7ZA 2HT3C 3UGXA 3NEEA 4YH6A 1Y0LB 1JCKA 1BSIA 1X5GA 4PJHF 2YGPA 4XVJH 4N2HA 1YDPA 3FK3A 5DDHB 5K9JH 1IVTA 4JFDE 2AABL 1X9QA 5I75B 3Q2VA 4S0HA 4QXUH 4CVUA 5BXFA 2WINA 1MIML 4YS4A 2DWTA 2R4SH 4NXSA 3VB9A 2Q3XA 3BJLA 2F8OA 4E0RA 2UXFA 5TH2A 4PCSA 1GRWA 3FW6A 1MRDL 5JOFB 3AG1B 2Y5QA 5A16B 2QLVB 5KBNC 2X4TB 1NGQH 2DIAA 3GRWA 4NO5A 2X4SA 1PKQA 3MLPA 3GJFA 1NC4D 1CFVH 5IVZB 3IXAA 5BRPA 4R4BA 1KN2H 1K5NA 5I5MA 3BISA 4OD3L 4PLJD 3ABZA 1R24B 1OP5K 3BWUC 4EDWH 2P5WA 4L3FA 4JANB 3N2JA 4KMQA 1KB5H 3CVHA 3SPIA 1IU1A 1MVFA 2Z34A 1R3IH 1JRHI 1WFIA 2YOCA 5ID1B 3D39D 2DLGA 4QXGH 4XCNB 1RUPL 2JE8A 2O6EA 3WMPA 5E03A 1CXFA 2JB5L 1HOCB 2PYED 2PP8A 1FL6B 5EU6A 4ZMXA 5DJAA 4WJG3 3FT9A 2ICCA 4TSCL 4WU7B 4UTAA 1ETZB 4ZSOE 1N6QH 4ODHH 3BW9A 4JPKH 4KI5C 3CLEL 1VHPA 1G0YR 1ZK9A 3T3PF 1J0JA 1SOXA 5B8CB 3KPPA 3N40F 4JRWA 5L2JB 3BEVA 1CE1L 3T4AC 4OFDA 2FJUB 4GRLD 2J3SA 3VB8A 4CVXA 3LJ3A 2QADC 1RPUA 1A65A 1AP2A 4QEGA 3IN2A 5DZAA 1TQWA 5AYUH 5MI0B 1RZ8B 3DGCR 7PCYA 4FTVD 2GAZA 1E8XA 2A9DA 3UPCA 4LCCC 2HFGH 4B9ZA 3D25B 4AIEA 4P23B 4XAWL 1OO2A 4H2AA 3K5SA 1LTXA 1TVBB 5K9KA 3BQUA 2BS8A 4BRVA 4DQOH 4OQTA 2ZUUA 3M1OA 1AGEB 5FYKU 3SOTA 1DR9A 2W8CA 3L4XA 1SGKA 3D8MA 3QJHB 2WNKA 1Q94B 1JYVA 3UACA 4P8QA 2R0WH 3BC9A 1FN4A 1XB6A 1RZJL 4OGXL 3GC3A 1I7RA 2IH1B 5D1ZD 5IF0A 1DO6A 1RZIA 2FZ3A 2PUQT 3HE6B 1JF1B 4AKQA 4PJIA 3SDXE 3UAJA 3GSWB 3ES6B 5T5NG 4GG6F 3KXFD 1N6UA 1HNGA 4QPEA 1HSAB 5GS2D 3V8OA 4JHVA 4Z7QE 2PCFB 5FC9A 3KPQB 4KQ4L 4A2LA 4O5LH 4QT5B 5CHNA 4BBWA 4JRLA 3I9GH 2FHBA 3GI9H 1KENH 1NCGA 4GKSB 3ZQXA 2A9NL 1JF5A 4R97C 4R84A 3FF7A 1Z3GH 4E2OA 2J6EA 2A9MH 1L5GB 4QGTA 1OD7A 3N1FC 2ENSA 2XG4B 4K71C 2GEEA 4NUMA 4Y2LA 5FF6A 2H32H 2JKLA 4KUZL 3KYMA 2NY5H 4TLUA 5DLMH 4EXKA 1RMFH 3VH8A 4LCWB 3CSYA 1UWGH 1WZLA 4U0QB 5INDB 4Y5XC 5H94B 4KO5A 2Z0BA 2BSTB 4X9FA 5JHMA 3FRUB 4XVSL 1KGJA 3K80A 4OZIF 1AXTH 4FI8A 5AVXB 1A8ZA 5GS1C 5BUGA 1C08A 3QQXA 1YNKH 3UBGA 1CUOA 1SBSL 1P84K 3OR6A 2FRGP 4XMZA 2X88A 1L6XA 3A47A 2XPYA 2VDRL 2BSDA 3TH2T 5C0AB 4JZJA 1IC5H 4LIQL 3QIWA 4KY2A 1G7MA 3IRCA 1AKJB 4E9YA 1UADC 25C8H 4I18C 4Q7DA 3HZMB 4KKRA 4M5TA 3UO1L 2GIXA 3P9LA 3QCVL 4PJBF 1R1CA 3VGAB 1WCBB 2J1ZA 4CU6A 5LAPA 1S7UB 1FG2B 5IMOA 1J0YA 2JSFA 2WWNA 1BYNA 1PEZA 5D2LE 5FV1L 3CXFA 4KY1H 5AVSB 1W80A 2P5PA 3MLXL 4R0LB 3AQYA 4MA7H 1PZ5B 4N2AA 3TJPA 1B2YA 2CDFB 4NT6B 4TVPD 3LMJH 4UT6A 4G6KL 3RWHA 4S1QL 3HAEB 2IDFA 3W2DH 3W39A 1UB6A 2ITEA 5KYWA 1QYGH 1SVZA 3MRQA 1IGIH 3G6JE 1RD6A 1BLNA 1YN7B 4Q2ZB 4QDGA 2Y7MA 5GGSY 3FQRB 3MLZH 1E2VA 5KTEL 5ANME 1VA9A 5CBEA 2G5UA 4UM9B 1YCSA 3ARDD 3RL1B 5H37H 3CFKA 3ECBB 3FQUB 3K2IA 4UT7H 2GFBA 1WA2X 5FCUH 1A6UL 4LNRB 1FNHA 4M6AA 3AUWB 4LGSB 4B9IA 5AZUA 2DQJH 3SJVA 4U7KA 3GMRB 4PJFE 4JCMA 5CILL 1W72L 1AQDA 4Y5VC 3LZPA 1FDLL 5LN4A 3TTYA 2ZD0A 2VQ1A 3NJNA 2YAPA 3K81A 1GCFA 1FNLA 2IADA 4KAQL 1AR2A 3S8WA 2RAMA 2V2XB 1NDMB 2NZ1A 3HRPA 3QXWA 4HH9B 3SEPA 2MHAA 2NY1D 3VX1A 1EHLL 1Z9NA 3SE8H 3BWSA 4GY4A 5G4NA 2H0JA 5H8DA 1TKWB 2LTQB 5EOCH 3U7YL 5ADPL 4F9PA 2NY6C 4PR5B 5D7HA 1PX3A 1E4HA 1TCMA 3AW5A 5BS0E 1DDTA 1KIQB 2DJSA 2JB6A 1KYOK 3DROB 1ZLSL 5DJ0B 4NB7A 1X7TA 4Z7VB 3AS3A 2ITDB 4LOVA 1IJNA 5DFTA 3B9KC 1VESA 5KZCD 7TAAA 3NCYP 3PWPB 1HINH 4JVPA 2GSIA 4H1LH 1AD9B 1S5HB 3II2A 3PAYA 2Q86A 1HHJA 1KBKA 1ZT1B 2FEDC 3R7QA 1MCWW 1UT9A 5FUOH 2HPTA 4DN3L 2GT9A 4UV4H 1FYTA 3FOMA 1KELH 1UASA 4DF9A 5IB4B 3Q5OA 3ML8A 5I8EB 2FGWL 2G2PA 4WI7A 4F9LC 1FH5L 3KLQA 2VMFA 4P2RA 3O0RH 2JCCE 1A3LH 3VQ1C 3MNWB 4JDEB 2V6HA 1DVFA 1B4LA 2PR9A 2G9HA 3MHZA 5GGSA 2D3VA 3TT3H 2LFGA 4YXHH 1OVZA 5D2NC 2HYMA 4OTXH 5DS1A 4OFYD 5CCKH 3HHMA 1G6RL 2HA1A 2A4ZA 3GNML 4HSQA 3U36B 5B1CA 4M6NL 1UH2A 1X9RA 2UZYA 1HYSD 4MB3A 1F6FB 1P1ZA 2P28B 4HJ0D 3U0WH 2IMMA 2OX5A 1JVLA 4G70B 4XGZB 3CDGA 5IQOA 5TF1H 1WK0A 2JJTC 1BD2B 2EADA 3KS0J 3S34L 5AWNL 3PU7A 2KDYA 3E38A 3NJHA 2LABA 4G3YL 1N0XL 5DJYB 5GS0H 2OMWB 3UTPE 5CIPH 4HG4J 1IILE 4W4OC 4YXKH 1CFTB 5LDUA 1KPUA 3PWNB 3QJXA 3W82A 5DK3A 1FYHB 2DIJA 4XP5H 5KN5A 1F4AA 3QCTL 2V8MA 4LKXA 5DJXB 3KPSA 4GW5B 4N0UA 2VDOB 5I6NA 3DIFA 5BQ7A 5CGMA 3MJ9H 3KLHC 4ZRGA 3GSQA 1UQSA 4IRSA 1AYOA 3ZYOA 4KTEL 2H0EA 1I7TA 3G9VA 2AQ3A 4HWNA 4H0GA 1YEJH 7CGTA 1ML0A 5T3ZD 4HWZA 3P9MA 4X7EC 3B2VL 1IEHA 3WLWC 2KS0A 2EE0A 3OX8A 4NO0D 1A7BA 3QORB 4DW2H 4XNZB 3OKKA 1CZ8L 5D9SA 4Y19E 5I1IL 4NKDA 3BUQA 2DL2A 3JV6A 4R5XA 1HE7A 1H8OA 3O6MH 1AXIB 2ZOLA 1DQJB 2I85A 3G04B 1ZTMA 1CT8B 1HNFA 4JX0A 5E5RB 3M88A 2F68X 2A99A 3NTCH 3S96B 1AGFA 2XRAL 2YBRA 1ZEAL 2E7DA 2X44D 3FUJA 4LASH 2ZQKA 2R23B 3LN5B 4JFYB 5TDOB 1X6NA 2EABA 3LH2H 2UV3A 3OJDA 5E94A 1JPSH 3N1PC 1U58A 1TVHA 2F18A 4NQDA 2CBPA 5A2BA 3UBFA 1KCUL 1QR1B 1QSFD 2X6BA 4P04A 3IKCB 1A8JH 4PJXA 4AT6A 1ZLEA 4HQQL 4ONOA 5B22A 1XVSA 2Z91B 4Y4FD 3VXRD 2VXUH 1P4BH 3HPLB 1G9NH 1YJDL 2Z4QA 3EOTH 4KHTH 4KKCC 4UINL 2AQPA 5FUCC 4CMMB 4NBZB 4FHKA 4P23D 3ZMNA 4DGIH 4ZX5A 5C86A 1K3ZA 4OF3A 1NTDA 4JN2B 3HZYB 4XN4A 3L5XL 4JRYA 1P7KB 2F54E 2BIMA 1FVDB 1NM4A 2AVGA 4OBRA 4HCRL 3SN6N 2IPUG 3N06B 3HUJE 3MKGA 4JRXB 3ZZ1A 1VLXA 4R4FL 1RK0B 5HGAA 1UWFA 4YSEA 4Y4KB 4KRLB 3RPBA 4DJMA 1VACA 4C55A 3RA7L 4RAUB 3PWVA 4OGAC 2NNAB 3TBVA 5MENA 4YUEL 3V5KA 1HZHL 5EU3A 5FGBA 3SD2A 3ARRA 4RQQB 1BFOA 1EO5A 4QCIA 4XO8A 2X28A 2PTTA 5AOLA 3QDME 3NUKA 1FNAA 3ZYZA 3MJGX 4GW4A 5ALCL 2WPGA 2VLJA 2IGFL 4U2YA 3SPHA 2PCXA 3F7YB 3BUYA 1AR1B 1H8LA 3O2WH 4D9RE 1ZLWH 4HIEB 1B2WH 3D9AL 4URTB 3C08H 3PXHA 4NC1E 1ZJAA 4XNUH 2OQJA 1CVRA 4ISVB 3RKPA 2QTEA 4UIMA 4ZMTA 4YGVB 4AC4A 5KYYB 1BQLH 3UTTE 1NDGA 3WJJA 2CQVA 5J5EA 2BHUA 2CO1A 2E7CA 4IBZA 1OCOB 3SKOB 3V0FA 4YR6B 5J6GB 3CZUB 3B7SA 4Y1TA 1IC4H 1R3KB 1TFPA 2NW2A 3P4OB 5H4YA 1FFNB 5C0AD 3RPIB 1N9PA 4U1SB 4X6FA 3VFTA 4IBVA 2IPKB 1E4XL 4KTDH 1AKJD 4WI2A 1JDDA 2W5PA 2OW7A 4HHWA 1G7PB 2VXQL 2HX8A 1NANI 1V05A 1JGDB 2IWEA 1AYRA 3UAJC 5I1GH 2E6PA 2CBTA 5C09E 2W0LA 3WDHA 5CGTA 3VRJA 1T03H 4PSPA 2GBTA 3IM1A 3TF4A 4X7SH 3ARUA 4YHZL 1KXQA 2IGLA 1U8IB 1GTFA 4EAEA 3PY9A 2OL3A 1CDJA 4YJZL 1LK2B 5DUJA 2WZPA 3NESA 2C9AA 1D2PA 3O4OC 5T3XD 1C7TA 1U91B 3DNKA 2FX8H 3PS6A 2FDBP 2B77A 4WWID 2EIBA 4MJ5B 3RTLA 2W65B 4M8VA 4NM4H 3QPXH 4JHWL 3TNNA 4LPWA 4NQXA 4YC2C 3WNNA 4RGNB 2H8PB 3D05A 4KVCL 1F1AA 2GK0B 2XX1A 3T8MA 1XGRA 3TIDB 1BPVA 2JI3A 1BZOA 2H7WA 4KDWA 3X1BA 2ESVA 2YOAA 2AABH 2FH8A 2CO6A 3OKDA 4I3GA 5F7DA 4HIPA 5CD3B 1UD2A 3F5WA 4FQXB 2GJJA 5IEHA 5JW4R 2V5TA 4XMPL 2R0LL 4P2QB 2VIRA 4WK0B 1JI1A 4OR1A 5TDNA 4AVHA 3SE6A 3QG7L 2EH8L 3E9UA 2OCCB 3QIWC 4WI4A 2ROYA 1U4EA 4GUOA 1MRDH 3DBXA 1NDTA 4Y16A 3CHOA 4AM0A 4RMUA 2NR6D 4RNRB 3V95A 4JK0D 3HG0A 1T5XB 4KV5E 2EVGA 2W81C 3GMOA 3CHXA 1K9TA 2XG5B 2IOOA 5TD4A 4N90D 4F2MA 3G5ZA 4W9LC 1KNOB 4AV5A 3C2AH 1ES0A 4GSRA 3TBTB 4OD3H 4DO5A 1UD5A 4YXLH 3M07A 3MGTB 4HISA 3FMGL 3ME0B 5FR3A 1OT4A 1DL7L 4HKBB 1B6DA 4F3FB 2IAMA 3H55A 4DP6X 3NN8B 5FUCE 5E08H 4OI7A 5I0XA 2DDQL 2JB5H 1QLRB 5HHMB 4KFZC 5KSBF 3WFEL 1SVCP 3ZLQC 4TSCH 3TGXA 1VGKB 5DJZA 1T7WA 4HS3A 2ICEA 3NCXA 4C4KO 1ZLVK 4WTXA 3C6EA 4NPJA 4NC0B 3UGUA 3TN0B 1NOAA 3MLTA 3QUMA 4JM2A 1CE1H 5DZ9A 3QULB 1MHHB 3L1OL 2JKIS 1HIML 2A83B 2BW5A 5DMKB 4AUJA 2HT2C 1CGXA 1ITCA 1F3RB 5EEYA 3ZU8A 1J8SA 2XYCA 5EUOB 4UUJB 2ZXAA 3K74B 3ZTCC 4MQSB 4QXTB 1F2XK 2JQZA 4NQEE 2IG2H 1SJEB 2DYSB 4YDLC 4DPRA 1E4WL 2VL5A 2XN1A 4L1TA 1OOAA 1TLKA 4Z3JA 5AZ2L 3ARWA 1C8PA 1I8MA 3RGBA 3OG4B 3ZKSD 1EZVY 1GZPB 2HFFA 1S7RA 1QFOA 1RZJH 4RRPA 2E7BA 1YYML 1AH1A 1TQCC 1KLUB 4P06A 3C60A 3EJJX 5C0CB 4F1ZA 2VDPH 2DQCL 1N70A 4F9PC 4KK6C 1QPKA 1ZRUA 4P5TA 1XL4A 3T71A 3TO4A 5C0DB 1L3WA 1AQ8A 4ZZFA 2FBJL 5D1XE 4L8BA 5I1JH 1MF2L 2BDNL 3CHPA 5I1HL 3S8FB 1EAPA 4KXCA 3SDDA 1KEML 4MQTB 5IMMA 1HN1A 3J07A 2FX9L 2HVJB 3F84A 3V0GA 4HFWA 1E4KC 3E2HB 1KCSL 1KIUA 3M45A 1NCOA 4ZPVA 1TZAA 2HFEA 5JHDE 4KUZH 4K5LA 2LVEA 4KK8D 1PSKL 1TJMA 4MQ7A 5CZXD 5JHAA 2GTWA 3BP4A 4AEEA 4PRAA 1BIIA 2AXWA 1XIWB 2IO5A 2Z31B 1T5KA 3QXDB 4ZFZB 1JL8A 1XR8A 4ELKB 3Q8EA 1W8NA 3VFRB 2V9RA 4XO3A 5LHDA 3TBCA 1GOGA 3OLGA 3H9SD 1QFWM 2ZUWA 4X9YA 4DUWA 1A22B 4HC1A 1SBSH 4B9GA 1Z32X 1F5WA 2CRIA 4X98A 1QLFB 4PP1C 4X5XB 5KVDH 1FFOA 2AK4B 4LIQH 2BIOA 3IDMA 5IQNA 2ALWA 4JG0L 2AK1L 1DVFC 3JTTA 3BKCH 3CZNA 1RJCA 2WCGA 2XBTA 3QORD 5ESVA 3CFIC 3MNZA 2PCPB 3QFGA 4UQ2A 4LLYB 3QCVH 3LVEA 3CUPA 3ARGB 2XFGB 2YQ2A 2EEFA 1LEIA 2YPVL 2FSEB 4PJ5E 3BGMA 2KUTA 4GUPA 3RI5K 1GGUA 3L4CA 5BUAA 4PY7B 4RAVB 4ATTA 4MASA 2ZYHA 3MLXH 2ZE0A 4ABVA 5EUOF 3RIFK 3W9EA 2VXQA 3MV8B 4DAGL 2BP5M 4XAKE 3P54A 3ULUF 3ZL1A 1T21A 4G6KH 3UAFA 4BGLA 4C59B 1A6VL 1JHLL 3IRPX 4IK7A 4LSDA 5HDOA 2HH0H 2R59A 1TJXA 1EH9A 3E6HB 1NIFA 1XO8A 4YFEA 3MV7E 4U6HB 2C5DC 5EU4A 1G9ML 4LHUG 4MNQB 3ZE0F 1PPIA 3JYBA 3F00A 2RFXA 5KTEH 5FM5O 2WKGA 3TP4A 5IFHL 2HMIC 4ODSH 4IRJA 3QUGA 2ZP9A 3ASNB 4FXGA 5KYNA 4IRSC 3T6VA 2P7TA 2YWYA 7PAZA 5DJ6A 2R29L 1F4YL 1CK0H 4W9KC 5CILH 4E41A 3MUY1 2UXGA 1J5OH 1R5WB 1QMUA 4FQLL 4ZMAT 3LVTA 4GXUN 2XQYG 4NM8L 2YKLH 4U7SA 3NABH 2OV0A 2BVOA 4IRZL 3BRFA 3PF2A 5GGQH 4PRIB 1U41A 3ETSA 3NT0A 2WBJB 1MHPH 4U6TA 3A3YB 3KCPA 1OWRM 1EHLH 4Y4KD 2JIXD 1UZ8B 1DQIA 1MCNA 4DPBX 4TQPA 3ESOA 3QXUA 2ARJB 4XP9L 1RIHL 3N42B 5CZVL 5JA9A 3D1MC 4Z18A 5CGBA 3FRPB 3OB8A 3W38A 2VUKA 5GZNA 4YBQC 3FFOA 3H0TB 2Y0SA 4Q6IA 3EGSA 2RR3A 1LP9A 3GMPA 3R0MA 5CD5D 3SPVB 4MDIA 4O2CA 1BVLB 1JWMA 3U7AA 4PVBA 5ISZA 4PJDE 4PJEB 2HWZH 3CSFA 2VDKB 3KPRB 1AR1D 4IJ3B 2K1MA 4PJ7E 5HI4C 1LO4L 4ETQB 1UC6A 3RWIA 4RX4A 4FLSA 1K4CB 4I2XA 4JKPL 2BERA 3GRBA 4NGHL 3CN4A 3UJTH 4U1NB 4DN3H 4X7TA 2AEQL 2OSXA 1A9EB 2VLLB 3RWDB 2KC0A 3T6XA 1PGRB 2F53B 3P0VL 4WJ5A 4ECNA 1B9KA 2FGWH 2MTPA 4PS4L 2M26A 4MQXD 3GI8L 1DJSA 4YSSA 1KCBA 2CO3A 2JH2A 4I4WB 3PRZA 1IM9D 3QNXA 4MMZB 3FUDA 4GSUA 4ZS6C 3P3YA 3WUZA 4LZKA 4MXVF 2MH4A 2LGNA 3ZOAA 3HN8A 1HWGB 1REIA 1IB5A 3DSNA 2VZOA 4KU1A 2OSWA 5FYLL 4PRBA 2EH7H 3UTSA 4MDRA 3E8VA 5SWQB 5IFJA 2MWCA 4APQB 5EO0B 1JK8A 2Y5TB 4LCVA 2YLKA 3GMMB 4M6NH 4NKMB 4R5TA 5IQMA 4MAYB 4NUJA 4X80L 1BZQK 2E8YA 1IBDA 5DFVC 3ISYA 5FGBC 3MXWH 4XPFH 1VFAA 4LP5A 5HYSG 3L48A 4GO6B 4HGMA 5HDRA 1JD9A 1FZKB 4CC4A 4U1MA 2VAAB 3KG5A 3MRGB 3W1ZA 4HXBL 4MZRA 4JGJA 3S3PA 5F8RC 1M71B 2A6IA 4G3YH 4A2EA 1N0XH 1U3ZA 1Y07A 4JL2A 5CN2A 5JMOC 3TLRA 1I1AB 4MJJA 5GHWL 1CL7H 2FWOB 2LR4A 3B43A 1S9WA 3OHXB 3QCTH 2YKKA 2P5EB 2ZUXA 1OTTD 2NZ9D 5D7JA 2QTVA 4PAZA 4ES9A 2Z8VC 1WZMA 4KXZH 4UTBA 2QGBA 4FQXD 3WJJC 5FHBH 1BQUA 2UY6B 3N42F 2EVJA 1SMDA 2ITCA 1R3JB 1A3RH 3DC0A 1JRHL 3DJSA 5L88L 3IVKB 1S5IH 4FG6C 3APDA 2JKXA 4C83A 1A4CA 2XWEA 2NY0B 4XB7A 2IC2A 3BO8A 3CDCA 3V79C 2EECA 1ZVSB 1SJXA 1JCVA 3CBRA 3QUHA 1CZ8H 5I1IH 1YPZF 1UXSB 3IMRA 4IMLB 3MI6A 4G8GA 8FABA 3FTSA 4Z5RA 3VGHA 3U2SB 4F58H 1X4XA 4WGWB 3ETBF 5G2NA 5F44A 5KAQG 2Q2EB 4BXSV 4YMPA 3JUYA 5A3ID 4N5UA 2CR0A 1UA6L 3LH9A 4JFQA 1VEMA 4G82A 4YHLH 3EJRA 4PGDB 4HLZG 1T20B 4PD4J 1IGMH 2XRAH 5T5FA 1ZEAH 2Y3NA 4QRUB 3EFOA 5ES4B 3CV5A 2DJUA 3GIZL 4X5LA 4Z7QB 2XICA 5IW6B 3VJ6B 5DGQA 3S5ZA 1KCUH 2X7LA 1RZFL 2AXFB 2LLGA 5IHWA 5EEUA 4GFXA 1RPKA 1M53A 1BQSA 1URLA 2LHAA 4HQQH 1E6OH 4G59C 4LIQE 1S8DB 5D6DA 3RHWK 2OKMA 2WNXA 5GGUB 1AGDA 4X6DA 4ZXBA 1IEBA 4XBGA 4ZOCA 1YJDH 5HYJA 5C0EB 4FX5A 1C12A 3WEXB 1KY6A 1KBVA 1A6TA 4IU3B 5HD8D 3LKRA 3NSYA 3QDAA 1HL8A 3F7RA 1IC1A 4E9QA 5DI8A 4MD5B 4HCRH 1MKFA 3O8XB 3TCXA 3AREC 2IBZY 1DVZA 2AI0H 2GSGA 4WW1B 5DUBA 2ZONA 4PRHA 1TEYA 3RILA 2P80D 4LCUA 1SMAA 5C0CD 3UPAA 5BRZB 3ECQA 5T1KB 1D6VL 5FDWB 3RA7H 5C0BE 2IAMC 3NPZB 2VNCA 1KB5A 1MOEA 3ERXA 3EYOA 5KVEH 2Z1PA 2CXGA 3DX8B 3X14A 1Q9OA 2O72A 3FH5A 1YEGL 2IDTA 4YPGB 3DYPA 1L0YA 3BZFA 3C87A 2C3GA 4QYOB 1QBLL 1T2QL 4J28A 3FU6A 3AC0A 4R7DA 5GGRB 1G7QA 1QUPA 2EXTA 5JIIA 2ICEC 4C4BA 4X9HA 5IW1B 5BOPA 2IGFH 1WAAF 5I15H 3S98A 4XXDA 4JM2C 2GG1A 2FYVA 4G80A 2B5IC 3BUTA 4GMSL 1N59B 5BV7L 5T1MB 3HVDA 4BCXA 1XIWD 1BQHB 2Z31D 2D7PA 1INQA 2LAGB 5TE7L 4QTIL 1ZJBA 3M7FB 1SDYA 5JOPD 2DI7A 5G4MA 2B8OT 4TNWK 1E5UI 4I0PD 4HWBA 1KJ2A 5DMGD 3T2PA 1J8HE 3HVNA 3TIEB 3K2UL 5HPOA 3NA9L 4I3RH 3L95A 4FA6A 5CKGA 4L9LC 1BZ7A 3T3ME 5B3JF 3TH3T 2VZUA 4IBTA 2AK4D 2Y36H 4POZC 4JMXA 1E4XH 4NQTA 2F19H 3JWNC 2WW8A 4ONHA 5DJDB 4G6AD 2W60A 3VFVA 5C9JB 3SPCA 4B95C 1F56A 2OFQA 5L4FA 3STZB 5CCHE 2C3WA 3GS7A 4EKJA 1ET5A 4RMSA 4ACPA 4I13B 4GLRI 3D50A 4FQHB 3C60C 3IAQA 3QUYD 3WKML 3VXMA 3WNMA 1A4JB 3HKFA 4NN6B 4XZ4A 2KPWA 4P5TC 3TO4C 3LXUX 1M1XB 3AT0A 5B1KA 4HX1B 2BOBB 3SDDC 1KLFA 1HNYA 2FB4H 4PGEB 4LVEA 5DD6A 5BQDA 4LDLB 3V7MA 1QA9B 4X8CA 5LNGA 2BVQB 3TX4A 3QRBA 1AI1L 2Z7ZA 3T4AB 1Y18A 2E6QA 3WFCL 1NLDL 4JM0A 4K8RL 3DJ9A 4MS8C 3W81A 1DLHA 2QADB 2OA9A 1QP1A 2Q2LA 3HZKB 1SY6H 1GGTA 1T0MB 1P7QA 1RJYB 2H32A 4JHWH 4JE4B 2Y4SA 1JGVL 4KVCH 2I69A 5F7LB 4UB0L 1WYJA 4LCCB 4RISL 5E8DH 2FNWA 2B1AL 2IFGA 1A1NA 3SODB 4OLZH 2QELA 2YMOA 5F72S 3DX6B 4JDVB 5AOJA 2GB2A 2YS4A 5AEAA 3ULSA 3WUWA 3WTXA 1MREL 2R0LH 1QPPA 3RE0A 3O6KL 5D55A 5SWSA 1BXAA 3WNJA 5MEOB 2BSRB 4JUSA 2LE9A 1KXTA 3QG7H 4OIIL 3MJ7B 2VJ8A 1UM5H 3AAZB 3LB6D 3O3UN 3SOBL 1B4RA 5C71A 2YEVB 3A67L 3V9EA 4P2AA 5MEQB 2J1YA 4S1SL 2I9LA 2IWFA 5GZOD 1NIDA 3C75A 5LGHL 1S3KL 2YD6A 5DCCA 4ENEC 3VFUB 4GI9A 2WBJD 4TUOB 1EPFA 3NFNA 4JO8A 4UMGA 2EILB 4KJPC 1MUJA 2F54A 5JIQA 5HJ3A 3T0EE 1S9VA 4U1GC 4R97B 3FMGH 3ZX1A 1CXLA 5ACZB 2EIJB 3HC2A 4DP2X 4QD2E 3W3BA 3KPOA 1SYVA 2J1XA 2WNWA 4K71B 2ENQA 2HJFA 4QY8A 3U6RA 2UVEA 1TZIB 2DDQH 2QQKL 3EO0A 3L5WA 4XB3A 3B9VA 4GW1B 4Y5XB 4U6XB 5L0QC 2XLLA 1C5BL 3FFDB 3TTSA 5D96C 4MYWB 4ELDA 2ZUQC 5I8OH 4DESA 5CSGA 1E65A 5FDYA 4KVNL 3Q5YA 3VXTB 5HHNB 2YAFA 3CDFA 3UL4A 5GS1B 3O0LA 1UZ6E 4YBHA 4EMZA 5KYUB 3QUXD 2E8ZA 4IRJC 1F86A 4FXGC 1F97A 4AIZB 1H9DA 4A6YB 4OUUA 1OK8A 3I6GB 4N2BA 2PF6A 4N5ED 2HG0A 3CN2A 3FU5A 4NSKA 2BS71 5TGBA 5CEXA 2Y7LA 1T6BX 5CMAA 5ILTL 3FQ1A 2CRYA 1MFEL 2GYSA 3VXSA 1E4WH 1ZV9A 2VDQH 2CIIB 4GT7A 5F6IC 5TQ2L 1PAZA 4WDIB 4D94A 2WWMC 5B4MD 5AZ2H 1K6QL 5KS9B 1JMXA 5ICXB 2VN7A 2OMXA 2BO0A 2FX7H 4LO9A 5K9OB 1W91A 1A2YB 1FVEA 3WFHB 4JFUA 4ZNCD 5ALBL 3HHRB 4QRRE 2IH3A 1JNNH 2DYPD 2Y2WA 1XB3A 3EF7A 5LCVL 4APQD 4Z3TA 1HL5A 2COVD 1HH9A 2DQCH 3DI2B 4JKNA 1FZMA 4M5ZL 4R90H 3VI4B 3EDFA 3L1GA 5GZNC 3FB7A 3UBXA 5HYQB 4X4MA 1V3KA 5FYJL 1MF2H 2BDNH 2DM2A 5I1HH 4U1LB 1XGYL 2NXZD 5FXCH 1KEMH 1XGUA 2Y5EA 4Q6IC 4WUKL 3MYJA 3S3CB 4BRJA 4FE9A 3ZYJA 1WD9A 3THML 1KCSH 4X4XB 8CGTA 2JTDA 3LQZB 2D0GA 1I1AD 1KB9K 1PSKH 1WA1X 3DJTA 3MREA 2QKIA 1QFHA 3BWAB 4HIJB 5E4IA 2NUTA 1PS3A 1F8TL 3QHZH 5HHOA 4ELMA 3FU3A 4FZ8L 5I8CA 4OI8A 2P5ED 1E9PB 5IBLD 3IDNB 5LB1A 1ZA6B 4Y5VB 4PHXA 4PGZA 2QHLA 1OF2A 3F65A 1RK1A 4YDZA 1A3ZA 3DGGB 3DLQR 5F9AC 3TBBA 4HZAA 3ZUNC 1P84J 2ZPKH 2IQAB 2OZ4H 4OZHE 5CU9A 3KWTA 3MAWA 2C9SA 5KVFL 1TNMA 4MAUL 4NFCA 2UY7A 4LL1A 1WZ1L 2NY0D 2BVUA 1GJWA 1YMMA 4M00A 5DUPH 2AK1H 3VUAA 3RI5F 2G2NA 4UQCA 1Z9SA 3WE6A 5IB1B 1OK0A 2EQDA 2X87A 2NY6B 2VDNH 4N2DA 4NJ9H 1LD9B 4R7XA 2IQ9L 1AHWA 5I1LA 1QHQA 4OIFA 4LCIL 1JTPA 1E5BA 3RIFF 1F6AB 2CO7A 2XZAH 1ACYH 4NPYB 3F01A 3O2DH 5E00A 3PE9A 4KFMA 4ZTOH 4BXVA 1DBJH 3B3IB 4WEUD 2GJRA 2YPVH 1ZMYA 3B9KB 4OZFH 1FF5A 3FT0A 3LEXA 4XH2A 3L3HA 5D7IA 2CLRB 2DD8L 1N19A 5GRJL 1FBIH 3U79A 4DAGH 3SQOL 1OD9A 1L9QA 4A7QA 2BY0A 1Z9PA 1ZAGA 3RNKA 1A6VH 1JHLH 1KSRA 4PIRF 1J48A 3HI1A 3HRZA 3OPZL 2QEJA 1TOXA 4HPOL 4OKDA 3VQLA 4PJCB 4ZMWA 1G9MH 1H3GA 1CDBA 2FD6H 3ECVA 5CJQL 4OCNC 3FFCA 3RB5A 5D7JC 3GUTB 3F85A 3QDMB 1OSEA 1UKQA 4F5CE 4OKVB 2C3VA 4PB9H 2X09A 1UYWL 3AS0A 3VI4F 4NP4L 1USQA 3OXSB 1YEHH 1CYGA 3GUFA 3HE7D 2F1BA 4YAQB 1T3FB 2A9BA 3SKJH 2RIKA 2NX5B 15C8H 1UA7A 4U6VL 5AAWA 5D2NB 5IEKA 3G6AA 4ZOAA 4FQLH 4FI7A 2WJ5A 2CO4A 4YSUA 5KBDA 2BCMA 2CZNA 3U9UB 2AHIA 2NPLX 3WIFA 4MX7A 5EBLA 4IRZH 4G1EB 3NFPA 2C3HA 2V2TB 3DYOA 3CFJA 4WLCA 3ZR5A 1LWJA 2QT6A 2FECI 3PJSB 4ZODA 2VUOA 4GJTB 4LPXA 5D7LA 3WS3A 4X4YA 1A7NL 5KVGH 3QJFB 2X2JA 4AL8L 4D0BB 5CZVH 1KJMB 2VZSA 4NNYB 4RMRA 2BMKB 3FCGA 2BS9A 4OIBA 4CAGA 1XEDA 4QNPF 1HQRA 1ZS8A 4ZMYA 3EYVB 2QZ5A 2YD7A 4J6IA 1ECZA 1KYOJ 1H6TA 2FEEL 4XP6L 4GUCA 1T1XA 5ENWB 4FNLL 5BOJA 4NI6A 2BNRE 1F11B 1FAIL 1RZPA 5ACMA 2Q8BL 3F6JA 4Y2DA 4MB4A 3ZK0A 3VG0L 3MR9B 2FK9A 1LO4H 1LM8V 2DQUL 3QA3A 4AGMA 1A1OA 2BNUA 4KRMB 1L9PA 2P9RA 4YIQB 5D6DC 1E30A 4Z76B 2AEQH 4P59L 3MNMA 3NQKA 7FABL 4Y8DC 1PD1A 3X2QB 4V2BA 1NMAH 1N5AA 1YY9D 2W59A 3GI8H 1HX0A 3G5XA 4QRQA 1ILSA 4AY0A 1ZHBA 4EVNA 5I1CL 3EOAA 4PSRA 2I9TB 2EC8A