3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
molecule keywords Azurin
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
1BEXA 1ET5A 1BXUA 1L9PA 1V10A 1A8ZA 1NDTA 1OCCB 2YAMA 1GY1A 2YAQA 1V54B 1NPJA 3ABMB 4A2GA 1ASQA 4YSDA 1ADWA 1JVOA 1AZUA 1W8EA 1L9QA 3HB3B 3QJSB 1IBYA 3CDZA 2AANA 3DIVA 1AAJA 2FTAA 1WA1X 1BXVA 5I5IA 1RKRA 4WKXA 1A3ZA 1JERA 5D4IA 3IE9A 4A2HA 1ZDSA 2YAPA 3NSDA 1RCYA 2BWDA 4AKOA 1A4BA 5AFAA 1GS7A 3FSAA 4ZK8A 1PLBA 1AG0A 3AG3B 5F7AA 1JZIA 1OCZB 4PAZA 5I6LA 3EH4B 4GP8B 4JKNA 1AZRA 3TASA 1AR1B 2JFCA 3PXLA 1M57B 2UXVA 4QLWA 2DY2A 2GBAA 3OD3A 3S3CB 2P80D 2J57A 2GI0A 3DTUB 4G70B 3CVBA 4P5RA 1OCOB 3X1BA 2IDSA 2IH8A 4N4YB 1WA2X 3NJNA 3FS9A 3WNIA 4AX3A 2BW5A 4A2FA 4X4KA 4WTQA 2DWSA 3X1GA 9PCYA 4W1TA 1HFUA 5E9NA 2H47C 2AZAA 4DP2X 2XV0A 4M4RB 2LLNA 2PP7A 2UXTA 4YSPA 3X1FA 4E9TA 1L9SA 3G5WA 4EF3A 4E9WA 1PZBA 1L9TA 1HAWA 1SFHA 1IC0A 3FQ1A 5A7EA 3ASNB 4YSAA 4YSCA 3UAAA 2IWEA 1ETJA 1SJMA 4KO5A 3TBBA 4FAAB 2RACA 4AZUA 4GXFA 1PZAA 1ZPUA 3ABKB 4K9JA 5I5JA 3GDCA 2PLTA 1E67A 2UX6A 1URIA 3PAZA 1JZHA 1IUZA 2JXMA 3QPKA 3ZIYA 4E9QA 2FJSA 2ZOOA 3H4FA 2GIMA 3T6ZA 1OE2A 3FU7A 1KDJA 1PLAA 3FQYA 4P5SA 1ZIAA 2PPDA 1AOZA 2UXFA 4DPAX 2NRDA 4YVUA 4KO6A 3KW8A 1TEGA 4KNUA 1E30A 1QHQA 4HALA 2YAHA 3CG8A 3SQRA 1J5DA 3S3DB 3CVCA 1JZGA 5D4HA 1R1CA 3AZUA 3TBCA 1E5ZA 1XB3A 4A66A 3BVDB 2QDWA 3UGEA 3OMNB 1SNRA 2VSMB 4HZ1A 1CUOA 4G7RB 3S3BB 1GS6X 2OJ1A 2BO0A 2BP0B 1KV7A 1CURA 4CSPA 3JT2A 4KO7A 2CUAA 2BWIA 2IDQA 1KBVA 2XWZA 2IDUA 3ZBMA 4YSRA 2WSDA 4YSTA 3UADA 2FT6A 2I7SA 5ANHA 4KO9A 1PLCA 2FWLB 4HCIA 5F7BA 3IEAA 1IKOP 1RZQA 5TK4A 3S8FB 1BXAA 2B08A 1OOWA 2A3TA 1YLBB 4GP5B 3T71A 3QJUB 1EZLA 4QKTA 2PPEA 1GSKA 2ZONA 4M3HA 2UX7A 2GHZA 2XUWA 2YQBA 3ZDWA 2QPEB 3WKPA 2J5WA 3EF4A 4ENZA 2Y69B 1TU2A 3V9EA 1ASOA 1AIZA 3SBPA 5IY5B 2YAEA 1HAUA 1JXDA 4GY4A 4F2FA 3T6XA 3D12B 3T9WA 1AQ8A 3IN0A 3ABGA 2BHFA 2PP9A 2CJ3A 4DP0X 2I7OA 3C75A 2BP8A 2R7EA 1JZEA 1BAWA 3OMAB 2JKWA 1N68A 1NWPA 1WA0X 4HIPA 5I28A 3AG4B 4YSEA 1NIBA 2PCFA 2FT7A 1AG6A 1KYAA 8PAZA 4G7QB 3EH5B 2DV6A 2AFNA 2IWFA 2XU9A 2XXGA 5B3SB 4A68A 5PAZA 2Q5BA 4F2EA 1NINA 2CCWA 5B1BB 3CDZB 2VN3A 4E9VA 1QLEB 2X88A 2AZUA 3NYKA 4YSOA 3H56A 2BZCA 4KNTA 3FPYA 5AZUA 2CALA 4YVNA 3NSFA 1ILSA 4NERA 6PCYA 3NJFA 3NJHA 2HRGA 3SBQA 1BQKA 2N0MA 3OQRA 4YL4A 5I6KA 2BZ7A 1IBZA 2H5UA 2X87A 3WI9A 2R7EB 3AW5A 4AKPA 1B3IA 4YSUA 3HEIB 3T6WA 1OE1A 5B1AB 2MRYA 1GR7A 3DKHA 1XMEB 1CYWA 1GYCA 2HRHA 2WO3B 5PCYA 4W9ZA 3NT0A 3T6VA 2EIJB 1VLXA 3AG1B 1FA4A 3IN2A 3FQ2A 1AZCA 3TU6A 2VW4A 2ZXWB 3AG2B 4UANA 4BDVB 3QJVB 3QQXA 1J9QA 5EHFA 2GC7C 2GC4C 5I5MA 3WNJA 2ZWNA 1J9TA 1DYZA 4UAHA 1PNCA 2HLEB 2EIMB 2HZHA 4KOBA 3FSVA 2YAOA 2IWKA 3WIAA 4A2DA 4AKQA 1WS8A 2EILB 2XX1A 1CYXA 1A4AA 1AS8A 5I6MA 4YSSA 1WAEA 1CC3A 2PPAA 1OE3A 3WKQA 3PCYA 3FT0A 3FSWA 1OV8A 3EH3B 5FC9A 3L45A 4GYBA 4BXVA 3UAEA 2GB2A 3UABA 2IAAC 2UXGA 1KCWA 3OM3B 3PAUA 2QDVA 1ZIBA 4BWTA 2MTAA 3ABLB 3N2JA 2XV3A 2HX8A 1ZV2A 2WO2B 1A65A 2CAKA 3X1NA 1AS7A 2TSAA 2BW4A 1PZCA 3NJKA 4G7SB 4KNSA 1JXGA 1XB8A 4MFHA 3NSCA 2TSBA 4UF7C 1ASPA 1GY2A 3CVDA 4YSQA 4Q8BA 2VSKB 3X1EA 2E86A 1ILUA 4TXVB 2W88A 2VW7A 3QJQB 4JHUA 4RH4A 1M9WA 1GS8A 1PNDA 5LDUA 2W8CA 3FYIB 2VW6A 2QT6A 3NJLA 4HCFA 4HHWA 5AKRA 4Q89A 1FWXA 4A2EA 4BWWA 1PY0A 3NP4A 5B1JA 2QPDB 2GSMB 1KGYE 4E9XA 2VM3A 1QNIA 1MG3C 2DYRB 1NICA 1M56B 5TK2A 3PPSA 2FQDA 1BQRA 4JHVA 1AZNA 1PMYA 1BYOA 2B3IA 3EHBB 2PPCA 3GYRA 4HHGA 4F7KA 2XVBA 4DP5X 4G72B 3NP3A 2PPFA 1JZJA 3BQVA 3IBOA 4E9RA 1W6LA 4DPBX 3RYMA 3WG7B 2VMJA 1L9RA 1NZRA 2OV0A 2YAFA 3X2QB 2YARA 3SBRA 2IDTA 2AVFA 2J56A 3ZX1A 1NPNA 2BP8B 1TKWA 2FT8A 3FPXA 5I6NA 1KBWA 1JOIA 2FQEA 1FFTB 2J55A 2BP0A 1A4CA 1N70A 2FQFA 1L9OA 3ASOB 4PCYA 4CSZA 4G71B 4HAKA 1JVLA 1MZZA 1ZDQA 5I6PA 5I26A 5B7FA 1SF3A 1OF0A 2XV2A 2YXWA 2VM4A 2XXFA 2HXAA 2Q9OA 1TEFA 2PP8A 1E5YA 1DZ0A 1ET8A 4BK5C 1ID2A 1AANA 3U25A 3MBWB 1MDAA 1AS6A 3NJMA 1EHKB 1W6WA 4DP9X 4KOCA 1NWOA 3QJRB 2IH9A 3FSZA 3KW7A 3NJJA 4DP7X 2XYBA 1J9RA 1KDIA 3TA4D 5B7EA 2DWTA 1RZPA 4DP1X 3FU7B 1SHWA 1I53A 1SDDB 1OCRB 2OCCB 4L0PB 5D4JA 1V55B 1XB6A 4BWUA 7PAZA 3PAVA 1SHXA 1SFDA 4DPCX 3NSYA 1PF3A 1AZBA 2EINB 3QJTB 3MX0B 4DP6X 7PCYA 1PCSA 4A67A 3ERXA 2YXVA 5B1JC 1GW0A 2Y1AA 2FQGA 3UACA 1J5CA 1NIDA 2XLLA 1T5KA 3NJGA 3JTBA 1MG2C 2I85A 5I6OA 1X9UA 3OMIB 4BXSV 1E65A 6PAZA 1BQ5A 1NTDA 3NJIA 4GP4B 2CBPA 3S8GB 3GXUB 4NAJA 1NIAA 4BDVA 1UATA 2EIKB 2XX0A 4AI7A 4E9YA 2P80A 3AY2A 1X9RA 3H4HA 4NB7A 4DP4X 4E9SA 3FU9A 4FA7B 2HX7A 5B7MA 3CZUB 1NIFA 1JZFA 1ET7A 1NIEA 1MZYA 1JXFA 1F56A 1WS7A 1KCBA 2DYSB 2H3XC 4N8UA 2PCYA 4HCGA 2IDFA 3FU8A 5B1KA 2FNWA 1BYPA 1PAZA 1J9SA 3FYEB 3N55A 1SDDA 4DP8X 1SF5A 3V9CA 3PLYA 1AACA 2HX9A
chains in the Genus database with same CATH superfamily
2VABA 1NC4A 3CZKA 2YAMA 1EFXB 3T65B 1IGFL 2RJMA 2A74B 1IU1A 2XWRA 2BY3A 1FLRH 1BZQK 3ARQA 1Q0XH 1W8EA 3EO9H 1IM9A 4QF1A 4TM9A 4WV1C 4YDVA 4F3FB 2BOLA 3CDZA 2XQYG 5J1SC 3ZRSA 2HN7B 4PHZA 2DQEL 3GO1H 1X3DA 3R0MA 1DQIA 5D4IA 1D7FA 2EICA 3VB8A 4ESKA 5AG9A 4L3CB 4MNQE 4KI5E 5JQHC 3EJZC 2HTKC 5CCKH 5FHAH 2FJGA 4WEBL 3CVHH 4GLRH 1GXEA 2DQCL 5MEOA 1WGOA 3S36L 4PGDA 4X4ZA 1UD4A 2PYEA 5C0CB 1H9DA 1ZVSB 3RIFF 4JZJC 5AW7B 4GP8B 3CFUA 2VDLB 3W2DL 3BE1H 1VESA 2JCCE 4KKBD 1FH5H 1M3JA 1UM5H 1BQHG 2DLFL 3BPCA 1OY3B 5LB1A 2DY2A 3MUY1 1SYSA 2VOTA 2DYPD 4NZDA 1BX2A 5JW4N 1NCWL 5EEUA 1YN7A 3TVMD 2IOMA 3P9LB 3HN3A 4TL4A 1WBXA 3CSPA 1MCRA 2AQ1A 3HHSA 3SDDB 5D2LA 3KPTA 4E42A 5CEXA 5HYSA 5ITBH 4ZUVB 1KMGA 3IDUA 4PWEA 1ZK9A 2H47C 3I84A 2ZOLA 2YMOA 4JG1L 4G1EA 4I7ZC 3OKKB 1O5PA 2NXYC 4PY8J 1YECL 3TONA 1CGUA 1J1XL 2BY2A 2LE9A 3NA4A 3SO3B 3RWEB 5GSVB 4P9HL 1QEXA 4W4OC 3PGCA 4NO3A 1JPEA 4IBUA 1KCKA 5HGBB 3VWKA 1SOXA 4OCLC 4XN2A 4MB1A 4Q9QH 1QLEL 2F54B 1KPRA 3GJFB 4TL5A 3EYQC 1PZAA 3B9KA 3MLSL 3GDCA 3S4SB 1PYWB 3WLWC 1URIA 4QXTA 1L0PA 3PWPB 2NY2C 4XN9A 5I1EH 2B20A 1NAKH 3OKMA 4E41B 3SYAA 3K71B 3A4EA 3FU7A 2OMYA 3GF8A 3LMJL 5IK3B 4HLEA 4Y9FA 4LOFA 1U33A 4G5ZL 3LTVA 1D6EB 4PVBA 4KO6A 3MA7A 3AM8A 5DT1L 4N2AA 3NFNB 3EYUL 3OKDA 1QBML 2GJ6E 4OCSH 4N0CC 1KJMA 4HT1L 1IC7H 1KB9K 2ZKYA 3ASWA 4MA8L 3AZUA 2BCKA 3BPOB 2J12B 1ZSDB 1U92A 1T83C 1Y6NR 2YN5A 4Y5XB 5BV7H 2B1AH 2BHYA 1KENH 2YD4A 4ICXA 1BMWA 1AJ7L 4KRPC 3K7UA 3ZIMA 3WNOA 4CU8A 1S3KH 1CUOA 1UZ6F 3GHBH 4WWKB 4C56D 5LKNA 3M1OA 1UCBL 1ZT4A 1ZS8B 4PJAE 5F71A 2OJZL 1SOSA 2R2BA 4HU2A 1CURA 1QVOA 4RETB 4DUXA 1T66C 2VDKH 3QQ4A 4DGVL 4XN5A 3IMSA 1MRDH 4Y2LA 4MB5A 4PJDB 2XWZA 4B27A 1E0OB 1E9OB 1JJUA 4GBXD 4NO3B 4PY7A 4LT7A 4YXLL 1OLLA 4QUOA 1ICTA 1R5VA 4UCFA 2I7SA 1Y07A 1E4JA 1JNHA 4TNWK 4HCIA 2B9BA 2DLTA 2HT2D 4JFDB 1UZ6E 2WINB 4YHKL 5AW6B 4APQB 5FUZH 2XXCB 5L2JB 2AEPL 4XMKH 2UVEA 2YUVA 5C0IB 4J2XA 3E6FA 1TVBB 4MXVE 3WHXA 2NXZC 1GSKA 3BUPA 1AIFB 1KYDA 4M93C 2H2SC 2Y1ZA 3KYAA 3IDYC 2OMXA 1UWEH 2P44B 5FOJA 4QRPE 5D93C 3SBPA 1XZWA 3BEWB 3CFBB 2OKMA 1JXDA 5A43C 1GAFH 4QT5B 2YD6A 4D9QE 2GITB 1PU0A 5EEZA 4QCIB 4JM2F 5JPMA 4ODXA 1QG3A 1EH9A 4NI6A 1D2OA 2WN3A 4WY7L 1LO3H 3PV6A 3D3VE 1QBBA 1WITA 5FV2A 1KGWA 5T5FL 4FYTA 5DC2A 1CXLA 1WA0X 5KOMC 5I28A 1MXDA 2MJWA 1CBVL 3UTZB 5GGTA 4YHKH 3VXSE 5GGSB 5IG7A 1ZT1A 1SUJA 1KYAA 5F9WB 2F8OA 3MUGA 3P11L 4PJ7F 3HN8A 4TUJB 2DV6A 2ITFA 5BZZA 5IMMB 4PV8A 4HKBA 2HFGH 1BHGA 2E7DA 3T4AA 4AG4L 5D7SH 4F2EA 1JF1A 4HX1B 1HDMA 5FGBA 2UV3A 3EFDL 2VDKL 3TF4A 3CVHB 4Y19E 3SE6A 5C0EA 4EI6A 4HF5H 3O41A 3FQNA 3D2UB 1MH5A 5IVOA 4OAWA 2FO1A 5MENA 3NCCB 4F8TA 1IEHA 3NJHA 4Y4HB 3ZKMD 4JDZB 3QFDA 2F68X 1DSWA 2BSED 2XFXB 2BVEA 5KVFH 3E8VA 4KXBA 2J4WH 3GKZA 4K07A 3O2DL 4PRDB 2BOCA 4HF5L 3M45A 2XA8H 4WNJA 1MAMH 1CFNA 3T6WA 3L9YA 1B0RA 4TQHA 4E0RA 1CGSL 3SDDC 1KELL 2MRYA 2Y4SA 3KBEA 4FNTA 4P9ML 5F7YC 5TJWK 5JQ6H 2AQQA 4YDVB 1UTDA 2O5ZL 3A4AA 4JJHA 3D6GA 1H5BB 3MDJA 4L3CA 4E36A 2ZSWA 5B39A 2EKSB 3IXTA 4OZIB 4KZEH 5A2JH 1IGIH 5HI4C 4RSYA 1NJ9B 5KZCB 1I8KB 3FAXA 4NBXB 4ECNA 3OWRA 2WLLA 2MH4A 4HBQA 5AQ0A 2HRLA 1QSFB 3Q2WA 4X5RA 3QH3A 3WDJA 4PMEA 1H0DA 1B0IA 5F8QC 3HZKA 2CNYA 2EADA 2HLEB 3CK0L 3IFOA 1RZ8B 3OPUA 5I71C 1YHPA 4Q9QL 1IZJA 2LAGB 5DC0A 3OKNB 4WNSA 2VDOH 4A7QA 2H3NA 2P26A 3KXFA 4P2QE 1A4AA 3ZPDA 5C0DB 2HUHA 3GK8L 3UC0L 2BCMA 4MCYB 4U1NB 5CIPH 3S4SG 4BHUA 5C0EB 2DM4A 1NDGA 4TSCL 1NCJA 3HAEG 5AYTA 2E6JA 3V2AR 1U8OA 2ZICA 3D2UA 1HHIA 1EO8L 5D2LB 2QEJA 1WZMA 4MA1C 1F86A 4ZMOA 3M17B 1JFHA 4PJBA 3MRCB 2VLKA 3PAUA 2QR0A 5F8RC 3IM1A 5JHAA 2BW4A 3T1FA 4MAUH 5J56B 1JIBA 4GQQA 2IAMD 3VFWA 1V27A 3S5LG 1W0VA 2ZOTA 1XD1A 4X6FB 1KGJA 4KTDH 4M43H 1KEGH 2ETWA 5HHNA 3BAJA 5SWQA 1KSRA 1ZWIA 3MGAA 5IQ9A 4KXZI 3HC4L 1G1OA 1I7ZA 1F0LA 3VFNB 1OF2B 2R1WA 3FN0H 3BO8B 4AEEA 1QP1A 3PGFL 5DJ6B 2CG9X 2PW2B 4QAMB 1AI1L 1R3JA 3IS1X 3ZDXF 2NY3C 1BQHB 4Z7NB 3OJMB 1S9WA 4KH2A 2WW8A 3Q1EA 3HNVL 5B1JA 4Q9BA 1FO0A 1LE5A 1KPRB 1N8OE 2J1KA 4IU3B 4AW4A 1HKFA 3ULAB 1K2DA 4AL8L 2AI0H 4Y9GA 1AGCA 1HH6A 3CFDB 4JHVA 5E9DB 3IFNL 4N8CH 3OKDB 4PP2B 1XSJA 4Q6IA 5J4MA 4LSDA 2PPFA 4U1SB 1A7NL 2IH3A 1WT5C 1P1VA 3EBGA 3QISA 2NX5E 4Y1TA 2VMJA 4QJ3B 5DJ0B 3VXOB 1NZRA 1NCDL 4ZAKA 5A2CA 1JWMB 1LTXA 4LIQH 2YWZA 2YAFA 1XBDA 4WEEA 3SBRA 3WFZA 3ZT7A 3L4TA 5I1EL 1F11B 2NUTA 1NQBA 2AW2A 1AY1H 1JOIA 2FQEA 2WLIB 4NNXA 2YD0A 3A6CL 3PABA 5IMKA 1A4CA 3L4YA 4TF4A 5JYMA 4YHIB 5ABAA 3BUQA 1P53A 2OA9A 3OJ2C 1OSPL 1YEKH 4HIEB 4JFEA 1IE5A 7FABL 1TZIB 1WICA 4MWFB 4TVPL 2I32A 1LO2H 1TYJA 1T0OA 5IROC 1OARL 3D0AA 4AV4A 1B6UA 4BJLA 2WNWA 1T04A 5E24E 2VC2B 5EC1B 1QLFB 1G1KA 1T3FA 4NT6A 5J12B 4KKCD 2COVD 1QOKA 1WUZA 1KIQB 3TYGH 2XWBA 4OI9A 3FUIA 4XWGH 3UTOA 4H88H 3HI5L 2NYKA 3LZPA 4HC1H 4PD4J 2Q8AH 3G5ZB 1FL3B 3QUMA 5IMLB 2NNAA 3DECA 4JFXA 1LO3L 5EU6A 5H35A 3W11C 4JFOA 2BNRD 2L7JA 2XETA 5CMAA 4Y5VA 1AXTL 5DF0A 1P5UB 1N19A 2IVFC 5HVHB 4YDLC 3RWJA 4LKCB 4KMTH 4LOVA 3GS7A 2QVTA 4HA1A 1OM3H 4ZMLA 1XGTA 2VB5A 4AGQA 3HS9A 4AMKH 3QJTB 1FF5A 3QPXH 4LHQB 2KQMA 1TJGH 3MRNA 4G8EA 3WFBL 2GITA 3BWSA 1N8ZA 2CU9A 2PTTA 3LB6C 3LXCA 4HKBB 4Q14A 4G1MB 2Y5EA 4HIXL 3OLEA 5JW4Q 1Y1UA 3NMEA 3KNBA 2P5WD 2UZXA 1TG8A 3D48R 3EGSB 1ND0A 1QEWA 2C4FU 5SWZE 3KYKH 1E65A 1JF5A 1I1AC 1U4EA 5TPWH 2H32B 1DR9A 2H1PL 1N3NA 3FONB 4JFUA 5IHLB 1JHLL 3C09B 2Z31D 3NJIA 3VU2A 4J3OH 2QZQA 5GGQH 2NYYD 4YNYA 1CDJA 4BDVA 1CD1B 4AYBA 4A7UA 3JZYA 4KZCA 3U30C 3B3IB 2OL3L 5EC1A 3VWJD 1ZA6A 4RMVA 1PZ2A 1QFWM 3B5GA 4GMTL 3W9EA 4JFFE 3V4VA 3FQUA 3WEBA 1AXSA 2J6WA 3TWCH 3QEGL 4V1DD 5HYSG 4NKMA 1DCEA 3H3PH 3FU8A 4LCYA 5B1KA 1BFTA 2B1AL 1SDAB 4G9FB 1BYPA 5F0LB 1OAYL 3KPSE 4GSDH 1YEIH 4H0HB 3QSKB 2OW6A 2HT3D 4N2CA 1K8IB 1XL6A 4OUUA 3JTSB 4XP1H 3VXQA 3WMPA 1Q9LB 4PCTA 3HE6A 1U95A 3ENEA 5H2BB 1NPJA 4MQ7B 4OCXH 4UTAH 1EERB 4ZMXA 3WOVA 1TQBB 2XWDA 2WUBL 5DJYA 4KROC 1AZUA 3AQDA 2GJZB 3HB3B 1CGVA 4QOKD 3BDYL 1TT6A 3N44F 4R97C 3BGMA 4CVXB 1AYOA 1IAII 4C57C 2AGJH 4RRPM 3G08B 4ORGB 2WB7A 3PWUB 4JFQA 4X6CE 4XVUD 1EDQA 2CXGA 2HLFD 4G7VH 2EIDA 2OMZA 1U9KA 2GUOB 2YD1A 2G9HB 5IBTH 4PAZA 2EVJA 1BCIA 4JDEA 2HVJA 3BP4B 1MUJB 4JKNA 4WFED 3D39E 3KHOA 3MRCA 5IOPB 4WHTA 5LBSA 2KPWA 2L0DA 4F5CA 3JQOB 1QR1A 4OLUL 1RSYA 2JI3A 1MFAH 3NFPB 2YLHA 1NEZG 3P4OB 3VWJC 5KBKA 2ZXEB 5EPMA 2GBAA 3I3DA 3ESPA 1WEJH 4PB9L 4M56A 1KYOK 4PTUB 5JIMA 2DQGL 3D2UD 2N7SA 4J3OC 5FA3A 4EZMA 1KCUH 3INUL 3FT4A 1HHHB 4LCYB 1NEUA 4M5SA 2Y22A 2VDQH 3T4YA 3VI3F 1LE9B 1JUFA 2DM7A 4CAGA 4N87A 4G8AC 3O4LD 2UXTA 3QZWG 3VXMA 4HK0A 1H6UA 3X1FA 3OWEA 3RWCB 4ZI8A 3DROA 2XWCA 2VYRE 2FR4B 3HNVH 3AWFA 3P3RA 2P45B 1BF8A 2W07B 4DT2A 1EAPA 3WKML 4OFDA 1T7ZA 4GSRA 3QWOB 5DURB 3ZHNA 1IKNA 4HZLA 2NW2B 1KBBA 3GMQA 4LVHC 3CN3A 4N90D 5F2FA 2E46A 2PLTA 2VXTH 1ED3B 1WJ3A 1YEEH 1TFHA 2HPTA 4DGIL 3D0VA 2C7UA 1J1PL 3VXPB 5FECA 5HJ3A 1ZLSL 4N28A 3LNGA 4Y8DC 1CDCA 3BP5B 4EDWL 3MV8D 5DQ9B 4ZMPA 2FGZA 2UZPA 1WTGT 1PZ3A 4LPWA 2ADGA 3STLA 1JP5A 2G3XA 2O6DA 5JNYA 5I9QC 2VQ1A 2YAHA 3HLKA 4YE0A 2XKSA 1M2OA 4LVHB 1LO4L 3QFJE 2FUTA 3M7FB 3ZYIA 5AW3B 1UGKA 2Z8WC 1XB3A 1QUNA 3HG1A 3MVSA 1WBZA 4FL4C 3UPRA 4CW1B 1SOKA 3APNA 2FUQA 5MENE 4CKVX 4GUQA 4FFZA 3T77B 1KXHA 1RZKH 2NQCA 3LVEA 3FL7A 1UKTA 4IOFC 2CLZB 4Z3TA 4HEPA 4M3KB 4IOSD 1XGUA 3KEHA 4FNQA 4Z8FL 2W5PA 2XZAL 5GPRA 4ES9A 1KGCD 1UJTA 5FK9B 1UEMA 1FLTX 5ERWB 2OCFD 3N0PB 2GIXA 4FGMA 1JZ4A 1WFNA 4U7KA 4YUEL 3HE7C 1EAPB 3QAZB 5I5RA 3MC0A 5EU3B 3BIKA 4RWHA 5JQIB 5F7HA 1VGEH 5HYJE 3R19A 5DRNA 2PW1B 1XGPA 4HWEH 5KS9A 5F7BA 3AREA 4XX1E 1S9XB 1TETH 3U4KA 2QQQA 5DO2D 4NRZB 5CLXA 3X14B 1FNEB 3SDYH 3ARDB 5FECB 1XIWB 3Q05A 3GLAA 3LNHA 4FZ8H 1BZ7B 4QRQA 1OAQL 5E94B 3TWYA 5HJGA 5K59E 2J5WA 2H7WA 4FKKA 4L4VA 2E7CA 2I07A 2P46B 5JPMB 1GPOH 4PJ6A 5CINH 5CSZB 4DOHB 3FH7A 4N0CD 3ROOB 5MP6L 5HJDA 3PV6B 4BELD 3KPOB 3TXAA 5E5RB 1QQDB 1BECA 4XXDB 1YY8B 4MVBD 1JZEA 4L23A 1NCAH 5E7BA 5FM5M 2JKWA 5FUOH 3TFKC 4LF3B 1QNZL 3IAPA 3I3EA 3BGFB 3MJ9H 1XR8B 2DJMA 3VRIA 1D6VL 1TVDA 4G7QB 1MHCA 1UB6A 2AEQH 1K4CA 3O3UN 3QULA 4M00A 2BSTB 2MCPL 4U1LA 1M2VB 1TR7A 3G7TA 4MBOA 1NINA 1UENA 4I0PD 4WSKA 4QMEA 5BS0E 3HB3D 2FX9L 3ARFB 3F84A 1CFMA 3V4VB 4PGZA 2DQIL 4G80A 3IMBA 1CTOA 2X53A 4GRLA 2CALA 2A9DA 4YVNA 3CZJA 4AV5A 5KSBB 2EDDA 3L2MA 5DMKB 5ENWA 3QB7C 1RUPH 1W72L 2JQMA 3SQOH 1JFQH 2NXZD 2ZWYA 5I0XA 5L8LB 1LJMA 5BVPL 1IBZA 3SCMC 2UUDH 2F15A 3ARPA 3VXUA 2HUEA 3LQZA 5C09E 5GS2D 4IHOB 3CXDL 3MOQA 3EH2A 5KSVB 4Y4KA 4BK8A 1KCSH 3C5ZC 4FEIA 3W81A 1HJBC 1SDYA 4ALAL 1FC1A 5B1AB 3GD1C 1EANA 1YNLH 3VXTB 3ULUF 1E2VA 1OP5K 2QVFB 4GAFB 4BSVB 4KGLA 2YA0A 5I1DA 3AG1B 2MMXA 5HGBA 4LLVB 5MEQA 2VW4A 4UANA 5IB1A 1UOKA 3WTSA 2QKSA 2V5MA 2ZUSA 2CHNA 3L2LA 1GMEA 1VFUA 2PYED 4LU5H 3MLPA 3Q2VA 4X8XA 4Y16B 1ACCA 2GC4C 1J9TA 2YN3A 1CGXA 1CF8L 4N3TA 2LOEA 4POYA 4FJZA 5I76B 4G82A 5IUCA 5TDOA 3MBEB 1FFRA 1U8PA 4P49A 2HRPL 2EE9A 3B7YA 4JR9H 2H4EA 5C2UB 5ACLA 4KVNL 5SWSE 5IFHH 3G5XA 2PO6C 3PWNB 2DN7A 4F8PA 1CC3A 3HBQA 4RFEB 4F91B 4UIMA 1CGSH 3FN3A 3QXAA 2A83A 4X98B 4LOUC 2XA8L 5FC9A 2PXYA 4YBHA 1KCSL 1RVFH 3QS2A 3OKLB 1P1ZB 1IM3A 5AKSA 1KTKE 3RVWC 1SOQA 2BNRB 3U7AA 3ELAT 5F9JB 4JFPB 1A1MA 4AQ8C 3CVIL 3BKML 1AO7B 2XY2A 2V2XA 4PJ8B 1XB8A 4HOXA 1NFIA 4EBQH 5DWUH 4HZAA 3VWKB 3RY6C 4LLMB 4X4XA 4PBXA 1DL7L 2E74C 2KPNA 3BH9B 2C3GA 3KE0A 2EDRA 4N5EC 4XPTL 4XN7A 5FM8A 1NC4B 5AKTA 1MCLA 5E2VH 1LDPL 2DQMA 1GW6A 2VH5L 4FQ2H 4R84A 3WDIA 4DETA 3K8KA 1XX9C 4M1GL 5HJ3B 2ZZUT 1SBBA 3GRWL 3B5HA 2QQNH 4L4JA 5FYLL 3LDBC 1CLOH 2F8VA 1MHHB 4UV7H 2JJTA 4XRCB 5GS2H 4UINH 2Z91A 2F5AL 4KXAA 3UTTA 3K2UH 1CXKA 2OR7A 4PJBB 5IMOB 1RULL 4BD4A 4G6FB 2IGFH 4LGSB 2JWYA 5J3HC 1JPST 3CIQA 4AVKA 4HWBA 3RFRA 2W60B 1TYRA 4CGTA 2O4EA 2EIZA 2OSXA 4QHNB 1KB5B 2Y9RT 4BA8A 4GIAA 2IDTA 1IM3D 1CVRA 2F0CA 2IF7A 5L4IA 3ZX1A 5I6NA 1TKWA 4PGEB 5IR1A 1MFUA 1ULVA 4EUPH 2W59A 2B0SL 2J55A 5K1VA 5AD0A 3ZTJG 2VXSL 2EDHA 3HC0B 1E3FA 2XG5A 2P8MB 4CSZA 3GSQB 4NQDB 4NHUB 3MRPA 4Z7UF 4NJAL 4ZW8A 1JE6A 2X4OB 3L4XA 4QHLB 5DA0B 2RD0A 4CJ1A 4JE0A 3UOAB 4QIRA 4PJ9C 1EZVX 5E99L 5K9OA 4Q52A 3KYMB 2DB8A 4PREA 2EACA 3COOA 4Z77B 5KW9H 2KKQA 3K6NA 5JMOC 5IVXF 3MNZA 1EGJH 1FZMA 5DUMH 3Q01A 2MCG1 4F7EA 1MCWW 1MLCB 2NZIA 1E8YA 4NKDA 5C0JB 1NWOA 5ICZB 5DHVA 4WWKD 4DP7X 3POCA 1S5IH 2O30A 1WZ1L 3DUSA 3PL6A 1JYVA 1ZANL 3DTXA 2PR4H 4HLZH 3T3PB 5BXFB 5C9JB 3X11B 3PE9A 1KXVA 5IMOA 4NP4H 2Y06H 4L0PB 4P2YA 5D4JA 2CKBL 5DJ8B 3OG6B 1GYVA 4KKZA 2BHUA 4WHYH 1QWUA 4TNVK 3UXFA 1QD0A 3VU1A 2YFNA 2D7OA 3MA7B 4D8PB 2XQ0A 1DVFA 3UO1L 4ANVA 4R83A 3OF6D 4X6CA 3H2QA 1HNYA 3II1A 1H6FA 4PGEA 1H8SA 5IR1B 2ZKHH 3DIFB 3E80A 3FO2B 1MFNA 3MRQB 3BVNB 1KLGA 3LKNB 2IQAB 4DN3H 1UCTA 3IWVA 4NM8H 1EXUA 3QUYD 4FNUA 4QTIH 3UACA 4Z3EA 1J5CA 1NDMA 5HYQB 5IJBC 2VXTL 3U2SA 4KITB 4H40A 3UP6A 4MSWA 3NABH 4S1SL 3LRLA 2B2XH 3DVIA 2AK1H 3CLFH 4MKMA 5C6WH 1LK3L 1RIVH 5AZ2H 3ZRCC 3GUFA 5DS8A 3BWUF 1UA7A 3CFMA 3VXSD 1G43A 3WXWH 4DN4L 2BXYA 4UM9D 1JMZA 2UZXB 1OTSD 3WKMH 2EIKB 2G3NA 4IEFB 2IBZY 4M7KH 5L88L 5CJOH 3MJ8A 1DQLH 4TULL 3ZJAA 5B7MA 2JI1A 2MQ0A 1IO4C 1N0XH 1QLRA 4JRXD 4UTBA 4JFDA 2VC2H 4PJEF 5CAYB 4Y19D 1UURA 3FTUA 3P3UA 4CGUB 1D9KC 4IKNA 3WL9A 1FCCA 3LPFA 3C5JA 3O3DA 3G5YA 1GZPA 4XN1A 1DBML 4MBRA 1N8ZB 5DJZA 1FN4B 3TVMB 4OFIA 4OM0L 1SDDA 1WAAA 4R7NA 3IGFA 1AMXA 2J8OA 4U3CA 1A3LL 2HX9A 5CP3H 2WZPD 2GVYA 3VG0L 3LZRA 5I1HL 1R0AH 3AQZA 4AK1A 3DX6A 2VDNH 43CAA 2A6IB 2I69A 1M7IB 3ABMB 2F7RA 3ISYA 1XH0A 3PWPE 1BWWA 2VXQL 2DLEA 5EOTA 3T8XA 1N12A 4BSVA 2W94A 3I50H 5EDSA 2Y24A 4FQCH 4EJ1C 2WQXA 2BS8A 4JO2L 1A3ZA 3IE9A 4LPUA 4XXWA 5D9SB 3NRPA 5AVUB 4GT0A 5HYFA 5IUSA 2OL3H 1VIWA 5CJOL 4BUHA 2ZKWA 1NBYA 4LKXA 3QXAB 1PFOA 5AVXB 4QRRD 3PWJA 1E8XA 3BDYH 3OJVC 1AKPA 2M83A 1P5UC 1KIUA 4HIHB 3PV7A 1GZHC 1XXFC 3EIFA 5IWLA 1JVKA 3RVVC 1T1XB 5D1XA 3X3GH 3L3JB 4N2NA 5KVEE 3WFDL 4YFDB 1VFMA 3L3OA 1AE6H 3CSYB 3FB5A 3B8SA 4QLWA 4ETQA 4Y19A 3QEQA 4JM0A 4Z7WE 4JRLA 4MJ4A 4OD2B 4M1DL 1A1MB 1RUAH 5EULV 1T2JA 2YEZA 4YHLL 3SDCC 3SDAC 2PWHA 4WFFD 4EI0A 3G04B 1P4UA 3OKLA 1P7KB 2PNDA 1CK0L 2M26A 3L1GA 2ZYIA 2YGQA 1MRFH 2DEXX 3H0TB 2A6DB 4M4RB 3BRGC 1GTNA 5I1GH 3AM8C 2O5XL 4FX5A 4PW4A 4D9RE 4MCNA 3GEFA 1WFOA 1PZBA 3EJCA 4RA0C 1PJWA 1FNGB 1K8DA 4IOIA 4AQOA 3S88L 1I7RA 2YHGA 3MI6A 1D5ZA 5GGRA 3ZO9A 4ES8A 4D9LL 3FO0H 5DJ2B 4IIZA 3LNFA 1M42A 1K2DB 1RJCA 1SHMA 2DZEA 2KC0A 3DETD 3A21A 4L3EB 4HC1L 3TCLA 2RACA 1JZ5A 4LPCA 2R69A 4F9LA 3ABKB 5IB4A 2H1LM 3LKPB 1E67A 1H3PH 3PAZA 1N4XH 2E0PA 1FL3A 5DVPA 1A7OL 4ZSOB 3MV9B 5ID0B 3EYSH 4FQXB 3WJMA 1GOFA 3TT3L 1HEZA 3K1KC 5D1XD 3RU8L 1KV3A 3FU5A 1G7PA 3MV7D 3MCKB 1OK0A 2V7NA 3RVVD 3QR0A 5KVDL 2A4ZA 4J3TA 3TA3D 4HS6A 1Q9KB 1ZSDA 3VXSB 1H3GA 2Y7NA 1KCVL 4DCQB 4ADIA 4XCNA 1Z9MA 2EDEA 3AROA 4UI2A 5CU9A 4M6ML 4AZ8A 5IEKB 4PJCB 1HH9A 2WKLA 5CZXC 2OYPA 1XGUB 1SMOA 1E28A 1T04B 5E08H 1CIDA 5FK9A 3S2AA 4OQTL 4PN6A 5KVMC 2ICES 3HI5H 4R7XA 1ZHBB 2ZIDA 2BMKB 4CSPA 1USQA 3CHQA 2YPLA 2WBJC 5D72H 4QHUA 4KQ3H 2WXGA 3F7VB 4NCDA 4RFOL 5LO7A 3T3PE 1DQJB 1XIWC 2ADJB 3I9IA 3S3JA 4AQ1B 2P43B 4UQBA 3IDXH 1U30A 4FCAA 4ZW7A 1JF6A 2G5BA 3HKZA 4ODHL 4HKJA 4KO9A 1N2RA 4QYOB 4IMKA 1S7SB 3H6JA 4TNGA 2QQNL 2YUZA 4HUCA 4WEBH 4XPFL 5L0QB 1KJ3H 1UWXK 3W39B 4ACTA 4YXHH 4LLWA 4O00A 4JFTA 5E6IA 3MLZL 1CK0H 3B6SA 2X7LB 1OAKL 5J13C 3RDTC 1JI2A 4TQEH 2VZ3A 2G5UA 4ONFH 4NO0B 2B59B 5JOFB 4ZFFB 5EIIG 1D9KA 3QHZL 1QFWL 3GIVB 2E9WA 2W1NA 3R8QA 1JRHH 4U1KA 4YSEA 5EF0A 3W0WA 2WYIA 2WWMD 2PO6A 5I74B 3WTYA 5D7JB 3AB0C 1VPOL 2HVBA 1W91A 2VDRH 2BNQD 4KRMB 4LBEA 5BPPA 4N85A 1L7IL 2VLME 1X5ZA 1VHPA 1BBJA 1T1YB 3MUGB 3O41B 5D6CB 1AGEA 3DX9B 4JHZA 1QLEB 1MWOA 4K55A 4KV5E 4NPYB 2DYPA 4QI3A 4XPAL 4FQCL 3RJOA 1QLFA 1T3FB 1GC1L 1IC5L 3QIBC 4UQ2B 1IX2A 4XXWC 4K3EH 3OJDB 4NM4H 3KDPB 5TH2B 1CWVA 3ESNA 2DMHA 4YR6B 1CE6A 3VGDA 4DZ8B 5TDPA 5I16B 3B2VL 5E2UL 3S35X 2B7DT 3VFTA 4OJFH 2WXOA 3QBTB 4LLWB 2JCCF 1B3IA 1OM9A 5T33H 2C9PA 1BJ8A 1QACA 4H8HA 1TUPA 4Y1AA 5E6IB 1OHZA 3ZUCA 4FQ1H 3RG1C 1UM6L 5ECGA 1A1OA 1I8KA 3UTSD 3UYOD 2N59A 1EJFA 4CVXA 1XMEB 3DROB 2OPCA 4TSCH 1XHHA 4E41E 1YO4A 4XBGA 4LRNL 4XMZA 5JUEH 5MEQB 3SZ6A 5JORB 4S10A 3T6VA 5FFLA 2CDEA 2Z92B 2WVSA 1JHKH 2JJTC 3WUWG 4FXGA 3UTSE 1QSFA 4X5XA 4LHUG 2G3ZA 2EDYA 3U4BH 5DYOA 1MNUH 4FTVE 3VH8A 4R5TA 3S8WA 1FNSL 1Q9WA 4JL2A 1K85A 2GJJA 2G9HA 3QQXA 3PJSB 2WY3B 3FZUD 2P28B 1NCTA 5IHHA 2N56A 1SZNA 3DGGA 5DEJA 2A9BA 1X44A 3GWJA 4FP8L 4JG5A 1Y7VA 4DGYH 1CDHA 3GI8L 3MLYH 4L9DA 2EYRB 2R8SL 1RPQA 1S7TB 1SM3L 1K5NA 3NFPA 4RMBA 1RJZB 3N3EA 3PDOA 1QBLL 3IRPX 5FYKU 5E4IA 3EW3B 4LSPH 3RGVD 4F58L 2CHWA 1YEIL 3GS0A 2K70A 1BQSA 4XHQA 5FYJL 3AITA 4PBVC 3ALPA 4NQCD 3GKWL 5IHBA 4JPWL 1XCXA 5I8KH 1KCWA 4NWTH 4HKZA 3PP3K 4MCMA 3ZMEA 3CZGA 4HFWA 1ZRUA 4KNQA 2C26A 2A83B 4X98A 2WO2B 4V1DA 2HT4C 1P9MC 1AS7A 3QI9C 1I7RB 2N1TE 2XIBA 3F7YB 1HSAA 1MNUL 1P84K 4Y4FD 3QWRA 3SDAD 1DJHA 1K8IA 1QFHA 4HOMA 1FZOA 5FHBH 3WENA 1KPUB 3KS0H 4PV9B 3X1EA 4DESA 4AYID 1T22B 5D71L 5ALCH 4JHUA 4G7VL 4YXKH 3DGCR 3O4LE 5B21A 4B5EA 3CMOH 1E6JH 1KTJA 2HJFB 5T1MA 3VDCA 2EJ1A 2FGWH 1HEZB 4QHMA 4KUCD 5DJ2A 5JOEA 3G08A 3KJ4B 3LXBA 2QPDB 4N26A 3VFRB 1JDCA 1GMIA 2D3NA 4DQAA 4FYSA 1HC1A 3OHXB 5D6DC 2WQWA 4XVJL 1FAIL 1I9JH 1Z9SA 2P24A 1VRSA 4ZO6A 1PMYA 4K7FB 2B3IA 5FFOA 2BZDA 1K3IA 2Z91B 3K8MA 4AIZA 4HDIB 4E9RA 1W6LA 3CZFB 1F11A 2NUTB 3GHBL 3NESA 2OTWB 4MJIE 3BT2L 5BZDA 1YPZF 1AD0A 4R8WH 5J89A 3X2QB 3SKUD 2D9CA 1AP2A 5KYUA 5F9OH 4LRIA 2ERJC 3H55A 1XR9A 3LEXA 2R23A 2NY7L 1G7LA 4HKZB 4UDUA 3G5VA 4Z23A 4E42B 4HAKA 3PPEA 3HHRB 4L18A 1MVUA 1R5IA 3QI9D 2GK2A 3BD3A 4WGWB 1DBBL 5IROD 3WEAA 2YPLB 2VO8A 3FOLB 4JFYA 2NY5L 1G6RB 2LU4A 4Y5XA 1A6UH 3WS3A 3T3MB 2NXYB 4NT6B 1P84J 2HKFH 1F42A 2V8LA 4F7MA 4DEWA 3CQFA 4YDIL 4PCKA 3U25A 5ICZA 2VMCA 1UT2A 3QCTL 2Y1VA 1VZHA 3NJMA 2NNAB 1S7XB 3E8UH 5L4MA 3IJSA 2VKXA 4GQ9H 2DW5A 2GK0B 3FT2A 1RLWA 3NJJA 4JN2B 5MP6H 4FF9A 1KJMB 4UTBH 1P5UA 2CCLA 5F44A 2W0FB 1KEML 4DWHA 3WAKA 4NQQA 2FBOJ 4P4RA 3VXPA 4F27A 4ZTPH 3IJ9A 1UZ8B 2E9IA 4JRYA 1LQSR 4TPRL 1ADQA 1FPTL 1WHPA 2HG5A 3IDYB 2X2IA 3OB0H 2X0VA 1FGVH 3ZQ9A 4LGRB 1DVYA 2BSRB 3FTSA 2HWZL 1FV1A 3CX5K 3B2VH 5E2UH 4F15C 4DPCX 4R2GB 1DJGA 4N8VB 2V3EA 4P57A 5CMAB 2KDGA 2P5WB 5KUKA 1JGUH 4X9YA 3BC9A 1GJUA 3BEWA 3ZTCC 2BSTA 3H3PL 3U2SB 4AEIH 3IJEB 5CU5A 2NUPB 3KJ6H 1T5KA 3OZLA 5EBLB 3H9SE 2W9EH 2CR6A 2CO1A 5CD5D 3DIFA 4KZ0A 4AMXA 4TVSa 5ALBL 4AH2B 4HGWB 3WY3A 3IPBA 3ARGA 5IEHA 4HP5A 4ZNCD 5HYQA 4XC1L 4AQAB 4KKRA 1IEBA 2JKXA 43C9B 3TS8A 3KJ6L 2DEWX 5TH2A 4GBXB 1FG2A 4YS4A 1MELA 1WVZA 3D4GA 2WLKA 4Y2NA 5I8EA 3GHEL 3L95A 3ZKNC 1I3RA 5DO2C 4ZMQA 1FFOA 2H3XC 5JR1L 1IKNC 3RX7A 1P2CA 3QIUD 3TC9A 3JUYA 1J1OL 1MRCL 3C6LC 4MKTA 3ZOAA 3BLBA 5LNGA 2O61B 2OR8A 4KJQD 2Y36H 3UC0H 3STBA 5FO8A 4NUQA 3BAYA 1IFGA 1SF5A 2F5BH 3NIFB 1FC2D 1PIFA 5D7HA 3Q5YA 4Y2OA 1MHPL 3QDGB 3ZT5A 5BUAA 1NDTA 1SBSH 2GJZA 2N4IA 5CSBA 5DD0H 5DVNA 2YAQA 1V54B 3GSNH 5DZVA 5C86A 1OQOA 2ED8A 5H37G 4HSAC 2UUDK 1W15A 1YY8A 3CLEH 8FABB 1Q9LA 3BWAB 4JGMA 3HZVB 2O5NA 5I23A 2QADD 4ABQA 3D69A 1K5NB 3QUYC 5LGHL 1P0SE 2OMZB 3OAYK 3Q06A 1GGCL 2VLLA 2YAPA 2BOBB 5I19L 1J8HE 4JKWA 2AITA 1K5WA 1MCQA 2R59A 4OZHF 4FC3E 1JTPA 5EOCJ 4MDJB 3A0OA 3KPRB 4UBDC 1HEJC 3ARYA 1AKJD 1LNUB 1N0XL 1EJOH 4WWPA 5EBWA 1N5AA 5F6IC 2AQNA 5IW1B 1MJJB 1TNMA 4JKPL 3P77A 4PJEB 2EYRA 5L8KB 5JW4M 5H94A 2DIEA 3KL3A 3PG2A 1WFJA 3JV6B 4NUGL 1GZQB 4FP8H 3NCJH 2YS4A 2OXGB 1ADQH 1B0RB 5D7IA 4E0RB 3PY9A 3A23A 2A73B 3EJYC 3S3CB 4WHYG 3FT4B 1Y6MR 3L3IA 2GTZB 4GW4A 1INEL 2V37A 4LCCB 3O6FD 1YUHB 2XKUA 4LCVA 3QIUC 4P2AA 4YMPA 1N6QH 4EOWH 3BSZL 3L3KB 2NNXA 5D7IF 3KPMB 3TBWB 2VZUA 1HHIB 2W07A 1BVLA 2AZAA 3VQ1C 3SDDD 5C0BA 4ZW6A 3A47A 4OGZA 5LLIC 3FT9A 3IFLL 4WI5A 3ARTA 3SYOA 4Z6AT 1Z1WA 1IC0A 3K6FA 3ATFA 1XZ0A 1U8IB 4NPKA 4YSCA 1XAKA 4RZCA 2AI0L 4JPVH 3CWGA 1NFDA 5GGSY 3NCYP 1LEIB 4S1RL 5FXCH 3RUGE 4P4KB 2VQTA 4JVPA 2WPGA 5E2WH 1RK7A 4XMPL 2FEJA 4RWYL 3UZVB 2ODHA 2X3BA 1NCUA 3QH3B 2RQ8A 4W6XB 5GGUB 1JZHA 4HJ1A 5C7ZA 5I76A 5DXWA 1F58H 4TUOA 3QPKA 1E90A 2CRMA 3N9GH 4UQ3B 4ZUWA 3T3PF 3TCLB 5T3ZD 5BZDB 3VRLE 2QSCH 1PLAA 1IFRA 3MLWH 2XYCA 2E6PA 3VXSA 3G5XB 4M7KL 4PJEA 2XSKA 3RZCA 2P8LA 1VZIA 2VXUL 3M7OA 1WYJA 4HJUA 1UG9A 4HALA 4X8JA 1MI5E 2EE0A 2UZIL 4XPHL 3NEEA 2D8KA 4OSUH 3CVCA 1JZGA 4NS0A 4AIZB 1CF1A 3IGAA 3TBCA 5F3HB 1A47A 3WN5B 4HEMA 4S0HA 5IB5A 5HDRA 1MF2H 4PYGA 5AVWB 1HSBB 3KGRA 1NMBL 5D8JH 3CPUA 4QO1B 1P9MA 3HMWL 3QI9A 1EUTA 1A9EA 3CNKA 1OHQA 3D09A 3IDGB 3BAXA 2ED7A 3PABB 5IMKB 2W81C 3MHZA 4AYEC 4WK0B 2JELH 4N5ED 4W9HC 2R9HC 3PNWA 4UOW0 3V9FA 4AYSA 4IW4C 4FQXA 2QELA 3VFNA 3ZBMA 4IGBB 2V3DA 4ISVA 2EC9U 3O6ML 4UQIM 2BMKA 1RULH 5ANHA 3RIFK 4B0MB 4LPXA 2IFFH 3DMMC 1RIUL 2KLSA 3MJ9L 1IAIM 3EBAA 2NTFA 2Z65C 4GW1B 3WHE1 4ZW3A 1DQJA 3BVWA 2B1OA 5TPWL 4U1HA 4HVBA 4QKTA 4RFOH 1S78D 2WTOA 4CA4A 1S7RB 2YOCA 1IC7L 3APCA 4NRYB 3KPOA 3OKMB 3KL5A 5CEYA 1INQA 4RMRA 1BP3B 4N8VA 1HH9B 3MNMA 4FQ1L 4PH8A 3ROOA 3TJHC 5I8CB 1FV1B 1MVFA 1URLA 3O6FB 1KFAL 5EFIA 3U30B 3WY2A 3LJ3A 1MCJA 3DX6B 1THCA 2CUIA 1AQ8A 3QUML 3ABGA 4X8JB 5AUMA 3SDXB 2BHFA 4L5FE 4JZJA 5F7FA 1WBYB 1XR8A 2BP5M 3VRIB 2EVFA 3V5KA 3T8XB 1JXKA 4FZ8L 5F96L 3AB0B 4TQIA 4HOZA 5IB2B 1N68A 1NWPA 3CVIH 4OF3A 3ZSTA 1QBAA 1FIEA 1XWVA 3LSOB 1I8LA 4N0RA 1C5BH 2GPZA 3RAJL 8PAZA 2XJLA 4QHLA 4R97B 1ZS8A 1UWXH 4DNLA 4AGPA 2OYMA 3SB3A 3LOWA 2EZ0C 3HB3C 2CUHA 3DBXB 3FJTA 4AQ8A 2VRAA 1KIUB 3ELQA 2CO3A 1MHCB 1UB6B 3HG5A 4G80B 1FJ1A 4CADB 5LVEA 4ZBJA 2J6EA 3RVXD 1QHPA 3QEHA 4J8RB 3V7AE 2AZUA 3RVTC 1UOLA 3DVGA 4YSOA 2VDKB 3H56A 3MOBH 1E3ZA 4M7JL 5KSAD 3W82A 5E9AA 1FCGA 2HRPH 3SCMD 4X0NA 4TMPA 1UWYA 32C2A 1NKOA 4QYAA 1CD1A 1CZ8L 1CF8H 1A6WH 1LK2A 4IRSA 5EOCH 3L4CA 4JB9L 2R7EB 2D2OA 2XNAA 1R19A 1M7IA 4RISL 4WY7H 1ECYA 5EZJB 3MRMA 1QAWA 2O5XH 4L05A 4JFOB 1J8HA 4HXBL 1UACH 3BWAA 4FG0A 1FL5A 3W0WB 2IC2A 2WK2A 3Q2LA 4TPRH 4NIYE 4XCYB 1DJXA 2HTLC 2E56A 3MACL 4S1DC 4JS7A 1DUZB 2C9AA 1E5BA 5DYOB 2HRHA 3VH8B 4W9DC 3II3A 1ZGLA 3PGFH 1VLXA 2EXSA 4JG0H 5EU7E 5AAMA 3RGHA 3L48A 4HAFA 1EFXA 3T65A 4GINA 1IQDA 3QJVB 1UYWL 4N1EA 5E1IA 2C1OA 4PVMA 1EBAA 3KPSB 5DVKA 4URKA 2XPGA 4OLYH 1HCYA 3UERA 1BFOB 3INOA 4IRZH 4LHUB 3ARUA 3BD5A 1EV2E 3L3JA 4X9GA 3W37A 1G7IB 1F5WA 2ICWI 2VLLB 1P4LA 1MKFA 4E5XG 2OXGA 4KOBA 4BH8B 1J1XH 4L4TD 5HHXL 4A2DA 3RUGF 5A40E 4JCLA 4IMLA 5MEOB 4UUJB 3GXNA 5E8PB 2Y5QA 1N64L 4WEMB 2F8XC 1YUHA 5T1LA 2QVKA 3ZQXA 4WK4B 4B9JA 1W9XA 1WHOA 3C60A 3HG1D 1F18A 3GT6A 3L45A 3QA3B 1EXGA 2DL2A 3F7QA 2YEVB 4RFEA 1DSFH 5HYSB 2GB2A 5H2BA 4WHTB 3D5OF 5T3XH 3BWZA 1D5BB 3BP6A 1X4ZA 4GUPA 3O3DB 2NY3B 1I4FB 4K7PX 4UM9B 4G7SB 2EDFA 4IKJA 3HRPA 1I7ZB 1JXGA 4F37F 2DQHL 1RZ7L 2AJ3A 1EEYA 4QTHB 5BRPA 4J3SA 4OCSL 3QORB 3MV8A 4MS8C 1TQUA 4DKFL 4KKLC 1CL7I 2OULB 2RMNA 4Y4KD 5FKAB 3KLAB 4LNVA 5KYXB 5FYLE 3DXAE 2F5AH 4KUZH 4C56E 3QDMB 2ORBH 1S7TA 4JFFA 4ZPVB 3V8CA 5AVVB 3TYGL 4HWBL 1H19A 3QCUH 2L4OA 5LDUA 4XAWL 2ARJB 2VITB 3EZJB 1TYEB 1DANU 3BGMB 1RXLA 2TRHA 3OX8A 3WO4C 3MV7A 1I1YB 3FRUB 3QE5A 4JK0D 5E51A 1JFQL 2WZAA 1U41A 3KWVA 1WFMA 1D7CA 2OLDA 2H6PB 3NRQA 5EEWA 2X12A 5ICYA 1IVTA 3NCBB 4OCWL 4HSCX 3BZFB 5FA3B 1FI8C 4M8UA 3VD5A 2ISDA 4AZ8B 4HPOL 2ADIB 5IEKA 2EDJA 3UH8A 1JZJA 1YDPA 4GRWH 3B56A 5A3ID 5T1LB 2CLVB 2EO7A 5FW8A 1HE7A 4N0UA 5D1XE 2VDOB 5L8JB 4NHUA 1D7DA 4L9LC 2XZAH 4RESB 1OP5H 4GFTB 2LLLA 1IKFH 4OD2A 5F88A 1N0LA 4I3SH 5HGAB 4PRPB 2CR3A 3C6LB 3CXHJ 3KYMA 2KZKA 1D5BA 3BP6B 4LVNC 4WI6A 3SY6A 3ZL4H 4PJ9D 4M62L 4GG8B 1DBKL 4XPHH 1T66D 5ICXB 4Z77A 1FZMB 4HS8L 1CXIA 1J5OL 3BN9C 1RZGA 2A77L 2P8MA 3I6KA 1KN2H 2B4CH 4OQ1A 3ZUNC 1YYLL 3QR2A 2XIDA 5CGBA 1CCZA 5HYJD 2C9VA 4L29B 5KYXA 4GLRI 1E5YA 3FT3B 2GK0A 3KGUA 2K4WA 4IOSA 3PWLB 3H53A 5DTFB 4Z7UE 1LO5A 4MNHA 1AKJB 4HJTA 4NQDE 4PLOB 3T0EE 1AH1A 4ENEC 4BZYA 3OZKA 4F8NA 5H4YA 1TQVA 1DE4A 3GSUB 1T7WA 3QZOA 2HKHL 3V4VH 3WYRA 1JK8A 3DK2A 3JWDC 5EN2B 3GPEA 3VFGL 1B9ZA 2G4EA 1JGVL 4B50A 4EZLA 3BAEH 1DUYB 1UB5A 2XTJD 3WFHB 1A64A 3Q2NA 1UM6H 3MRBA 4WCYL 2Y07H 4PJFE 3SOBH 1CTMA 4HJEA 4FFTA 1V55B 4BWUA 2NY4B 4FDWA 3UJJL 5JMRA 1LWJA 1VCBC 2OMXB 4Z3FA 5DFTA 1EXUB 2P5EB 1TZOA 4QRPA 4JRYB 1KLGB 2IH1B 3LKNA 4JX0A 2NUPA 4A67A 2W9DH 2ZOKA 2R51A 4M8RA 4X6CB 1N3NB 2ID5A 4X9BA 4R4BA 2FX9H 2WANA 2LABA 4NBZB 5D7JC 1U93A 5AOMA 4WI4A 4H88L 2K6ZA 3OHXC 1IBDA 5DJAB 5HXMA 3HMXH 3X3FH 3B8YA 3AT8A 2VR9A 3KL0A 4MWFA 1TJMA 4OR1A 4PJIB 1Q9OB 4Q0XL 4QWWD 5CJQH 2FH8A 6PAZA 1TIUA 2J25A 1DVFD 5INCB 1PS3A 2XQBH 3MLRL 5LNDA 4FFZL 5GHWL 2VDPB 4GRWE 2XX0A 4AI7A 4B53A 4U49A 4JL1A 5I8OH 1FN4A 3TVMA 4IEFA 4FHBD 3F7PC 4D94A 2F54E 4UTCA 4Y7MA 4ENED 4HC1A 3LVTA 2EUZA 2RALA 2QGBA 4HCGA 5IWLC 2ALAA 4G42A 3NOIA 4JHAH 4CC4C 2KH2B 5DMIL 3QUMB 4JG0L 4ZD3H 3FYEB 1SLVA 4X5WA 4FABH 3WL9B 4NIKB 1DUZA 1W72A 4XMXA 2A74C 2IWGA 1KXVC 3APFA 3QO0A 2DKMA 3KDMB 4JO1H 5KBMA 3LQAL 4NWUL 4X7FC 3TBVB 3V10A 1D7BA 2W0LA 2JJVA 2O61A 3DI3B 1J1OH 1MRCH 3PWUA 1D5MA 4KY2A 4YSDA 4WWID 1KTLA 4EN3D 3CDYA 5T1MB 43CAB 4YEFA 1Q1JL 4P23C 4PW9A 4OGXL 4ZAKC 2XT1B 1A6VL 4ZZFA 1JWSB 1RKRA 1CDYA 3L9RB 4R4BB 1J7VR 4LF3A 3RBGA 1BD2A 2VZOA 3VA2C 2VXVH 2FHBA 5HD8D 3BFQG 3NGBB 4ZK8A 3QG6B 1PLBA 1KTCA 3CSYA 3KCWA 4Q9RL 1M2VA 1CBJA 4BFIA 1D5XB 3VXUB 3Q13A 2PTUA 2AVGA 4LP5A 2ZG2A 4NPYA 2GTZA 1PLGH 1KJVB 3VD2A 1BXXA 4HFWB 4L3EE 5EUOE 2UXVA 4ZUTB 3BPNB 3P4NA 2QR0B 4XPGL 1A7QH 2X3AA 1T83A 3SDAA 1CFQB 4UT9A 1FZOB 4P5RA 3W9DB 2RAMA 4AX3A 2AJ3B 2AXJA 2BW5A 4KKAD 2K7PA 4A2FA 4AMWA 1KB5H 3B9KD 9PCYA 3WE6A 2IGFL 3MNDA 4JFFB 2PABA 3T08A 3DYOA 4P59L 5T3ZE 2I60L 5K1NA 4GUPB 4I3GA 4Y4KB 5DZ9A 4E9TA 3BPLC 4U6YB 1Z9PA 2YA1A 3FQTB 2XI9A 3OC5A 3ZE2E 4DGIH 3L08A 3LNDA 2V4LA 3W3BA 3AU1A 4YSAA 4LCWD 2NY3D 1BQHA 1UA6H 3OX8B 3U9PH 1CJYA 3STZA 4AQZA 5HI3D 2JKRM 3IRZA 3TBBA 2GABA 5ICYB 1G4RA 1SEQH 4ZUWB 3QZPA 4FMFA 2VH5H 4FQ2L 5ESQB 1IC4H 3TWCL 1A7PL 5DR5L 2A6KA 2OP4L 1EHAA 3BESR 2MHAB 2GIMA 1ZHLA 4WJKB 2HKFL 2YD5A 3KLDA 3P3SA 1OTTC 1MCOH 1TTCA 4JDVA 2PETA 3TIDB 4WGVB 3SGEI 1KENL 4PRPA 3RGVC 2K7QA 1QHQA 1MSPA 4PWFA 2R2HA 3B7RL 2OCJA 4PWJA 2BSEA 3CG8A 5E03A 3ILDA 3K1DA 4CU7A 3BZ4B 1VCAA 3F6IA 3CFCH 1DQKA 1Z3GH 3VI3A 2P42B 1TPXC 3FCGA 3QJHA 3RKDC 3K4DA 5KVFL 1WUNT 1YQVL 2VAAB 4WNQB 3V0VB 4AENB 1EX0A 1VKXA 5CUSL 4QHUB 3VYPA 4FXTA 4R4NC 2V2XB 1TLKA 3OKOB 4NQSA 5JW5A 5L0QC 2BO0A 3QIUB 2G5BB 2JJUA 2A9ML 1X6LA 5BVJA 3SQBB 5DD3L 3S98A 2ZJSH 5J6SA 4DKTA 3I9PA 5E5MB 1NL0L 2F1EA 1UM4H 5CXPA 3VRLF 1KBGL 3JZ7A 5SX4I 3SODB 4K5PA 4HJSA 4YIQA 4PLJD 2WBJB 3KGSA 3H3KA 2ADJA 2H6OA 3L7EB 1YLBB 3RWHA 1YA5A 2AS5M 1M7XA 3HC2A 1A22B 4D0DB 1A2YB 2ZP9A 3EOAB 1AKJA 3B6SB 3N50A 3VQLA 3ULVD 4IBWA 3GNML 3P9WB 3NIFF 3GI9H 2YQBA 3BUBA 4XVTL 3RDTD 4XC3H 2YD3A 2B5IB 1Z9SB 2P24B 3ZDWA 4ENZA 1G1YA 3V9EA 5KVGL 4QXGL 1AIZA 1MFMA 2BRQA 3W39A 4MTMA 3WFEL 4IBVA 5AWNL 1E8WA 1EZVY 3ULVE 2ZXAA 3BGAA 4P2QB 2R2HB 4Z7QE 1MIMH 2VMFA 4D0CA 3KLSA 4KTDL 1U93B 4M43L 1GL4B 2PO6B 3JWDL 4YBLB 4U1IA 8FABA 1G9EA 5GRUH 2I7OA 4NWTL 4WQOA 3LEYL 5GGTH 1DO6A 3ZYJA 1N6QL 1A1NA 1RUQL 1F4YL 2VAAA 4WNQA 3C08H 3L1FA 1WG3A 1YRKA 3BEVA 3R06B 3MLXL 2DLGA 4R4ND 3TJEH 4CADA 1HI6A 1B0GB 1P7QA 3CBRA 2F74B 2NYYC 3FN9A 5HP5A 1CXFA 4U1KB 2XZCL 5TDNB 4Z7QF 3O4LB 3TGXA 5J12C 1MJJA 4H5SB 3D4YA 1VEOA 2K4AA 5B1BB 5BVJB 4YHZH 4NRYA 3DV6B 4PJ7B 5CEYB 3L2NA 4JRXE 1YCSA 4AUYA 3ZL1A 1FFOB 2OS7A 2IO5A 5I8CA 4GBXC 4ODTH 4DW2H 4DGYL 4AOFA 4KNTA 2H26A 4WU5B 3DBXA 1HCZA 5KS9B 3BAWA 5E8OA 1VGKB 3RDJA 1SPDA 3HRZC 3QPXL 5CHNB 4J2QA 3CK0H 2R27A 3QO0B 5DUBA 2N0MA 4HAGA 1W72B 3G6JF 3N91A 4XNBA 1QRND 1YUKB 1AXSB 3EJTA 5MERA 4OCWH 1JGIA 3V4UH 4YPJA 1ZTXL 5JORA 1ZLUK 3FB6B 5FCUH 4LLDA 5FB8A 2X44D 1KCRL 4XBGB 3TBVA 1BAFL 1JGLL 4KDVA 4AJYV 2I07B 1OZTG 1CLZL 2F18A 2YO3A 3QAZC 3EYUH 4EIZC 1OE1A 2WQSA 3BI9X 4Y1AB 2XICA 1LL1A 3DGGB 4GXUM 3RNKB 3PJSA 3L9RA 3IN2A 4R7LA 5EUOA 3TU6A 1TQSA 3BPNC 4RMTA 3HE6B 1AHMA 4IGBC 1MI5B 2KZBA 4RRPA 4X7SL 1U2CA 2YIHA 3JV5A 5A6LA 1C5CH 1Q0YH 4YBLC 5JZ7C 1F4HA 2EO1A 5I5MA 4XH2A 4LRIC 4J4PC 1ETZB 1MFDL 2JXMB 2ZUUA 3ARBA 4IU2B 1MUJA 5GJTL 3RJDA 1IE4A 1K4CB 1LDSA 5KW9L 4J39A 5CF3A 1QPKA 3HMXL 4UM8A 4H20L 2WLMA 4BRJA 1M6UA 3MXVH 4H5SA 2G9KA 5T3XL 4KK8C 1VFBB 3KWUA 3HHSB 4GPVA 4UT9H 4ZUUB 4L1SA 5AALA 1AGFB 3MLVH 2B0SH 5D6DA 1ZY9A 4K94L 1ZCRA 5CN1A 3AU0A 5I8EB 5M95B 2ALWA 3OKKA 1QFWH 1RK0B 4QGTA 1SMAA 1NFAA 3O6LL 3U36A 1U58A 1HSBA 2O6EA 3TV8A 3QZLA 1CDGA 4Z3HA 3LIZH 3SDAB 3SYPA 1CIUA 4KNSA 4R96A 2WGXA 2XWEA 2C9UA 4P5MB 4QO1A 4ZD3L 2HWZH 4K71B 2CGRL 4CN1A 5D2NE 3BLKA 2DJ4A 1JPSH 3GJFA 1EJOL 4YE4H 3CMGA 3HPJB 4R90L 4TXVB 4Z76A 2W88A 1ES0A 1USZA 2DAVA 4GRMA 4O02H 4IMKC 4UM9A 1JI1A 4I18B 8CGTA 2LU3A 4PV9A 2CDGB 5EOTB 1FSKB 3OHXA 1T1XA 5D1XB 3FMGH 4NZRH 3BJLA 4KBPA 4FI8A 3PHOB 4WO4B 3ZE0E 4ANWA 3LRMA 2DICA 1IGMH 2Q2LA 1KB9J 1XD0A 3QAQA 5DQ9A 4QEGA 1CU4L 4QHMB 5C0RL 3N85L 2VM3A 3ARBB 4MDJA 4TQPA 1UA6L 3U9PL 5EO0B 1M56B 4QRSA 2OBGA 4KUCF 3W57A 4HIHA 4XNZC 3P77B 1SUHA 3HR5A 3GB7A 1FFQA 3LPWA 2Y36L 4JM2A 4K0OA 3PJNA 1HQRA 1R4XA 4WENB 1I9EA 3RYMA 3NIGE 4JDVB 1OTTD 2VLRD 3L3OB 2CH8A 3EFOA 3O9WB 4LASL 2Z4TA 4IKIA 1U8KB 2XACC 4OZFH 5FIEA 3HBPA 3V0VA 4AENA 4EO5A 2FT8A 3TNNA 2BIOA 5JNYB 1R24A 1VA9A 2AMUA 2BP0A 3GNMH 3O6FC 2WQAA 1L9OA 1FZJB 1RZGB 4G71B 1IC1A 3ZRFC 4KPHH 4P46A 3K4AA 5I6PA 2D31A 4NFCA 1C1EL 3GHPA 3QJFA 1KTDA 1I1YA 4JAMA 1B6DA 3ABZA 1U8HA 3C6LA 2F1AA 2K3TA 2VN6A 3K2KA 3ULSA 1DVZA 4CBZA 2M1KA 4P23A 2G2RB 1FO0L 1IIKA 3MLWL 4JFYB 3OSKA 1I9IL 4MRBA 3WJMB 3VM7A 4AEFA 5BNXD 3ETTA 1UXLA 3L7EA 5BZWA 3E3QE 2W92A 3VGAC 4DP9X 1JK8B 4YZWA 3FSZA 3JTTA 2WO4A 2FGWL 2XVLA 2QFPA 4N1CA 4AQ1A 3MBWA 4WUUA 5I75C 4QNPF 4PLJC 3UTTB 5F70A 1KDIA 1S9XA 1WFIA 1Z5LA 7TAAA 1NMAH 4G3YL 5B7EA 2FDBP 4DP1X 2X4UA 3FULA 4OIIL 3D7PA 1KBGH 1AGCB 1K6QL 5E9DA 1CICC 2OCCB 2DWEB 5DEZA 3ULVC 1KIPA 3FO2A 3MRQA 1KOAA 2H6UA 1SN5A 4HWNA 3JVFC 3A5VA 4J6RL 4L4VB 4M7JH 2X5PA 4DIXA 1MWAA 4RBPH 3O3EA 1DSFL 2P7TA 3QXDA 4WKZB 1COBA 5E9DE 3LZQA 2ZYSA 4K15A 4GRWB 2VLJD 1YMME 5B1JC 1HZLA 5AD0B 3B37A 3ILEA 3T0EC 3ZDZB 3U79A 1SJEB 1G9NL 2WXFA 4PJCF 3GSXB 2EC9T 5GRVK 4ALAC 3ARGB 3D9AL 1MY5A 2OXHB 4Z7VE 4R26L 5DZLA 1MJUH 4NAQA 2OW7A 3EYQD 2O5YH 3L95B 4TOYL 2H0JA 3B7UX 2AXHA 5AYQA 1HYSC 1JD7A 4G5ZH 5CFAA 1QNZH 1O9VA 4E9SA 4PJIA 4EDXA 3VDBA 5DLML 2X7LA 4LZKA 1Y0LB 1NGZB 4GEIA 4W9IC 2A9CA 2OQJB 4I88A 4PRDA 1FGNL 4YQXH 5I19H 5DHVB 3JTTB 3QNYA 3VD0A 4AMKL 2D3JA 2V17H 2ZNWA 5I66A 4XB7A 5LN4A 2IDFA 4A7GF 3PHQB 4MNQD 5DHYA 4IRJB 1JHKL 3GIVA 4KVCL 4E41D 1MCHA 3MRDA 4C83A 4J3UA 5IKCB 3OR7A 3PLYA 4P07A 4MMZB 1K3ZA 4DQOH 5D70L 1BEXA 1GGIH 4ZQTA 3QYMA 1A8ZA 4Y9BA 3GBNL 4PP1C 2YPLD 3ZKXB 4JY6A 5DJCA 2G4GA 1ADWA 5ECJE 4AIEA 3KDMA 3TURA 2Z3FA 1BXVA 3T8MA 1U21A 3MV7B 1ZDSA 3APMA 3EOBA 4L8SA 3FRPG 4PHXA 5C2BH 5JYLA 4FXGB 4UOJA 4FQXD 3O0LA 2XZQH 1RK1A 1OALA 5JZ7D 3PWNA 1IJNA 3VAEA 4XPGH 5D71H 3MLXH 4NKOB 2ZX8A 4P2RD 3R4DA 4K71C 1UKSA 4L0YA 4W9CC 2SODB 3D34A 3DOHA 3I9GL 5TDOB 4ZX3A 1RJLA 2YEZB 5KYWB 5FAAA 1BX2B 2CD0A 3UO8B 4HJJL 3B3IA 2CJUL 3DVGB 3GZKA 4WJ5A 4XCCH 1BMGA 1SJVA 3N41B 4Y4HD 2QQKL 3OD3A 4BH7B 2P80D 1MCFA 4R96B 4X80L 2H2SD 3SKMA 5JXAL 1E5UI 3LX9A 4EQ3A 4UIMB 5K9JL 1RIHH 3CVBA 2YPVH 3REVB 1C08A 1OCOB 3X1BA 1WA2X 3WNIA 3FK3A 3OL2A 2QSCL 3PHQA 4IRSB 2FBJL 3BZDA 4FQIH 4WTQA 3DUHA 2R0ZH 4HYTB 4UIKL 4M6NH 3ZTJH 4AVIA 4Z76B 5D2NC 3VQ2C 1OSEA 1OAKH 3W9DA 4L3EA 4N68A 4MA3A 1KCRH 3VSQA 3WNLA 2R29H 4L8CA 2CBMA 5I0YA 4BCXA 4W6WB 1BAGA 4P5KB 3TV3L 1T20B 1YEEL 1RUKL 4YLBA 3MAWA 3F7YA 2ZX5A 4ZMYA 3WXVL 3R0NA 2FLMA 3UAAA 4ZAKD 2IAMA 4ZRGA 6FABH 2DI7A 1NLBL 3WIHL 3FFCE 3MN8A 5C3TA 3ARGD 3MBEC 4JUTA 2V8MA 4OGAD 4MCZB 2XPGB 2V7NB 2DKUA 2OL3A 3GEWB 2XBZA 1IUZA 3WIIL 2GJRA 4YFEA 1EEZA 3H4FA 4ZQKB 4CMHB 3B1UA 4PYHA 2YR3A 3BXNA 3F6JA 3S37X 3G3LA 4PWHA 1WISA 1HYRC 3CN2A 4M48H 4KK6D 3VNZA 3DA0A 3GTTA 3HC0A 1PX4A 3GRGA 4AQ1C 1E6OH 4X80H 1JGDA 2WJ5A 1LGVA 3TOPA 2CK0L 2VISB 1OK8A 3LD8C 3IGAB 1A9EB 1SXAA 2YKLL 3NZ8A 4JO4L 4LFHD 3K5SA 2DLHA 3L5JA 3NPZB 4EXPX 3H8NA 2F54A 5AVTB 3RI5K 2X70A 1CGWA 3OAYH 1WC7A 1ZVNA 5CEZL 3L7FA 5A16B 3S4SA 3FO1B 5AZEH 1A7PH 4G9FE 1OD9A 2GFBA 3GRBA 5ID1B 4M7LH 5D55A 3KYNA 1FNGA 3RU8H 1T80A 3NG5A 4O2FB 2IBZX 2I9LA 1MJ7L 3CLEL 1HIML 4GRLD 2AC0A 3BW9A 4U0QB 3TESA 5EEYA 4WCYH 4GW1A 4OGXH 2YWYA 3KHQA 4BQCA 1J0YA 2YD9A 5DK2B 3D3VD 1S78C 1A2YA 1IKOP 4FS0A 3MBED 5IQOA 2WXMA 4MQTB 4PRHE 5F7NC 2ZCKH 3T71A 3QJUB 2ADFH 4NN5B 3QUXB 2R2EA 2JK5A 1QFUH 2BSBA 2R4SL 1AQMA 1XV8A 1OXYA 2FD6H 3VW3L 4P2QA 1IKFL 5KG9B 2EECA 5B39G 3PL6B 1VKXB 3MCKA 1MAJA 5IESH 4XVSH 2AEOA 4K9EL 1IQWL 4F2FA 4K5MA 2DTML 5ICUA 3OAUH 3T6XA 5C0GA 4F7CB 1R3LA 2GBTA 2BY1A 3QIWA 1KIRA 2Z6FA 1UJ3B 3HJEA 4C4KO 3IVKB 1SJEA 2ZWSA 4MB3A 2AMGA 3NA9H 1FE8H 3QEGH 3QDJE 1QI4A 1BAWA 3AVEA 1A6WL 3OMAB 1BWMA 2EDQA 1SN0A 1NKGA 2MQGA 2ZTBA 3PREA 4A38A 4OCYL 2QHRH 1XH2A 3BIKB 1SVZA 2PCFA 4WRLA 1NPUA 3QDJD 2PW1A 4Q9CA 1DBJH 2IQAA 4HIQA 4GSQA 4W4OA 1AC0A 1FAKT 4YFLI 5I0DA 2YMXL 2IBGA 2MEJB 3MJ8B 4A6YA 5DFVC 2FHFA 3HG2A 1BZ7A 2VGLM 4JPKL 1G9NH 1CBVH 5DS8B 3QARA 3HE7D 5LGHH 2FB4H 4DFHA 4OZHE 4NXKA 4F1SA 2BZCA 2B39A 2XHNA 3O4LA 3RTQC 4KTGA 3CFEB 4JE4B 1U4FA 1ZGLP 5C09D 5I1CL 2F7PA 1FGVL 2BRRH 2WXRA 2FYYA 4ODXB 3IMUA 1SBSL 3DJSA 2BDNH 5DD0L 3NFSH 1CFNB 3OR7B 3WD5L 5HGGS 4G8GA 2R39A 4JY6B 1GHFH 4WW1B 2Y6SD 1DJSA 4YEEA 1F41A 3VUAA 4W93A 2OM5A 4IRJA 1GJWA 2ZD0A 1M71A 4PRID 4TSAH 1J8RA 2VR5A 3QIWB 2VDPL 5FF6B 2OMWB 4N2EA 2ATKA 2RFXB 5D7IE 3STZB 4KFZC 5D9SA 1RURH 4J3OG 1DFBL 3QDJA 5C0NC 2XQBL 4BFIB 1IGCH 3O6KL 1MOEA 2GSGB 1FYTE 1PNCA 3K2IA 2YQGA 1YEDA 1OARH 2DWDA 1NA8A 1MHEA 4JDZA 5B8CC 3I3BA 4MCYA 4U1NA 2VDMH 5CJBA 1WS8A 4EIGB 2WAQA 3G6JE 3MUHL 4OB5H 1RIVL 2FSDA 3VGFA 3QPQC 5C07A 3WN6A 1LNUA 3K2MC 3QEQD 3D30A 1U8LB 3OAUL 4YGVA 3EH3B 1JUFB 3F8UB 2G0KA 4A2LA 1DQTA 1LLAA 3P9MA 4NQED 3UAEA 5K9QG 5KSAA 1I1FA 3VXMB 2AV1A 5KS9E 3QORA 2NX5D 2ZKHL 3OV6A 4IS6B 4AJVA 5IREA 4JHWL 5BCAA 3DDFA 3BVVA 3FO9A 4L4TA 2A73A 3D0LA 3HPJA 3E2HB 1G0YR 3AJ7A 4UF7C 3GI8H 5KSVA 2IIJA 3CVDA 5HHOB 3TF7C 1UH3A 3WN5C 4Y2OB 1HE8A 2H0FA 1JNNL 3P3TA 3H0TA 4M4RA 4GT7A 2JB6A 4DPRA 4N22A 1JSYA 1BIHA 1OO2A 4EN3C 1G5GA 1YN6B 2MPAL 1ZHLB 3Q1SL 3D39B 2W8CA 4TUKL 4CSTA 5ID0A 4H44C 5I1AA 3CHXA 1DVQA 4ZUUA 3ZMNA 4N2GA 1CZ8H 4P9HH 5CR1A 4O02L 2B4CL 2IPKA 2OZ4A 1AR1D 2W95A 4A7GA 1LEIA 2OMVA 2YBGA 4MCZA 5DRZA 4AM0Q 3WMSA 1AZNA 1Q9KA 5D72L 2ICWB 3MR9B 2XVBA 4G72B 3P4MA 5EIIA 2HMID 4ZUVA 1MW1A 35C8L 1RP9A 5KTEL 3PQYB 2ED6A 3UBXI 1XVSA 4TKWA 5GS0L 5J7CC 2EDKA 4S1QL 3B4NA 2CIIB 1T0PB 2FWOB 2YARA 2Q86A 5D96B 5GSRA 1BQLL 1JD9A 1FZJA 3KWWA 1HHKA 3FPXA 3RDTB 3SYCA 3HR5B 3FOLA 1C7TA 1KBWA 1ES0B 2NY0D 3K3QA 2B14A 4HIEA 2G75A 2BNRA 5F9JA 3QJFB 1YY9D 4Z7NE 1ZTXH 1BBDH 5ERWA 1IFHL 4PBDA 3L4WA 1FPTH 3C8DA 1ONQB 3O4OC 2IMNA 3OXSB 5DRWA 2HH0L 1I3GH 1INDL 2ZX6A 2BNRE 1ZTMA 1S7XA 3Q5TA 3KD4A 2X70B 4N2OA 4P2OB 4GFXA 1FNEA 2WC7A 1YAIA 1MDAA 3FB7A 4WI7A 4KY1H 1UYWH 1C5CL 2DQEH 2EEAA 3GO1L 4NM8L 3QVAA 1W6WA 3BYYA 4X6DA 2VLJE 4X7SH 2D7TH 5EN2A 3MRJA 3CZSA 4Z7VF 2IH9A 1IJ9A 1HXYB 3B9DA 3OKYA 3U7YH 3VFRA 1LO5B 4Y5VB 5TQ2L 1ZSHA 2OMVB 5CBAA 1UACL 2QHLA 2WLIA 3O6MH 2WXKA 4NNXB 2IH1A 4F20A 3TVMC 1RUQH 1XGTB 4K8RH 2VWEE 1GC1C 3BCFA 4J3VA 5AOJA 4WHDA 3MRBB 2MCAA 4J1UB 1JG9A 3TJPA 4P9HC 2VMEA 4BV1A 2PR4L 1JXJA 1VACA 3RI5F 2DMBA 2R2BB 4PVLA 2CIIA 3EG9B 2JKLA 3ZZSA 2D0FA 5C0GB 2ENPA 3U0PB 3DJTA 3ZDYE 1EJ6A 4UQEA 5CEZD 4JQIH 1TDQA 4XVSL 1UD6A 2VCOA 1WAPA 2G75B 2WTPA 4ZFFA 1OSZB 2AXWA 4ODTL 4PJFF 4DW2L 3X17A 3FUKA 5BW7A 4OF7A 1R5VB 5CZRA 3AWGA 3CFQA 4AGOA 4IU2A 5L2KE 3EGXB 5BRZD 5F3BB 4NPJA 2OZ4L 3MRHB 3P69A 2LGNA 5E08L 2RB8A 4GJTB 2CK2A 3JV4A 2C9SA 2YRPA 4PREB 3RFZA 4G8GE 4OLEA 4P3CL 4MXVF 3RWIB 4N24A 1UATA 1U0QA 1U8CB 2YPLE 2EH7H 4E9YA 2V9UA 4LLQA 3BOVA 5IQ7L 1VFBA 1WZAA 4B9GA 5DJ8A 1NCBH 2IGTA 4B9ZA 4FXKC 4YDKH 5LG1A 4NKDB 5LWYH 3ETBJ 4ZFOA 1F56A 2ZXDA 3IDJB 3VTTA 3RWGA 4L9LB 4PJHB 4YK4C 1MWAB 2KT6A 4WTWA 4JRFA 4WUUE 4D0DA 2FH6A 1HCVA 2EO9A 3TA3A 1GKEA 4ZTOH 1NGZA 1VAHA 4PWIA 3H9SB 3UPCA 3EJQA 4QLRA 2JJWA 1BOGA 4L4TE 5DQJB 3WHE0 3V9CA 1NAML 2WNKA 1KYFA 3GINA 1MI5A 5EF1A 3NCJL 5FPIA 5I8KL 5M7QA 4CNIA 1MDTA 5E8DH 3H3BC 4ZUSB 3V0FA 3V6BR 4W9JC 2YRLA 3P0YL 5DO8A 4TOYH 3CC5B 2FL5B 3WUZA 1RU9L 1IBGL 5FYLH 1IC5H 4OZGE 5ETUA 1C12B 1QATA 1FIGL 2F58L 4HUWA 1RCYA 5MI0B 2J8UE 1PIGA 2CA4A 5A2BA 5JIIA 4OF0A 1GS7A 5C0ND 4MSWB 4D2NA 2F74A 1AG0A 3SEPA 3AG3B 1NGQH 3RVXC 1P7BA 4HGWA 1YEDB 3D87B 2LFGA 3TH2T 3MLUH 2AV1B 1NC2B 4LESA 4H8QA 2R83A 1RJZA 4PTUA 3ZE1F 1E9PB 4JJ5B 1VF5C 4BH8A 2D7PA 1DQDL 3GMPA 4DGUA 3TNNB 1VJSA 2YRBA 2J57A 1MREL 3EOTL 4OUOA 3FO9B 3ZE1B 2VZ1A 3ISRA 4Y4FC 2EKSA 3IXTB 4N4YB 2TRYA 2MNJB 3IPFA 4MYWB 2E8YA 2X41A 4W1TA 4APXB 2GQHA 3QA3A 4RDQG 4R8WL 3PGCB 3QIWC 4RGMC 4DP2X 1CN4A 4ZTOL 15C8L 4ZNEE 2FX7H 4K9EH 4XMUA 4YSPA 1XFPA 4ONHA 4ORGA 3WEMA 1LMKA 2YPVL 1X5HA 5MEND 3FQ1A 3PGDA 4UQDA 2G2RA 5E1QA 1G7QB 2JVUA 4LARL 2QADB 4M03A 4JPSA 3RB7A 1F3RB 1PYWA 2ARJQ 2H0EA 3QG7H 2UY7A 3FOMB 3HLAB 1B90A 1KYOJ 3Q9QA 5I73B 5IHWA 3II2A 1BFVL 4OZHA 1AZVA 2EH7L 2ZG3A 3VGBA 4U6HB 4QRSB 3D0VB 5DCCA 2W0PA 3L16A 3QDGD 2RTTA 3T5WA 2B1HH 1TVHA 4B9FA 4ZFOL 4JMXA 1NMCC 2ODIA 5EIVA 1WZKA 2EEDA 3T6ZA 3S96B 4QHNA 2AJVL 5HPOA 3EFOB 1AGBB 2OTWA 4WWNA 4IDJL 2VQ1B 3RDTA 4YWGH 3VI3B 3H7BA 3SE3A 2Y7MA 4AEHL 2Q86B 3NZUA 2NR6D 5T1JA 1XCTA 4HLJA 4LL9A 4ONGL 5D4HA 1F4XH 5GJSL 2FJHB 2R56H 3VFVA 4M5YH 3WUWB 5GS0D 2WNGA 3FCSA 4ODVL 3GKWH 3PFQA 4XNUL 4HU8A 5KYUB 2XY1A 3VXRD 2BS9A 4JW3A 2HB0A 4X0KB 4JFHD 2Q7YA 2IFGA 1IAIH 1EA9C 1NANI 1FL6B 1Z9LA 1IGML 4G7RB 3QIWD 2Y6TE 2F08A 4LLYB 1YPZE 1QSVA 4HBCL 2LTQC 5HPMB 1QBLH 1UHVA 3L5WA 4OFYD 4RGMB 5FYJD 3BSGA 3N1MC 3VWJB 4BQ8A 4PJ5A 4YSTA 3UADA 5LJYH 1EK3A 4LCWB 3FAWA 4Y7OC 1AIFA 1VB9A 1TZAA 5JA9A 1U6AL 1NBCA 2MOQA 2P3YA 5FM5O 3OTTA 2KERA 4JKKA 4W81A 3KG5A 4PG9B 4Q0XH 2Q6WB 3VI4F 1YPZA 3CFBA 1M9SA 1F8TH 2C1PB 2QV4A 3QUYA 1O5DT 3D9AH 4F5CE 4F93B