3FSVA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaahaaam)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
118
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQYMFFCAAAHAAAMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 16
structure length 118
sequence length 124
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsvA00
1AZNA 2QDWA 4HHWA 4KNUA 2R7EA 3S8FB 3SBRA 1ID2A 2VSKB 5B1JC 2FQEA 3V9CA 4AKQA 2IWKA 1J9RA 3CVCA 2BO0A 3NJMA 4DPCX 2BWIA 2N0MA 4YVNA 3QJSB 2BWDA 3EH4B 3AG1B 2QT6A 2PCFA 1L9TA 4BDVB 1ZPUA 1NDTA 3FQ1A 1SNRA 1OV8A 2XXGA 1M57B 2YXWA 1PCSA 3CVDA 2PPDA 2QPDB 3ABLB 1AAJA 4DP0X 1NWOA 1A3ZA 3UACA 2VW4A 3NYKA 5E9NA 2PPFA 1ZV2A 3TBCA 2EINB 1KYAA 2XVBA 3OQRA 1KV7A 2HX7A 1JZHA 1AR1B 3G5WA 1AZCA 4M4RB 4YSQA 3T6ZA 2CAKA 3FS9A 2P80D 1ZDQA 1NIEA 1M56B 5TK4A 3ZDWA 2FQDA 4BK5C 1PAZA 3CDZA 3EH5B 4N8UA 4DPAX 2OJ1A 2JFCA 3T9WA 3OD3A 2AZAA 4UAHA 4HIPA 3MX0B 3ZBMA 4FA7B 3H4FA 3IBOA 4PCYA 4X4KA 3WIAA 2VW6A 2XV2A 4DP5X 3ASOB 2TSAA 2IDTA 1BAWA 2AVFA 3OMAB 2XX0A 3WG7B 5B1AB 3HEIB 2OCCB 1OE3A 2BP0A 3JTBA 1AQ8A 2J5WA 1NPNA 1AS6A 2MRYA 2YAEA 1JOIA 5F7AA 2FNWA 2VMJA 3IN2A 4ENZA 4YSUA 2I7OA 3SQRA 1GY2A 1AIZA 4E9SA 1ET7A 3NJLA 1BQRA 1NICA 1A65A 1J9QA 1OCZB 2IDUA 1QLEB 1X9RA 5I6PA 2XYBA 3FSAA 2AANA 4HCIA 2H47C 4YSPA 3QJQB 1XB3A 1CYWA 2DWTA 1OE2A 2PPCA 5AFAA 1CURA 4YSCA 1E30A 2J55A 2B3IA 3AG3B 5D4JA 4CSZA 5ANHA 4HAKA 5I6LA 2TSBA 3NT0A 4JHUA 5AZUA 4YSAA 1M9WA 3IEAA 4GY4A 1KCWA 3BVDB 2XLLA 1BXAA 2PP7A 5FC9A 4DP4X 2VSMB 3FYIB 1TEFA 3ABMB 2AFNA 2HX8A 3FYEB 3HB3B 1MG3C 3FU9A 2DV6A 3FU7A 3D12B 2Y1AA 1E5YA 3T6WA 4AZUA 1L9PA 4YL4A 1SFHA 3S3DB 4GP8B 2BW4A 1V55B 4A68A 3IE9A 3X1GA 3X1NA 1JERA 4BWTA 4E9TA 1RZQA 1E67A 4YSTA 2GHZA 2IH9A 4WTQA 3QPKA 3FT0A 3WNJA 3NJFA 1NZRA 1HFUA 4E9WA 1V10A 2PPEA 1IUZA 1I53A 2I85A 2FQGA 2YAMA 2VN3A 1F56A 1ZDSA 3X1FA 4QKTA 1BQ5A 1ILSA 5B7MA 2DYSB 1MZZA 2FT7A 1EZLA 2UXVA 2UXFA 4PAZA 4G72B 3EH3B 2DY2A 2EIJB 1J9TA 3OMNB 4YSDA 2BW5A 4K9JA 1L9SA 2LLNA 3N2JA 4RH4A 4G7SB 4G7RB 3NJKA 3AZUA 3NJHA 1CYXA 4NERA 3WKQA 1SHWA 1WS8A 1QNIA 1KBVA 3TASA 1FA4A 3NP3A 1L9RA 2H3XC 1OOWA 1QHQA 1NIAA 3ABKB 1PLAA 3NSYA 4HZ1A 3T71A 3S3BB 1HAWA 2IDSA 3NJNA 4BDVA 1HAUA 4TXVB 1BQKA 2XXFA 3AY2A 2H5UA 4YSOA 4KO7A 1T5KA 2GIMA 3RYMA 3ERXA 4KO6A 4DP6X 2ZXWB 5EHFA 1BXUA 4DP8X 1EHKB 1GR7A 2YARA 4WKXA 4QLWA 3ASNB 5B7FA 2E86A 2XUWA 4A2HA 2P80A 1KBWA 3CZUB 1SJMA 3N55A 1PZBA 1CC3A 2BZCA 1VLXA 2W88A 4E9XA 2B08A 3FPYA 5I26A 4DP7X 3FSWA 4GP5B 1AACA 2X87A 3CVBA 5I5JA 3MBWB 2Y69B 3TU6A 5I28A 4E9VA 3CG8A 3NJJA 2YXVA 5AKRA 2UXTA 4YSEA 1L9OA 1ILUA 1RZPA 3ZIYA 1FWXA 3PLYA 3EF4A 4GXFA 1NIBA 3S3CB 6PCYA 1E5ZA 1SDDB 1SFDA 2PPAA 2HRHA 4UANA 1ZIBA 2FT8A 5TK2A 1XB8A 3FPXA 3H56A 1ASPA 2VM3A 2XX1A 2HZHA 3UGEA 2PCYA 2YAFA 1UATA 2GBAA 5PAZA 1JZGA 2WO3B 1NWPA 1PNDA 3NSDA 4AI7A 4BXVA 4JHVA 1NINA 5I5IA 2FWLB 1PZCA 3FSZA 2CALA 3JT2A 1AZRA 2QDVA 3ZX1A 5F7BA 2YAQA 2CBPA 3UADA 2BZ7A 5I5MA 4G70B 5A7EA 4DP9X 2GSMB 2UX6A 3UAAA 1AOZA 3NP4A 3AG4B 1GS7A 7PAZA 1JVOA 1MG2C 1WA1X 6PAZA 3QQXA 1WA0X 1JZFA 2YAOA 5B7EA 4BWUA 3DTUB 2X88A 4G7QB 1JZEA 2JXMA 5PCYA 4P5RA 1J5DA 2NRDA 1RCYA 2BP8B 4GP4B 1SF5A 1ET8A 1AG6A 3PPSA 3UAEA 5D4HA 1PLCA 3PCYA 2EILB 3X1BA 4HCGA 4P5SA 1ASOA 4E9YA 1RKRA 4E9RA 1IBYA 1R1CA 4YVUA 4A67A 5I6NA 3AW5A 4NB7A 3T6XA 2AZUA 2I7SA 1BYPA 1OCRB 1XMEB 2FQFA 3PAVA 5LDUA 3WKPA 3NJIA 4E9QA 5IY5B 1TU2A 2RACA 1W6LA 3PXLA 4N4YB 2JKWA 3DIVA 3H4HA 1AG0A 1KDIA 1JXFA 2CUAA 2Q5BA 3C75A 1JXDA 4CSPA 1ETJA 3NSFA 1GSKA 1KDJA 3KW8A 1WA2X 4HCFA 4AKOA 3ABGA 1JXGA 4ZK8A 2MTAA 1OE1A 2PP9A 4YSRA 2WO2B 1AS7A 5B3SB 3EHBB 1IBZA 1BYOA 4KNTA 8PAZA 2XV0A 1PF3A 3FQYA 2J56A 1GW0A 2XU9A 4A2GA 1GY1A 1MDAA 2GC7C 4KOCA 1BEXA 4UF7C 2GI0A 2FJSA 2WSDA 1URIA 1W8EA 1N70A 5I6KA 1B3IA 3GDCA 3CDZB 3FU8A 3TBBA 3AG2B 1ZIAA 2GC4C 1NPJA 4DP2X 2OV0A 4KOBA 3BQVA 3OMIB 1CUOA 3QJVB 1AZUA 2BHFA 2A3TA 4F7KA 1KGYE 3X2QB 1AS8A 5D4IA 4W9ZA 3SBPA 5I6OA 1ASQA 1A4BA 2BP0B 1NTDA 2DYRB 4HHGA 3WNIA 2HXAA 1N68A 1OCCB 3QJTB 4G71B 2IH8A 3SBQA 2CCWA 2J57A 4DP1X 3TA4D 1A8ZA 1BXVA 2UX7A 1PZAA 1JZJA 2EIKB 2VW7A 1NIFA 3QJUB 1DYZA 1W6WA 2IDQA 2ZONA 1J9SA 3GYRA 2YAHA 5I6MA 4BXSV 4EF3A 1FFTB 4KO9A 2QPEB 2HX9A 4A2FA 3WI9A 2YQBA 4HALA 1KCBA 1JZIA 1PY0A 1JVLA 1ET5A 2IWFA 1DZ0A 3T6VA 1SF3A 3DKHA 4BWWA 1OF0A 2IDFA 1SDDA 1A4AA 3NJGA 1PNCA 2HLEB 3X1EA 2Q9OA 3OM3B 2FT6A 1NIDA 2PP8A 2YAPA 4KO5A 4A2DA 4W1TA 7PCYA 4NAJA 1AANA 4Q89A 1OCOB 3FU7B 1GS8A 3FSVA 3UABA 2VM4A 1MZYA 1PMYA 1YLBB 2GB2A 1TKWA 4AX3A 3L45A 3NSCA 3GXUB 1WS7A 3PAZA 3QJRB 1ADWA 9PCYA 2XV3A 4YSSA 5B1BB 5B1JA 4Q8BA 3S8GB 4A2EA 4F2FA 2CJ3A 4DPBX 1X9UA 3V9EA 1J5CA 4M3HA 2IAAC 4KNSA 1IKOP 4F2EA 4AKPA 2ZOOA 4A66A 1GS6X 1PLBA 2R7EB 1AZBA 1TEGA 5B1KA 2UXGA 4JKNA 2W8CA 4MFHA 3U25A 3FQ2A 2DWSA 1E65A 1IC0A 2BP8A 2PLTA 1GYCA 1A4CA 4GYBA 1V54B 4FAAB 2ZWNA 1XB6A 1WAEA 2EIMB 2FTAA 3KW7A 1SHXA 3PAUA 2HRGA 3IN0A 2XWZA 4L0PB 1L9QA 2IWEA
chains in the Genus database with same CATH superfamily
3KWUA 5F7UA 4KZEH 4J3UA 4S2SB 3VI4B 4XGZB 3QZWA 4FFZL 5GGQH 2DQCL 2AV7B 3DXAD 2LTQC 4G9FA 2XN0A 1UM6H 2YSSA 1E9PB 3V4UL 2B16A 4LRNL 3O4OB 2ESVB 3V9CA 4ADGA 2BERA 4XPHH 1T83C 2VLJB 3BSZH 2PYEE 3JWNE 1DLFL 1PZ3A 3WEOA 4N87A 5CJXC 3GXIA 3O3BA 4NQTA 3AG1B 5ITBH 3ECUA 2BXZA 3RNQB 5DHYB 1W72A 3UP6A 1DQKA 1CDIA 2YD5A 2YXWA 2MCAA 2WSPA 3V6OE 4GI6A 3L1OH 1RPKA 3SE4C 4JO2L 3CX2A 1L6PA 1P1VA 3KXFB 3SSGA 5AWNL 2J71A 5IUSA 4OZHA 1FNSH 2VDKB 3UPRB 4MA3B 1G6RA 4ZUWB 3V4LA 3PL6A 5CR8A 4H8QA 5AZEL 5I1EL 4Y9FA 1P53A 3LNEA 1SGKA 2V33A 4ERSH 5C0BB 4JUTA 2GJ6B 1RSFA 3OR7B 2VM9A 2OR9H 3QDJA 3CDZA 3EH5B 2PETA 2LE9A 2VJ0A 3GHBH 3BDBA 2AKRB 4X9GA 2Z4TA 3IBOA 1TQUA 5AAWA 3QJOA 1LEGA 1YJDL 3V4VH 3VYOA 2DQUH 5DO2D 4LCWB 3ASOB 4G7VH 3S37H 1XIWD 4P3WA 4GSXA 2O5NA 3RGVA 3QUHA 1FZOB 1CTNA 2WK2A 5L4JA 1L3NA 2XWRA 4OLZH 1DVFD 1S7UA 5DEJA 4HS3A 3SYAA 4KKLC 2ZYHA 3IDIB 3OAUL 3EJRA 3DV4B 4GXVL 5J1TC 1HNGA 3NFPA 3DVNA 1QRNE 1KCKA 4S11A 4BRJA 2PO6B 3LXBA 1J86A 1KPRA 3ALPA 4WFGD 3RL2A 1MNNA 5LLIC 4XMLL 4BZ1L 2G5BB 2H3NA 2X9ZA 2AANA 2FJGB 2NX5A 3DIFA 4OGYH 5SWZB 1N8OE 1T5WB 4I77L 4TQEL 1J1OH 1E30A 2GBVA 5FM5O 1RU9H 3BFWA 5ANHA 5GSRA 3MNMA 4FG6D 4PLJD 5ANMA 5IIEA 1IM3A 3CNKA 3OJDB 5E2VH 3MACL 2ZP8A 3E8UL 4AUYA 4U1LB 1X5ZA 1DLHB 3GSXA 2APXA 1ZS8A 4P23C 2Y5TA 4Y4KD 3D1MC 2CGYA 3VXOA 2ZKWA 5IVZA 1E2ZA 4CJ0A 2CPCA 3D06A 2PP7A 4YHNB 3ZRSA 5EUOB 1YNKL 4MWFB 4Y2OB 3Q8EA 4Q6IA 3FYEB 3LDBB 1MG3C 3MOQA 4DZBA 1S9KC 2C1OB 1RZFL 2L3BA 3DV6B 1CS6A 3JVFC 4HJTA 1XGQA 2AAVA 4H8UA 3FHAA 1G87A 4XP6H 5FYJU 3SJVA 4AH2A 3DMMB 4P4KC 3IE9A 1PKQA 2R23B 1RZ8B 4NQCA 3HG1E 2FO1A 5E8OB 3FQTA 1CE1H 1E6JL 2CKNA 2OZ4H 2WNGA 3GSNL 4KUCD 3IB4A 4NC1C 1HOCA 2I85A 4OR1A 3P0YL 5AOJA 3IDNA 5FYJE 4X6FA 3GSWA 5IBUG 2E7DA 5D72L 1P2CB 3MRQB 2WQ8A 3VD5A 2VXUH 3QEUB 3R18A 1UD4A 2IQAA 2W60A 3ZQWA 5KSAD 3CH1A 1EZLA 5CD5D 1WFMA 1MXDA 2AABL 2E7LA 2OP4H 4BGLA 4YSDA 2XKNA 4XP5L 3VG0L 2RA1A 3N2JA 1AGDB 1U8JA 2VNCA 2WAQA 2CKBA 2OM5A 3GB7A 1DQDH 1QG3A 1DVTA 4GMSH 3MFFA 2EUZA 1PW3A 3B7TA 4GAGL 4HWEL 1J0KA 4NJAL 3MRRB 3UTZB 3HNVH 4APQD 1QTYT 1U2CA 1XF1A 5LVEA 3OB8A 4ENEC 1MCNA 3VD7A 1ODUA 4JFWA 4BIKA 3FK3A 3H7BB 3MLUL 5F89A 2AJZB 32C2A 1I7TA 4KQ3H 4PTUB 2WLLB 3TXAA 4FQ2L 1NCIA 2P5WB 3IU3A 1XF5B 3QUML 2HVKB 5F8RC 5L2JA 3S97C 2FX7H 5DMGD 2APTA 3GMPB 4PWEA 4IGBA 4LU5L 4OFYA 1TTRA 3DOIA 5EHFA 1CFVH 4PWHA 1YJDC 4CUCA 2VN5A 4GNKB 5DK0A 3NDZE 3BE1H 1U6AH 3P9LB 4B9KC 2AEQL 4N2MA 4A2HA 1YEJL 4PJ8D 4WO4D 1NCWH 4AGLA 1PZBA 3O3DA 4AQOA 3ZZQA 4R7NA 4PY8I 3KBHE 1GZHA 4UUJB 4O9HL 5D7JC 1KOAA 5DI8A 1S9VA 2IH3A 1BWWA 4QOKD 4GT0A 4XXDA 1N5AA 4XO9A 5AUMB 1AXSA 3Q5YA 4GT7A 2QMJA 3J8F7 5EULV 5C0AD 2XQYG 2YXVA 3A21A 5AKRA 4YXLL 4U1SA 3U7YH 4HVBA 5G2NA 1AC6A 4XWOC 4ZUTB 4XVTL 1CDUA 3O6FA 1OLLA 3UL4A 2ZKHH 3T04D 1HL4A 2DMCA 4X5XB 3BZDA 1AC0A 3P0GB 4J5VA 4ZTOH 5GGVL 1XB8A 3SIKA 4TPRH 2XX1A 4G6MH 5C9JB 2F8OA 5E1AA 2GBAA 1WO2A 2V8LA 3B83A 3VB9A 4YO0A 2WXIA 2WO3B 1MNUL 5C0CA 1CDCA 5EWIH 1D7DA 2J21A 2O5YL 3T8XB 4I0PB 3QXDA 1L9NA 5H4YA 2JI3A 5BZWA 1YPZF 2A77H 3B5GA 2DIEA 2FO8A 4N22A 4L8CB 2CXGA 4N0UB 2DZEA 4FNSA 4YN3A 1RL1A 3EJCA 4HZLB 4GMTH 4NZTH 4W9LC 5FM4A 5IBLC 3O3UN 2XQYA 2DKMA 4MNQD 1LWRA 1DCEA 5GPRA 5HYSB 2OMYB 4OGZA 1M4KA 2WD0A 4PP2B 3SY0A 4WDIA 3TCXA 1NGZB 5KVEE 3CHOA 4IMKA 4JB9L 4IM8A 4H0LC 3DPBA 4OY9A 3PHSA 5IMOA 2P49B 2GITA 4UT6L 5AL0A 4M1GH 2WTRB 4JY6A 5DR5H 4D0BA 3DO7A 1X7TA 3WYRA 3N1QC 2Y25A 3WD5L 1M1XB 4LQFL 1JXKA 3D69B 5F8QC 5T1DL 5IESH 2NY1C 1ANUA 3FT2A 3D18B 1G9NL 2J6WA 2YPLE 2EKJA 3KS0J 5FDWA 3GNML 3QJXA 4GW1B 1TNMA 1I31A 1QFWI 4J6IA 5J6HA 4CADB 1WIPA 3IMWA 2K45A 3IETA 4K7PX 2I7SA 1KCRH 1UH3A 1OCRB 2Y7QB 5AD0B 4PJDF 3WNMA 4JR9L 1MVUA 4KVCH 3B9KC 2BLFA 5JHLA 4O02A 5IFJA 1QATA 1OTUD 2P8PA 3FL7A 1P4IL 3GZPA 2PW1B 4YDKL 5DUBB 4M8QA 4HULB 3BLBA 4Y8AA 5D2LB 1UM5H 4OLVL 3B7SA 4Y4HC 2IOOA 3W0WA 5BCAA 2RGSA 1MCOL 3CC5A 4G7YL 4NQEE 1TJHL 5KJ7E 1MJUL 2KBGA 5FKAA 1YUHA 3DGGB 1TFHA 4FFTA 4FTVE 3TPUB 4TUOB 1URZA 2PWFA 4KZCA 2R0LL 4MMXA 1IBZA 5DUPL 1I3UA 2Z8RA 4GRMA 2AXWA 5ISZA 3VGFA 1PYWA 3QJHA 4XH2B 3RI5K 3V4UH 2ADIA 2X4OB 2NY2D 4PJGA 3IE4A 4P9MH 1S3KL 3L4CA 1SLWA 2V7NB 2XTJB 3ARXA 5FO2A 3GDCA 3HOGA 1S5HA 1ZANH 3QG7L 4NUQA 4X5WB 5D96B 4JHWL 4F9PA 3T6QC 1R24A 4QCIB 4AYGA 4PV9B 5F44A 5MEOB 5DRXA 2WZAA 3QUXB 2UWEA 2WWOA 1NOLA 2NMSA 4WSKA 3V0HA 3ZTJG 4U6HB 3UBXG 1HK6A 2ITDB 1Q1JL 4Y1AD 4FP8L 5GRWA 3PRZA 4LMQE 4W9CC 2EKSB 2CNYA 1ASQA 3SBPA 4FXLA 4HOMA 2VWEC 5AWNH 5IJVA 2W0KA 3B2UC 1DBJL 3WJLA 4LIQE 5DWPA 1YHPA 2JTYA 3BKML 3CZFA 3KPLA 4FNUA 4N20A 1O7DE 1I8MA 5I1EH 3FRUA 1KMGA 4GQ9H 4ODBD 4KAQL 1AGBA 1FBIL 4Y7OC 3SDYH 1RI8A 1NJ9B 4X6CF 4R9HA 5BW7C 1U91A 1WBZB 5T3XH 1QO3A 5EO0B 1OSPH 3TNMA 4EF3A 3ZL4H 1Z9LA 4P8QA 4BUHA 1RZ7L 3EG9A 5EF1A 2HYMA 3GI9H 4IKJA 1TENA 4XCEB 3B5HA 4BKTC 2EDEA 3GS4A 2P28B 2R1YB 2BY2A 4LOVA 3FCBA 5I75C 3SCMC 1VFMA 1YJDH 4R90L 1Z9SA 1DDTA 3GIZL 5KTEH 5F6IB 1IAIL 5C07A 3UO1H 4ZMLA 1QEWA 3UBXA 3B2DC 5E2TL 3C9NB 3OHXB 2FUTA 3NJGA 3E3QC 1USZA 5D7LA 4DKEH 4BH8A 3MGTA 3UZQA 3OAUH 4DTGH 7PCYA 2Y07L 4HSAC 3PJNA 2E7MA 1GS8A 4X80H 4FQ1L 3RJQB 1JNHB 2YSTA 3LRSB 5T1KB 4NO2A 4ZSOE 4PGJA 5J11B 4N1HB 3NZ8B 3FCTA 1UENA 4B9CA 5BO1L 5DC2A 2DWEB 3FMGL 1G9NC 1LVEA 1X9UA 2GCYA 5IJKA 2HTKC 3FTWA 5F3HA 3RWEA 4ENED 4TQHA 1J0YA 4ONFL 1IKFL 1LMKA 4JRYD 4NGHL 5D7IA 3ATBA 1OT4A 1NMAH 1YMMA 3E8UH 2MNJB 4I2XE 3SHSA 1VJSA 1JZ2A 1CGXA 4JKNA 3Q44A 2V3DA 3RVUC 1E65A 1A4CA 1V54B 1CF8L 2DYPB 2VB5A 3ALXA 4UQIM 5J1AA 3LX9A 3QQ4B 1Q8MA 3CBKB 4KHTH 2D3JA 4L0PB 2DICA 3SGKA 2VMCA 1T1WB 1AGCA 4NSKB 5D2NB 3ILQD 4YX2L 3AWGA 1TQCB 2E74C 2R7EA 4UT7H 3B8SA 3DYPA 4FXKC 1CGYA 2G3NA 2V8MA 5JIMA 3F64A 1KPVB 3WU1A 3MXVL 3WKNA 3X3FL 3FC8A 1J0ZA 1E8XA 4M7LL 2Q7NA 3KR3L 3DXAA 4NRXB 1CFQB 1G6RB 3HIZA 4UAOC 2X10A 1TJGH 5LN8A 3QEHA 2HKFH 2QT6A 3R4DA 4N26A 3U46A 4L29A 1H3VA 2OMZB 4ZS7L 1JFQH 2NW3B 3ZKSD 3I9GL 3M6DA 2WIIA 1K8IA 3C6SB 4PV8B 2PPDA 2EDYA 4OZGE 1A14L 3LHPL 4P2QB 2X6MA 1MRDH 1FGNL 2QGEA 1QSED 3PGCA 2H2SC 1JE6A 1ZV2A 4O2FB 5EU4B 4TV3A 1UQSB 1M42A 4NJAH 4HWEH 1Z1WA 1LEGB 3LQAL 1PU0A 4HISA 1AR1B 2G2PA 1BAFH 2R56L 3QCTL 4M6NL 3SDXE 2IMNA 5CUSL 1S7QB 1QQDA 2Y2TA 4HS3B 1E27B 4Q0XL 4KXCA 2IAMD 2ZX8A 4PJFA 4AYFB 1TLMA 3QUMH 2FX8H 2GUOB 1NUDA 1DDHA 2XWJB 3OG6B 1NGYB 1U8OA 4JGJA 4OD1L 5DK3A 2IDTA 3RUGF 3MJ7B 1IMHC 2AVFA 4KJPD 3FSOA 3WHXB 1B9KA 4H0IA 4LU5H 1N67A 3Q6GL 5B1AB 3RL2B 3UDWC 1RHHA 3ZGHA 1KJ3L 2DTSA 5HDBF 2J2ZB 4UTBH 4AVIA 2OMBA 2AEQH 3PREA 1XIWA 4H8WL 3JSSA 5AVXB 1N7ML 1DVFA 1PL3A 5F21B 3RRQA 4PRDB 5EF0A 3VXSB 3P9MB 4O9HH 1IM3B 3ZZ1A 5CFHA 2X2IA 4WNQA 4Y16C 3SDCC 2XOTA 3ML9A 3RBSA 1E5AA 3QZPA 2ZIDA 4XC1H 1ZSDA 5IVZB 3VQLA 5EU3A 3QDHA 4LEOB 3ZKQD 2Z34A 3CU1A 3T2OA 3O9WD 4DZBB 1TCRA 4GS7B 2DIAA 1UXWB 1H9VA 3AG3B 2NNFA 4NKDB 4YZFF 5E5RB 5I15H 4GG6A 2HG5A 3ARBB 4YFLF 3M88A 1IB5A 4HAKA 4LNRA 4FE9A 4ZBJA 4YE4L 2WXOA 3EGSB 4AH2B 3C12A 1IGYA 5L4MA 4X7CC 3B9KD 3TBWA 1ZOXA 4NQCB 1E2WA 3V0VB 4WVRA 1FAIL 2EE2A 1E3XA 1ZLSL 3UCRA 3T77A 3VI4E 1WBXA 1GZPA 4D0CA 4RWYL 1DVYA 1L9MA 1X9QA 1FNLA 2C34A 1G4RA 2AQNA 1MNUH 4Y4HD 1Q0EA 4Y4KA 5TD4A 1SFHA 1ONQA 2X12A 3BVWA 2O30A 2AW2A 1RZIA 4NXKA 1AD9B 2VLJE 5K1JA 4ZD3L 1Z6JT 3X1NA 1QFWH 1JERA 2CBQA 2IQAB 3U4BL 4EVNA 3C6LC 5DVNA 3AB0C 5A2LH 3TO4C 3CCHB 4ELMA 5JW3L 1OOAA 5CEZE 5TDOB 1UJ3B 5HDRA 4B3VA 3FT0A 2WVUA 4U6VL 1ETZA 3NJFA 4YHPA 5JIPA 3HG4A 3VD9A 4JGNA 1UB6B 4R8WH 3RX5A 4N8VG 2CKBB 2V2XB 4E9WA 3VD2A 2YAMA 4UQ3B 4KKPA 1BQ5A 1M1SA 2LU5A 3ATAA 3KXFE 3BPLC 2ZF9A 3SKOA 4Z0BH 1ZXQA 2J8UE 1FFNA 3HC3L 2BVYA 5A2FA 32C2B 3HBZA 4LQFH 4P2AA 4OCNC 5T1DH 4QT5A 3ECQA 2VZ1A 3NJHA 2GJ6E 4Q4IA 1YN6A 2HKHL 3JTTB 4JPKL 2EDOA 2NSXA 5H37H 2YQGA 4KY1H 3LEYL 1KBVA 4KPHL 3NP3A 4P5TC 4PJIA 4YDJB 1TPXC 5E99H 1JCVA 5EC2A 1RULL 2WLIB 3RZWA 3ULVD 1WBYA 4RFEB 3ABKB 4PTTB 3LQAC 3WFEL 4ACTA 1JG9A 1V7NL 4PB0H 4KMQA 5DK0B 4A63A 1TZGL 1WWAX 1AI1H 4JM2D 2IV9A 2CUIA 3TCTA 1OSYA 1P4IH 3ARUA 3WY1A 1GSMA 2P52A 4YDKH 4R7NB 1O6VA 1QPPA 4HWBH 4HBCL 5LXVA 3NG5A 2AJYH 4NNPH 2IH3B 3NZSA 4OLVH 2PWGA 5I30H 2G60L 1N5AB 3BAJA 1MCOH 3P0VH 1L0PA 1QBAA 1QX1A 2ZAGA 4G7YH 1MJUH 4LLMB 4RMUA 43C9B 4EIUA 2XUWA 4U1SB 1CR9L 4CVUA 2R0LH 2WYIA 3J27A 5DUPH 4F7EA 4XVSL 1Z66A 1VLXA 4J6RL 4PD4J 5SWZE 5TF1L 2C7UA 4UM9B 1CGUA 4H8WC 5IB2B 4WW1B 1S3KH 3CVBA 3Q2LA 4U2ZA 3NIDF 3HC2A 2XWBA 4PWIA 3PDGA 4PJ8A 5HI5C 4WO4A 3VFGH 1EJ6A 3QG7H 4I1RA 1OAUL 4D0DA 3JV4A 4NKOB 5BUGA 2ZX7A 3CFJB 3MA9H 5D1ZC 4QOKA 2ISDA 2V5TA 5AB9A 4YO0B 2R2HB 1QSZA 3ARGC 4WHTB 1J8KA 3KD4A 1RZPA 3IXAB 1Q1JH 2WVTA 5EUOE 2HTKD 9CGTA 5C0AA 2Q76B 4HJUA 2R15A 3APNA 2ROXA 4W9JC 1M05B 4ZAKC 1Z9MA 2AEPL 4L37A 1DBJH 2X4SB 5KYNA 3L4TA 1VACB 1YEKH 4KAQH 2EE0A 3DX0A 3QQNA 3RVUD 1IKNC 3H6AA 2VE6A 1SY6H 4U1MA 3SY0B 1NGWA 1YPZB 1EFXD 3EOTL 3ZE2F 2ZOKA 4IRZL 1TKWB 5JOPD 3NBNA 4K23H 5IMOB 1EA9C 5ALBL 3JT2A 1FPTH 1RZ7H 4D0BB 4PPTA 1A7RH 1KGIA 5A7EA 3GJEB 1C5DA 4Q9RH 4XOBA 2UX6A 3CK0L 3V6FB 5KBKA 2CDGA 3L3HA 3LPFA 1JWSA 2H32B 1CD9B 4C8XA 5AB0A 4J12A 3GTVA 4MXWH 1HH6A 3LKOA 4M8RA 1JK9A 4UM8B 4DW2L 2QSTA 1G7QB 3MRBA 3QO1A 4PHXA 4D9RE 1JZEA 4KMTL 1C1EL 4MNQA 2VDNL 3DOHA 3TZVC 3GGWA 5D71L 4UDTA 5DURB 3IETB 5JA8B 5CCJA 4XWGL 3SZKC 4CVWA 3OMZA 4UQEA 2R1XB 4YWGL 4O02B 4FQ1H 1ULVA 4BH7A 1PD6A 3M45A 4E9YA 2H2SD 1SUHA 1G1KA 2I60H 2BNRA 3TA3B 4PJDB 5BO1H 2H6UA 2P5WE 1IBYA 4XBPA 4NB7A 2X3BA 4X42A 3W0WB 3FO0L 5D1XE 3RIFF 5CKGA 1IAMA 5FKAB 2IPKA 1U2YA 3BGAA 5FUOL 5K9OB 3MUZ1 4GUOA 4N2EA 4QGTA 3KL0A 4LPYA 4AQEA 1X5AA 4HHAB 2OKMA 2X4PA 2H26A 3GSUB 1AMXA 3D39D 4MYWB 5JIKA 5HYQB 2VZTA 3QJHB 3WBDA 4G3YH 2ADIB 1ZK5A 5CLTA 5E2WH 4L05A 1EEZA 4N9OB 1YNTA 4IJ3B 3Q0HA 4XR8C 2R4SL 3MNZA 2D7QA 2AJVL 2BS71 3FTGB 3QFJD 1WA2X 2WQUA 2IH1B 3ZMEA 1R24B 4AL8L 3M8OL 1JZDC 2XRAL 4YX2H 5DRXB 2UY7B 4XB8A 2A5UA 1OGTA 4XNQB 2XV0A 3MXVH 3WIIL 5DD6B 3MRJA 2VLMD 1UCBH 5IMLA 3NQKA 5DEGB 4NFDA 2BVUA 4M7LH 1URIA 3KR3H 2PYFA 4PG9B 3D0VB 3MNWA 4AIEA 4FA6A 3SDCD 4WWID 5ERWB 4L0ZA 4G6JH 5I76A 5DXWA 1CUOA 4X7DC 1AZUA 1K6QL 4U1HA 4U6TA 5LAXA 3PWUA 2YZ1A 5EU6E 2NSQA 2TRYA 4L8DB 3BPCB 1FGNH 5DZOA 3RPBA 5TTRA 3PABA 5M95B 3LVEA 1FZMB 3ZT7A 4PRBA 4Y1AA 3ZOAA 1C12A 3LQAH 1AP2B 3IPBA 2HVJB 4HJGB 3QJUB 5FS5A 1VEPA 2OSYA 3D50A 2OSLB 4N0UE 5BRPA 5C07B 3GMRA 3QCTH 4M6NH 4AGNA 2ZG1A 3AREC 3G08A 2Q7AA 4HUWA 4R0LA 4BH8B 3IK2A 3F7VB 3MGTB 5GJSL 5SV3A 4OTXL 4FMVA 3WTTA 2QQLL 3MGOB 3O2DA 4Y5XC 3C6LD 3AGVA 3ZZSA 1HESA 5TQ0H 4MJJA 3TFBA 4U3SA 3VFOB 1MW3A 5JXED 2GEEA 1PAMA 1T0MB 3Q6GH 4ALAL 4LDOB 1QBMH 5H35A 5IFAL 5CS7A 3ILPB 2A6KB 1U8IA 1KYDA 3WUWG 4EPSA 3F5WA 2YMXH 2D2CC 4QXTB 3VFUA 4DFIA 5CZXD 4H8WH 1PKOA 1C8QA 2GCYB 4MSWB 4Q89A 3ZT6A 1FRGH 1IARB 2C4XA 2CLRA 1BG9A 4X9YA 1FNGA 3JWDL 2A6DA 2BOLA 1F2QA 4ODSL 1CFNA 1UWYA 3S96A 1WZ1H 1WS7A 1D2OA 2F5AL 2AVGA 2ENPA 5INCA 1KTJA 2YA0A 3LOWA 2P8MA 4YDLC 1RPQA 2EO9A 1NCGA 2D7PA 4WTWA 2GTQA 1OW0A 2M83A 1LD9B 4P5TD 4Q56A 2BRRH 5EC1A 2OTUA 3SE9H 1BZ8A 4KXDA 3MV8A 5E1IA 1AGCB 1IFHH 5D2LE 3RX8A 3MRNA 4GKNB 2BHZA 5HYJB 2R7EB 4YE4H 2D0FA 1TEGA 5FWQA 3KBEA 4MFHA 3U25A 1PEZA 2O1AA 3BQUB 3WUWA 3H3PH 1ZLSH 1CICA 4YXKH 4JLRA 4MJID 1NAMA 3IDYC 4JRYA 1SXAA 3DXAB 4PJAA 2XWZA 1AZNA 4L29B 5AAPA 3CBJB 3OXSA 5K59E 3HHRB 2XTJE 1EEYB 5T3ZE 4WO0A 2ZUQC 3HCVA 2WLJA 1T1YA 4HF5L 1OTTD 1ZMYA 2PN5A 4JZJA 5JW3H 3VXTA 4AL8C 1W0YT 2DMGA 4FG0A 1NC4B 2L7JA 1FORH 3WXWL 2OJEA 4ODWB 1U8MB 3PGCB 4Z18A 2O6FA 4CC1A 3ECBA 3VXRA 2DKSA 3EYVA 3L3GA 3FQ1A 3Q1EA 5HI5D 4DGYL 2GJPA 2BS9A 5IHZB 4TVPH 1KG0A 5F9WB 3QEQD 3HC3H 1AGEA 2FK9A 4O58H 1QQDB 1UA7A 2YPVL 3MHZA 4LCCB 2PPFA 3Q7JA 4PJFB 4PJCA 2WB7A 2HKHH 4B95C 4ZAKD 2B59A 1T2XA 4TM9A 4YXHH 1U8OB 2P5ED 3SO5A 1BF2A 2X9YA 1KJMA 2LABA 4KPHH 2UZXA 1HNYA 3C87A 4U1IA 5EEZA 3LD8B 2WQRA 1E9OA 4M29A 1QSEA 1RULH 4XMWA 2V5RA 5IQ9A 3ZLQC 3D25B 1V7NH 4PI2A 1TZGH 2OJ1A 3WFHB 3N1MC 1BJ8A 3WIAA 2YWYA 3NCYP 2BSTB 4DP5X 1BHGA 5F1NB 3UBGA 3VWKB 5J3HD 3RLSA 2ATKB 5C0FA 1FC1A 1MJ7L 3ARRA 4M4PA 2Z31D 4HBCH 5HDBB 3OMAB 1JF5A 4WNQB 4R3SB 2IAMA 2OCCB 3GZKA 3CVHB 3JTBA 4MAYD 4X5LA 3P73B 3SKNA 4FABH 3B9DA 3KLDA 5EU3B 3W2DL 1Q72H 1ZSHA 1NFDA 2VKXA 1DVZA 5T1LD 2VMJA 3KEHA 3WEAA 1CR9H 4ALAC 2BFVL 3TZVD 2CRIA 1KIUA 3NFSH 3SQRA 1BVOA 4QO1A 3L5IA 1F45A 1NCAL 1YYCA 5D5ME 5TF1H 5CLYA 1H15A 1NEZB 4BHUI 1HSAA 4BQ9A 4TNGA 5HDWA 4NZRL 3REWB 4IMLA 5LGKA 5ICZA 1N10A 4JPVH 4OI8A 1T04A 3DHMA 3JWDC 4X5PA 1GZPB 1XSIA 4JANA 1EHAA 5EV7A 3TBVA 3MRGB 3DJRA 1MSPA 5BXFA 3GZOA 2K8MA 4Y4KB 4U49A 4NZUH 4XN7A 3VM7A 1RZIB 3QQDB 5TE7L 1ADQL 1J7VR 4I9WD 4U7KA 4PRPE 2VRAA 4EVNB 2JQMA 3O9WA 2AEPH 2R9HC 5HJDA 3QT2A 1BXAA 5D2NE 4L0YA 4L4JA 3S0PA 3ULSA 4V1DA 2VSMB 2PXYB 4JDEA 4MA1C 2WHVA 5ECJE 4IYKA 5JPMB 3WAJA 4O00A 1J10A 3BWZA 4LGPB 5EBGA 5LNDA 2MH4A 2VL4A 5JTWA 2OL3A 4PJ5D 4GW4B 5EF3A 4FXGC 4OUOA 2OMTA 3EOTH 3QDMD 1JHTB 1N4XH 2Z6FA 3LZPA 4LPUA 5ALBH 5FHAH 4I4WB 5KVDL 1XGPB 3B56A 4XXWC 1EUTA 1F8TL 1FFNB 2EYRA 5FOJA 2A6JA 5DZAA 4Y4HA 4XNZC 3T4AB 5D7EA 3HJ0A 2ZSWA 4BSWA 1F56A 4PREA 4ABUA 4BSVA 1JCKA 1CTOA 5KSAB 1YN6B 1T6VN 2NXZC 2A1WH 4I0CC 3MRFA 4P2QE 2QHRH 2WINB 1OGAD 3PWPD 4KMTH 2UXVA 4YNYA 2EEBA 5D71H 3RG1C 1DL7H 4PVMA 3S2CA 2ZYRA 3BO8A 1FIGL 3DOSA 4QGYA 1CXIA 3OJVC 4IKNA 3V0FA 4APQB 1G9HA 4FULA 4IU2A 4JFYB 4N8VB 2GFBA 1HHIA 3AZUA 5F7KC 3RTQC 1RUQH 4HFWB 4GAFB 4WI3A 3S98A 5HVFB 3OKEB 1OAKH 2P42B 4GLRI 3K2KA 1G7HA 5FFOA 2X09A 3ELAT 4XNBA 1WT5A 4N9GA 1OCWL 3ARZA 1MELA 3F2LA 2Z91B 3K4ZA 4MB1A 2H0EA 5ECGA 4N1CA 5E56A 4XP4L 1BD2D 3KPPA 3LS5L 1T66C 2FZ3A 5FUOH 5BNXD 3QFDA 1HILB 4YSOA 2XXFA 2OXHB 3GSOA 4YHLL 5DYOA 4DKFH 5B38A 3V6ZB 1E28B 1LGVA 4X6BA 1IZJA 4YPGB 5L88L 4JM2A 4ZMXA 2R4SH 2AJVH 1LK3L 3VXSE 4XO5A 2NUTA 5I1LB 2X4QA 2GJZA 3DSNA 5ADOH 1I9RL 1SM3L 2XRAH 5I9QB 2LVEA 1TITA 4NNXA 4FFYH 3UAFA 5C0EB 3H9HB 2E9WA 2NY5L 3NIDB 1KXQE 2DQGL 5LB1A 1B2YA 1JF6A 4WEBL 3GSQB 1XT5A 3HBGA 3NPSB 4OZFA 5F7EH 5CJOL 3BUBA 4IBVA 4GQPH 3FUIA 2P46B 1VRSA 4L5FH 4DUXA 2J7LA 1IX2A 4TSCL 1NGWB 4P46C 5CLZA 3INUL 2OMVA 1NIBA 2ZOKB 1NEPA 1NKOA 4E36A 3DUUB 3CDGB 2H45A 2KQMA 4W9KC 1GTFA 3H56A 4H4NA 4W9EC 4GO8A 3ZYJA 1ID5I 1C5DB 1E42A 5PAZA 3G04A 3ZE2B 3F05A 3MRPB 2CDGB 1X5MA 4FHBD 4BXVA 2JQAA 5CBEB 5I5IA 1ZHBB 3ARWA 1BF8A 2Q3ZA 2FWLB 3EO9H 2LTQB 6CGTA 4DH2A 4TQPA 1B4TA 5AZ2H 4BKSC 1MUJB 5MERA 2QDVA 3F6IA 4XZUA 3FKUS 3L8QA 3NCJH 3UADA 2BZ7A 1AIFA 4F58L 1EFXA 2R8SL 5K33A 1Z0NA 1BOYA 4GRWH 1XBRA 5E9DB 1T3FB 4JGUA 1MG2C 4BH7B 1I4FA 4FCHA 3IKCA 1WA0X 1XSOA 2BNQB 3AU1A 3L4UA 1D6EA 1HL8A 4O2CA 4ONHB 3S34H 3WFBL 2EVGA 1JGEA 2MPVA 1Y0LB 2XQYK 4G8FA 3LV3B 4OLEA 4BFFA 4KQ0A 3PAYA 1ET8A 5AOKA 4DGIL 3KLAB 4PJ9C 4AJ0A 1PPIA 5D4HA 2CO7A 3JWDH 4OJYA 1RFDL 2FLRT 2V5MA 4TVSa 2X4PB 2X4NB 5IOKA 4NBYB 4NP4H 2ZF8A 3K46A 1A1OA 1CK0L 2C4FT 1E5BA 1R5WA 1BZOA 3T0DA 5DJ6A 5LCVA 1AHKA 1NGQL 5CEYA 1BYPA 1E9QB 1KFGA 2FQFA 5CKAA 3LEVH 3NJIA 3D4YA 1I75A 2IGLA 4P3DA 5CJ8A 3WEBA 5A43C 1W6LA 4F5CA 5D6CB 3TTSA 3IJSA 4XNMA 1DQML 1S7RB 5DRNB 3P1VA 2IPTH 2VXTL 2KUTA 3T0EC 1SVCP 1JL8A 3I9IA 4XHJC 4YK4C 1W8OA 1QWNA 3TEZA 3CHPA 1IGCH 2PW2A 1OAYL 1VAHA 3CC1A 3STZA 1I1FA 3C2AL 3MRJB 6FABH 1UA3A 4GIOA 4C56E 1S9YA 2X2UA 1KPUA 3H6JA 3RWDA 2NPLX 3WL9A 1IE5A 3D2TA 3RWHA 1UEYA 2CCVA 4TQ8A 1JYNA 1Q9OA 1A47A 2WTPA 5C7XL 4XOCA 4K7PL 2GY7B 2LV4A 3GRWL 4HF5H 2M26A 3TIEB 1QUNB 5LAXB 3HS0A 1FE8L 1RV6X 3MV7D 5E4EC 1KIPA 4AJWA 1A7OL 5HDQL 2AJSL 1AHMA 3HMWL 2LHAA 2NY5C 6TAAA 5F1OB 3WXWH 1I7RA 1LNUA 3ZHKA 3PABB 2VDRH 2BY0A 3UTOA 5CLWA 3WTXA 1HEZB 2Z1KA 4Y1AB 3L7FA 2OV0A 3BLKA 3BQVA 3QJVB 2CIIA 4CDGC 3GMRB 3SDCA 2FB4H 3UTQB 2K1MA 4P23B 3A67L 2YPVH 3IPFA 5LUMA 3L4ZA 2W9EL 1YPZE 2ROYA 3RQ3A 2HKAA 2IH8A 1W0WA 1U8HA 2CO3A 1HHGB 3DYOA 4G9DA 2ORBL 1NCDL 4HUMB 3BJ91 1CIUA 4XOEA 5KOVC 3W3BA 2IXQB 4UV4L 1DR9A 4FMKA 3KPSD 1J9SA 5I5RA 1RUPL 1YA5A 5AW5B 1ZXKA 3I3DA 4P4KB 4J7RA 3KJ6H 4HUUA 3F5WB 1B0WA 1H0DA 4LOFA 3T2NL 4H8VA 2ZWYA 1IAKA 2ED6A 3Q2CA 4FZ8H 3SDAC 3ULUC 3VD3A 3RIKA 4EKXA 1KFAL 2CLRB 2RCSH 3FULA 5I1IL 5IB1B 4B5EA 2EC8A 3PHQA 5EOCL 3GJFH 4KX9A 5AVUB 3A24A 1LO0L 4IIQC 4K3EH 1ZGLB 3C6LA 5IF0A 1HYRC 3RWJA 4TMPA 2NXZD 3MKGA 1IGML 2AJXL 4WI0A 2Z7YA 3AITA 3W2DH 3GI8L 4KO5A 1I7UB 5CGBA 1OL0A 1CYGA 1T7WA 1U8KA 3LZQA 1E8YA 3GTNA 3QXUA 5CJBA 5EC1B 5JXEA 3QR2A 3RVVC 5I24A 5I2IA 2OTUB 4PJDE 1YEWA 3A6CL 3L16A 4HT1L 1FN4A 1NCAH 3DO4A 3W0WE 1MJJA 4PW4A 3ZE0F 2VSDA 3DX6B 1N6VA 3IDJA 4O4YH 2Z0UA 4XB3A 2HRLA 1H8OA 3RTQD 4QTFA 2QL1A 3WUWB 2DEYX 1XF2A 1RZJL 3O8XC 3QUGA 4Y19B 2E6JA 5LBSH 2ZOLB 2YWZA 5SX5K 3C8KA 2OJZH 4PJAB 4TNWK 4HXBL 5GRUH 1C8PA 4LKCA 3P54A 1H9DA 1GS6X 2HG0A 2WY3B 3ECWA 2ZUWA 4HUKB 5F1IB 1JWMB 4TN9A 2I9LB 1AZBA 3BYTA 1ADQH 3SE8L 3VSUA 1EXHA 3K74B 3HCVB 5DJAA 4P5TA 4AQ1C 1SJHB 1T66D 2DWSA 1JD7A 5F96L 4I9XA 1LO3H 2FYVA 1IQDB 1NDMA 3E6FA 2ZWNA 2ITCA 2EIMB 3LQZA 3HN5A 1A6UH 4S0TD 3MOAH 1HT6A 1EDYA 4UINL 5BUAA 4FD0A 4NDMB 4NOFA 5AALA 3L3GB 1S7WB 3NGBC 3ULUH 1HI6A 4MJIA 1I1AC 4S1SL 4QJ4B 5I8CB 4E41D 3SQBB 5ABAA 1KB5H 5D7JB 1QPXA 4EZJA 2BVEA 5D6DC 5JIDA 2FQEA 2GEQA 1AGEB 1MAJA 5BRZA 3CVCA 1ZHKB 4LE8A 2E27H 3N1FC 1TZHB 3N0AA 2FSDA 3K6OA 4FI7A 4F33B 1PY9A 3CLFL 1SQ2N 3EH4B 1GHFH 2PCFA 1IT9L 4JN1L 3AGWA 1OVZA 4HIEA 2ERJC 5C0GB 5E6IC 2VLLB 1M57B 1KJMB 2EICA 1PCSA 1TJIL 3F58H 1E9OB 3ZUNC 1QSEB 4X6CE 3JTSA 4DN4H 2HFEB 5D55A 4PJBA 1FIGH 5K93A 3WS6A 5ESQA 5C07E 3EOAA 2EAEA 2BSDA 2O6CA 3HLAB 3RDTD 2B77A 5J5EA 2YPKA 4OLXH 4MNHB 4JFHE 3QEQA 2W38A 5E4IA 4XMPH 3GD1C 4JFVA 1T4KA 3TLRA 3WEXA 4XAKE 4JL1A 3ZQXA 3T6ZA 3IVKA 2P80D 1G9ML 1OCWH 3FB8B 1TZOA 1JAEA 1MCPH 4ZTEA 8FABA 4WK4B 2WKGA 1BREA 2EUVA 3NIGF 3SKNB 3SZ6A 3BX7C 3L9RA 2AK1H 2P5EA 2WAHA 5HJ3B 2XPZA 5IHWA 2QMKA 1DBBL 3HRZC 2CJUL 1KIUB 1F13A 4QO1B 1JTOA 3IDXL 3BUIA 3GSNB 2YBRB 1H15B 5AVYB 2BWQA 1HSAB 5AW8B 4GJTB 3NK3A 5EO9A 4HKBB 4JFSA 3LHAA 1LK3H 5I19H 2E59A 5LJYH 2HFTA 1T0NA 1TXKA 1R3LA 2FD6L 2Z31A 4MKMA 1A7PH 5CBAA 1I9RH 4P2RB 5ACZA 1N9PA 3BDYH 3SQOL 4PBDA 3KLSA 2NY1B 5E94B 4MAYA 1KN2L 4YSUA 1BXXA 1GY2A 1ZTXL 3F8UB 3GIVA 5B22A 1HH9A 3R19A 4I3RL 4HFUL 5T1LA 1QZNA 5IG7A 2R2EB 3MUUA 4FKEA 3TZVA 1WEJL 4X9BA 4JDEB 2GW5A 2PPCA 2XXMB 3DX9A 5HYJE 1BZEA 2C7FA 3H85A 2XFXA 1VGEH 3QIWC 5D4JA 4OJDH 1NGPL 2OX5B 3B9KB 3O3AB 4D9LL 2OMTB 3KE0A 2VMEA 1MLCB 1JGIA 1RZJC 1M2OA 2B7DT 4YSAA 3VXMD 4PD4K 3TO2A 4G8EA 2FSEA 5DQDL 2VJXA 5MP6L 5FPIA 1Q0XH 3GXDA 4MQXC 3WE1A 4HWZA 4Y4HB 1YRKA 3QUMB 3T0ED 5M7QA 2P7TA 1ZJAA 4WI2A 1JP5A 2UY6A 4XHJD 3WMQA 4OGXL 5ICYB 1RK0A 3FU7A 1X6LA 1KN4H 2GKIA 2ZSWB 4BSWB 4TLTA 1A3LL 3MOBH 2ZSVB 1V55B 1FGVH 1JF1A 3D2UA 4X0NA 3X1GA 4YHIB 4A68A 4MD0A 1UT2A 2AXHA 1RZQA 1F6AA 4YNYB 1KB9J 2V2WA 3MSPA 4UDUB 4ZXBC 4F58H 4Z77B 4JFUA 4U1JA 3K71A 3QDMA 5C2UB 1WFIA 4IU2B 3V8OA 1XR8A 3ATDA 2GFBB 4WIQA 2MKWA 5HGAB 4Z7QB 2XNAA 1CD0A 3DI3B 3ARFA 4PJHF 1RZKL 5C9KA 5IEHB 2A0LC 3WFBH 1NBYA 4HJIA 2J20A 4Q6KA 4GKZA 3B9AA 2YKLH 4HCRA 1RJZB 4DGIH 1SXBA 3LB6C 2I69A 3CSGA 4FMFA 1OGAA 3CFQA 3ARTA 3PWPA 4G7RB 2CE6A 3F12A 1KTRL 1N19A 2AJ3A 4PGEB 1VDGA 4X6DF 4F8TA 4H25A 5DYOB 3RUGE 1MFMA 1CK0H 1QHQA 1AQHA 4X6BB 3N43F 4MVBC 3O45A 2JK5B 4GAJL 3DVGB 5HDBE 3L5WB 4L3FA 2X4QB 3PV7A 3Q5OA 1G9MC 5I75B 4IBUA 3SCMB 4DN3H 1P5UC 2F18A 1ORQA 5CZVL 2WBJC 3BIAX 4F7TA 5CF3A 2WLHA 1E50A 1X5KA 1ZV5A 5SWSD 1OO2A 1X6NA 1PGRB 1OAYH 1BD2A 1G7JA 3QAZC 1FFOB 5FB8B 4FQCH 3FFCA 3EFDH 5L2KB 3NEOA 1NCBL 4Z9KB 1U3HD 3CUPA 4NN6C 5C7XH 3D52A 4YZFE 5IHHA 2B5IC 2YBGA 2WXGA 3GRWH 3OC5A 3BZ4A 4LMQI 3LNHA 3MRIB 1XR9A 1BVZA 1A7OH 1UXSB 2C9PA 5I5JA 1KT2A 4F3FA 2DQFA 5E2UH 3WV0A 4DJMA 5AYUL 4M61A 2MTPA 1DFXA 2R4RL 3DNKA 3P30L 4CU8A 3T2PA 3ZDZF 2EO1A 5FIEA 1K9TA 1RP9A 4GUCA 4OCXL 3L6FB 3S88L 3G04B 1QVOA 1BGXL 1FFQA 3RE0A 1CVRA 4G8GE 4RBPH 1J1PL 4DCQA 1IL1B 4FQLH 4R7LA 3O8XD 3EF4A 5K9KA 1F4XL 2ICWA 2MHAA 4J8QA 2PPAA 2HRHA 4NN5C 2XZQH 2NDFA 1FCGA 1EO7A 1JN6B 5ID1B 1O9ZA 1UWXK 2OMNA 5F9DC 1EFXB 2H0PA 3WE6A 1OAQH 3RWGB 2Y7SA 3M1BA 2VR6A 4IRJD 4N1EA 1ZLWH 1NWPA 3OLIA 1ZV9A 3Q1SH 1J12A 4JHVA 4UV4H 4B7IA 4NQDB 1YZZA 1UD3A 4FKKA 2IJ0C 3D6GA 2EH7L 1LL1A 3AU1B 1F3DH 3IKCB 1DN0A 4WQOA 1Z3GH 3HAEH 3ROLB 3CBRA 4FXKB 1ZT4B 3CZLA 4IJTA 4HUVA 1KSRA 3MCG1 4PGDA 2ZZUT 4Z3FA 2DOCA 5GGSA 4JVUA 5HDOA 2GSMB 3GMMA 4MDJA 3FFDA 2AMGA 1T6WA 1GS7A 3VX0A 5KZCD 1QSFD 2CO7B 4D7PA 1AJ7L 3QQXA 5EOCH 4L2LA 3UJJH 3H2PA 2WBWB 4NENA 2C9UA 3GO1H 4X0KB 5TPWL 2R0ZH 4IOIB 4BQBA 1IGMH 1R5WB 4H0GA 5DJ6B 2YIHA 3GI8H 3APFA 4JG9A 4ZFOA 1OM3H 3O0LA 1RZKC 5T8IA 2WUBH 3ARDD 1FO0H 3ARPA 5K39A 3KVQA 1EANA 4JMXA 1CLOL 1TVBB 3H8NA 2DQTH 4RAVA 3HUJF 3EXLA 5FK9B 5GXBB 1BOGA 4N6RA 2E6PA 2HT2D 4XPBH 3RWFB 1RZJH 2YUWA 3GMOA 3GS7A 4UI2A 2AK4D 3WKML 1IM9D 4E5XG 1MREL 4HXBH 4L4VD 4JN2A 1TU2A 3RWDB 3D39B 3PWNA 5D7SH 3NEXA 3WL9B 4S1QH 3DIVA 1K85A 3RJDA 5IB4B 5JHMA 2YGNA 1NBVL 4R7VA 4AIZB 3SOTA 4BQ8A 4LP5A 5I1AA 1MFCH 2QSVA 2WC7A 3QFJB 2IFFH 4NQXB 3NJXA 3OF6D 5C0IA 3Q3GB 3UYRH 3NIDE 4KXAA 1AMYA 4HCFA 5I73C 1I7RB 1J0JA 1LNUB 4UINH 5DZPA 5FUZL 2IWGA 3RVWD 2PP9A 1KJVA 4KI5D 4MCYA 4RGNC 1S2EA 3GSVB 1ZVYA 2NXYD 1FFRA 2VR5A 4S1SH 5FO9B 1BYOA 1OM9A 3BUDA 1VGKA 2N7BA 3ZE1F 5DSCB 5EBMA 2X0UA 5IBTL 2J56A 4Y16B 3SDCB 4A2GA 4KOCA 5IK3A 2G9HA 5KN5A 4OSUL 2J72A 1XZ0A 3TBBA 5TQ2L 4E5XA 2ICWJ 3VGGA 1ZIAA 3UTTD 1JPST 5LG1A 2MOGA 2XWTB 4C4KT 5CN3A 1IVTA 2VERN 5DD1H 3MV7A 1BA9A 3PGDB 1NEUA 4TTGA 2X41A 4FTDA 4OKDA 4WU5A 1ESOA 3QC6X 3QIWD 1PY4A 3FO2B 3ZE2E 4KX7A 1SXSA 3MZGB 3WNIA 1AQDB 2C9QA 3MV9E 5FO7A 2LVCA 3MRCB 3BP5B 3UYOD 5GJTL 3RA7L 3KDMB 4PG2C 4ZFGH 1P9MC 4MQXD 2HFGL 1IBHA 1U8NA 3PHQB 4LLWB 4FLQA 3BSZA 1FFTB 5L8LB 3KBPA 3GLEA 1SPDA 2WGNB 5E9DE 3AB0B 3TO4B 4OIIL 3B3BA 3N91A 1BLNA 4WI0B 5ITFA 1JV2B 2BNQE 1DTUA 3VW3L 2WTOA 1D5XA 4FXGA 3IDXH 5CMAB 2YJQA 3D9AL 5AOIA 2A9ML 2W07B 3EYQC 2ZOTA 3BPLB 1ZLUK 3V0GA 2C3VA 2CDEA 5B3JF 5C0JB 1FFPB 3G5YA 2NW2A 4CNIB 4EZKA 1N6QL 4MCNA 2CR6A 4UTAL 2FD6H 3IFLL 4G1EB 3MJ8A 2A0LD 3SQOH 5KVEH 3C8KB 3ZU8A 3ZE0B 1WAAF 4JFQA 1MWAL 1K4CA 1KN2H 1ZTXH 2VABA 1R47A 4L9DA 3GBEA 3LB6D 4EJ1C 5HHNB 4I3RH 1P7BA 1OT1A 5HYEA 2IALB 3NABH 4BFGA 4P5TB 4LXFA 3RIAK 1TPXB 1PJWA 2X28A 3FF8A 3V4VA 4MYPA 4EN3D 3AS3A 1SEBB 1EAPA 3V9EA 2IAAC 1AFVH 1GOGA 2JJTC 4L1BA 4Y89A 2ADYA 1MEXL 2LU7A 4AKPA 1H3GA 1NGPH 4MVBD 3RTQA 3KWVA 4HDIA 5F2FA 1B4RA 3MBED 2UXGA 2ATPB 5DQDH 4GXUM 4HK3N 5DHVH 5MP6H 5TDPB 3ZTNL 5CD3A 2BIQA 1QWUA 4JRLA 2R29L 2Q8AH 3RZCC 3UC0L 5IQOA 1MCKA 1WAEA 1SHXA 4OGXH 1I85A 2VZUA 4HLJA 3NAAL 1QW9A 1MFAH 5LBGA 3MLVH 5E1QA 4HHWA 5EN2B 3X14B 3L5JA 2GIYA 4FF9A 5DUJA 2CBMA 4PRAA 5DC0A 3HI6H 2BVOB 4H40A 5F9JA 5B1JC 5DRWB 4NRYB 5CN2A 4N0RA 5F7LB 4ZNEE 4GRLC 4KZ0A 5ESQB 3ETBF 3Q01A 4LL4A 1NC2B 5C6WH 1MI5D 3PQYB 5D1ZB 1L9TA 3ARQA 4MRBA 5ELIA 5IQ7L 4NP9A 3QNXA 3ARSA 3ARGB 3WEXB 3O3EA 4JO5A 5L8KB 2OW7A 2DM2A 3VH8B 3WAKA 4GH7B 3ESMA 8FABB 1UB5B 3HBPA 1E4XI 4ZAKB 3KLKA 2HT3C 2Q2LA 3ZSTA 5IT2H 2VLRD 3HMXA 1FYTB 3OQRA 5F70A 2WSKA 5C0RL 2OZ4A 1WCBA 5EIVA 2QQNL 2X40A 3Q8BA 4QRFA 2WMPA 5CP7B 1XF3A 3NIGB 4XX5A 3F85A 1ZDQA 1NA8A 3MMEA 4KKAC 5A3IC 1RIVL 1DSFH 4LIQH 3RDTA 1M56B 4ZDHB 4KZDH 3VXQA 2BOCA 4NC1E 2X3CA 4NO5A 2KZBA 1UJTA 4LESA 3KYKL 2BHYA 4GAJH 2HTLD 3OD3A 4X50A 3WSQH 2AZAA 4CDHA 2NUPA 4HIPA 4U4BA 5CBAB 2GTWA 3LYRA 4TRPH 1FNAA 1PLGL 3EUUA 4L8SC 5E8DL 4ZMQA 2YXFA 1XBDA 4O5LL 3ZKMC 5CZVH 1MQ8A 2YEZA 3JZ7A 5BVJB 1XO8A 3HRPA 3ULUF 4HPYL 3QJZA 1UM4L 1VPOL 2VMDA 4BFJA 2V0AA 1AGFB 4ZO9A 1HJCA 5T1LB 4RWHA 1ERNA 4CC4C 3IGLA 2XWEA 3TZVB 2PWDA 3VFSA 5IW1A 1J18A 1JDAA 3IGAA 1NCBH 4FX5A 1J8HD 5H2BB 2XFXB 5AEAA 2QFPA 2X4TB 4JK0D 2DQDL 3LKNB 4KDVA 4XMZA 3CXFA 3O4LB 4KBPA 4MB5A 4Y19E 1A6WH 2BVQA 4OQTH 3LPPA 1KBBA 2FSEB 3IJEA 1YAIA 2K8QA 4ACPA 3P30H 4GUPB 5E0QA 4FQXC 3LKSA 1AOHA 1BZ9B 1REIA 1PX4A 2LR4A 5CINL 5T5NG 4PLNC 3K6NA 1BGXH 2VXQL 4Z3TA 2QZQA 5GGRB 3WJMA 5JHDD 5C6PB 1J1PH 1BVNP 1OPGL 1ZAGA 1YAZA 4YBQC 5I6LA 1DHKA 3L3JB 3W9DB 3HJEA 3II2A 5C2BH 1JF1B 3R0MA 2N1TE 2ZCHL 4MD0B 1F6AB 3V5HA 1XEDA 2QV4A 4PJ5B 4DP4X 2OULB 3NH7L 4Y2DC 4QRPD 3CQQA 1Q0YL 2RFXA 2HX8A 4WSGA 1HKFA 4AIXA 3GMLA 3QDMB 3MLYH 4M03A 5DFTA 1U33A 4C83B 3VXMA 5F7DA 1I8IB 5DVKA 3PF2A 4W9DC 5T5NF 4YQXL 2NY3D 5EOQL 4NUGH 1L7IH 2N01B 4MMYA 1YYML 4IEFB 4ONOA 5GRXG 1Z3RA 4J39A 3MREA 4GKZB 4RGND 1JNLH 2W5PA 4WUUD 1GCYA 3VI3A 4QLRA 4U3HA 4AJVA 1U8PA 1V10A 4HBQA 4PJHB 5CCHE 1HHJB 5I66B 3S6CA 4CVXA 3F12B 5CIPB 1QSEE 5DDHA 4CN4A 5E24E 1C9SA 1R3JA 2X1PA 3K5SA 4H25B 1UC6A 1O9WA 1KEMH 2WXJA 3VXUA 1DJGA 3V4PL 3AXLA 3Q6FA 3SO3C 2E7HA 2IAND 5INDB 3OMNB 3E0GA 3AQDA 1U92B 1L9SA 4TLSA 5SV4A 3CXDL 1ZKAA 4ADJA 2XVLA 2XICA 1CLOH 3MPCA 1YEIL 2AQRA 3IDMA 1LO2H 1BIIB 4A2LA 3N43B 1UKQA 2O6DA 1TUPA 2ZD0A 2ZNWA 3ES6A 1FA4A 4FJ6A 4CL7A 1LEIA 3H9SB 1I3RA 3AREB 3WIHL 2QVIA 1G7JB 3KNBB 3LS4L 3PP3K 1A1MA 4PBVC 1FJ1A 5IOPA 4KUZL 3QDGB 3QA3A 1PLAA 3WKMH 3NUKA 2KPNA 4KU1A 3NJNA 2X1OA 3NTCL 4G83A 2NT0A 4Y5XB 3IF1B 1ETA1 3CUPB 1F97A 4Z3EA 5I1HH 1X4ZA 3OKMA 1IIKA 1T5KA 4FL4C 5E6RB 1MCSA 4AITA 1JSYA 2B1HL 2GTZA 4IS6A 4OZIF 4P2RE 2ZICA 3UG4A 5KSBA 3CFUA 1Y18A 2F53D 4F3FB 2DQFB 4M61B 3H53A 1UASA 2Z92A 5C3TA 4C47A 3EYQD 3DVIA 4P3CL 1RIHH 1QVOB 3N9GL 1HVXA 3L17A 1H3WM 4XBEL 5FECB 1G9EA 2VDNB 4DCQB 2A4EA 2JKIS 3L2NA 2ICWB 4Y5YC 4FFWC 5DVPA 2J6EL 4RRPG 4FQJL 4YHZL 4JY4B 3BAWA 1HXMA 1ORSA 1U3HA 3DTXB 3CG8A 4JFFD 4YDLB 4K3DH 3K8KA 5E7FA 3DWTA 3Q2VA 4UZGA 3BVNA 4PIRF 2J4WL 1LQSR 4RA0C 4LL1A 4WHDA 4BZ2H 4I48B 4XPTL 3BPOC 1P69B 3BYYA 3LEXB 1LO4L 4BEIA 5SWQA 4UT9L 2B4CL 3T3MF 4HUVB 4PRHD 5DMJB 1RURL 3ZMNA 3FZUC 1QI3A 3IDYB 3O8XA 5GJTH 5M94B 3FB5A 3KLQA 1JK8B 1JZGA 2YRBA 3FQ4A 3GF8A 4RGOL 2QR0A 5T1MB 1PG7X 1O7SA 2F5BL 1NINA 3RZCD 5GGUA 3ROOB 4NT6A 3QRFM 4JFDD 5FFGA 4HW6A 1Y7VA 2ZUQB 4RRPA 4YE0A 3BI9X 4RDBA 5CLXA 1ZK9A 2XPGA 1CMOA 4OIIH 3WCYA 4IRJA 5BMFH 4M6OL 2X6CA 4C59B 2W9DL 3QIUC 3UCQA 3V5DA 2YGQA 5IB3B 3VW3H 1DQJA 1IAIM 3P77B 3NP4A 4LSPH 4LLYA 3LKPA 5K39B 4AENB 5L0QC 3O41B 4QRAA 1R3IH 1VFAB 3U79A 2H8PA 4JJ5A 3MUGA 4JRXB 4ODVH 4GRLD 3D9AH 5CEZH 1D5IH 1JZFA 3LXAA 4X7TA 2A9MH 2VWEE 5HHQB 5L7XL 5HVGB 2XN9D 5EIIB 4RDQF 3S5ZA 4JPSA 4KJYB 5I17A 1QSFA 1J05A 4J3WA 2C3GA 3L3OC 4X99B 4A2MA 3GMOB 2B15A 3BVVA 1YMHA 4JZOB 1RJLA 3HUJB 4L1LA 5FA3A 2YD4A 3M17A 1MWAH 2VDKH 2Z3FA 2X4UA 2IMMA 3PUCA 2VITA 2OMWA 4HCGA 4OFKA 4JCLA 5I0VA 1F4HA 2J1WA 1TFPA 4HGMA 3ARDA 3U6RA 1ZT7A 4LSSH 5FO8A 5I1CL 3CSTA 1OY3B 1QEXA 3CFBA 5A3ID 1KIRB 1MEXH 4KKAD 3VFNB 2F1AA 2DM4A 2RACA 3AABA 4FADA 3QZMA 4XPAL 3E3QE 3QISA 3ZYZA 4KKBC 1E8WA 1M7XA 5L2KE 1IM9A 4XMXA 2ZYIA 3ZTNH 1RLWA 4L4VA 1E4XH 3VUAA 4PLOB 2R29H 4FNLL 5I0XA 5IV2A 5A2AA 5G5DA 4ATWA 3S5LA 1N0LA 3ZKMD 3MRDB 2YK1L 4A6YA 3BOVA 4E5XB 1BF5A 4X6EB 1JPTL 2XTSA 3KPNB 4M3KB 1EO5A 3ZE1B 3HRZA 4MD4A 5EEXA 3MV7B 5C08D 4K7FA 3OF6A 3ARVA 2BNUA 1EGJA 4WU5B 5D1QA 4L48A 1BQHG 2WOYA 2YZ8A 1BEXA 4UF7C 2PCPB 3QORD 1P4BH 4YIQA 1CDGA 1VFBA 2NR6C 1XAUA 4FLOA 3VVWA 1FL3A 2CA3A 4PEEA 3SGJA 4ZMOA 3KAAA 4CW1B 5HGBA 2H3KA 1YY8A 3RPIA 5IQ7H 1R5IA 5F6HI 3GBMH 2A3TA 4FQXD 4ZMPA 2VC2L 1N26A 3AT9A 5D4IA 3QWNA 3UTTA 3QUKA 4QF1A 5JOFB 5CZRA 5JOPE 2ZCLL 3IFNL 4GPVA 4TYUA 4YBQD 5DEFA 4N90E 4LVOC 4NQDE 4MA1B 2Y7OA 4LP4A 3KPSB 4OCLC 4U4IA 2UX7A 4LSVL 4XCFL 1XVSA 1D5XB 3L3KB 5C0RH 4DO6A 1T03H 3KM1A 2CHWA 4FXGB 4Y2DD 1W6WA 5DC4B 3H3KA 1HQ4A 2HLAB 4HUNB 1RIVH 4BXSV 3VTMA 1BQHA 3HA0A 2C3VB 1W72L 1XCXA 2QPEB 5EBWA 2HJKB 3KYKH 1B2WL 4LEXL 1ED3B 1C16A 2X2JA 3MJ8B 1UHVA 2JKSA 3QUYC 1JZIA 4NQQA 4TNEA 4XNZB 3VO0A 4PLKC 1MIML 4DVBA 1PLGH 2IWFA 2J88L 1V8HA 3MCKA 5E00B 4O5LH 4ES9A 3HZKA 3CWGA 5IGXL 1E2VA 3G5ZA 1OF0A 4PUBH 2NXZB 2IDFA 2APWA 2C1PA 4HPYH 2GSGA 3KYAA 5FW7A 4J2XA 3K91A 3TIDA 5GHWL 3IMSA 3ZQ9A 1B4LA 2CK0H 4XNXL 1PNCA 2AQQA 1N59A 1O5PA 1MFEH 1BBDL 2ZXAA 3VMOA 4CVZB 4WCYL 3D8MA 2BSBA 3X1EA 3FTSA 3OQ3B 2UZYA 1YY9D 2E7BA 1EAPB 4JRFA 1AO7D 4GAYB 4FA8A 2V2TB 2DQEL 2WLYA 3JQOB 5AQ0A 1OCOB 5DMIL 2DQDH 3DECA 3FO9A 4HGWA 4IQHA 3A4AA 4BE6A 1U8CA 3CN1A 3RTQB 3MBXH 2Q86A 2BH0A 2GB2A 4ICWA 3SKMA 4PGCB 3GXUB 3KPQA 2MQCA 3AT0A 2A9BA 2BM3A 4LFHD 5DVLA 4L23A 4C4BA 2EDBA 2H1PL 1SYSB 3D39E 4MJ5A 3DBXB 4LCVA 3CFMA 2A4CA 4OT1L 1EHLH 5CINH 4M3HA 4PMFA 1IKOP 4AQ8C 5E08H 2KERA 3QFJE 3BKJL 1WV7T 3AY4C 5T33H 3P4NB 4PRAB 1IC1A 2FRGP 4EN3A 1QA9A 5GSVA 3FTUA 4UTBA 3UC2A 5HHXL 4JFPA 1T5XA 3RVTC 2JKLA 1GYCA 4JFEB 1DO5A 4J3OC 4DK3A 1Q0YH 2WQSA 5DD5H 2FTAA 2YD0A 2G2RA 3PAUA 5F72S 2KLRA 2L7UA 3UBHA 4MX7A 3MBEA 2IWEA 4E41B 2NZIA 5EG6C 1E4JA 3GJFB 4YQXH 3S8FB 4KJQC 5HTSA 1OAJA 3BVTA 5EUKB 5EOQH 2XN1A 4QUOA 4YDIL 3VE0B 1JYWA 2NY7L 2VSKB 1DBMH 3TEWA 1S9XA 2Z7ZA 5BS0E 3EIFA 4ZFFB 4DGVH 3IJ9A 5ILTL 2HB0A 4FFWD 1NQBA 2MOVA 4BDVB 3AQYA 4YDMA 2MCPL 3CZEA 2YA1A 3HE6C 2CIKA 1N8ZB 4P46B 2QLVB 4F8LA 3OX8B 3V4PH 3P3UA 1INDH 2C9XA 2JB6B 1IGTA 2BOCB 2MFNA 2B8OT 3HFMH 3FQNA 3W39A 3UERA 4M6MH 4DP0X 2F54A 1QBBA 2DKUA 2CRYA 1KB9K 1OQXA 1D5BA 1RMFL 2WNXA 2XDHA 4EOWH 1G7LA 4M48L 4JY5H 1YEIH 2CPUA 4NYLA 4Q14A 1F4YH 3KYNB 2X4RB 1OKEA 2CHXA 1WFNA 2YEZB 4JQIA 3FZUD 4PRID 3GRGA 3ZMRA 4XP1H 5F7FA 3LS4H 3CFEB 4ELKA 1LP9F 3OVUB 4ZPTA 1NKRA 1CCZA 4KUZH 2HN7A 5DS2A 2X05A 4BK5C 1P84J 1T20B 3D09A 5I6XC 5A16A 1MIEL 2B1AL 1N2RB 5F1KC 1BFVL 4R4BA 2HVBA 4PCYA 5JLZA 4UNIA 1JYXA 2BCMA 4OQ1A 3B4NA 5C70A 1BZDA 2XTLA 3QIUD 2B1HH 2Y06L 2WLKA 1IAOB 3ZE0E 4HD9A 4QHUB 3CMOL 1FNHA 3GKWL 1ZGLP 3PL6C 1MF2H 4P3CH 3W9EA 4NCC1 4ZI8A 4OM1H 3N9GH 4PJ9B 4HOZA 1A9EA 1H3UA 3LSOA 5JDSA 2MQ3A 1XAKA 3IFPB 4K55A 4XAWL 3DX2A 5FYLD 2ENSA 3CN3A 2Z64C 4FQJH 4YHZH 1J8HA 2EC9T 2XYBA 2BY3A 2ZUUA 3NCEB 3T8MA 3WKYA 4AMKL 2V37A 4HX1A 3CQFA 1GZQB 1XB3A 1EVUA 2E7CA 5I1DA 3TBSB 1OE2A 3U0TB 1HQRA 2VL5A 2FEJA 3GMLB 4HWBA 4HEME 4NNYA 4WWKB 5AAWC 4Z7WF 3VXMB 2VDML 3FUNA 4HJJL 2BC4A 4E2OA 4HIHB 1FVDA 1AR2A 2VDLL 3RGVC 3T8VA 2TSBA 3UJTH 1EBPA 1LO4H 3T0EB 3WXVH 3HR5B 4HJSA 5ESAA 3D3VD 3L54A 2B4CH 4YK4B 1WZMA 3ZHDA 1OWRM 2BVTA 3VI3B 5JHDA 1DUZB 3NZHL 4M7KH 4LVEA 2YR3A 3GZQA 2BMKA 2F5BH 2KI6A 3WHE1 3OGCB 3U9PH 2WLZA 5AG9A 4RQQA 2BW4A 1U8QA 4QRPA 1M2VA 1ZLDA 3TP4A 4KJWC 4E9TA 2IGFL 4M1CC 4MCZA 1QFPA 1XF4A 4YSTA 3PQYE 4JDZB 1XGTA 2O72A 5E4EB 5DHEA 5G4OA 2DQIL 1HC1A 3FTYA 3KLLA 1EERB 4ABQA 3RJOA 3DHJA 1F90H 1TQSA 4UILH 3IDMB 3FUJA 4A7GF 4WUUA 1TYJA 2AV1B 5GRYA 5L7XH 1IC4L 3EJPA 3T2LA 1JFHA 2ODIA 4PW3A 1T7ZA 3C5XA 1A3RL 1VKXA 3NRFA 1FYTE 5HHOB 1X7QA 2EIJB 4MAUH 1IGJB 3B5TA 4Q6IC 4XCNA 3G6DH 4R84A 3NIGE 4RISL 2OMXB 4XMKL 3V0WH 2Z93B 1FYHB 2JELL 1IBGL 1ZE3C 2EVFA 2JJSA 3RI5F 1J9CT 5DJ8A 4GO9A 1JGDA 3HLKA 4IOFC 2DJMA 1KLUA 2VXSL 3KPOB 2QQQA 4ZMNA 5AW3B 3BD5A 1OOWA 3IRZA 4F7MA 5TJWK 5KSBB 4KTGA 4WFFD 4UBDC 5CILH 3TT3L 5LGJA 3PV6A 3T71A 4G6AC 4WJ5B 3Q48A 5E95B 4XPAH 5SWSB 3RP1A 4PG2A 3AY2A 3SDAB 5FV2A 4YZWA 1P6AB 3QUYD 2QVTA 3P3SA 4IBSA 4PLKD 3QYMA 4DP6X 4FNLH 2FJUB 3EJTA 5D70H 4GSDH 5HHVL 4HGKC 5HPMA 2F1EA 4IIQB 3FT1A 3A23A 2YARA 5C09B 4PS8A 4DESA 5FOBB 1G7PB 3QDAA 5B7FA 1WITA 3O4LE 1JPTH 2KZKA 3BSHA 3UIYA 2O5ZL 1W15A 2ICEC 1NCNA 1WWCA 4I5BB 3PGFL 4YMPA 2F53A 3BW9A 3NCWA 3NQIA 2XVGA 3OAYK 3FPYA 5JHLL 4O02L 1EXUA 3FSWA 5GS1A 4TTDC 4GP5B 1BBJA 4LKXB 4OV6F 4FCAA 1NCUA 2XACC 4I9WE 1QR4A 4E9VA 3K72B 3MX0A 4NKMA 3O8XB 1CVSC 1EK3A 2FIRT 4PSRA 5L4IA 4HKJB 1CLZH 1L9OA 2EYSA 1ILUA 3FQRA 4PJ5E 3SD5A 3T3MB 2WP3O 2BVPB 4B0MM 1WH0A 4IGBC 3V5KA 4HLZH 4AQ1B 2Y6SC 1LE9B 1EZSA 3HZMA 4Q9QL 5AW1B 5JXAL 2YAFA 5TDNA 4NC0B 1YVLA 1DQJB 3X3GH 3C60D 1IQWL 4DQAA 3JWNC 4D8PB 4JJ5B 1AKJD 4J3OD 3OZ9L 1JNNL 4V33A 4YGVB 1JRHI 4ODTH 3NGBB 4PRHA 2CH8A 1OSZB 2UYLA 2VAAA 1I1AB 2CALA 3FB6A 4ETQA 4PJHE 3MJGX 3V6OC 3D08A 5C86A 2AJUL 2D2OA 4XN4A 3UTPD 4C54A 2VLKD 1QSFB 1J05B 4KJQD 5LXGL 3RZCA 4DP9X 3BWUF 1NBZA 1YMHB 2Q8BH 1MIMH 1RJLB 4JFDA 4AEIL 2HMID 1CGTA 3VCLB 1BAGA 2DEWX 4KROC 5FA3B 5GGSY 1K8DA 4UB0H 3IGFA 5IGXH 1RJYA 5IREA 1G6RH 2W65B 3O6FC 2VN7A 2X4UB 3HB3D 4Z7VF 2ERJB 5E6IB 3EYOB 4G7QB 4GW5A 4XNXH 4X6DE 5GS2D 1BBDH 5CNHA 3NJVA 4K0OA 3VD1A 5I71C 5FO8B 1E40A 3GBNH 4Y88A 3WO4C 3HE6D 5IKCA 2ADGA 1KLFA 4NHCH 4GRLA 2DQEH 4MHHI 3PPSA 2SEBB 3L5HA 3LRKA 3H9SE 4AV4A 2F19L 3N6YA 4HC1A 1ODAA 4KRPC 4EQ3A 5GS0C 1SVBA 5C0ND 1NMBL 2BSED 2R0KH 1ASOA 3QDGE 2AK4B 2H1PH 4HS8H 3E6HA 1GAFH 3HPLB 4L4VB 4OGAC 5EOTB 5KYXB 3OPZL 1A1NA 1F4AA 2F58L 3P4OB 5G5DB 4G9FD 4OVVA 2DIBA 2VDPB 1XMEB 3PG2A 1AHWA 1WK0A 2V5YA 5IY5B 1HZHL 1I1CA 4U1KA 3STLA 1F3RB 3HRZB 3HAEB 5IP4A 2MNWA 4IMKC 3N50A 4ZG1A 2BNUB 4N25A 1JXFA 1BJMA 4TNFA 2VXVL 3GK8L 5KS9F 5LGHH 3DETC 1JGVL 1CGVA 4JO4L 4HJ0C 3BUQA 2IADA 3ATEA 4PJ7A 4K8RL 3HG0A 1JXGA 1TQTA 5F93C 5FDYA 3ZDZE 1AS7A 2IG2L 4L8SA 5KS9A 4YDIH 4J3TA 3QH3B 3PL6D 2NY7H 1SLXA 3Q06A 1LE5A 3FQYA 3RB5A 2B1OA 4Y4FA 1J87A 3TNNA 1MJ8L 4CC4A 1KTCA 5C08A 3AM8A 2VR8A 1RK1A 1H6EA 1IILE 2GAZA 3GMNA 4AUUA 3QB7C 1HINL 5D93C 4J2QA 5EIQA 1IBFA 1CIDA 2CNZA 4XRCA 3QIWB 2YRLA 3DC0A 1DN2A 4F7PB 2MCPH 3QDJD 5DUMH 4DEPC 3GC3A 3QORA 1JWUB 3S35H 1HQ4B 1Y07A 4ZUSA 1ZHLA 4ISVB 1BQHB 4H8HA 5HP5A 3OXRB 2BP0B 4UYPA 5EBWB 3RGVD 2E8ZA 5AB2A 3JYCA 1CZ8H 4WFED 4EI5C 1EPFA 4MMZA 4JQVA 3NMEA 1ZEAL 3PFQA 4FQXA 2LQRA 3MR9A 4DVBB 1Z5HA 4DF9A 1CFMA 3AU0A 2YGVA 1P5VA 5ACLA 3LNFA 3HZKB 4MMXC 3WTUA 1S7SA 3F7LA 4BQ6A 2IDQA 3G6JA 1PFOA 1J88A 3CFDA 2XZAH 3IAQA 3K2MC 4F7CB 1TG8A 1M7DB 1CFBA 1D5RA 1MKFA 1Y6KR 5AW0B 2BCKA 2HX9A 1TQWA 1QABA 4JRXE 4ZXBB 1QTSA 4NUJB 4M1CD 1Y1UA 2YOAA 5AVTB 1I7ZB 4LFHG 2A9NH 1PX3A 2FEEL 2NX5D 1U8CB 2CKBH 2XG4B 5IZ7A 2Q86B 3IS1X 2E76C 2IV8A 1JHKL 3X12A 1WICA 5EB9A 4KFMA 1FG9C 3WTWA 3HUJE 3W38A 5FLVA 3UAJD 5ID0A 5KSVB 3PDOB 2K6YA 4NAMA 5HGHA 4KK8C 3QCVH 3P02A 5AVSB 3WJLC 1PDKA 1Q9KB 3CHRA 3PU7A 3MA7A 4MDIA 4Z0XA 4F8QA 1L6XA 5J12C 5GIRB 4B5ZA 2WWKT 5EMYA 2VQUA 4CGTA 3KS0H 5EZLB 5IM7B 5D7KE 1HIMH 1AO7A 1DUYA 4JVWA 4AMKH 3EFOB 2NY0C 1T5XB 3DUSB 5C0DB 3R1GH 4WGVB 3L1GA 3KCPA 4IOFD 2VO8A 3EDDA 2Q7YB 2HFFA 1T1XA 2FDBP 4P2OA 4XPFH 2VDMH 2F8XC 5DHXB 3HZYB 4A66A 5DEZA 1DE4B 1M9SA 4JGMA 3TJEL 1P5UB 3VDBA 2I5YL 1PZ5A 4XNYL 2WBJB 4Z5RB 5JUEL 3VYPA 2BP8A 3ZE1E 4NJ9H 4NKIL 1BX2A 3QAZB 3EFFB 1OXYA 3NZHH 1RUMH 4ODXB 3WTYA 4WY7H 1V3JA 4JE0A 1S7TA 5TF0A 2OCJA 2ALWA 3IJYA 3ESNA 3LH2H 4QRTA 3X13A 4NN6B 5AB1A 1ID2A 3LIZL 2B5IB 4K8RC 3MRKA 1CFSB 1GL4B 4RNRB 4D3CL 3HS8A 1JZ6A 1IGTB 1MI5B 4BE5A 3F3HA 4ICXA 4DPCX 3LPGA 2HH0L 5IJKC 4MXQD 4MNGA 4Y9BA 3BP6A 3H9YA 4RZKA 1D5BB 4X4MA 1X4XA 1FH5L 3HI1A 4IDJH 3V0EA 2WUCL 5A40E 1FVEB 3LRLA 4XX1G 1CL7L 4Z78B 1OV8A 2QTVA 2L4OA 1ES0A 3L5XL 3D0LB 5J4MA 1KLGA 4B9FA 4EQ2A 4Y5YA 1XH3A 3ABZA 3KPSE 3ABLB 2G3ZA 1S7XA 1ZVSB 4ELKB 2WANA 4NN5B 4ZMZA 2VLRB 5DJYB 1CD1B 1N5YL 3NYKA 4AEHH 5LNEA 1TSRA 3BGFC 4OFYD 5DQJA 2DPKA 3CPLB 1RUAL 2JELH 2DL9A 1KYAA 1GGBL 5A2CA 2Y6SD 5H94B 3BHBA 4AK2A 4QTIL 1BZQK 2FGZA 4MASA 1W2KT 3VQ1C 2D7TL 3ETTA 4LNVA 4QXWA 1X7SA 4ZX6A 2FHBA 2PYED 5AOLA 4LLUA 2VXQA 3JUYA 3TT3H 3GXMA 1I8KA 1FG2B 2JFCA 5B3JE 3N3EA 2UZIL 4BFRA 3H4FA 2H6PA 1QMUA 5JOEA 1L5GA 4YFLI 3QS2A 4YDVA 3H55A 3NN8B 4JZNA 4A55A 1WAAE 2H32H 4RIRA 4TUUA 2GT9B 2XX0A 4Y2NA 4M62H 1HL5A 4KROD 4WHYG 2D03L 5KJRL 1AH1A 1JOIA 2IOIA 4OIBA 3BKCL 2C8NA 2Q0ZX 4H8PA 4R5TA 1IE4A 2O5ZH 2BJML 2Z35B 2I26N 2CA4A 2FIKB 3KPRA 4Z95L 3PGFH 1JRHH 1UYWH 3WMSA 4TNVK 4E9SA 3NJLA 1GKOA 4O02H 3GXFA 5J7CC 5IVNA 7FABL 4LHUB 1X9RA 3PXHA 5I18L 3FQUA 2DRUA 5IMMA 4KRPD 3KJ4C 5GS0D 1EJOL 1DP0A 4Z7WB 5IW6B 5JHDB 3MO1A 3BEVA 3L3OA 1YN7A 4I3GA 4M8UA 4XP9H 3X17A 5AFAA 1CURA 1EEUA 4YSCA 2QSQA 5FYKL 4NFBA 2ADFH 2BMKB 4OGAD 1D6VL 3UFIA 2WPGA 2ZOWA 3ESPA 4JFEE 2JJVA 3C5ZC 5HHPB 3NT0A 4CBPA 2VIRB 3MLRH 4DKTA 1M2VB 3O2WH 4GY4A 1MPAH 4MCZB 2JXMB 4E41E 1EWHA 1RZGB 1XGTB 2D9QB 1XIWC 5EU7C 1QRND 3NA9L 1X3DA 1CGSH 5FEBA 1DJIA 5I73B 1JIBA 1DVFC 4MJ6B 1Y1DA 3W37A 3DETD 3E2HC 3E9TA 3OZ9H 1IEHA 4RGNB 4HJ0D 3A4EA 4WUUB 3JYBA 4OFVA 3DBSA 3K5RA 4XOAA 1R46A 3O0RH 2UV3A 4PRNB 2B0SL 1B6DA 1LDPL 1JXJA 5FHBH 5CAYB 2XA8L 3VFVB 4ES8A 3U6XA 3O6KH 4NQSB 2DLIA 4FZEL 1TQVA 4X8CA 5KVGL 1WQVT 3DRQB 5AKVA 4H1LG 3ZUCA 3CLWA 3TESA 1O7DC 1J5OH 4NO3B 3VRIB 2IANB 3VAEA 1JGDB 2R51A 2X2YA 3K4AA 1WFTA 2ZCKL 4ZFZA 3BGMB 4ZS6C 4KHX