3SBWA

Crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKLKIEESPGAELVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Programmed cell death protein 1
publication title Crystal structure of the complex between the extracellular domains of mouse PD-1 mutant and human PD-L1
rcsb
source organism Mus musculus
total genus 25
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sbwA00
3G6JE 5L8KB 2IEPA 1MHPH 3LKRA 5FYLD 4XBEL 1KELH 3SDCD 1GOGA 1IGIL 3MGTB 1F6AB 3VA2C 4PRIB 3MLWL 1MCEA 4PTUA 2AABL 4JPVL 2AXGA 2ZNWA 3IKCA 4JFHE 3VWJC 2CMRL 2QEJA 4MJIB 4Z7WF 1YJDL 3VXRA 1ZLUH 1RZ7L 2DBLL 4X7TA 2ZUVA 3V4VH 3CK0H 3OPZL 5DQJA 4RBPH 3GJFH 1BPVA 1OAXL 4LEOA 1XIWD 4U1MA 4LSRL 1RJYA 3CSPA 4G3YL 4JPIB 4YUEL 2A83B 2KH2B 1KYOK 3P11H 5CP3A 1ZHBB 1U8PB 3V6BR 3KS0H 1R3HB 4HFWA 4DQOL 2G9HB 3QEHB 1T0NA 3IVKA 5I0ZA 5JW4N 5IMKB 5E95B 1NLDL 3ARYA 4Y2DC 2BNRD 1BVZA 1EHAA 4PJFE 2I5YH 4XVSL 1FV1A 5GSVB 1TVBA 2LABA 5IEKA 5L88L 4X6BA 1BD2E 1R5IB 3BP6A 4HUUA 4O9HH 2BC4A 4OKVA 4IRJB 4F7TB 1YMHA 2V5SA 15C8L 4YHLL 4ZXBD 1JGUL 4Q9RL 3T2OA 1F11B 1AD0A 5DD5L 5EU6A 1N26A 3JWDH 3ZYZA 3FT4B 3HUJA 5I18L 1GRWA 3V5DB 3B9KB 2YSSA 5MP6H 3RY6A 1WSST 2APXA 2PTTB 4G7YH 3D3VD 2PO6D 2XPGA 4JRXA 4U33A 3DRQA 1S9WB 4LNVA 2EKSB 5SX5K 5MI0B 4CAGA 3L5HA 4JANB 4JG1L 1AHWA 4LP5A 5JUEL 4Y4KD 4WEBH 3QJFA 5L7XL 3UZQA 2F53D 3AROA 2BZDA 4KVCH 5DGQA 2ZUUA 3H42L 4P46D 4CN6A 4GXVH 4P2CG 3HZMB 3SKMA 4F7PA 3GSWA 5IV2B 3VFRA 3WXVL 3AAZB 1CU4L 1XF1A 2E7LC 1ZANL 2Z35A 4JAMA 5D7LD 4HT1L 5DO2D 3MV8B 3ZT5A 2Q7YB 1CYGA 3U7AA 5IMLB 3NTCH 4YIQB 1KEMH 1Q0YL 5IIEB 4GG6E 1LK2A 5D1QB 5DVMA 4M4RA 4HUXA 2X4RA 4PY7B 1ZLWH 3EJZD 3O3DA 2ZKHH 4EIZC 4PJDA 4YQXL 3HI6H 4OF6A 3C09B 1KSRA 4WI5A 1LGVA 4M6MH 4PGEA 5F1IB 1JUFB 3RTQC 1MCOH 1G7LA 2IADB 3L5JA 1JI2A 3OKLA 2VDLH 1KG0B 4OLYL 3D25B 1XT5A 3RDTC 5HHME 5HI3C 2DLFL 4XP1H 1AGCA 3RNKA 5F6HI 1L9MA 2YPLA 3BKJH 1P7QD 4HWUA 4LPXA 3OWEA 3MV9A 5CINL 2C3VB 3KDMA 3QIUC 3MCLL 3M1BA 1VFUA 3C6LC 4LIQL 4GRMA 2VN4A 1AFVH 3FAXA 5GRJL 3AU1A 1ORQB 3SQOL 1T04B 3I9GL 2VOTA 4J1UB 4OV6F 4KV5F 3DXAE 1PZ5B 3O45A 2AK1H 1MEXL 5EB9A 1FQ9C 3SKJL 1QR1B 3QQ9C 4AIXA 2VE6B 3IETA 5CJQL 4Z7VE 4Z7WE 3OX8B 1OGAE 3L7FB 3O4LB 4LLAA 4RMVA 4UIMA 5JO5B 1WZ1H 3TPKA 2ZCLL 2DOCA 3VI3F 3HR6A 3R0MA 2QBWA 3TYFA 5I8KH 1Y6NR 1P4LB 4C55A 2IQ9H 2BY0A 4W6WB 2EECA 4NQEB 4UNTA 1CDCA 1D3CA 2K3TA 3Q5OA 4KKAD 1WC7A 1F2XK 1YY9C 5IGXL 2C3GA 1Z5LB 1P5UA 4LLQA 4ZUVA 3WLBA 4LHUA 3BE1H 3CU7A 5J6GB 1Y0LA 4G5ZL 5DEFB 1WICA 4HIIA 3KR3L 4TUKL 3V5KA 4CN1A 4WWKD 4JZJB 3MRJB 1EXUA 3MRPA 2EYTB 5F9WC 4TNWF 2RHEA 3EO9H 3QIBD 4KJYB 4LBEA 2X70B 1S7VB 4HEPG 4KQ3L 5TE7L 4M7KH 1YN7B 3B5HA 1NC4D 2HT4C 3LV3A 4JKWA 1J0KA 2UV3A 1YDPA 1JF5A 4ZTOH 4X99B 3EJYC 3RVXC 2J5LB 4I77L 4XCNA 3C9NA 4ODHL 5C0AE 2AEQL 5CBAB 2OTWA 1JFQL 1L6XA 2ZOKB 1OT1A 4W6YB 3RU8L 3F8UB 1E27A 2BNUB 5ESAB 3T3ME 4ERSH 3MRKA 3VRLE 1OAYL 3I02A 1MFAL 1WT5C 5CUSH 4OQ1A 3PGDA 3VFOB 1ERNA 3IJYB 1Q0XL 1UH3A 5T5NF 4FNLL 5IVZA 3B8SA 4TPRH 2VC2L 1LO5A 5F96L 1A6ZB 4DN4H 4CGTA 3LKSB 3TH4T 4Z7UA 1EMTH 4P3DB 3DX7A 5IESH 1HILB 3D69B 3VCLB 1IGTA 1BZQK 3HPLA 1OWWA 3TBSA 3W11C 1GGUA 1YNLH 5F9OH 1RZGA 1NGZB 4G8GB 2YR3A 3MYJB 4APQA 4WRLA 1I1FB 4D8PA 1ZS8A 3ZDYF 1AIFB 1UB5B 1TJIL 1PW3A 4OCYL 3K80A 1RIHH 3GJFA 4JEGB 3V0AC 2V2XA 1BREA 2VLKA 1I9IL 2KDGA 1C08A 2UYLA 3LS4H 5EULV 4R90H 3ZKNC 3BRFA 5C2UB 2IAMA 2DQEL 5E70A 4C4KT 3RU8H 3MRBA 5GZND 3FQUA 2WQRA 4G6AD 4QOKD 3SQBA 3U4BH 1MCJA 2BVTA 4YHMH 3KPLA 3O3UN 3TESA 1G7IB 1IKFH 4XNZC 5FYKL 1A7NL 1CDUA 1FYHB 4IS6B 4GAJL 1IAOA 5HXMA 5FYJD 3OAUH 2VIRB 2DL9A 4XAWH 2JK5B 2EC9U 1RZFH 2BP3A 1I7TB 3EW3B 4GBXB 2JIXD 2AV7A 2NY0D 5SWSD 5C0FA 2V5TA 3FL7A 5GGTH 4LSVL 4XWGH 4HUWA 1NGQH 5F96H 2G2RA 4P23D 1JHLL 3MRMB 3PWUA 4BELD 2YWZA 5HYQA 4K7PY 2CIKB 4EUPG 2XWTB 2BXYA 3DUUA 1A7PH 3BEVA 4FFWD 1FNGB 4P59L 5ALCL 3JXAA 1R3LA 3QSKB 2XY1A 3F7PC 5FO7A 4PRNA 4KV5E 1W0VB 5ILTH 2JE8A 4ONHB 5MEPB 4GRLD 4JQIL 5F93C 2AV1B 4CVWA 1UKQA 3QG6B 1I8MA 5GHWL 4Q97A 2Z93A 4HIEB 5ISZB 3ZMRA 3DURB 1IFHH 1HOCB 1CF8L 2R1WA 4IM8A 5CEYB 1EFXD 5C6PB 3MNWB 3L9RA 2NNAA 3VI3E 2VXUH 2QSVA 1TXKA 4FQXA 5I1KH 4LQFL 3NIGE 4N0FA 4OLZH 1FYTE 1NAKH 3ULVF 2ESVA 4NC1E 4PRBA 3SY0B 4DUWA 3QUZC 1BJ8A 3MLTA 1P9MC 3OKMA 1IGJA 3WJJC 3SGKC 4CMMB 3RPIA 5DVLA 1QLEL 3WHXB 3OJMB 4HWBH 1PKQE 4HX1A 5I30H 4MD4A 4P3WA 2H2SD 1J86A 2ICWI 5EUOE 5H8DA 3RWIB 32C2A 3SOBL 4C56A 4RWYH 4NHUA 4MA1C 4Y4HC 5JXAL 4NPYA 5F3HB 5HPMA 1HEZB 2YXMA 3QEQB 2GK0A 5EUKB 1F3JA 3TO4B 3GSQA 3A6BL 2EE9A 4PJBA 4GKNA 3WIFB 1MLCB 1WTLA 5JW5B 2BCKB 4FQCH 4B7LA 4GUPB 2PYFB 4ZS7L 1WBZA 4PY8I 4CJ1A 1BLNB 1MCBA 3PHSA 4N5UA 4WHYG 1NMAH 2J2ZA 4OLEA 2F5BH 2IGFH 1L6ZA 3TBTA 2WBJB 4PLKD 4WFGD 1T21A 3BEWB 3FOLB 4JO3H 4M7JH 3V4UL 4OGYL 5I8OL 5GISL 3Q6GL 3DO7A 1BFVH 3GI8H 1YNTB 2C5DC 4WHYH 3O9WD 1J8KA 3D18A 1CD9B 2P5EA 5DQDH 4D9QE 5KSBF 4TSCH 3UO1L 5AYUH 1SQ2N 4OSUH 4PLJD 4QRRB 4WHCA 4F33B 3OR7B 4YPJA 2H45A 3E2HC 4WFFD 4OZIF 3ZDYE 5DJZA 4PR5B 4QHNA 5DRXA 1BF2A 4OJFL 3MLXH 1OSZB 3GSVB 5IW6B 2HRPL 1YEJL 4HC1L 4X7CC 5HYEA 1ZVSA 1WQVT 1D9KB 1DQTA 3QQNA 1KC5H 5F6HJ 1CGYA 4NQXA 2LU3A 3QXAA 3IXAA 2P8PA 2HA1A 4OCRH 4YDIH 3TEUA 4WTWA 4ZQKA 4FQ1L 4QLRA 5CHNA 5DJ6A 1A9BA 4RX4D 1AKJD 4GRWB 1ZSDA 2V5MA 3LH2L 5FO9B 1S8DB 5AYQA 2GHWB 2D2OA 4U7MA 4YXKH 3RWCA 1ORSB 1QBAA 2BXZA 5E8PA 4JDZB 3CUPA 1KLGA 3VFTA 1S7UA 4JFDE 1P7KB 1XGRB 5A3ID 1LILA 1TQCC 4HWNA 4KZDL 2XN9A 3IF1A 3U6RB 1F90L 1R24A 2PYEE 3C60C 4I3SH 1WFNA 2Y5TB 4JN2A 1OP3K 4RGOL 4QXUL 4ZYKB 1WBYA 3WNLA 3HI1B 1YZZA 3U9UB 1RVFH 1CLOH 2EYRB 3MLYH 4WENB 3S36H 5CLTA 2FB4H 3L6FA 3T1FA 2WSKA 3D85B 3L3JA 2ATKB 3HLAB 3TZVB 1PQZA 2OQJA 5D93C 1FL3B 3VXSB 2AJVL 2X05A 3EZJB 3PWPD 1JYWA 1NDGB 2H2PC 2N7AA 4MS8D 5CBEB 3BWAA 3I2CH 2W9EL 4K8RL 2VLJB 3ARGA 5E2WH 1EO8L 3DECA 1YMMA 2HVJA 2DI8A 4NHCH 2IQAB 2NY2C 5K93A 1B9ZA 3IFOA 1S5IL 4YK4C 4U0RC 4IOSD 1OTSD 1ZHLA 5LG1A 2QQLL 5HPOA 3ROOB 1K6QL 3QO0A 1N6UA 2PW1B 1HYRC 2ZUXA 3O0RL 3MRGB 1ADQH 1LDSA 4TUJA 3PHQA 5FOBB 2HP4A 3NZ8A 3LRSB 2PR4L 3EYOB 4PTTB 4FXGB 2GAZB 5F8RC 4P2OB 3MJ7B 1BQUA 3C08L 1QLFB 3MUY1 4QTIH 2CKBH 5C08D 4QRUB 1NCBL 1DBML 5IUSA 4ZFFA 3UJTL 3KPOA 4Q58C 3WFCL 5GRUH 5FGBA 1RUAL 4XPBH 1G7HA 4JHWH 4PRHE 2VAJA 1YQ2A 3GJEA 1RU9L 1A5FL 1M7IA 4FRWA 5EZIL 1REIA 5E5RB 4AT6B 4OGXH 4OZHF 4PP1C 4L9LA 1KCLA 4UQ2A 4WY7H 1AJ7L 1ODAA 1QRNA 4JB9H 3EFDH 5GGTA 1XZ0A 1OTUC 3BFOA 4G9FA 4NKIL 1WLHA 2IPUG 4HWEH 3A6CL 1IGFH 4F7EB 4OLXH 5EBMB 4WFHD 3SKUD 3CFDB 1A6WL 4OI9A 5SWQB 1OLZA 1AO7E 1R0AH 2ARJQ 1S5IH 5D7JA 3R4DA 5C9JA 3JWOL 5CEXB 3RVVD 1UZ6E 1I1AD 1A3LL 2XWBA 1WFOA 1OWRM 3L5XH 3CFCL 3ARBA 3AREB 2Q86B 4YBLC 4HIXH 4EUPA 5KSBE 1UA6H 1BZ7B 3KJ4C 3TIEA 1BIIA 5HHOB 4X7DC 5SWZA 4PRAB 5FO8B 4NZDA 1T2QH 3VFSB 1Q9OA 4OZIE 5EO0B 2C1OA 2OMNA 2YC1A 3BAEH 3LZFH 3FAWA 3CMOL 2PNDA 3W82A 1RU9H 4OM0L 5A2LH 4JPWH 1DQJA 3G9VA 3DX9B 3EOAB 1XR9B 1IGML 3PQYE 2A9ML 3HRPA 3JV4A 4YDKL 2CDGB 3SDDA 3VFWA 3CPLA 4U3XA 1X5YA 3AFLA 5ACZA 2NX5D 4UILH 4ODBD 5DRNB 2J4WL 1EBPA 3A6CH 4BZ1L 2GITA 2GI7A 1JWSB 4HWBA 4NRZB 4LDEB 5FKPB 3TT3H 1NKRA 1A6WH 1FZMA 3ZHKA 4JFFA 3VXPA 3HNTL 35C8H 3WS6C 3JWOH 1G6RB 3MGTA 4X9BA 4AL8L 1F6AA 3QEGH 4MQXD 4PRIA 4KMLB 3CX5K 1WFUA 1FIEA 2C3XA 5F89B 2YD6A 1N0XH 4MJIA 4M7ZB 5I1JH 4F58H 3RDTB 5E5MB 1T4KB 3IS1X 2HJFB 1LQSR 1VACB 3G04A 4IDJH 5AAWA 3KYNB 4HPYH 4K94C 4JPIA 2A83A 1ZHBA 1PY9A 5D8JH 4M9OA 1OD9A 1U8PA 3K0WA 4LPWA 1A47A 4CADB 3V9FA 4XHJD 1R3HA 4HUMB 2G9HA 3QEHA 4YHNB 4DUXA 2ICWJ 5IMKA 4X6DE 1FG9C 2F54E 1LEIB 4I4WB 1VA9A 1KYOJ 4JRYB 4HJ0C 1FAIH 5GSVA 3WIHH 4JFPB 4XNUH 5KVEH 2DM2A 5T1MB 2VXVH 3NMEA 3TFKD 5H94B 1V3LA 3WSQH 1NFDA 2E7BA 1R5IA 3VMPA 1F58L 3MQIA 5H37G 1BVKB 5E08H 4UV4H 4IRJA 4F7TA 4KTYA 2IF7A 2W38A 1F11A 1VESA 4MD0B 1YYLL 5I1HL 4PY8J 4ZAKC 1FG2B 3FT4A 4YO0B 3ALXA 3C5ZD 4DK3A 3V5DA 3B9KA 3IU3B 2IH1B 2W0LA 2PTTA 5CGYC 3AS2A 3NAAH 2UUDH 5CGMA 1QFPA 1S9WA 1QFHA 2EKSA 1RJZB 3UTSB 1IM9B 3GDBA 2CO7B 1AQKH 3QCTL 4JANA 2APFA 2W60B 1M7DB 3CFIC 1QBMH 5DHXB 1YEEL 1CXKA 1KNOB 3EBAA 1BAFL 1QBLL 1TZGH 3B2UD 3HZMA 2UVEA 4B53A 1JNNH 5IV2A 1FDLH 2XWJB 1VPOH 2OJZH 2D7TH 3AAZA 5INCB 3S35L 4FOMA 4QGTA 3EJJX 2B2XL 3WLWD 4HXAL 4KHTL 3CDCA 3MV8A 2Q7YA 5INDB 1DN0B 2DI7A 4HC1A 5GS3A 1WVZA 4YIQA 3CDYA 5IIEA 2YPVH 5D1QA 1D5MB 4PY7A 2AERT 1IKNC 2DMCA 4F8QA 1A6VH 3RKDD 4PJ8C 2VDQH 3U36B 5F1IA 1JUFA 1RZJC 1CIDA 2IADA 2NMSA 4KJPC 4TVPL 2RAMA 4O4YL 1KG0A 3D25A 4JM2B 4PJAF 3W5MA 1RUPH 4OZHB 2HKFL 3BDBA 2FEDC 2IBZX 2C3VA 3P0VL 43C9B 3OKNB 4DKFH 4J4PC 1H3PL 4TTGA 5ID0B 4F15C 4N90E 3THML 3OKKB 1ORQA 3RUGE 2I9TB 1T04A 2AP2A 4J1UA 3LDBB 3AY4A 2A73B 1EHLL 4UB0H 1VFBB 1PZ5A 2XTLA 4ELMB 2A9NL 2BSSB 1QR1A 3L1OH 2VE6A 4LRIA 4DOHB 4EOWL 1UYWL 3OX8A 1MVUB 1XCTB 4XPAL 3L7FA 2NY4C 2OR8A 3O4LA 5JO5A 1WITA 1KIUA 2ZWLT 3K2UH 5DHVA 5DVOA 2FX8L 4RFEB 2VH5H 5KVFH 1P4LA 4P2RB 5IFAH 1JMZA 4NQEA 4YR6B 1FPTH 2DS4A 1EEUA 5C0NC 3MUGB 1PYWB 1DVFC 1Z5LA 3BDYL 2I9LB 4KJWC 3ARSA 3QUXD 5IEHB 5A2IH 3GMNB 5J6GA 3PXHA 5DEFA 3WKNA 3WFEL 4MZ3A 4OAWB 2IMMA 2V5RA 3V7AE 5D72L 4JVPA 4JZJA 3MRJA 1ZMYA 5IBTH 5L6YL 2EYTA 1A0QL 1DUYB 3TH3T 5DMIL 5EA0L 4KJYA 5CWSB 1JPGB 3ILQC 3OAYH 2X70A 4F57H 1S7VA 5MEND 1AR2A 1OCWL 4OCXH 2D03L 1YN7A 3DLQR 4R0LC 3WNPA 1IC4L 1FORH 4QKXB 4X99A 4L8BB 5CBAA 4ONFL 5CKAA 1IEBB 3LEYH 3QA3B 4GLRH 4MCZB 4U6HA 2VB5A 2ZOKA 4RMTA 1Q72H 1MQKL 2BNUA 5ESAA 4KJQD 3CXDH 4HJGB 5K9JL 3VGHA 1I1YB 4FFVD 3OXSB 2XT1B 3UJJH 1V7ML 3VFOA 1DLFH 2WNGA 1EZVX 2FZ3A 3IJYA 2AKRB 3AXLB 1UT9A 4EDWL 3QH3B 3O3EB 4YBQD 4YWGH 5BS0D 4U7SA 5IHLB 2YK1L 3V0VB 3QRGL 3QFJD 1A6ZA 3LKSA 4P3DA 3IU4L 3TVMB 5HVHB 3CVHB 4MNHB 1HILA 3D69A 1HH6B 3UTPE 3VCLA 2XI9A 4MDJB 4LHJB 1QPPA 4L3ED 1MI5B 5J13C 1NGZA 1S7XB 1GAFH 1YQVL 2R69L 3MYJA 4G8GA 1I1FA 2IANE 3FO0L 1KF9B 1AIFA 2WUCL 1UB5A 2AJZB 3CLEL 1LK3H 1R6VA 1T7XA 1NUDA 3HE6C 3O6FD 4PJHE 2W9LA 3O6KH 1CXFA 3RIAK 5BJTB 3ZKXB 4OFPA 1NFKA 1DQLH 4MVBD 5DTFB 1G7IA 2YD7A 2FEEL 4IS6A 4EVNB 2VIRA 2J8HA 2JK5A 5TE6L 4OD3H 5KJRL 1I7TA 4N0UB 2DQTL 4EDWH 5M7QA 5IB1B 4GBXA 3IAGC 2FJFB 3ULSB 3KPSB 3VWKD 5KW9L 3BKCL 3MRMA 3GK8H 3B5TA 3IT8D 3MACH 1CICD 4EBQH 4KZEL 3GNML 5AZ2L 2CIKA 4QRPD 4YX2H 2XWTA 2Q20A 5BVPL 2EEAA 1FNGA 2BDNL 3IAQA 2R69H 3C8HA 3SGJC 5K9OB 3ULVH 4KGLA 1G6RL 4BK4A 1V05A 1TCRB 3FB8B 1G0YR 1T1WB 3SDAC 1W0VA 4J2XA 4ONHA 3AVEA 5MEPA 2AV1A 5HYJE 4M1GL 1MJ8H 1Y6KR 4KPHL 4HIEA 5ISZA 2OL3H 4O5LL 3DURA 1HOCA 1QSEE 5CEYA 2OCFD 2R23B 3MNWA 1MFNA 1R3IL 3OJVC 1TQCB 5FCSH 2VXSL 5KJRH 1KJ3L 1JWUB 3SY0A 4W6XB 1U3HD 3KLDA 1QFUL 4FG6C 4EXKA 1CFVH 2AGJL 2K1MA 4CMMA 3EYUH 3WHXA 1RI8A 2VMFA 5FV1L 4PJAB 5FUZL 1Y18B 1KCVL 4RA3A 1U8HB 2BY1A 1P84K 3TA3D 1LDPL 4MB4A 4JFHD 5HI5C 3RWIA 3U83A 5B8CB 3WJLC 1AR1C 1DQDL 5AUMB 5CIPB 3D0VB 1DBBH 3DVGB 3BGFB 5J06A 3GSXB 5F3HA 4Y4FC 2ZCHH 4S1DC 3SKNB 5D1ZC 1HEZA 3QI9D 1NCUA 4WCYL 3QEQA 4D0DB 5EUKA 3TO4A 4LQ1A 3U2SB 1RULH 4K07A 1ZLUK 4FTVE 1MIEL 3GMOB 2KBGA 5DLML 3WIFA 1MLCA 5JW5A 2YS4A 2BCKA 4V1DA 4YK4B 1MLBB 4TQEL 4GUPA 5DD0L 4RBPK 3PP4L 1TZIB 5GGVL 1BLNA 5SX4I 3MV7B 1TFHA 4LHQB 4A2LA 4WEMB 3RX5A 5H35B 4YHZL 3ULUC 2WBJA 3HS0B 2DTSA 5HDOA 3CNKA 2VDKH 4KK8C 1OPGH 3BEWA 3FOLA 4ODWB 5F3BB 4H8WC 5IB2B 2ZSVB 2VDRL 1RIUH 5JXED 5L8LB 1IQWL 1J8HD 1N64H 1BJ1J 1YNTA 3OXRB 5ETUB 5DFTA 4R4BB 3EZ8A 5ITFB 4Z0XB 1NCDH 3VXUD 3FO9B 5J12B 4QRRA 4XWOC 4QY8B 2ADGB 4L4VD 2R8SH 3OR7A 3WN5B 5KN5B 5CILH 4PR5A 3T0ED 1CLYL 3T4AB 1NLBL 4YHYB 1OSZA 5FF6B 3GSVA 5IW6A 2A77L 2E3VA 2A2QT 1YEIH 4FN0A 4OF0A 3ZL4L 1A6UH 5DFVD 1D9KA 3N9GL 4RFOH 4NZRH 2K9UA 1CQYA 4J3WA 1NSNH 4BQ9A 4Y5VC 2GQHA 1MCNA 4Y5XC 3E3QE 1FBIH 2C7UB 5DWUH 4P0DA 5C6TL 2XXCB 3QIWD 5FGCE 5D2LB 5FO9A 1S8DA 3MXVL 1YPZE 4ODSL 3QPQD 1IAIM 1ORSA 4KXZH 4EQ3A 5DJAB 2FWOB 3RJDA 5BZWB 3ABZA 4JDZA 2CO6B 5I15H 1P7KA 1XGRA 5D96C 1IBGH 5I74C 3MOBH 3V7MA 2VLRE 2ZP0T 5KSAC 2Y5TA 4XTRD 2AAVA 3GFUA 4ZYKA 3BD4A 3HI1A 2K7QA 4M1DH 3BN9D 3U9UA 3SKOB 4NFBA 2EYRA 1RUQH 4MJ2A 4P5TD 5HSFA 4P48A 4KFZC 5BRZE 3SDCC 4RQQB 5ID1B 2D31B 3LEVL 5E8OB 4CMHC 3D85A 2J8UB 2ATKA 4NM4L 5FA3B 1BHGA 4OFYD 3HLAA 4MLSA 3SGEI 3TZVA 3JTSB 1ZLWK 4LLWB 1WIUA 1P7HL 1FL3A 5HHMD 3VXSA 4LNRA 3GMMB 5I17B 1NCCH 1UG9A 1NDGA 2Y23A 5EORL 1A7RL 3BZEB 4TRPL 1CXLA 2H3NB 5CBEA 4YDLC 4ZNEA 2VLJA 4XMPL 4WI9A 1N3NB 4S1RH 1VFAA 1XIWC 2IQAA 3S88H 1BOYA 1A2YB 3GHEH 5KANG 3FTGB 5JW4R 4QNPE 4PJEF 4KU1A 1DEEB 2ORBH 5IVXB 3ROOA 4N9OB 1TJGL 2PW1A 1INEH 4TOYH 3MRGA 3EOTL 2XZQH 5GGRY 2CPCA 5FOBA 5E8NB 2IFFL 3LRSA 3EYOA 1T80A 4PTTA 5TE4L 2GAZA 3HE7C 4P2OA 3MJ7A 2Q87A 3IYLW 1QLFA 2X7LB 3LQAL 1C5BL 4X80L 3MXWL 2LFGA 4QRUA 2CUHA 3PJSB 3IFNH 4NQCE 4J3UA 1A9EB 3D2UB 5JPNB 3BISA 3UJIH 4AT6A 1XF2A 4PJXF 1W0YT 4N8PA 3PL6D 4ZXBC 4HJJL 2JB5L 3KYKH 1CFSB 1ND0B 4M61B 4U05A 4KVNL 1TVDA 3RGHA 4F7EA 4HBCH 2EDJA 5EBMA 3S5LB 1DUZB 4UT9H 2VN7A 3CFDA 1HHKB 5SWQA 5EIIB 5C0BE 3RI5F 3U7WL 4WI8A 3D6GA 3R1GH 2PO6C 1IZKA 3HNVL 5DD3L 3K7UA 5CEZE 5CEXA 4F7MB 1YYMH 1JF1B 3ARVA 3CVHL 4ZOAA 3FQRB 2PXYD 3AREA 2Q86A 4B7IA 3FRPG 4BQ6A 4UDUB 4Z7QF 4Y19D 1V7NL 1VGEH 4K3EL 3CZJA 4ONGL 3A6OA 5HHOA 2NY1D 2Y06H 4PRAA 4Z76B 2CXKA 1O7VA 3VFSA 4JO2L 3BMWA 4P46C 5CZVH 5EO0A 3VGBA 3V52H 3UTTE 3ECBB 1N5YL 1QP1A 4I0PD 3MLSH 4MB3A 2MCPH 4MD5B 3DX9A 3EOAA 5F8QC 1XR9A 4JG0L 4JHZA 4ZODA 1BQSA 3A67L 5J1AB 3EUUA 2AK4B 2AQ2A 2CDGA 3WFHB 1JZ5A 4JVWA 4HQQL 5DRNA 2LAAA 1RUMH 2L4OA 4R4FL 1UCBL 1JWSA 3CGTA 4NRZA 4MWFB 3EJZC 5FKPA 3HPJB 4K3DH 4TSBH 2A1WL 4LLUB 2MQCA 2E27H 3B4NA 3MTRA 1KB5B 2VDML 4R7NB 5CJOH 3U1SH 3GSOB 1G6RA 3BVNA 4XP9H 2PTUA 3IJHB 1QFWL 2M1KA 4KGJA 1NANH 2DQCH 5F89A 5J1SC 3STBA 5E99L 5L2KE 5CKGA 5B39B 2WM0A 1GZQB 2YRLA 5E5MA 1T4KA 5MHSD 4UV7L 5T3XE 5DR5L 2HJFA 3QNYB 1VACA 3N50A 4HMDA 3CX5J 1YUHB 3VFUB 3KYNA 5AZEH 1FIGL 5FUCC 3QJHA 4Y0GA 1PG7L 4GAGH 4JJ5A 2EICA 3A67H 2VSDA 1DBJL 5T3ZE 4YHNA 1HNFA 4HQQH 4LSSH 2B5IC 4KRLB 1OARH 2C26A 4FZ8H 5C70A 3RWDB 2MOVA 1CGUA 1LEIA 1EUUA 4I4WA 3A0OA 4JRYA 4E0RB 4N1HB 4JFPA 5T1MA 4PJ9D 4LASH 1EEZB 4LSDA 5H94A 2HTKD 4PJEE 2ITCB 3KYOB 1BVKA 1KIRB 3ULUF 1MUJB 4KKAC 4F9LA 2Z9TA 5F72S 4DGYH 2GTZB 3CC5A 3H9HB 5EIQA 3QPXH 4WWKC 4YXLH 1FG2A 4YO0A 1D6VH 4UV7H 4G6ML 2FD6H 2QTEA 4WW1A 1U93B 3QIBC 2UY7A 3IU3A 4M6OL 2IH1A 2Y07L 5DD1H 1RD6A 3R8QA 4LSQH 2WUBH 3WCYA 3UTSA 1RJZA 1KCRH 1IM9A 1MREL 3U0TB 4PJXE 4XNYL 3LQAC 4YC2C 2W60A 1WCBB 1M7DA 4R0LB 3UYRH 3TBWB 5F97E 1KNOA 1JGVL 4K2UH 4CU6A 4MA7H 1MCLA 1FZOB 3OGCB 4KTEH 1WTGT 5C09E 2F8VA 2XWJA 3SDXB 5B3JE 1F00I 4L8SC 2D0FA 5INCA 6CGTA 1DSFL 4LVNC 1WT5A 2P48B 4P9HH 4JLRB 4XMLH 5EU6D 5INDA 1DN0A 3NFPB 4FFZL 1OF2B 2Z31B 1KTRL 4Z7QE 4NKOA 2P24B 1D5MA 3DV4B 5CIPH 5BOZG 3VXMB 3VD9A 4O58H 4JRXD 4PJCB 2HFFB 4JY5L 4TVPE 2FGZA 2IBGA 3U36A 5GSRB 4PGJA 4H0IA 1E4XH 5JA8B 5J13B 4CUCA 4JM2A 5ICXA 2BNQE 4FXKB 1CE6B 1CFTA 5F1NB 5JW3L 2CUMA 3W5NA 4OZHA 3SE4C 2VUOA 1JTTA 5GZNC 3UCRA 4G6AC 5E6IB 1BOGB 43C9A 4M3KB 3MV11 3OKNA 1T6WA 4W70A 3CXHK 2FX7H 5ID0A 5I71C 4YE4H 2QLVB 1F4HA 5IOPB 5C07E 4UOJA 3U4EA 3OKKA 4RDQG 3IKKA 2I9TA 4KI5D 1SEQL 4NKQB 1KN2L 4Y89A 3NCJL 2NY0C 2A73A 3QAZB 1VFBA 2VR4A 1BWMA 4ELMA 5IWLA 4OIAA 2BSSA 3KPRE 1W72L 4U49A 4P23C 4WUUB 1H3VA 1OSPH 5EU4B 1MVUA 1XCTA 1MRFH 2LAGB 1KB9K 5AG8A 2DJ4A 3BZFB 4FQIL 4TSAL 4FFWC 1S7TB 1T2XA 4ZUWB 4RFEA 5DZOA 1GGCL 4NQUA 4TVSa 1F6FB 1F5WA 4P2RA 5AWNH 4XVUD 3BRDA 3C2AH 4YR6A 2VQUA 3MUGA 1PYWA 2XFXB 4GRLC 2YPLD 2I9LA 3MV9D 1UM6L 4UDTB 5IEHA 3GMNA 2I26N 1BQLL 4OAWA 4WDIB 4JFDD 5CS7A 3PHOB 2B39A 1DUYA 1OAUL 4KQ4H 4XNQB 5GQBA 2PYED 4RMSA 5CWSA 1JPGA 2FLRT 2R2CA 1G9ML 1I4FB 4NUJB 3EO1B 2UWEF 5HYIA 3WFDH 2A0LD 2F5AL 4L8CB 4I2XE 3MRIB 1GPOH 1WGOA 3BGMB 4HS6B 5TDPB 4L8BA 1DL7L 1ZK9A 1DANT 3UAJC 4E5XB 3FRPA 2ZPKH 4F37F 4JM4H 1IEBA 4MB5A 3QA3A 1CVSC 5BZDB 4MCZA 4XP6H 2OP4L 2H2SC 1T7YA 4HJGA 5BXFB 2R1YB 4M5YH 4JKLA 5IFJB 3OXSA 1FFPB 4OGAD 2D4DA 1E6JL 1QVOB 3LKPB 2RFXB 3BX7C 3MLUH 4K3JL 3D39E 2AKRA 3AXLA 4N0YL 4K23L 1DZBA 3QH3A 3P77B 4I5BB 4LHUD 1WV7T 3QUKB 2EEDA 3V0VA 4XX1E 2V2TB 4Y4FB 3UTZB 1WBXB 4UNVA 5D1ZB 1T03L 4WVRA 3HR5B 3TVMA 3CVHA 4MNHA 1U8MB 1HH6A 4R3SB 4MDJA 1MI5A 4IJ3B 2DQHL 1S7XA 5M94B 5C0CE 2AJZA 1UM5L 4PLKC 1CFNB 5EZLB 2D3VA 2N56A 3MJGX 4K94H 3ESVF 3GBNH 1TQBC 1BM3H 2XQBH 5BJTA 5I9QC 4UT6H 4HUNB 5DA4A 4M02A 1JNLL 5IJVB 4LCWB 3N1FC 1MWAL 5DTFA 5KZCB 1X3DA 3MREB 2BOBA 4J23A 4U6VH 4EVNA 1F8TL 3S5LG 5E0QA 3O2VL 1NBZB 3P9WB 4N0UA 4HS8H 5IB1A 1B6UA 2Z0BA 3GB7B 4M5ZL 2FJFA 3D39B 3ULSA 3BHBB 2NQCA 1MAKA 1HI6B 4L9DA 3KPSA 5B4MD 1VB9A 2HWZL 1CTNA 3VFPB 2ADIB 4M62H 4KROD 5ESQB 4CDHA 3ARDB 4WO4D 4Y5VB 4QTHB 1KB5L 5DFWH 5K9OA 1X9QA 5DVKA 1PBYA 2MWCA 4FHBD 3MGAA 4Y5XB 4JFZH 3PP3H 3QIUD 4MAUL 1TCRA 1TCMA 2P5WE 2VLKD 3ZKMD 3FB8A 5D5MF 1T1WA 1TZHB 3WKMH 3TCLB 2VXTH 1LE9B 5DMYA 1E28B 3DUHA 4MYWB 3WFBL 3LIZL 4G6JH 5E2TH 2Z4QB 3SEPA 5A3IC 3BGAA 3IFPB 4AG4H 3BT2L 2R23A 3L3HB 5D7SH 5DJXB 4D3CH 3BKMH 3P4OB 5D96B 2IPTL 2BNRE 5I74B 1JWUA 5KSAB 1NUGA 5K33A 2AXHA 3WUWB 1X5XA 4M5ZH 2WK2A 4EI5B 3BJLA 4Y16C 1GCFA 1U6AH 4LAJH 3JVGA 2VTFA 5IVOA 1IC7H 1X5FA 4PJAA 1Y18A 1U8HA 3ILPB 3MOAL 2EE2A 1MRCL 4KRNA 1F4XL 1YECH 3ORJA 3OV6A 5B39G 5B8CA 2DQDL 3QFDB 4MS8C 4K71C 5AUMA 1XF3A 2HJKB 5CIPA 3D0VA 3DVGA 4H1LB 2EIBA 2JJUA 1E4WH 3GSXA 3BPOB 4LU5H 2UWEE 3SKNA 2JCCE 1P84J 1RZJH 1OTSC 3MSPA 3QCUL 3U2SA 1A6TB 2D4FA 3GMQA 4OCSH 1KIQB 3GMOA 1CL7I 5IROC 4LAQL 3U82B 4HKBB 1MLBA 3SPVB 4FQXD 1ZLSH 2R29H 1TZIA 2C1PB 3T2NH 2BMKB 1D5IL 3MV7A 2DQGH 1TJHL 2MQ3A 1AI1H 4NRXB 3I75B 3R8BB 1I3UA 3HS0A 3FMGH 1QOKA 4ODWA 5F3BA 1BEYH 2AXFB 4POZD 2J6EH 5IB2A 2ZSVA 1WK0A 4ELKB 1MJUH 3OXRA 5ETUA 1HZHL 4R4BA 5D7LE 3LRHA 5ITFA 1JF6A 1I7RB 4C56D 4L3CB 2YXFA 3FO9A 1PSKH 3KS0J 2FGWL 4QY8A 2ADGA 1RFDL 2MQ0A 5KVMC 4ZXBB 3WN5A 5KN5A 1M71B 3RJQB 4OBSA 3T4AA 5TF1H 5FF6A 4HMCA 3W11D 4BKLB 3OF6D 4QRSB 4X6CF 3TC9A 4RGNE 4XH2B 1I1AC 3RVVC 4LSTL 3KYMB 3ESUF 5L0QB 3D3VB 2HN7B 4Y5YB 5IFHL 4DTGH 2R4RH 3ZDXE 6FABH 4RWHA 2XKNB 1JRHH 4XPFL 2C7UA 5EWIL 3NH7H 5T3XH 2UUDK 4Y4KB 5D2LA 5IR1B 3O4OC 1WF5A 4ESKA 2F53B 3KPPB 1TTGA 3EDKA 4MNQB 5DJAA 1TNMA 4PIRF 2FWOA 4P46B 1Y6MR 5FUCE 3X3GL 2VITB 2OJEB 2P5ED 3VD5A 3KLSA 5T3ZH 1RZKC 3RZCB 1I85C 1WIPA 5I75C 3VXTB 1BGXH 1S3KL 5D7LB 5F7NC 1JPFB 1CGSL 4CL7A 2YKLH 1J9CT 2ZUQC 3GEWB 1Z0MA 4LSPL 3SKOA 4WTXA 4AZ8A 1UQSB 5FM5O 2ICEB 2YD2A 2VISB 3ZYJA 3L3GB 1JGLL 4RQQA 2HFTA 5ID1A 2D31A 5E8OA 4LSTH 5D2NC 2AW2A 3VH8B 4X9FA 2J8UA 4MQXC 4ODVL 5FA3A 4GSDL 3JTSA 5IFHH 4LLWA 4Y8AA 1I9RH 2M26A 3GMMA 1P5VA 5I17A 4HCRL 3KXFB 4DEPC 3BZEA 2H3NA 3B2VH 4X9HA 1N3NA 1P7QB 2OK0H 4OZGF 2VRAA 1NGYA 3SE8H 4N90D 1A2YA 2X5PA 3FTGA 4JO4H 4PLNC 2ITDA 1DEEA 3TJHD 5IVXA 5IQ7H 5LCVH 3CFJB 2BRRH 5GS2H 4G8EB 1LHZA 1SM3L 5E8NA 4XHJC 2P8LB 4JN1L 4XP5L 1ED3B 1OAKH 2WLYA 3QWRD 1CGSH 2X7LA 1R3JA 3ARWA 4H26B 3V0WH 5IW1B 1JYXA 3ARUA 5JIHA 3PJSA 5JMOC 5F9AC 1OAQH 3TFKC 2YMXH 3TV3L 3H3PH 3OG4B 4ZSOE 1A9EA 3D2UA 2WIIB 5JPNA 3F58L 5D5MB 4HKXB 2JB6B 4WI3A 1NFIB 2EH7H 1EK3A 1F4AA 3QQ3B 4TNWK 4BZ2L 1CFSA 1ND0A 1VDGA 4M61A 3ARGD 3O8XB 3S3SA 4XPTH 1NCWH 3G5XB 1CZ8H 3RGVD 3S5LA 1DUZA 3VFGH 2B1AL 3C5ZC 1FGVH 4PPTA 1HHKA 5EIIA 1B2WH 1AXTL 4WWKB 1T1ZA 1YC7A 12E8L 4F7MA 2R0KL 4LL9A 2R0ZH 3QIBB 4N8VB 4IRZH 1JF1A 3QULB 2Y1VA 3FQRA 4AIOA 4LSUL 2F9BT 1NC4B 1T89C 5IBUB 2DKMA 2X40A 4UDUA 4D9RD 1MVFA 2ADFL 3OAYK 4XBPB 4P5MB 4YC2B 4Z76A 4QOKE 3WDIA 3B2UC 3ZHLA 3BPCB 5ICYB 3ECBA 4MD5A 3NCBB 3U46B 4HZLB 2J1KA 1QRND 3PNWB 1A3RH 1K8IB 3HRZB 5J1AA 4G9FD 3WLWC 2AK4A 1BBJB 3KPQB 3WFHA 4LGSB 1G7JB 4L8SB 1UH4A 4LVNB 2P47B 2EDEA 2B1HH 1QBBA 4POUB 1QACA 2R0WL 4MWFA 1WWBX 5EOCH 2E9BA 3HPJA 2NTSP 1H3TA 5D7JD 4LLUA 4QHMB 2VAAB 3RKDC 1ZVYA 1NCAH 2EXWD 1GH7A 1KB5A 4NNPL 4R7NA 1EPFA 1V3KA 1ZT7B 4YHOH 3GSOA 3QNZB 1I8KB 3ARBD 3K8KA 4NDMB 1OAZL 5F88B 2HT2D 3IJHA 4LCUB 3QCVL 3HMXH 2AJUH 1KV3A 1JZ6A 4OT1H 1LE5B 5SWZD 3QG7L 5JHDB 3Q6FB 1CFQB 3BO8B 5J3HD 4X4XB 5T33H 3OKOB 5B39A 1NKOA 4Z8FL 1GZQA 3UBXB 1A14L 5FYKD 2CRIA 3TYGH 3KLHD 4ORZC 2P46B 2VLME 3AS0A 3QNYA 3I85A 3DTXB 4B41A 3TGXA 2CR3A 2MNUA 3TCXA 1YUHA 4U1JA 1RSFA 1BZ9B 3ULUH 3RL1B 4BQ8A 3OKYA 3O2WL 4X6CB 3GBLA 4H8WH 4KY1H 1SVCP 2H41A 4P2YA 1YEFH 3HN3A 4LPUA 1J1XL 4KAQH 3NIFE 4Y1AB 5DA0B 2JLLA 3RWDA 1OW0C 2NY0B 5SWSB 4ODXB 2BVQB 3VDAA 1GC1H 4JFFD 1GL4B 2LVEA 4UQ3A 4E0RA 3PXJA 3RA7L 5EG6C 3QO1B 4TYUA 4LPCA 2QSCH 1EEZA 3X17A 4NWUL 4O02H 5IMMB 2ATPB 2ITCA 4JHBA 3KYOA 1I3GH 1KIRA 3OR6B 3HMWL 1MUJA 4YBHA 4G6KH 5I1CL 2IG2L 3I6LD 4OUUB 3AB0C 2EDFA 4HFUH 4H20H 3QUXC 3HC0B 4QHUB 3QQ4B 2GTZA 5HYJD 3H9HA 4UIKH 1A14H 1B88A 1WJ3A 2F58L 1QSED 4FMKA 1J11A 2P45B 1U95B 2RIKA 5J56B 1U93A 3RPKA 5IK3B 4N1EA 2EDKA 1J1PH 1OHQA 1TETL 3U0PB 3I3EA 3K4ZA 2FJHB 3SE3A 3IS0X 4K3GA 2B4CL 3U0TA 5DUBB 3WUWG 1SBSL 2C4FU 5IF0B 1VERA 1WCBA 2CDEB 3WIIH 2DQJL 3DYMA 1ZHKB 3TBWA 1OM3L 3MO1B 4M43L 4DGIL 1KFAH 4M6NH 4XVTL 5KS9B 1FZOA 3OGCA 3I50H 1OTUD 3Q0HA 4NWUH 5CD3B 3SDXA 4IRJD 2AS5M 1MAMH 2FBJL 4H1LG 4WFFE 3MFFB 4OZGB 3TJEH 2E6QA 3EOBB 4GMTH 4YBQC 2NCMA 5FYLH 1AC6A 1BECA 5HI4D 4JLRA 5EC1B 3EDFA 3NFPA 1OF2A 2Z31A 4Z0BH 2DLIA 2P24A 4ALAH 1NC2D 2W92A 3DV4A 4PRPE 4H1LH 3VXMA 4PJCA 4PJGB 2HFFA 5K9KB 2RCSL 1Z0NA 2AJ3B 3C6SB 5GSRA 4XPGL 3CSYB 5I6XC 2BJML 4FXKA 4GW1B 2IH3A 5F1NA 5DI8B 5FOJA 4WI6A 1JZ8A 1JHKL 5LGJB 5E03A 5E6IA 1BOGA 5E8DH 4MVBC 4MQSB 5SV4A 1FH5H 3O9WB 4NZUH 3U79A 1X6LA 5LWYH 2E7CA 5IOPA 4HF5H 5TFSL 2ED8A 4BFIB 2H9GB 5TPWH 2HLFD 2A6KB 3MV8D 5E2VL 3MCKB 4OTXL 2R56L 3VG0L 4G6FB 2NW2B 3MLPA 5D1QD 1KT2B 2BVOB 2FH8A 4KKBD 3VWKC 4WUUA 1F6LL 3CXHJ 3NA9H 5EU4A 1CICC 4GMSH 1GGBH 5GS1B 3BZFA 2JELH 1S7TA 1KOAA 2VZOA 4ZUWA 5EZOL 3KVQA 4HGKC 4D94A 1RQ5A 4RNRB 1N7MH 2R0LH 2OZ4H 3VD4A 3ZE1F 5TDOB 5DSCB 1J0JA 4YXHL 1KB9J 1U8OB 4OB5H 2XFXA 3L3IB 3HG1E 3GGWB 1FNSL 1G0XA 4R97B 4UDTA 3GSNB 4A6YB 2XTJB 4MXWH 2O5XH 1AY1L 4WDIA 2E5EA 3PHOA 1K3ZA 1KPRB 1FAKT 4XNQA 2NY6B 4PRDB 1MFCL 4FZEL 1H5BB 3KPNB 1SY6L 4WHTB 5DT1H 1I4FA 4NUJA 3EO1A 4MAYD 2NY7H 1U3HC 4OTXH 4L8CA 3MRIA 4Y7MA 5TDPA 3BGMA 3GIZL 4HS6A 2BY2A 1QYGH 3ZLQC 4DAGH 5I1DB 3PG2A 4E5XA 2XZZA 1KLUB 2DQUH 3O4LD 1ITCA 3VH8G 2FDBP 5FAAA 5BZDA 3RIFF 4Y88A 4I0KA 4ZPTA 1HXYB 4NZTL 5A16B 3TA3C 5BXFA 2R1YA 4JHAL 5IFJA 2JJVA 4K8RD 4M48L 1FFPA 2YHGA 3TN0B 3K46A 4ZAKD 4NQED 3F62A 4MA8H 2YRZA 1QVOA 1H3GA 1U8NB 3LKPA 2VLLA 3PWPB 1RIVL 2RFXA 4P2QB 1SVZA 3SDYL 2QQKL 3FFCB 3VI4E 3BESR 3WJLA 3QI9C 3MRLB 3P77A 4I5BA 2BVUA 3PGFH 3QUKA 3VJ6B 3GI9L 1XGTB 2V2TA 4Y4FA 3UTZA 1WBXA 5CJ5A 1AE6L 4NCDA 5D1ZA 4RSVA 4S1SL 4X4ME 3HR5A 4AM0A 2DM7A 1NAMH 2HH0H 4R3SA 2CXGA 2Z8SA 5T5FL 2QR0B 2P43B 4NJAL 5HDBF 1PAMA 4HK3N 1X5GA 3L3KB 4DW2L 1QQDB 3GRWL 1I7ZB 5FYKU 4M93C 1U58B 1S9KC 3VW3L 5MERB 1CFNA 5EZLA 1J0IA 3FRUB 3P4LA 4NQCD 5C08B 1KTKE 2AJXL 5HDQH 1G9NL 5JXEC 1Q8MA 3IXTB 2OR9L 3QHZH 1X5JA 3OBAA 5FUOL 4XI5D 3VFMB 2WWKO 4LCWA 5IJVA 3RVWD 3MREA 1U36A 5C7XL 3HFMH 4M3JA 5BV7C 4I3GA 1FGNH 4U1LB 1NBZA 1T6VN 4K7PH 3T0EC 1A7QL 3GO1L 3SDYH 2A6JB 4XRCB 3GB7A 2W0FB 1KN4L 5DFVC 2EC9T 4PJ8D 4FFYL 5DZLA 3S97C 1HI6A 4YLQT 4KHXL 4N8VG 5D2NE 4NP4H 2O61B 2OI9C 4G80B 3BQUB 3VFPA 4B5EA 2ADIA 4G8GD 5ESQA 4CU8A 3WXWL 2J88L 3ARDA 2O5YL 1IEAB 4Y5VA 2X42A 4QTHA 4R8WL 4GLRI 2I24N 4U2YA 4K3HA 3CAFA 3D9AL 4Y5XA 4NYLB 4XNXH 1GYAA 3VW3H 3QPQC 1C5CH 2EXYD 1FO0B 1TZHA 5JDJA 4DN3L 3TCLA 2WLZA 1LE9A 2UZIH 1E28A 4O51B 5BO1L 3UYPA 5F7EH 2Z4QA 3LQZB 2ED9A 4OUOA 3RX7A 3IFPA 1JZ4A 2Q8AH 1LO0H 2VABB 3L3HA 5DZNA 5DJXA 5D7IF 4XTRC 3P4OA 1MNUH 3P3YA 2NX5B 4GBXD 3BN9C 1P69B 4EJ1C 4EXPX 1EA9C 3MGOB 3VFNB 5KSAA 4P5TC 1LO3H 3WUWA 3CU1A 5B3NA 1OOAA 4J6RH 1KCSH 4PBWD 4EI5A 4QRQB 1NBVH 4JFEB 1U8QB 4NGHL 3HC3L 4MXQD 5ERWB 4NO2A 3X3FL 3ILPA 4WI2A 5C0ND 25C8H 4KDWA 4KJWD 2VERN 1UC6A 3QFDA 5GGUB 3UBXG 2HJKA 4WIQA 1HK6A 4H1LA 2NY5L 3N06B 4PGBB 4C58B 4WNQB 1G84A 3DETD 4UTBL 1MFEH 1UXWB 1WAAF 1KULA 5ISZD 3SCMC 1D5XB 2GJ6B 1KIQA 3TT1H 1WUNT 3AUVA 4HKBA 3TIDB 2D7OA 3SPVA 2C1PA 4PJ7B 5KAQF 5DXWA 4L5FL 4J3TA 4NRXA 1FC1A 4YZFE 2VXQL 3I75A 1W8OA 4HW6A 3PE9A 4XCFH 5FYJH 3W9EB 7FABH 3T4YB 2AXFA 3REWB 2ZJSL 4ELKA 4JO1H 1MPAH 3EGSB 3V6OC 1T5XB 3FO2B 1GHFH 1I7RA 4NKDB 4L3CA 4XP4L 2D7MA 4LVOC 4TULL 4ZTPL 2V9RA 4QXGL 4KH2A 5HDBE 5TGBB 5IQ9B 3E8UH 4NJ9L 4ZXBA 1M71A 4XMKH 3QEQD 4LRNH 3G6DL 4YGVA 3TO4D 3KGRA 4UTBH 3Q5YA 1KJ2B 3HAEB 4BKLA 4QRSA 4J3SA 2ZUTA 5HY9B 2VDPL 1UVQB 3C5ZB 4M8VA 1BBDL 4XH2A 3EYSH 3KYMA 4V1DD 3FB6B 2OZ4A 2A74B 4FABL 4F9PC 3NFNB 3D3VA 2HN7A 4Y5YA 3VFVB 2PXYC 3QDGA 1N59B 1QKZL 3NIDF 2XKNA 2V17L 4I8DA 5EC2B 1KBGH 4RGMC 4WW2C 4Z18A 4N8CH 2WBJD 2NY1C 5GJTL 4U1IB 4Y4KA 5IR1A 2OM5A 2FHBA 2F53A 3KPPA 4I0PC 4MNQA 4NRYB 4KMTH 4YHKH 1J05B 3INUH 3Q2CA 4BZYA 2VITA 4XVJH 2OJEA 3RZCA 5EDXA 2E8YA 3AS3A 1J1OH 1MHCB 1JPSH 1QO3B 3GBMH 3E6FB 2DIAA 1JPFA 1B4JL 1W8NA 5GS0L 2Y5EA 4H88H 3CDFA 2ZG2A 2GSGB 1JI1A 1G1CA 1UQSA 1VGKB 4HXBL 2ICEA 3OZ9H 2VISA 5IVNA 5F1SA 4RFNC 4PUBH 3L3GA 4J12A 5CJ8A 5MEOB 3M8OL 3VH8A 4HPOL 4O00A 3DV6B 4I18C 1UKTA 5EOTB 4O2CB 5I1GH 5I19L 3CCHB 3ZTNH 4LCCA 3TH2T 4E41B 5C9KA 3WO4B 3KXFA 3OAZH 1K3IA 1ITBB 4NT6B 5HVFB 5ECJE 2CRYA 4OF5A 4Q0XL 1KENL 4OCWH 2I27N 4L29B 1PGRB 5L9DH 3FN0H 1VENA 3ME0A 1EGJL 2I60L 3BXNB 5C07D 4XC1H 1YA5A 3P4NB 5EBGA 3AMLA 3CFJA 1GGIH 2WV3A 5FECA 5JHLL 1OL0A 4EN3B 4YHPB 2P8LA 3QZWB 4ZFGH 1SJHB 3EYQD 5BVJB 5I0DA 3KPRD 4H25B 4DGVH 4GKZB 2MPAH 4JRWA 3LKNB 1N6QH 1C16B 1KACB 5BW7C 4L1HA 5IW1A 3MA9L 3NACH 5DJ0B 4U1HB 1MFBH 3D87B 4PJ9C 3TNNB 3LN4B 2AVGA 3D85D 4JGUA 2HTKC 1AR1D 3TZVD 2WIIA 1WAAE 1A1MB 3DSFL 3O6LH 4Q9BA 5D5MA 4HKXA 3VRIB 2JB6A 1EIBA 2B0SL 3VXSD 5AEAA 1NFIA 3BKYH 4N1CA 1NMCB 4HK3J 4U1NB 3BPLB 4OQTH 5BS0E 4KXZI 2P4AB 5C2BH 2VLJD 3QDMB 3O8XA 4Q7DA 4PJIA 4MJ5B 4W68A 5ANMB 3G5XA 5D7IB 1MCHA 1MRDH 4L3EE 3R0NA 3BRGC 4P5KB 4WWKA 4JQXA 3GRWA 2I60H 3WHE0 2VR5A 3UEZA 3GSNH 4A6YH 1NMBL 4XPHH 3QIBA 4N8VA 2XXMB 5F1KC 3QULA 4B0MM 5MENB 2NXYD 4CNIB 4P2OD 5BMFH 5HVWA 1NC4A 4OFDA 3H9SE 5FM8A 4BK5A 1TPXB 5DUPL 4XBPA 4P5MA 2QV2A 4XCCL 2OS7A 4PG2A 3GZKA 1FRGL 3CSBA 1LO2H 1ONQB 3F65A 4F80A 3BPCA 5ICYA 3BD3A 4HEME 4Q2ZB 5EU3B 3U46A 2FX9L 4HZLA 1Z9OA 3CDGB 3PNWA 1UCTA 1K8IA 3HRZA 2R4SH 2OLDA 1L7IH 1TNNA 1BBJA 3KPQA 3I3DA 1G7JA 1MHPL 1WZLA 4L8SA 1KELL 3NIDE 4OLVH 1FL5B 4PP2B 2UZYB 2EH8H 3RY6C 4HLZH 2OSLB 4HK0B 3QFJB 4QHMA 2VAAA 1KCUH 1JPST 5A2JH 4N0CD 1A6AB 2D7NA 4L3EB 3QNZA 1I8KA 5KANI 4NDMA 3ARED 3V4VL 1CE1H 3CK0L 4LCUA 2C4XA 4EIGB 1IT9H 2E8ZA 1LE5A 4FS0A 5JHDA 3Q6FA 1CFQA 1M1SA 3BO8A 4X4XA 3P11L 3O6FB 3OKOA 3SJVB 4LP4A 3UBXA 3DHJA 2O26U 2WAHA 2CLZB 4NQDE 3DTXA 3C87A 4HV8B 1LWRA 3LPFA 1BZ9A 4KI5C 3RL1A 4CDGC 4HH8A 3NCYS 1ACZA 3MA7B 4X6CA 1RMFH 3QXUA 4Y1AA 3H8NA 2OTUB 5SWSA 4O9HL 5I73C 2BVQA 4NM8H 1EO5A 1T66D 1FL6B 1QTYT 1FNLA 5ABDE 3QO1A 4Z7VF 2Q8BH 2A6IB 2NZIA 4QRPB 3JWDL 5IMMA 4XVUC 5HHVH 3BYTA 3OR6A 2P5WD 4HGWB 3S3PA 4OUUA 5MP6L 1BF8A 4JFXB 4G7YL 4P4KB 3HC0A 4J8RB 4QHUA 3QQ4A 1E4KA 4L1DA 5FB8B 1Z2KA 5HGGS 4YDVB 3PP3K 2ADJB 1JYNA 2GT9B 2UVFA 1U95A 4LMQE 1FO0H 4JFYB 4WEBL 2EYSB 1IAMA 3HE7D 1MIMH 3U0PA 5BQ7B 4UAOC 4KVCL 2FJHA 2A0LC 3VD3A 3UPRB 1HDMA 4GXVL 5E9DE 1KLFA 5DUBA 4YFEA 3MLRH 1IAIH 5IHBA 5IF0A 1Z6JT 2CDEA 3HZYB 1ZHKA 1J8HE 1ES0B 3G6JB 4JRYD 4IDLA 2MFNA 3WS3B 3MO1A 3VXUE 3DOSA 5KS9A 3RKPA 5GGQH 5E4EC 1NANI 4S0TD 1I9JH 2YRPA 3NTCL 4OGAC 1KEML 4WW2F 4L4VE 3TA3B 5CD3A 4KRMB 3P0GB 4LCIH 3T3MF 4MNGE 3MFFA 4OZGA 3VRLF 4L4TA 3T0EE 1JPTH 2XA8H 2ZKHL 3EOBA 3MJ9H 4GG8B 5D7KE 3HI6L 2VUYA 5EC1A 5EZJB 3DVNB 4M6ML 5IKCB 4RRPG 3BIAX 1Q1JH 1MY7A 1IGCH 1MCOL 1HIMH 5IM7A 2VDLL 3L5WB 4P57B 5C71A 3B43A 1K4CB 3FONB 4PJGA 4XP1L 5K9KA 5D6CB 1QSFA 2WW8A 1IM9D 4XB8A 2AJ3A 3BKJL 5GGRB 3C6SA 2CH8A 4WV1A 3IRZA 3CSYA 2VQTA 5FDYA 3ZE0E 4X6FB 3MBEA 2XZCH 1AXSB 4QEGA 1G0DA 1AFVL 2X2YA 4PJFB 4Y2OA 4M93B 4MXVF 3W2DH 4K9EH 5DI8A 3V8OA 4ORGB 5CZXD 1NGXB 5T1LD 5LGJA 2ERJB 1IC1A 4U6XB 3DVIA 1ZLVH 1BD2B 1A4KB 4QRTB 1MCPL 2AK1L 3O9WA 1G9EA 1BVLB 3VXUB 5FIEA 4B50A 1PLGH 1WZ1L 4BFIA 3DX6B 4HD9A 2A6KA 4HKJB 2DWEB 3BUYB 4WJ5B 3MCKA 4KDTC 3LKOB 3HAEG 4MNGB 2NW2A 5I8KL 1KT2A 1KEGH 2BVOA 2IQ9L 2Y9RT 1CXIA 4RGND 5B4MC 5C92A 1DCLA 3IJSB 1Z9LA 1XGYH 3W0WE 4KROC 5GS1A 1LP9F 4CVZB 5F7UA 2DD8H 4WO4C 1KJ2H 2OI9B 3HAEH 3BE1L 3SHSA 1QA9B 4RNRA 2C9AA 2J7LA 3SO3B 3ZKMC 4JM2D 5TDOA 5DSCA 2C3HA 4RX4A 3QIWB 1U8OA 3L3IA 3EO9L 3GGWA 1EGJA 4KK5D 3BYYA 2CKBB 3GSNA 4M7KL 4A6YA 2NTFA 1P4IH 1KCKA 1N4XH 3PIQB 4X7EC 3BJ91 2W9DH 4ZTOL 1NPUA 3S35X 1KPRA 1WEJH 1MCPH 1CFBA 4PRDA 2ID5A 1H5BA 3MODH 3KPNA 1YEGH 1CD1B 4WHTA 2FATH 4ERSL 3T1WA 3ARZA 3CFBB 4GG6B 1E6OH 3QXDB 4GQ9H 5IT2H 4H5SB 1KXVC 3NIGF 5CUSL 5I1DA 3BW9B 4OGZA 4JREC 1KLUA 1E4XI 1QNZH 4NBYB 4NUGH 1CK0H 5KG9B 1YJDC 3V6OE 1HXYA 5A16A 2Z8VC 4TPRL 4PGZA 4P2RD 4DN4L 1C8PA 3TN0A 5HHMB 1EMTL 5T1DH 1N8ZB 5IESL 4P2QA 1U8NA 3PWPA 3LD8B 5EUOF 5F44A 3FFCA 3MRLA 1YNLL 4GAYB 5F9OL 4EEEA 4AENB 1XGTA 3DMMB 3QDJE 3FN9A 4MGXA 4HDIB 3ARXA 1LMKA 1RIHL 3JV6B 4NC2B 1ZV5A 3WFZA 3QZWG 4FQXC 2XACC 1RURH 2QR0A 2EIEA 4F7CB 4Y19E 1EAPB 1AC0A 3EDEA 1UWEH 3DXAB 3HUJF 3LS4L 4PJ5E 4R90L 3L3KA 5FCUH 4HULB 1QQDA 3O6MH 1I7ZA 2LVCA 5HDLA 1U58A 3U4BL 2VYRE 4Z7VB 4Z7WB 1PEZA 4YHML 5MERA 3QB7C 1OGAB 1IKFL 2LTQB 3FRUA 3N1MC 4U1GB 1AH1A 5C08A 1CD0A 4POZC 2N7BA 4P3CL 4F3FB 4X98B 5GJSH 3OAUL 1XH3B 5CSBA 5ITBH 3FT2B 4XAWL 4PG9B 3IXTA 1RZFL 4ZG1A 4LVEA 5FXCH 1HINH 3RI5K 4X8JB 3QUYB 1RY7B 3VFMA 5LXGH 3IDYB 1JP5A 5GGTL 4XWGL 3NZHH 1NGQL 4DWHA 3PL6B 3PABB 4OFVA 4LVOB 4U1LA 5ESVB 1FNEB 2P1YA 1VKXB 1D7FA 1JJUA 1A7PL 2A6JA 4XRCA 2W0FA 3HTLX 4OM1H 3TVMD 1JIBA 4MXVE 1P4BH 4JFOB 1F3DH 3H9YA 4KI5F 4AJ0A 5HTSA 2O61A 4ZS6D 4G80A 2L7UA 3BQUA 1MI5D 4JY6B 5ILTL 4AEIL 3ARFB 4DZBB 2O5ZH 1IEAA 1YNKH 4AQ1B 5E56A 5C0AB 1IFHL 5ALBH 4NYLA 5MHSE 4PLOB 4DKEH 3PWNB 1FO0A 2VXUL 1X4ZA 1MAJA 4P3CH 3TP4A 5I1KL 4BQCA 3MRCB 1NBYB 1WWCA 4O51A 4OLZL 1NAKL 1CL7H 3HZKB 5CFHA 4I0PB 4U1KB 4AEEA 3LQZA 4R4ND 2X44D 2VABA 4KUZH 1LP9E 5CJBA 2NX5A 3HZVB 4HWBL 3S8WA 5I30L 3MGOA 3VFNA 1FE8H 1DQMH 3P4MB 4TN9A 5KAQG 3KPSD 3CSGA 4RWYL 4Q9CA 4OD1H 4QRQA 4JFEA 1H0DB 1U8QA 4RIRB 5ERWA 2GW5A 3S7GA 3I3BA 3MJ9A 5CAYB 3GM8A 2X4PB 4AEFA 4RFNB 2I07B 1CGTA 2L7JA 2FO4B 5D70H 4JQVA 3VXRE 3U9PH 4AEIH 3CLFH 1U8IB 2E7MA 4I18B 3HHRB 2APWA 3BPNC 5GGUA 2G5RA 3RFZC 3VA6A 5C0RH 4FQCL 4PGBA 4WNQA 2VLMD 5F9JB 1H8OA 8CGTA 1NMAL 1UXWA 1FVEB 3TJHC 2F5BL 2IGFL 4JKPH 3UXFA 4RRPA 2GJ6A 4HSQA 4RMWA 1FC2D 1ZT1B 2GSIB 2EIDA 3TIDA 4JO3L 4M7JL 3MROB 4PJ7A 3UAJD 4Z5RB 5FHBH 1BFVL 3GI8L 5DQDL 4TSCL 5AYUL 3ZDZE 1H8NA 3NABH 4OSUL 3W9EA 4G8FB 3H9ZA 1HKFA 5LBSH 3T4YA 3REWA 2GCYB 4MHHG 1X5HA 4L4JA 4PJ9B 2YD3A 3EGSA 4UTAH 1T5XA 3FO2A 1YEKH 3MPCA 4NKDA 3MLXL 2AJSH 2AXGB 5EU6E 3D0LB 4PS4H 3T0XA 3ARGC 3FZUC 2WINB 5TGBA 3HUJE 1KC5L 2X09A 3RGVC 4OCRL 4YDIL 4IRSB 4NWTH 1FFNB 4JRXE 1MF2H 3HAEA 5D9SA 2BOCB 5HY9A 3C5ZA 1U8JB 1UVQA 3FB6A 4JGMA 2A74A 3NFNA 2DQIH 3QUMB 3VFVA 1QSFE 2EE3A 4Z7UF 1FYTB 1G6VK 4MJ4A 3MV7D 5DUMH 4YXKL 1N59A 2YD4A 1CCZA 2X41A 4QXWA 1UZ6F 2JJTC 5EC2A 5FGBC 4U1IA 1UACH 2CGRH 4X6EB 1CTOA 3LSOB 4LVHB 2WP3T 1PKQB 4I3SL 1RUKH 5J4MA 4L9LC 2WANA 3WUZA 2JJSA 3EYVB 5EUOB 1J05A 4XNMB 2IALB 4KI5E 1RVFL 1CLOL 1ZXQA 2VL4A 3MLYL 3S36L 5JDSB 4R2GD 4X8XA 3BSZH 1Q94B 2FB4L 1N6VA 1MHCA 1QO3A 4OFIA 3E6FA 4GOSA 1F4WH 1CLZH 4JCLA 4PJDE 4PRPD 1T5WB 2ZCKH 5D7JC 4UBDD 2GSGA 1VGKA 2EXWC 4U1SB 1X7QB 3NGBC 5MEOA 3ARBC 3I2CL 2ICCA 5E2WL 2DYPB 2HT2C 3DV6A 4NHCL 5EOTA 4O2CA 2YPLE 3CCHA 3MV9E 1Q38A 4E41A 2GY7B 5J3HC 2YD5A 4NT6A 3FO1B 3OKEB 5JORB 1ADQL 5I66B 3KLHC 3DBXB 4PB9H 5GIRB 3MLZH 1RK0B 1YY8B 4L29A 3SKMB 2W65B 2Y6SD 3PGCB 3VG9C 1NCTA 3GSWB 3BXNA 5TQ0H 3H2WA 4IMKA 2EDOA 1Z9SA 4QTIL 2CKBL 3P4NA 4WUKH 4ZOEA 5GRUL 4XPBL 4EN3A 4JHWL 3QZWA 1SJHA 5BVJA 2QSTA 5F7DB 5F6IC 4H25A 5EBLB 4Y16D 2APVA 4GKZA 3LKNA 4OGXL 1C16A 3WNNA 2MMXA 4WY7L 5D71H 1O7SA 1HXMB 3B6SB 4JB9L 5DJ0A 4U1HA 3EFDL 3PWLB 5E94B 5BV7H 2YUZA 5I73B 3TNNA 3QXTA 3LN4A 1JRHI 4HWEL 4X6DF 1IGFL 2IC2A 4YDJB 4OLXL 1A1MA 1ZTXH 5L2JB 3VRIA 3TNMB 3VWJB 2NW3B 4UINL 1MOEA 2N1KA 4U1NA 5FHAH 1R0AL 3HG1D 5K59F 1E0OB 3QDMA 1QG3A 2YPLB 4MJ5A 4OF3A 3V6FB 3L5XL 4PV9B 5ANMA 1I3RB 5D7IA 3UC0H 4HIXL 1PX3A 4LLDB 1UA6L 4P5KA 4F37K 1SHMA 4JFDB 1YC8A 1T2QL 2PYEB 1DJSA 2IBZY 4FA8A 5MENA 3BAEL 4CNIA 3LZFL 4Y2DB 3SE9H 3GHBH 4JPWL 2HYMA 3U0WH 4XHQA 4RISH 2GTWB 4UILL 1ONQA 3D2UD 1A7OH 3CH1B 1GZPB 4Q2ZA 4IRJC 1H15B 3JV0A 4LLYB 4XZUB 3RHWF 5CD5D 3CDGA 3TT3L 3T09A 4UINH 4A2MA 3LMJH 2JKXA 4NN5C 3DVFA 5HI4C 3T0VA 2E7HA 4BFGA 5LAXB 4C57C 2VL5B 4Z7UE 35C8L 4WGWB 4CN4A 5ELIA 4OZFH 4PP2A 3QEGL 1PVHA 3MLVH 1CT8B 2DTMH 4WFED 2OSLA 4HK0A 3QFJA 5LQBH 3UTOA 1DDHB 1N0XL 5IG7B 2WZPD 1UEYA 2D0HA 5MI0C 1RAMA 1A6AA 4X5XB 5I1JL 4F58L 2OL3B 1XAUA 1HCVA 2VLKE 1B4RA 4IDJL 1M6OB 4XCNB 2DJUA 4HPYL 3K4AA 3O6FA 4PRHB 4Z95H 3SJVA 4FQJH 5D8JL 4JJHA 5I8EB 1J12A 2CLZA 2BFVH 3H0TB 5GRZA 4HV8A 4OLWL 1MCSA 2ARJB 2AK4D 2QQNH 2HLFC 5FM5M 3QXVA 1R5VB 3HC4H 1FAIL 3WIHL 3MA7A 4XNUL 5KVEL 2EKJA 2VXVL 2J3SA 5I1AB 4I3RH 5D1QC 1VEPA 4KKBC 3S3JA 3WSQL 1FVDB 5TDNB 3RUGF 4S0SD 2OTUA 5JR1H 1AO7B 4R26H 5E08L 4UV4L 4NZJA 1UZ8B 2NR6D 3C09C 3J8F7 1EZVY 1FL6A 5LJYH 3F6LA 1RK1B 3RTQB 5JPMB 3E3QC 3T2PA 1ZA3B 2A6IA 3LOWA 4QRPA 1H8SA 2YUWA 3ZYIA 5KSBB 1HQ4B 2AJYH 1CR9H 2GJZB 4WO4B 4KI1A 1S7QB 4AMKH 4HGWA 3HKFA 4JFXA 3QIUB 4OZIB 4P4KA 3NAAL 1CBVH 3C6LB 3WNKA 2DF3A 2Y72A 5FB8A 3PF2A 4YDVA 4M1CD 2ADJA 3BH8B 5E00B 3WD5L 4JPKH 1AQKL 2GT9A 3PQYB 1G7QB 1F4YH 2Z92B 4OKDA 1JTOA 2ESVE 4OLWH 2EYSA 1QBML 1IAOB 3B3IB 4XXDB 5BQ7A 3RWHB 4MAYC 4KMQA 3K8LA 5CJXA 2VDNH 1TZGL 2E9IA 3UPRA 4LRIC 5H2BB 2DKUA 2PN5A 1I8IB 1JNNL 4C59B 1FDLL 5K59E 3S34H 1VPOL 2OJZL 2D7TL 3HZYA 1ES0A 3G6JA 3WS3A 2R15A 1ZAGA 4C56E 4UOW0 4CRPA 4Y8DC 3FT3B 4F2MB 4X4YB 4K8RC 1ZHNB 2MJWA 3TA3A 2YPVL 1GIGH 1DN2A 1ETZB 1MJ7H 5ADPH 4GG8A 4AH2B 1A6VL 2KUTA 5EZJA 4PJBE 2VDQL 3DVNA 4QHLB 4Z6AT 5E5UB 5IKCA 4JZJC 1WZKA 2HKHH 5F9WB 5EOQH 2LE9A 2OMBA 4YEEA 1PG7X 1NQBA 1O5DT 3L5WA 3P30H 4P57A 3WD5H 1K4CA 3FONA 2MCG1 3CX2A 1RUPL 5D6CA 3LHPH 4KRPD 5GGRA 2R2HB 3FN3A 3LKQB 3GMPB 4YH6A 4BFEA 4DKFL 4U3HA 3ZHDA 4X6DB 1CXHA 2F54B 3TWCH 1AXSA 2ZUYA 5HHXH 2LV4A 4PJFA 4FXLA 3OQ3B 4GAFB 4ORGA 5EN2B 2P5EE 1NGXA 5FFLA 4U6XA 3QEUB 4NBZB 1BD2A 4XI5C 1A4KA 3WE6B 4UB0L 4ZOCA 5JXEA 4QRTA 3RVWC 4PJHF 4ZD3H 1X6NA 3S4SB 5IMLA 1BVLA 3L1OL 3QHFH 5F71A 4ODTH 3DX6A 3IFLH 4HKJA 2DWEA 3BUYA 3JWOC 4WJ5A 1HHJB 3K2UL 4C4KO 1H3UA 2Z31D 3LKOA 2VH5L 4HH9B 1PJ9A 5KVFL 1ZEAH 1HKLH 1UENA 3Q3GB 5IFAL 3IJSA 1FPTL 2W59A 1RJLB 2PCPB 4CVZA 3AM8A 1GGTA 1QA9A 4QF1B 4LIQE 1ADQA 3Q1SH 4X7SH 1OT2A 3NCEB 3NPSC 2JJWA 1C1EH 5IBTL 4NOFA 2EXYC 1CDIA 3QUMH 3QIWA 3LEXB 2Z8WC 3CMGA 4ENED 3QHTC 4F57L 2CKBA 4OCXL 5E6ID 4XNZB 5JOPD 2XN9E 1IGYB 3PIQA 4MJ6B 1FORL 1AP2B 3KWWB 5CGTA 2PF6A 2KPNA 1D6EB 3CFEB 3P40A 2DLGA 2CDFB 3LEYL 1SJXA 1W0WB 4GBXC 1CD1A 5DDHB 1Q72L 3CXDL 2H1PL 3CFBA 3T65B 3WL9B 4GG6A 1QFWM 1DQQB 4H5SA 3UJJL 1NGPH 3EO0B 1DBKH 3BW9A 4MXQC 4PGCB 1DLFL 2IBBA 5KG9A 1FSKC 1OD7A 2MHAB 1Z3GH 4YWGL 5HHNB 5TH2B 4JDTH 3GUTB 4KKCD 2Q76B 5T5NG 4M7LH 1YMME 3HB3D 1N8ZA 3S37H 4NO0D 4D9LH 1NFDF 3DETC 2DDQH 3LS5L 4GAYA 3FOMB 1GAFL 3ALPA 4PYGA 4AENA 1PG7W 1U3JA 1OQXA 3DMMA 1A7BA 4HDIA 3OAZK 1LK3L 5E2UH 3JV6A 3RUGB 3UZVB 4F7CA 3ALWA 1ZKAA 3O6KL 3QUZB 1EAPA 4D9RE 3DXAA 1J10A 2YOCA 3STZB 4L8DB 1UH2A 2H1PH 2ZG3A 4Z7WA 1DQLL 1RZIB 4Z7VA 5DJDB 1OGAA 1FLRH 2Y4SA 2XZAH 3V4PH 4F3FA 4X98A 1XH3A 2F19H 4PG9A 1QRNE 4OD3L 5IHUH 4DVRH 4G9FE 4Y4HB 4MA1B 4X8JA 3QUYA 5F7WC 2DLEA 1S5HB 3H3KA 1QFOA 1N5AB 1T83A 3PL6A 3IDXH 3PABA 3GK8L 3MACL 4EBQL 3K3QA 5ESVA 1FNEA 4YX2L 3TO4C 5ADOH 3LS5H 4H0HB 3WV0A 3WYRA 5DK2B 3RGVB 2NY3D 5B38B 1EDQA 5KTEH 3QDAA 4JFOA 2Y36H 5DURD 3ULVL 5D1XD 1E4JA 2P8MB 3BMVA 5HD8D 4JY6A 1QUNA 3IGAB 3KJ6H 3H9SD 3ARFA 5SWZE 3FQWB 4DZBA 2WBJC 1MJ8L 5FYKE 5DMGD 1XEDA 5C0AA 2OL3L 1A6PA 3O2DH 1MCDA 3IDMB 4AEHH 3HNSH 3PWNA 2GY5A 4GKSB 1SYVB 4LCYB 2CLRB 1NEUA 5I1IH 3MRCA 5KVGL 4LCWD 2RGSA 1YPZF 3HZKA 3T0BA 2AEPH 4I0PA 3BP4B 4U1KA 3WIHA 5KZCD 4ZUUB 2BHUA 3E2HB 4YFLF 1CFVL 1NL0H 3EOYG 3EYUL 1EH9A 3VGGA 3HZVA 3K4DA 4JFFE 2R2EB 2WQ8A 4TNVF 4OF7A 3P4MA 2VZVA 1G7PB 3N85H 4PRIE 3HI5H 1H0DA 1DBBL 5KVDH 4RIRA 4YEFA 4LEXH 2IANB 2X4PA 2ZCHL 4MJIE 3I6LE 4PB0H 3ZSSA 3N1PC 4YGAB 2I07A 3MBXH 3NGBB 5AD0B 2FO4A 1XGPB 1U8IA 1RULL 3GKWH 4I18A 1NH6A 3QG6A 1FNAA 1U3YA 4PJHB 1EJOH 1CGWA 3VGFA 5EOCJ 3P0YH 4NQDD 2XRAH 2CK0L 1OB1B 1U2CA 4OI7A 1FVEA 4M7LT 4S1QH 2BK8A 5KVGH 1ROWA 3C60B 1ZT1A 3VG9B 2VDKL 3EYQC 4ZPVB 1I8LA 1OPGL 4QNPF 4P9MH 2W0KA 1T7VA 4Z5RA 3X13B 1RIUL 1N64L 2X9XA 5JQ6L 1C7SA 1SMOA 1MCWW 2DN7A 5D4QA 1PY4A 1NCDL 3DI3B 4EI5D 1NFDE 4QWWC 3VXPB 1JHTB 3TZVC 3RY4A 2R8SL 2GCYA 5D93B 1T7ZA 5CILL 4PJ9A 4KKNA 5DS8B 3NFSH 1X4YA 3P9MB 3D0LA 1YEIL 3RVTD 1A6UL 2YPKB 3T0WA 2WINA 4RFOL 2NY2B 4NZRL 3SBWA 3V5HB 4G7VH 1KUMA 1NSNL 3ET9F 3RZWA 4U0RB 4IRSA 5HYJB 1FFNA 2PYFA 2EDNA 1DE4B 3IAPA 2AI0H 1J5OH 1FBIL 2CK0H 3G04B 5DWUL 5ACLA 5A2FA 2BOCA 3ISWA 3B9EA 1QSEB 4D0BB 1U8JA 1UM4H 1MFDH 3U30C 3GMRB 2NXYC 1MJJB 3QUMA 3L3OB 5E9DD 4P2OC 5GGSY 5J57B 1UWGH 5E7BA 1FYTA 3W9DB 3FQXB 4FQ2H 5IMOB 5JQ6H 2CRZA 3N0PB 4X6EA 2RQ8A 5I15L 1BIHA 1YEHH 3LSOA 1A1NB 1IBGL 5LGHH 3MOBL 4D2NA 1PKQA 5JXAH 5F7FA 5IJKA 1OP9A 1T1YB 4F33A 5EUOA 1CDYA 1NFDB 3EYVA 4XBEH 4M1DL 4E42B 4XNMA 2IALA 1IGIH 3MV8E 4N9GB 1GJIA 5JDSA 1RUQL 5D7KD 2YA0A 3MLWH 1Q94A 2AABH 4JPVH 4HBQA 1J87A 3ZYOA 2CMRH 4NN5B 5T1KB 3W39B 1YJDH 2BSED 3KNBB 1RZ7H 3L7EB 1MSPA 3OHXB 3UBXI 2DBLH 1T5WA 4OZ4B 3T08A 3ULVC 1NC2B 1YN6B 3OPZH 4FTVB 1OAXH 4N0CC 1EV2E 1DP0A 1NCCL 4ACPA 4U1SA 4LSRH 1X7QA 4ODUB 3ZSTA 1WISA 4G3YH 4YBLB 3AREC 1HHIB 4XXCA 2DYPA 3KJ4B 3QDGD 4YUEH 2ED7A 1ZGLP 4S1RL 3S88L 3GHEL 4HKZB 4DQOH 2ORBL 2HAZA 3FO1A 3OKEA 4TOYL 1INEL 1NLDH 5JORA 4NCC2 2XZQL 5I66A 3DBXA 1SJVA 5GIRA 4MNQD 4XVSH 1K9TA 3S4SG 2X1OA 1RK0A 1YY8A 3U6RA 2W65A 5L88H 3PGCA 1QR4A 3RZCD 1ZLVK 3PV6B 3IFNL 4EI6B 1M05B 1KJVB 1QFWI 15C8H 4YHLH 4Q9RH 1JGUH 5F7DA 3O4LE 2DB8A 5EBLA 5DD5H 3UJIL 3IB4A 3DIFB 1T66C 3W0WD 1HXMA 3B6SA 4M6AA 2NLJB 5I18H 3KYKL 2XG5A 3PWLA 5E94A 1EVTC 2NZ9D 1TVHB 4NQEE 2V6HA 1HN1A 4YDJA 1A3QA 4HBCL 5L2JA 3TNMA 4UT9L 2NW3A 3VWJA 4HIHB 3QP3A 4GW4B 5FGCB 5TQ2L 3KXFD 4M7ZC 1FJ1B 3R1GL 1P53A 3TO2B 5EU5B 4G43B 4JG1H 1YPZB 5JUEH 5JA9A 3GKZA 3SCMD 2RJMA 2KZ1B 1YYML 3V6FA 5L7XH 4V2BA 4PV9A 1INQB 5FV2A 1I3RA 3ZO0A 4W81A 4LLDA 3H42H 4FXGA 3F7VB 3I6GB 1LVEA 4JFDA 1A02N 1VGEL 3RIFK 2Y06L 3WXVH 3FCTB 2VLRB 1CU4H 3O2DA 2PYEA 5CZVL 1ZANH 2FL5B 3V52L 1T0MB 4HT1H 4Y2DA 1TDQA 1JYVA 3MLSL 2MCPL 3R06B 4MAYB 1DLHB 3AS1A 2VZUA 5BRZB 1Q0YH 2GTWA 4YQXH 5DHVB 1RUML 2CR6A 3CH1A 1GZPA 4E9LA 2D9QB 4RAVB 1CG9B 3X11B 1H15A 1N2RB 4LLYA 4XZUA 4F9LC 4K3DL 4TSBL 5I1EL 4ZAKB 3B8YA 5TQ2H 2E27L 4OLYH 5LAXA 3O8XD 1KJMB 2VL5A 3RNQB 5B3JF 5CJOL 2DLFH 3QDJD 3U1SL 4XP9L 5J6HB 5CINH 2X4OB 1CT8A 4G8GE 3MCLH 2DQCL 1DDHA 1L7TL 4LIQH 2WBWB 5IG7A 1BZ7A 3RBGA 3MRFB 4PJ5D 4WI7A 4X5XA 5GRJH 2DL2A 2OL3A 3SQOH 5FO8A 1VHPA 4WHDA 3I9GH 3TF7C 1M6OA 2DQFB 5CZXC 5AZEL 1MEXH 3C5SB 1K2DB 3SKJH 4NQCB 5CJQH 4GAGL 4PRHA 3O11B 4U6HB 5I8EA 1JTPA 5KOVC 3MNZB 2ZCLH 5TJWK 3H0TA 4GRWF 5GPRA 2E7LA 4LSSL 3WNMA 1OARL 4FZ8L 3T77B 4UT7L 2YUVA 2ARJA 1R5VA 2FZ3B 5I1EH 3V7AG 3MRDB 4LASL 5I1AA 5B38G 5IGXH 4RGNC 3G5YB 1FVDA 3K81A 5TDNA 5C0BB 3B9DA 4KDTA 1AO7A 4G5ZH 1SEBB 1UZ8A 1EFQA 4PJ8B 1XGUB 3KR3H 4TUKH 2HT3D 3MJ8B 1OGTB 2V2WB 1RK1A 3RTQA 5JPMA 1L7TH 4DGYL 1FCGA 1ZA3A 4N68A 3RDTA 3JUZA 5KSBA 4KQ3H 3DSNA 3QPXL 5TE7H 5J8OA 1HQ4A 3B83A 4JM2C 4YXLL 2GJZA 2XY2A 1D6VL 4WO4A 1SJEB 1S7QA 2FD6L 1CDJA 5JHDD 4KK5C 5DD1L 3RVUD 3VXNB 3NPSB 4I77H 3QIUA 4OZIA 4LSQL 2X89A 4ODHH 2WUBL 2AEQH 3SGDH 5ISZE 3C6LA 1KCRL 3UTTB 4HUKB 1JFQH 4F15B 1PEWA 2PETA 3BH8A 5E00A 4CADA 3PQYA 1G7QA 1OAYH 5JIPA 2Z92A 3UYRL 4UT7H 4GS7C 1MFAH 1GXEA 3LDBC 3B3IA 3GMLB 4XXDA 3RWHA 5IWLC 1JV5B 2EDQA 1HCFX 4K2UL 4MA7L 3NCMA 1Q0XH 2EDWA 3T8XB 3ZKSD 1DFBL 4KTEL 4FNLH 4RCAA 4Y1AD 5H2BA 1I8IA 2NY4B 1MH5B 2HTLD 4NCC1 2VO5A 2VC2H 1J0ZA 2C4FT 4P9HL 4XMLL 3VXRD 2Q3ZA 3FT3A 1TLKA 4F2MA 4X4YA 4ISVB 3LQMA 1KXQE 1TTFA 4MD0A 1FVCB 4Q74A 1ZHNA 1FSKB 1WIOA 4RZCB 1DVFB 4PGDB 1ETZA 3QEQE 1TJIH 4OCYH 5L2KB 4O58L 4AH2A 5CP7B 4GW5B 5CLWA 4QHLA 4EUPH 1I9IH 1K5NB 4V1DE 1E4XL 4LLVB 2NXZD 4XCYB 2DQEH 2PKDA 5FYKH 4HUVB 1X5KA 1A7NH 4I1NB 4GAJH 2D0GA 2R2HA 2YA2A 3LKQA 3GMPA 3MV01 1P6FA 4X6DA 1DFBH 2F54A 4HAGA 3O81A 2FX7L 4YE4L 3OKDB 5C3LD 4LSVH 5EN2A 1H3WM 5ENWB 1F02I 4EKXA 1JHLH 4QRRE 3QEUA 2DRUA 3WE6A 4PJEB 3VGEA 4OLUL 3S4SA 3UYOD 1IEHA 4P59H 1OSPL 3CD4A 4L4TD 5ALCH 1MRFL 4JKKA 2J8OA 5IB4B 1HHJA 2EDRA 1EHXA 5HVHC 3TVMC 4HH9A 5JNYB 4LLMB 4JQIH 4OFKA 2P44B 5F7KC 4ZS6C 5GHWH 5AWNL 1A4JB 3OF6A 3Q3GA 3C2AL 1QSFD 4V1DB 1CF8H 5I16B 3LN5B 1JCKA 1RJLA 2PCPA 1IAII 1JZ3A 4GRWE 4PJXB 4CU7A 4QF1A 3VXQB 2EDBA 3HE6B 4LQFH 3U48A 4HS3B 3MBED 4Z78B 5TF0A 1JVKA 1ACYL 3LEXA 4KQ4L 3QBTB 3ZKXC 4EZMA 2G5BB 5HGAB 1QLEH 5E1HB 4XBGB 5C09B 2A38A 1IGYA 4MJ6A 3T04D 4R4NC 3WFDL 1AP2A 5FK9B 3KWWA 1GPOL 5GS0D 4OLUH 1JBJA 1D6EA