3SBWA

Crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKLKIEESPGAELVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the extracellular domains of mouse PD-1 mutant and human PD-L1
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Programmed cell death protein 1
total genus 25
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sbwA00
1PYWB 5TH2B 4LVNC 3NFNB 5I19H 5AAWA 4D9LH 3B4NA 3GSWB 3WUWA 4DAGL 4FQQB 3U36A 4KJYA 1KELH 4S1SH 4GLRH 1LDSA 4S11A 1KXVC 1WTLA 4XMPL 5BXFB 1NGZB 4Y4HA 43C9B 1VKXB 2APFA 4HWNA 5JHDD 1BJ1H 4O4YL 5IV2A 3GSVB 1TQCB 4L3ED 1KSRA 4MD0B 3HC4H 3QXAB 5DD5H 1OP5H 3VXOB 1EJ6A 4OZGE 5C0AA 4OF5A 2VZOA 5FDWA 4RRPG 4YHKH 5FHBL 3CCHA 4MLIA 5L2JA 4BH8A 2CKNA 4K2UH 1D6VH 1FPTL 1WITA 4PLOB 4LLMA 3ARZA 4X6EB 4MLSA 3NCYS 4MWFA 4NNYA 4QHLA 3IF1B 2HWZH 3U48A 3OR7B 1U8OA 5D1QA 3KJ6L 2Y23A 3ARXA 1TVHB 1TQCC 4B50A 2ARJB 1A0QL 1ADQA 2VIRA 2P8PB 4Y4KA 3UTTA 3NZHH 4U1NB 3BKMH 2OCFD 1Q9LA 5EBLA 3VW3H 5DJXB 4PJ5D 5DMJB 2CIIA 1KULA 1H9VA 4XP9H 3CK0H 5FYLE 1U8HB 3S96A 1ZEAH 1Q9OA 1D3CA 3CFIC 4HDIA 2BNQB 4NP4L 5GGUA 4MJ6A 2Y06L 3MRFB 5E5MA 2ZNWA 2B1HH 3BP4B 2NY7H 1BZ9B 1OTUD 4Y5XA 1CICC 4PB0H 3KDMB 4M48H 5KSVA 4YPJA 1E4WH 4PYHA 3REVA 5EOQL 1I1FA 3CMOL 4NQDE 2HFFB 3GSRA 4AY0A 4P3CL 1QKZL 1OAKL 1A7NH 1FFQA 5DHXB 3DARA 4JGJA 1YNLH 4O2EB 2ICWI 3IDGB 1EBAA 1JNLL 4PREA 3OKNA 3MJ8A 5ICZB 3P0VL 1XZ0B 1EEQA 4S1DC 5H37H 4J4PD 3KYOB 1IAOB 2FIKA 4Y4KD 5E5UB 3EYUL 3UTTD 5IHZA 1CVSC 4PY8J 5TF1H 3K4DA 4P2OB 5F7EH 5IB1A 4F7TB 3VGBA 5CLWA 1YC7A 4NNPH 1FC1A 2P5ED 3HC0A 1WVZA 1S7RA 4TVSa 2I07B 2YBRB 3RPIB 5T1KA 3Q3GA 1C7SA 2PTVA 1RJZB 3KR3H 2EH8H 1DQDH 3DJ9A 4WGWB 2BY1A 2YD8A 3ULVC 7FABL 1XR9B 3LQZB 4ODVL 4O4YH 1AIFB 1NC4B 5B3JF 3QHZH 5HY9A 4TN9A 2OJEB 1HEZA 3D2UD 3KJ4B 1D9KC 4KJQC 2H26A 3IS0X 1L9MA 3ES6A 5DR5L 1N5YH 5DJCB 1Z5LB 3MV7D 2BVPB 2WUBH 4FTVB 5IVOA 4A6YL 4CJ0A 4HKBA 1K4DB 3IDMB 4HWBL 5AZEH 4OCRH 1MIML 2YMXL 4DKFH 4JPKH 2I24N 2LFGA 4HKZA 3F8UB 3IDGA 5FYKH 2BHUA 2RFXA 4PJBA 5GRVL 2V9TA 2EZ0D 1J0YA 4YK4B 5BW7C 3BT2L 1RFDL 4MJID 4MNQE 3CCHB 4HUNB 5C3LD 2ZG1A 1RJLB 3OV6A 1SJEB 1WWAX 4UT7L 4BSWB 3LN5A 5DMGC 3IAQA 1I3GH 3V79C 2R1XA 3PIQB 5BJTA 2HTLC 1ZWIB 3B9VA 2DYPB 2Y5EA 1NFDE 3PE9A 3DXAD 3ZE0E 5MEND 5C08D 4JFZL 2N56A 2IADA 4ONGL 6FABL 4NQXA 4UDUA 4JM2A 1R0AL 1C08B 5C0FA 1NUFA 2VERN 4QCIA 5D5MA 5MI0B 3ULSB 2VXTH 5GGRB 1UWXK 4L3EE 4NO2B 3M1BA 3DV4B 5HYEA 3KLAA 5C9KA 5HYIA 3VXUD 3VD9A 1UZ8B 4XHJD 1LGVA 4ZOAA 5MHSD 1TVHA 4DKEH 3QUYB 4LIQH 3H9HA 2XTJE 1FDLH 5JZ7C 5J4MA 3EAKA 1FNHA 1BX2A 4PJHE 1OGAB 1CFNA 4DN3L 3REWA 3HTLX 1HZHL 3E6HA 3SHSA 5MI0C 2P5EA 5IP4A 1PQZA 5FKAA 1RK0B 3KYOA 1EO7A 1CFQB 4HUUB 2IEPA 1TTUA 3OKNB 4L1HA 3ZL4L 1A3RH 3C2AH 2APTA 1URLA 1L0YA 3OPZL 4YUEL 4JPVH 5I1LB 1FBIL 3MBXL 1G0YR 5C0CB 4YHYC 2ITDA 2HJLA 5CINL 3MRNA 5BRZB 1LEKA 5HHQA 3RWIB 2HH0H 4G8GA 3HI5H 4DZBB 3ROOA 4P2CG 4AENA 2A77H 4N90E 1MCWW 5DVMA 3RHWK 1HN1A 3WV0A 4YDKH 4ERSL 5T5NF 4HIIB 4PRPA 3RDTB 2FB4L 5F9WB 4LSQL 3UYRH 5D9SB 1KIPB 1FNSH 4FQ1H 4ZXBB 3V7AE 1TQBC 4HDIB 4AIXA 4U0QB 1ITCA 1MRCH 3BUTA 5I16A 3GSXB 2BCKB 4MDJB 3MJ9L 1AGBB 4CGTA 1RFDH 1U8HA 3L3GA 1J0IA 4HKXA 1MQKL 1T22A 1KUMA 2DLFH 4K7PX 3B3IB 5BRZD 1ZWIA 4RMUA 2YSSA 5HHOD 3QULA 2C3VA 4HMEA 5HYQA 4HSQA 5GXBB 2FCBA 1T2XA 1NBVH 5J13C 5IHZB 1S8DA 1JNNH 4GRWH 5HDOA 3FHAA 3VXQB 5F97E 3MX0A 2IGFH 1HH6B 3IETB 3KPSB 4ZXBC 1FDLL 1GGIL 2Q86B 4AIZB 3TH3T 3GHBL 4UZGA 2P5EE 2OI9B 4U6XB 5D5ME 5D7IA 3H7BA 4N0CD 4HGWA 3HN3A 2WP3T 4MQTB 3GBLA 4LU5L 3MLXL 1VPOL 4IMKA 2W07A 2QJDA 3BEVA 3OG4B 2IQ9H 2PTTA 2YWYA 4GKOA 3CAFA 4H8WH 2R2EB 3QI9C 4ODXA 25C8L 5B3NA 3VG0H 1A9BA 2GHWB 3IKKA 2BNQA 1PY4A 3B2VH 2AS5M 3LH2H 2Y7QB 4Y88A 3AU1A 3CXHK 3O9WA 4Z95H 5FGBC 1WIUA 3INUH 4NGHL 4WHTB 4H1LH 1T6VN 1IBGH 1I8MA 4L3CB 3WNKA 5I18H 4DUXA 4G42A 1C5CL 1VFMA 3TC9A 4NKMB 3MODL 4D9LL 4TNWF 2XOTA 4BQ6A 3RL1B 4Y5VB 3FOLB 3PWUA 2R69L 2X40A 4S1QH 2W65A 4HEME 3W39A 5JA9A 2UZIH 2Y36L 5JXEC 1NGYA 2BVTA 4ZAKD 4NDMB 3WUZA 4QHUB 3SGKC 4I3GA 2GUOB 4MNQA 4EDXA 2DIJA 4JFXB 3DV6B 3CFEA 4Z8FH 4KTYA 3ILPA 4NKOB 1XR8B 3QUZA 5F96L 1DN0A 3JBG7 1XF5A 2FX8L 4RGOH 4W70A 4B5EA 2QHRH 5IJKC 1HDMA 1KTKE 2YD7A 1LEGA 3MLXH 2Q87A 4Y4FC 1QFWL 4EI5A 4XCEB 3LKOB 3SJVA 3MNWA 3PWPB 4PJCF 5KS9A 1JHTB 2GJJA 5CUSH 4ZO7A 2NTFB 4Y2DB 4YHMH 1KJVB 3SKMA 4N9GB 2GK2A 4S10A 3THML 4HJ0C 3QFDA 4OLVH 1NPUA 4EI5B 4Z77B 1F4YH 3UZEA 1EEUA 2F8XC 5FA4A 3T3ME 1UB5B 2AXFA 1SBSH 3FO2A 3WFHB 3JWOL 2DQIL 3U0PA 3HE6D 3U7WH 1S7UA 4FZEH 2EDWA 5EIQA 4Q9QH 4GRMB 1GAFL 4F7EA 4X9HA 3T3PE 2FATH 5EZOH 3TZVD 1N3NB 1DLFH 5LGHL 4RFNC 3WE6B 4HAFA 4OGYL 4WGVB 3ZLQC 4MX7A 3IDJB 1SYVA 4JPIA 3VG0L 1E4JA 3EYSH 3OX8A 4FQCL 4H88L 4OCYH 1UQSB 2X4NA 5T33L 3ZE2F 3UC0H 4D0CA 5KSBA 3FONB 3RUGB 3SCMD 4FQHA 4FQIL 1U8JB 4TTGA 4GG6A 1TVBA 2EDRA 2J8HA 2YR3A 3G04B 5DD1H 3TYGH 5I76A 5I8KH 1X5ZA 4KZEH 3IFLH 3VCLB 2ED8A 3UXFA 1RZFH 5FYLH 3LD8B 5HYSA 1S7QB 3W0WD 2BX5A 3MOBH 3I6LE 4QHMA 4DW2L 4H1LG 3PWPA 2NY3B 3U0WH 4MNGE 5H94B 2J2ZA 4N0UE 3HNTL 4X8JA 4M48L 3D3VA 3VGHA 4JFEE 2OXGA 3HZVB 4BQ9A 4TSBL 3H3PH 3MLWH 3C5ZC 3LN9A 4NCC1 4U6TA 3HI6H 4XMLL 1NGXA 3VXNB 4DCQB 4HK0B 2I25N 2CKBH 1ETZA 5C0IA 2EDLA 3G6AB 8CGTA 4Y4HC 4OLZL 1YY8B 4Z7NF 1W72L 5CMAB 4P2RE 5HYSG 3FB6A 4U1KB 1GYAA 1DE4B 4X7SL 3DBXA 2PO6A 1CI5A 4R4ND 5CWSA 1BQLL 1V7ML 3IDNB 3ILQD 3U7WL 1KLFA 2PW2B 4XCFL 3UTSB 3UCRA 5T1LB 1YECL 3L5HA 1UH3A 1Y18B 2P46B 3M07A 2VDPL 1SMOA 1NFIB 1KPUB 1S9XB 4D0DB 1EZVY 1W8NA 5F71A 4O2CA 5DMKA 5DO2C 5IFHL 1EFXD 1U91B 1XF3B 3KPRB 2FJFB 4LGPB 1P2CB 4JO4L 5DK2B 4OZHB 4MXWL 4RZCB 3TFKC 2X4TA 3Q6FB 1KCUH 3ULUC 3RIFF 3BE1H 2NTFA 1GZQA 2AK4B 4HUVB 1EEYB 4P2YA 4P2QE 1A6TA 1CDHA 3RWIA 2IALA 2RJMA 4A6YH 3CVHA 5L7XL 3O3UN 3CX2A 5DVKA 1DUZB 4JFDE 1J8HD 2V5TA 3ARGB 2YXFA 1FFOA 4HZLA 5L2KB 3KLDA 2KL6A 3DI2B 2XPGB 3RVUD 3CFJA 5KOVC 3TA3A 4EI6A 1MJ7L 1KCVL 3HC3H 3H0TA 3ARVA 5KG9A 2H8PA 5DJXA 1KIUA 3MRQA 1DVFA 3VI4F 4PR5A 4BZ2H 4H0GA 4RAUB 4W81A 1P4LB 3HE6C 4YXKH 3MODH 3BPCB 5JPNB 4NDMA 1CQYA 2COQA 1U8IB 1HEZB 1RUQH 3HAEG 4YDJB 5CIPB 4Z7OE 4M1DH 5BS0D 1ZS8A 2AJSL 3P4OB 5IVZB 2Z92B 3VWKC 4C83A 3DV4A 4KKLD 2Y07L 4HT1H 4I18C 3S7GA 4GW1B 3GHEH 1OT1A 4ZSOA 5GRWA 1HYRC 5IW6A 3NBNA 4L5FL 3IDUA 2LTQB 4WHDA 1TENA 1I3RA 4WI7A 3KYNA 4QYOA 5CEXB 4LLWA 1CLCA 2R2EA 3VRJB 4KK5C 1LD9B 3F6LA 5FGCB 5C0BD 2R1WB 2EDYA 2HVJA 1MAJA 3TZVB 3C6LA 3FN9A 1EFXA 2FNBA 3W2DL 1BVLA 3C6SA 2BNRB 4I18B 4N8VG 1SEQH 3V6ZA 4NUGL 1FFOB 3LQMA 2P24B 1FIGH 1U3HB 4RFOL 2LTQC 5L7XH 4KJWC 5I1JL 1MJ8H 1UQSA 1JNHB 3RVXC 3U7YH 2VDNL 4NHCL 1GGUA 1W72A 1R3JA 4JG0L 5E7BA 3FOLA 3WSQH 3BP5B 1DUYB 2IPUK 3Q48A 1HOCA 3PNWB 5A3ID 3EO9L 1N59A 1TJIL 1MCJA 1UZ6F 2YSSB 3N1MC 5ESAB 2ITCA 3FTGB 3O11A 1QQDA 3MREA 5T1LD 4D0DA 1E6OL 1MHCB 2CH8A 3GMNB 4N8VA 4PRHE 5ENWA 3T2NL 4AEIH 1M6OB 2C3HA 1J1OL 2DQEL 3QHTC 4G8FB 2OMBA 5C92A 2AJYH 5I2IB 4HIEA 4QHNB 1F4XH 1LHZA 1KJVA 1FIEA 4CU7A 4WCYL 4X5WB 5GSRA 1CIDA 3MR9B 5KJRH 3IYLW 4N8CL 1KEGL 3GMOA 2L7UA 4KHTL 4M6NL 1JHKH 3QQ9C 4LLUB 5DTFA 4JLRA 5F9OH 2DQUL 3QNXA 2ITDB 4Y2OA 3W0WA 3V7AG 4XMPH 1AD0B 3MC0A 5HHOE 5CS7A 4YZFF 2FHBA 1FIGL 2J12B 1AGFB 4JZJA 5IVXB 1NGQH 3TVMB 5CP7B 4R9HA 2NY6D 5ICZA 5JOPE 1FL6A 3FT4B 5SX5K 5LJYH 5I1KH 4OCLC 3RU8H 4XNMB 3SKJH 4MD4B 1MF2H 1HWHB 2DBLH 1AQKH 2P4AB 4JFOA 1QOKA 1K4CB 4NBXB 1AY1L 2F53E 4ZO9A 5JW4N 1YN7A 3P77B 1S7QA 3OAYH 1CU4H 1C5CH 1UZ8A 3TV3H 5B8CC 1QSEE 3VA2C 1OP5K 3TVMC 5JHLH 2OTUB 2PW1B 3TBWA 3RAJL 1D6EB 4POYA 1I7ZB 2NY5L 4OF0A 3RWFA 4KAQH 4LVOC 3VI4E 4G6AD 3DXAB 2NZ9D 1L7IH 3JTTA 3MRMB 3IRZA 2Q3ZA 3MUHL 3VFOA 3PP3K 5JIKA 1EAPB 3LB6D 3HR5A 5E2VH 2ZSVB 3RIAF 3SGJA 4U1NA 5ID1A 4WTZA 1ZHNB 4YC2B 2GAZB 4KI5E 4HG4K 5I30L 4J2XA 3LHPL 3VXSA 3PWNB 2HTKC 4P4RA 1RMFL 4KK9D 2E9IA 2B4CC 2IC2A 3Q1SL 3AXLB 3QB7C 1IT9H 5T1DL 3IVKA 4M93B 2Z93A 4GMSH 3V5KB 5GRXG 3LKPA 4HV8B 2PYFA 3BPLC 5EH1A 4LKXA 4JZOB 1SVCP 1NGWB 1QFWH 3B5TA 5E6IB 4H8WC 4LKCB 2VYRE 3RTQC 1CLYH 4K7PY 3TFKD 3NH7H 1MEXH 2FECL 5EULV 2XWJA 3QULB 5LG1A 1P4BH 2QR0A 3CUPB 4UI2A 3D2UB 2B1AH 3NACH 6CGTA 1C5BH 4YX2L 5IKCB 4MVBD 4PRHB 3EDDA 2CK0L 4XGZA 4FG6C 4R7NA 2I26N 4JFYB 2GSGA 1AQDA 3Q5YA 1KPUA 2CLZA 4HCRH 1MCBA 5D9SA 2EYRB 4PJGE 3O6FC 2VZVA 1NSNH 3HPLA 5D1XA 1C12A 4Z7NE 1CGXA 5JHLL 1KN4L 3D85D 3T4AB 2YC1B 2HP4A 5EU6E 1BP3B 5JMRA 1IEHA 2I07A 3DURB 5J3HD 3P2TA 4X7CC 1OCWL 4L5FH 2Q6WA 3WL9B 5CBEB 3IVKB 3QFJA 1AXTL 1FE8L 4U6YB 5E9DD 2EE2A 4QRTA 1KIRB 15C8H 3X14B 4YIQB 2GFBB 4KXZH 3LKSB 4PR5B 2IANA 1ZLVK 1S7SA 1BBJB 4JDVA 1KTLB 5LAXA 2MCPL 4GW5A 1AH1A 3T2OA 3VD4A 1N6QH 3RGVD 3HPJA 4AT6A 3HNTH 3TV3L 4WI2A 4WW2A 1JRHH 3RQ3A 4NKQB 5IOPA 1FSKB 5DLMH 3CSPA 1T5WB 4JFFE 2QSVA 2H45A 1NH6A 3IXAA 4JO3L 4ZFOA 3MV9A 4TUOB 4BUHA 2VDLL 4NRZA 1FG2B 1PYWA 3W0WE 2E7BA 4PJHA 3V8OA 3TO2A 4ZOEA 1P2CA 4XXDA 4KROC 4X4XB 2AVGA 3GMNA 4N8VB 1GIGL 2AQ3A 1JNJA 5FA3A 1JNNL 2CIKB 4F33A 1QQDB 4G8EB 3EJYC 1PLGH 1EHXA 3MLZL 5IF0B 1WTGT 1T1ZB 1FPTH 1YEGL 4KK6D 5DI8B 3QCUL 4HWEL 4LVNB 2NY2C 4CW1A 5I17A 4WI4A 4PJEE 4G8GD 1H3GA 2M8XA 3S35L 2EDKA 1HWGB 5CZVH 4J4PC 1EO8H 1HXMB 2K7QA 2VNCA 1MCSA 2HT3C 5D2NE 1A7QH 4FXGB 2VITA 3LSOB 4FQXB 4H0HB 4NQCB 4ZFFA 3TA3B 4WHCA 5T3ZL 4OM0H 1RJLA 1JYXA 2X4QB 3G5ZB 2EKJA 2B4CH 5DURB 3GIZH 4DWHA 2D7NA 4G7YH 5IJKA 4XVUC 1OW0C 2V9RA 4I18A 2BNRA 1P4IL 3EFFB 4HUWB 1WZ1L 5B4MC 2IMNA 2MJWA 4X6DB 4XVUD 1A4JA 3ZTJH 1NGXB 2NY2B 2HVJB 2EO9A 1XIWA 2E7LA 3FO1A 4HC1L 4OM1H 5ANMA 3MRFA 5E5MB 4TSAL 1TZGL 4FQXC 2BVPA 3RP1A 1ES0B 1A3RL 3SKUD 3OBAA 3OHXA 3SE4A 1AGEA 3VJ6A 4JO2L 5GHWL 4R4BA 1NDMA 1C5DB 4NZUH 4EDWH 2E8YA 1INDL 3R4DA 3MACH 4R96A 3D69B 4YHLL 1A64A 1FZMA 3CNKA 4YFEA 3DMMA 4KMTL 4QTIL 5C0EB 5F6HI 4NWTL 9CGTA 2CDFB 5E8OB 1NC2A 4LDLB 5CJXA 1CD1B 4I1NB 3L95A 3ZDXF 1BZ7B 3D39B 1FVDA 4Z7VA 2JKXA 2YA2A 5D72L 1TCRA 3CFBA 5CZXC 3WE6A 2DB8A 2ADIB 3LY6A 5F7FA 4ZDHB 4R8WH 1DJSA 5TGBA 5GRZA 2Z0BA 1F90H 5ITFB 4CVWA 1G9NC 2P5WB 3O3DA 1K5NB 3F7YB 2XTJC 3RA7H 3OL2A 5DZLA 2HKHL 4J8RB 2VAAA 1JYWA 1KENL 3WXVL 1CBVH 2ERJB 2CK2A 4OZGF 3DECA 3IDYB 1DUZA 4FQXD 4JQVC 4PFEA 1PX3A 1YMMA 4Q6IA 1O7VA 2ID5A 4R90L 4PIRF 1G7PB 5KVGL 1I1AD 3FFCE 3NIDF 1VADB 2IG2H 3BIAX 1WEJH 3CFKB 4EZMA 4X0KB 1JE6A 3PWVA 5AAMA 4MNHB 4E42B 1NC4D 1SBSL 3U4AA 1E4XH 1ZHLA 4PJEA 1N5AA 5FECA 2A6DB 1YQVH 4PV9B 3ORJA 5D93C 1PBYA 3HS0A 5ICYA 2EIDA 5MERA 4R0LA 2YD9A 1MFBL 1RIVH 3HI1B 4YDJA 4Y7MA 5I1EH 3IDJA 4RFOH 4G7VH 4HXBL 4WJ5A 4AG4H 3B2UD 1YMHA 3CFEB 4UBDC 3VMPA 3DO3A 3QZWB 4P2OD 2B2XH 3KJ4C 3OAZH 2BY0A 5D93B 1ZSDA 3KXFE 4RMVA 2YUZA 3G08A 3J7HA 3MOBL 3KWWA 3TNNB 1JV5A 4Q0XL 4X4XA 5J1AA 3VFRB 1NC2B 1EERB 3ARBA 4KQ4L 5IR1B 2HFEA 5D8JL 4NO5B 1MPAL 3IKCB 2BFVH 3QJFA 4X6DF 3TBVA 1K4CA 4ZG1A 4PJCB 3D18B 1VGEH 5F89A 2X41A 4Z0BL 1BGXH 2NXYB 1H8SA 4KK9C 5FYKD 1CBVL 5IB2A 1DEDA 1FE8H 4GRLD 3W11C 5JIHA 1I8IA 15C8L 4EVNB 4RMWA 4XPAH 1UWEH 1LVEA 3WXWL 5FO8B 2LQRA 4MXQD 2K1MA 4P4KC 3IFPB 3QT2A 2GI7A 3KYKH 3C5ZA 5KAQF 4OI8A 1TPXC 2AJ3B 3CXDL 4MQXD 4U1GB 5D7KD 2FL5A 4P3CH 1KCVH 3QI9D 2C9AA 3PV7A 2Y9RT 4KUCD 5K59E 4PJ5A 1VHPA 5F3HA 2C7UB 4KRNA 5KANI 1IC4L 5D1ZB 4WHYH 2R4RL 1J8HB 1U8QB 4NM4L 5D7JA 5FKPB 1NBYB 2R56L 4QHKJ 3PG2A 4XRCA 4Z18A 1ZA6A 4D9QE 3H9SE 3TH2T 3I6LD 3GEWB 1DLFL 3PP4H 3CLEH 1MJUH 2KQNA 3DYOA 3GHBH 5IVXE 4PRIA 3QFJD 1WGOA 2X89A 4MJ5B 4PLJC 4M8VA 5TE4H 5TDPB 3IGAA 1I4FA 5D1ZC 1WAAF 1P4IH 1QFUL 2OMNA 4WO4D 2P8PA 5CBAB 1DQTA 5D1XD 1DZBA 2G75A 4Q7DA 3LPGA 5GIRA 1NGPH 1HHHB 3NN8B 1T89A 1J8KA 1JNHA 1RU9L 1KNOA 1DQJA 5TF0A 1DCLA 3H6JA 1JZ7A 3JUYA 4B41A 1H5BB 1P53A 2CDEA 3U30C 2UY6A 3CVHL 4AL8L 1K3ZA 5TDOB 1P9MA 5KZCD 4Q97A 2JELH 3WS3A 1M7IB 1IAMA 2V7HA 2NPLX 1FCCA 1MEXL 3K7UA 4XMLH 4Z76B 2XQBH 3FKUS 2YPKB 4HS6B 4OCRL 1TNMA 3TN0B 4NQED 3QIBA 3RBGA 2FX8H 1Z5LA 1LO3H 4LMQI 5A40E 5J6GB 3DRQA 2HG5A 1UM5H 4G6AC 1OOAA 3SKOA 3MRHA 5F7KC 2J8UF 3X17A 4U0RC 1U36A 3M45A 3FAWA 3VH8G 2VXSH 4KVCL 5FHAH 3MQIA 3TF7C 5EUKA 1T1YA 3R06B 3QFDB 4ONHB 2V17H 5IQ9A 4M3KB 1T4KB 2ESVE 3BDBA 4N0CC 5KN5A 4RCAA 4P5TB 4O2FA 3I02A 2EKSB 4KJPD 4D8PA 1WUNT 3IDXL 4HIHA 5D1XC 1JBJA 5CIPH 3O8XC 3ZKND 4IM8A 3ZE1F 5EN2B 5EPMB 3QDAA 4LIQL 4W6WB 4I2XE 3V6BR 1G7IA 4EN3D 4IJ3C 3HZKA 4J6RH 4NN6B 5A2IH 3UYOD 4WTXA 1MCOH 4FZEL 2J1KA 5KSUA 2DJUA 4XX1E 1KTLA 3JSSA 4HMDA 3T0XA 4LCWB 1B0WA 1RPQA 5HGDB 5ICXA 3T77A 4NNXB 3F5WA 5KJRL 1NGPL 3UTQB 3I6GA 2EEDA 2C5DC 3NIDE 3MA9H 2DQEH 3O8XB 2OX5A 1AD9A 1U93B 2MCG1 5L9DH 1HH6A 4TVPH 4WRLA 3KDMA 2JJSA 5E08L 4Z6AT 1IGCH 3MGTA 4L4TD 4Y5VC 2VQ1A 5T3XD 2NY4D 4G80A 2FJFA 4HBCL 1FBIH 2ESVA 4UT6L 2XWBB 1BLNA 1AE6L 4ODHL 5I1IL 2F8VA 3VGFA 1MFAL 4N8CH 1UWXH 2ZPKL 2HMID 2IH1A 4NQVB 5EBLB 1JPTL 2G60L 2X4OB 3LZFH 1F11B 2A1WH 3MRJB 2LU3A 3LB6C 4OD3L 4I3RL 5T3ZD 5J1AB 3MLWL 3I3BA 1HOCB 2JK5B 4KJQD 5HBBA 1RHHA 1NGWA 2EICA 4UU9A 1TITA 1NEZG 3PWJA 4DZ8A 3OKMB 1XGTB 4JHAH 3QEGL 1R5IB 4XPAL 1BFOA 3FT4A 1DQDL 4WV1C 2CKBB 2X44D 3MLTB 1S7TA 4UQ2A 2X10A 3ZO0A 5TQ0L 4FQIH 1PQZB 2BSSA 5TE7L 4ONOA 1I7UB 3HUJA 4F8QA 5MP6L 2WBJA 4BZ1H 5IQ7H 4LPUA 4O2EA 2P45B 43C9A 5LKNA 1DFBL 5T1MB 4YDVB 5HHPB 5DTFB 3DVNB 5DVOA 5DHVA 3OKEA 4OLXH 4I5BA 1UT9A 2PYED 4PG9A 4UTAL 4IRSA 4JR9H 3MRBB 4U1JB 1NCWH 4QXUH 4X5WA 5ISZA 3HE6A 2Y06H 1C5BL 5J9PB 3VWKD 2B0SH 1YEDB 2XXMB 2FZ3B 5TDNB 1A1OB 3H3KA 5KVFH 4L8SC 5T5FL 5BV7L 2ZOKA 4C4KO 4YHNA 1DBBL 4UV7H 2YS4A 1L7TH 3FO9A 5KAQG 4HWBH 3M17A 2E7CA 2Z35B 3EOBB 4U31A 4I3SH 3LD8C 3MRCA 1FV1B 3VWJA 1AHWB 4ZFZB 5DF0A 5T1DH 5HGBB 5IMLB 3BJLA 4F2MB 4OIAA 3HAEH 4Y1AD 4EI5D 1GRWA 4L8SB 3J8F7 5EO1A 5EZJA 2XNAA 2W9DH 5DYOA 5E8OA 1XCQB 3OKOA 4Q2ZB 4ZYKA 1NUNB 4GUPB 1IGJA 2QHRL 4O51A 3V4VL 3HS0B 1D5MA 5KVGH 2XN9E 1CK0H 1YEFH 2HLAA 2VXUH 4G3YH 4WUUA 3UTSD 4WEBL 2X4PB 2LU4A 2WQ8A 1RD6A 1DVFD 3QPQC 2F5BH 2IAMB 3PQYA 3QUXB 3T65A 4GG8B 1FZJB 5JO5B 1ES0A 4FTVA 5C6PB 4LLWB 3EOAA 3HZYA 1J86A 4WEUD 5DO2D 5ACZA 1J0KA 1ZA3B 3MBXH 3VFSA 4KUZL 1QLFA 3O6KL 1AJ7L 5HY9B 2OZ4A 3BVNA 3V95A 4H5SB 4LSVL 4JDZB 3PGCB 4YPGA 5CEYB 4G6ML 1H15B 3RJQB 2OBGA 5IW1B 1KB5H 3UBXB 3TEUA 1OQOA 1YYMH 4WEMB 4TRPL 2Q7NA 4K71C 5D1QB 4JO1H 5J89A 1ZXQA 2AEQL 4LLMB 1Y0LA 1F8TH 4FMFA 3QQ3B 4PRID 3FRUB 3MCLL 5DC4B 5DJ8B 1DANT 5DJYA 3RIFK 5C0RH 2DQGL 3SDXF 2JJWA 5GGQH 3IU4L 1CICA 4XC3L 1KCSL 2XWTA 4XAWL 2W9LA 3KYKL 1BAFH 4X4YB 1ZLVH 3ECBB 4YJZL 2AJUH 4X80L 4U6HB 1UVQB 5ALCL 1T66C 2BOCA 4NC0B 4RAVA 5D1QC 5ELIA 4HT1L 3B8YA 1L7IL 2X4SB 4FABL 4R26H 1ZLWH 3BX7C 3MMEB 4GXUN 1VFOA 3IXTB 1N0LA 3IJSA 5D71H 1JHLL 2QADD 4AH2A 1NLBH 1ZT7B 4ZUSB 5JUEH 2NY2D 2FYYB 3FB7A 3VFTB 1FG9C 1RUKH 3UEZA 2R0WL 4HMCA 5A2JH 1U8JA 3H7BB 5C0JA 4L3AA 1F58L 1J1PH 4KWUA 3D25B 2BOBA 2NY1B 1X6NA 1KIQB 1MIMH 4L8CB 4QTHA 1JF6A 3O4LA 1TJHH 4XBGB 1AC0A 1JJUA 4FFWC 5GSVA 5F44A 4U33A 4Y89A 4XT1C 3ZE2E 2R1YA 1JGDA 4K07A 3X11B 1YMHB 3FN0L 4K7FA 3KPOB 3LS5H 1ZGLP 5HXMA 3VMOA 4PJIB 3RGVC 4MXVE 2OQJA 5SWQB 2B39A 2K7PA 4J3VA 1HSAB 4MWFB 4Z7WB 3EDJA 5J12B 4PREB 5L2KA 3QDMD 3UBXA 2NY1C 4WWKA 4Z9KB 3AY4C 3WNPA 1KIPA 1UC6A 5D4QA 1I1FB 1I9JL 2J8UE 3CMGA 1ZEAL 3BIKA 2D0HA 1UEYA 1T3FA 1JZ8A 2VLJB 3O6KH 2DM4A 2DJSA 4ZPTB 3MBEA 3QWRD 3MV9E 1F4XL 4TUJA 5ANME 3NFPA 1LQSR 3LRHA 1RZGB 1DSFL 4ZTPL 4B7LA 5DA4A 4WW1A 2A9NL 5D2LE 5D6DC 3QG6A 4KAQL 3C8KB 3GJFB 1Q9KA 4M7KH 3RNQA 1GGBH 5IEKB 2J4WL 5LAXB 3BPNB 5C0ND 1OCWH 2X1OA 5C07B 4YGVA 1WJ3A 4XTRD 5E0QA 5DZNA 5ABDE 4Z78B 4Y8DC 5AD0B 5GRJH 4Y1AE 4Y4KB 3UTTB 4UT9H 2R0WH 5JXED 3GBMH 1RIHH 1WQVT 4OCXH 3QP3A 5FM4A 3QRFM 1WT5A 1CE1L 3CZFA 3GKZA 3UP1A 1QRNA 1A7OH 3T2PA 1IM3B 5IJVB 4P59H 1S7XB 3HB3D 4J1UA 2WZPD 5EU6A 3V0VA 1ORQA 2ZCKL 2NLJA 3O3EB 5DFVC 5FYJD 5JLZB 1NMCB 4HK0A 5D70H 3MYJA 1VFBB 4NJAH 3MTRA 4X6CF 1LEIB 2I60L 4U1HA 4YO0A 4MS8C 1A6UH 3PWPE 1SM3H 1UM4L 3QQNA 5EUOA 4C54A 3D85B 2O5XH 1OAXH 5K9QG 2DMBA 4PTUA 5MEQB 1YEHL 1A9BB 1L4IA 4U1LB 3VD7A 1OF2A 1ONQB 1GJIA 2MFNA 2CXGA 2GJ6E 5EWIH 5CGMA 3VXMD 3FZUD 5C08B 3WDJA 3O41A 1AXSA 4NM8L 3O9WD 1MCQA 5B39A 4GG6B 4KKCD 3OR6B 4XCCL 4I0CC 2QQNL 1D6VL 4OKVA 5I1GL 2V2TB 5E24E 1MCPH 1WCBA 2Y5TA 4MZ2A 2H1PL 1XCTB 5I75B 1SEBA 3GRWA 3NIGF 4XP1L 5IBLC 4MJIB 3TNMA 4L1DA 3U2SA 3VGAB 4PRPE 2NYYC 4CDGC 4DZ8B 3SO3C 4LCCA 4OGXL 5FHBH 2JCCB 3L3DA 3RWJB 3T0ED 5JQ6H 3WLBB 1H3UA 3SDXE 1AXIB 1IE5A 3A6BH 4ELMF 4DOHB 2AEIT 3FOMA 1NAMB 1EJOL 3HMXL 2DWEA 3EFDL 3H3PL 5B39G 1YJDH 3LKQB 4J4PA 4NKMA 3G6JE 2R0LH 4YXLL 5DR5H 1FN4B 2NY6C 1TJIH 3CH1B 5LXGH 4ZAKC 5EUOB 3QYCA 4R4FL 1YPZB 1P7KA 1P84K 5HHOA 4PG9B 1ZANL 4YBHA 5HGAA 3G5YB 3O8XD 1S5IL 5HHQB 4XC1H 5DGQA 1N4XH 5EUOE 4BFBD 4QXTB 4WW2B 2CGRL 2GJZB 2XKSA 4GAJL 1JZ2A 3KHOA 5SWZB 5SWSB 4OD2A 2EXYD 1EX0A 5AYUL 2PXYD 2F15A 2AV1A 1G9MC 2XA3A 4YHIB 5DHVH 3CX5J 1P7QD 1JIBA 4LPWA 4OGYH 1MVUB 5DEFA 3TPUB 3C6SB 3QXDA 4YAQB 5FUZH 3K46A 1GC1L 2W60B 2AW2A 1LO2H 1YEIH 3MJ7B 1N7MH 1MFEL 1IL1B 1JNLH 4IIQB 2I9TB 4JVPA 3AY4A 4F15B 1DL7L 3VXQA 1MUJA 4MD5B 4S2SA 1WFTA 5JNYA 3AUVA 3MLYL 4KRPB 1W0VA 4CVZA 3WS6A 1LK3L 3M1BB 5F1OB 4PJCA 3U46A 3QUML 2EDDA 2Q8AL 5CILH 1N0XL 1RZKC 2B4CL 5L6YH 2FJHA 4GMTL 3KPMB 3PGDB 5GRUH 4M7LH 4ODUA 3CUPA 1Q94A 1HQRA 4K3EH 1FNEB 1NCDL 1UADC 5DQJB 3GBNH 5L8KB 1N59B 1DEEA 1I1YA 3ZTJG 1K8IB 2QQNH 4PJ8D 1FFNB 2FECI 2DD8L 2VZUA 1OWRM 2WINB 1T5XB 4CJ1A 4RDQF 1SY6H 3O2DA 1FZOB 3C8HA 1FSKC 1F4HA 3QIBB 3ALXA 3P73B 4TYUA 3TO4D 5KVDL 4JM2D 1JGUL 4O5LH 2XZCL 1DVFB 4X4MA 1RJYB 4FFYH 3SGEH 4NSKB 4QGTA 3RWDA 1X5XA 1OAZL 1JTPA 3Q1SH 1MAMH 1Q9KB 2PTUA 2OTWB 2DLEA 1GOFA 3FAXA 1OP3H 1BM3L 3L3HA 4QT5A 3GMRA 2BERA 1IJ9A 5EC1A 2AK4D 1EHNA 4X7TB 5A2FA 3QIBC 2YN3A 1AJ7H 2AK4A 4KJYB 4L8BB 3LV3B 3T0EB 4LLVB 1G0XA 5E8PA 4POZD 4O9HL 4DN4L 3NPZB 7CGTA 5KN5B 4JREC 1ZE3C 1N0XH 2EDXA 3NFNA 1NCUA 1Y6MR 1A7PL 5E2TH 2EDHA 5JXEA 3MLRL 3NCYP 4ELMB 3BN3B 4UAOB 1IGIH 4X80H 2Q8BH 4YXHH 3MV7A 3LQAH 4U3XA 1YPZF 2E9WA 1GC1H 3K81A 4QRRE 2CRYA 1YEHH 5GGQL 3DX8A 3RL2A 5IM7A 5DFVD 3VGGA 5MEOB 3HB3C 3KPLB 2NY3D 4K3EL 4YHZH 3N1QC 3FQRA 3QUMA 5CFHA 1B2WH 1MHHA 4OLEA 1IC4H 4NJAL 4JY5L 5F21B 5DJAB 4OCWL 5H2BB 1KGCE 4LVHB 4H8WL 4KVNH 5CHNA 5IMOB 1A6ZB 4PLJD 2DQUH 4JJHA 1CGWA 1T6WA 2OR8A 2YWZA 3DUHA 4FQCH 5KVMC 2HFFA 4EIZC 4MMXC 4YQXH 3SCMB 3UDWC 4H5SA 3DX6A 4JKWA 5BO1L 1QRNE 4HH9A 2EECA 3DGGA 1AE6H 4XH2B 1VDGA 2EIZB 4KTEH 4PJ5E 5L2KD 2CMRH 3C60B 3BP4A 4I48B 3Q6FA 3SKNA 1SHMA 1R3IL 1U41A 4HLZG 5I2IA 3QIWB 4YDIH 4JR9L 5DMIL 4OZGB 3ARDB 4XPGH 4XNZC 5E4EC 5LGJA 4QCIB 1SJXA 4O2CB 3HMXH 4K7PL 5FCUL 1RZIA 1VACA 3E6FB 2OS7A 4OV6F 4OLVL 4IRJA 4RA3A 5E8EA 2CIIB 3ARFC 4BQCA 1FFPB 4G5ZL 3KPNA 3MRLA 4L8DB 1JWUA 2X4QA 3G5ZA 3C60C 4P4KD 5DEGB 5E94B 1FL3A 4XCYA 3FHQA 3UYRL 4AQOA 2R29H 3L3KA 2XXCB 4HWEH 5FYJU 2CKBL 1WBXA 3QIWC 1MAML 3LEYL 3V5DB 4BH7A 4V1DB 4PD4K 3ARDC 2E6PA 5E4EB 1IZKA 1AHWA 3B9KB 3C87A 5CJBA 3MRGA 2I9LA 2DQTH 4N0YH 5TQ2L 2OP4H 4GKSB 4I4WB 2VL4A 1J05B 4XVJH 5I8CB 2KUTA 5CINH 1MI5B 4OFIA 1VEOA 1YUHA 4L4VA 3RTQA 4PGEB 1UKQA 1CVRA 3RGVA 1ZA3A 8FABA 3ARQA 4IOIB 1F3JB 3CFCL 4JFED 4N9GA 1S78C 1UM6H 2WBJC 3LAFA 3DVGA 3C2SA 3B9KC 2F58L 3D18A 4LHUB 2ICWJ 3L7EB 2R56H 4P2OC 2H32H 5EZIH 5F6IB 4U2ZA 5I6XC 4RIRB 3BZFA 1DBJL 3WYRA 3NCJH 1V05A 3CFDA 4EQ2A 1IBGL 5MEQA 3WIFB 5C0BA 4JG1H 4BFEA 3KPPA 3AMLA 3HUJB 2ZJSH 3P0YH 2FATL 5EZOL 1OARL 4Y16A 3ROLA 5KSBE 5EO9A 3CDFA 1S9KC 2OR9H 4JHBA 4S1QL 3NIFE 1EZVX 3CIQA 1I1AC 2VABB 4H25B 1UACH 1CT8A 3TT3H 1KCRL 1I8KB 1RIHL 1S7XA 3OKMA 2F54E 4PJAB 5INCB 4EEEA 1PDKA 4H1LA 5F6IC 3C8DA 2H6PB 3IJHA 5GGRY 3TIDA 5EC2A 1P7QB 4OZ4A 4LLYA 2NXYC 1HSBB 1A8JH 3OAZK 2PCPA 4Y19A 2FBJH 5C0RL 3EO0A 2QSCL 4OCSH 4XP4L 4F57H 3GUTB 1S78D 3DMMB 3RRQA 4A2LA 5J1SC 3LKRB 1E4WL 4U1JA 2AABL 2NZIA 1K85A 1ZHLB 2QKIB 1FZKA 3V6OC 1EMTH 2EXWD 3GMMB 4PV8B 5DS8B 3RWGB 5TE4L 3ULUL 1EHLL 4N0UA 3BRGC 5CUSL 1J0JA 2F54B 5GS0H 4NQSB 2VO5A 2V2XB 2ZG3A 2WIMA 3LEYH 4G6MH 2ICEB 3GMRB 1KPRB 3MGTB 5AWNH 3QUXA 3T65B 2WBKA 4PGEA 5E6IA 2W0PA 2W0LA 4ISVB 4PV8A 3RWGA 2I9TA 3GJEB 4PJXF 3EFFA 4WUUB 5HHMD 4HGWB 1IFHH 4CN1A 4N0YL 2PW2A 1D9KA 1T1WA 1S9YA 1AP2B 3DRTA 2HJFA 1RMFH 5LQBH 3EO1B 1WFUA 2E6QA 4P4RB 4P5MA 1CXLA 1KPVB 3PF2A 1UFUA 3E0GA 4XVSH 1I1YB 1WWCA 3L95B 1FJ1A 2YKLH 3GB7A 3PHOB 3GMQA 3IAGC 3MROA 2EDEA 1IZJA 3GO1L 5FO9B 3GFUA 1LMKA 2IF7A 4IMKC 4JRWA 3QIUA 1NFDF 2W92A 2QQQA 1FGVH 3RZCB 4PLNC 1AKJA 4OZFA 4BFGA 1JHLH 4FFVC 1DBAL 1MCNA 3FT3B 5I74C 1MY5A 1UH2A 3K1KC 3U30B 1VKXA 2YA0A 3RKDC 4N0RA 4X8JB 4GBXA 1FG2A 1P69B 5FYJL 3EIFA 2F5AL 3STZA 4KK8D 1IRAY 4M62L 5E7FA 4PRDB 1OAQH 1WWWX 4YR6B 3SEPA 4XC1L 3FN0H 4KGLA 3CPLA 3NCCB 5DHVB 1QG3A 5ESVB 1NBZB 3DVGB 2PETA 3BN9C 1OPGH 2LE9A 3QUYD 4KROD 5EIIB 1UWEL 4RISL 4N68A 2Q3AA 4XPBL 5JORA 1G7HA 3MCKB 5I74B 4M1GH 5EDXA 1S7TB 4UQ2B 1X5YA 5A2LH 1K2DB 3OMZA 4DQOH 3RDTC 4JN2A 3M8OL 1T1XA 3GMPA 1D5XA 4OCXL 3FRUA 2AJSH 2CLVB 4XCNA 3SE3C 4UB0L 3KNBB 3PV6B 35C8H 1E27B 4R6UA 3I02B 1T22B 4BQBA 3VW3L 2CLRA 1QLEH 4G8EA 5CLTA 5IGXL 4XPHL 4ZTOH 1DQML 4TUKH 2AEWA 2MQ3A 4HHAB 3HE7C 4WU7A 3SDAB 1TIUA 4IJ3B 2IPUG 1EGJA 4PJAF 4Z0BH 1CLZL 2H3NB 4X6BB 2EXYC 3VXTB 3TBSA 3QNYB 2GSGB 4K94C 5GZND 3V2AR 3MNZA 1YN6A 3D1MC 3VFWB 2R23A 2Q7YB 2VZ1A 5LGJB 1T0MA 4UV4H 4JEGB 3CLEL 1FO0H 3P9WB 5IFAL 3FQTB 1CD8A 1HHJA 3LKOA 2W0FB 3BH8B 4GG8A 3HHRB 4JM2F 1JN6B 1JPSH 3H9SA 4LDEB 5LBSH 5HVHB 4XP9L 5ID0A 1QP1A 3MLZH 2ADJA 4GW5B 1G9MH 1VB9A 2C4FT 3G5VA 4HFWB 5E8NA 5EWIL 4DKAA 1FFRA 4R97C 5D1ZD 3S37H 1JPGB 5HGGS 2DKUA 1U8NB 2PCPB 4HJGB 4RISH 4Y19B 2J88H 5C07A 2JCCE 3DPBA 5DVLA 1VSCA 4MYWB 5KSUB 5H37G 3K74B 5CBAA 1LD9A 2WAHA 1ZHNA 2D7MA 3GJFA 4QRPB 4G43A 3EYFB 5I1HL 4XP1H 5IB2B 4FN0A 1N8ZA 3KPQA 5FO7A 5H35A 1AO7A 4LAQH 1S7WB 4HIHB 4JQXA 4AIOA 5IHLB 3ULVE 1F4AA 2A83A 3MV8A 2P8MA 4R97B 3VRIA 4F7PA 4QXUL 1A7PH 3GM0A 1CFSA 4UDUB 4NN7B 4PRHA 1OARH 4LOUD 3TBSB 2F53A 1BREA 2DF3A 3OJMB 4FQLH 4KI5D 4I2XA 1NBYA 4OFYA 4ODXB 5E70A 4KTDH 3IDXH 1GPOL 1BJ1J 1ZHKB 4U1IB 5D7LB 3DROA 5D1ZA 4MA8H 2P7TA 1BPVA 3DLQR 2JJVA 4QTIH 2CGRH 4Y4FB 3P0VH 1PD6A 4YAQA 1WBZA 4GRLC 4LPCA 3QHFL 2HT2D 4LU5H 4YZFE 2PYEB 3QPXH 1A6PA 1EO8L 1FL6B 4P3DB 1VEMA 4A6YA 4BZ2L 1T7XA 1FGNL 1MWAB 1Q0XH 5AG9A 4HF5L 5CZKA 2BNQD 2BNUA 3WD5L 1WCQA 1F8TL 4NYLB 1KJ2B 4EUPA 5CSZB 4N5UA 1PX4A 3JVGA 2BOBB 3NZHL 1ZT4B 4EIGB 4NKDB 4TRPH 5LCVH 2HLFC 2PYEA 4JPWH 4LAJH 2XG4A 2ZUUA 3CU1A 2D0GA 4HXAH 2YD3A 4M5YH 4WTZG 4JANA 4CAGA 3S9DB 3RWFB 1HH9B 3B6SB 4RAHA 3FQXB 1F2QA 3QAZB 4PRBB 5EOCJ 1ZLSL 4HIEB 5FAAA 5C0NC 2BSTB 5IFAH 1DTUA 2JB5H 3JWDC 5JXAL 3MV11 2P47B 4PBVC 3AAZA 1LK3H 1FYHB 3RFZC 1NFDA 4S1DD 1HSBA 5C9JB 4AEEA 3ECBA 3NIFF 5E9DE 5JOFA 1NDGA 1NCBL 1N8ZB 2Q20A 4ZDHA 1ORQB 5FB8B 4HS8H 3ZHKA 1E4KA 4P4KA 3QAZC 3CJJA 4I3RH 2Q1EA 5E8DL 1NCNA 5IBUG 5F3HB 3ROLB 5IVXA 1LO2L 1YEIL 3U7YL 1XZ0A 2A2QT 3BP6B 3WN5C 3MUZ1 2E8ZA 5IK3A 1CGSL 4O58L 2APBA 1OWWA 5ILTL 4WI6A 5DDHB 4JPWL 1VADA 1UJTA 3DHMA 1ONQA 3TH4T 2J6EA 3S35X 43CAB 1AGEB 5EPMA 5F7DA 3EW3B 4K71B 2IBZX 1ZVHA 1NKRA 3MRIB 3FB5B 3G5YA 4E0RA 1LILA 3B8SA 3NFSL 2VLRE 4ZNCD 1S7WA 2Y6SC 1NCAL 4ACPA 3PHOA 3C08H 1IGIL 2Q8BL 3G5XA 2DMKA 5GGSA 1ZS8B 3LKNB 4GRWF 1TLKA 5J8OA 3C5SA 5CJ8A 2BNRE 4E9LA 1UXWB 3TIEA 1YEKL 1XH3B 1QR1B 4JDTL 4P5KA 4ZTPH 4HQQL 2A6KA 1JI1A 4QOKA 4XNQA 1GL4B 5K9KA 3CSGA 4NQCD 3TM6A 5E6ID 1CXEA 2E9JA 2BDNL 4P2RA 5KG9B 5DHYA 3BT2H 3X12A 3R8QA 4LRIA 1KJ2A 2FX7H 2V17L 3SJVD 4P46C 5HJ3B 1A3LL 3H9SB 3QDHA 1IFHL 3RWDB 4ORGB 1B9ZA 2OL3L 1C5DA 3QXAA 2BK8A 4OZGA 3FB5A 2EE6A 5C0BB 3ARGC 4IS6B 2IH3A 1H0DA 3BGMB 4U6VL 2IAMA 2YZ8A 3QDJB 2KDGA 3DGGB 4M61B 4EOWL 1A4JB 4WI5A 1B88A 2AXHA 2OK0L 4I5BB 4UV7L 3DYPA 3BQUA 3LQZA 1D5MB 4MXWH 5CEZL 2QADB 1MQKH 4DVBA 2IQAA 2XZAH 2NW2A 3BE1L 3HPJB 3VDBA 5GQBA 4U6HA 1ACYH 2RIKA 1CFSB 4L4VE 3EJYD 3W11D 1SM3L 1UM4H 1CDGA 1YUHB 1J1XL 4PRNB 5ITFA 1XEDA 4ODTH 5E2UH 5GZOC 3TBYB 1WFNA 1YECH 5DJZA 2D2OA 1CXIA 2XFXA 4KDTC 5FB8A 3HLAB 1KJMA 1PG7W 3LEXA 3OKDA 3WO4C 5D7JB 1XGYH 4B7IA 5JOFB 4XNUH 4JN1H 2IANE 4BH7B 2QADC 1CK0L 2EIEA 3KG5A 3HE7A 4R8WL 2R0KH 5B38A 1FNGA 3D6GA 4AEHH 3FFCB 4YXKL 2R15A 1ETZB 4H0IA 5C0IB 1LO5A 4TTDD 3PP4L 1F3DH 2DBLL 5L0QB 5DRWB 2A9ML 4ZUSA 1G9NH 3U4BH 2VLRA 2NXZC 5IEKA 3TZVC 3GJFH 3WUWG 1NCCH 5ID0B 5EOQH 2GY7B 4ZQKB 4L8BA 4ZUTB 2YEZA 1QKZH 3CU7A 2CK0H 2ZCLH 2DQFB 3CX5K 4WVRA 5D8JH 5D7JD 3BGMA 3RY6A 4KMTH 4OD3H 1T83A 3DX7A 4FOMA 4CBPA 4KDVA 3WIHA 1T0NA 3A67H 1SMAA 1RZKH 5EZLA 3ARGD 2H32A 3QXTA 4EJ1C 5EOTB 5IG7B 2F74A 2NXZB 1CXFA 4YXLH 3GMQB 3ALWA 4NZTH 4IRJC 3X3FL 4LGSB 2MHAA 3MCLH 1Y6KR 3B9KA 3TNNA 4UTBH 4O02H 4N5ED 5DJAA 3DURA 3B9KD 5F9AC 5JW4Q 4HFUL 4E41B 2C3WA 1AR1C 4ZFFB 2NR6C 4I0PD 3S4SG 1G6RA 4Z7QE 5HVGB 3DBXB 2A73A 1FFNA 1X5HA 2GTZA 4NT6B 5GS1C 5IB4A 1JI2A 1HK6A 4U1MA 3MJ6A 3BXNB 1U2HA 3PGCA 4MNGB 4MXVF 1EGJH 2FGWL 3WNNA 1S3KH 1ZLWK 3ULVF 4TUKL 3QPQD 3QEQE 3P4MA 4H20L 5CZVL 1A6WL 3FQNB 5FCSH 4UV4L 3EO9H 1U3HD 5HDLA 4J7RA 3UZQA 4QRQA 1U6AL 2PW1A 3TBWB 2N4IA 1MRDL 3ARDD 1YJDC 1MNUL 2FR4A 3RNKB 5J9PA 4JFFD 5DD5L 3JV5A 1YEEH 3BZFB 1FORH 2VLRD 3NCBB 1Q0YH 3RUGE 5I75C 3C60D 3S4SA 3ZKMC 2FWOA 4HS3A 4GAFB 4G8GB 1LO0L 5FF6B 12E8L 5JW4R 5DDHA 4WFGD 3TCLB 4GT7A 3GNML 3V5HB 4OUOA 3QDJA 3MNWB 5DJ6A 2ZOLA 5BVJA 1CDUA 2FR4B 1XCQA 3PABA 1D7FA 3F12B 4PY8I 1MCOL 3D85A 5KBNC 1F6AA 1FYTE 1PZ5B 2Z91B 2IBBA 2XZZA 3Q0HA 3QO0B 3A67L 3LQAC 5FYLL 4YHOH 1IEAA 3VXMA 4MX7B 2MTPA 3HLAA 1PKQA 4D9QD 4KZDL 3D5OF 4JLRB 1A3QA 4JM2C 5MENA 3DXAA 1QLRB 4PJFB 3UTPD 2SEBB 5E03A 1IKNA 2MKWA 3MNVB 2P42B 1UG9A 3EGSB 1I7ZA 1NAML 5CJOL 3TIEB 3MLYH 1FL5B 4YEEA 2CO6B 5IQ9B 5SWZD 1A7OL 4Z7UA 4FS0A 2X4OA 4X6BA 4YGVB 4Y5YB 1T03H 3ULVH 3MRKB 1AQDB 5K9JH 3VD3A 2Y6SD 4IRZL 1W0WB 2VLKA 4PGCB 3VGEA 5INDA 1Q72L 3I84A 2E7HA 1OLZA 3OHXB 2APXA 1FLRH 2MWCA 5M95B 2BP3A 1MNUH 3WFZA 2O61B 1D5IL 3BPLB 4LQFH 43CAA 1ORSB 3CC5B 3WKMH 3FQNA 3UMTA 2C1PB 4Y5YC 2DLIA 1B0RB 1A02N 2FDBP 4TVPD 5JXAH 3ESUF 2DI8A 2AJVL 1G7HB 5I1GH 1A6ZA 4LASL 1HI6A 3KPSD 1OAZH 4FHBD 1OTTC 4KKBC 1KN2L 1QRKA 5B38B 1FZOA 4M7ZC 3GSOB 1B0GA 3F7VA 2B2XL 3D9AH 3SGEI 5IESL 5E94A 3O6FB 2YPVL 3QWRA 1KJMB 5DWUL 2ATPB 1RAMA 2YPLE 1BBDH 1OSPL 3HFMH 1FH5H 1HXYA 5SV3A 4XPFL 1GSMA 5EA0H 1FORL 3K80A 1VEPA 1OAYL 4W68A 4RNRB 3FTGA 5IHUH 2ESVB 3WHE0 2IG2L 4LOUC 4Y5YA 4ZTOL 4M7ZB 4XNXL 5KVFL 3KR3L 1W0VB 4V2CB 1TVDA 4CVZB 4DGIH 4ONHA 1S7VB 4KDTA 1RUKL 4NN5C 3DTXB 4D3CL 4F80A 3EGSA 2FLRT 4NO0A 1U8LA 4TNWK 4LHUG 4ZNEE 1ZSDB 1D5IH 3HC0B 2X70A 3OKYA 3VH8A 2AEPH 2OR7A 3E3QE 5C0DA 4RAUA 2WNGA 5EBWB 4M7JL 4HS6A 3T0EC 4ELKA 3D0LB 5HGDA 2CRIA 2H8PB 3BKCH 4QXGH 4IRSC 5CSZA 3L5IA 4NQEB 3ULVL 1S9WB 2YPLD 1MHPL 2V2TA 5EBGA 4YDLB 2E3VA 3ARGA 4KKLC 4F9LA 3L3OA 5DJYB 5DJ8A 1PFCA 2O61A 4XC3H 2CJUH 3B2VL 1NAKL 4J3OC 5F3BA 4GG6F 4UU9B 5C08E 3ARBC 3O41B 3W82A 4ONFL 5CGYD 1A1NA 2HT2C 1DDHB 1BVKB 5IFJB 4GW1A 2BVOB 4LEXL 4DGYL 5KSAA 4LNVA 2WWMC 5C86A 1ZANH 1JUFB 3BISA 3BPOB 3O0RH 1JWMB 5IHUL 3BEWA 5DQ9B 3T08A 1N4XL 3BD4A 3GUTA 4K3DL 2HMIC 1BZQK 3ZKQD 5I1IH 1I7RB 1IQWH 3PL6B 3LV3A 3T0EA 1JPSL 3AROA 1XMWA 5E00B 4YO0B 3H7LA 4M9PA 4M6OL 4OTXL 5HHVL 3HE7D 3PJSA 2VL5B 3PIQA 5D7LE 5BJTB 3D9AL 3BJ91 2EYSB 1TXKA 1KB5A 1INQA 3CSYA 3QUKB 4XAKD 1XGUA 3GK8L 5FM5O 3V0WL 3IAPA 4Q9RH 4NNYB 1YEJH 3O4LB 5FOJA 3THMH 3QPXL 1AD9B 1QA9A 3BH9B 5J56B 1RJYA 4F9PA 2VDQL 4HWUA 4HUMB 2FL5B 2GJ6B 4C56A 4N1CA 1JF1A 3WSQL 3SBWC 3WIFA 2A6IB 5EOTA 5DSCA 3ZL4H 5IB5A 3U6RB 4CMMB 1T2JA 1KYOK 2BJML 3OAUH 4KQ3H 1CR9L 1QR1A 4QLRA 1PG7L 1P1ZA 4FTVD 3BW9A 2NX5E 1PSKH 2R8SH 4KK5D 2VLME 4QXTA 4JFQB 1ZOXA 1G6RH 4DGYH 4MA3B 5F8RC 2Y1VA 4KZDH 2IAMD 1V7NH 1KJ2L 3O3AB 2CRMA 4XB7A 4KKCC 3MOAH 2PO6C 1FGNH 5A43C 2I27N 5CJQH 2AK1L 5KW9L 1JGEB 1CTNA 1F02I 3MA7A 1ZA6B 5F8QC 3QJHB 5JPMA 4NJ9L 3LKQA 4U1MB 3STBA 3ZTNL 2X5PA 2ILLA 2F9BT 5FXCH 3WXWH 1J8HA 1U8QA 5E2VL 4BKLA 1I9IL 1KCRH 4NOFA 2NY5C 3TYGL 4MQ7A 1KCLA 4X6FB 4LPTA 5BZWA 4CVXA 4D0BB 5DSCB 4Y8AA 3SE8L 4YHZL 3KPNB 4GAYB 1ZT4A 3OF6D 5DRZA 1CE1H 5E8EB 3HUJF 3VE0A 1PW3A 3T8XA 5EO0A 5EU4A 2YKLL 3GSNA 5SWSA 2VN7A 4FQ2H 2DL9A 1TZGH 3MLVH 1BWMA 1LK2B 1E0OB 5EU7C 5GISL 1FAKT 1GHFL 3LMJH 3MRRA 2VUYA 3IRPX 1I3VA 3W9DA 1KTRL 1YNKH 4C56E 1T5XA 1S5HB 2OJEA 5I71B 3BRFA 3DTXA 4G6FD 2XIDA 1QFUH 1QFWI 5C6TL 2BZDA 1G9ML 4U7KA 2DJ4A 4X7SH 2AGJL 1UVQA 4NQDA 4XBPA 1WIPA 1QSFE 4HKJB 1CCZA 2G5RA 5T1KB 4RNRA 2R2BB 1T2QL 1IC5L 3DMMC 2HVKB 3LPFA 5BMFL 1Q9LB 4ZUVB 5I1CH 3O4LD 4YIQA 5IROC 4XCNB 5TE6L 5JNYB 3SDAD 3WFEH 1DBMH 3I3DA 5FKPA 5IJVA 4G5ZH 5I1EL 1R5VB 1F4WL 4G6FB 4G6JL 4OLWH 2RGSA 3RVWD 4Z8FL 2H2SD 4LFHD 2UZIL 2Y36H 3S34H 5E08H 1S9YB 5IUSA 4LRIC 1CG9A 2F5BL 3Q5OA 2CDFA 3VXRB 1C16A 2G5BB 4K9EH 1A6WH 4Q74A 2AXGB 3K4AA 5IGXH 5DFWH 5DLML 3S97C 4U1IA 3VRLF 1Z9MA 3BZEA 2AKRA 4RGNE 4U1GC 5DJDA 5HPOA 2W0FA 3BH8A 3HZMB 4YK4C 3P0GB 1A47A 3BP7A 2ZUXA 2V5YA 4TUJB 5JO5A 4FQLL 3AREA 3SE8H 5BS0B 2OM5A 3T0DA 1IGYA 3P4LA 3V6OE 5BOPA 2VLKB 4PGCA 3SE9H 1AO7E 1MI5A 3S36L 3MLSL 4LHJB 4OAWA 4M43L 2C1OB 3FB8B 3BXNA 4P2RB 2YUXA 4S1RH 3BGFB 2X1QA 2XT1B 2WUCL 4QHUA 3IJYB 4JHAL 1MSPA 3WL9A 1XGPB 2R9HC 5HGHB 5T5FH 5BV7H 2IFGA 1KCSH 3OR7A 4XCYB 4YBQD 3WLBA 4BJLA 5K9OB 1C12B 3ZT7A 2ICES 3TJEL 3T3MF 4LSSH 3B3IA 5J11C 3E8UH 4OF6A 4P23A 2OL3A 4G8IA 4KHXH 2ZUSA 1HHKA 3SGKA 1GH7A 2AJVH 2VH5H 2ZCKH 5ETUA 4ZUWB 2QQKH 4DN4H 3DX7B 4E0RB 2OK0H 1CLYL 1H5BC 3F12A 2DLFL 3V4UL 5E2JA 3FQXA 3A6CL 4KQ3L 5I8EA 4TSAH 3PGFL 2VE6B 3DNKA 1MHEA 3RJDA 1AO7D 2E6JA 5ADPH 2VLKE 1VFUA 3JVGC 4QRRA 4JFFB 3DETC 3MLRH 4KUZH 4UNVA 5DD3H 3CVIL 3LKPB 1YEJL 3MXWL 3RI5F 1E28B 2JIXB 1A5FL 3FMGH 3P11L 1G7JA 4U3CA 4YHYB 1O5DT 3S34L 3HUJE 1MVUA 1INEL 4M7KL 2HRLA 4PTTB 2BOCB 1EVTC 1R3IH 4IOIA 1EIBA 2NXZD 4P23D 5GJSH 2XICA 4NNXA 2G9HA 4YGAB 1JGVL 3HE7B 5JR1H 4IOSD 3P4MB 3WDHA 4AMKL 5I19L 3NFSH 2YD5A 4MB4A 5FO9A 4XP5H 5CEZE 2R9HD 3OJ2C 4OB5L 3X14A 4LBEB 1PKQB 1QBAA 4XNYL 4LF3B 3H9SD 1CT8B 3HRPA 1IM3A 1TQBB 4HAGA 4LIQE 4PP2A 1G7MB 2X9YA 1OLLA 4NO0B 4UUJB 4BELD 3I85A 2EH7H 4U2YA 1T1WB 2WW8A 2KH2B 4OIBA 1N6QL 2N7BA 3WFDH 2WV3A 4M02A 4NN6C 4PJDE 3UAJC 5L88L 1ZMYA 5J13B 2AJZA 3PDDA 1IGFL 1NBZA 1MHPH 3IXAB 3L5WB 4S1RL 3K2UL 3LS4H 4JO3H 1V5JA 4KHTH 4M6NH 1GZPB 5FHAL 4P2QD 3RU8L 3VXME 3MRPA 1CGVA 1UWGH 3NIGE 4W6XB 5GISH 3VJ6B 3MLSH 1FVCB 1QEWA 1OAQL 4POZC 3BWAB 1X7QA 1Q38A 1DBKH 4NQSA 2R4SL 1I7UA 1HKFA 4CN6A 4OZFB 3U2SB 4WDIB 5E1HB 1F97A 3FJTA 5CEZD 5DK0A 1PGRB 1M7IA 2V7HB 4HJ0D 3E2HB 1QUNA 4EN3B 3MJ9A 2X9WA 4QF1B 1M1SA 3KLHC 5ERWA 3QI9B 2VLRB 5IR1A 1KFAL 2KQMA 4NIKB 4C59B 4H20H 3W0WB 3C09B 4U6XA 3RUGA 3MRGB 3NCJL 4Q9QL 4J3SA 5CBEA 5HYJA 3S35H 1UA6H 3RWEA 1XIWC 1BM3H 5DK0B 5IWLC 2WIIA 1BFVL 3EO1A 4Z7UE 3C5JB 3ZDZE 4ERSH 3ELAT 4GQPH 4W4NA 4POUB 4HPOL 1RIUL 1RUML 1ULVA 5T3XH 4I2XB 4EN3C 3AS1A 3QR2A 1UJ3C 1T0MB 5FYLD 1QPXA 3DXAE 2H2PD 4GRWE 2F5AH 4ISVA 4XI5C 2VZSA 3MV7B 1F4WH 2BSRA 4I77L 4LLDB 4ZOBA 1LEIA 3VU2A 1SJVA 2EYTB 3AREB 1B6UA 1LO4L 2OLDA 1NUDA 3JWDH 2WSKA 4IDJL 1CD9B 3CFDB 3K4ZA 3VXUE 4MNHA 4E42A 3KPRD 4UUJA 2X4PA 3ROOB 4XVTL 2DM3A 3GMMA 1T5WA 3OTTA 5DS8A 4OF3A 4M61A 5IIEB 4MGXA 1EHLH 1YMMB 4LQFL 5M94B 5T1MA 5DGRA 3WKML 1FC2D 1CXHA 4GJTB 2D7OA 5CHNB 3EUUA 3AC0A 5FUCE 1JF1B 4K9EC 4Y19E 3I75B 2NX5B 2JIXD 5EO1B 3CXDH 4YHIA 4EN3A 5I66A 4YFDB 1HINL 3QWOB 4RMTA 1RK0A 2E27L 1T80A 3ARYA 4XAKE 1A9EB 5K9JL 4X6CA 4ZFZA 3E6HB 3VDAA 1UA6L 4GOSA 1ZK9A 2BDNH 1JN6A 3DYMA 2GUOA 4MNQB 4CU6A 4EDXB 3QFJB 4TPRL 3K1DA 4ONGH 3PWJB 1H3TA 1T03L 5GIRB 4OCMC 3T0WA 1CD1A 3I50H 2JK5A 4JE4B 1K8IA 4P57A 3IU3B 4MB3A 4ETQB 1J0HA 4XI5D 3WJJC 3LH2L 1ZT1A 1AHWC 2IQAB 1F11A 2VLKD 4RGOL 3KYMA 3QEHA 3K2MC 2PR4H 4JKPL 1I9IH 2YBRA 2XV6B 3WN5B 2WK2A 3BPCA 3H2WA 2FX9L 3NCFB 1YYLL 4JJ5B 4IDJH 3BKML 1Q1JH 1B4JL 3MO1B 3ULUF 1NC2D 1QFHA 5DMGD 5EU4B 3TT3L 5KVDH 4NOBA 3RX5A 4OT1H 4Z7VF 4Q58C 2E27H 3GSQA 5FOBA 3RY4A 4EBQL 4BSVB 4WI3A 2CRZA 4PPTA 5FECB 4WO4A 2VTFA 1L0XA 4GRWB 4JQXC 3C5ZB 4P5KB 5JTWA 2V6HA 5T3ZH 2WLYA 1BQHB 3FQWA 4X5LA 2RCSL 5GGTH 3DROB 4BZ1L 5IQ7L 4M1CC 2ICCA 1KB9K 1MCPL 2DTSA 2VKXA 2G2RA 5T1KD 5DK2A 4Y4HB 4NQVA 4OD1H 4M5YL 5A3IC 4GW4B 4YDKL 5ENWB 1N64H 1OM3H 3D0VB 5CD5C 4CNIA 2XY1A 4JFEA 2EDFA 1P7KB 5HHOB 1FNFA 3HI5L 2KZWA 3ARDA 3QCUH 4P23B 2J8UA 2DTMH 1DQLL 4P99A 2A38A 4YDIL 1DQMH 4PJHB 1IC1A 4OBSA 1NJ9A 1QFOA 4TSCH 3DUUA 3C2AL 4HX1B 5GS3A 2FX9H 4ZO8A 5IMKB 4HWBA 5EC2B 4UB0H 2W9DL 5J06A 4K3DH 4N8PA 3QHZL 3T0AA 1R5VA 2DI9A 1S7RB 1IQWL 2R39A 5BRZA 1GC1C 2WBWB 3LIZL 4MD4A 3BI9X 3U1SH 1HYSC 4NFDA 3U6RA 4DQOL 1OGTA 2XRAL 3H42H 1N3NA 4HLZH 4KH2A 4AT6B 5I8KL 5CCKH 5EORH 3VXMB 1DANU 4P23C 5D96B 4NUGH 4UBDD 4I0PC 3L1OH 4LLAA 3WFDL 4QGYA 3UTSE 4APQB 1X5KA 1PY9A 5D2LB 2FLBT 1FP5A 3FO2B 3MZTA 3QUMB 3V9FA 3WFHA 2JJTC 2PR4L 2Z91A 4PRPD 4EVNA 4PJ9D 4MA7L 4KKAC 3QO1B 4OZIA 1G9NL 4X9IA 3U4BL 4DFIA 5JIPA 4PJ7E 1BIHA 3P73A 1I3RB 4G9FD 2C3GA 5GJTH 3RA7L 1NEUA 4JY4A 2F54A 3WUWB 5LXGL 2FWOB 4HS3B 2MOVA 4Y0GA 3VFWA 4MQXC 4PJHF 4ZO6A 1BJ8A 2V9QA 1BIIA 1MLCA 4YXHL 1JHTA 1FN4A 3CH1A 3UPAA 4RGMB 5D7JC 2ZSWA 3OKLB 1Q0YL 4GUPA 1NCBH 3RGVB 4PRBA 5TDPA 4ETQA 2X05A 4P9HL 1FNLA 1HILB 1P7HL 5J12C 3MUJA 1J05A 4TTDC 1A1NB 3V52H 1AGDB 2Z31A 4GFTB 2OJZH 4CADB 3Q5TA 3RHWF 1DUYA 1S7UB 5HDBE 1U8OB 1NGYB 1K2DA 4JHWL 4QNPF 2BY2A 4UT6H 5HYJB 1ND0A 2YN5A 4HXBH 4OF8A 1M05A 3D25A 3ALPA 5BS0E 4FQJL 2NX5A 1I8LC 3DUUB 5DWUH 3G6AA 3MOAL 4XVJL 2L4OA 1FO0B 2CD0A 1MAKA 3SGDI 5C08A 1KXTB 2Y72A 2A1WL 1JGUH 4G7VL 1LO3L 3ZKXB 4TQEL 3VXOA 4AH2B 4MCYA 1YQVL 4OBRA 5FDYA 5JMOC 3GSVA 1A22B 1CL7L 1FYTB 4XNYH 4OI7A 2EXWC 1CF8L 2VDMH 2AXJA 1LE9A 4R0LC 4M6ML 5H94A 3VXRE 4I48A 4M7LL 1D5ZB 2P5WE 4FQQA 4UIMB 5JR1L 2EKSA 3FO1B 4G9DB 4QRQB 3QNZB 1S9VA 3S3PA 4FQ1L 1FNSL 3AM8A 5KOMC 1FLTX 2D7PA 4WUUE 1GVIA 5DRWA 5KS9F 1YDPB 3ILPB 4CMMA 3G9AB 1FLRL 3OSKA 4NNPL 5C8JA 2EDQA 3MCG1 3PHSA 1G6VK 2FD6H 4N0FB 2DWEB 4JPVL 1ED3A 4P2RD 3O3BA 5CIPA 1XF4A 4TPRH 5D2NA 1X5GA 3WMSA 5EU5A 4FQ2L 5JDSB 4Y5VA 3V6FB 3WEXA 1AY1H 4RGNB 3IDIA 2BNQE 2F19L 5FUZL 3LDBC 3CFCH 2ZKHL 2QV2A 1SEBB 3VXNA 3OJVC 1WF5A 3K2UH 3LS4L 4NRYA 4DCQA 1PZUB 5B22A 4EI6B 4OFKA 3IT8D 2NY0C 3L5XL 4M6AA 2DYPD 5F7YC 4GW4A 1KXQE 3OR6A 4GH7B 4UTAH 1M7XA 4G80B 1AI1L 3S37X 2YOCA 3VFTA 3QUMH 4JRYA 1FGVL 5HGAB 1R5WB 1MLBA 5E8PB 4JFFA 2VC2L 4M8QA 4PJ7F 3F58H 3D87B 4OFVA 5GSRB 5LGHH 2GIYA 5IMMA 3LDBB 5GHWH 4EDWL 3U4EA 3W9DB 3VGAC 3VG9C 1TZIB 4Y2DD 1KJ3H 1R6VA 3RZCD 4NGHH 2D7QA 3SE9L 1X44A 3AXLA 1R0AH 2W9EL 4AEIL 2YRLA 4IHOB 4EUPB 1HQ4A 1J1OH 2HFTA 1ZTXL 2MSPA 2DLGA 4Q9RL 2AJYL 5SWQA 1P7QA 2IFFH 5IT2H 3STLB 1VFBA 1AR2A 2N1KA 1AR1D 4HZAA 3NA4A 5MEOA 1CWVA 3GIVA 3EZ8A 2VIRB 2VXVL 4PB0L 5E2WL 1T7ZA 3WO3B 4EKXA 1I8KA 1I3GL 1BQLH 1V7MH 1FJ1B 5B4MD 1W72B 1MCIA 2WINA 1RU9H 4JRYE 1OT2A 1UB5A 2ZZUT 4IOFC 1FNEA 5DQJA 4WHYG 3EHBD 3MCKA 3F7PC 1LO4H 4PYGA 5MERB 1MCDA 4RFEB 2P24A 2EC8A 3HI6L 1BD2D 3O81A 3GI8L 5AD0A 1U8KA 4EUPH 4QY8A 4Y4FD 4YC2C 3VFNB 4F3FA 1NEZB 3T1WA 2NCMA 3I6KA 3UO1H 4RWYL 5IV2B 3ZDYE 3MFGB 2BHYA 4ODWB 3RWCB 3NA9H 4R4BB 1NGZA 4KKAD 4DKEL 3O2DH 5EC1B 1RZGA 4M93C 2J8OA 1FYTA 5C6WH 4PP1D 3NTCL 2VXQL 4F15C 2FO4B 3RTQB 1ZLUK 3UBXI 2ZUTA 2AXGA 3QDJE 5F96H 1S7SB 2Z8RA 2HLFD 4WNQB 3NCMA 2DRUA 4PS4H 2APVA 2DQHL 3C6LD 1RZ7L 1UXSB 4HQQH 1CFTB 1UM5L 5D7IB 5EU6B 3BD5A 1FRGH 4OQTH 3B9DA 4NKIL 1Z6JT 4L3EA 3V5DA 2ARJQ 4L8SA 4K3JL 3O2WL 3I50L 2MPAL 4X9FA 4OJFH 3S8WA 1ZVSB 1XGPA 3AS2A 5DA0B 1T7YA 5GGSB 3FRPG 5F1NB 3MRQB 4NFBA 4Q0XH 5DI8A 3UZVB 4CU8A 4LFHG 1X4ZA 4R96B 4QRSB 1J7VR 1BWWA 1YPZA 2QSQA 1BGXL 3AU1B 5EZLB 1D5BB 1IC7H 1I1RA 4HZLB 4PGDA 4OLWL 4PRHD 3OZ9L 5BS0A 2YD2A 1NAMH 5CJOH 4K94L 1MJ7H 2X42A 3FFDA 1LWRA 2IPTH 3FQUB 1L6ZA 4WUUD 4JANB 3ISWA 2VLJA 2LU7A 3DIFB 4L9DA 4D9RE 5HHVH 1U2CA 1DBML 1KLUB 5FYKL 2VXQH 4RMRA 3LZFL 1CL7H 4YHOL 5CKAA 1KB5L 3FRPA 3CXHJ 1XF3A 3FO0L 3BMVA 1G7LA 1U8MA 2EH8L 4HK3N 1GGIH 3IETA 3GSNB 1Z3GL 4NQCA 3WIHL 1IAOA 2FIKB 5D7SH 1BEYH 3BPOC 1A6AB 2FSEB 5DRNA 3QWQB 4BFIB 3MRDA 5JOPD 2D7TH 4C58B 2GSIA 5B8CA 5DC9B 1EA9C 3PL6C 1F13A 4QRTB 1MCKA 3ES6B 4L4TB 1E28A 2JIXA 4XBGA 2A74A 3MRPB 2PUQT 4BKLB 4O2FB 3FB6B 4U1KA 3QCVL 5DEGA 2R2HA 2MPAH 2NW2B 1U8KB 5IBUB 3VWJC 4NO2A 5DZOA 3P9LA 4HXAL 4YPGB 5HSFA 3P77A 4NC2B 1VESA 4U1HB 4R7NB 4MA7H 3TA3C 3JWDL 4ORZC 4WWKD 3S96B 2XZCH 1QFWM 4JZNA 4LEOB 3MRNB 4LVHC 5D71L 1PEWA 3C08L 1HXYB 4MA3A 3AB0B 5C7XL 3QZWA 2QR0B 1NMBH 3HRZA 2ATPA 1SJHA 4DGVL 4KKBD 3PNWA 1A9EA 8FABB 2FO1A 1P1ZB 2FSEA 2ADGB 3DSNA 5JZ7D 2ZG2A 5FGBA 5HJ3A 4E41A 4R3SB 2FEDC 1R3LA 2XWTB 4QRUB 4U4BA 4Y5XC 2DLTA 2IJ0C 5AEAA 4QXGL 3OKOB 4ETYA 4XNZB 3CVHB 4NBZB 2GYSA 1BVLB 1KCKA 1QBLH 3GJEA 4XHQA 4M7JH 4JY5H 3RVVD 3H8NA 2P8LA 5DD6B 2Z4QA 2DQCH 2ADGA 2UUDH 3QUYA 3S5LB 4F2MA 3S3JA 3SDCA 1JPFB 1NBVL 4L8DA 5FK9A 1G7IB 2EIBA 2VQUA 5BW7A 4N1EA 2EYTA 3L3GB 4MJ5A 4ODWA 2Q7YA 2R23B 4ZQKA 1NCTA 2FB4H 4G9FE 4HPYL 3U9PL 1JPST 1Q8MA 3UX9B 4Z5RB 5ESAA 5TH2A 1TJGH 3QCVH 1AKJD 4EUPG 3BUYA 5DUBB 3P11H 3PQYE 3WFCL 3EO0B 3RVTC 3TO4B 1PLGL 2D7TL 2NYYD 5L88H 1V3JA 3MUY1 4PGBB 4ZPVB 1J1XH 1G6RB 1P84J 2XTJB 3U7AA 2D4FA 2VR9A 1SJEA 3OKKB 4OLUH 3GI9H 3V4PH 2MQCA 5D7SL 5E6ZA 3V4VH 2H1PH 5JW3H 3JV4B 1YEFL 4M6OH 4OTXH 5ECJE 1MREL 3NMEA 2JCCF 1D9KD 2R2BA 2VWEC 1OD7A 3NZ8A 4L9LB 1K4DA 2XI9A 1TMCB 5I6XB 4OCWH 3T0BA 5L2KE 1U8MB 3LKSA 4OGZA 3ZT5A 3UTOA 1XGUB 5DXWA 4K8RH 1SEQL 2GTWA 2DAVA 5IIEA 1N5YL 4V2BA 4XB8A 4GMSL 1GGYA 1QO3B 1U8LB 5IMKA 1BOYA 4ELMA 2VR4A 5JQHC 5I30H 3WXVH 3LEVH 4XCFH 1I3UA 3BIKB 4B53A 4L9LC 2X7LA 4M62H 4HPYH 5ADPL 4LNRB 3BGAA 3RPIA 1ND0B 1QSZA 5FGRA 2IADB 1KLGB 2ITCB 3N1PC 1O7SA 2VOTA 2YXMA 3TGXA 4K3JH 5J6GA 4ZAKA 1Y18A 2X1XR 4ZNEA 3TBYA 4OGAC 3X11A 4MA1B 3BDXA 4HJJH 3QCTH 4ALAH 4XTRC 1MJJA 1QBLL 4JFDB 2HRPH 4R2GB 4Q6IC 2AJUL 1IL1A 3TWCL 2MKLC 2JB6A 5EORL 4JAMA 1D9KB 2YUVA 2MHAB 3QA3B 1CGTA 5EIVA 5KS9E 1JYNA 2AK4E 2F58H 4LLUA 2OYPA 4PG2C 2EEBA 1IQDA 1N6VA 5EB9A 4FA8A 2AV1B 1YEGH 3PWVB 1QLFB 2EH7L 1JF5A 2FO4A 4RBPH 3DX9A 3I9GL 4Z7VE 3EHBC 5LWYH 4IOFD 3HZVA 2ICWA 2VDOH 2DBJA 4Q6IB 1HE7A 3SO5A 2DDQL 4AM0A 5F9OL 1QYGL 4E41E 1Q9OB 2J3SA 4F58L 1A4KB 3CVHH 4AL8H 3EYOA 1MREH 3VE0B 2WWKO 2WBJD 1KV3A 3NGBB 5IVXF 5TQ0H 5J11B 2VXVH 5E2WH 3QH3B 1X6LA 1KC5L 3MUGB 1MCRA 3GB7B 4MHHG 1BHGA 4LPXA 4OSUL 4K3GA 5C6TH 3RZCC 2VISB 1UZ6E 4HLJA 1J5OL 2SEBA 4WI8A 4XP4H 1RULL 3PXJA 3BESR 2UYLB 3OKDB 5CMAA 3HG1B 4LF3A 4Q9BA 5I0DA 2VXUL 4WY7H 3OPZH 3QH3A 2EYSA 4LVEA 1WSST 4KV5E 1X4XA 4OAWB 3MA7B 1UCTA 1LP9B 4YHKL 3CDGA 4GLRI 2VDRH 4GSDH 2ADJB 2DICA 1QHOA 3O9WB 4YQXL 4TOYH 1KFAH 4IRJD 5TPWL 5TFSH 1MJ8L 1CFNB 5F7DB 4BZYA 2BRRH 2ICEA 4LP5A 2HT4D 3EYQD 4GQ9H 2VDNH 5JOEA 5HPMA 3MRBA 2IALB 3NOIA 2AKRB 3SKMB 3ULUH 4YE4L 5IW6B 3FFCD 2DDQH 4GBXD 4Y2DA 1PEZA 2DQJH 4O58H 4JZOA 3B43A 2X4TB 1XF1A 4CVUA 5LWYL 3MRKA 1WZKA 4FQPA 1H3VA 4OFDA 1N2RB 2Q76B 3D39D 4L4VB 4U0RB 2VLJE 2VKWA 2X4RB 2WANA 4X99A 1IGML 2O93L 3SDAC 3C9NA 1A21A 1U9KA 2CLRB 4YBQC 2DYPA 3WKNA 3T04D 1CDCA 5SWSD 2ZSVA 5J7CC 1BMGA 4HC1H 4NRXB 5E99H 3O2WH 2NW3A 2A73B 2R8SL 5IF0A 3F6IA 5EU5B 3WNMA 1IKFL 2FD6L 2EDOA 1BF8A 4X99B 2CIKA 3ARTA 4OZFH 2A6JB 4Z7UF 4LSVH 1S3KL 4LSRH 3U9UB 1AXSB 4M6MH 1PKOA 2A0LC 3E2HC 5DJ6B 1A6TB 5DURD 1HKLL 1KEML 1OB1B 4UQ3A 5KVEL 4XAWH 1J87A 1EFQA 4ZS6C 4AENB 3MV8E 3VRJA 3C09C 3QIWA 5BVPL 1AO7B 4LPYA 1RHFA 1ZGLM 4PBXA 5F93C 2VAJA 4K8RL 2EDNA 2DQFA 3EZJB 5DJDB 2GSIB 1KC5H 3NABL 3BZDA 1PJ9A 1Z3GH 3BKJH 1BEYL 1DLHA 1LNUB 1NFIA 2FIRT 1U42A 5DUPL 5KANG 1F42A 1JWSA 3FO0H 1F6LL 3PWLB 4ENED 2H2SC 3D0LA 1UJ3B 3ARPA 4D9RD 3MZGB 1CG9B 1E4XL 4ODVH 3UTQA 3O3EA 4UMGA 3SKJL 4MAYA 5D7KE 3WEXB 5CWSB 1Y0LB 1CFVH 4LSSL 5ITBL 4Z7WA 4PJAE 1KLUA 4NN7C 1HHIB 1EEZA 4FXGA 3DMMD 3QDME 4PGBA 4ZPVA 5ESQA 4NRXA 5C09E 3HMWH 3MRJA 4GQ9L 4MAUH 1OQXA 3ETBF 4HKXB 1OGAD 3C9NB 4GKZB 1NMAL 2G9HB 4XGZB 3MJ8B 1U8PA 1HILA 4JQVA 4GRLB 4P9HC 1BLNB 3F65A 2ATKB 4K23H 1J12A 3RGHA 2O5ZH 1FAIL 5GS0C 2OR9L 4JFQA 1LE9B 1N7ML 3MGAA 4QRPA 1UCBH 4PJEB 5GPRA 4WENB 2J4WH 3TBVB 1REIA 5AUMB 1RUPL 1MCEA 2ZJSL 4UNUA 4TVPE 4BSWA 3P0YL 3ME0A 2R4SH 3R8BB 3MRRB 3V5KA 1IVLA 1G1YA 5C0CE 3KPSE 4OF7A 3NACL 4XCEA 2GJ6A 3RTQD 4C56B 4JFDD 4R2GD 3RWHA 4YHLH 1DSFH 4PJ9B 1JV5B 4GAGL 3QI9A 2OTPA 1OY3B 1QSEA 3NTCH 1INDH 4LLYB 3IDMA 3SOBL 5D6CA 2H6PA 3KPLA 4NPYA 4TNVF 2OXHA 5I17B 1ZHBB 3IDIB 3DV6A 2J88L 1U3JA 3JV4A 5FUCC 1WBZB 2BHZA 2YD1A 4EI5C 5DJCA 2PXYC 4WWKC 3LRGA 5GSVB 3QG7H 2XY2A 2Q6WB 1QVOA 2BRQA 3QDGE 1DE4A 5T3XL 5L8LB 1DEEB 1I75A 2VDPH 1RURH 4M1CD 1PG7X 1IAIL 1U3ZA 3L7FA 1BFVH 2F53B 1N64L 1MRFL 3RNKA 2FYYA 5C0EA 1A7BA 1XF2B 4RFNB 4RFEA 3P9MB 3O6FD 3RZCA 3HC4L 4XNXH 2EDBA 1H3PH 3OB0K 1NLBL 2HG5B 3DVIA 5B21A 4G43B 5I1LA 1L6XA 2HH0L 5AYQA 4RAVB 4AYFA 4HUKB 2A77L 4ZD3L 4NM8H 3MRDB 4JM4L 4WUKL 1CU4L 3O2VH 2W60A 3MJ7A 3DX9B 3GSOA 5SWSE 2P5WA 3O3DB 5CGTA 3L3JA 3QUXC 2GW5A 4ELKB 2PYFB 2HKHH 3DRTB 3I75A 3UROR 4YUEH 1J0ZA 2NY3C 3VH8B 5KTEH 1OGAA 4Q2ZA 3HG1A 4JHWH 3UTZA 3AS0A 4MAUL 2A6KB 1KACB 1HZHH 1JZ6A 1BZ7A 1VGKB 3ARWA 4IDLA 4W4OA 4W6YB 5HTSA 3LEVL 4QRRB 2XYCA 2D9QB 4KVNL 5IEHB 5I8OL 3DSFH 3BSZL 4ONFH 3Q6GH 2V5MA 3R0NA 3HRZB 4M3JA 3NFPB 1HQRB 5GGRA 2XZQH 4G8FA 1NCCL 3IGAB 3IFOA 4LEOA 3G6JF 3SBWA</