3SBWA

Crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKLKIEESPGAELVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Crystal structure of the complex between the extracellular domains of mouse PD-1 mutant and human PD-L1
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sbwA00
3SGEI 1EXUB 3V0WH 3UROR 3NZ8B 3G5XA 3ARED 5F1NB 4K8RD 2VAAB 3CX2A 4XNUH 3D2UD 1P1ZA 1XF5B 2F15A 4JFDD 2YD4A 3HC4L 2DTML 2KZWA 3MYJA 4FXKB 4LRNH 4JY4A 4PJ8B 2O5XL 4XBGA 3QNZB 3C5ZA 5T3XL 3T4YA 3RWCA 3KXFB 2G9HB 1TZIA 4ZUWA 4YHKH 4MZ3A 3SGDH 3ULVC 3JWNC 5L9DH 3MACL 3P77B 4X4XB 4JM2F 1ZMYA 1RZIB 5CLTA 3BH9A 1F90H 1QLFA 4OGYH 4OZGF 1B90A 4L4TA 1PQZA 4P48A 5TDOB 5CBAB 1EAPA 3S36H 4YUEL 3U82B 4EUPH 2ARJB 3FT2A 3ULVH 4RGMB 3EDEA 2Z4QB 3UBXA 1MCHA 1BJMA 4PGEB 1N59A 1RK0B 4NQDE 2AK1L 4RAUA 1UZ8B 5CUSH 3L6FB 4G80B 4J4PD 3RUGE 2DQTH 1N5YH 2Y06L 4D3CL 4KHXL 4OGXL 3RZWA 4M5ZH 2C4XA 4Z0BH 1BFVL 1E4WH 4DN4H 3FB8B 3CC5A 3LH2L 4GXVH 4XP1H 1QRND 1HHIA 4JFFE 3NFPB 1GAFL 2FNBA 1VSCA 4ODSL 1H3UA 3QDJB 4Z7WE 4NQEB 2V2TB 5IMLA 4GAYB 1MJ8L 4G9DB 3V95A 3RL1B 4FXGB 1WWBX 1D9KD 2X4OB 3VH8B 1CF8L 2RHEA 2CUMA 3ABZA 1EO8L 4UUJB 4AH2A 5A1AA 1QSVA 4X0KA 1OQXA 5GGSB 5C86A 1DZBA 1TQBB 5KG9A 5IVXB 4GLRH 2J88L 4EJ1C 3U2SA 5GGUB 2W9EL 3ARWA 1OF2A 2AK4A 4N90E 4W68A 1R5IA 5CEZE 3SJVE 3Q5YA 5IT2H 3RVVC 4OCYL 4KJPC 1JFQH 1CTOA 4PJCF 4Y4FD 4EIZC 5IW6A 3UTQA 1U8JA 1JF1B 2HKFL 1DBJH 3QUZD 4AIOA 4Y5VC 1R24A 1I4FB 2YD1A 2OXGA 5CILH 1YDPB 2XKNB 5KVEL 3BKMH 3EYSH 2KZ1B 4HCRH 2E8YA 5T1LD 2X4UA 4HXAL 1NGZB 1I1CA 1U92A 1JN6A 1A9BB 2Z31A 4XXDA 4JR9L 3ARBD 2OR9H 1VGEL 1QNZL 3FQNA 2EDFA 1KEGH 4A6YH 4Z7UB 5ETUA 2GTWA 2PW1A 4R7DB 1X4XA 4U1IA 5HYQB 1PY4A 4RIRB 1T7VA 4KJQD 1T03L 2RCSL 1HH9B 4UBDC 5IG7A 3WUWA 4MAYD 1UJTA 1C8PA 4NZJA 5DUPH 3HA0A 1AD0A 1T2XA 3L3OA 5FM5O 3I75B 4NQSB 2G60H 4ZUSA 1U42A 4ZOAA 5I1IH 4UNUA 4YXKL 1A1OB 2AAVA 1G7PA 8FABB 5DMJB 5F89B 3EDDA 2CKBA 5A40E 2NY0C 4WEMB 3T0BA 5E95B 4M9PA 4YHIB 4PUBH 2C1OB 4BFIA 3MLYL 5IK3B 4K71C 3FOLA 4GBXB 4N0YH 4ODUA 4Y8AA 3BGFC 2XQBH 4Y5YA 4D8PB 2HT3C 4CVWA 2QADD 3FAWA 2CRYA 4PRHE 1OQOA 3VFUA 4IMLA 4PRBB 1X4YA 3VWJD 3VE0A 4RGNC 2X9YA 2ZUVA 4WY7H 3WE6A 1SY6L 1F4HA 1A4KA 4AQOA 2GT9B 3MMEA 3D3VD 2A1WH 3V6ZA 3QPQD 1WGOA 4LLQA 4WU5B 1FZJA 2DQJH 4KKLC 1HWGB 5J1SC 3WJJA 4LPWA 4I0KA 2RQ8A 4Z6AT 5I66B 3MNZB 1MHCB 3MRPA 3PWPA 2CR3A 1VKXB 3IDNA 3CVHH 2IALA 1OAUL 3BOVA 4G6AD 5HYEA 1SBSL 4M1CD 3L95A 1LHZA 1JGLL 3FQUA 1RJZA 1HOCA 1ZE3C 1T2QH 1GGIH 3UYRL 4YXHL 2WINB 5L88L 4GKOA 1XMWA 4MA1C 5HI4D 4P2OA 4OLXH 4RFOL 2CGRL 1H8OA 4KRLB 3IDUA 5C0CA 5ICYB 5KJRL 2FGZA 1S5IH 1AGFB 3QH3A 4MNQB 3MUY1 5CEYB 3LPWA 4G8IB 5HGHB 5DEFB 1NFDE 4MDIA 2Q7YA 2OZ4A 3SGEH 3HZYA 4LLWB 3HAEG 4QGYA 1REIA 1WICA 2CLZB 2P8PA 3PP3H 4PJ7B 4B53A 4YQXL 4P4KC 1ZOXA 1NDMB 4P2QD 3BDYL 3L3DA 1YMHA 4JQVC 3SKMB 5D6CB 4GMTH 1QSFA 5FGCB 2Y7QA 2J8UA 1E28A 4PJIF 4MLSA 4DW2L 4XCEA 3F6IA 4F3FB 1CE1L 1R3JA 1DBAH 4NP4L 4WFHD 4QRRA 4KRMB 3BP4A 2VISA 5TH2B 5TPWL 5D1QA 1H3WM 1PKQA 3ZT5A 4I18C 2WUCL 1P4LA 5JQ6H 2OMBA 3EZ8A 4I1NB 5GS2D 4I77L 5IVXE 2K7PA 4GS7B 1N2RB 4Z7WF 3G5ZA 3MV9B 2IH3A 5A2IH 5JPNB 2X4QB 5KVDH 5I6XB 1K3ZA 3EOYG 2H45A 5EBWB 4TUJA 3EJZD 5CZXD 1G7JA 1HN1A 3EOAB 3VJ6A 3QDGA 3C08H 5HI3C 4FQXC 5M7QA 3QHFH 5C08A 2FEDD 4JHBA 4YX2H 3MLXH 4K2UL 1TETH 2CK0H 5TQ0L 1TTGA 2NW3B 3PWJB 1W0WA 4HFWB 5F7HA 1FG2A 3MGAA 1RUKH 4HIJB 3DIFA 3WIHL 3AAZB 1S8DA 3PG2A 3UP1A 3AXLB 2EYRB 2VYRE 2W0FA 3RDTD 1TJGL 4G8GD 4NN5B 3OG4B 4N0FA 5HHOD 5KTEL 5GRVL 3P0VL 4LCCC 4U33A 3FZUD 4N8PA 4LFHG 4XPTH 4KGLA 2XACC 1A7QL 2VH5H 4NZRL 3VFPA 1GZPB 5MP6L 4JM4L 4GW1A 3OPZL 3VGGA 3DGGB 3UJJL 3BRDA 3DVIA 2WLYA 4RWHA 1F3JB 2NX5A 4PB0H 4XMLH 4DUVA 2A9NL 5FOBA 2V7HA 4Y4KD 5HHNA 2AEIT 1I3RA 4XP4L 3MRGA 3WD5H 5C9JB 4G6FD 3NZHH 35C8H 1OVZA 3RVXD 1MCQA 2WBJB 4X5XB 4LHQB 1OGTA 2IADA 1LD9B 2ICWI 1AC6A 2IQ9H 2DS4A 5BMFH 5E99H 2XRAH 4YNYB 2WWKT 1KYOJ 4LOUD 4P5TB 5M95B 2CDFB 2VZUA 1A6VL 2DRUA 4L3EB 5FKAB 1SJEA 4OZFA 3MRFA 1BQUA 3B4NA 3VFTA 4X9HA 4XNMB 5LCVL 2V6HA 5JHDA 1JPTH 1FL6B 2C9AA 4WFEE 5I71C 2VO5A 3RWIA 5CMAB 5ICXB 2DDQL 5GSVA 5FYLD 5FGSA 2NTFA 5A2JH 4KTEH 2D0GA 2F54A 3X3FL 3BESR 1PZ5B 2XY1A 4GKNA 4GRLC 3QO0B 2AXGB 4OLUL 5FYJL 3TT1H 3MSPA 4LVNC 3SE4A 3T0EE 1M7IB 3R1GL 2YSSA 2VQ1A 1L0YA 2CDEB 1EEYB 2BXZA 3ARFD 2QKIB 1P7QD 1YEIL 2PW2B 1BVLB 2VNCA 3MA7A 5MENA 3HFMH 2NZ9D 1B0WA 1UGNA 4B41A 2GK0A 5KSBE 2IMMA 5C07D 4KHTL 2CR6A 3T0XA 4F9PA 3U4AA 3TBWB 4JZNA 4Y19B 3U9PL 1MFEH 1SMOA 1UCBH 1URLA 2X1QA 3HE6D 3O3BA 4U7MA 4LEOA 3WHXA 5IFHH 4JKPH 1K4CA 4DZ8A 1BF8A 4WU7B 1JZ6A 4GUPA 4ODXA 1FC2D 1ZLUK 4NJ9L 4HK3J 3TYFA 1FNFA 2O26U 4Q6YA 2HJFA 1CFVL 4PJ7E 2B1HH 1DBMH 1X5KA 1NC4A 4XCYA 1M6OA 4P0DA 1I1AC 4S1RL 1NFDF 2DYPB 4L8BA 5DS8A 4EQ3A 2P1YA 3L3KA 5SWSD 4GRMA 1T0NA 4WV1B 3QUXA 5EUOA 1NCBH 1WSST 5I8EA 3H0TB 3OB0H 3L3GB 4J1UA 2VN4A 5J57B 3RZCA 1Y6MR 1EIBA 3ARUA 4ZDHA 5C1MB 2BOBB 3AS2A 2H41A 3NA4A 3EUUA 4LHUD 4HJGA 5JNYB 3IDGB 5F1KC 4HSQA 4ORZC 3H7BA 5IOPA 5EO0A 1JK8A 3S98A 4EN3A 4C56E 1OAZL 2QV2A 4Y4HA 3JTSA 1V3KA 1NAMA 3OF6D 2G5BA 4XPAL 4CDGC 3KYMB 4O2FA 4XNXH 3QIBB 1L7TH 5HVFB 4OBSA 1KCKA 3RA7H 4L4JA 2WUBL 1MLCA 1A7BA 1J8HE 4M1DL 2DKUA 3MCKA 2BHYA 4WFFE 2FHBA 1II4E 5F96L 3UO1L 3ROLB 2FB4L 5EU7C 4X80L 1RURH 1Q9LA 1SJHB 2I07A 1JHLH 5FK9B 3PIQB 3P11L 2FBJL 5KZCB 5D72H 3SDDC 2R0LH 4ENEC 3U0WH 3C6LD 3KVQA 1NCAL 3QULA 5E7BA 4ZO9A 1ZA3B 3RI5F 2FR4A 3V6OA 5DRNA 4NO0A 4E42A 1Z0MA 5JO5B 2ZZUT 1G7LA 4BH7A 2DJUA 3BDBA 4DAGL 1LO0L 2OSLB 1RZGB 4G43B 2E27L 4K3GA 3PGFH 2DAVA 1Q94B 3GI9H 5IHUH 1NGPL 3GBNH 4JFOB 4ZUUB 5GSRA 4KRPD 1DFBH 3BKJH 4F8TA 43C9A 4OB5H 4LVOB 2DKMA 4W70A 4E5XB 4H20L 1SHMA 4M7KL 4AT6B 3EGSB 4HIHA 4ZQKA 4JRXA 3QG7L 3ZKNC 1TJIH 2BJML 4YHPB 3HC0A 4UQ3B 1G9MC 1IM9A 4PJ8C 3X3GL 1JGUL 5DK0A 1P2CA 4PJ9B 4UDUA 5J13C 2F9BT 2OK0H 2DN7A 3ZYIA 4XNQB 1TFHA 1J9CT 4HQQL 3RGHA 3SDAB 1A3LL 2IAND 2NY7L 3HAEA 3VXSA 4HHAA 1BD2A 4KQ4L 5JPMB 3D0LB 1ZVSB 1G9MH 2GJZB 4L3EE 4HWEL 3F8UB 3GI8H 1UH3A 1A6TA 2ESVD 5CBEA 2YD5A 1AQKL 2W0LA 3GMQA 1EGJA 3WIFA 3BISA 5ESQB 1I8IA 1DSFH 4KKAD 3DX8A 3BX7C 5CEZL 1YECH 1YY8A 2DIBA 1UVQA 2AKRA 5BRZB 1U8LB 2BNQD 2HN7A 1A1NB 5EC1B 2ZSVA 1MELA 3KPSD 1FO0B 2VLJB 3MUGA 3PL6B 1Z9LA 5C7XL 5HDQL 3TC9A 2X4SB 1Z5LB 6FABL 3KPQB 3OAZH 4NZUH 1U0QA 1IGMH 5GJTL 4FFVC 2D2OA 1EEQA 1A7OL 2R2HB 3LKSA 3A67H 2IG2L 3QCUL 1HILA 5DVNA 4PJFF 3GSNB 2X1XR 1GRWA 3OKEA 2PF6A 1WBXB 2R0WL 4JFDB 4LSQL 3V0VB 5F7LB 4OV6F 5T5FL 1D5MA 2HJKA 1K4DB 1QSEA 3O8XC 1FNLA 4HLZH 4I2XB 4IS6B 5DLML 4BSVB 3E8UL 4O02L 2EDJA 4Y19E 5D2LE 3WFEH 4MNHB 4LASH 4H5SA 3WYRA 4U6VH 2XWJB 3O6FB 3OKOB 4U3HA 2NLJB 4PJAF 1AR2A 4NKIH 3TWCL 1J0KA 1X6NA 2V2XB 1FZKB 3QJHA 4K3EH 4OFYD 5B8CB 4P3DB 3VGAC 4OSUL 2CPCA 3L7EA 1A2YB 2WZPD 4JE4B 2WP3T 4APQC 1JGEB 4OLVH 4LLUB 3B5GA 4XC3L 1NGQL 3QG6B 2P5EE 1J0ZA 5FYKH 2DQFB 2MCG1 4U1HA 2VL5B 4NKOB 4PRDA 4JQIH 1S3KL 5FUZH 1GOHA 1SMAA 1NKRA 1FFNB 4IDJH 1CICA 4D94A 2X41A 1KOAA 1IGCL 1FAIL 3F7RA 3KWWB 1WBZA 4WO4D 5ILTL 3IVKB 1GL4B 5HBBA 4G8EB 4EI6B 3SDCC 3OHXA 1UM6L 1NMBH 1HQRB 4NRYA 5C0JA 3AB0B 4L29A 1KIRA 1VADA 4K23L 4HJJL 3LSOA 1YMMD 1YN6B 4TSAH 1G0YR 4TUOB 2AJXH 4XC1H 4D9RE 3KPLB 3V4PL 4ONHB 3D5OF 5K9QG 1OAXL 5TF1L 1NANI 5JW3H 4NO5A 3B2VL 1PYWA 2CH8A 4L4VB 1L7IL 2GK2A 1RHFA 3ZDYF 2GITB 1A1MA 4EOWH 5AG9A 1PG7L 4HIXH 3O9WB 2BSRB 1HYRC 4UV4L 3X14A 5E8EA 4P46C 2YPLE 5MEPA 4KTDL 1JL8A 5D7IE 4BQ6A 1Y6NR 2PO6D 3SKJH 1JWMB 2XG4A 4OZ4A 4EXPX 4KK5C 2EKSB 3LB6D 3CFJA 4PP1D 4JM2A 1DLHB 2RGSA 1T3FA 2IQAB 4OF0A 2YRZA 4YPGB 5JIKA 5FECA 2WMPA 4EI5A 5IQ7H 4G7YL 3VI4E 4I5BA 4OZGA 1RK1B 5EOQL 3U36B 4Q9QH 2A74B 2W65A 5IBLC 1IAIM 5MHSE 5SX5K 3WIHA 3EZJB 3SKUD 5HHMD 3JXAA 4MJ4A 3S35H 1RZ7L 1BOGA 1KG0A 4HS8H 2HVJB 1S9XA 4YO0B 4MJ6A 5F9JA 4JLRB 2GJJA 5HYSB 1BMGA 4JCMA 4W6WB 2WSKA 1X5HA 4RX4D 2R2BB 4MAYB 4ZS7L 4KY1H 4FQCH 4WGWB 5LGKA 5CSBA 1X4ZA 5JXAL 1QPXA 4IJ3C 1G6RA 5TDPA 1FGNL 2BMKB 5GZNC 2VXSL 4DZBB 1UWXK 5IKCB 3VI3F 1FJ1A 3DETD 4OJFL 1G7QA 1S78C 4LCWD 1PVHA 5AYUL 3VRJA 1YUHB 2HVKB 2X7LA 4QTIL 2GJ6A 1RZ8A 3S5LA 2Q7NA 1HQ4B 2JCCF 4U6YA 4FFZH 1TQCB 4MXVF 1OP5H 2PR4L 3U4EB 1MJJA 4JPVH 4CVXB 2YN3A 3D48R 3KGRA 1A22B 5BRZE 5CHNB 2UZYB 2QADB 2J6EL 3B9AA 1S9VB 4X6CB 1EERB 5DRZA 3VWJB 3IT8D 3HG1A 1NLBL 2VLJE 4KGJA 1U8MB 4U4BA 2IMNA 4PJCA 2ZUSA 2DD8H 1CK0H 1IE5A 1OSPH 1YPZA 4QT5B 3HZKB 1DE4A 1AGEB 5E8OB 3D3VB 1CD0A 3NTCH 1RFDH 3REVB 1QR1B 1F3DJ 5F9DC 5GGRB 4YBLB 3OJ2C 4ZXBD 4JFQA 2ITDA 1LQSR 3T3PF 3KLHD 1YY9C 5L2KD 2Q87A 1JI2A 3WLBA 1OAKH 2GAZA 4MA7L 1RVFH 4YHZH 3VXRA 4XPHH 1MY5A 3MBED 4U6XA 2FO1A 4GS7C 4OCMC 3WSQL 4UU9A 4WI5A 1XIWD 3HPLB 4JG1L 4NT6B 1RD6A 5I6XC 3VXNA 1KCUL 1U91A 4MXQC 1IAOA 4XPBL 2Z35A 2QSQA 3RX5A 1I3GH 4Z7VF 3SQBA 4FMKA 3S37H 3VWKA 4S2SA 2Y9RT 4ISVA 4ZYKA 3MC0A 2JTDA 5ESVB 4JFYB 1BX2A 5A3IC 3A6CH 1EBPA 1CGVA 3PWUA 5E24E 3REWB 5ISZD 4NQCA 4QLRA 1TDQA 2B2XL 2O5YH 4RSVA 4PD4K 1M71A 3D39B 3IU4H 3H42H 5E5UB 4NN5C 1KJMB 2IF7A 1A3RL 4AZ8A 2J12B 4H26B 4U1LA 3TO4A 2JB6A 3BEVA 3FRUA 4HX1B 2Q6WA 1K2DB 5HGAA 3BQUC 5EA0H 1I7TB 1N7MH 3HPJA 3HMXA 3RP1A 3WUZA 1IEAB 3MRHB 4PRPA 2CLVB 5I1HL 5LAXB 4LNRA 1JWUA 4L4VE 2AXFA 3QEGH 3QDMA 3MLSH 4FNLL 5EZIH 1RUAL 3R06B 1MJUL 3JV4A 4XVUD 2COQA 2BDNL 5FA3A 4JHWH 5EPMA 5FYKU 3HMWL 4X98A 5BZDB 3ZHDA 3B8YA 4MA8H 1C5BL 4D9LL 4JZJA 3UTTB 2X9XA 4FFWD 3GSXB 4RWYL 2ZUQB 4OZIB 2C3VB 4HS6B 1FYTA 2D31A 4IIQB 1KJ2L 1XF1A 4QO1A 5GGTA 1VACA 1T5WB 2HRLA 4YGVB 1J1PL 3ARGD 3MA9L 5HHPB 1FFOA 4P5TC 1Q9OB 3QDHA 4AIZB 1J1OH 4JRYA 3EOTH 1QQDA 3FB6B 3VRLF 3TJEL 5C0DB 2R9HD 4XAWH 3Q6GH 1WT5A 5I17A 2YD8A 3LEVL 3FO2B 1INQA 4XVTL 2EYTB 4QRPE 3RDTB 4IRZH 3MRDA 3TNNB 1ACZA 1JPGA 3MZGB 2ZOLB 4LQ1A 4UNVA 3W9EA 1N6UA 3LEYL 1A6WH 3MRJA 2MOVA 1NANH 3UAJC 5I1CH 2E5EA 3VXQA 5ENWA 1KLUA 4HPYL 4K07A 5EBLB 4H8WL 3WEXA 1AH1A 2E9JA 3D87B 5DMGC 1LEKA 5JMRA 1QBBA 3VA2C 3VCLA 5LG1A 4MJ5B 1DEEA 4WDIA 1A9EA 1HE7A 3MV8A 4HUWA 1NGYA 1OGAA 2YR3A 1IGIH 4NGHH 1HCVA 2R23A 1GSMA 3EJYD 3TYGL 5GS0L 1JMXA 3RUGA 4Y4KB 4PJIA 3CZJA 2A0LC 3NCYP 4QEGA 3F7VB 4ZO7A 3CZFB 4MWFA 4ZS6D 1L9MA 25C8L 1BZQK 1LO4L 2VITB 1QLRB 4JFFA 5EN2B 5LGJA 3BDXA 4D0BA 3DI2B 2A6DB 4AQ1B 1JNNL 1UENA 4Z7WA 2VWEC 4BKLB 3BKYL 5KSAA 3P0YH 5I30L 3DO3A 3GKZA 2NMSA 1KELH 2R1WB 2ADJB 2BX5A 3HCVA 4NSKA 5D1ZB 1AQDB 4PLKD 1XF3A 1P84J 4DVBA 2CDGB 4G9FB 4GRWB 4YAQB 3PXJA 3C5SB 1YEGL 4TSCH 1IKNC 1WWCA 3A0OA 5JOFA 5C0FB 2HLAA 3O41B 2P43B 4ZUVB 2HH0L 5LJYH 5E9DA 4KXZH 2GW5A 3K2UH 1EUTA 4QXWA 3BXNA 3MROA 3KPNA 4OFPA 3BFOA 4DK3A 3T77B 3KLDA 3X11B 1NFIB 3C09B 4FABL 1T22A 3W5MA 2X89D 2OQJB 4OT1L 2I9TA 3GMRB 4NFCA 1IMHC 3MLZL 1XR9A 4DUXA 2WQRA 1I3VA 3OQ3B 2NY1D 1PX3A 1HCFX 4OD2B 3CSBA 4UDTB 4HPOH 2DL2A 5C07B 1XGYL 4ZFZB 3LD8B 3BUTA 1UJ3B 2BNRD 4XWOC 2MQCA 4ERSH 2WM0A 4HAFA 3T4AB 3TNMB 2B39A 5C3TA 1C16A 5TE4H 1HHGB 4N0UA 7FABH 3G5YB 2A77H 4X7SH 2R4RH 2VDLL 3TJHD 3ESVF 3L5IA 3UPCA 4NHUA 5DEGA 3H3PH 3O3AA 4KUCF 1S7SA 3MLTB 4H88H 5F7WC 4PY8J 3MRLB 4YDVA 4XBEH 2HT2C 1CFBA 1AKJA 1JV5A 3S35X 1VFMA 4KH2A 3GHEH 1V5JA 3F7YB 1X7QA 4KTYA 2YPVL 3CXHK 4XXCC 1DUZB 4LHUB 5D70H 3SEPA 5D1XA 5I19L 3VG0L 4U1KB 3GJFA 4U2ZA 4MS8D 4LVOC 1UKQA 2OL3B 5JZ7C 1G1CA 2IWGA 3DLQR 2A6KA 3ILQD 4PRHA 5L7XH 5D7JB 1CD9B 3IAGC 3U7WH 4HUXB 5DJCB 3W0WE 4MXWL 3M07A 4NZTH 4J8RB 4XGZB 5C0GB 4OZIE 4PJ9C 3PJSB 4AMKL 1KT2B 3BZ4B 4YHYC 3FFCE 3LIZH 3T65B 3GSWB 3G6AB 4LSPL 5L2JB 1E4KA 1I8LA 1UA6L 3SDAC 5DHYB 4WGVB 1CDJA 2C3HA 3CSYA 4HUNB 5IB4B 1FLRL 1XGTA 5BO1L 4YIQB 4OCWL 4K3DL 4OM0H 3IS0X 1FGVL 3C6LB 1IBGL 3SBWC 2OTUB 5DI8A 4PJBF 5DR5L 3B3IA 4O58L 1J87A 1W72L 3RWJB 3SDXF 1F8TH 3D25A 4F9LA 3WIIL 4L8CA 2AJSH 2EDNA 4QHMB 1DP0A 4PRIE 5E8PB 2P8LB 3OBAA 5ERWB 4WVRA 4CBPA 4IRJA 3PL6C 3NH7H 3B9KA 1OLLA 3QYCA 5I8OL 1AGBB 2YXMA 5FA4B 3UC0H 2JIXA 4KRPB 4ORGA 1A6UL 1NFDA 5DJXA 3U30B 2FJGA 1AO7A 1MCPL 1LP9B 3BKCL 1YNKL 3GZKA 4NRXA 3TP4A 2KUTA 3AREC 1UWGL 2X4NB 4K8RC 4MJID 4M03A 4XP6L 3LEXA 3DV6B 1LK3L 2DIAA 1IC4L 1RHHB 4FTVE 4X4ME 1JVKA 4ZAKA 4JFPB 3ZL4L 4PJ5D 5JORB 5D7LE 5EU4B 3QIUB 5A16A 4K8RH 3B83A 3GSNH 5EZOL 2O61B 4HF5H 3FO9B 1NMAH 5BVJA 5F72S 4ETYA 4X7DC 3LHPH 1GYAA 4JFEA 4TOYH 4P23B 5MEOB 4OCSH 5B8CC 5FGBC 3I6KA 4BSWA 1I8MA 3KJ6H 4BK4A 4G9FE 4GRWE 5HYIA 1U58B 4HGMA 5HDOA 1BP3B 5AAWA 3ZYJA 2PXYA 4YDJA 4MQXD 5DZLA 3ETBF 1DQML 3AM8A 3DWTA 3GMMA 4J4PC 4IRSD 2DM7A 4K9EC 3KPSB 2HWZL 4WENB 1UM4H 1U8OB 4TNWF 3RU8L 2AI0H 1A7PL 1BJ8A 5AUMB 1EZVY 1ORSB 3ZDXE 5EWIL 4F7MA 4PGCB 5H37G 3RHWF 5F7NC 2OTWA 1OAYH 3AB0C 3FO1A 4BZ2H 1FFPA 1FBIL 3LS5L 4K9EH 3MFFA 1KN2L 1L6XA 4MAUH 1W8OA 4WCYH 4P5MA 4NN7B 1QYGL 2EC9U 1MF2L 4QXGL 2ENYA 2DQTL 1BIIA 4PGZA 5GGVH 4X5LA 2GFBB 3DNKA 4LKCA 5JW5B 1RI8A 2UWEF 3TT3H 1I7UA 5IEHB 1RUPH 1MFCH 4Q7DA 3O9WC 1YEEH 2ADFL 4NKQB 1T7XA 3P4MA 3HRPA 5EZLA 3BWAA 4Y2DA 1JHTA 4P9HL 3TA3A 3KHOA 4MB3A 2ADIA 3EJJX 4Y4FC 3FOMB 1T1XA 4ONGL 4Q2ZA 4Z0XA 4RFEA 4DGIH 3HI6L 2VOTA 1MCSA 3IDXL 5IMOB 1F4WH 3QUZC 2H26B 3OR7A 2A6JB 2VUYA 1KSRA 4ZFFB 3S34L 1TZHA 5I73B 3ARBC 4O51A 5DD3L 4QOKE 5E56A 4NM4L 4X8JB 2WANA 4ONFL 2VDPH 4K55A 4WO4B 5D5MB 4YJZL 1T7YA 3DRTA 3MQIA 4KJQC 2Z92A 2BRRL 1MCBA 1BZ9A 3ALPA 1LEGA 3HNSH 1CFQB 1GC1L 3MJGX 4MAYC 4MNGB 1YMMB 3NIDF 3HB3D 3F7QA 5F3HB 1INEL 4PREA 1IARB 1E27A 3QHTC 2DI9A 3TVMA 2QQKH 3GIZL 3JUYA 4PJFA 1NLDH 1CE6A 4I4WA 4PPTA 1O5DT 1KEGL 3QO1A 1YN7B 4A6YL 2VIRA 3K8MA 2ZCLH 2A9MH 3V52L 5FCSH 4JHZA 3CMOH 3VXOA 1I9IL 1U8KB 1BM3H 4EUPG 4OFDA 1XGQB 4NCC1 3MRCA 2HFTA 1FZOA 4GW5A 3L1OH 5EORL 3CLFL 1TQCC 3O3EA 2PO6B 3ARXA 2LAGB 2OLDA 1KJ2A 5GGVY 1U36A 2H1PL 4V2CB 5D8JH 4PJAA 4L9LB 2JJSA 4R8WH 5D2NE 2QADC 3R8BB 3VWJC 4YDIL 1NC2D 5DJZB 1CT8A 3T1FB 2ZWLT 5F1SA 1V7NH 1G7HB 4OZHF 3G9VA 3U7AA 1I9EA 1ZT1A 2R0KH 1RMFH 3O6ML 5HHMB 2YUXA 5D7KE 5DJAB 5KS9E 1RJCA 32C2B 3HUJF 2C4FT 4YBLC 5DQJA 5ITBH 2FX8H 3ECBB 4XZUB 1AD9A 1S7VB 2AV1A 3V6FA 3L3IB 2EDBA 5IROA 1DANU 1S7WA 2P24A 5H2BA 4G6AC 3MLWH 4M1CC 3V5HA 3IFOA 5KVMC 2R1YB 4NNPH 1OHQA 2CSPA 5SV3A 5CD3A 3QUYD 4MJ2A 4JKKA 3CFDA 3ZYZA 2D4DA 4LL9A 3UTSA 5HI4C 2VC2L 5IHLB 3O3DB 5BS0E 2A1WL 2P5WD 1I8KA 3DV4B 1RZJC 5ACMA 3W9DB 2IGFH 3TLRA 3RGVA 3GSVA 4LCWB 5SWZE 1MH5B 3V5KB 1X5JA 3OKNA 5D7SL 4C56A 3DSNA 3UJIL 1U8QA 4F2MA 2BCKB 5AZEL 2DQGH 2E6PA 4MCYB 4XPFH 1TMCB 1EFXA 1RZJH 2CK2A 1ND0A 4KZEL 3O2VL 3TFKC 1TZGH 1J8HA 1TVHA 4HK0B 4Q97A 2MCPH 1WCBB 2SEBA 3HNVL 3HR5B 1DQLH 4TVPH 5ADOH 4D0CA 4XWGL 3VXUA 2CIKA 2A73A 2JELL 4RFNB 4YDLB 5KAQF 1IGYA 4DGVH 4HKXA 5JOPD 2Z0BA 1RJLB 1CXIA 3CVIL 4KVNH 1V7MH 1ZTXH 5CAYB 3PDOA 3QEUB 1GXEA 2DBLL 3LKRA 2P7TB 1UWEH 1ZGLA 5JUEH 4AEHL 1OM3L 1JZ4A 3AMLA 4FS0A 4ZXBB 2WWMD 5F7YC 3UZQA 1NCWH 2EH8H 2OXHA 5CP3A 4XVJL 3EO0A 5KSUB 1AGDA 3OKYA 4ODVL 1NEZG 3GO1H 2ZPKL 1KJVA 3IB4A 2D7QA 4K3JL 2MMXA 3DUSA 1ZLSH 1TIUA 1BGXH 1ZLWH 1SM3L 3EAKA 12E8H 3MBEB 1FNHA 1H0DA 2CIIA 3QFJA 5TDNB 3QQ4B 4HWBL 1DQTA 3GK8L 4G6JH 4S1SL 1XIWB 5K9KA 3GM0A 4ELMF 1DQQB 4F57H 4PRAB 2KPNA 1EEZB 3EJZC 5CZXC 2ZUQC 4E41B 1CD8A 4AG4H 5GS2H 1BQLL 4IIQC 2VLKD 2A83A 2QL1A 5BZWA 3TIEA 3EOBB 3VG9B 3Q6FB 2JKXA 4Y16B 3I50H 4UV7H 5DJYB 3UTZA 3GHBL 2DLEA 1EZVX 4KKCD 3VGHA 1P69B 1KUMA 3FRPG 2F53D 1CD1B 3OKMB 4PJEE 3S6CA 1B6DA 2AJZB 5JXEA 1HHHA 4KV5F 3F58L 1CZ8H 4NC1C 2JCCA 2WIIB 3RDTC 4TSBL 1CG9A 1YNTB 5C0BA 2ZKHH 4U31A 5HYJA 5DUBB 3F12A 2GY5A 4AEIH 3VFSA 2YMXH 3GRWA 3LQZA 3QWOB 2CD0A 4MNGE 4GG8A 4F15B 4X5WB 1AGCB 2NY5C 3CCHA 4TTDD 3P4NB 3X17A 3P3YA 4U1NA 5I1KL 3RPIA 4OKVA 3ZKXC 5GIRA 4N5UA 4F7PA 3BIAX 5C09B 3ET9F 4HZLB 3WS6A 1HINH 3NA9H 4Y4KC 3PNWB 4GMSL 3H9SB 2NY5H 3PHQB 3WCYA 2XWTB 4B0MM 3STZB 1BF2A 1KXQE 5EDXA 3RVXC 4QYOA 1PDKA 3U7YL 1BVZA 1U6AH 3CLEH 1MI5D 2C3XA 4Q6IA 4MHHG 2DJSA 4JFXB 2Z9TA 4TYUA 1EMTH 4HT1H 4YHNB 4D0DA 2NYYD 4BQCA 5F7FA 5LXGL 1CDHA 5D1ZC 1C1EH 3CXDL 4Z7VA 5IM7B 2BP3A 4N9GA 1KTLB 5FO8B 3FTGB 4AM0A 2N56A 5E6IA 4LCUA 4JANA 5DHVA 4ZSOB 1Y18B 3RWHA 4NJAH 4PJDF 5F9OL 2OBGA 2Q3AA 4QF1B 5E4EB 1KB5B 4NC2B 1MQKH 5HJ3A 1FNSH 3FN9A 1ZGLM 2D0HA 1FCGA 1R3KB 2VDQH 4HC1L 4N8VG 3KJ4B 4WWKA 4LLYA 5EC2B 3C09C 3QZWG 3KR3L 3ULVD 1MCFA 4PJXB 1GZQB 2XA8H 1EO5A 4KJWC 3TN0A 5FYLH 4UNTA 2UY6A 1KGCE 3W11C 2XT1B 4HWZB 1T83A 4KI5E 2NZ9C 3MCLH 1Y0LA 3RTQB 3D18B 3HE7D 1NSNH 5FB8A 1NH6A 2C3GA 2G75A 1N5AA 3LS4H 4N1EA 2FYYB 4M9OA 3LD8C 1YJDL 3BAEH 3G5XB 5KW9H 1IL1A 1J7VR 1H3PL 3MJ6A 5FIEA 2NXYD 4JPKH 3EO9L 1GHFH 1A14L 1P1ZB 1N26A 4WUUD 4J3WA 4MQ7A 4E0RA 3I85A 3MYJB 4Z7UF 3TZVD 3CX5K 5DGRA 4JY4B 1NL0L 4KZDL 4V1DD 5HGGS 3T4YB 3MXVH 3RWCB 4XH2A 1DBKL 3V8OA 1TZIB 5IBTL 4ZUWB 3RVUD 5IHZA 5B38A 3GSUA 1DL7H 5J6GA 4LF3B 4D9QE 1XR8A 4YHLH 4KMTL 4PV8A 2AJUH 3G6DH 2X70A 3UTOA 1ZWIA 1KN4H 3BH9B 5FCUL 1MFAH 4JO1L 1HWHB 5D7IA 1PQZB 1EAPB 3FT2B 3N1QC 1MCIA 3LOWA 1JP5A 3I9GL 3UBXB 2ERJB 3WNNA 4BZ1H 4RAUB 1OSZA 5D7JC 1R3IH 5I15L 2FH8A 1MRDH 1YEFH 5IW3A 5CINL 43CAB 2XZQL 2DJ4A 5T1DL 5GISL 3ARDD 5IMMA 2WQ8A 3CC5B 1IT9L 1OW0C 2OYPA 2OL3H 3SDYH 3VXMA 2B4CC 4YC2B 3VXPA 1K8DB 3MFGB 4H25A 4FN0A 5I18H 3KAAA 5J12B 2N7BA 1FE8H 3OR6A 3TF7C 1D7FA 4L1DA 4UTAL 4KMLB 2C3WA 2V9RA 3C6LC 4YEEA 2HFGL 4Q9BA 5HI5D 2B4CH 3DVGA 2PYEE 2CMRH 1OARL 4AH2B 4X0KB 2YBRA 4JN2B 2FJFB 1QFUH 3FFDA 3U2SB 4OIIH 2A6IA 4MCZA 2BOCB 5IMKA 1LE5B 2AK4B 4GOSA 2EDRA 4UINH 1GGTA 1JGDA 1R5IB 2VZTA 2ID5A 2EZ0D 2V2WA 3MO1B 1J0JA 1EJOL 4KRPC 1JYWA 1P4BH 3U30C 3UTQB 4ACPA 3QNXA 5IW6B 1OOAA 5C09E 4LCIL 2QJDA 4LCYA 4LDOB 1A0QL 3IXAB 3FO0L 1ADQH 1QFWL 3T09A 4M7LH 5F7KC 6CGTA 2YKLH 1U92B 3H2WA 1JN6B 2Z31B 1KTDA 4XXDB 1LNUA 3LN5A 3FQNB 3TM6A 3PQYE 2HT3D 4X9FA 2GTWB 2PW1B 4WFGE 5E00A 1FNGA 5CP7A 4R4FH 3QIUC 1K6QL 3D69A 4U1IB 2AV7A 2LU7A 3HS0A 4HCRA 1DR9A 5IG7B 3DBXA 3RWEA 4KWUA 3HZVB 4NOFA 3KS0J 4A6YA 5B3NA 1PBYA 4Y5VA 3L3OB 5J9PA 1JIBA 3MJ7B 1FSKB 4GG6F 4ZUSB 4JGMA 4LQFH 3RFZC 5D6DC 1V3MA 4KKAC 3TV3H 5C0RH 2XN9A 2CKBB 1QHOA 3WXVL 3FHAA 1JUFA 1T80A 5F7EL 5EO9A 4BFIB 2IAMA 3FOLB 4JQXA 2BSTA 4ODUB 4PJXE 2QSTA 1E6OH 4PG2C 4Y5YB 1U8IA 1UCTA 4PV9A 5EUKA 1B4RA 5D71H 5BV7L 3GM8A 4UOW0 2VKXA 4MJIB 3MRKA 1U8NA 4IMLB 2V17L 3QNYA 5J56B 3CGTA 3VE0B 3QXAA 4P2RA 2QQNH 3ARSA 1UC6A 4NN7C 3IDMA 3WE6B 1AJ7L 1A4KB 1WWAX 5CLWA 3MMEB 2IJ0C 4Z9KB 1U3HD 3V6ZB 1IQWL 3I3BA 4LLQB 4P2CG 1FZJB 5F1IB 1ITBB 5F70A 5C3LD 5KANI 3RNQA 3PDDA 4QHLB 3MRPB 3PWPB 5C0AD 3RAJH 5F7DB 4PTUA 3IDNB 2IALB 4IEFB 3JWOC 4XHJD 3GB7A 3FQUB 1RJZB 1HOCB 4WW2B 5TQ2L 3CDYA 3V6BR 2YPKA 2EH7H 1MIML 2VN7A 4M61B 4P2OB 3CVHA 1MCCA 1YYLL 4GKZA 5C0CB 3LY6A 5F6HI 3JWOH 2LV4A 3WDJA 4L4TE 3VDAA 4PJBA 5EU6A 3DUUB 2G2RB 2AJVH 3EIFA 1CI5A 3QH3B 2XPGA 4U0RB 4AK1A 3KPRA 3SDXA 5E2JA 1HZHL 3RWGB 4WO4C 5FUOL 4IOIA 2ZCHH 5T3ZE 5E70A 2APFA 3DXAD 1T7WA 3UTPE 1KTRL 3HZYB 3MOBH 3WNMA 4XMPH 4OLVL 5HI3D 4ZO6A 5DYOA 2FLBT 5DD1H 3ULUE 4XPGH 2NY2D 3MODH 2P8PB 3H8NA 4QRPA 4EVNA 1KJ3H 5F7MC 4FQ1L 2YXFA 4FZ8L 1YMHB 3MV7A 4RISH 4QRQA 5CZVL 1HXYA 1QSFB 5GRVK 5K9QI 2Y7QB 3VFOA 2ZSWA 1E28B 1RZFH 1WBYA 3QEQE 4P9ML 3WN5A 1EDQA 1UXWA 5GZOC 5K59E 3L3HB 4QRRB 4PG9A 4I0PD 3DURA 1MVUB 4HKJA 2IEPA 3BP4B 1CGXA 2L4OA 5D1QB 1PKQB 4WHTA 4MB5A 4NWUL 1I9RH 1P4LB 5E2UH 3LKOA 1P5UA 2PO6C 1L4IA 4WWID 3G5ZB 3O6LL 4P4KA 2IH3B 5J6HA 1UQSA 3OMZA 5EZJA 1SYSA 3LB6C 4L9LC 4LVEA 1Q0XH 3BHBA 1T1ZB 4N8VA 4TUJB 5DJ8A 3VJ6B 3QDGB 4QRSA 5AWNL 3DYOA 3WLWD 2XQYG 5C08B 4CNIA 3UYOD 4ZFGL 2NXZD 2R4SH 1XCTA 3K8LA 2XXCB 5GHWH 5KSVA 2UZXB 1W0WB 5FM5M 1EH9A 1B0RA 1MREH 1DUYB 1XCQA 2P4AB 2RR3A 2Y72A 3Q1SL 4ODWB 3CFCL 5AEAA 3DIFB 4FQ2L 4N1HB 4FQJH 5BQ7B 3G04A 1S8DB 3P9LA 2W0FB 3BT2H 4N0FB 4LBEB 4F7EA 3HR6A 3VH8G 4FQXA 1MEXH 2W60A 3QHZL 4JO3H 3FQRA 3VFPB 5I8KL 4KUZH 1F6LL 4AL8L 5HDLA 5TFSL 1UT9A 1W8NA 1JZ5A 3L5WB 4ZD3H 2NX5B 1YYMH 4NQDD 5DFVD 4J3UA 1KYOK 3WHE0 5FOBB 1JHKH 2CXKA 2UWEA 3MRBA 4M43H 3W2DL 5HHNB 1Q9WB 1J86A 1IGFH 1C7TA 4JAMA 3H3KA 4X7TA 4FZEH 3PE9A 5FV2A 5HHXH 3U0PA 2H2SD 4LCCA 4YWGH 1CVRA 2HFFA 3BZEB 4LSSH 1OGTB 2P8MA 2IADB 3TBTA 5L6YH 4RFNC 1QVOA 4YDLC 2VDNH 1HKLH 2EO9A 4LEXL 2P45B 5CJ5A 4ZTOH 4ZXBC 2P44B 3KLHC 4OZFB 3MRFB 4OM1H 1CL7L 5DDHA 4LAJH 1AP2B 2LQRA 3QAZB 4PS4L 2E6JA 3MBEC 2ORBL 4N90D 3IYLW 2NTFB 1CLYL 2CRZA 4NDMA 3O4LA 1EBAA 5CEZD 5L8LB 3PUCA 1XIWC 4GKNB 3SJVD 4NRZB 1H3VA 4NQXA 1OWWA 5DJ6A 2BNUA 2Z91B 3D85D 1N8ZA 4ZOBA 3K4DA 5BXFB 2V9QA 3N85L 5J8OA 3VG9C 2VQ1B 1FORL 4TPRL 3T04D 4HG4J 3FMGH 1CCZA 2IBBA 2UZIH 3QPXH 5HD8D 3DX7B 5C0CE 2ZJSH 1KV3A 4LLMA 4P3WA 2GK0B 1Q1JL 1ONQA 5FKPB 4ZODA 4ZTPH 3BYYA 4F33A 5C2BL 1NCCL 4JZNB 3WHXB 4GRLA 4F7CB 4XCFH 4KK8D 1K4CB 5D9SA 4DTGH 4DZ8B 1KPVB 2VABB 4GUPB 5FO9B 5GRYA 5GRUH 4R96A 4ODXB 3TYFB 4F15C 3FT4A 2J8OA 1TCRB 4JPIA 1ZHBA 1N64H 1JNHB 3BZFB 1XGPA 4GXUM 3BPNB 4XCYB 1CGUA 1M6OB 4YFEA 4UOJA 4L8BB 1NPUA 5DS8B 3TCLA 3L3KB 2J8UE 4XVUC 2XZAL 1G1YA 3HUJA 2Z8RA 1ETZA 5EUOB 5CJOH 4JB9H 4QRRE 5I8EB 2DLGA 4J1UB 4ZDHB 4CMMA 2BVQA 1PKQE 4FFWC 2V5RA 3QRGL 4DKEL 4DKAA 1YEKH 4JDTH 2DQCL 3PWLA 3VFRA 5EO0B 1JK8B 2VLKB 3ELAT 4EN3B 1NAKL 3TPUB 1T1YB 2G5BB 2FJHA 2K7QA 2B1AH 5I75C 5I8CA 4LSRH 4O2FB 1I1AA 2D03L 4HUVA 3GIVB 1QKZL 2F53B 4FTVA 4X4MA 3T0WA 3QDGE 1T6WA 1IQDA 4OCXL 1MLCB 1KF9B 3O2DL 5D7LA 3BIBX 3E3QE 1I1YA 2MHAA 4K94L 3HI1A 5CD5D 3ZKND 1Q9LB 4XHQA 1MCWM 2I07B 2RB8A 5E4EC 1GJIA 3VD5A 4PJ8D 2ZCKH 5LBSL 3EYUH 3KXFD 3QULB 4XVSH 3C9NA 5M94B 1T4KA 1MHEA 2FR4B 1F4YH 1B6UA 4BFEA 3NN8A 5T1MB 4E42B 4C54A 3FN3A 2ED7A 5E2WL 5HVGB 1JNLH 3SKOA 2ARJQ 4BH7B 5DD6A 1JYVA 2JJWA 3EJYC 4R97B 3S7GA 4NUGH 5HSFA 3RTQC 1VEPA 5AAMA 3JWDC 4P2QE 1UG9A 4MX7A 4PR5B 1IC5L 2FIRT 4NKDA 4ZS6C 1F02I 5TE7L 1C5CH 5DC0A 3SDDA 2DQIL 2X4RA 2E8ZA 4LPVA 1BBDH 4LIQE 5JDSA 4JHAL 3JWDH 4K7PH 1QEWB 2VLRA 4ELMA 1FH5L 3FAXA 3NIGF 3HC0B 4PLKC 1IM9B 1UKSA 4JREB 4POZC 5CCKH 1P2CB 3MOAL 3QDJD 2LVCA 1GOFA 2R1XA 3S88H 3PHSA 3LMJH 2IBZY 4JY5L 4DFIA 1WEJH 1EXUA 4HHAB 1BD2B 4KI1A 3BO8A 1I9JH 1LO2H 2UUDH 5F1NA 3W5NA 2VZ3A 2IPKA 3NFSL 1YEHH 3WS3B 4H0IA 1MPAH 5JHDE 1XF5A 3OKLA 1KACB 2PYFA 2W59A 3GMQB 4O9HL 3WIFB 1I8IB 2X9WA 2ERJC 5L0QC 2HG5A 3QXUA 4FFYL 4MLIA 4FQLL 3DX8B 1OCWH 2Y5TA 2F54E 5D4QA 4S0TD 1UVQB 2AKRB 2G9HA 3R0NA 3I2CH 1W0YT 4G8GE 4QOKA 3GJFK 5HHOE 1QPPA 1AXTH 4YC2C 5IBUB 1AFVH 3HNTH 1ACYL 1PLGH 1D6VL 5TDOA 5J12C 3IDYB 3U79A 5CBAA 5I1EH 5MENE 1FP5A 2ARJA 3ARQA 5HDBF 1NUNB 1FIGH 4WUUB 2VQTA 3U46A 3GGWA 1QA9A 1S7XA 3TZVB 1D5MB 1T89A 2HJKB 1B3JA 1QSEB 1O0VA 2J3SA 1QLEL 2YK1H 4LU5H 4R4ND 2HRPH 1UZ8A 3TJHC 4G80A 1PSKH 1SEBA 3K80A 4H5SB 3THML 2ICWA 5C8JA 3FB8A 5F9WB 2NY4D 1B0GA 5HGBA 2EECA 4K7PY 2HKHL 3NFPA 3SOBH 3QJHB 1M05A 5J4MA 4NQEA 4LMQI 1KB5L 2V2TA 2YZ8A 2QQLH 2W0PA 4POUB 1OD7A 3QI9A 4NNXB 4MS8C 4PJDA 4CMHB 3O8XA 3PWNA 1LO5B 3H3PL 3QCTH 5EUOE 1GGBH 4PRDB 4GBXD 4H88L 4OFIA 2F8VA 1ZAGA 2R0ZL 4G6MH 4BUHA 4R3SB 4L8DA 1CICB 1FV1B 3N9GH 1CN4A 5GGUA 1JNJA 3ARDB 1MNUH 2C1PB 3C5JB 4H0GA 5KVGL 1WBZB 1IGJA 4YZFE 4X6CF 3OHXB 3RL2A 1GPOL 5KN5A 4EDXB 5C0JB 2IH1A 3WJLC 1XGUB 1VADB 1A7NL 4APQA 5EOCL 1JF1A 2AVGA 2AEPL 1I4FA 1UM5H 4WFED 3IFNH 4M7JL 1QZ1A 4NO5B 1FSKC 1PYWB 2IBGA 5BW7C 4QGTA 2XIDA 1VENA 1IAKA 1A1MB 1H5BB 1KTKE 1G0XA 3O6KL 3V4VL 4Z7UA 3T0ED 5E8EB 5HYQA 3PF2A 4RIRA 3W39A 3SDCA 2FLRT 3GBMH 3ZE1E 5B21A 4BJLA 3STLA 5MEPB 3V6OE 5H8DA 3OB8A 4XCCH 5BJTA 4Y5YC 2X4PA 2EYSB 5DQ9B 4HGWB 2VXVH 1S78D 4JM2B 3TBYA 4A2LA 5IGXL 1RUMH 2J4WH 2UYLB 4GQPH 5FECB 4NQSA 2AEQH 4EI5B 1NGXA 2K1MA 1T5XA 4KVCH 4N8CH 4MNQD 5IVNA 1TNMA 4I5BB 4OZGB 3RI5K 2NTSP 1A1OA 5T3ZL 3I6GA 1RUQL 5C0IA 1F58H 2I9LB 1CXFA 5SWSE 4G7VL 4P46A 3ULUL 1BOGB 1KG0B 5GGQL 3BUYB 4KK6C 1S9XB 3MUZ1 5ICZB 3HI5H 1D6EB 4WI8A 4JRXE 1MFNA 3MRIA 3SQOL 4PJHF 4D8PA 1B2WL 4PYHA 4M5YL 1HH6A 1RZKC 1EVTC 2YA1A 4WW2C 3CPLA 2OMNA 4PRBA 5DD5L 5DQDL 4Q0XL 5TDPB 3O45A 2ICCA 4YH6A 4MQXC 1YY9D 5DJDB 4P2OC 5GS0D 3S97C 3VXSE 1BD2E 3O81A 1FJ1B 2GT9A 3LZFH 2F5BH 2H3NA 1RZKH 2R29H 1G7QB 4M6NH 4IRSC 4GW4A 4JVWA 2GSIB 5E0QA 2GJ6B 1HSAA 3O2WL 1RZ8B 4U0RC 3S5LB 2VXTL 3BE1H 3FB7A 1VKXA 1BREA 4J6RH 4KDTC 1GOGA 4I3SL 1MJJB 5CSZA 1MUJA 4LSVL 1ERNA 1SYVB 3SKNB 3UX9B 2XY2A 1U3YA 2HT4C 1G84A 5DRZB 4MQSB 1N6QH 1HSBB 4WFFD 5I9QB 3MLPA 5LGHL 4WEBL 4W81A 4PJCB 3NCCB 4ZPTA 4DGYH 4UIMA 1YPZB 2I60H 1RV6X 1YQ2A 4KC3B 1DE4B 2PN5A 2OZ4H 1VHPA 2BHZA 5DMIH 2BFVH 2IFFL 5CEYA 2BY3A 4G8IA 3ZHLA 1QSEE 5D1QC 3WLBB 2D4FA 2JJTC 4LLWA 2GAZB 4HBQA 3VXRB 1Z3GL 1MCNA 2CLZA 4NM8H 4XCNA 4M6OH 5HHQB 5GJSH 3C2SA 5AD0B 4L3AA 3VD3A 1XF2A 1NBZB 3VXNB 2DWDA 4HUKB 3LQAC 1IAOB 3U9UA 2Z35B 1CR9H 2BY0A 1YEJL 3QR2A 4GG6A 2CKBL 3VWKB 1GIGL 3S8WA 4ISVB 4ZYKB 2V5YA 1UYWH 4P57B 3HKFA 4QNPF 5CGYC 1D5XA 1Q72H 3LQAH 2WBJD 3SE8L 2OP4L 2OS7A 4UT9L 1N2RA 1M71B 3UMTA 3MV9A 2LU3A 4QWWD 4G42A 3HB3C 2X5PA 4ONOA 4XTRD 2XZCL 5C6TH 2DB8A 3KPOA 3ZTJG 5IESH 1KPUB 3PDGA 4U1LB 1FPTL 2O5ZL 4IOSD 3TO4B 5I2IA 1TCMA 3BEVB 3HC3H 4L3ED 1PAMA 2F5AH 5I1AB 1DBBH 2Q6WB 3NAAL 4I48A 5HGAB 2VDPL 3EO1B 3HPJB 4I0PB 3WO3B 3PWJA 4W6XB 1AXIB 2P49B 4PRPB 4LNRB 1JWUB 2AXFB 2NNAB 3QDMB 3AAZA 4XB7A 3JV4B 5FA3B 1A47A 5EPMB 3U1SH 3AXLA 2EYRA 3DX9A 4X98B 2B5IC 1HYSD 5GRJL 2AJYL 4R26L 1MWAH 4Y1AA 3BQUA 1FYTB 1VACB 2J2ZA 1GZPA 3O2DA 1UACH 4HBCH 3QWRD 2X40A 4WI6A 3ES6A 4J3OC 1OLZA 1RULH 3LPFA 4TUKH 1FFOB 1R5WA 4I13B 3OAYH 5C9KA 5DJ2B 4JRYB 1DQDH 4Y19D 4OZGE 1SEQL 3ZE1F 5CGMA 4ALAL 3T2NL 1INQB 3NFNA 3QAZC 3MRDB 3SY0A 5C0ND 3W9EB 3OJDA 3UJTL 2MJWA 3MRJB 4FHBD 3VXQB 1KLUB 1UB6A 2XZZA 1LD9A 2X1OA 3QIWA 1LEKB 1LDSA 3VCLB 3VFWB 1DEEB 4WDIB 3MV8B 4HUWB 2EDQA 4M48H 4P5TA 1N0XH 2CDFA 4AIXA 1OGAB 3O0RH 2P5ED 5JQHC 4TRPL 1EFQA 4FP8H 5BOPA 1KNOA 4Y7MA 3RUGB 3B9VA 4PJIB 1JF6A 3A6BH 4RAVA 5HY9A 2IPUK 4KK9D 7CGTA 3KYNB 1NCDL 3VFGH 1CXLA 2GJ6E 5LGJB 4HMCA 4JFFB 2ARWA 3QO0A 4D0BB 4O5LL 2AXGA 3RIAF 5J3HD 4Z7WB 1CLZL 1V8HA 3ESUF 1T0MA 3QIBD 2LU4A 5KSAB 2MWCA 4D9RD 4M8QB 3B6SA 1ZANL 3HC4H 2DTMH 2CDEA 3R0MA 1EEYA 2OI9B 3HCVB 2WWMC 2PYEA 5IUSA 3HG1E 2O5XH 2X4TA 4DVBB 4PJCE 5FHBL 3BPNC 5T3XH 2F74A 4LKXA 5HYSG 5JOFB 3EYVA 1VESA 4DKDC 3WNKA 5E9DB 3TBWA 3MACH 2YPLD 3I6LE 2BC4B 4X6FA 3UZEA 2GSGA 3MLUH 3BXNB 4WTZG 3GKWL 3SJVB 3H9ZA 5F1OB 4WU7A 4L3CA 3P9MB 3QISA 4LLDB 1T22B 4YUEH 2HT2D 1MCKA 3D85B 3NABL 2I9TB 3NACL 1ZLVH 4RNRB 4YHMH 1XR9B 2AK1H 2Q86B 2ZUTA 3WDIA 5MHSD 1WIUA 5FF6A 2DYPA 2Y06H 4D3CH 5LQBL 3CSPA 4KHXH 4OGXH 1LP9F 4JY6A 3PQYA 4FQIL 3DYPA 1BFVH 4LIQL 4HKBA 5JZ7D 3LH2H 4HD9A 1BFOB 5EU3B 4KAQL 1VPOL 2I26N 5H37H 1GAFH 3UDWA 4ODSH 4NQCE 4OUOA 1OB1A 2MFNA 4G8FA 1UZ6F 5IJKC 1G7IB 3LPGA 1MJ8H 2YS4A 1CF8H 4M02A 1D5BA 4NHUB 3KYMA 1EO8H 3O3AB 2XFXB 3QFDA 5IB1B 2J88H 5F6IC 1ZHKA 1AKJB 1CZ8L 4R97C 1F5WA 1JV5B 4QXUL 2J1KA 4NQTA 3MBXL 1Z0NA 5IJVB 1BLNA 4PGBA 3PIQA 5I1JL 4OCYH 5D1XB 1CU4L 5BRZD 2AXHA 2HKFH 2XNAA 5ITFA 3ULSA 4UB0L 2A6KB 4PRHB 3EFFA 1ZA3A 2NYYC 1S5HB 5KVEH 2VLJD 3NCJL 1L0XA 4MHHI 4HXAH 2EDYA 2HFEA 4JR9H 1VGEH 1QNZH 1FYTE 3FL7A 4NOBA 4OLEA 2AQ2A 2H9GA 5F7UA 4XXCA 4ZUTB 1T03H 2RCSH 4HUUA 4ZUUA 3CLEL 4EXKA 3CSYB 4JRYE 2OJEB 5T1KD 2D9QB 3JVGC 2VDKL 1ORQA 5DI8B 2R56L 3O6FD 4CL7A 3B3IB 9CGTA 2OR7A 3AU1A 4R6UA 2I27N 3D25B 5ISZE 4YHPA 3M45A 5HVHB 4LPYA 2KQMA 3CU1A 4TULL 4PJ9A 2R69L 5GS3A 3SDAA 4WW1A 1JZ2A 3MX0A 3HE7C 3MLYH 2BY1A 3MV8E 1OGAE 1DVFD 2YD3A 3BYTA 4YLQT 2JIXB 3D0LA 3MRNB 1NFDB 1ZVSA 5DJXB 2FJGB 4L9DA 4KU1A 3SBWA 3IDYC 4PJIE 2NXYC 5K33A 3VGBA 5JW4R 4CU8A 4M3JA 2FL5B 2DQUL 1QSZA 4DUWA 3TZVC 3QXDB 5D5MF 3FN0L 4G3YL 1NAML 4ZAKB 1SY6H 3MCLL 3SE9L 2MQ0A 3P4OB 5EC1A 1NJ9A 4LPXA 5A16B 3RVUC 3SN6N 3QEQA 4B50A 4OIBA 3CK0L 3PL6A 3DI3B 5E2TL 5T33H 1OTSD 5BVJB 5F9WC 2JLLA 4JFEB 5E03A 5F9AC 3NIFF 4HLJA 4L4VD 5KOMC 4R4BB 4UOW1 3SPVA 3AREA 3VMPA 4RDQG 1HI6A 3SO3B 1OAUH 5ACZB 1SBSH 3I6KB 1I8MB 3D2UA 1WBXA 4JFDA 1LO3L 3UYRH 3O9WD 1IKFL 3DMMD 4YXHH 2PXYB 3QDAA 4YDJB 4CMHC 4I2XA 5L88H 4IS6A 4TQEH 4BSVA 5E9DE 5ID0B 4RFOH 4JFHE 2CGRH 1D5ZB 4NNYA 3LDBB 3GMMB 4MNHA 1RIVL 2XWJA 1CICC 3OKOA 5KJRH 2AJ3A 1JTOA 1MHHB 3ARDC 4PLOB 3X13A 4MVBC 3DGCR 2WLZA 2V2XA 1FZKA 5J06A 4F7MB 5FGBA 1JPSL 1CDIA 2OTWB 2X09A 5IFAL 5IQ9A 3N50A 1FFPB 1CFTA 3Q2CA 1MFDL 5DK2B 2LTQC 2D7TL 1F97A 3S4SA 3QG6A 4YQXH 4P5MB 5HI5C 4XX1E 3BDYH 4RRPG 3O4OC 4X9IA 4GAGL 1BIIB 4J4PA 5JIHA 3VDBA 1F6FB 5T5NF 4BFBD 2B0SL 1S7UB 1I7UB 1H5BC 3K1KC 5IF0A 5JHLL 3RY5A 1KCSL 2F58L 4PJGF 3KWWA 3MV01 4DW2H 4N0UE 4NP4H 1QRNA 2NY4B 4G8EA 1Y6KR 5DVMA 2VSCA 4G5ZH 5ELIA 3P4MB 2Q20A 4LARL 5TPWH 5EZLB 3BWAB 1JHTB 2WUCH 3MPCA 5MEQA 3LRHA 1LWRA 2EZ0C 4B7IA 3EYQC 4RA3A 1YN6A 4I77H 4M4RA 1T1XB 4Z0XB 1MIEL 4LSUL 1D9KA 4JG0L 3HRZA 4GJTB 4NO3A 4KPHL 4EI5C 1S9YB 2VR5A 4Y2OA 1HNGA 1ULVA 3OGCB 4M7ZC 1EGJL 1TZHB 2IC2A 3P73A 1LGVA 3E6FA 1DDHB 1TENA 4O51B 2BSRA 2DIJA 1ZKAA 1A6AA 3L7FB 4BQ8A 1AY1L 5IW1B 4K2UH 3CFBA 1ZT7A 1IAIL 3DRTB 3K46A 5ALBL 5TQ0H 1E6JL 2Z92B 1A4JA 1BZ9B 2E9BA 2L0DA 4RQQA 3QQ9D 4Y4FA 1OAQL 3WIHH 4CVUA 3QUZA 4L8SB 1U3JA 4HH8A 2DQEL 2PTVA 5IFJA 4PREB 1TJGH 2YUVA 2DQDL 5T1LA 5KTEH 2CXGA 3P0VH 2A74A 3UYPA 4PJFB 1LVEA 4O2CA 4I4WB 3ARBA 3QO1B 4OCNC 1MVFA 1A7QH 3WNLA 3FONA 5EOTA 4NZRH 1RAMA 3BW9A 5MP6H 4JM4H 3T0EB 3PP4L 3OPZH 2HVJA 4YO0A 4JO2L 1K5NB 1FC1A 1FZOB 3M8OL 5EULV 3WFDL 2R2BA 3O3EB 4MAYA 3BGAA 3C87A 2A9NH 1KJ2B 4OI8A 1QP1A 2MTPA 4P2YA 5FUCE 4XP4H 1VFAA 3BH8B 3ZDZF 5KSBB 4LHUG 3MV11 3D0VA 5CIPB 1KFAL 1VERA 4TVPD 3W82A 1CT8B 2EDWA 5I9QC 4PBXA 3VW3L 4OD3L 2HLFC 5IIEA 5BVPL 1N3NA 3PABB 1AO7E 4K7FB 4BH8B 1HHKA 1YQVL 2Y36L 1U3HC 1H15A 1T1WA 1YUHA 4Z76A 3K0WA 3TFKD 4X4YA 2ICES 3D39D 3WHE1 4YHOL 5DQJB 4ODHL 1A6VH 3I3DA 2QR0A 1RSFA 1BHGA 2AV1B 3V6FB 1WAAF 2P24B 1S7WB 1WQVT 1UH4A 2BVUA 1BFSA 5DTFB 3V5HB 4XHJC 3IFOB 5LCVH 1W0VA 4X6CA 3VWJA 4UAOB 5CD3B 3PP3K 3ZT6A 2DDQH 3NPZB 3JV6A 3P30L 1BBJB 3X3FH 2LVEA 4JFEE 3MXWL 1AGEA 1CGSL 4GKSB 3D3VA 4OLUH 5FYJH 1I85A 3GSVB 5CJXC 3REVA 1QR1A 4NWTL 3M17A 1FVEB 1RU9L 3OKNB 4C56B 3R1GH 4F2MB 2FX9L 4JVUA 1Z9SA 5LWYL 4ETQA 1FVCA 1FHGA 3W0WD 3UTTD 1I7RA 1YEIH 4ODTL 1KIQA 1NEUA 2EDTA 3IDIA 1EFXB 4ZG1A 2E7LC 1ND0B 3U4BL 1T66D 1J8HB 1TVHB 3FFCD 2NY2C 4HKZA 1MCWW 4KHTH 3CSGA 4Z7QF 3T08A 4D0CB 1OP3H 5F44A 4NT6A 2CIKB 3U9PH 2A73B 5KVFL 4POYA 4HKXB 3I3EA 3OAUL 3T8XB 3RWFA 3PDOB 1N6VA 1PJ9A 3WKNA 4NJ9H 4I0PC 4OQTL 4H0HB 1CFVH 3EO0B 4TNWK 5AZ2L 1AGDB 3ZO0A 2IPTL 3REWA 1KJVB 1N0LA 4ZFOA 2R8SL 3DUSB 4JPWL 3V2AR 4S1RH 1WV7T 3RHWK 2Q8BL 4PRID 4MSWA 2CIIB 1MFBL 2J8HA 2VL4A 4P2QA 1KJMA 5K9KB 3MGOA 5HTSA 2QHRL 3IF1A 4PJHA 5EU5B 1G6RL 4PJ5E 1AR1D 4HX1A 2ITCA 4NUJA 4QCIB 3VFNB 2A83B 5BZWB 2UVFA 3TIEB 3WLWC 1F4XL 3GNML 2NXZC 3C8KA 3SO5A 2QEJA 3UTZB 3MRHA 4PD4J 1WVZA 5LAXA 4XPAH 2XV6B 3S3JA 1HHHB 2WUBH 4HGKC 4S11A 2JCCB 4M1DH 3S36X 4R90L 4IHOA 2Y6SD 4LVHB 5F96H 5C0BB 3UO1H 2FB4H 4R7NA 5D1ZD 3K8KA 4HS6A 1UXSB 3F12B 4IIQA 3P11H 3ARZA 2FBJH 3VFSB 3U0TB 3LQZB 3MJ9H 4JDZB 4G9FD 2P48B 2FEEL 1NCAH 4PLNC 4U1NB 5H35B 3MLVH 3RPIB 2VDOL 3S3PA 1Q9OA 4AIZA 5GS1B 4OKVB 2X42A 3DVFA 5DFVC 5GIRB 1MHPL 3UPAA 1EHAA 2BVPA 4PJFE 3ME0A 4RZCA 3WFBL 3HHRB 4RGOL 1LO0H 4DAGH 4U1SA 3RDTA 4G8GA 3TNNA 2E27H 1YNLL 2YC1B 5HHOA 4KJWD 2H2SC 1NGPH 4I3RL 4Z78B 5EB9A 2ZNWA 3QEHA 4Q6IB 3W11D 1MCEA 2BXYA 2VDRL 5JLZB 3BP7B 3V4UL 3GMOB 4MJ5A 1W2KT 1A7RL 1TJHL 4DCQB 4PJAE 4H20H 5ID1A 4M7KH 4P3CH 2H32H 2OI9C 3QG7H 3C8DA 2BJMH 5D2LB 4Z7VB 4Y4KA 3X3GH 1JGUH 2XTJE 2VXQL 4JRWA 3C2AL 5HHXL 4AM0B 5HYFA 3CZFA 3H9HB 3KG5A 4HFUL 4LLAA 5E6IB 4RMRA 4OD1L 5DHVB 3RWHB 3ZZ1A 4HQQH 1W72B 1A3LH 1QLRA 4QHNB 5EN2A 2NY7H 3DRQB 5HJ3B 4KQ4H 5E6ZA 1HKLL 5E2VL 3OJVC 3MRMB 4HWEH 1BZ7A 5H94A 3LQMA 4LLYB 5JA8B 3GSRA 3AC0A 4HMEA 2ENSA 1AQKH 1XGRA 2FHCA 2P5EB 1AQDA 3HMXL 4PFEA 3NCFB 3F7PC 5CEZH 3UTSE 4YAQA 2HJLB 5B3JF 3C5SA 5HD8C 1Y0LB 5IB5A 3MREA 5FB8B 4N0CD 2GUOA 4ZUVA 2G75B 1H3TA 4IMKC 1N5AB 5HDQH 4KMQA 5D7JD 6FABH 1BEYL 3ZDYE 1MAJA 4YE4L 3OB0K 4YDKL 1IL1B 1WF5A 5GJTH 2E6QA 3LRSB 4KK8C 1A7OH 4ZMAT 2IG2H 3QCUH 4KKBD 3RBSA 3FCTA 4MQ7B 5GGTL 4E0RB 3C60D 2R0WH 3DJ9A 5I74B 4LSQH 1BQHB 4S0SD 3OL2A 3GMRA 5T5FH 3ARFA 4AEFA 5DLMH 2VE6A 2ATPA 1P7QA 4O02H 5E5MB 3OTTA 3OX8A 3VXUE 4XH2B 1NCUA 5IHZB 5B38B 3GSUB 1A5FL 4H1LB 4OI9A 5T5NG 5J6GB 1LE9B 5C07A 2EIZA 2D7NA 4JCLA 3CUPA 1KULA 1P53A 1XR8B 2LAAA 4PV8B 2YPLB 2X70B 3HE6A 2NW2B 1RIUL 3KPMB 3TWCH 3RX8A 1E4XL 1T04A 2JF1A 3IS1X 5D7IB 2EC8A 2KH2B 5F6HJ 4RMQA 4OSUH 5I16B 3INUL 5JR1L 2RFXA 3QFJE 4XC3H 1MCOL 3G5YA 1NGQH 4EIGB 1OSZB 1UKTA 4JZOA 3MR9A 4Q9RL 3CH1B 1S3KH 1QR4A 2FD6L 4XI5C 5ADPL 5IMMB 5SWSA 1IGCH 1FAIH 5D7KD 4HIEA 3VXMB 5DO2D 5ILTH 4H25B 1E4KC 1I8LC 3F7YA 4OBRA 5SWQB 1FG9C 4UT6L 4HULB 1UM6H 1DUZA 4XMKL 4LHUA 5CD5C 3VI3E 3O11A 3QUKA 2GI7A 4K23H 1KCVL 4HJJH 4U1KA 2JB5H 5DUML 5F88B 4I8DA 3V4PH 4CJ0A 3QIUD 1OAXH 3DVGB 5EBGA 3LN9A 5TF1H 4NZDA 4QKXB 3B2VH 2JCCE 3OF6A 4HUMB 4MXVE 4CN6A 2VRAA 4HUXA 4Z7NF 5C0BE 4GAJL 5DWUL 4F9LC 2VDML 4J8RA 5HVHC 3OZ9L 5BS0D 4P23D 3FFDB 5TE6L 5HYJE 3G5VA 2A6IB 3RPKA 1PG7H 4MCZB 1KT2A 3BZ4A 4WW2F 5IMKB 4UV4H 5SWZD 1FL3A 4ESKA 5L2JA 3KS0H 1MRCL 5DHYA 1JGDB 3HLAA 4RGMC 4F7TA 1B4JL 4XAKE 4NFDA 5I1LA 5JOPE 4KTDH 3QNXB 3C6LA 1NBVL 1KLGB 2OTUA 5EOCJ 3T3PE 4G7YH 1QFHA 4I9WD 5EOQH 3STBA 4R0LA 3LN5B 1R0AL 4X6BA 1KC5L 4NUGL 4ZAKC 1NGWB 1FNGB 2UVEA 5CP7B 1CVSC 2P8LA 5ERWA 2FATL 1RZ7H 3QUML 4JFZL 3T0DA 1AGBA 3O3UN 3CFKA 1ZHNA 1QFWM 3LKPA 3OAZK 4ZS7H 5T1KB 1LP9A 2XQYK 4A6YB 3T2OA 3TBSA 4Y5VB 4Z7VE 3SO3C 3UPRB 1TQBC 2FX7L 3TO2B 1VB9A 3RIFF 5F3BA 5JXAH 1M7XA 4P99A 4ZO8A 1HK6A 1F11A 1RHHA 1FGNH 5HPMA 1MRFL 2VXSH 4JFPA 5JORA 3LDBC 4OJFH 2FDBP 4O4YL 2XI9A 1SVCP 4DKFL 5AYUH 3QCVL 2IAMB 4MD5B 2BSTB 4HWUA 3KNBA 4QTIH 1CBVL 4BA8A 2IANA 5CJQL 1FN4A 1I9JL 4NKMA 2Q8AL 1DVFB 5MI0B 1BAFL 1KBGL 2PR4H 5MEOA 4PV9B 4GQ9L 3BGMA 5EUKB 1EEUA 3DSFL 2ESVA 2D7MA 3MRKB 2J6EH 5A43C 1Z9MA 1A8JH 3OSKA 5D6DA 1NLBH 4ODBD 4R4NC 3IDMB 3CDGA 4HH9A 2NY0B 5DSCA 1MAML 2DL9A 2BNQA 1INDL 3LCYA 1WZLA 4OLZL 3KPSA 4PRNA 5E08L 2YRPA 1IC7L 3BGFB 1ZA6B 4PG2A 5AUMA 2NY4C 4UZGA 1C08A 2GCYB 4LPTA 3I02A 1A64A 4MA7H 4M6AA 1LDPL 5DC9B 3L5HA 2YPKB 5GZOD 2VAJA 3MNVB 3DMMB 1J1XL 3WSQH 4CJ1A 4AJ0A 1CS6A 4WUKL 4DQOH 2EXWC 3VRLE 4JG1H 5DC4B 4GKZB 4GBXC 1KCUH 3BSZL 4O00A 4X9GA 4XPBH 3L5XL 3TBVB 1HIML 1WWWX 4UIKL 4U7SA 2WK2A 3BN9D 5FEBA 5FAAA 5MERB 1VA9A 4CVZA 1F42A 5INCB 4IOIB 4P5KA 3RY6C 1QO3B 4OFYA 2DWEB 2QQLL 4M1GL 4QTHA 5DYOB 3ZLQC 2B2XH 3G6JF 3BRFA 3ULVE 2QSCL 4QRPB 5GGSY 3V5DA 4L8SC 4AENA 4OQTA 1P4IL 3VXME 3MV7B 1A3RH 4LK4A 4QRQB 4ZFFA 2VZOA 1FRGL 3L5JA 3VFOB 2ZSWB 3SCMD 1WBYB 3WN5B 2A38A 2LE9A 4G6KL 3DURB 4PG9B 1ZK9A 4HKJB 4WO4A 5D5MA 2MPAL 1JPFB 4KXZI 3T0EC 4HDIA 4WHTB 5JW4N 2J5LB 4FQPA 4NHCL 5I1HH 4HZAA 1RUAH 1YMMA 5K93A 1MJUH 4KI5D 1RY7B 3IFNL 1KLFA 2BDNH 5J6HB 5F3HA 1SYSB 2JK5B 3HMWH 1C12A 3BHBB 3ISWA 1C5BH 4D9LH 5A2LH 3UBXG 4QRSB 2PTUA 4RWYH 4Z8FL 1ZEAL 3HZMA 3U6RB 4CNIB 1KJ2H 1HDMA 1BVKA 1CDUA 3P0GB 1OPGL 3E6HB 3VFVB 1J1PH 1XCTB 3MA9H 5KSVB 5CIPH 2CJUH 1F3RB 1B0RB 1OP5K 3QWQB 2PO6A 3TJEH 1NUFA 3UEZA 4H8WC 2VXVL 1KCRL 4L9LA 3LEVH 2EDOA 4XVTH 4UQ2A 1T2JA 2BERA 4F7EB 3DOSA 4UAOC 1AHWB 3T1FA 3LEYH 2C26A 5CEXA 4FQXB 2ED9A 5GS0C 3JV5A 4HPYH 2W60B 2W07A 4H8WH 3FQRB 2YEZA 4UTBL 1J05A 3AS3A 4Q9CA 1VFBA 3IFLL 3ZKSD 3ECBA 3Q3GA 5IVZB 3ZMRA 1GVIA 2WIMA 2UWEB 4RX4A 3IJHA 4A2MA 3TYGH 3VMNA 5GS0H 4JAMB 4PJGA 4UILL 2XN9E 2R1YA 4E41D 1JZ3A 1F00I 3VGDA 5ESAB 2Y07L 4LCCB 25C8H 4F58L 4Y16D 2I5YL 1LO4H 2P8MB 3EW3B 3TBTB 2AW2A 1QVOB 2DLHA 3O3DA 2R29L 4YFLI 3QA3A 1JNNH 3W9DA 4LCWA 2Y25A 3BKYH 3V5KA 5I30H 2FGWL 4P2RE 2MSPA 3B5TA 3ZYOA 4QRTA 4U6HA 5DDHB 5JDJA 4S1QL 3CH8A 1YEGH 4J3SA 4PB9L 3BD5A 2XG5A 2XWBA 4HJ0D 3HR5A 5E8DL 1T0PB 2HH0H 4N1CA 3LKQB 4NQXB 2GYSA 5C09D 5DJ6B 3BJLA 4FABH 1N8ZB 3BPCB 3H9SD 4ZXBA 4OT1H 4WEUD 4RGNE 5I1GL 5L2KA 1RIHL 3MLZH 3W0WB 1I1RA 1MJ7L 1VFOA 1EHLL 2WBJC 3Q0HA 3WKML 1XZ0A 3MBEA 1JPST 4WFGD 5IP4A 5JXEC 4PJBE 1ONQB 3QQ4A 4Z95L 5EU6E 3FFCB 1SJXA 4QWWC 4F33B 5HHVL 1XGYH 4RBPH 1XIWA 3KPRE 3SDXE 3IJYA 1CWVA 4XTRC 4LVHC 4PRAA 4WJ5B 5B22A 1IEBA 5D9SB 1QBML 1ZV5A 2XICA 1ZVYA 4OTXL 4C57C 1KEML 5EH1A 3FT4B 4JPIB 5DJYA 1OWRM 5GS1C 1DQJA 2VDLH 4PGJA 5E5RB 1XGPB 5ISZA 3MV7E 4U49A 3DX6A 1CD1A 1PGRB 3TCLB 2UV3A 4PRIB 3HUJB 3TH3T 5IV2A 1ETZB 2WIIA 2Z93B 3ZHKA 3ULVF 4PGDA 2EKJA 1HYSC 1WAAA 2EIDA 1X5XA 2OJZH 1GGCL 2YPVH 5DUBA 4ZNEA 3PWLB 4Q6IC 3VFRB 3QWOA 5I19H 3VG0H 4XP9L 5TGBA 3RTQD 4LPUA 1JGVL 4JO4L 4LGPB 4MXWH 4FTVB 3QXTA 1S7RB 4DN3L 1IQDB 3CFEA 4XP5L 5D7LB 1A6ZA 1Q0YL 3WMSA 3PHQA 1SQ2N 4UT7L 1I1YB 4OLWL 2MHAB 3PGCA 4MMZC 4AMKH 1U2HA 5E6IC 3ZE0F 4LSPH 4E9LA 5C0NC 1G9NL 3C6SB 1UA6H 2HTKD 4JDVB 3WV0A 3MUJA 1FLRH 3C5ZD 4JFXA 4POZD 1K8IB 5DT1L 1EA9C 1J0HA 5BO1H 3M1BB 4OCWH 4K3DH 1FGVH 5IB3A 1IBGH 2W9DL 3ARGA 4YHNA 3C9NB 1T4KB 4KKNA 5DR5H 1J5OL 4O58H 5DHVH 5E1AB 4WV1C 3DXAE 3NN8B 1W72H 1ZSDB 2N7AA 3UCRA 3KYKL 2W91A 3WIIH 2AQ1A 4L4TD 1V3JA 3FTGA 1XF4A 4FXLA 4X7EC 4KK9C 2AP2A 1AIFA 4NKDB 5T3ZD 5I8OH 4LP4A 3BIKB 3SDDB 1A6UH 2D0FA 4F37F 3TIDA 2UWEE 4NCC2 5J3HC 1MCPH 2X4RB 3BKCH 2N1KA 2OM5A 3T2PA 3QIBC 5JDSB 4X7FC 1GZQA 3QUMA 4ELMB 2VLRB 4XP6H 1WZ1L 5I74C 4FP8L 4Y5XB 1LK3H 3RQ3A 1AI1L 2C5DC 4X6DF 1LK2B 3ZE2F 3DTXB 2ATKA 3ZL4H 3B43A 1TPXB 2R1XB 3J7HA 3WFCL 4HV8A 2FYYA 2F19L 1J0IA 2IFGA 3BO8B 4J3TA 3AY4A 4OCRL 1FDLL 3GUTA 2IPKB 1C7SA 2HA1A 2FRGP 3GMLA 2AGJL 1KENL 3OKLB 4H1LH 1MCJA 2DQHL 3GRWL 5E94A 2PYFB 4JJHA 1QBLL 2HG5B 4LSTL 2AK4D 1QRKA 2Y5TB 3O4LE 4O2EA 5DJ0B 5J13B 1DQMH 4EBQL 5BV7B 3NIDE 2GTZA 4QOKB 3BRGC 3OXSA 4LF3A 5ALCL 4J3VA 3GSQA 3NCEB 2HWZH 3MLUL 3RU8H 1A7PH 5CJ8A 3GJEA 4CKVX 5EWIH 1RJYA 3CX5J 2Z31D 3GMNA 1FBIH 1KXVC 2X89A 1QA9B 3GGWB 3C60B 1S7XB 1AE6L 2DLIA 3LS5H 4Q58C 1KN2H 4YHML 2VKWA 1XH3A 1QYGH 3IU3A 4QXGH 1MF2H 1SEBB 2NY6B 4P9HC 43CAA 3N1MC 4MQTB 3N1PC 2ICWB 4XNYL 5C8JB 4KQ3L 4OZFG 1I7ZA 3BVNA 5HGBB 1B0GB 2ADFH 4GSDL 1K8DA 1BFTA 4OZHE 1M05B 3MLRL 4FQQA 4GH7B 2AEWA 2BNRA 4HS3A 1WIPA 4P9HH 1JRHL 2EICA 4TNVF 3DHJA 2L7UA 1XT5A 4ONGH 1SBBA 3QI9B 4PJDB 3HI6H 3IDXH 3O8XB 5D2NB 3HUJE 3PWNB 1DLFL 3JTTA 2Q1EA 4MYWB 2FO4A 4JN2A 2FJFA 4L8DB 3CIQA 1GC1C 3S34H 3EFDL 5DD3H 2BOCA 1LE5A 2KKQA 3FT3A 1PEWA 2PNDA 4NCDA 1IGJB 4UI2A 4NM4H 5KS9B 4ONFH 3VFMB 3RL2B 3VGAB 2BRQA 5KN5B 1FO0H 3MO1A 2IH1B 2BRRH 3UXFA 3D9AL 1U93B 4APQB 3IKCA 3ROOA 3C8HA 1GC1H 1YPZF 5DD0H 3IXAA 2RIKA 4KK6D 1INEH 3O6FC 2Q76B 3FQWB 5DMKA 3ZTJH 5DURD 3S37X 1IAKB 3V0WL 3GIZH 3DVNB 3PWPD 5BS0B 1J10A 1KB9K 3BEWB 3AFLA 3RVWC 3V52H 3E2HB 4XNUL 5SWZB 3W39B 1I9IH 3SDCB 4LRNL 2IAMC 4QXTA 4X8XA 4CRPA 4JQXC 3STLB 3WJLA 1DVFC 5EORH 3CLFH 4P2OD 3HZVA 4Z5RB 5BJTB 5MI0C 3MRRB 2X4PB 1SJVA 5B39B 5C0CD 5EO1A 5TF0A 3TBYB 2H1PH 4YHKL 2I25N 3MJ7A 2GKIA 4KJYB 1NGXB 1T5XB 5BW7A 5L9DL 4YDIH 5EU7E 4CUCA 3I6GB 3OKDB 2F8XC 1F90L 4OGYL 5C0IB 4PBWD 2FECL 3EBAA 4HEPG 2AXJA 4Z7OF 3S36L 4OIAA 3O6MH 4P46B 3QB7C 4LDLB 1CQKA 2HT4D 3BMWA 3ULVL 5ANME 2APTA 4DK6A 4L5FH 4ELME 2VLRE 1IGTB 1Q8MA 1OTSC 5A2FA 3X12A 3MRIB 5CUSL 3KLAA 4LSDA 5GPRA 3BP6B 5I1DA 2K3TA 4P4RA 1N5YL 1A6PA 1HH6B 1QSFD 5FO7A 4CN4A 4M5ZL 3CPLB 4MJIA 4Z0BL 1E4WL 4DN4L 4GXVL 4HEME 4XP1L 4QRRD 3DMMC 3PWVB 3RJDA 3O45B 3BZDA 5D1QD 1CFSA 3IETA 1CGTA 2VLLA 1RQ5A 2VC2H 4PJ5A 2H3NB 2VZ1A 4RA0C 5I0ZA 4KV5E 4GW4B 1NDGB 5F1IA 4RAHA 5IWLC 5T33L 1HSAB 3T3MF 3ZTNH 5D7SH 4QHLA 3UJIH 3FB7B 4UMGA 5F7DA 1FL5A 5CSZB 1MUJB 5AZEH 1HEZB 4PJEB 3QDGD 4WW2A 3KXFE 4KZEH 3O2VH 4IJ3B 5C08D 4TQEL 3HNVH 4M61A 4MB4A 5CGYD 4XWGH 1JZ7A 4ZPTB 1F6AA 4UIMB 2JELH 5IT2L 4BM7A 1JFQL 4IRSA 3CVIH 3DUUA 2G2RA 4WNQB 1BWWA 2DBLH 1DBJL 4U1JB 3WN5C 4AEHH 1OM3H 5CILL 3RWGA 3ALWA 1WUNT 3BKML 2ZUYA 3EYSL 4KDTA 4XVJH 4HCRL 2I24N 4LRIC 2J5LC 4ODVH 2ZPKH 4K3JH 4OF7A 2VMFA 2OR9L 1SM3H 2AABH 4XCNB 1TITA 2JJUA 4MDJB 1IM3A 4HWBH 1XF2B 3BD3A 2CLRB 3GK8H 4S1SH 2DWDB 3I84A 2NX5D 3U9UB 4FA8A 5DUPL 3RUGF 3QDJE 4NQEE 4CW1A 4GG6B 1QFWI 3RKPA 1BQLH 4OV5A 3L3HA 1MVUA 4G5ZL 4PJDE 2G60L 3GHBH 2JJTA 1D5XB 5I1IL 3SGJA 2NZIA 3IAQA 3QQ9C 5IBUG 3RKDD 5J11B 4U3XA 4G42B 4PUBL 1JYXA 3F58H 1T1ZA 2ZOKA 1T21B 5FYKE 4TSBH 1G7MB 4N0YL 3KPOB 1U8HA 1AHWC 1U8PA 5I2IB 4NO2A 2D3VA 2XQBL 5K9JH 4I48B 3SCMB 1S9WA 4PP2B 3ZKMC 5JHDD 5DVOA 5I1KH 3SGKC 4U1MB 2BK8A 4ODWA 1FNEB 1DUYA 4NQVA 2E7CA 3OKKA 2F54D 4WY7L 1BJ1H 5BQ7A 3K3QA 2C7UA 4GMSH 3DX9B 3WL9A 4Z7UE 4YFDB 5DRWA 2DQJL 1EUUA 1JWSA 4LBEA 1MCLA 3U7YH 4Y1AB 5FDWA 3BQUB 3CVHL 2APBA 5MEND 1T2QL 1GGIL 2V5MA 3ES6B 1NFKA 3V79C 1R5WB 3EYOA 3L5WA 1XEDA 1MWAA 4LLVA 5LXGH 4OLXL 1Q9WA 3CXDH 3IXTA 5T3XD 3F5WB 5F97E 4WHCA 3NFNB 1CDGA 3AGVA 1S5IL 3SY0B 1NBYB 3OJDB 1NC2A 5F9OH 3BZEA 3WFHB 4QY8B 2E7MA 1UB6B 3QIWB 3G6JA 2E7HA 1NC4D 1TVBA 4HC1H 3EHBC 1CLOH 2VUOA 5CWSA 3KR3H 1Z6JT 3QUXD 1KNOB 2L7JA 4S1DD 1ZVHA 3OXRA 1YJDC 3RZCD 4GMTL 1C5DB 1S7QB 2M8XA 1AP2A 4RAVB 4U1GB 5HY9B 2PCPA 3WNPA 2EEDA 1DEDA 5EIQA 4DOHB 1ZLWK 1T66C 1DBAL 2J7LA 4OLYH 4OUUB 5GRXG 4EN3D 3QUYA 1P6FA 4Y4HD 4NRZA 1YJDH 5JQ6L 5GGRY 1H3PH 4MD4B 2P5WA 1T0MB 5K9OA 3EO9H 2Z91A 1A14H 4PLJC 3B6SB 5BXFA 5KVDL 2ICEA 3FQXB 3ILPA 1NMCB 2PYEB 1ES0A 1NL0H 3GMPA 2X4TB 4N68A 4KZDH 1ZS8B 3DX7A 2F74B 3C08L 4LKXB 3FB5B 3TH4T 1DBKH 3P40A 5IBTH 3QHFL