4N0CC

42f3 tcr pcpe3/h-2ld complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
198
structure length
195
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSSSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANFNNSIIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 195
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cC01
4UNTA 1BZ7B 4KV5E 3R06A 3TO4B 3L3OA 3MODH 4NZTH 5SV4A 3O3BB 3DVGA 3BPNB 1FNLA 4RGNC 3S36H 5ISZD 3STBA 4MCZB 3L5IA 2X1WL 4IIQA 3V4PL 4AH2A 3RZCA 4P2QA 2R1YB 3RA7H 1UB6B 1MIML 3QWQB 1RY7B 4Y19A 2CXKA 2ZUUA 1T1WB 2VNCA 3C6LA 4QGTA 4JN1L 3L9RA 4OJFL 1YEIH 3QG7H 3GIVB 5E08H 4UB0H 2DQDH 5ALCL 1JNHB 5BZWA 3CX2A 1I8LA 1DQJB 4AK1A 1CDJA 1I3RB 2R0KL 1BWWA 1FYTD 3G6DL 3KLSA 3VFPB 4QKXB 4P9ML 4I9WD 3EDKA 3UTSD 1GZQB 4Q6IB 4RFOL 1YNTA 4JEGB 5C0CE 4C58B 1FZOB 1LVEA 3O3EB 2NY3B 1HQRB 2XICA 4LF3B 4NJ9H 1D5XB 3HAEB 4RRPG 4KZEL 4FQJH 3SQBA 3TCLA 4HIXH 5EORL 3F7RA 4X4YA 3QEGH 3HZKA 5KZCD 3PWPE 1NCBH 5HI3D 5F71A 1KJVB 1X5FA 4LP5A 2W9DH 3QXDA 3EYSL 4G9FD 3AS0A 4DZ8A 1W0WB 1FJ1B 3QG6B 3W81A 4JFQB 2IFFH 3OKMA 2KPNA 1OT1A 2MQCA 3K4DA 1B3JA 3WEXB 1YMME 1Z5LB 2GCYA 3HB3D 4BFGA 4R0LB 3I6KB 4HH9B 3WUWA 4E5XA 4Y4KD 1S7QB 3WYRA 4Q0XH 3WJLA 2A0LC 3MV7D 1YMHA 2C1PA 4HLZH 5FM8A 2E7CA 1N0LA 5GGQL 4KI5C 3TVMD 1RIHH 1OQOA 3C60D 4K7PY 4ALAL 4HFWA 5JHDA 4PLJD 4AEIL 2FEEL 2JJTA 1P9MA 4PJEF 2DYPA 4RDQF 1I7TA 1UJ3C 5JW4R 1I3GH 2VQ1B 5TF1L 4RX4A 2BRQA 5F7YC 3VG0L 1BFVH 1A7RL 1NGWA 4OV5B 1MLCA 2F58H 4EN3B 3VFUB 2F74A 2FX8L 1XGYH 35C8L 3MJ7A 4UQ3A 1INEL 3C9NA 1J8HA 3P4NA 1L9MA 3HLAB 4KAQH 1E4XH 3L3JB 3NABL 1DBKL 3EGSA 4PY8I 3TA3C 1U92A 4V2CB 1DVFC 1FZKB 4PG9B 2XG4A 4WGVB 5D7IF 4W70A 2QSVA 3F58H 3QJFB 4LARL 5F1NB 4OZGB 5EA0L 4FXKA 1OAQL 1NGYB 3QAZB 3GJFB 4KY1L 1Y6MR 2NMSA 3HZYB 4WWKB 5B38B 4ZSOA 4JANA 4FQXA 1MWAH 1ZT7A 1GAFL 2CJUH 1LO0L 1MI5A 4G3YL 5T3ZD 3QJHA 3M07A 4GW5B 4PYHA 4D9RE 1YQVL 3T4YB 3MUGB 4U31A 2A9MH 4LLUA 4WENB 4M6AA 1I8IA 1PG7X 1KACB 4AG4H 5ITBL 2B39A 1G7QB 2VLKB 2BSSB 3BSZH 1NCWL 3HC3L 3O2WH 1EJ6A 5I1HH 4OB5L 3X11B 4QRRD 1QFHA 2EDNA 2E7MA 4M43L 3VGAB 4JREB 1XF1A 5FO8B 1LK2A 5I66A 4S1RH 4N0UA 3MBXH 2DQCH 3G5YA 3IDUA 4JDTH 4K71C 4UIMA 1HILB 4ONHA 2OQJA 1Q9WB 5D8JH 5H2BA 4YGVA 1MCFA 4WWID 2XXMB 4R2GC 1DDHA 1HE7A 1CN4A 4L3CB 5IB3B 4DGIL 5IK3B 1EDQA 5B21A 2XPGB 5DYOA 3U4BH 3UTPD 5CKGA 7CGTA 4ELKA 4PGDB 2B7DT 3V7MA 3VXRE 4Z7OF 2PYFA 1PLGL 3LS4H 1QA9B 1WFNA 5H35B 5HYJA 3X13B 3PL6B 5TJWK 4LSPH 3C8HA 4PRBA 4XP1L 4X6BB 3W0WA 3T1WA 4GBXA 1NH6A 2R2HA 1MIEH 5F6HI 5HYIA 1ED3B 1S9VA 5SWSE 4Y4HB 3MREB 5BW7A 2ZWLT 1EEZA 3B3IA 1O7VA 3BIKA 3ARFB 3KJ4B 1L7TL 5E2VL 5CJ5A 4RZCB 1TJIH 3VH8G 1M6OA 1MCPL 4LLWA 1PG7L 4HLZG 3V6FA 2VLMD 2O61B 2DS4A 4H25A 4J3WA 3IDIB 4DTGL 5BCAA 1P69B 3TFKD 1CE1L 5A3ID 1A3RL 3D2UB 4YXLH 1FVCB 4OM1H 1B2WL 2HJLA 2Y1VA 3RIFK 1FGNH 3MRRB 1FIGH 2V2WB 3GSOA 5HHVH 5C07D 5E70A 1FLTX 4MQTB 4Q7DA 3EOYG 1YEDA 1A7PL 3MRJB 1NBVH 3PP4H 3FQRB 1PBYA 1I1YA 2LE9A 5IVXB 4WV1B 3P30L 4PR5A 1TVBB 1HIMH 4QRTA 2Q7NA 5E8DH 1F3JB 4DKDC 5KG9A 4QXWA 5FYLE 1MAML 4OCYH 1E4XI 4JHAH 4KJWD 5T5FL 4EDWL 1MCIA 1QRNB 1OCWH 3GMMB 1IAOB 3KLAB 5EOCH 2C3HA 3HE6D 3KPOB 3FOMB 2WMPA 3DVIA 5A43C 1MRFL 2P24B 4GRLB 3EYUL 4K07A 1YY9C 2HN7A 1BD2A 2XRAH 3RZCD 4P2QD 4NWUH 2GY7B 5JOEA 4ELMB 25C8L 5D1QB 1NC2D 4G7YL 4M5ZL 5JZ7C 4XBEL 1G6VK 4LSUH 1U41A 4OFYD 3GM8A 2P4AB 3PF2A 4CVXB 3ALXA 4F37F 4PJIF 1UYWH 1I75A 3BN9D 5HD8C 5B3NA 4B7LA 2Y36H 1EAJA 4DAGH 4U1SB 1N4XH 2IFGA 1JGEA 5CIPA 4MQ7B 2A6DB 5D7KE 4XRCA 4XCYB 5GHWH 3QUZB 4M62L 2FYYB 3FT2A 1AR2A 5JIIA 4KDTA 5FECB 4NFCA 1QTYT 4FQIL 1YYMH 3VXMA 2DD8L 3B9DA 1AD9B 4YHOL 1AKJA 3WIIL 2UY6A 5C09D 1M7IA 3K4AA 5EPMA 2DIBA 3H3BC 5KOVC 4RAVA 5HGHA 5D9SA 1A5FH 3DIFA 1F2QA 4BZ2H 4YDIH 5TFSH 4FZ8L 4ZO6A 5BXFA 4XP9H 3ZTNH 1RZGB 5DD6B 1ZHKA 1SEQL 2NXYB 4TPRH 3KLDA 1MFEH 5DK3A 3N85L 3ILQD 2WIIA 4Q6YA 4J4PC 3OR7A 2P8PA 1YEGH 1A9EA 4AY0A 5A16A 4CN1A 5E2JA 5DRWB 5EFIB 4ZFFA 2XWBB 3MZTA 4OQTH 2DDQL 4JB9L 5TE6L 1QSFE 4Y16B 4RMQA 2HT3D 3NPZB 3SPVA 3BRFA 1CXEA 3QCUH 2ATPB 3JTTB 3TO4D 3W9DB 3BPOC 5JHDD 3R8QA 1HOCA 2NX5D 2P47B 2DYPD 5IROA 4B7IA 1KTDB 3L5HA 5CGYD 4HD9A 1ZWIB 1IM9B 3WDHA 1ZHBB 2X42A 5FFLA 1RJYA 4Z5RB 5CS7A 1N3NB 2E27L 5KSAA 1NGXB 5D7JC 5EOCJ 2IANB 3IXAA 3MA7B 1W8OA 2NY2C 3RWFA 4QEGA 1PVHA 3V6ZA 3T1FA 9CGTA 4PP1D 4JG1L 1AGEB 1J8HD 4LP4A 5J6GB 3FONA 4GLRH 4HXBH 1DBAL 1U8JB 1RK0A 1NAMA 3FO0H 2OL3L 4GMTH 5F9OH 5DSCB 5D2NE 3QWOA 1RZFL 5DUPH 3AXLB 5F44A 1E6OH 1P7QA 3QNXA 2GITA 1I4FA 2NY3D 5DS8B 2B0SH 4Y5VB 3WN5C 4JRWA 1WZKA 4FXLA 1MI5D 2BVQB 2ZG1A 2F5BH 2Y07L 3S96A 4IRZL 6FABL 5DD3L 2A77L 4QRPB 4OM0L 4EI6A 3DYMA 3SDCC 4G43B 5FHAL 5T5NG 1WBXA 2XZQL 1VKXB 1A02N 1BX2A 2VLRE 4HULB 1R3IH 2IWGA 3LEXA 3QIUA 4J1UB 4JQXA 4MXQD 3EYQD 1ZLVH 1MWAB 1I85A 3BISA 4FQLH 5FUZL 5D7SL 4K9EC 2VKXA 4U6TA 2VH5H 4WNQA 5IQ7L 2JIXB 4MJ4A 2C9AA 4HQQL 4HC1A 5EZIL 2R29L 2W60B 4AIOA 3QQNA 4HK0A 2LFGA 3DSFH 3M8OH 4KKLC 5DI8B 4WFGD 1N5YL 4YHYC 1UJ3B 1IBGH 3FO9A 1U8LA 3QDJA 4PJ5A 3M17A 1RQ5A 2VTFA 4P4KA 4BSVB 1T5XA 2CRIA 4QRUB 3I9GL 3BZ4A 3RKDC 4L29B 1PX3A 2AP2A 3O6LH 1OWRM 5ESQA 1FGVL 5I1LB 1CD1B 4GKZA 3GSQB 4Y89A 2AJXL 4I3SL 1IC5L 4JZJC 2ICCA 3IFLH 1S9KC 4LNRA 3TA3B 5EBMA 3OZ9L 1XF3B 1SM3H 5D5MA 4ODUA 2EE9A 5HYJD 2X7LA 5HHXL 4EEEA 5IMMB 1ADQL 4LSSH 1TETH 3OAZH 3W0WD 2B1HH 4ONOA 4GBXD 1BQUA 4JFEB 4HKZA 1CXKA 4LLMB 2V6HA 4OTXH 1XIWA 2XN9A 4K9EH 4NGHL 1GGIL 1X4YA 3TH3T 3HZMA 1WAAE 3PGDA 2WBKA 2XNAA 1LEGA 2F53D 1A6PA 3ZLQC 4LPXA 2RQ8A 4WW2F 1NANH 1FL5B 4PJDE 3AS2A 1F00I 5I6XC 2Y06L 3NIGE 5DJAA 1RZ7H 1X5XA 5KS9E 4QLRA 3DMMC 3PWVB 4L3EA 1QVOB 4HIIA 2BJMH 4LK4A 5C6WH 2IBZX 1R3JB 1U8NA 5I1IL 5T3ZL 1EMTL 5E7FA 5KSBB 4HCRH 5T1MA 1GPOL 1YDPB 4NOFA 1A1NB 2VQTA 4QXTB 3REWB 5DHYA 4R3SB 1FFOA 5FA4B 4NN5C 2YRLA 3RGHA 1E4KC 3EIFA 4PJCE 2YUWA 5FO9A 4P3CH 5EBWB 4L8CB 1ETZB 1W72A 3TV3H 1QP1A 1OSPH 3VE0B 5CEZE 1SJVA 1YYLL 2CRYA 1OY3B 5DO2D 1J0IA 3MLYH 3GM0A 4MNQE 4GG8A 2AK4B 5GSRB 2VAAA 3OR6A 1IGJB 3PHQA 1VHPA 1BD2D 3B5GA 2YR3A 5F9DC 4PJFA 1MCWM 3LN5A 4YLQT 4JGMA 1AFVL 3RI5K 4GW1A 4HS3A 2R2BB 3K2UH 4OCLC 2FH6A 5TDOB 5LQBH 1RFDH 3FKUS 2OJEB 4LSTH 1KV3A 3DROA 5T1DL 4KQ3H 5I16B 2QTEA 1N6QH 3AS1A 1HCVA 1O5DT 4QCIA 4RMTA 4R7DA 1BJ1H 1KB9J 1ZE3C 2ZZUT 3QEHA 4BQBA 4LSQH 4Z95L 1CDHA 5I2IB 2EH7L 3GRWL 2OR7A 2WUBH 4IOFD 3E8UL 1IE5A 4XHJD 4Y4HD 1ZT4B 2NY4C 3QPQD 2X1QA 1KTLB 1PQZB 3LIZH 1K8IA 3VXMD 1HH9A 5FDYA 1U58A 4X6DA 2BP3A 2HT4D 5E00B 3QUKB 3THML 1RIUL 1AKJD 4EOWH 5DRNB 5KANI 2OJZH 4L9LB 4O2CA 1LDPL 3TWCL 4XI5D 4ZNCD 1RUAH 4QOKB 4X4XA 1ZA3A 2VZSA 1K8DB 4NCC2 4NRZA 4Z7VE 3JXAA 5CP7B 1KIQB 3KGRA 5DEFA 2F5AH 1FFNB 3BH8B 4CL7A 4YX2H 1PW3A 4RBPK 5IB4B 3SY0A 1BBDH 3BP4A 3IU4H 4P5TD 1ZHLB 3VFWA 2EDWA 5SWQB 3OKEB 1HI6B 2EECA 5ESAB 4PGZA 4U0RB 1U8HB 2EDJA 4Z6AT 4NSKB 2DQTL 4R97C 4O02L 1MEXL 3E6FA 1VACB 3RNKA 2CRMA 1LO3H 4RFEA 2P49B 2V2XA 2X4UB 3QEQB 2QSCL 1MPAH 3JVGC 3K80A 4NO5B 2PTTA 1GIGL 1JGLH 3CIQA 5D1QD 5GRYA 4WUUB 3U4EB 1VDGA 4G6FD 5IQ9A 2EH8H 2AJUH 1W0YT 3CFIC 5E94B 1P7KA 3UEZA 2VABA 1BLNA 1PZ5A 2HRPH 2ADFL 2AI0H 3DLQR 4HGMA 3GHEL 2D7MA 4HUVA 2EYTB 4Y2DB 1UEYA 4X6EA 1A2YB 2UV3A 3OGCB 3SDDB 1UWGH 1MFBL 3H3KA 4NQEE 2AS5M 1J1XH 1L9NA 5D2LA 1G7LB 1KT2B 3DSNA 1QFUH 3CFCL 3DXAA 1RULL 1A6ZA 1URLA 2Y23A 1P7QD 2HLAB 3KPNA 4K7FB 4NJAL 4X7CC 5HDLA 4PJ8A 3GMPA 4KPHL 2NLJB 1BM3H 3F6IA 1IQWH 2GJ6E 2X4OA 3PGFH 3DGCR 1RHHA 5LGHH 2HFEB 1FNHA 4NN7C 4U6XA 4MA8H 2EKJA 2X4NB 2AEQH 1EHXA 3MCG1 5J12B 4R96B 4JN2A 4RGOH 5DJXB 4JZOA 2HG5B 2O5ZL 1QBAA 4DVBB 1A7NH 5C0CB 3K1KC 4YHMH 3UROR 1T4KA 1NFDA 1X5LA 3F7QA 3HI5H 4JQVA 5GGVY 2PO6A 4D9QE 4J2XA 1WWCA 1GYAA 5M94B 4OUUA 4N8VG 4RGND 3PWPB 1F45A 2VDNH 2ZNWA 4W6XB 1QPXA 3UJJH 3MGOB 5D7JB 3VD7A 5DHVB 1CF8L 5MEOA 4M4PA 4P4KD 2NY2B 2PXYB 2IAMC 3GIZH 3O11B 1UGNA 2NY5C 2GJJA 5EO9A 3AU1A 1SBSL 3SDAA 4MB5A 1T20B 3ARQA 3DWTA 5C6PB 1KB5A 2YD7A 3Q6FB 3BDBA 2JE8A 3GGWA 3GHBH 1YMMB 2EDFA 3RWEA 2YPVH 4I0KA 1I9IH 4D0BA 4NKQB 4OF0A 5DA4A 1G6RH 2IQAA 4R9HA 2V9TA 1DANT 1QLRB 4QF1A 3TCXA 5C08E 4JO1H 4POZC 4X99A 4L8SB 4OFDA 4POUB 3EYOB 1CGTA 2H6PB 1NBQA 2EE6A 1XIWD 2XN9D 1AGCA 1HINL 1OSZA 1VPOH 2XACC 4LSVL 4ZYKB 1TENA 2Q7YA 4I4WA 3P2TA 1YEKH 5FCSH 5J3HC 2ZCKH 4CRPA 1P4LA 1NCCL 4ZNEE 1E6JL 2VIRA 4JPIA 3UAJD 1D5BB 3EYVA 5FAAA 4JFHD 4L3ED 1NCAL 3EYFB 5FYJE 1QR4A 1PX4A 1C5CH 5JDSB 1QUNA 4H8WC 2NY5H 4NKDA 2LU7A 2ZCHL 4N8CH 4WI9A 4YDVB 1K5NA 1OGTA 4M4RA 4HJGB 4J4PA 4MNHB 3SHSA 4Z7NE 4HMDA 1BVKB 4NZRH 4X5XA 2CDGB 2GAZB 3VFGL 3JUZA 1B4JH 1CXFA 4LIQE 2VMFA 2A0LD 1JPSL 2YKLH 2X4SA 4DCQB 3BN3B 1G7JB 4JY4A 4JGJA 3KYOB 4KI5D 4AT6A 2ZCLH 1WIPA 4JGUA 1LMKA 3QZWG 4JFZL 3WLWD 3AB0C 3V5HB 1U8KA 3HE7C 4NKOB 1S7XB 2D31B 5I76B 1UJTA 3CXHJ 3H7LA 5CD3A 3QHTC 1P7HL 2XT1B 3OJMB 4LCWA 1MRCL 5D5MF 1HDMA 2APVA 1C1EH 5DR5L 1LEKB 5IUSA 4LVNC 1ACYL 4RA0C 2DMBA 4O00A 1JGVL 2OR9H 4HHAA 3TA3D 4KJYA 5HXMA 3GUTA 3MRMB 1DVFD 4H8WH 5FHBL 1YUHA 2VE6B 4YUEL 5EU3A 3LQZB 2CIIA 4G8IA 1K3ZA 2NY0C 2HWZH 1Q38A 3RX7A 1CFQB 4Q9RH 4YXKH 3O6FC 4YHPB 1C12B 3OPZL 3WN5A 5I6XB 4Y88A 1LD9B 2ADJB 4P3DA 4U1MA 5FA3B 3MJ6A 2IBBA 1TQBB 3CVHB 3PUCA 5L2KA 3ZTJG 3SGJC 1T5WA 3SDCA 1KCUL 3VXRB 2HVJB 1H0DA 2YXFA 4N8VB 3QWRD 5A2LH 1K6QL 5IOPB 1UCBL 4UIKH 5DFTA 1KTRL 3GI8L 2J7LA 2R0ZL 5IM7A 4JPKL 1WITA 1U8IB 4ZOEA 4L4VA 3BO8A 5MERB 4M03A 5HYSG 3KHQA 4HUNB 3IS0X 4PUBH 5GGRY 5SWSB 5CBEA 2BVOA 4TUOA 3VW3H 3T2PA 2FJFA 1I7UB 4LKXB 4FFZH 1DN2A 1UQSA 3VXSE 4UMGA 3U0PB 2PW2B 1XZ0A 1IC4L 1RVFL 5HHOA 3UPCA 1ZA6B 4R2GD 1ONQB 1SJEA 5ECJE 3O8XC 3RVWD 4E41E 4R8WH 5J9PB 4KK9C 4W6WB 4DOHE 1B88A 5CEZH 5FYKE 5I71C 4JJ5B 2ZUWA 3V6OE 2OMNA 5E56A 3BPCB 3RVXC 3S4SB 3NIDE 4Z77B 4QHNA 1JNJA 3FQXB 1NCUA 4RWHA 5BJTB 1U3JA 3LEVL 3D85A 3WFDL 5KVEH 3IDNA 1T0MB 5SV3A 1NSNH 5JQ6H 3U30C 3GSVA 3L3GB 1OQXA 5HGAA 3DOSA 5IVZA 3RUGA 1LP9E 4FP8L 4HPOL 4JG0H 3U9PL 4YDLB 3RWGA 1I7RA 5DEGB 4O58H 1T1ZB 4WFFD 4XVTH 1YPZE 5CLTA 4LVHB 1G84A 4C56E 4DEPB 4X6DF 3RVVC 1N8ZB 2UYLA 4QYOB 5GZOC 1YQ2A 3D0LB 1KCRL 1Q0YL 4OD3H 5D1XC 2OSLB 1Q0XH 4OZFH 5FO7B 4J23A 3HNTH 4JFPB 1ERNA 1FZMA 3P4MA 1T7VA 4JRXA 3DMMA 4Z7UE 2BERA 1GGCL 4Z18A 1KENL 4JFYB 5K9JH 1FO0B 2OP4H 3L3IB 2HTKC 3NN8A 4R7NB 4NCDA 4V1DE 4HPYH 1ZOXA 1FIEA 2CDFA 3HG1A 5IMLB 1T03H 5IHZB 3EZJB 1MCHA 5E2WH 1OM3H 4MNGE 3QZWB 4U1JA 4C59B 3BZEA 1KLFA 5JOFB 4KJQC 4ZUVB 1J5OL 3VFSB 3QUYA 1ZGLP 1E4KA 3ARBB 3LMJH 4YFEA 4OLZL 3FB8A 4JKMA 4U1KB 1JHTB 4YO0A 4PIRF 3U0TB 4FNLL 1EA9C 3G5VA 4R97B 2PO6D 3OBAA 2DLFH 3L3KA 3STZA 4BQCA 2HYMA 4M7KL 3MMEB 2VC2L 3E2HB 3P9LB 4RQQA 2YHGA 3L6FA 2ITCA 3KHOA 1YY9D 2A1WL 4JCMA 4UDTB 1ZGLA 2AKRA 3L5XL 2OK0H 1OHQA 3B9KC 5JZ7D 4OLYL 5CHNA 2FX9H 4P99A 5F88A 5IJKC 3BDYL 1PG7W 1IEAA 3KYMB 1FRGL 4PJAF 3I6LD 4K3JH 4Q9BA 4K8RC 4Y5YC 3ZT7A 1HHIA 4XPBH 1CFVL 2XKUA 4MA1C 1F3DJ 3LKRB 3DRQA 4HJJH 2A74B 2EYRB 2AJYL 1PEWA 4W4NA 1MQKH 4N0CD 4G42A 2X9WA 5D2LF 4BKLA 1E4JA 1G0YR 1MFAL 4NRXA 4NDMB 4MVBC 4I2XA 3ILPB 1FORH 1QSFB 1FDLH 2P8LA 4TVPH 1UXWB 3CFEA 3I6GA 1NC4A 5I8KL 3WIFA 2B5IB 1DUZB 4UUJA 1K4DA 3MRCB 1RZ8A 5HYSB 4WEUD 5E4EC 2A6KA 3B8SA 3MODL 4NZTL 3GKZA 3N1MC 1AH1A 3S36L 32C2A 2XKNA 1U8PB 5EZJA 3RA7L 3V5KB 3KPTA 3QDGA 5LKNA 3C87A 2QQKH 4TTDC 4IRJC 5FB8B 4PRIE 1YEIL 3QG7L 4KVNH 5E08L 3EO1A 2DQDL 4K8RH 43CAA 1FC1A 1DQLH 1ZHNA 4J4PD 1KNOB 4KI1A 4LLVB 4NYLB 5D2NB 1LO4H 1XAUA 3BGFC 2RFXB 1IGTB 3BVNA 1BZ7A 3E3QC 3NCBB 4NQXB 4NJ9L 4RGMB 2WLZA 2AJVH 4P49A 4FQJL 1NEZG 3CFJB 1JMZA 1GXEA 1JTTA 4HIXL 2F19H 5DURB 3WFHA 2X4RA 3PWPD 2P48B 1K2DB 1YN7B 3QEGL 4MWFB 5JXEA 1F58H 1NCBL 4OZFG 1UB6A 4LCWD 2C26A 2W9DL 3EO0A 3L5JA 4U49A 2UZIH 2VLRB 5DJ2B 4HWEH 3SE9H 4NP4L 4S0SD 2ZOLA 2P43B 3L3DB 4ZQKB 2WBJC 1FFPA 3GIVA 3AAZB 2IFFL 5JLZA 2CIKB 3WLBB 2C3VA 1YMMD 1AIFB 1ZV5A 5DMIH 2FJGB 5AZEH 2PW1A 3RL2B 5CJXC 2MHAB 4NRYA 1DEDA 4FS0A 2WWMC 4Q6IA 3RBGA 4Q0XL 1AHWB 5ICZA 2EO9A 3O3EA 1HQRA 5DJYA 1D5XA 1RIHL 3IGAA 1CLZH 2EKSB 3VFRA 1CL7H 1AD0B 1MVUB 4HV8B 2J5LB 4FQQB 3ZL4H 5L2KD 3B83A 3MV9A 3QUXC 2R56H 2EXWC 1EO5A 1KJVA 1G6RA 4ODXB 4YAQB 3SDCD 5IEHA 2CKBH 1EPFA 2NTSP 4GXUN 1I3GL 1T1XA 2YK1H 1FJ1A 1KJ2B 2V7NB 1BFVL 1OL0A 3SCMC 3BFOA 2ICEA 5JMOC 4L3AA 2F58L 3QXWA 1XGYL 1DBBH 2RCSH 1E4XL 4KRNA 3WL9B 1FL6B 5CMAB 5TH2B 4KKLD 3F58L 1WK0A 4ZMAT 1KLGB 1S7WB 4LIQH 5JW3H 2BMKB 3KPMB 4PJDB 1MCLA 4TSCH 4YDJB 5KOMC 4BQ8A 3U1SH 1MWAL 2APXA 2IAMA 3RPIB 4HMCA 3RKDD 2VLLA 2UWEA 2A9ML 1T1YB 4EXPX 2J88H 3C5JB 1YEFH 5GIRB 4AG4L 1LE9B 3G08A 1M71A 3D85D 5BS0A 3FB5B 4MJ6A 3HMXA 4OV5A 4F15C 4DUWA 3BSZL 3S3PA 5GGTA 3O2WL 4EN3A 4GW4B 3DGGB 3R4DA 1AGBB 5I1HL 2NY0B 4MDJB 2P8MA 4PJCB 4ZXBC 3KWWA 3L3JA 4X6FB 3QISA 4FQ1H 2IH1B 4I0PB 4NO0D 5IWLA 2X4QB 1T2QH 4S1RL 3ISWA 3MBXL 2DQCL 4CW1B 3QJFA 1JV5A 5GGUB 5D8JL 3NBNA 1ZLVK 4MNQB 3MROA 3N06B 4HKJA 3ARGC 3CJJA 3HZYA 3SKMB 2FZ3A 1MREH 3HRZA 4YJZL 4MGXA 4N9OB 5DUBB 5DVNA 1ULVA 4JRXD 1SYVB 3VFTB 4M5YH 3DMMD 2D9CA 3EDDA 2B1AH 1V7NH 4P23C 5C1MB 5KN5B 4BSJA 1DUYB 3U4BL 1ZT1A 4AENA 1OD7A 3HG1D 4YK4B 3WE6B 1L4IA 1G7QA 3CLEH 2GJZA 1ZKAA 5I30H 3MOBH 3B5HA 5DK0B 5F7WC 4DJMA 4HLJA 2NZIA 2JJUA 1KB9K 1NGPH 3LS4L 1J1PH 4NC2B 3PJSB 4Z7WE 1XGPB 5FKAA 3CSYB 3D3VE 3VXQB 3BDXA 5FGBC 4LSPL 4WFHE 2R4RH 2A6JA 5TE4H 5E6IC 2ILLA 1QR1A 1VA9A 1BZQK 1MIEL 2O93L 5JW4M 5FUCE 5F7HA 4KK5C 4OLUH 1BP3B 2A9NH 5DT1H 5HGBB 3OAZK 1CLYH 4HMEA 5I71B 1AQDB 1TJIL 5J11B 3NIFF 3IS1X 1EEYB 3ARTA 4RAUB 5FXCH 5IK3A 5L9DH 3HI1B 3I75B 5B22A 5TE7H 2Y5EA 2XPGA 4CU8A 4YXLL 4OM1L 1Z9MA 1FGNL 4PGEB 4Z7VB 3WFEH 1QEWA 4PGDA 1FIGL 1XF4A 5HHVL 2HVKB 1NBZB 2GEEA 5FYKH 1OP5H 5GS2H 3T04D 5GS0C 4NT6B 1NBVL 3PP4L 4JFDE 1CICC 3X13A 2QR0A 3PL6A 1F6LL 2MFNA 4X6BA 1HIML 3H3PH 5E8DL 5I73C 3CZFB 2C1OA 1H3GA 4OCYL 5K9QI 5K9QG 4D94A 3UO1L 1RUQH 3MREA 4JHAL 3VXNB 4AEFA 2NY4D 5B8CC 4L8DB 1NC4D 1OCWL 4MZ3A 1Y6NR 3ULUF 4OT1H 5EOCL 2Q87A 3X17A 4RZCA 3OAUH 5HGDB 1RZJC 1T7ZA 1ND0A 2NNAA 4ZUUB 3DX7B 2XRAL 4NO2B 2AJZB 1IM3B 1TVHB 3C5ZC 4NWUL 3QXTA 2PN5A 4L4JA 1U3HB 3TGXA 1QACA 2YRZA 3A6CH 4P57A 2BNRE 3I84A 1TITA 2X9XA 3O45B 1QBLH 1UYWL 3FQRA 3LN4B 5IVXA 2YEZA 3SN6N 3TNNB 1X5AA 4DAGL 2Y36L 3MRDA 5FGCE 4NQEB 1N4XL 4U2YA 1F3JA 4OGAC 5GS0H 2XQYG 3L7FB 1KCSL 4KGLA 2OS7A 1VGKB 3BUYA 5GHWL 3GMMA 3KLAA 5FUOH 5BZDB 2GJ6B 5J06A 4BELD 5DMKB 5GRUH 5D6CA 1EXUA 1YYML 4GRLA 1KIRB 1FV1B 3OX8A 4K55A 2WSKA 4MA1B 2D2OA 3TYFA 5HHME 3EFFA 5JXED 2PTVA 1RZJH 4ZPVA 4D0DB 4PGBA 1A5FL 4M1DH 4HGKC 1EAPA 3BD5A 4BZ2L 4YDIL 4BYHA 5F97E 4Z78A 5TFSL 4CVXA 5ACZB 1FSKC 4XP9L 3ZTNL 2P5WE 3DX9A 4ZAKC 2YS4A 1A8JH 4U1SA 2AGJH 4TPRL 1OP3H 2SEBA 1MFEL 5EU4B 1YEGL 1QYGH 5E4EB 4K94C 3UZVB 2HJKB 4PRAB 4XCYA 2DBJA 4UAOC 4D8PB 5EUKB 1BVLB 2GQHA 3PWUA 4IBLT 4OQTL 4QT5B 4X5LA 5FECA 3QCUL 4LDLB 3T65B 4OF7A 3FT4B 3V9FA 2CUHA 3T0EE 1T89A 3MV9D 4UBDC 4EI5A 3G04A 2QLVB 1QFOA 2CUIA 1FG9C 4YHLH 4PTTA 4UILH 3HUJF 3GMLB 1BQSA 2GFBB 5GRJH 1MHPL 1J0ZA 4HZLB 3UXFA 3GMNA 3GSNB 4RFNB 1HH6A 3KPPB 3S3JA 1R5WA 1U95B 5C08B 2VKWA 4PV8A 2H45A 4LLDA 1U8QB 5F7KC 4HWBA 1OGAE 3UTZB 2EC9U 2J8UB 2XIDA 1D5ZB 2VDML 1FZJA 2Y7QB 5DD5H 4HXBL 3TESA 4NQDA 2N7BA 4OFPA 1ZVSB 3QO0B 1OWWA 1UB5B 4XPTH 3TBSA 2CKBB 2HFGH 3FO0L 3RWDB 4GMTL 5F9OL 5E2TH 1MH5B 5EFIA 5ESVA 5JNYB 3CDGA 5L2JB 2F8VA 4P48A 3H9HB 5DUPL 3ESVF 1CCZA 4K94H 3B9KA 1E6OL 4Z0XB 2EIZA 4WU7A 2XKSA 3JTTA 3TBYA 2B0SL 4W81A 2IAMD 3V0AC 1OTSD 2F5BL 1OF2B 5DURD 2ZJSH 5J13C 1TLKA 1Y6KR 1NGXA 1ZS8A 4EKXA 4OZ4B 3D39A 5J6HB 5E9DA 1I1AC 1U91B 5BS0D 3ZZ1A 2BNUB 2N56A 3FTGB 4WUKH 4CMHB 1BAFH 4APQC 1I9JH 1S3KH 4DN3H 1R3IL 1V8HA 4P46B 3VGBA 1K4CA 1IKNC 1LK3H 3BWAA 1AGEA 3TIDB 3WO4C 4FQLL 4F2MA 4WO4A 2YZ1A 1JGUL 5ISZE 4LVOC 1ZTXH 3ECBA 5EULV 2VH5L 1U8JA 2XZZA 5LJYH 5CEYA 1VGEH 4IOIA 1F6AB 4CVWA 1D6VH 5JORA 4M1GH 2WK2A 4F7EA 5CSGA 5J3HD 4HGWB 2XG5A 3DSFL 1N5AA 3M8OL 3CXHK 2OI9C 2UUDH 3O4OB 3U36B 3GDBA 1IBGL 5EC1B 3V4UH 2BVQA 1ZVHA 3TN0B 2D03H 2HFTA 1IFHH 1FYTE 3HR5A 1IT9H 4I9WE 3QFJA 4NHCH 3O6LL 4OZHA 2IPKB 3STLB 5I1DA 3IFLL 3ZDXE 4YC2C 1SM3L 4S2SA 2NW3B 1X5GA 2YC1A 4LSSL 1WFOA 1TETL 1RU9L 4QTHA 5IBLC 2B1HL 3LY6A 5E5MB 5I19H 3DV4B 1WF5A 1HHJA 2APWA 1S8DB 1L6XA 2FIKB 2CLZA 4NM4H 2BHZA 2P5EA 1NCNA 4OTXL 4K9EL 4YHIB 5FV1L 1JP5A 1S7UB 5DI8A 3HE7D 4GKOA 3QUMH 3DX8B 1QD0A 3ULVF 2JB5H 1EUTA 4BSVA 2EIEA 2Z93B 1CK0H 4F15B 4X5WB 1XF5A 3AREB 1RZ7L 2WBJA 5C0AA 5CJQH 5F7FA 4OLVH 1YZZA 5I1LA 3WFBH 5D6DA 4PYGA 4N90D 1P6AB 3MV7E 3BIBX 3MFFA 3B9AA 4HCRL 2OTWA 3ARRA 4PRNB 5FM5M 5CJXA 3QA3B 3MX0A 4NM8H 4ODSH 1UENA 3TIEA 3DO3A 4OZGF 2NY0D 3H7BB 3ARGB 4M7JH 5EUOE 1JBJA 4OI7A 4JFEA 3O6FD 4KTYA 1IAII 3QFDB 2IGFH 4GXVH 4XNZB 4P3CL 2FIRT 1F4XH 4E41B 4NNYB 2YD1A 3TV3L 4DOHB 1OSPL 3BXNA 1DQQB 2J6EH 3A6BH 4CADA 4EVNA 5KVDH 3MLYL 1O0VA 4MS8D 4XC3H 3MLPA 3SKUD 2OZ4H 4P9HC 3RTQA 3I3EA 5KSVB 4OF8A 4Q97A 4PY7B 3K2UL 4AIZB 3RWCB 3AM8A 4G8FA 5LQBL 3SCMA 3MV8D 5ID0A 1HXYA 1RFDL 1FNSH 1R3JA 4LSTL 4KQ3L 4I18C 5KSBA 1LP9B 1EFXA 1N6QL 3VXPA 3F7YB 4AQOA 2Q86B 2DWEB 4LPTA 3LKOB 1YPZB 4C56B 2FGWH 4LSQL 5T3ZE 4JFFA 2WUBL 2IJ0C 4JAMB 4L8CA 5FYKU 2EDHA 1NCDH 1MUJB 3O8XD 5DGRA 3VE0A 5LXGL 3IU3B 2VQUA 3EAKA 3RGVB 1J0YA 4Z7UB 3LIZL 3BMWA 2G9HB 4V1DB 5A2FA 3QXAA 4HXAH 1U93A 4P5MA 2VXQH 4XGZB 3RVXD 1CI5A 1N59A 4QRRE 4D0CB 2WV3A 4EOWL 3VRIA 5DDHA 1G0XA 2OJZL 3T4AA 1P1ZA 5D70H 4TVSa 4B50A 3CH1A 1Q9KA 2OJEA 5MI0C 1RUAL 4P9HH 1FVEB 1P2CB 3WBDA 4PG2C 2EDQA 5DK2B 4HIEB 5I73B 3KLHC 1OAKH 2O5XH 3GSUA 3OXSB 4ZXBA 3QB7C 2F5AL 4OFKA 3ABZA 1G1YA 2XI9A 1H3WM 1H15A 2J8HA 3O2DH 4O9HH 4YX2L 3F12B 1LO5B 1IMHC 1JRHH 3KNBB 4KWUA 4RNRB 4FFYH 4NKMB 3IU4L 4MD4B 3QI9A 3RVVD 2MJWA 4LLQB 5K9KB 2WINA 1FNEB 1MSPA 3DVFA 3IJSA 3CNKA 4DFIA 5KVMC 4GAJH 5D1XD 2QADB 2YWYA 3UTPE 5J1AA 4ENEC 2OXHA 3C5ZB 2NR6C 5I8OH 4O2EB 2OBGA 3BD4A 1KTLA 4JFOB 4GRWH 2R23B 1RJZB 2BOBB 4P23A 5GGSY 2HTKD 1CWVA 1LO3L 1K9TA 5HHNA 5DRNA 3CFKB 5LCVH 3QDAA 1S9XA 1MPAL 5IVXF 1KXQE 5HVHC 3U46A 3LS5L 1JGLL 2DQHL 2E9JA 4MHHI 2QSTA 4QOKA 4MHHG 1K8DA 2EH8L 1HXMB 2AJUL 2VXUH 1K85A 4TVPD 5C2BH 1KIQA 1D9KA 1ZK9A 2HRPL 2AI0L 1TFHA 4NNPH 4XP4H 3TJHD 2VLME 3CMOH 2Y25A 4ONGL 5IB4A 4NQDD 3NCFB 1ZHLA 3SDYH 1UWGL 2FEEI 1J1XL 4NSKA 2CMRH 4N5EC 1CTOA 3N1QC 4ELMF 1QFUL 5C07E 3B9KD 4OKDA 5EZOH 5B4MC 1PD6A 1BM3L 2BDNH 5DQJA 2MTPA 1IQWL 3ARPA 3PGFL 3TF7C 4PRIB 3EBAA 5LGHL 2IQ9H 2DI9A 2M1KA 4NO5A 4MA8L 4GO6B 2VN7A 4MXVF 2AEQL 4NHUB 5DJ0B 4JFXA 5H37G 1CICA 3WFCL 4M1CC 5E9DD 4Q2ZB 3BAEL 3DVNA 4RGOL 5HHQB 3DUSB 1UZ6E 5E94A 3X3FH 4ZG1A 4MVBD 5CGTA 1I8MA 4KK6C 1A7NL 4YHML 3K8LA 1C5BH 4MLSA 4WO4D 4YNYA 5D93C 3BEWB 2H3NA 3CMGA 1A2YA 1NL0H 3SDDA 4DGYH 1JMXA 3HI5L 5FGRA 1JZ6A 4P2QE 3B2UC 4GKSB 4U6YB 1OLZA 3MUHL 4ZPTA 1JN6B 3BYYA 4H1LA 1IZKA 3GNMH 2C7UB 5M7QA 2VDNL 1UKSA 2HLAA 4K7FA 3HFMH 3UJJL 2NLJA 3FQNA 4P4RB 4J12A 5F3HA 1H8SA 4ZOBA 4PJ9A 1XMWA 2HFEA 3GIZL 3QFJD 4TTDD 4IRJD 3K2MC 1A3QA 1P6FA 1JUFA 2MCG1 1HN1A 5KSUB 3NZ8B 3GHBL 1FL3A 5FEBA 2W0FA 2YPVL 2D9QB 1I9IL 3WNNA 3OWEA 1G6RL 1Q9OB 5DD0H 1CTNA 4IS6A 1BOGB 4JO1L 4BH8A 5F6IB 4FABH 4C4KO 3UJTH 1MHEB 4RISH 2YSSA 2HLFC 4NNXA 2X1OA 5C09E 1XGUA 2FO4B 2P5ED 4DWHA 1JZ5A 3V8CA 3KXFA 2R1WA 1BVZA 1YEKL 1CQYA 5J13B 2ZCKL 1BOYA 3ULSB 5DHVA 1LNUB 3BGMA 2FBJH 4JVUA 1G7PA 2WBJD 5C0AD 1G0DA 1TNNA 1T20A 1MCSA 3Q6FA 2KH2B 3WO4B 2AW2A 1FH5H 1C5CL 4QO1A 2NZ9C 2NY5L 4N8CL 2VITA 1JHKL 5L8JB 1JF5A 4MAYB 2I9TB 3QUMB 3WIHA 3LKQA 4XP5H 3MJ8B 2I60H 4NZRL 1B4JL 4L8SA 5JHDE 3SGKA 2YPKB 1ITCA 2NX5E 3EYOA 3QIBB 3FOLB 2X1PA 2ZCLL 5JPNB 1U8MA 4S0TD 3DTXB 1JPFA 2VL5B 3ZYOA 3QUXD 2EXWD 5GGVH 4IMKC 4OCRH 2CKNA 3RTQD 2R4SH 3IVKA 1J8HE 2V2TB 1BFSA 1EH9A 3B43A 4BFEA 3SCMD 3SKNA 2NXZC 1S9WB 2DWDA 3ES6A 3GMRB 4Q74A 4XZUA 4MSWA 4JLRA 1W8NA 1G7IA 4ZFOA 3LKNA 3D18A 4MNHA 1CVSC 4LLYB 1XCTA 1BBJB 4ZSOE 4H8WL 3QNZA 4WJ5A 4A6YA 2W91A 3ARDB 1MI5E 1YY8B 1N2RA 3O2VL 4OFIA 2HWZL 3RRQA 1XEDA 3MRQA 4JKPH 3MA9H 4Q9RL 4YXKL 1TTUA 5LGKA 1IGMH 5EBLA 4JZNA 3J7HA 1XCQB 1S7VA 2D31A 5I76A 1NUFA 3CFDB 4X7SH 3U7AA 1JPST 2NY7H 5E8PB 5IB5B 2MKLC 3QSKB 1MLBB 2Z35A 4YHNB 1I1AA 1B0GA 4Z7WB 3D3VB 4LU5H 2BSRB 4OAWB 5FM4A 1FNFA 3MRHB 4PJHA 5J1TC 3O9WC 4UIKL 4ZXBD 2JJSC 5IW6A 4NC1E 3V52H 5BOPA 4WFGE 3HPLB 4IMLA 3UZEA 3C2SA 4PUBL 5IIEB 3VW3L 4O2FB 3FB6A 1UEMA 1S5IH 3QI9D 4FFZL 3LQMA 3TBWB 1AO7A 3ARGD 3OAYH 3ZHLA 3IRZA 1UC6A 4YHPA 1Z9LA 3MNWA 1B0RB 1CFSB 3TT3H 3MZGB 1TMCB 2ADJA 4IRSB 2ENYA 2MKWA 4R8WL 3MRLA 3RIAF 2FSEA 3FQWA 3CVHA 4AZ8A 4P23D 2E9IA 1YEHH 4YBHA 5CEZL 5HYJE 3VRLE 1NDGB 5CFHA 5KSBF 2DL2A 4P2YA 2YD2A 4JFDB 5DJZB 1WBZB 3CC5B 3W0WE 4FFVC 3VDBA 3QULA 3H9ZA 5KVEL 3QHZH 2DI7A 2HMIC 3ETBF 2BC4A 1NSNL 3KYKH 1T7XA 1MCDA 5JQ6L 4GAGH 1DZBA 3IDJA 5E6ID 3LB6C 3WS3A 2F53E 5IJVB 5AYQA 1HKFA 4KK5D 4JG0L 1UWXK 3SO5A 1T66C 2XQYK 4LRIC 4KQ4H 4O58L 4XVTL 1G7HA 3RIAK 4C4KT 1UM6H 1AGFA 5TDNB 1EZVX 1CU4H 2ADGA 1XGRB 3D5OF 4PRHA 3UPRB 4OD3L 3SGDI 2VZ3A 1OD9A 1Q0XL 3SDXB 2CLVA 3HNTL 1CE6B 1QSVA 4JDZA 3GZKA 4DUXA 4GG6A 2HT2C 3TT1H 5C8JA 5I15H 2BNRB 5K9JL 3FQUA 2OP4L 1OOAA 4HPYL 3FCTA 1T03L 4J3TA 4B41A 3FQXA 5BJTA 2LV4A 2NW2B 4K3HA 5E2WL 4KZDH 1OM3L 1A4JB 1CICD 2YWZA 4GS7C 1T0MA 3DYOA 4ODHH 2H32H 5FGCB 2CDEB 1UG9A 1JK8A 3MRFB 3T3ME 3L3GA 5F1OB 5ITFA 3LMJL 5F7MC 1QNZH 3V5DB 4MAUH 1H5BB 2JELH 3MRKA 3H9YA 5DEGA 4YBLB 1BD2E 3LD8C 3KDMA 2AJ3B 1WJ3A 2VXVH 3TPUB 5HHMB 5DWUH 4FQHA 1SVZA 2OSLA 5HVHB 4MB4A 4JFPA 3D69A 1WZMA 2OK0L 3C5ZD 4LHUB 1UCTA 3BD3A 2FX9L 3T77B 5C71A 3ZDYF 1EGJH 1FO0A 2YD5A 4OLEA 2AV1B 4R7NA 4R4ND 2RR3A 4W4OA 2DOCA 1IGYA 2P5WB 4K3JL 3G6JB 3S5LG 4XPBL 2W38A 1HHKA 4PRDB 4ZTPH 2H26B 3CLFH 4BA8A 3H9SD 5AG9A 1DQMH 1DLHA 4M8VA 1GGBH 4KJWC 4HJJL 8CGTA 3ARBA 2XTJC 3W9EA 1MQKL 1JHTA 1OP5K 1NPUA 3VXME 4XBPA 1JF1B 2PTUA 3JBG7 1FORL 1CR9H 1FDLL 4TVPL 3VI3F 4IIQC 5J89A 3RZCC 3PHOA 5I8EA 4G8GA 3HS0A 4CU7A 3T0EB 4HFUH 3KXFD 2BVEA 3C6LC 1IARB 1BIIB 3ZO0A 4R6UA 2FEDC 2VDRH 4FMKA 5IHLB 3QHFH 1I8LC 3KYMA 1L0QA 5KJRH 2W59A 4G8EB 3MGAA 5JW4Q 3LKRA 4ZAKD 1OGAB 1GZPB 4KVNL 5D93B 2W65B 3G5XB 4KV5F 3IDYC 4K8RL 1FVDB 1DQLL 3ARVA 1DJSA 1F42A 4WW1A 3FJTA 1Z2KA 4OIAA 1KJMA 1LO4L 4L8BB 5CUSH 2VWEE 1F4WH 1FN4B 1IC7H 4I0CC 4HKXB 4MDIA 3GJEB 2ZG3A 3C8KB 43C9A 3ZKMC 1S7TA 1MHHB 2AJVL 2EE3A 3L7EA 2VZVA 4UBDD 2F19L 1EHAA 3VWKB 4MJIA 1F58L 2ZUQB 4XNQA 3V5KA 3NMEA 3BPLC 2UZIL 1CYGA 4HWEL 3FRUB 3G9AB 3SE9L 3L3HB 3ILQC 1YA5A 4GRMA 3MFGB 5E03A 3HZVA 5DJCB 3DJ9A 3WJLC 1WBYA 5ISZB 3NFNB 5DZLA 1Z3GH 1KG0B 2IPTH 4JM4H 5DMIL 5AZEL 5HJ3A 5JOPD 2HT3C 4G5ZH 4LBEB 5F70A 1INDH 2Q76B 4BK5A 4NYLA 2YD8A 4IDJH 5D2NA 3UBXG 5ACMA 1IGTA 1P9MC 3RWJB 1F11B 3GSNL 1UH3A 4OD2A 4U1IB 1OP3K 3PNWB 4CVZB 3BHBB 4LPYA 3CFBB 4PB9H 1X6NA 4JPVL 1CBVH 4L5FH 5BVPH 4N5UA 1CLZL 1LILA 2G75A 3PWNA 3ZL4L 1JWMB 5BRZA 1YN7A 5JO5B 2C4XA 4XVJH 4TNWK 2R56L 3U6RB 3VG9C 4HEME 2CKBL 1M7DB 4PP1C 5CKAA 2VLRA 4MLIA 4X80H 1I1AD 3MNZB 3ME0A 2YK1L 3MO1A 4APQD 5C0GA 1QZ1A 4Y4FC 2CIKA 4LCIH 5GZNC 2LTQC 4YH6A 3RQ3A 5KZCB 4OLWH 4RGNE 4K7PX 3RL2A 3FRPG 2RCSL 4H26B 2BRRH 4FQXC 3Q6GH 3S5LB 3ARUA 4I3RH 5I1AA 1AO7D 4FQ2H 5IW1B 4LIQL 5JW3L 1UVQB 4TSCL 3U83A 1MVUA 4WEBL 4XBGB 1QO3B 4QXGH 5HHPA 3PIQB 3VRJA 4TRPH 1CGXA 3OKDA 4H88H 4WHTA 4Y4KB 4JDVA 2I9LA 3GBLA 4YAQA 3MV7B 3EYQC 2JCCE 3GMOA 2J88L 1YEFL 4AM0B 4MQXC 2V7NA 4KTDH 1EO8H 2X40A 1DEEB 3TVMB 3C60B 1MCJA 1VADA 2XN9E 5EUOB 2VRAA 4OIBA 5TF0A 5IBLD 4NC1C 2A6IB 4YR6B 5EN2B 3QPXH 4DN4H 4G9DB 4FQ1L 3MUY1 1KYOJ 3REVA 1T2QL 3OHXA 4LDEB 3MLTB 1UZ8B 2HFFB 2C3GA 3WNOA 1KLGA 1RZIA 4M48L 1MCCA 2BMKA 4KMTH 4JFHE 4PJEA 4L3EE 4PJDA 2BOCA 4PRHD 1MREL 1KPVB 4FHBD 4JCLA 5KS9A 3T0VA 5IMOB 3RPIA 4Y1AA 1W0VB 3BP6A 4M5YL 1MJJA 5D7LA 3RKPA 1HHGB 1KXTB 2B1AL 4P59H 5GIRA 1LE9A 5I30L 3CLEL 2ATKB 3NFPB 3MOBL 5IR1A 1VFAB 4GBXC 1T04A 3FB5A 4HBCH 1NGPL 4KI5E 5HDBF 4ZO8A 1J1PL 1GGTA 3UTOA 1MCEA 4MDJA 5I8CA 4WFHD 2DN7A 3IJHA 4LQFH 2R4RL 2B4CC 5L7XH 4I0PA 3WNMA 1P4IH 1S5HA 5HI4C 5TE4L 1CXIA 2MQ0A 2DQFB 2EIDA 2EEBA 4FQCH 3V0VA 1BQHA 1BZ9A 3IDMA 2AXHA 2CGRH 4PJFE 5GGUA 3SE4A 5GS1B 1P4BH 4OLUL 1MNUL 2A9NL 5DT1L 4EQ3A 3NTCH 1PSKH 1IEBB 1CLYL 4G7VH 4AEHL 3BQUA 1CGVA 4QRRB 2WP3O 4K3EL 4P0DA 2GUOA 5BMFH 2FL5A 4QHKI 2V7HA 5L9DL 1L7IH 3VFTA 2QHRH 4G6KH 3EFDH 3FAWA 4J6RH 5TE7L 2C4FT 3AC0A 5KN5A 4PV9B 3VGHA 3GKWH 3VJ6B 5KVGH 4UT9H 3IXTB 3WE6A 5CWSA 4XH2A 1BHGA 3WFEL 5FYKL 1CD8A 3NCYS 2P46B 1JZ8A 4HUUA 4KUCD 4A2MA 3OB8A 3CSYA 3MJ9L 1IRAY 5EU5B 1E27B 4BSWB 2ED9A 3LRGA 3H3PL 1JWSB 5DO2C 3NACL 5MEQA 2Z91A 3WUWG 4X6DE 3CVIH 1LEIA 2AV7A 3NZHH 4JO4H 1RUQL 5AD0A 5I74C 1NBYA 2B4CH 1SBBA 4G8GD 1WQVT 2GIYA 4RBPH 5C2UB 12E8H 2X4PA 4OT1L 3OAUL 2XYCA 4U6VH 3AFLA 3DX6B 4NQSA 1MAJA 4QHUB 2CXGA 3HI1A 3I75A 1M05B 4GS7B 3OJ2C 2GK2A 1RPQA 2VSDA 1XH3B 4J8RB 3WS6A 3VFNB 2GK0B 4PGEA 4Z7VA 3KLHD 3O9WA 4HUMB 1MOEA 4Q58C 2JJSA 3A6CL 3LZFH 4FG6C 1DN0B 1MFDH 3FFCD 2FWOA 4NT6A 5IB1A 4HT1H 4HS6A 1QBLL 2FR4B 3H42H 5JDJA 4XHJC 2J8OA 4HWZB 3S3SA 2E6JA 1B6DA 2Z31C 5GS0L 4KDTC 4YWGH 5F7UA 4I13B 2EDRA 4XNXH 5C07B 4YIQB 3TEUA 3OKLA 4ENED 3O4LD 2NR6D 4L8DA 1NDMB 4OF5A 5HYQB 2KQNA 5FUOL 3U4AA 5DRXA 1A47A 4ODWB 1EVUA 3RWIB 1SJHB 2ICWJ 5GRUL 1YEEH 1FBIH 3RAJL 5J8OA 1I1RA 1WZ1H 4MJID 2KQMA 4OCWH 4OQ1A 3MR9B 4PTUB 3H6JA 2D7PA 1MY7A 1RZJL 2VERN 1U3HA 1KTKE 4H0IA 1EUUA 3R06B 4M1DL 3T8XB 3JTSA 1CS6A 4WFFE 3DETC 3HE6B 3O45A 1KSRA 2QHLA 4NQTA 5CIPH 4HW6A 4IIQB 3CUPA 4HIHB 4AH2B 3RZCB 4P2QB 4K2UH 2AGJL 2VLJA 4YPGA 5GGRA 3QDMA 1HZHH 3L7FA 4LRIA 1VGKA 4TN9A 1NJ9A 1QYGL 1HHHA 3L9RB 5TQ0H 3MJGX 2VWEC 1E0OB 1VEMA 5IROC 4ETQA 3RHWK 1DP0A 3TYGH 2I5YH 5D1ZC 5BZWB 5B4MD 2GJ6A 5KSAC 4UDUB 5DMKA 2XY2A 4MXWH 1TCRA 2IH3B 3DHMA 1C7SA 1KIRA 1FV1A 4ZUTA 5BRZD 4XB8A 3RJQB 1YNTB 4YHLL 3IDYB 4ZOAA 1A6WL 2BNQA 4UILL 4M1CD 4EIZC 1NFDE 5GRJL 1JYXA 2PUQT 3FAXA 5TQ2H 3TCLB 1QRKA 2QQNH 2JTDA 1T3FA 1AGDB 4U7KA 3HZKB 1B9ZA 4TSAH 5C09B 5EU4A 5DD5L 3B2UD 3T0AA 1X5YA 3MGTA 4DUVA 4M7LH 5B39B 4XPTL 3OKMB 2HFGL 2FNBA 4DKEH 5E2TL 5EUKA 3I6LE 5AEAA 4QT5A 1GGYA 4K94L 4S1QH 2GCYB 1II4E 1HSBB 3WUWB 5IEKB 2WP3T 2P7TA 3MRBB 4E5XB 3CD4A 1NAKH 2ZJSL 3QIUC 2ZKHH 4JQXC 5F1IB 2OYPA 1I85C 1YMHB 2C1PB 4NUGH 1F90H 2M2DA 4N1HB 5F9WC 3KPPA 5C08A 5FGSA 2LU3A 4WUKL 1OAXH 1I9JL 1S3KL 3M45A 4DN3L 4HFWB 1UKTA 5ACLA 5JHDB 1E4WH 5EOTA 1LK3L 2NX5B 2DYPB 1I7TB 3MLWH 1NAMH 2HLFD 1IQDA 1ZTXL 3QO0A 3IRPX 5IF0A 1UB5A 2P42B 2EEDA 4KXZI 1VGEL 4ZFOL 4P4KC 1D6VL 4M1GL 3VGEA 5E1AB 5A1AA 1MLCB 4ZNEA 3AY4A 4I48B 2AXGB 2NTFA 4UQ3B 2R2EA 3MJ7B 4ZS7H 4Z0XA 2ADIA 3C9NB 5INCA 1J8HB 4LHQB 5AZ2H 3V4UL 4YDKH 3EGSB 4Y1AD 1U92B 2D03L 2VN4A 1IFHL 5D7LD 4D2NA 3WSQH 3RL1A 3CK0H 3KPSA 1IT9L 1CG9A 4F58H 3AS3A 4NHCL 5JW4N 2NZ9D 4OZ4A 2BY2A 3PGCB 4GAYA 1U91A 2BNUA 4ZSOB 3ROLA 4FQXB 4XMLH 1ZT7B 3VDAA 2ARJQ 3RX5A 1XIWC 3FN9A 1HQ4B 1MI5B 3QJHB 2QV2A 1KCVL 3TIDA 5ENWA 4CBPA 4LLUB 4HC1H 1I8IB 4DZBA 5I19L 3T3PF 5F93C 4FXGB 4LCWE 5IESH 4NM4L 4XPFH 4HGWA 1CVRA 3UAJC 3QRFM 3TNMA 3T09A 35C8H 3QUML 4LASH 1X9QA 4BK4A 2YPLA 1JPTH 2XZAH 1LK2B 1RHFA 2BY3A 2FD6H 3VDCA 2JB5L 2LVEA 3ROOA 1WEJH 1SY6A 4M6OH 3G5YB 3SGEH 2NXZD 4UIMB 2OQJB 4S1SH 5CJQL 3T2OA 2Q6WB 4OLVL 3SE3A 3WFBL 4YGVB 1EEUA 3JV5A 3BESR 3STLA 1U3YA 1DDHB 1WAAF 2VDOH 1QPPA 4YHZH 4NM8L 4ODSL 1S7SB 3WLWC 1TTGA 5DYOB 2R2CA 5DC4B 4M7JL 1F97A 4PJDF 2UVEA 5E5MA 3X3GH 5L2KE 4HS8L 2IGFL 4GXVL 3NIGF 5EB9A 5EO1A 1S8DA 4ELKB 5KS9F 4LEOA 4BFIB 1TJHH 4P5KA 1S7UA 5C0ND 3X12A 2J6EL 3A6BL 5HYJB 2BSTB 3W5NA 4XHQA 5IBTH 1T22A 1PDKA 2FHCA 4XC3L 1FE8H 4BZ1H 1AE6H 5SWZA 2OZ4L 4HZAA 3W0WB 3EDEA 4GBXB 1IGFH 3GMQA 1XGTA 2R2HB 1UA6H 5I1KH 4X5WA 3AREA 2VR9A 5EU6D 2E9BA 1ZVYA 4ACPA 4Y4FA 3B3IB 1BREA 3V7AG 1R6VA 3BIKB 3O9WD 1FNSL 2AEPH 2AXFA 5HYFA 3TO2A 2F53B 1M6OB 3V6FB 5HHOE 1F8TH 4H25B 5LGJB 1KFAH 5IFJB 1W2KT 3VXSA 4UTAH 5E95B 1IGIH 1CDIA 1W72H 4HAFA 2FGWL 2HJLB 4FTVD 2ZUVA 2GT9B 3O41B 4E41A 3JUYA 1T83C 1NCDL 1YEDB 1GGUA 1PLGH 1Q72H 4WW2A 3M1BA 5DMYA 1I1YB 3HCVA 1FLRH 1A4KA 4PR5B 3V6OA 1WWAX 1KLUB 4W6YB 4QRTB 3BZFA 4HXAL 2VXQL 5KG9B 4J3XA 4FFVD 1UWEL 3PWLA 4OBSA 3GB7A 3RUGE 5C0JA 5D70L 3FO1A 2ICWA 2ZUYA 2HMID 3MBEA 1MQ8A 4XNUH 4P9HL 4GQ9H 3MCLH 1LP9A 1OAKL 3LB6D 4HWUA 1ACZA 1R5IB 3NOIA 2HN7B 1BD2B 5CAYB 3G6AA 5I74B 3LKOA 5J0BA 3O2DL 1A3RH 1T66D 3IAGC 2VLJD 3RVWC 3QDMD 5B3JE 1JRHL 3WHE1 1TQCC 1DBJH 3Q0HA 4FFYL 4JRXE 4JAMA 4WU5B 5GSVA 4Z76A 3TH2T 2H9GB 2G5BA 4GAJL 3IU3A 4JM2A 3RGVA 3HG1E 4N9GB 3VXUA 4Z7UA 5I8OL 4F57H 3OAYK 2G9HA 2HT2D 3BOVA 4QHLA 4Z7VF 2XWJA 1JGEB 1JZ4A 3MLSH 2AQ2A 4NBYB 4QHMA 3LCYA 4MNGA 2EDTA 4IHOA 4C83A 4XRCB 5LCVL 2AK1L 2BNQD 2DL9A 1YJDC 3SGEI 3FT2B 1D5IH 3KPRA 2X70A 4PRPA 3C5SB 5DK2A 4MQSB 3OXSA 5JPMA 1U9KA 1HKLH 3VXMB 2VXUL 2X10A 3OKNA 5C2BL 1RUMH 3CGTA 1QSED 5EIIA 1FHGA 1Q94B 3GFUA 3F12A 1AKJB 3QQ3A 4XPHH 3TBTA 1M7IB 3P40A 3CMOL 4XP4L 4RAVB 5HGHB 5D9SB 3E6HB 4PJ8C 1N64H 3DIFB 3MNVB 3BP5A 3SDYL 3Q3GB 1FNEA 2MCPH 2XXCB 3EZ8A 2W9EH 5BXFB 2Z4QA 3JWOC 5IHBA 2CMRL 4RIRB 1NGQH 1ZHKB 4O2EA 4P2OC 1T21A 5EZOL 2NY6D 3D0VA 4XP6H 1E28A 2WIIB 3TZVA 2BDNL 4P5TB 2FECI 2P8PB 1A9EB 3QQ4B 5A16B 2IQ9L 3B4NA 4UNUA 4OLXH 4L4TD 3S9DB 4ZFFB 3L5WA 4I2XE 3BYTA 4C57C 5I17A 5HPMA 4JQVC 4ODBD 2PO6C 3SPVB 5FKPA 1UACL 2IALB 2O5YH 2XTJD 1YJDH 4LCCA 3X3FL 4ODTH 3BW9B 1N7MH 2IF7A 1C5BL 6CGTA 1RJYB 3EOTL 4ZUSB 5KSAB 1NL0L 1IGCH 4DGYL 3S35H 3BH9A 3IXAB 4EUPA 4G6FB 2MPAH 4Y19D 4K23H 5EIVA 3C6LD 2CQVA 2VJXA 3RWFB 2L0DA 1I8KA 2FATH 3H0TA 3MRPA 4WIQA 3SDAC 3V6ZB 1RUKH 4CNIB 2FEDD 3HFML 3JWOH 1FNGB 1H9VA 4MJ5B 3AVEA 3MRGA 1J05B 1RK0B 3KPSD 4DK3A 1LO2L 4N0CC 1FYHB 5E7BA 3SO3B 5EG6C 1JWUA 2E7HA 3P3YA 3QWOB 5ABDE 2XFXB 4TNVF 4U7MA 1KXVC 1P7QB 3QNXB 1I4FB 2Z31A 5DD0L 4UOW1 3S96B 3ZE2E 3IFOA 3QH3A 3WNPA 2XY1A 3DECA 4EI6B 4FABL 1TZGH 4ZDHA 4RISL 4F37K 3ZKMD 3F8UB 1VFUA 4NQVB 3SE8H 3KYAA 5CILH 1BX2B 1A9BA 1WFTA 3PABA 2C7UA 3LEXB 2Q8BH 3ZE1E 4JG1H 4F9PA 2YPLD 4U1LB 2QJDA 2HTLC 4JY6B 4U7SA 1BFOA 1KIPA 1AP2B 2YUVA 2FBJL 4QRSA 1KB5H 5KBNC 1CT8A 5CP3A 1KULA 5GISH 4HK0B 5JIPA 4RGNB 1VFOA 3EUUA 5EC2B 1JFQH 1FH5L 4X4ZA 3VD3A 3FO9B 3JV6B 5F8RC 5FDWA 1HSAA 2YBRB 4XP5L 1DE4A 4P4KB 2I60L 4XX1G 2F8XC 1BOGA 1T5XB 2OXGA 3BZ4B 1WWWX 1MHEA 5FHAH 3MV9E 5M95B 4L1DA 5D1ZA 1OT2A 4B0MM 4LNRB 5EBMB 4RX4D 5D5MB 1R3HB 3VH8B 5AAWA 1JPGB 2X7LB 4Y5XC 2ESVA 3D1MC 2AEWA 4LCUA 4POYA 2JCCB 2ZUTA 2CLRA 5SWZD 1TPXC 5DGQA 4Z7NF 2DQIH 4OCRL 3S7GA 4E0RA 1KELH 2R4SL 1XIWB 2XN9B 4PJBE 4Y4FD 5C0FA 4ZFGH 3HZMB 5GZND 2XNAB 1KBGH 2V9RA 1EVTC 4PD4K 4XNMA 4NQUA 4G6JH 1KYOK 4FQXD 1RZKC 2GTZA 5DJAB 5FOJA 3OTTA 4L3EB 3QIBA 2AJXH 2GSIA 3TPKA 4ISVB 2UWEE 4JKPL 3MA9L 1ZANH 4X9BA 3ZHKA 1IGML 5T1MB 5HHXH 3KPLA 3EJZC 5BS0E 5DHYB 1FFOB 4WY7H 1PY9A 1R3LA 4X7SL 5JUEH 2NY7L 4RMVA 5FO9B 4MQXD 4WTZA 1YEJH 3MUZ1 3FT3A 3W39A 3QXUA 4LU5L 5F72S 3P0VH 4X8XA 1J11A 2OM5A 1OW0A 4GG8B 2VAAB 3OR6B 4J3VA 3V52L 4LLYA 1BBJA 2OR8A 3PQYA 4PJFB 5C0BA 3LN5B 2DQJH 5GS3A 4OGZA 4GW1B 4HS3B 5ID1B 2VDLH 3BT2H 4DKFH 1S5IL 3P9MA 4WI3A 1RZKH 5DMGC 2XQBH 2BFVH 1MJUH 3TP4A 4JE4B 4ORZC 1HEZA 3VXUD 3Q1SH 4QCIB 1XCQA 4XCNA 3B6SA 4R7DB 1DVFB 1H3PH 2CH8A 1HCFX 4U3CA 1G9NC 1YEHL 2K3TA 1WISA 4IJ3C 3EJJX 1C5DA 4O4YH 4TUKH 3D25A 2BSRA 4OAWA 3KPRD 4PRPD 5GJTH 3QHZL 3MRHA 1NUNB 3VI4E 5E8OA 5FF6A 3K7UA 4NKIH 1HH9B 3KYKL 1U58B 4X6DB 4GAGL 3MXWH 5HI4D 3BKCH 3A67H 1OAYH 4R90H 4YE4H 1WTLA 4O2CB 2C4FU 3TBWA 1Z0NA 5E6YA 3ULUC 2X05A 1WVZA 4X4XB 1UM6L 3Q2CA 1B0RA 1CFSA 3NIDF 4NRZB 4NN6C 1CU4L 5F7LB 5GJSH 5DEFB 4N90E 4PP2A 4HUKB 1AXSA 1UT9A 2X89A 1CGSH 4OD1H 3BKJH 1T7WA 4K71B 5C9JA 5CJBA 4PJ7E 3S37X 3P77A 1NDGA 3TT1L 4F7PA 5I15L 1LP9F 1SHMA 3EOAA 3QUYC 3EJYC 1KN4H 1G9NH 2EDYA 3QBTB 4R2GB 2E7LA 1YPZF 4GLRI 4KZDL 4ODHL 3QP3A 2P45B 3PWJB 3E6FB 1TQCB 3BKMH 2E8YA 4ORGA 4ZD3H 1FFRA 2J3SA 1P5VA 1FAIH 2V2XB 1QNZL 4JM2F 5D71H 5CSZB 4MAUL 3RVTC 2JELL 3B5TA 4Z7UF 1A6TA 1IVLA 2EZ0C 5IQ9B 5TDNA 5IB2B 4XNYH 2I07A 2VXVL 3MV8E 1XGRA 5MENA 1P7KB 5L0QC 5DWUL 1BLNB 4OBRA 1PZ5B 3S34H 3ULUH 3OKKA 1WWBX 2BY1A 3WHXB 3P9WB 4OGXH 4ZS6C 4HUVB 1CE6A 4X7DC 4X6EB 3GSXB 1ITBB 4R26H 1EGJL 2C3XA 4UOJA 4YZFE 1AC0A 4FG6D 4MB3A 4X98A 2NW2A 1A4JA 4L1HA 4ZTPL 3CLFL 3SQOH 4H0HB 2WAHA 1A6ZB 1WCQA 3KPNB 1DQML 3MRFA 3IKCA 1T0NA 4PJ8B 3GMPB 4BUGA 2Z31D 2VUYA 5HVGB 4X0KA 4WDIA 4X9FA 1RHHB 1IAKA 4U6XB 3UYRH 5CINH 4PS4H 1H5BA 1T83A 3BE1H 5BQ7A 5DQDH 1CR9L 5DQ9A 4JN2B 4HFUL 3TPUA 3B9EA 4MA3A 2PCPA 2ZSVA 5HDQH 1NFIA 2MNUA 5F7DB 2IBGA 4HX1A 4MMZC 1BGXH 1T4KB 3RVUC 1NFDB 1VSCA 1RURL 2VDRL 3VFVA 2PO6B 3GEWB 3QHFL 4EBQH 3V6BR 5I75C 5DFVC 3DO7A 5KJRL 3DETD 4OUUB 2P5WA 2DI8A 3P4OA 2GSGA 2H26A 1WT5A 1RULH 3UDWA 5IVOA 1ZGLM 1JI2A 2QKIB 4KPHH 4Q9CA 2FB4H 5MEOB 2AQ3A 2VISA 3LSOA 3CPLB 3O3DA 1MCOH 4JRYA 4WFEE 3BPNC 2EXYC 5ICYA 4DFHA 2CRZA 5CUSL 1F4WL 1IC7L 1NANI 5D1ZD 4AL8H 5KSAD 5JXEC 3GGWB 3LPFA 3T0EA 1BF8A 4OFVA 2IQAB 2XZCH 4HIJB 4HSQA 2ESVD 4QF1B 4PJAA 3TM6A 4TVPE 5D72H 3PDGA 4XCEB 4RAHA 4X99B 4I5BA 5K9OA 2I26N 4ZFZA 2C3WA 3L95A 1V7MH 4NQDE 2CK0H 4EDXB 1OSZB 1JHLH 4HJ0C 5JA9A 1OGAA 2Q7YB 4I4WB 1CDGA 4Q6IC 2W65A 3G5XA 2HJFA 2Q8AH 5DVKA 1HWGB 4P2RA 1FVDA 1Z3GL 1P4LB 1FCCA 2IPTL 4JM4L 5IG7B 2ID5A 1OAZH 4G5ZL 3HC0A 1PAMA 2VIRB 5I1EH 1JF6A 4JPIB 2VDPH 1DCLA 3FN0H 4M9OA 1INDL 2ERJC 3EYVB 4ZODA 4IDJL 1FN4A 4HKXA 2F8OA 1PYWA 4P2OA 1UXSA 1T7YA 3GJEA 2CO6B 2VUOA 2F9BT 2YUZA 4PFEA 2DIJA 4QXUH 4PB9L 1OGTB 5T1KA 1CBVL 4L5FL 3GO1H 5BVPL 3S97C 5E9DE 4L9DA 4GH7B 2DJUA 5JW5A 4Z0BH 3VWKA 3QIUD 5GGSA 4OIIH 4QNPE 2X4SB 4XVJL 1DL7H 3LKSB 1QQDB 4JY4B 5IVNA 1UH4A 4X80L 3P0YH 3WNLA 3BPOB 3U7YH 4CMMA 4LCIL 1U8KB 1R3KA 2L4OA 3PV6A 5CD3B 4OLWL 1XF2A 2BVYA 4NZDA 3I02B 3PQYD 3QDJD 5GRXG 4PJ5D 4FRWA 5C0BD 2EC9T 4LCWB 3Q6GL 1HDMB 4HUWB 5FIEA 1A1MA 4J3OC 4I3RL 1OTSC 3HAEH 3DBXA 3QFJE 2RIKA 4U6HA 4FQ2L 1CDUA 2OL3A 3C6SA 3ULVC 3OGOE 3CFBA 4RMSA 4OZHE 1FYTA 1H8NA 4HHAB 5AG8A 4KJYB 2Y5TA 3GUTB 1C08A 4QXGL 1YUHB 3UTSA 4TRPL 4H88L 3QCTH 4EN3C 2CIIB 2APTA 4G8IB 2G2RA 4F3FA 3MNZA 4NIKB 1JYVA 2J8UE 3E3QE 3WN5B 1JE6A 1A6AA 5IWLC 4KTDL 4IDLA 1EO8L 4U1MB 4YFDB 2P5EE 1MHCA 1I1FB 1IL1A 3RX8A 1RJLA 5L2KB 1CLCA 1T5WB 3SDCB 3QPXL 4WWKC 4WCYH 4DN4L 1H0DB 5D96C 4G9FA 3CCHA 2QQQA 3RDTA 1EV2E 3KYNA 4X6CE 1VFMA 1N0XH 5C0AE 1CXHA 1X7QA 4LQ1A 5IM7B 5BO1H 4LMQE 3SKJH 3EDJA 1KJ3H 2AQ1A 2ZSWA 4I77H 3BO8B 1CFTA 1QO3A 5DLMH 5HY9A 5FK9A 2BVOB 1BEYH 3PIQA 4TUOB 3ULVH 1FPTH 5GRVK 3IB4A 2FJFB 5JXAH 1BIHA 3L1OL 1UQSB 5EZLA 3VGAC 4P59L 4WHCA 1XZ0B 4AM0A 4YHYB 5HHOB 3HMXH 3CXDH 1IC1A 5GGTH 3TVMA 2Z8VC 3C60A 4HG4K 5J7CC 5EU7C 4NZJA 4YR6A 2OTUA 4LQFL 5IKCA 5L7XL 3PG2A 1P4IL 1DQDH 1QHPA 1ADQA 4LPUA 5AUMB 5T3XH 5KAQG 1AXIB 4JZJB 1S9YA 4QHNB 3GJFH 4FQCL 3P73A 1GC1C 2CGRL 3D85B 1P4BL 4Y5XA 1GHFH 1S7RA 1HYRC 3NTCL 1PSKL 3C8DA 4G7VL 5MEND 3GSVB 4CDGC 3CSPA 5E8EA 5C7XH 5HGAB 4IJ3B 3TBVB 5IVZB 3RUGB 4Z7WF 5BMFL 5E8NA 4NO0B 5ETUA 1L7IL 1X44A 2QHRL 1I7RB 4G6KL 3RWGB 3EFDL 4J6RL 4UINH 5IMKA 4UTBH 5KVGL 1CFNB 3H8NA 3GKWL 3PL6C 1RVFH 1IEHA 5DJ6A 2DTML 4UT9L 1LQSR 5LAXA 3WKML 4D9LH 2UYLB 3OB0K 3NAAH 4NO3A 4WI7A 4RWYH 8FABA 1T6VN 1FZMB 4JRXB 5HI5C 3ARFC 3KJ4C 3DMMB 3NN8B 1Y18A 4XCFH 2YMXL 5A40E 2CDFB 3QIWA 3HG1B 4MS8C 3U48A 3NZHL 3MCKB 4JO4L 5ADPH 1KC5H 4ERSH 2B4CL 4U1JB 3BZEB 3TLRA 5F89A 1Y0LA 3JWDC 4QRRA 12E8L 4NBXB 4YFLI 4NN5B 3D6GA 1GC1H 4U6VL 2K7QA 4U1HB 3T2NH 3VXTA 4YO0B 2G60H 3HNVH 4LCYA 4F33A 5T1LA 4KRLB 3HR6A 4WV1C 4YEFA 4KUZH 4PV9A 4OZIE 3L3KB 3STZB 3QNYA 3OMZA 5L8LB 3IXTA 3RNQB 5DTFA 1Q9LB 2FJHB 4RQQB 4KK8D 5C0RH 5CEXA 3LZFL 3L6FB 2ITCB 1MFDL 2XWTA 4ODVH 1ZGLB 4HT1L 2AKRB 3O6MH 1F3DH 2LABA 3H42L 4KKNA 5CHNB 1E27A 2OX5A 4Z8FH 1JWSA 2E6PA 4QGYA 1XR8B 5F3BB 1IEAB 2GTWB 4JRYD 4YWGL 1SYSA 1HHIB 4GRLC 3U79A 4LNVA 4XNXL 3GRWA 3UTTA 2BCKB 1TVDA 3ARZA 4FFWD 4FQPA 4LKCA 4MX7A 4OLZH 4LEXH 1YEEL 1FBIL 3ZDYE 1A3LH 4ZUWB 1EBPA 1JL8A 4G42B 5DVLA 1M05A 3JWDH 3CU1A 4NRXB 1WZ1L 4OCWL 4I2XB 5K59E 2P8LB 3I2CL 1R5VA 2NY4B 3CFEB 1D5MA 1NC4B 1J87A 3WIFB 2ORBH 4UUJB 1K4DB 1RZ8B 3FFDB 1DN0A 4M6MH 3LOWA 4ESKA 3Q5YA 4P2RD 4OUOA 3DXAD 4MD0A 4OLYH 3OKOA 32C2B 2XKNB 2NY1D 4PJ8D 4K2UL 5EZJB 4HF5H 1MJ7H 1HZHL 2BX5A 2EEAA 3IF1B 4WI2A 3F5WB 5C07A 3ZHDA 5TQ0L 4AEEA 3U0WH 3BRDA 1T89C 4KRPD 4P2OD 4EI5C 5HYQA 3EO1B 3TYGL 2I5YL 43CAB 2V5YA 4XXCA 3RWIA 5ERWB 5T1KD 1ZHNB 4MXWL 4M02A 1CDBA 1ZLUK 4IEFB 3SJVA 5MEPB 4F7TA 3ESUF 1H3VA 4PTUA 4KGJA 2IADA 2NXYC 5FM5O 3BVNB 5I8KH 4OI8A 3TJHC 3T8XA 4K3DH 5J4MA 4V2BA 3HE6A 3MTRA 3SKOB 2Z8SA 5TQ2L 3Q48A 3MC0A 1VFBA 4OCXH 1RK1A 2QQNL 3WFHB 2CO7B 2X4RB 1MRDH 1KN2H 1QLEH 4HIHA 1UM4H 4Y16C 4TSAL 1NC2A 3HTLX 3EO0B 4M8QB 3VWJA 3DI3B 3VGDA 4OFYA 3MV01 3O3AA 4NQCA 2ZOLB 2HH0L 3ALWA 3MUJA 4M7LL 1FFPB 2A73A 1OARH 4DKEL 3LRSA 3SDAD 5JLZB 3UTQA 2GHWB 2C3VB 4UDUA 3KS0J 3CZJA 3K81A 4M3JA 2DBLH 2F54A 4S1QL 2PW1B 2IH3A 1L6ZA 5ANMA 3H9SE 3T2QA 3DV6A 4TUJA 4NRYB 2R69H 2R0WL 1U8OA 1A14H 5F9JB 1MAKA 2BHUA 1NAKL 3LKPB 2ZKHL 5ICZB 1CLOH 4WO4C 1SMOA 3PDOA 4NUGL 3QQ9C 5DJYB 1F90L 4M6NH 3OXRA 4HWBH 3EW3B 3IGAB 5ADOH 3VFRB 2ERJB 1L0YA 1OAXL 1OTUC 2LAAA 1AGDA 4NN7B 1E4WL 3KXFE 5IHUH 3MV9B 3GI9H 3PDDA 4X4ME 1G6RB 5C09A 3MLWL 5IEHB 1UH2A 1NAML 4Y5VC 4NP4H 1T1XB 1I9RH 5B39A 5J56B 4YGAB 3I3DA 3RDTD 2QQLH 4HUXA 5GRVL 2Y6SC 1QFWH 2ICEB 3IETA 1S78C 2HTLD 3ZT5A 1YNKH 4ZS7L 4UB0L 4LOUC 2E6QA 3HUJA 1HSBA 5AZ2L 4YDKL 3NPSC 4PJBB 3V4VH 5IEKA 5KTEH 3MRBA 3QYCA 1TZHA 2VR5A 2IPUK 3WSQL 2CR3A 2E5EA 3CK0L 4NPYA 1JGDA 3I3BA 5F1IA 3VXOB 4LGPB 2PYEA 4F58L 5C0IB 4D3CH 4PY8J 1JYNA 1J7VR 4Z9KB 4XMLL 2HKHH 3TO4A 1QFWM 1PEZA 2IAMB 2NX5A 3O3BA 4XWGH 5AYUH 2VLLB 3GSRB 2UWEB 4MCZA 5LWYH 4HC1L 2R1YA 3G08B 1M71B 1T1WA 1T2XA 5BS0B 5IESL 5E1AA 4MJ6B 4XPFL 4I48A 4OKVB 2AXGA 2HKFH 3MLRH 4LASL 4N0FB 4MA7H 2P8MB 5D6DC 3ZDXF 1JNHA 3KWWB 3C09C 4XCCH 1DQJA 1JPTL 1I3RA 4UT7H 2XZAL 2FD6L 3JV0A 5T33H 3VFPA 1WEJL 4M6OL 4X83A 5JOPE 4HDIB 1JV5B 5DF0A 4S1SL 1GZQA 1FG2B 3MROB 4HKJB 5I1JH 3PGCA 1FZOA 2FZ3B 4HAGA 3HRZB 1EHLH 4LF3A 5D96B 3HAEA 1HYSC 1HQ4A 2VDOL 1J86A 4YHZL 3VMPA 1ZLSH 1WUNT 5DEZA 2JK5B 1ZT1B 4AENB 3QIWD 3X3GL 2GJZB 5E5RB 3VCLB 4FXGA 4O5LH 3RTQC 2VDKH 2X5PA 3EJZD 5DC9B 1TJHL 1W0WA 3QG6A 4JFQA 5FKAB 3AM8C 2DM3A 2FECL 5IBTL 4PJHE 1FE8L 4BZ1L 4L4VD 2A6JB 3WEXA 1AE6L 1QR1B 1Z5LA 1IGFL 5T1LD 5E24E 4KAQL 4R0LA 1UA6L 3I6KA 4HH9A 5I1KL 5A2JH 3V95A 2WLYA 5EUOF 2Q6WA 1S7QA 5HDBE 3AB0B 3MXVH 3HE7B 1X4ZA 2AEPL 1AO7E 5F6HJ 5HHOD 2F15A 2R8SH 1F8TL 3EO9H 1IAMA 1KFAL 1S7SA 1TJGH 2Y72A 2CJUL 4UTAL 4LVNB 3IFPB 1IGIL 1W72L 4Z7QE 3R1GH 1U36A 5DMGD 2DAVA 1QEWB 1XF4B 2DKMA 2V5TA 5JIHA 3UTTD 4BFIA 2VQ1A 4N0YH 1Q72L 3RIFF 4NFBA 2H2PC 1FLRL 2BSTA 4PJ7B 2QR0B 1UWXH 3VFUA 1QFWI 1UM5H 5HVFB 3NA9H 2C1OB 3HLAA 3O6FB 5HYEA 1X6LA 2YD4A 3NFSH 3C08H 1FZKA 4PG9A 4LGSB 1H8OA 4JDTL 2UVFA 4XNUL 5E6ZA 4GQ9L 5F1NA 4OZGA 3MCLL 2F53A 3QI9C 5K33A 2JB6B 1NGYA 3GJFA 1ND0B 1J18A 2NNAB 5GXBB 5B38A 4WWKA 5LGJA 5IFJA 2Y9RT 4PRHE 1OB1B 1A7QH 1ES0B 2EC8A 4ONFH 4PJXE 4GW5A 3ULUD 1DBJL 3T4YA 3MV8B 2GT9A 3MUGA 4GG6E 3O41A 1R24B 1AI1H 4P57B 2NYYC 2VLKA 1F13A 2BSSA 1V3LA 4K7PH 4S11A 3N1PC 4L9LC 1NEZB 2NPLX 2YEZB 1KLUA 3S35X 3MRDB 2WW8A 4F57L 3X11A 3SJVD 2MOVA 3MLSL 1D3CA 5LG1A 3QUYD 4OZFB 3EJYD 5FO8A 3BUYB 3KR3H 3UO1H 1D9KC 5HTSA 2JLLA 4NOBA 3PXHA 3O8XB 5GRZA 1HILA 1Q9WA 1D5IL 5D6CB 4GQPH 1REIA 1EXUB 1HKLL 4AJ0A 1R5IA 1RUML 4U0RC 3RBSA 3OX8B 4PLNC 3RVTD 3TYFB 3EFFB 4WVRA 1JTOA 4L3CA 2FHFA 4XPHL 5IB3A 2EZ0D 4ZPVB 3VWJD 4PGBB 3CH8A 4WU5A 1CL7I 3U2SB 2E7BA 4NQCD 1N64L 1EAPB 4Z78B 3U30B 2W0PA 2H9GA 2MCPL 3WD5H 3UX9B 2W9EL 4RRPA 4N9GA 3DX9B 4LFHD 1NGQL 4ZS6D 1KEMH 1QA9A 3RY4A 3ZE0E 2F54D 1NMBH 3RU8H 5H35A 2SEBB 4XP6L 1KCSH 2E9WA 3D9AH 1PKQE 2V5MA 4PJGE 1X5ZA 5CJ8A 1TZIB 4OLXL 5D1XB 1ED3A 3ORJA 4DQOH 5H94B 4Y2DC 4LMQI 4GRWE 4Y4HA 3PWUB 3OL2A 3SDDC 3C5SA 4XMKH 3ARFA 3LEYH 2O5YL 4G8GE 3OQ3B 1YJDL 1TNMA 1Q94A 5EDXA 2O61A 5CBAB 4ODTL 4EI5B 1JNNH 3T0DA 1N7ML 3IDIA 3G04B 2B2XH 4PTTB 3E6HA 1IGCL 5C0DB 3D2UA 3MNVA 3S35L 3SDXE 1FVCA 3Q3GA 2Z8WC 3GMNB 2MPAL 1HH6B 4K23L 4ZTOH 4LSUL 4B53A 1R5WB 3MRRA 3QDGD 2V2WA 4PJ9C 1I3VA 4RIRA 4R4NC 4PV8B 4LLDB 5ALBH 5IFHH 3MRJA 2AABH 2FATL 4OGYH 2FLBT 3RVUD 2V17H 3IKKA 5J12C 1RUKL 3FFCE 4WV1A 1UZ6F 3JWOL 1FZJB 1TVBA 5DFVD 4OCMC 4NQDB 4P5TA 3SBWA 3QQ4A 4OSUH 3TBSB 4JY5H 3EOBB 2PYED 3ZYJA 1J1OH 5ESVB 3CDGB 4JPWH 3B9KB 1QRNA 2EIZB 3O4LE 1IAOA 2IALA 4WU7B 3MLUH 1MELA 3TBYB 3KPOA 3FOMA 2EXYD 3BW9A 3WKNA 4Y5YB 3BUTA 4ETYA 2P24A 2RGSA 1BPVA 2R0LH 4ZUSA 3LDBC 1PZUB 1ZS8B 1V3KA 1MHPH 1TZGL 5D1QA 4H1LH 4MJIE 4ELMA 3VMNA 5C6TH 3D39B 5E9DB 2PXYC 5E99H 3SE8L 5CILL 4LSRH 3U9UB 5J57B 4GSDH 1A7OH 1K4CB 3TJEH 5DZOA 4UV7H 2Q8BL 3BWAB 4CNIA 3G6JE 1CIUA 1R0AH 3FMGH 1FNGA 1RV6X 2VDMH 3JZ7A 1WFUA 4WO4B 1ZLWK 4F2MB 4MJ5A 1J05A 3ECBB 2YUXA 4Q9QH 2PR4H 4JHBA 4JHWH 4MQ7A 5CEYB 2A6DA 4HJ0D 4IOIB 1KB5L 5JORB 4F7EB 3IDGB 5GISL 4L8SC 1N5AB 4DGVH 2XFXA 3SGKC 3QUZA 4PGCB 1JFQL 4M61B 2JJVA 2FYYA 2DICA 1Z9SA 4F8QA 3ZKSD 3E1F1 4U0QB 4OF6A 3HR5B 3QFJB 4IRJB 1AD9A 5BRZE 3HC4H 4OZHB 4IM8A 4Y8DC 4NQVA 3NPSB 4E42B 5I1DB 2DQGH 5HGGS 4S2SB