4N0CC

42f3 tcr pcpe3/h-2ld complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
198
structure length
195
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSSSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANFNNSIIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
total genus 28
structure length 195
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cC01
1UM5H 1N7MH 2LABA 4WNQB 3O45A 4DZBB 3QRFM 1A1NA 2CIKB 4JM4L 5T1MA 5C0IB 2GK0A 2A6DB 4D9QD 1CN4A 2J8OA 5EUOB 5LWYL 3MV8B 3O11A 2J5LC 1UG9A 3ARGC 1FG2B 4TSCH 2X70B 2XZAL 3Q1SH 2JJSA 1KCRL 4PBXA 5DS8B 4GG8B 1XGYL 2XZCL 1U8JA 3HG1E 3IJHB 3O11B 2DQUL 3KVQA 4MJIA 3OPZL 4NWUH 1F00I 1YPZF 3JVGA 4V2CB 5EU6A 3U4EA 5CZKA 4L9LA 3EAKA 1YPZA 1I9JH 4OD3H 5TGBA 5HGAB 3SJVB 3LPWA 4DKEL 1U8MA 2DJ4A 2VN7A 1JNNH 4U6VL 4LCCB 2FZ3B 2V5TA 4HIHA 1JYXA 4Z5RA 5FKPA 4LLVB 1HK6A 1U3ZA 5HDBE 1FZKB 5BRZA 3QUYD 1OP3H 4EUPA 5GRVL 2ATPB 3GSNB 4WI3A 5E6YA 1KLUB 2G75A 4IJ3B 1MFDL 2X4OB 3ZKMC 1AE6L 2BCKA 3C87A 2D31B 2VQ1A 3VDBA 1J5OH 3IKKA 1L0YA 1XGUA 4U1KB 4Q6IC 4K8RD 4Y7MA 3SOBH 1AO7A 3LS4L 1FG2A 4I77H 1MFNA 4S1SH 4FQ1H 2ERJB 2Y7QA 1MAMH 5JQ6H 2PYEB 3TYGH 5HHMB 1F4XL 2GY7B 3KR3H 3NCEB 4HCRA 3QDHA 4GT7A 4EN3C 5HGHB 3N9GL 5GQBA 4PRIA 1UZ6E 1U93B 2ID5A 4NN7B 2X89A 2VH5H 5F7MC 1D6VH 3PP3K 4OGXL 3BQUA 4WUKH 1QBAA 2ADFL 4FG6D 4I0KA 3KHQA 3CVIL 1CTOA 1I8LC 2F8OA 1KB5A 2IC2A 5F7LB 2MPAH 3C60B 3NA4A 4JFZH 3AU1A 1I85A 4I5BA 3JV4A 2MNUA 5E6IC 4ZTPH 4LLUA 4HH8A 3RP1A 3MLVH 4UTBH 4BJLA 1WZ1L 4BA8A 1I1AA 4JPKL 4W70A 2VLJB 2WUBL 3L3KB 4N8PA 4DQOH 3UZEA 3VGDA 5J11C 3AGVA 4K71C 1YMME 2FGWL 4XP5H 4Z7VF 3C6LA 4FQPA 5IFAL 1KTDB 4J4PC 3UTTB 4Y4KD 3PWUB 5AUMB 4TN9A 3QIBB 3RDTD 1N5YH 4K3JH 1I9EA 5E2WL 5FGSA 3RTQC 1KUMA 3HFMH 2G60H 2Q7YA 1EVUA 4LCIL 3K4ZA 4OI8A 1UACL 2VXVL 3JWNC 5DJDA 1EEZB 4POYA 4LHJB 2MJWA 4ZUTB 3UTZB 2I26N 3HNVH 2E7LA 5FECA 2GJ6A 4ELMA 3U4AA 1OSZB 4IRZL 4JDVA 4LOUC 4M48L 4NQCA 4D9RE 4PRBB 1JFQL 4BK4A 4WEBH 2IQ9L 3BPOB 1EMTH 4CVUA 3MLXH 1Z5LA 1LO3H 2JJTA 2VITB 1G6RH 4ZPVA 1RZIB 2RCSH 1HI6B 2PTTA 2Z35B 4FRWA 1KELH 1T22A 4JFDE 3MZGB 2R2CA 3TFKC 2BVYA 2EDNA 1VEPA 3U4BL 1QNZL 4LAQL 3QCTH 2HKHL 3FQXB 1U36A 3ARYA 4KY1L 1MJ8L 4P2QA 5HGBB 1B0GB 1UH4A 4M6NL 3A67L 2P49B 1CLOH 5I8EA 4H1LH 3DO7B 4K3EH 5D7LE 3C6LB 3EFDH 5HVHB 4LSRL 3KPSD 2PYEA 1KIPB 5FO8B 5KN5B 2R0WH 3TYFA 1VKXA 4RX4D 4PRPA 4H0GA 1IGIH 3JBG7 4CAGA 3X12B 4HEME 4MD4A 5IG7B 3F6LA 3WXVH 5KZCB 2EIDA 4TRPH 1QVOA 2A73B 4PJ5B 3DOSA 3T65A 5CUSH 1INDL 1J0KA 1FNAA 2EIBA 5IP4A 2X1OA 1R3KA 2G75B 4RDQF 5HYJA 5IEHB 3P9WB 3DVGA 1I7RB 4POZD 2P5WB 3QFJA 1A1MA 2VZSA 4NCDA 1FO0L 2P5EA 4Z7UB 1G1CA 1EO8L 1MUJB 5EOTB 3GJFA 3FQXA 4KC3B 3UTPE 4X6CA 3LV3A 2AJZB 2F9BT 4ODUA 5E1HB 2FLRT 4GBXC 2FB4L 4CL7A 2DQIL 2FX9H 4YK4C 5CBAB 5DA4A 3EO1A 4JDTL 3VXNA 4OUUB 1FNLA 3K8KA 3GMOA 1NDGB 4ZFGH 4YZFE 1I7UB 2PXYC 4OKVA 4P3WA 1G7HB 3PJSB 5D1QB 5C08A 4R2GC 3ZDZF 3O6FD 4XC3L 5IQ9A 4NHUA 1QLRB 3RIFK 3W2DH 1YMMD 4YDVA 4J8RB 5KG9A 1KCSL 4UIKH 1YN6B 1LE9A 2NY2D 1G9NL 3HR6A 2LVCA 3C9NB 3S36L 4FN0A 1IAIH 1PQZB 2P24A 3D39E 4NFCA 2ENSA 5B3NA 1ADQA 4OUOA 5IIEA 1JZ2A 2WBKA 1U92A 1MQKL 1A7QL 1WTLA 2B4CH 2EE2A 3HA0A 4WW2B 2QADB 4Z5RB 1F4YL 1KPUA 1RURH 1ZWIA 7FABL 2H9GB 3QUZA 1J0ZA 3SKJL 5DHYA 4ZD3H 4TQEH 1HHHB 3F12B 5GGTH 2X42A 1MI5A 5J56B 4N5EC 2RR3A 4U7SA 3TA3A 1KCUL 4XX1G 5C6PB 4M7ZB 4D0BA 5DEZA 1II4E 1FNGA 1U2HA 3QDME 5TE4L 3UEZA 1XT5A 3VWJC 3EYUL 1I7ZB 1K6QL 5MENE 1GZQB 4KAQL 1TQCC 3L7EA 1XGPA 3RWGA 4E0RA 3NH7H 4JM2A 2WIIB 1WFOA 4OB5H 4QWWC 1UM6L 3LKPA 5BMFH 4HC1A 1KIPA 1NLDH 4E9LA 5CJ8A 4NNYB 2CLZB 2XN9E 1HH9B 4PP1D 4KUZH 1S7WB 1ZA3B 5HYSG 2CK0H 4KDVA 5EA0L 4FQXB 3VJ6B 1J86A 4KK5D 3WFDH 1OQOA 4NN5B 3CH1B 4HS6A 3MA9L 4NWTL 1ZANL 4RAUB 4GW4B 2XWTA 3R1GL 3MLRL 3U48A 3ZKND 3U9UA 3ARGD 1NGPL 4YGAB 2DD8H 1GHFH 4YHML 3EOBB 3KNBB 5EPMA 2J7LA 2NW3B 5IVZB 2AJYH 3BP7B 2X2YA 5DVMA 1G1YA 3UO1H 4WI6A 4Z0BL 2MKWA 2BK8A 4RISL 4IIQA 4G7VH 5DRWA 2QTEA 2XY2A 4KTEH 4ETYA 5JPNB 1ONQB 4ONHA 3LKQB 4XX1E 2AEWA 1AGEA 2CDEB 3BDYL 3V5HB 3V6BR 3FRUA 3TT1L 1U95A 1Q9LB 1IQDB 1K3ZA 3DUUA 2R1WB 3RVXC 2D7OA 4FQJH 3QUMH 3TN0D 4JFQA 5CAYB 1U8PB 2NNAB 3B2VL 4J4PD 5TDPB 4Y4KC 3GHEH 1YPZB 1FPTH 2C1OB 3VXPA 3UPCA 3WD5H 3WEXB 5I1IH 4EUPG 4PGCA 4PJHE 2C1OA 3VXPB 1IAIL 5FM4A 3DPBA 3HHRB 3GMPB 4GQPH 3MX0A 1MCKA 2DIAA 4QRUA 1JVKA 4XBGB 1KNOB 1Z3GH 2XZZA 3HR5B 3PL6B 4WV1A 2B1HH 1CFNA 4ESKA 1IGFL 3GJEA 2BVQB 2JJVA 3CD4A 4AY0A 3DYPA 5F7EH 4HC1H 3VGEA 2I60L 3MRPA 1F4WH 3UZVB 2Q86B 2ARJQ 4M6MH 3HPJA 3BESR 2NY4C 1VFAA 4XWGH 1E0OB 4BFIB 3QNXB 2FB4H 1ADQH 1YDPB 3T0ED 3QNZA 4K2UL 3IETA 1EO8H 4WO4B 3JTSB 3GIZL 5F1SA 4FZ8H 4TSAL 5E6ID 4JFDA 3O8XB 1MREH 3BQUB 1DN0A 3MZTA 5J9PB 4I48B 3V6ZA 5LXGH 3KXFB 1Q0YL 4OLZL 4KJPC 2X4QB 4HCRL 1FVEA 1SY6L 3ZT5A 3NPZB 3VXSA 4HT1H 4LARH 4RGMB 2DICA 4UMGA 5GGUB 4BK5A 4R7DB 2NX5A 3PWJB 4PV9A 1KFAL 2DLFH 2W9EH 2ZUTA 5FDYA 5IK3B 1FAKT 1AXSB 5EBGA 2IQAA 3B9KD 1KTKE 2VZUA 2W92A 4Z7VB 5A16A 5I18H 4B7IA 1CLOL 1B88A 1RIVL 3WUWB 1BX2B 4U6HA 3QDAA 2PO6B 3TBYA 2FATH 3QEHA 3QULA 4OLUL 4PREB 3QUXC 2AJSH 1BZ7B 4X6BB 2DAVA 4PGBB 2R1XA 1C8PA 3ULUH 2VOTA 5I1EH 1A0QL 5EO9A 3G6JE 2ZG1A 4L3EA 2VKXA 4NKMA 1CXIA 4K9EC 4LNRA 3KLDA 5E8OA 3MV8D 3UXFA 2RCSL 1HDMB 4N0RA 4HXAH 2IQ9H 4GKZA 3WFBL 3N1QC 4J3SA 4R4FH 5I8CA 5E8EA 3KPQB 3TNNB 4EI5C 4NZRL 5EU6B 1KPRB 2GQHA 5CGMA 5CMAB 5CKGA 3IJSB 4HUXA 4LIQL 3BPCA 1MHEA 4MCZA 4F15C 1A14L 2VXVH 2DF3A 3QUZD 4GG6F 2EYSA 2HVJB 4YXKL 2YD7A 5BO1H 4U1JB 5EIQA 3SPVB 1H3PH 3TM6A 4KV5E 4HUUB 1SBSL 4J23A 5KSVA 4Y5XC 2DLHA 3NIGF 2DBLH 3D87B 1M6OB 4OSUH 3OB0K 2WMPA 4ONGH 2VZVA 1I9IH 1R24B 3D2UA 3SDDB 3EO0B 4LLMA 4XGZA 2FYYB 1NSNL 4XMKL 4UV4L 4M5YH 4N5UA 5KVDL 5JIIA 4OJFH 3LQAL 4N1HB 2WUBH 5F6HI 3DXAB 4NRYB 3FB6B 1PZ5A 4JFYB 4X4MA 1NGYB 1WZ1H 1R5IB 3Q5YA 3CAFA 4NO5B 3MLVL 4WFGD 5TPWL 3VA6A 3K0WA 3HC0A 1CLZH 1V8HA 3WLWD 1CD0A 4JLRA 3RZCC 4LFHD 3SQOH 4FMFA 1MOEA 4AL8H 5E9DE 4QGYA 3C8DA 1I3RA 3L5XH 2UY6A 1LDPH 4ZMAT 5I8OL 4LF3A 4HAFA 5EBLB 4RA0C 4WU7B 2GUOA 1A4KA 2R2HA 3C6LC 1ZGLA 5C0EA 2QQNL 1YN7B 4PP1C 1DUYA 5K9QI 4HMEA 4YFEA 5DMYA 4TTDC 3MODH 1TCMA 2YOCA 1Q0XH 3E2HC 3QP3A 1W72B 1MAML 2JJWA 5DC0A 3MLUL 4F9LC 4S1RL 1AJ7H 1JGEB 3C2AH 3TZVD 1LK2A 2KDGA 3WV0A 5HI5C 4JREB 5KSBA 5C08B 4U1IA 4MJ5B 3KPOB 5IKCB 3VRLE 4N0CD 4FQHA 5GS2H 3EYOB 1GIGL 1NC2A 2ZSWB 3N1MC 4HPYL 5I71B 4XPFH 4M93C 1A7OL 4XMPH 1JF1A 3QB7C 2V7NA 3B5TA 4WENB 1OOAA 1EPFA 1AGBA 1J0JA 4N1CA 2BSRA 2I9TA 4QTHB 2E27L 4EN3A 4LFHG 1JGVH 2CUIA 5ITFB 5JDJA 1A6UL 2Q7YB 5HJ3A 3UCRA 1I3GH 2PF6A 1CICA 1BD2A 2V9TA 4DKEH 4J4PA 3RJDA 3K8MA 1WZLA 1N26A 3J7HA 1GIGH 5HTSA 2UUDK 4CNIB 4YLQT 5FM8A 2J88L 1F45A 1H8OA 4XI5D 5E56A 3FQWA 3VFUB 4OLVL 1HILA 1JK8A 1MRCL 2IWGA 4U1LB 3KWWB 4HGKC 4EIGB 4JO4H 5J11B 2YD3A 5DHVH 1BIIB 1IL1B 4KKNA 2DLFL 2W9EL 1K4DA 4GW1B 5SX5K 4I9WE 5IBTL 3L7FA 2IAND 4PRHD 4S0TD 4DN3L 3WJLC 1AR1D 3CXHK 4YUEH 4DW2L 5I1JH 1VFUA 3HE6A 4RSVA 3ULVF 3RWFA 1CXLA 1EUUA 2QQNH 4P46A 3WHXB 4M1DH 5GXBB 1BF2A 3MCKB 3QUXA 4IOSD 5I8OH 1W2KT 4XNZC 4M3KB 5DMJB 1K8IA 4XCYA 3FOLB 4XBEH 2DBJA 3ZKNC 4KMQA 3L5XL 2QBWA 2HYMA 2Y25A 4PJ8D 2GFBA 1N5AA 4ACPA 1AFVH 1FZJB 4K9EL 1HZHH 4PR5B 1ZKAA 5C8JA 4UIMB 2AJ3B 1LHZA 5KVFL 3EYQC 5IG7A 2HMIC 5ALBH 3M1BB 1HOCB 2Q76A 4Z95L 1IZJA 1G0DA 4OZGF 1IC7H 2I60H 1LK3L 1KN2H 4J1UA 1B2WL 1PG7L 1ZS8A 3O3DB 5MP6L 5D2LA 4ODVL 2P47B 3LQMA 4NNPH 3RVXD 4DVRH 1JGLH 3FQWB 3VFUA 1ZE3C 2HP4A 4JO1H 1BVZA 1J8HE 5C2BL 2Z4QB 1KCVL 4FQLH 4L4VE 4J2XA 1DE4A 1U0QA 4GAGH 4M1CC 1NUNB 1A9BB 5A2KH 1MELA 5ADPH 2DBLL 1QHPA 5MI0C 2ZOLB 3C8KA 1E6OL 3VGAC 3JV6B 2Y07H 5D7KD 4WFGE 5BO1L 2YPKB 2R9HD 3QUXD 4NBXB 5I1LA 3GHEL 4ZUVB 5FYKU 4P2OA 3U36B 3IKCA 3DV6A 3U1SL 3VFPA 2Z92B 1FBIH 3ALXA 1BLNA 4YC2C 5DD0L 3MBEB 1CD1B 2J5LB 4Q58C 4HXAL 2BFVL 1S5IH 4KQ3H 4NQCB 1QFPA 2GSGA 4UOW0 1Z9OA 4NT6B 3CSYB 4G7VL 5HY9A 4EXPX 4JHWH 3Q6GH 4EI5D 5DJYB 4NDMA 3QXAB 3BT2H 3SDXB 3OKKA 4L3EE 4XPTH 5I1EL 3V0WH 1QP1A 3CZFA 2KL6A 1XZ0B 3JWOC 1I7RA 3PP4L 4N0UA 1ND0A 3ARFB 3OR6B 4Y1AA 1VCAA 5ISZE 4B53A 4HH9A 2QQLH 3HRZB 5EU7C 2FEDC 1KSRA 5J6GA 1DANU 1RZJC 1P1ZA 4MD0A 2AGJH 1AO7E 5IJKA 1YECL 2HFEB 3MV8E 2OJZH 4ZFOB 5JPMB 4P9ML 3AB0C 2VSCA 2A6KB 3ULVD 1RZ8B 5J9PA 4XXCC 1HHGB 4HT1L 5EU5A 2B2XH 1K8DB 3PP4H 4PJEF 3EHBD 4HUWA 1EXUB 3HC4H 2CJUL 4WO4A 4D0DA 4XPTL 3CFJA 4JRYB 1CDIA 3B9KC 3GSRA 3ZE1F 5CZVH 1G9MC 5B8CA 1IZKA 1MREL 3Q5OA 3MJ7B 4JG1H 4Y8DC 4CADB 3PV7A 1KXVC 3FONB 5IJVB 1ZHLA 1NLBH 4V1DA 4P9HL 1T1YB 5FB8B 5L2KD 4Y5YC 5DUPL 1DQLL 3H0TB 3P9MB 2ITDB 4LCCA 3BYTA 2DLIA 5SWSE 3P9LB 2NR6D 4DKDC 4R96A 3B3IB 3QEQD 4OGYH 4QEGA 1CFNB 3D3VE 4HEPG 4JJ5A 3OJDB 4YR6A 3VXRA 5FHAL 1FG9C 3KPOA 1NKRA 1IGMH 5FO9A 4MJ6A 4WWKA 3UTQB 5I73C 5J6HA 3L3IB 1XAUA 5C9JA 2XA3A 3ARBD 4WI5A 3AXLA 1DDHB 35C8H 4X9BA 4NQED 4G6FB 5SWSD 5DJAA 4S1DD 2R15A 1MCWM 3W2DL 5KAQG 1G7IA 4ZSOE 4PYHA 1T3FB 4XC3H 3D69B 1NCWL 1OPGL 5AUMA 2VDPH 2C3VA 4FXGB 4OLYH 2NLJA 4FQQA 5FHAH 3MMEB 1ITBB 3CGTA 2OZ4L 1KJVB 4LF3B 2I5YH 1RZ7L 5T3ZL 3VFMB 3ZLQC 4V1DB 4HIHB 4OGYL 1FVCB 1P84K 2F54E 1HZHL 3BD3A 2V5YA 3QUML 5DD1H 3AS1A 5I19H 4JKWA 2YUVA 4UU9A 2YA0A 3RA7L 4E41B 1NLBL 1D9KD 5A16B 5D2NB 2NXYC 1FYTB 1OB1A 2DIBA 4X5WA 3D0VA 4BQ6A 4Q74A 3UO1L 2V7HA 5DF0A 3BW9A 1AGFB 3SCMA 2ICWB 3RI5F 2CRMA 4GG6B 3ZO0A 1TQBB 1CS6A 5FDWA 2P48B 3UBXG 3PGCA 2KKQA 1RUAH 3SDAA 5IT2L 3WHXA 3K4AA 5D7LA 3UDWC 2AEPH 5C0NC 3HZKA 5I30L 4I48A 1MRCH 2G5BA 4X0KA 3U7WH 3DGGA 5DMKB 3WE6B 4HUKB 1EHNA 1G9NC 2HJKB 1KIQB 4O51B 2E8ZA 1L9NA 3C5JA 5BMFL 4RGNC 4MQSB 5KOVC 4HSQA 3QDGD 1N2RB 1PKQE 3BZDA 1TVBA 2YSSB 4X9HA 5E00A 2AXJA 4P23A 1MCOH 1Q94B 4LBEA 4KY1H 3BAEL 3VCLB 2X4SA 1T0PB 3Q2CA 2HH0H 5C07D 1AXIB 1IAOA 3BT2L 1OGAE 5JUEH 2X4OA 5BQ7A 1OLZA 1EBAA 4JHWL 3LRSA 3Q0HA 4JHBA 3R8QA 2P5EE 4CKVX 1JIBA 3VXMD 4G5ZL 3GJEB 1BJ1J 2HLFD 4XPFL 4Y2DC 4PJ9D 1F6FB 2R2BB 2ZG2A 5GRVK 2W65A 4QXGL 4ODBD 5JW5A 4RZCA 3FFCB 3U1SH 4AJ0A 2DL2A 1AJ7L 1QLFB 4M9OA 4MJ5A 3LPFA 1WITA 1IT9H 1KCLA 4RQQB 3UC0H 3VRIA 2DYPB 2HJLB 2ZZUT 3DX9B 3C60C 4NZTH 2M8XA 3QIWB 4KMTH 4ZNCD 15C8H 3O3BA 1GRWA 4UIKL 2VB5A 1LVEA 3HCVB 4P23D 3W39B 5F93C 4GKZB 2OTWA 3FCTB 3OHXB 4ZAKC 2VIRB 2X4QA 5KANI 2AJVL 4FTVD 4OZFH 4L8CB 4AL8L 4NO3B 4Y1AD 5EU3B 3PIQA 4JZOA 1DVFC 1T1YA 2WBWB 1CWVA 1KJ3H 2YPLB 3TBSA 5FB8A 3ILPA 1WVZA 2WK2A 2X4UA 4C4KO 5CJOL 2AW2A 1FNEA 2AEIT 4P2RD 2BRRH 2Q20A 5LGKA 4C83A 2CLVA 2OQJA 2CLRA 5IVNA 3GUTA 4XBEL 4Z7VA 3L9RB 4M00A 4WI9A 4I8DA 4D3CH 1T1ZA 1KULA 1XCQA 3SE9L 2P1YA 3RWJB 2DB8A 4S11A 2JJUA 5CJXA 3NPSB 3GB7A 4MZ2A 5CUSL 1YJDL 5I1JL 3VFOB 3LB6D 3F7QA 1KEML 3E0GA 2LFGA 1D5ZB 3OG4B 3VG0H 2JELH 2L4OA 5DQDL 5IB4B 1F58L 3QXDA 4OZGB 3GMPA 3WNPA 1WICA 4JDZA 3VG9C 5E5MB 1JWMA 4J6RH 5E6IA 1BFTA 1N4XL 2F54A 5FFLA 1J5OL 4XMLL 3SGEH 1A3RL 4Q9QH 1SYSB 3V9FA 2XIDA 3ZL4L 32C2B 3QXAA 4M6NH 4FFVD 2HRLA 1EEQA 1D5BA 5L9DH 4URTB 1T03L 2CIIA 4X5XB 4GSDH 1OM3L 1N59A 1NCAL 5D7JA 2X4UB 1UWXH 1P9MA 5JUEL 5C0DA 5I0ZA 4NUJB 4G8GA 4X5LA 3WKML 4ZG1A 2NR6C 4KQ4H 3X11A 4FQHB 6CGTA 4WDIB 4IJ3C 1JNNL 4PGDB 4OLUH 2JE8A 1G7IB 3FT3B 4ZO8A 4XC1H 3ZL4H 3BE1L 1NCBH 3EIFA 4XMLH 2MHAB 3MJGX 4NWUL 3ZDXE 1G7PA 3PDOA 4TTGA 3V6OC 1VGKB 4W68A 4C56B 5L0QC 3AREB 2J4WH 1XGQB 3DTXB 2AEPL 2GITA 4F80A 4RQQA 1CICB 4U0RB 5FA4A 2QQKL 4JN1H 5FGCE 4LDLB 4NQDD 1BZ9A 2G60L 2D03L 2DN7A 1RUAL 4WU7A 3MACL 1H3XA 5E8PB 2C9AA 3MFGB 5ESQA 3VXOA 2VXUH 3FRPA 5HHPA 3OKYA 5E6ZA 1RPQA 4EDXB 2EC9U 1WQVT 4GRWF 3FZUC 1D5BB 3U79A 3MREA 5CD3A 4X7CC 1G0YR 4BQ9A 1L9MA 1CZ8H 4YWGL 4MNHA 1T0MB 1ZTXH 4XNYH 3H9YA 1U91B 4DK6A 2CKBA 2RBLA 5D6CB 4HWBL 3MLYL 3DVNB 4U33A 4OCYH 2FSEB 3KNBA 5EPMB 5AYQA 3GDBA 2EE6A 4OT1H 4GXUM 1H3WM 1GOFA 2IPUG 4M6ML 2FYYA 5HHMD 4CBPA 4F58L 4G8EA 3T77A 2IANB 5HI3C 4JFZL 1DBMH 1IM3A 5DZNA 1WFNA 3GMMB 1NKOA 1KIQA 2EO9A 3NGBC 5FF6A 1MLCB 3R8BB 2CRIA 1D6VL 4PLOB 3MUGB 4GH7B 5FAAA 3L3OA 3HMXH 15C8L 1FL5A 3DHJA 4MCZB 5T1KD 3MUHL 3ZE0E 4K23L 3VMPA 1N6QH 3TBTA 3K80A 5EZIL 1QUNA 4B41A 5DFVC 3VXMA 5E2VL 4KUCD 1E4XH 3JTTA 4FQ1L 4GQ9L 1EZVX 1M05B 5D1ZA 5DD5L 4PGZA 3NCFB 5D1ZD 3PIQB 4X5WB 4QF1A 3RWCA 2VLJD 5E8DL 3TA3B 1GGIH 1Z5LB 4U6TA 5J3HD 2FEEL 4E41A 5F9JA 4XP4L 3U6RB 5ICXB 3MRBA 3EDJA 5GS0C 3S7GA 1T4KA 1KBGH 4I18C 4XVJL 1DR9A 3SDCB 4Y5YB 3I9GH 4PJAB 4Y4KB 1CQKA 3VE0B 4PREA 1U95B 5A2IH 3QIBD 3QDJA 1Z2KA 1U3HC 1QSEE 5D6DA 1FYHB 2K7PA 3DVIA 5ID0A 4GRWB 3BAEH 4FQQB 4S0SD 5MERA 2UWEE 4APQC 2C3VB 4FXGA 4JFFD 5F71A 4CRPA 4D0CA 5C0FA 1E27A 1UC6A 3BZEB 4LCWE 5CP7B 3CFEB 2WBJC 1RIVH 4K8RC 1ZHKB 4L4VD 5I18L 5E1AA 3OPZH 2A73A 4MZ3A 2AJUL 2YD5A 1EK3A 2XWTB 2AK4A 1ZS8B 3O3DA 1RIHL 1YQ2A 3S36X 4U1HB 3IDNA 3CCHB 3RY6A 1CYGA 4PJBB 4EI5B 3B9DA 5DXWA 2H6PA 5FYJD 3WN5C 4L3CB 5C0ND 3LH2L 2X1PA 4M5ZH 5C0CE 2WM0A 3JSSA 1J11A 1I85C 4HH9B 5IFHL 3H9SA 1DVFD 3F6IA 2CDFA 3TF7C 3OJ2C 3TV3L 1T6WA 2NY7L 4L8BB 1AC6A 3Q6GL 3TNMA 4NQUA 2IANA 5F7UA 2VISB 4LSVH 1Y6MR 5I8KH 1QFWI 2CR6A 2A6IA 4MA8L 5DMKA 3BKJL 3MXWH 3EYFA 3MLTB 4G8FA 3TT3L 4G8IB 5E24E 4RBPK 1A7RL 2YD4A 3KPSB 4K3HA 5A3ID 3HE6B 4FFYL 5CEXA 4PRIB 1X44A 1J10A 4YC2B 3ARDC 4KKCC 5EOCL 1A6PA 2OCFD 3FO2A 5K9JH 1YYLH 3QQ4A 5C0AA 2Q6WA 6FABL 2WWKT 5KZCD 3K81A 2PETA 1PZUB 4JDVB 4QRUB 2VDPL 3LEXB 4R90L 4PJXB 4P5MA 1SMOA 2BDNH 5FCSH 2DS4A 1S7XB 4GAGL 2XWBB 4XNUH 1IRAY 4HUUA 3TO4C 5D7JD 4LCUB 3ESUF 5GRUH 2PR4L 5C2BH 2QR0B 4PLKD 3BGAA 1MHEB 4Z7NE 5IHZB 4A2MA 5TDNB 3GGWA 2XFXA 1B2WH 1PG7H 1SEBB 2FJGA 4MA8H 5HVGB 4EUPB 4YPJA 4PGEA 1IBGH 1KACB 5JW5B 1VFAB 3PQYD 2E6QA 2ZNWA 4Y19D 7CGTA 3QEQB 1QG3A 3CC5A 4LEOA 4P3CH 5ACZB 3V5HA 5BCAA 2HTLC 2FX9L 3L1OH 4TULH 5ANMB 4BQ8A 2ORBH 5D72H 4FFYH 2BVPA 2QJDA 4DJMA 5D1QD 1X5AA 4MA1B 4JPIA 1T4KB 2BY1A 3TCLB 5C7XL 5AYUH 1JMZA 1WBXA 4LVHC 1KLFA 1XGRB 5MEOA 1G0XA 2PKDA 3INUL 1DBJH 2YUXA 3VFPB 4D8PB 5HDOA 4KTEL 3RVVD 3WHE0 4LKXB 2WNGA 4WFHD 2BOCB 1N5AB 2D7NA 5DK2A 5CZVL 2DYPA 2BVOB 2HJLA 5IFJB 5IB3B 3QEGH 2RFXA 5TQ0L 4Q2ZB 3VJ6A 1P7QB 1ZAGA 3LH2H 1R6VA 1I4FA 2VABA 5C0JB 5FA3A 3FAXA 1JWMB 1XIWD 4NNYA 1CCZA 1WZKA 3IGAB 4C59B 4KKLD 2EZ0D 5KVEL 3OXSB 4M8QB 3S96A 5FYLD 1RIHH 5HD8C 2NY3D 4Q9CA 3BO8B 2ITDA 2GUOB 3QIUC 3QDMD 4G6MH 4OZHB 2AABH 4LDOB 1U8LB 3LB6C 4X7DC 5EZLA 1PDKA 1Y18B 5E8NA 4YE4H 4YHNB 1D9KB 1YEFL 1ONQA 5L88L 5B39A 3TIEA 4HKXB 3K4DA 1FNGB 4KROD 1XCQB 3BP7A 2AV7A 5H37G 4JFXB 2Z8SA 5KSBE 1CU4H 2D31A 4ELME 3DO7A 5DTFA 5E8DH 2FSEA 5C3LD 5EU5B 4PRDB 3FOMA 1JV5A 3RAJL 3HUJE 4GQ9H 4KRPC 3LEYL 1CGXA 4YX2H 1A7OH 1M4KA 1VSCA 1FGNH 4WFED 4XMPL 4OD2A 5DD0H 8CGTA 3DGGB 1FBIL 4Z77B 1HH9A 2JB6A 3LQAC 1S7SA 4PY8J 3S35H 5F7WC 3SKJH 4EIZC 4I1NB 4HWNA 3B9EA 1RURL 3LSOA 2Y23A 2X4PA 2VO5A 4ZO6A 2ESVB 4X7SH 4AIZB 2D7PA 3SDDC 1A7QH 5E2VH 5DJXA 1AGCB 4PJIE 1UKSA 3UTOA 4CN4A 2UY7A 2CGRH 4QXTB 4K7FB 5AAMA 3QJFA 2GSIB 4B7LA 1EBPA 1RJYB 5CLWA 3A6CH 3KLHC 3SN6N 4LSSH 4B5EA 2VDQH 3MFFA 2CXGA 5JNYB 3EO1B 1RZFL 3LS5H 2QEJA 4FS0A 3BDBA 4MNGE 4ODVH 1DJSA 1CVRA 5CP3H 4DZBA 2OI9B 1LK3H 3PGFH 3SDCA 2Z0BA 4JZJB 4Z95H 3SQOL 3QQ3B 3LHPL 3ULSB 1BVKB 4YIQB 1CDYA 5HHOE 5IW3A 3N0PB 1VFBB 1B4JL 4EI6A 2DRUA 3ZKQD 2CO6B 1T83C 3MRLA 2VWEC 3ARPA 4X99B 2VXUL 3C9NA 4WO4C 3GMLB 2WWMD 4Y5VA 4YDJA 1JCKA 1K4CA 1JE6A 3LQAH 3IDXH 3VFTA 2D03H 4KKBD 2MPAL 4GFTB 2YPVH 3F7PC 3S3SA 4EDWH 2BMKA 4P23B 4TYUA 2AAVA 1TVBB 4KI5D 4NM8L 4GW4A 4OZHF 3PHQB 4ELKA 1RJZB 1KENH 2N7AA 5DRNB 5D1XA 5D1XD 4FQXA 4DW2H 1JL8A 2NX5B 3PWJA 4LLDA 4PV9B 3UYOD 1KEGH 4DN3H 5DQJB 3WXVL 1CFVL 43C9A 3BN9C 3RL1A 1H3PL 1TQCB 4ZO7A 1HINH 4PLJC 4YXKH 3P9LA 5EFIB 1OAXH 4KXZH 4EJ1C 4HUVA 3RL1B 3WBDA 3EYFB 4KQ4L 1AKJB 2QLVB 3KPLB 4P2QB 3S3PA 4YXLH 3QNZB 3L3JB 1BAFL 3BE1H 2EE9A 4G9FE 2VLRD 1MFDH 3MQIA 1IGCH 4XP1L 4ZTOL 4PTTA 2IAMB 2DMKA 2EDFA 1A6UH 5I73B 5IMOA 4FTVA 1NFDA 2LAGB 5JIHA 4JANB 3ARDD 1NCCL 3TCXA 3U4BH 3L3HB 3EGSA 3MRLB 4MNQD 4GSDL 3KGRA 1KELL 2Z8WC 1OM3H 4HIIB 1BPVA 3P4OB 4U6VH 3DECA 4HZLA 2ICWI 2XA8H 5KW9L 2IBBA 1QQDA 4ZUSB 4ZUTA 3VXOB 3B9AA 4HPYH 4N0FA 4QRPE 1HILB 4HAGA 3EBAA 1KEMH 4KV5F 5TFSL 1A3RH 3RKDC 3ZTJG 1KEGL 2FZ3A 1RSFA 2B5IC 2Y4SA 3SDYL 3QIUA 2FJGB 1Q9KB 4LLYB 3CPLB 1NFIA 1JZ6A 2VQUA 2J3SA 3C09B 3GSWB 3HAEH 4PLKC 4BFBD 4H26B 4JQXC 1WJ3A 3IAQA 4PY7B 1T89C 4LP5A 1CE1L 1A7BA 1UWEH 2IQAB 3V4VL 2LU4A 3L3IA 1QLFA 2YA1A 5IB2B 1SY6H 3FT3A 5BZDA 3CVHH 1K5NB 4GKSA 4OLZH 3QQ9D 1N0LA 2R1WA 1IC4L 9CGTA 1BREA 3MOBL 1LNUB 2X40A 1T0NA 1HNFA 4NJAL 3FRUB 4YEEA 1T7ZA 2B20A 5C9KA 1CF8H 2IH1A 3C5ZB 3FB5B 4GRLC 5IVOA 4PJGE 1CF8L 2ADIB 1TZHB 3G9AB 4KWUA 4PJ8A 1MFCH 4C56D 1JN6A 4X6DB 1HKLL 1FO0B 3C8HA 5CJOH 4TOYH 1Y6NR 4HPOL 2XQYG 2PCPA 4JRXB 3TVMA 4HC1L 1Q9KA 5JDSA 4XNMB 3V4VH 3QPQC 4PJIA 5C6WH 1P7HL 3A6OA 4LCUA 1VDGA 4JPWL 4TVPE 2NY3C 3OG6B 4OGXH 3H9HA 3TIEB 5FM5O 4XCNB 1YNKH 1M7IA 4MQ7B 3VXRE 3GRWA 4G42B 4XZUB 2N56A 4YHNA 1FZMA 2F53A 3H9HB 2IJ0C 3I6GA 4EBQL 3QA3A 2NYYD 3WD5L 5I1IL 4G5ZH 3G5YA 4RFOH 2E9WA 4FOMA 4F7CA 5IMKA 4QNPE 4IRJC 2OS7A 4NC0B 5CP7A 2FJHA 3AS0A 4NP4L 5F9WC 4N68A 1TQBC 4KUCF 2DMBA 1VFBA 1P7QA 3TT1H 4XCYB 1K2DA 4O02L 4Y2OA 4L8DB 2YN3A 5SWZD 1N0XL 2ATKA 4X9FA 5F70A 1YEFH 1T7YA 3ARFC 1IGYB 3NFNB 1I1AD 1OP5H 2AJXL 4MX7B 5E8PA 4K3GA 3ULUL 3AS2A 2DD8L 1J0IA 5GIRA 2W07A 3IDNB 5I30H 3ZDYF 3RWCB 2EYSB 1INEH 4TNVF 4I13B 1BIIA 3D39D 3IF1B 2XTJC 4PRHE 1TPXB 4QRSB 4K7FA 1CFVH 1MQ8A 3CVHA 2Q7NA 5ELIA 1L0XA 2I07A 4PGEB 5TQ0H 3ZE1E 2DQUH 5C9JB 3C5SB 3MRKA 4UV7H 1MCWW 4KUZL 3BJLA 3ZTNH 3Q1SL 3VXSE 5FO9B 5CFHA 1S8DA 2DQTH 4PJEA 3FB7B 5GSVA 5TJWK 2IH3B 4LARL 3NH7L 1GCFA 3RA7H 2XI9A 3HS0A 4ODXA 1JUFB 2VXQH 2YMXL 3QI9C 2X7LB 5AYUL 4H25B 1EHLL 3DUUB 4XVUD 1B4JH 1RQ5A 3G04B 5IROA 2WIIA 5DJ0A 5C0AB 2Q6WB 3MRHB 4L4TE 4JLRB 1DBBH 5FXCH 2AK1H 4JANA 4HXBH 4KVNL 2HA1A 4JE4B 2AJ3A 3MBXL 4L9LB 3IU3A 4PJ7E 3UTPD 1KCUH 3GSQB 1ZA6B 5HYJB 5IEHA 2UVFA 4G7YL 1FV1B 2NY6D 3QZWA 4F37F 4RWYH 3WLWC 2XPGA 4OGZA 1F6LL 1KC5L 3BSZH 7FABH 3S37X 4RIRA 4WRLA 5GJTH 2Z91A 3NIFF 1DQJB 2FR4A 4YFLF 4Z18A 3I6GB 1ZEAH 2CD0A 5I1KL 5DHVA 1RIUL 3FHAA 1DVFB 3CSBA 1OPGH 4RA3A 1NANI 1V3JA 3BPLC 1ZLWK 3OAYH 1YEHH 4P5KA 4APQB 4JQXA 4PIRF 4JQVA 2IPKB 1BMGA 5D7LD 4YBQC 3VFNA 3IFPB 4OZFB 1ED3A 2GITB 1YDPA 2C3XA 4Z78B 3TJHD 3ZKXC 5DYOA 4G7YH 4YQXL 5I1AA 4WUUA 4PP2A 3DSNA 1IKNC 1DQQA 4GO6B 4ZOEA 4ORZC 4PY8I 4MAYD 4DGVL 2VC2H 1KPRA 4ZNEE 4ZFGL 1GGCL 3W0WA 1NGXA 3D85B 5E9DD 3TBWA 3GMLA 4R0LB 3K1DA 3GHBH 1GC1H 3TV3H 4J3XA 5HJ3B 1F6AA 5ICZB 3OHXA 1DQLH 3CU7A 4POUB 4CMHB 5E5RB 3NFNA 2FDBP 4OZIB 5D7JB 4LSPH 1JRHI 3U0TA 1U8NB 3I75A 2WANA 4S10A 5GGSB 5L2JA 5DK3A 3RKDD 4PTUB 2F58L 1RFDL 2ZCHL 4CVZB 5GZNC 5DC9B 2GHWB 5D9SB 1DSFH 4Z76B 2VDOL 5E7FA 5IW1B 4QYOA 1UADC 3QIWC 1YMMA 2P8PB 2P44B 4LQFL 5CEZD 1J8KA 1VB9A 4DKAA 5F7FA 1EERB 5FIEA 3P3YA 1IGIL 4CJ1A 2BOCA 1G7PB 3PDOB 3ZDZE 5DSCB 2ICEB 3MRNB 5DJ2A 2NTFB 1FL6B 3QQ4B 1OP3K 5D1XC 3SCMC 3WIFB 3ZDYE 3NN8B 3QRGL 3VFGH 5J4MA 2F58H 4K3EL 3U7YL 3KXFA 3DMMC 4J3OC 4LNRB 5HVWA 3BN9D 1I7TA 4RMRA 4EN3D 2IPUK 2JB6B 5EBLA 2NXZD 1JGUH 2OL3B 3KJ4B 4XP4H 2W0KA 4E42A 2GJ6E 3EYUH 4WW2F 1FZJA 2HKHH 3GFUA 3P30H 2CUHA 5JDSB 2O5ZL 4GOSA 5D72L 2VJXA 1GC1L 1XIWB 3D5OF 4DVBB 1E4XL 3EFFB 3A6BH 1TVHA 2D4FA 5IHUH 4I0PD 3EJYD 3V0AC 3MV7B 2HAZA 5EZIH 1T2JA 4LGRB 3JVGC 1C08B 1T22B 3GEWB 4M48H 2K7QA 1IMHC 5FV1L 3FJTA 5JPMA 2JJSC 2W9LA 1RJCA 5GRUL 1F4YH 1RV6X 4LPTA 2VUOA 4KROB 2ZCLH 2Z31C 2B4CL 3SEPA 5AD0B 1P1ZB 4QOKE 3HFML 1GL4B 3WS3B 3RUGE 1AD0B 3T0EA 1JZ3A 1HEZB 2L7JA 5I75B 4P2YA 3QG6B 5E7BA 2R2EB 3EYVA 3O4LA 1JI2A 1BVLB 1CFQA 4LP4A 3GSXB 2IPTL 2HTKD 3SDXA 2CDGB 5DJ0B 4PJCE 3T4YA 4WU5B 5MP6H 3VXME 3QIUB 1KN2L 5I2IB 3U0TB 1FVCA 2X4TA 3T1FA 5DQ9A 4LSVL 5DMIH 3NABL 3I6KB 3MBXH 4UZGA 4IRSC 1W8OA 3V5KA 5DUBA 1J05B 4GBXD 1I3UA 2DTSA 3RX7A 4NO3A 3MOBH 3L3KA 1UA6L 1S7TB 3HZVB 3PGDB 4N90E 4QF1B 1S7RB 2BHYA 5ACZA 4GRLD 3F8UB 5IW6A 3VXTB 3EOBA 3BEWB 3CVIH 4NQEB 5DSCA 4GG6E 4IRSA 1AC0A 1RHFA 1R5WA 2A6JB 2AI0L 1MRDL 4JO4L 3ZTNL 3MLSL 2X70A 5B3JF 3S88L 3DI3B 2OP4L 3DSFH 5IMLB 2J88H 3QHTC 1IEBB 4PRPE 3O4LB 1OAUH 3O41A 1JNJA 1KT2A 5H35B 3MRMA 3OX8B 3QPQD 4QRRB 5DD3H 4V1DD 1H15B 4PJXA 1UB5B 1I3GL 5HGHA 5H94B 5GGUA 4UQ2B 1RY7B 4HIJA 4LVOC 2OSLA 3D39A 3EFDL 3W9DA 1WT5A 5INCA 4RIRB 4PR5A 2WLYA 2QQQA 1FYTD 2XQBH 4JRWA 5DD6B 1IGCL 4XP1H 3PXJA 2QSTA 3KYNB 1U91A 5F89A 5CIPB 1JNHA 5CWSB 5AZEH 4LGSB 3H9SE 2NY6C 2VDKL 4OD1H 2Y5TA 2ZKHH 2E27H 4PB0H 2GTWA 1BM3L 3BN3B 1MI5E 1FNEB 1Z6JT 4HWZA 4MB4A 5D7IF 4N90D 2E5EA 3PE9A 4F7MA 1FN4B 3VU2A 1HINL 2VAAB 1NCDL 4A6YH 1QA9B 2FWOB 1YC7A 3VG0L 1MAJA 4K23H 1WBZB 1QSEA 2NLJB 2ZUQB 4H5SB 4IRZH 1FVDA 4XP9L 3HMXL 5IF0A 1H15A 2NZIA 4WFFE 5IBUG 3JWDC 2MTPA 1JHTA 3P40A 1RMFH 1TNMA 2MOVA 3QDGB 3VXUA 4Z7WB 3SE9H 2OTWB 4TSCL 1BEYL 3O41B 2XN9D 3HCVA 4AQ1B 1S9VB 4NQDA 2XTJD 3IXAA 5J13C 3TIDB 3ULVL 3S8WA 5KS9E 3PHQA 3CSGA 2BRRL 3ARDB 3QZWB 4BELD 4IRJB 4UB0H 1LILA 2Z31A 1HXMA 1FYTA 4TOYL 5MEND 4D9LL 3MV9A 2AXFB 5TPWH 3BEVB 2ESVA 1NUDA 5C0DB 4PJAF 1HSBA 3F12A 1ZT4B 3VFVA 4CVZA 3NZHL 3MRGB 4DQOL 2YD8A 3NZHH 5BRZB 3MSPA 3DIFB 2GKIA 4KJQD 4UTBL 5CJQH 1HIML 3QDMA 2XG4A 4RGNE 3HNTH 3AC0A 3CDGA 3CMGA 3NGBB 5FEBA 2GY5A 3FB7A 4DAGL 4OSUL 5HSFA 1A9BA 3B4NA 4HJ0C 2X1QA 1XR8A 4HS8L 1VGKA 1RVFH 3UC0L 3QIWD 2V2TB 2W59A 5KVDH 1CE1H 1UWEL 1H3VA 1KTDA 2MHAA 4C55A 3CFBA 4WUKL 3MRDA 1JPFA 2YSSA 5DGQA 3NIFE 5AG9A 1N2RA 2VH5L 4P5MB 2YBRA 3W0WD 1X7QA 3C5ZD 4I2XA 5EZOH 4YDLC 3S35L 5ID1A 2R2HB 5TFSH 1ZGLB 2F5AH 3M1BA 4KRPB 4PJCA 3F7YB 3W81A 4W6XB 1FGNL 4QHKI 3KS0J 2IALB 3LEYH 1IKFH 4KI5F 1U3YA 3IGAA 3SOBL 1NBYB 2EEBA 4XPGH 3GJFK 3DX8B 3FRPG 2AJZA 4WTXA 1UZ6F 3PV6B 1XZ0A 2W0LA 1MVUB 1ACZA 2YC1B 2VDKH 4OD1L 1T04A 2HJFB 4K7PL 5L9DL 1RK0B 3CFDB 1AKJA 2V7HB 3PWPB 2VR9A 4JVPA 1A2YA 2CKBB 3MRCA 3V4UL 3M17B 1T1WB 1BAFH 1RZKC 5SWSA 1M71B 1UEYA 3HPJB 4UBDD 3HN3A 3U7WL 3IU4L 2M1KA 1MFEH 2A6KA 4RNRA 4JFFA 4TVPH 1IEAB 1X9QA 3TYFB 2YBRB 4GW5B 4DTGH 4LPXA 3VRIB 1KJVA 5JA9A 1FL6A 1TJIL 2BMKB 4ONFH 1NDMB 4WGWB 4O9HL 2WP3T 2XRAL 5DMGD 1TZIB 2DQGH 3T1WA 2AI0H 2P8MA 2E6JA 4CDHA 1KFAH 5D8JH 4LSPL 2DOCA 4TUOA 5FYLE 3QUMA 1FL3A 2BNQD 2ADJB 2C7UB 3OXRA 5CEYA 5FOBB 4OQ1A 4IRSD 1GGBL 3PXHA 1UA6H 2EEDA 5T3ZE 1U8NA 3SCMD 3ZKSD 1Z0MA 3CLEL 5F1IA 3SHSA 3NBNA 4OUUA 3WL9A 2I5YL 4YPGA 5T3ZH 2OZ4H 3VMNA 1NEUA 2DMCA 3EYOA 1X5FA 5BV7B 3UJIH 4FZEL 5DURD 2ILLA 3FTGB 3HAEA 1ES0A 5CEXB 4IIQB 5IEKB 5LGJB 4GG8A 2NY4D 3CK0L 3LN4B 1IGFH 2C3GA 4I4WA 2R0KL 3G6JA 3OR7B 1FJ1A 3RNQB 5C6TH 1CICD 3I84A 1K2DB 3L3JA 4XWGL 4UINH 1ZOXA 1ACYH 4NQDB 4DCQB 5MHSE 1KGCE 3SE4A 3A6CL 5HBBA 2G5BB 4X0KB 3VD7A 8FABB 3QFDB 4R90H 2XACC 3VWKC 5IB4A 1QRNE 4PUBL 1J1OH 2VSDA 1LP9B 4CU6A 2W60A 4Q97A 4JY6B 1UT9A 3B2VH 4PV8A 5ID1B 1HCFX 4LHUD 2IADA 1TPXC 3N85L 4ELKB 3BVNB 5DUPH 1P4BH 3MV11 5IHUL 3LKNB 5DEFA 4JJHA 2AK1L 4KVNH 1RD6A 4PGJA 4P0DA 4P2OD 1PZ5B 2NY7H 5GRJL 4DEPC 3MV01 1I1YA 2OR9H 2HH0L 5IFHH 3C09C 3GO1L 2JCCA 3RPIA 1C5BL 2BY3A 2QADC 4U0QB 3KPLA 3ROLA 4UAOC 4H8WC 2V9QA 4U4BA 2ADIA 3HZKB 3MA9H 1QSFD 3GSUB 4PJFF 4FTVE 2CK0L 2J8UB 3IT8D 1T3FA 3BRFA 2CKNA 4MA7H 2AGJL 5FA3B 1FFQA 3WSQL 4LL9A 1G7MB 4OM0L 1LEKB 4PRBA 4FXLA 1C7TA 4IRJA 2RFXB 3O3AA 3MRFB 4GKOA 3R1GH 4YFLI 2YRZA 4YZFF 5IT2H 5D1ZB 4HUXB 1O5DT 3WFDL 3BP6A 3IJYA 4DK3A 4HLZH 1JPGA 4PRAA 5A1AA 3TZVC 4YNYB 3QEGL 4G80B 1S7RA 4WWKD 2X6MA 1UM6H 2X1XR 4HHAA 4LRIA 5I9QC 5EO0B 3VXRD 3FQRA 4Q6YA 3S4SG 2Q3AA 2DQCL 4MYWB 4X4ME 3Q6FA 1QA9A 1JI1A 4JZJA 2ADGB 3GO1H 4KJQC 3QR2A 5I19L 1RUPL 4JFFB 1U8HB 3L1OL 3OKLB 3GMQB 4GUPA 2I25N 3QWOB 4P3CL 1VERA 1NFDB 5C07E 4Z7UF 4D0DB 4PBVC 3QO0A 5F3BA 2D9QB 1U8JB 2VTFA 3IJHA 2R2EA 2YN5A 4JDZB 4G8GE 3MRFA 3KDMA 3AFLA 3OWEA 3BH8A 1S9VA 1R3LB 4JO1L 3BP4B 2BHUA 1YEHL 4F57L 5B3JE 2EECA 1GGTA 1KIRB 4UQ2A 5ENWA 1S9WB 3SO5A 1RULL 4R96B 1XEDA 5HGDB 4Z8FL 1YN7A 3P4NB 4OFYA 1ZEAL 4D9QE 1Z0NA 5EOCH 5E2UL 3CZFB 5GJTL 4W81A 5D4QA 1KCSH 4JFEB 1A5FL 4NBYB 4WGVB 5JXED 3N50A 1SVZA 4LAJH 4JFHD 1MFCL 3I3BA 2IAMC 3H3KA 1RHHB 1T5XA 1ZTXL 4XNYL 4MJID 1FO0H 3P4LA 5EUKA 3VI4F 2BVUA 3FT2B 4N0YL 4PJBF 4QRPD 1KTRL 2FL5A 2VLRA 3CLEH 5HHXL 5C0GA 4Q6IB 5FUOH 4AEHH 2AXGB 3U36A 1P84J 3GKZA 3E3QE 1MIEL 4Z7OF 5KBNC 1ZGLM 1F3JA 5KS9B 3MTRA 3P0GB 3MMEA 5DQ9B 4GMSL 1NUGA 4JN1L 5I2IA 3MGAA 2MFNA 5JHDB 5F1KC 4CJ0A 2A83A 2OJZL 2P24B 4U3CA 4YJZL 3TPKA 2QSQA 3UTSE 1TJHH 2BOBB 5C0JA 4OLVH 4OCLC 1SYSA 1CQYA 3KYAA 1MCJA 3SDYH 4XCFH 1CDUA 2QR0A 3QFJD 4FQXD 4U1JA 4ONFL 3RDTC 3PP3H 2EDEA 4H26A 1G84A 1R3HB 3G5XB 5T3XH 5EIVA 4GKNB 3BKMH 1BP3B 1PAMA 4PJFB 4MJ6B 4LSQH 5D2LB 5CD5C 4M03A 3ARGB 3PWLB 1WC7B 1ES0B 2QL1A 4MD5B 1W72A 5EUOA 5AD0A 2R2BA 1RZJH 1MCBA 4GRLB 2JIXB 2H3NA 3SGDI 3VI4E 5F7KC 3C2SA 3QFJE 1O0VA 4NKMB 5KTEH 4F9PC 1LO3L 3NFPA 4KI5E 4LQ1A 3ROLB 3BPLB 1GGIL 3SE8H 1I3RB 3I02B 3X13A 3IDGB 1J1XH 2I9LB 1J9CT 4QRQB 4C57C 4LU5L 2XTLA 3GSRB 1YA5A 5FK9A 4D2NA 3IDGA 4NSKB 2NY3B 4PJ8C 4Y4HB 5A3IC 3VH8A 2OL3A 2F5AL 1NGQH 4QRRE 2F19H 4K07A 4KKCD 1IM9D 1R0AL 3F7RA 3L5IA 5IFAH 4M7KH 5C09A 4QXUL 1AO7D 4LRNH 4N0UE 2P43B 4PJ9A 1UACH 2XNAA 5J1TC 5JOFB 3TLRA 5BS0E 4D3CL 1A6AA 2YPVL 4MSWB 1NEZA 4P5TB 1I8IB 1QFUL 3DNKA 1ZLSH 2EYRB 3EHBC 3DVNA 5CGTA 3VRLF 4XNXH 4ALAL 4DOHE 4I0PA 3RWIB 1GPOL 2E6PA 3E6HA 4CVXB 3JTSA 4K9EH 5A43C 3B8YA 2OXHA 3TO4B 3MNWA 1NAKH 2GJJA 2I9LA 2R9HC 5GS1A 3DURA 4Y16D 5CMAA 3AROA 4D8PA 1CZ8L 2AJVH 1ZHNA 4YWGH 4NCC1 2ZUXA 3BQUD 1A6VL 5I8CB 4PJCB 2EH7H 2VAJA 5D1QC 5FKPB 3MNZA 4M1DL 1KB9K 1IGJA 2YEZB 5ICZA 2XTJB 4DWHA 2V6HA 4PJ7A 3RWHA 1IC4H 3KXFD 3HC3H 5TH2B 3B9KA 2ADJA 4G6AC 3DMMB 1JNLH 1SBSH 3RIAF 4Y1AE 3PL6A 5C0BB 1B4RA 3T1FB 1S9YB 3IJYB 2DIJA 1QO3A 1FGVH 1QTYT 1BEYH 2ZOKB 3CVHB 4JKKA 1A14H 3LPGA 3CFCH 3U9UB 3GGWB 1RMFL 3QJFB 3QULB 5JIKA 3EDDA 3OKOA 4BSVB 1BZQK 3N9GH 4JPVH 2VDMH 5FYJL 3CXHJ 4Z76A 1NCBL 4MMXC 5HD8D 4JQVC 4X4XB 1XFPA 2VZ1A 1HEZA 1IM3B 4S1SL 1ZGLP 4Q7DA 4PJAA 5EOCJ 3RNKB 1MJJB 1UQSA 1JYVA 1A0QH 3CZJA 1L7IL 5GHWH 4M7ZC 1EA9C 3GMRB 4NQVA 4YK4B 1YEKH 3K3QA 4X8JA 4L3AA 2X1WL 3MJ7A 3BPOC 3KDMB 2CMRL 2X4NA 5BVJA 5T33L 1UYWL 2RAMA 4JN2A 4IIQC 5IB1B 2HT4C 4OD3L 1IAOB 2OBGA 5DVOA 1U2CA 3W0WB 2HVKB 2KQMA 1QSFE 4Y4FA 4GG6A 1WWCA 2NX5D 3V0VA 1V3KA 5HYFA 3S3JA 5HYQA 4IDJL 5JA8B 1KCRH 5ICYB 5DVNA 3QUZB 2APBA 2C4FT 2GJ6D 3TH3T 4MQ7A 5DQDH 3IFOA 5HYSB 4PJFE 2H6PB 3GI9L 1OAUL 1WFUA 2E7HA 1MAKA 5J6GB 1T6VN 3UJJL 3FQTA 3I2CH 1Q0YH 2XKUA 3WN5A 3OKOB 4BSVA 4AT6B 4N9OB 4KPHH 1P6FA 3MRKB 1U6AL 2JKXA 1GZQA 2VLKB 1YEDA 2OL3H 3E6FA 2IAMD 1U8QA 3IDXL 1GH7A 2LTQB 3D48R 5DK2B 1ADQL 1WBYB 4QY8A 1TZHA 1QEWA 1HDMA 3LQZA 4ZQKB 3QO0B 2ORBL 2VIRA 2IFFL 3CFKB 4XRCB 3W9DB 1RZ7H 1G7LB 3MLWH 4NO2A 1BLNB 1IC1A 3NABH 4EVNB 1F4WL 2UYLA 4PLNC 1RJLA 1ETZB 4OLYL 3REVA 2DKUA 2BNRA 2R0LH 2EYTA 1NCWH 4GXVH 4OZIA 4XHJD 4JAMA 4OLXL 3ES6B 1NSNH 3U0PA 2DI9A 4F2MB 3GJFB 5JZ7C 2B1HL 1I9IL 35C8L 1ZVSA 1UVQA 2OTUB 3MJ9H 2VZTA 1EJOL 2VMFA 2YRPA 5IK3A 1S9KC 5DFTA 5IHZA 4G80A 2J1KA 4JZNB 1AQKL 1QZ1A 4IRSB 1XR9B 3DV4B 5IHBA 2Z4QA 1V3MA 2H32A 2ZCLL 1Q9WA 3EJZD 2XXMB 5EO1A 5FYJE 1TIUA 3REWB 2DDQL 2HG5B 2SEBB 3HZYA 5C08D 3RUGF 1ZLUK 1C7SA 4Q6IA 3GMNA 3QEUB 3V6ZB 4PJDE 4WI4A 5FUZH 4QXGH 5EO9B 4R4FL 1MCDA 2OX5A 2PW1B 3HG1A 3W11C 3AS3A 5J1SC 4PTTB 2NZ9C 4WW2C 3NMEA 2ATKB 2O5ZH 1MCSA 4RFNB 5D6DC 1LO5A 3L95B 5IQ7H 1ZHLB 3G6JF 2MQCA 2P5WA 1WZMA 3KYNA 1T5WB 4R4BB 3O3EA 1CK0H 1EEYA 2FATL 4NWTH 4KZDH 3H7LA 5L88H 3DETD 4P9MH 2EEAA 1I8IA 3L3DB 1QHOA 2N7BA 2C3HA 5EZJB 3T04D 3QRGH 1A6AB 1TETL 3VFGL 3RVUC 3PGCB 1YZZA 5CZXD 5DQJA 2OYPA 1HHHA 2QSVA 5DFWH 3VD5A 4MJ4A 5JR1H 2M26A 1K4DB 1VENA 4G42A 4ODWB 3ARGA 4LVEA 1M7IB 3CSPA 4OB5L 4ZUVA 3HLAB 4PRHB 1XH3A 2EDYA 1IKNA 1MH5B 1NC4B 1T1ZB 4OCXH 1TVDA 5HDBF 3JV6A 4MJIE 2VE6B 2CSPA 1T89A 5SWZB 3OKLA 4AEIL 3QIBA 1NC2D 3SE3C 2V17L 1QSFB 2GTZA 4XVJH 3GIZH 3C60D 5D5MB 1BWMA 4PJ7F 4ISVB 4YDVB 1QR4A 3O9WD 3RVWD 3QBTB 1JZ7A 4FHBD 1M7XA 1LE5B 1YMHA 3OMZA 4HZLB 4MAUL 3VW3L 3CSYA 3GM8A 5HPMA 2FHCA 5CILL 1MCRA 4HIIA 2UYLB 4G9FA 1HSBB 4TPRL 3WJJC 4O2FA 1P4IL 3X17A 1HXYB 4QHKJ 4FNLH 2NW3A 4A6YB 3HR5A 1MQKH 4DGVH 4NO0B 4YQXH 4MS8C 5J6HB 1JGEA 3C6SB 4WWKB 1ZLWH 1FLTX 4C54A 1SYVB 1T04B 5EBMA 1KCVH 2PR4H 4Y5XB 5SV4A 1BD2E 2W9DL 4NC2B 1B90A 4LSDA 3T8XB 2GK0B 4DVRL 1UWGH 1F2XK 3QWRA 4F33B 4AZ8A 1F3RB 1LP9E 4R9HA 4P99A 3ZSSA 2VLMD 1T1XB 1SY6A 3G5YB 5E2JA 1IC7L 1IQDA 4LCYB 1JGDA 4Z77A 1CGVA 3WFHA 2B7DT 1CDBA 5B39G 5GRXG 1ZT7B 3CXDL 4H0IA 1KIUA 3OL2A 4NQDE 2XTJE 3P4OA 3MGTA 2XY1A 3MLYH 4RWYL 4JM2D 3HMXA 5B8CB 3MXWL 1O7VA 2EDTA 3BKJH 3LN9A 4FABL 3QO1A 5ERWB 3OV6A 4NQCD 3IVKA 5I8KL 3QYCA 5F89B 2CXKA 4ZFZA 4JRXA 1MHPL 4Z0BH 4M43H 3DLQR 3OKEB 1F90H 2XOTA 5MI0B 1A64A 1YQVH 4LLQB 1FFOB 2F74B 1BQLL 2WV3A 3ARFD 3FB8A 5GSRA 3GIVB 3BQUC 3HRZA 1DVFA 3H9SD 3P73A 2A1WL 4GLRH 3C6LD 4QHMA 4P3DA 2DJSA 2J4WL 3L5JA 4X6EA 2AJUH 3T8XA 3B8SA 3MOAH 2VDLL 2EXWC 4O00A 1YN6A 4MXQC 4MJIB 1T2XA 3U4EB 3V52H 3AXLB 5FA4B 1H8NA 5IB3A 2ED9A 3OKDA 4I4WB 3UTZA 5SX4I 4C56A 5E94B 4NT6A 1ZV5A 3EOAA 4RX4A 5CINL 1XF3B 4Z7QF 1MPAH 1JGVL 1XMWA 5HI5D 4JRYD 3QCTL 1L0QA 1D5MA 4Y5VB 5LVEA 3ISWA 4MMZC 5BW7A 4N0CC 3DUSB 5K9KB 2ATPA 3GSNA 1D5XA 3I9GL 2CKBH 3QI9D 1KPUB 2C7UA 1S7UA 1IQWH 4NUJA 2WZPD 4N0FB 4Q9RH 3HKFA 1AD9B 1GGYA 1QSVA 1BQSA 5EO0A 3QFJB 4BFEA 3BHBA 3BMWA 3KG5A 2BJML 3MRGA 2EICA 4MNQE 4AM0A 4NP4H 2V5RA 3NVQA 3F65A 4OAWA 1P2CA 1ZVYA 5I6XB 2VQTA 3SY0A 5F44A 2WBJD 3O6FB 5D2LE 1Q1JH 1YEGL 4K3JL 2UZYB 1K8DA 5I1AB 4Y4FC 2VL5A 5CKAA 1ORQA 2X4RB 1A1OA 3BDXA 1G9NH 4ZFOA 2H2PC 3PJSA 5D1QA 5I66B 4KK9D 3PWVA 3FHQA 4JPWH 3WE6A 3WIHL 2FGWH 1CT8B 4XP5L 4NNPL 4JKPL 43CAB 4UUJB 1U93A 2E9JA 1V7NH 4X6DF 4FFWC 8FABA 3AM8A 3O3EB 4HPOH 4BKLA 4YBQD 4F58H 4KK5C 2AK4E 5HHVH 5DRZB 3FFDA 1CTNA 2ZP0T 3HTLX 5ETUB 1AFVL 4QOKD 1MWAB 1KJ3L 3PV6A 4AYFA 1T7WA 5F3HB 2XPGB 4Z6AT 5HHOB 4XBPB 1NGZB 1NFDF 1FV1A 4YGVA 4GAJL 3MYJB 4NQEA 1LDSA 2QKIA 4KTDL 2VITA 4M7LL 4NOFA 4XMKH 4ZXBD 3L3GA 3TGXA 2ADFH 5T3XE 3RWDB 3DETC 1U8KA 5GJSH 4OF8A 4DGIL 1HYSC 3DXAA 4NRYA 3RVUD 3BZFB 4OM1H 2HMID 4R8WH 2MKLC 3BKCL 3HZMA 4NZTL 1X4ZA 3CVHL 4HULB 1YEEL 1JPFB 1IT9L 5IBTH 1VADA 3D1MC 1C16B 1UCBH 3K74B 1UB5A 2QQKH 4DEPB 1HHJB 2XN9A 2FIKA 3BRDA 4YDIH 4J3VA 1WCBA 4LIQH 2Y6SC 3SJVA 4ZFFB 2CDGA 3BZEA 1X4YA 1FE8H 1B6DA 4XCEB 1EH9A 4DCQA 1WV7T 4M1CD 3WNLA 3BP5B 2V2XB 1UB6B 1MJUL 3QUYA 2HVJA 3E2HB 2VN4A 2J2ZA 1AH1A 1FO0A 3WFBH 3O0RH 4GMTH 4BZ1H 1NUFA 5EIIB 5KW9H 2N1KA 5C09D 4YBLB 3EJZC 5GGSA 1I9RL 1P4LB 4NO0A 1ETZA 1HI6A 3REVB 5JOPD 3M8OL 4KJWD 4HQQL 1NCCH 2W65B 3WKMH 3S97C 3DMMD 3WYRA 3BWAA 3FN3A 5BV7L 2UZXB 5ILTH 2P42B 5F1IB 1NCAH 5C0BD 2AKRA 4UOJA 3RGVD 1VEMA 3SKOA 1T03H 1MCOL 4M93B 5DR5L 2AJSL 2R4RL 1G6RL 3W0WE 3VRJB 5GGRY 1EMTL 3LV3B 1RK0A 1A4JB 2RJMA 2GK2A 3NCYS 3FFCD 1D6EA 3OQ3B 3LD8B 1N4XH 2VLLA 3ILQD 4JY4B 3O4LD 4WUUB 4R4NC 4K94C 1ZK9A 5DYOB 5EC2B 1SEQH 3RU8H 2XZAH 2HN7A 5K9OB 4PRNA 1OAXL 3VGGA 4F7CB 1F58H 4GRMA 2NTSP 4R97B 3L6FB 2EZ0C 1QVOB 1WISA 3QG6A 2CLZA 3WO3B 2X89D 2OJEA 3S6CA 4H88L 5D7IA 4PRPB 4ONOA 3PL6D 4F9PA 5ICYA 1S9WA 3LIZL 5KVMC 1MHCA 2E7BA 1LP9A 4FZ8L 4MDJA 4TSAH 5FYKD 4ETQB 1D3CA 1LDPL 1VFMA 2DQJL 4XBGA 1FORL 2O26U 1PFCA 4K2UH 4U1SB 4ORGB 1BQHA 4HIEA 4XB7A 3WUZA 1NAMA 3OR6A 4Y1AB 4PB9L 2PCPB 1E6JL 1ZSDB 1LEGB 4U3HA 2R8SH 1EAPB 1HQRB 3QXUA 4XVTL 3VA2C 3BWUC 4JHAH 1TVHB 3PQYA 4Y19A 3CDGB 5BZWB 1A4JA 1KXTB 3LHPH 2AQ2A 3QDJB 4ZS7L 3LN4A 2P8LB 2BXYA 3QEQE 4Y5YA 2NY0C 3P77A 4M5YL 3QWRD 1OGAA 1X5GA 3HS0B 4ODXB 5SV3A 3P2TA 4K94H 1OSPH 4M61A 4JFPB 4ZDHA 4OCRH 4UOW1 3IS1X 1K85A 4JGUA 4PJEB 2VLKD 3GMNB 3QEUA 4ONGL 3VI3E 2PN5A 4NKDA 1T7XA 4PJGF 3RVVC 2RHEA 4PD4K 3PABB 1FIEA 1WUNT 5JQ6L 3MRJB 4FXKA 3MA7B 3OAUH 4Y0GA 3IRZA 1XF2A 4Y89A 3CPLA 1BD2B 4LPVA 3O6LL 4LSTH 1UVQB 3B9KB 4M7LT 3ULVE 2XKNB 3T09A 4QRTA 4NZRH 2GIYA 1FZKA 4QKXB 3ALPA 5D9SA 1HH6A 3NA9H 4ZUUB 3G5VB 4S1QH 3ECBA 3BDYH 1UKQA 3MV7E 4MXVE 5CGYC 3U2SA 2CIIB 4ODWA 4JG1L 5JORB 4RISH 2P8LA 5ISZD 3U82B 1RI8A 2X44D 2CPCA 2RQ8A 2MCG1 1U58B 3FQUA 1J12A 4OZIF 1BX2A 1P5VA 4U6HB 5E95B 3WNKA 5JNYA 3HUJA 3HC0B 1J87A 1BQHG 4U1IB 1T1WA 4LSUL 1CDCA 4KKBC 2NXYD 3NCBB 3TA3C 1A3LL 3F7VA 3CMOH 2E9BA 5D5ME 5LCVL 5F6IB 3B2UD 2Y5EA 3V5DB 3E6FB 4OTXH 5E2TL 4OV5B 4KRPD 2Q87A 4G6ML 1F8TH 2XG5A 1KJMB 1WF5A 3CH1A 2QQLL 3RZCB 2IALA 2NY1C 1MLBB 3DX6A 3RUGA 3V8OA 3N06B 4M4PA 5L2KA 3RTQA 4QTIL 5E5UB 4FFWD 4HCRH 4KAQH 3QI9A 1K6QH 2EDBA 3L5WB 5EDXA 5IB5A 4FP8H 1T20A 5D7SH 1UM5L 3TVMB 3SDDD 1XCTA 5TE4H 3CU1A 3PWPD 2HRPL 5BXFB 3ALWA 3IAPA 1JK8B 2R0ZH 4MNGA 2PNDA 1B0GA 2Q1EA 2HT2D 2DKSA 1S9YA 1YNLL 1RZKL 1NFKA 1E28A 2BX5A 4G43A 4X4YA 3E1F1 1J8HD 3DX7A 4JZNA 3TP4A 4KHTH 4OAWB 4IMKA 1NGYA 1YY9C 3V2AR 5C7XH 4HWEH 1UCTA 2PXYA 5HHNB 4BQCA 4PGDA 4D0BB 2WBJA 3IDYC 3QAZC 1HYSD 1OLLA 1QSED 3VXNB 3WIFA 2C4FU 5E9DA 1BVKA 2R29L 4HBCL 3FO0H 1AGBB 4OCWH 3RL2B 1ZHNB 4NGHH 5F7EL 3RNKA 4XPAH 1ZMYA 4PS4H 4ZYKA 4MAYA 1JF1B 1S7VB 3BGMA 4H25A 5TE7L 1FQ9C 4UNUA 5FYLL 3LN5A 3UJTH 1YY8A 3TH4T 4NZUH 2DTMH 2BRQA 2XICA 3SPVA 1U92B 1BVLA 1CFQB 3VDCA 4JFEE 4XNUL 3DVGB 3HE6C 4U6YA 1PJ9A 3RTQD 3VWKB 2GSIA 2BNQB 1IAIM 4JR9H 4RRPA 4XI5C 5MEQB 2Z9TA 3SQBA 4H0HB 1TXKA 5KVFH 3B5GA 3PF2A 5JOEA 3MRIB 1C12B 2DLTA 2DQIH 5DURB 3KLAB 4FQJL 2FLBT 3MJ6A 4XT1C 4CW1A 3WIIL 3GMOB 3X11B 1W72H 3MR9B 4FQ2L 3L3GB 3CDYA 3L9RA 4UTAL 3IETB 5LGHL 5EORH 3HUJF 3O4OB 1RHHA 4OF3A 3UZQA 1QPXA 2AJYL 3HI6H 1GHFL 2CJUH 4YHMH 3HC4L 2R1YA 5DWUL 4YXHH 2HWZH 1S7WA 2EE3A 3MLRH 1SJHB 5CJBA 1BJ1H 4YHOH 1HN1A 2AEQL 4OZGA 5FGCB 2R0WL 3E3QC 3V6OE 1MF2L 1QRKA 1X5YA 3G08B 3IFNL 3VXSB 43C9B 4G9FD 1ORSA 4WW1B 5A2JH 1P4LA 3VGBA 5F9OH 4YHZH 1N3NB 4I18B 4DGYL 4CN1A 3UX9B 3EKCA 2CK2A 3ULUF 2XKSA 1OB1B 1MJ8H 1HHKA 1RZGB 1MEXH 1ZLVK 3AUVA 2NY5H 4HMDA 3MCLL 1N6VA 1MI5B 1BOGB 4MQXD 3RX5A 1U8HA 2J8UE 5HGBA 4M6OL 4EI6B 1P5UA 4UT9H 1AXTL 2ADGA 3MLXL 1SBBA 2CO7B 3TNNA 1JZ8A 2BSRB 3LOWA 2I9TB 3O6MH 3ZYZA 2IH3A 4PJ8B 4Y4HC 3ZE2E 4G9DA 1JFQH 1MCQA 1OAQL 4TQEL 1I1AC 4PRID 1OTUC 1JHKH 5C0GB 2IH1B 3C5ZA 3D69A 5H2BA 1IGJB 2E7CA 3C2AL 4X6CE 1QYGL 5DD5H 2H1PL 1DL7L 3QNYB 1EUTA 4ZOAA 3MV9B 2Y07L 1ZHKA 4LLUB 4GAFB 3WS6A 4MJ2A 2G9HA 3MJ8B 1E6OH 1Q0XL 1NGZA 4EQ3A 4WWID 3AU1B 2W0FA 2XYCA 1B0RA 3LCYA 5DJXB 4NNXB 3VXRB 4F7EA 3WNMA 2KPNA 4ODSH 5T1MB 5F96L 4P2RA 2APWA 3P4NA 1DFBH 1FDLH 1JZ4A 5C0BE 4PYGA 4JPKH 5C3TA 2NY5C 5CGYD 2A9NH 5DZLA 1MNUL 4JB9H 3OJVC 1PLGL 5DK0A 3LKQA 3RGHA 4OFPA 4PJEE 5KJRH 4QCIB 2IF7A 2YPLE 3MLTA 1QLEL 3CFJB 4JRYA 1TTUA 2VRAA 5F7HA 1NGXB 5F1NA 4P9HC 4X6CF 2AVGA 4UV4H 4GAYA 2F5BH 2FO1A 3BXNB 3QDJE 4JHZA 3VWJD 1CXFA 1GC1C 3OGCB 5EWIH 2IADB 4YUEL 1LMKA 4TRPL 2A74A 3MACH 1Z9SA 5JHLH 4ZUUA 1MFBH 2Q8BH 5J7CC 3QG7L 2NW2A 1DBAH 2A77H 4XNMA 4X7EC 3TJEL 3DUHA 2PXYD 4N0UB 4LSRH 4GRLA 1WWBX 1Q72H 3GK8H 1AE6H 3PWLA 5T1DL 4XC1L 3FN0L 3A67H 4JQIL 3STLA 3EO9H 4QRPB 3DO3A 4K3DL 4U1KA 2P8PA 3NCYP 1E27B 3U83A 5LQBH 3HAEB 3SY0B 4WWKC 1AQDA 3ZT6A 5HXMA 1XGRA 1EX0A 1CD1A 4ZFFA 2WLZA 4HF5L 1AR2A 3IDIA 4WUUE 4JFQB 4I3SH 1Q8MA 3GKWH 4WCYL 1XGTB 3KPTA 3RHWF 4AEEA 4G9DB 2ICCA 1RJLB 3BFOA 5DA0B 1EEZA 4L8DA 3I6KA 3PWPE 3WCYA 3GBNH 5IMMA 5L6YL 4TUOB 2P5ED 5DO2D 5IJVA 4UT7L 4N5ED 2BY0A 3T4YB 2WSKA 4XNQA 4EOWH 3H3BC 4HF5H 1NFIB 2ESVD 2GCYB 3AVEA 3MLUH 1WEJL 1BQHB 4LCIH 1PG7X 2JELL 2X9XA 3FO9B 4YGVB 3NPSC 5DUMH 4XBPA 4J12A 3G9VA 3DROB 2V2WB 3ARBB 1YJDH 1GVIA 1OF2B 4QHUA 4JFEA 2EDLA 4XCNA 3F58L 4WDIA 3OJDA 4YR6B 3FQTB 1CD9B 3UTSB 3DRTA 3S35X 4JFPA 4RFEB 4CU8A 3I85A 1M71A 5D70L 4RMVA 5BVPH 2IAMA 4HS3B 3SKNA 4UILL 1LEIB 1SM3H 4ZNEA 3BUTA 4F33A 4KJYB 3QG7H 4G8IA 4H8WL 4L5FH 4HMCA 1PD6A 1XGPB 4OD2B 5I66A 3THMH 2H2SC 3IXTA 5DVKA 2JF1A 4W4OC 2HFFB 2HVKA 4CADA 3QHFL 5BS0D 3T0EC 3X14B 4RGNB 4I3GA 4Q0XH 1OAKL 2C26A 2EH8L 2XZQH 2JCCF 3QCUH 5GGVH 1ZHBB 4OJFL 4PRPD 1QBLL 3EUUA 5D2NA 1NL0L 3BZ4B 5L8LB 4L3CA 3TWCL 3GSOB 4ODHL 3PDGA 3MRPB 4KJPD 5E08L 4AM0B 1CIUA 4Y5VC 5C92A 3KLAA 4TNWF 5D5MF 1HSAA 4PD4J 1VESA 5EZLB 2VDNL 3Q6FB 1Q9WB 1XGUB 1HH6B 1F4XH 1WFTA 3KR3L 5JXEA 3TYGL 3BMVA 5JO5A 1YJDC 4NFBA 4P59H 1FPTL 4L9DA 3TO4D 3LS4H 4DZ8A 3AREA 1N64H 2VE6A 3JWDL 4BH8A 2FIRT 2Y06H 1F97A 4N8VB 4Y16B 2GEEA 1A47A 3WDIA 3UTTA 1D6EB 3G6AA 4WI8A 4EZMA 1BHGA 1FJ1B 1QD0A 4TSBL 2OMBA 3MNVA 3J8F7 5T1LB 2Q3ZA 1IC5H 3LEXA 1IEAA 2VZ3A 4U2YA 5EULV 4PJ7B 1FRGL 4ZAKD 5C07B 3ZYIA 4L4TB 2IEPA 1FC1A 4IEFB 1G7LA 2DM7A 3BEVA 4MNQB 3BZ4A 4JY5H 4RGOH 5C07A 4NM4L 1JHKL 2E9IA 5EIIA 3H0TA 3P9MA 1CIDA 4QGTA 1UZ8B 5LBSL 5GS0L 3QUKB 4LLQA 3O6ML 1BD2D 2FO4A 2YA2A 3W82A 1T2QH 1X5HA 3D9AH 4P4KD 3QUZC 1XCTB 4AT6A 1GZPA 4DZ8B 3PWUA 4HUNB 3K2UH 2IPKA 4OI9A 5J89A 1RUQL 3BYYA 3ESVF 1D5ZA 1CGUA 2YHGA 1CDGA 2DLEA 2B1AL 3P0VL 1N7ML 5LXGL 4JGMA 3QJHB 3EGSB 4F8QA 3P11H 1IAMA 3LEVL 3QISA 3DHMA 4FTVB 5GGQH 3VCLA 1CR9H 2QV2A 1XF4A 3OZ9H 1VACA 2BNQA 5AWNH 4JN2B 4I5BB 5GGTL 3V7MA 3SJVD 4I3RL 4QRQA 4G6JH 5F7NC 4NKOB 5DD1L 1MWAA 1JZ5A 4M1GL 4MQXC 1WAAE 3GSQA 1FZOB 4AIXA 4NDMB 3C6SA 4JRXD 1R24A 3D2UB 5DHYB 3CLFH 5GZOD 1OARL 3BO8A 4O4YH 5D71H 4NKIH 4AG4L 5FCUH 4MXWH 1MJ7H 1RZIA 3S36H 3UYPA 1A7PH 2UVEA 4A6YA 1F13A 2HLAB 2ZJSL 2PW2A 1WLHA 3WFCL 1Z3GL 1QOKA 4OI7A 1A7NL 4JFOA 1U8IB 1A1OB 1LK2B 5IHLB 3BRGC 5IUSA 4DKFL 1UWXK 4EUPH 1IGML 5MEPA 1QFWH 1CE6B 5J1AB 5F9DC 3IXAB 3WJJA 1JHLL 2V2TA 2GYSA 2J6EH 4YHYC 3O2DL 1HHJA 5IJKC 3BD5A 3ZSTA 1A7NH 4QHLA 3BD4A 3U30B 3HPLA 1HQ4B 4PRIE 2FJFB 3VDAA 5KS9A 4NZUL 3MNZB 1UKTA 4X6DE 1JYWA 3VFMA 4MX7A 3FO1A 2DQHL 4PJGB 3RHWK 5CSZB 3DX6B 1OT2A 3MV9E 4MXWL 2ZCKL 4XPAL 2VXSL 2XFXB 3HE7C 3QT2A 5D71L 1I1AB 2C1PA 4HGWB 5BQ7B 1HOCA 2Q76B 32C2A 2R29H 5ABDE 2DWEA 4X6CB 4HIXL 2GTWB 1INDH 3U6RA 2D0HA 3A0OA 1V05A 1GOHA 2MCPL 4HJ0D 4R0LC 1L6XA 1NGPH 2AV7B 5CHNA 1CI5A 1BFVH 1CXHA 2EDOA 5I74C 4YBLC 3RWEB 3T3PF 5C0RH 4JKLA 1ITCA 1ZANH 4OKDA 3QAZB 5DJZB 5FHBH 3PHOA 3V6FA 1I1RA 4JFDD 5B39B 5EA0H 3WDJA 5DK0B 1L7TL 1ZLVH 5T5FL 1YECH 2V9RA 4GS7B 5L7XL 1URLA 3P11L 4LDEB 3RWFB 5BS0A 4PG9B 1VKXB 1D5IL 3P0VH 3GB7B 3TH2T 1FIGH 4AENA 4TUKL 1TDQA 1HYRC 4QTIH 2EXYC 1KT2B 1MLCA 1R3LA 3TN0A 3ZE0F 4TTDD 2R1YB 1DBKL 1UXSA 1MIML 2UWEB 2ARJB 4G3YH 3V0WL 1BWWA 1G6RB 4OGAC 5GGRA 5C0AD 4OFYD 5GRZA 5ESVA 3ME0A 3IJSA 2ZOKA 3V0VB 5FOJA 3AMLA 4M62L 3NTCL 1S5IL 4KQ3L 5K59F 5EU7E 3VXSD 1A02N 4EI5A 5EU3A 1S3KL 5GPRA 1JWUA 2IBZX 3EYQD 2DQEL 2PTTB 2Z35A 3KYKH 4P2QE 5LJYH 4XCCL 5E8NB 4RGOL 1C12A 3BWAB 4H1LB 3MUY1 5CSGA 2JK5B 4FQCH 3QEQA 1F42A 4XHJC 1MJJA 2AQ3A 5JW3H 5DI8A 1U3HA 1B3JA 3AAZB 4U7KA 4X6BA 1IJ9A 2H8PB 5CLTA 4F3FA 1CBVH 1NAMH 3CJJA 5ADPL 5BZDB 1NC2B 4X8XA 1C5CL 4FQLL 1BZ9B 4G6KL 3RPKA 5ESAB 4Q2ZA 1JGLL 3UBXB 4L9LC 2RGSA 1BQUA 3O9WB 3O2DH 5E5MA 5TDPA 1XGQA 1Y0LA 4RMSA 2H41A 5JHDA 1JTOA 4MAYB 5HY9B 4JCMA 5KAQF 4YH6A 4R26L 3E8UL 3M07A 4R7DA 5TF1L 3SBWC 2BNQE 4JDTH 4U3XA 3C5ZC 1W8NA 4ELMF 1GSMA 3MV9D 1F5WA 4QHNB 1S7TA 3HZVA 3PGDA 4NO0D 5DRXA 1REIA 2Q8AH 1KB9J 3JV0A 1KXQE 4G8GB 1T5WA 2YWYA 1OSPL 1OTSD 5HYJE 12E8H 5DT1L 1A9EA 5IM7B 3SDCD 4DFIA 5L8JB 1FN4A 4IMLB 4MQTB 3QCUL 25C8L 1TZGH 4ZPTB 1J18A 2AQ1A 4TVPD 4LCWD 4DUXA 1DE4B 4JFFE 3MRQB 3IYLW 4YHPA 1RU9L 2VLME 3V4PH 4NC1C 2YXMA 4H8WH 3FQNA 1JPTL 2SEBA 5CZXC 43CAA 1OAZH 4XPBL 1WCQA 1G7JA 4JM2B 3AY4C 5T1KA 4LCYA 4OV5A 1NMBL 4ZAKA 4X6FA 3QCVH 4OCMC 2C4XA 1PG7W 2VWEE 2NY2B 2B1AH 3OXSA 4M8QA 1RJZA 3S96B 4U1GC 2NYYC 3RQ3A 4MLIA 5I16B 1SQ2N 5KSVB 2N4IA 4LEXH 5B4MC 5D96C 3QXWA 2J6EA 5INDB 2EIZA 3KPMB 4POZC 1QNZH 4LAQH 4UU9B 2FH8A 4YHKL 1IGTA 2C1PB 4HGWA 2EDXA 4XAWL 1QO3B 3QNXA 3I75B 3H9SB 1VPOL 5GZOC 3ECBB 1KTLA 1WBXB 3WL9B 5F7YC 3IFLH 1H0DA 4ONHB 2FX7H 4RRPG 3ORJA 3RIFF 5JXAH 5DRWB 3HNVL 5HHNA 1XGYH 2XZCH 1PX3A 1HHIA 2V5SA 3REWA 4NPYA 5DJ6B 4YAQA 2D0GA 4S1RH 3BUYA 5E4IA 4KK6D 4WY7H 4HFUL 1GAFL 1YEDB 1BFOB 1XF3A 1U3JA 1X6NA 4BZYA 5E2WH 4LEXL 1JF6A 1N5YL 1J0HA 3MODL 3EZ8A 5IQ9B 2ERJC 4JM4H 1TCRA 1PX4A 1JRHH 3VFWA 4XH2A 1LO4H 3QI9B 1BF8A 5DRZA 4KKLC 3D6GA 4F2MA 5I15L 4MA3A 1IGYA 1MLBA 1N59B 3QIUD 3TJEH 1HSAB 1QRNB 4IS6B 3H42L 1DQDH 4ZSOA 2BNUA 4XVUC 1FFOA 1YEEH 5FUCC 1VHPA 3T2NH 4E5XB 1MCNA 4KKAD 1CLZL 3NOIA 4QT5A 2B8OT 5JPNA 2WBJB 4ZTPL 1NJ9A 3EYSH 5E08H 1NBVH 4HW6A 4JVWA 4WFFD 5CJXC 5IOPA 3H6JA 2ITCB 1FAIH 2R69L 1P2CB 4HUWB 1EZVY 3HB3D 1C1EL 5ADOH 1DQQB 3H3PH 3JZ7A 2WIMA 1QLEH 4NRZA 3QJHA 4FMKA 4KK8C 4A2LA 4HKJB 3L3OB 2KZ1B 4HZAA 4UT6H 3TN0B 5HHQB 5CBEA 5ESQB 3N1FC 1ZT7A 3LZFL 4DOHB 3QPXH 1JGDB 3RUGB 1DQDL 4QHLB 5JIPA 1D5XB 2EXYD 4RMQA 4QOKB 4QHNA 4I77L 5F9AC 1FCCA 5IV2A 5HHOD 4MGXA 4U1LA 2FHFA 1I4FB 1V3LA 1DQJA 2FR4B 1R3JB 4P4RB 3BKYL 2YK1H 3RJQB 3DYMA 3P0YH 2BSTB 3D0LB 1IE5A 4N9GB 1R3HA 3G5XA 3ZTJH 4CN6A 4MNHB 1KOAA 1MRFH 2BY2A 5F8RC 5T5NF 4HFUH 1CD8A 4XP6L 3W9EA 5F6IC 5EU4A 4FQCL 4UI2A 3CX5K 4YPGB 2HLAA 1OGAB 3DIFA 4L4JA 3GMQA 1LQSR 1WAAF 1NANH 4Y4KA 1BJMA 4L3ED 2GJZA 4FFZH 3RDTA 5CJ5A 3HE7D 1IQWL 1CDHA 2PYFB 4Y2DA 4CMMB 4LLWB 3MPCA 2J12B 2G2RA 2DM4A 5E6IB 3RVTD 3DTXA 5DGRA 2XN9B 3T65B 3QXDB 3TIDA 3F62A 4PRAB 3IVKB 4KI5C 3DVFA 3BP6B 2D7TL 3N1PC 4K3DH 5IV2B 4KK9C 4JQIH 4P23C 5EBWB 3S34H 5MENB 2NX5E 1S7QA 5GIRB 1DTUA