1DBKL

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL01
3SOBL 3BJ91 2AI0L 2AV1A 2ICWA 2UWEE 1CXLA 4GRWE 2F8XC 4IRSB 3QULA 3WCYA 1IGJA 4LCWD 2XN9E 5T33L 3KR3H 5M7QA 3TESA 2IAMD 5AEAA 1RMFH 3VXRE 1MHHB 5IB5A 3BUYA 4UU9A 3HNTH 4CDGC 5ANME 5CFHA 2H9GA 4D9QE 1OAZL 2FHBA 5GS1A 1L0XA 3LV3B 3VXSB 3MRIA 2HT2C 3LKOB 3BRDA 3TBYA 1RURL 5FK9B 5DUML 4KTEL 4ZAKD 2FX9H 3EO1A 1UXWA 3QIUA 3BDYH 4ZPTA 4JO4L 5SWQB 1VACA 5T1KD 2BSTB 1U42A 5HJ3B 3H9SB 1ZS8B 2YSSA 2QSCH 3ARDB 1I8KA 3Q5OA 1AHWB 1QSZA 3OKMA 4XNYL 1X5XA 4YGVA 1Y6MR 1HKLL 1CU4L 4KUCF 2Z91A 2KUTA 3DUSB 1JRHL 1U3HC 3HE7B 3SDDA 5CGMA 3IKCB 2ITDA 3X12B 5DD5L 4GJTB 3NTCL 4PRBB 4XVTL 1A6AA 3STBA 3ZKXC 5F9JB 3GZKA 3K7UA 3QEQB 3HAEH 4PRPA 1BFVH 2DLHA 5DUBA 3V4UH 4YXHH 4JHAL 3FO2B 1S7WA 4XCCH 3WD5H 4PGBB 5B39A 1OW0C 3E8UH 5JXEA 4NQCA 1CGSL 3DETD 1DQQA 1H9VA 5F3HB 5KVGH 4F37K 3O6LL 1BEYH 4ODXA 4NO0D 4PRPD 5DD0L 5EFIB 4GXVL 4L3EE 5F7WC 3SCMA 1DBAL 4X6EB 3SDXA 5I19L 4GOSA 2RBLA 3SE8H 4ALAH 3ULUH 5CIPH 5I1JL 4L3ED 3PDOA 4GG6F 1FFPB 2DLEA 1L6ZA 2V2TA 2ARJA 2HTKD 1F8TL 3RP1A 3FO1A 1KFAH 3D85D 1V5JA 3LKNA 1FNGA 1RPQA 3FFCA 4CRPA 2YPLA 1FFOB 3EFFA 3P4LA 3DROA 4K3JH 4MNHA 5IEHA 4JFYA 4OKVA 2X4QA 3LZFL 1UB6B 1TJHH 4Z78A 5K9KB 1MFCH 4W4NA 2DWDA 1S3KL 3MZGB 4S1DD 5AG9A 2FD6H 5FHAL 5E24E 1YEHL 1KJ2A 2AW2A 5HHVL 1D9KB 4PJAF 3SKMA 1YZZA 3W9EB 4UTAH 3EUUA 3W0WA 2H8PB 5IESL 5HYSA 3NPZB 2X4SA 2FX8H 5E2VH 1QSFB 3WFCL 2VXUL 1H5BC 5D70H 4PGCB 3CSGA 4Y16B 4IS6A 3QEGH 3SY0B 2X4UB 4TYUA 1R3JA 2OR8A 5EBWA 2FHCA 3TH2T 4LRIA 4DKDC 3HCVB 1S7SB 4Q58C 1X5JA 1S9VB 1D6EB 1RZKL 3MYJA 3PQYE 3TIDA 5E2TL 5C6PB 5I1IL 4LQFH 3S96A 1WBYA 4ZNCD 4P23A 4NP4L 2ZSWB 2HFEB 1J0KA 5A3ID 4TPRL 1BJMA 3O11A 2Z4QB 4YQXL 3VGAC 4NYLB 5DD3H 4QRPB 1I9IH 1GHFL 3ILQC 5ESAA 4D9QD 3MV8A 5HGAA 5E5MA 5JXED 2NY6C 2DICA 3RWGB 5D7IE 1IMHC 2FATL 4NM8L 3QH3B 4FRWA 4OGYL 2AV7B 4HAFA 2YRPA 1HH6B 2DM2A 1RUAL 3W39B 2J5LC 2CMRL 3UP1A 2QHRH 4FQ2L 4HK3N 4QTIL 1RZGB 3BUTA 4JFFD 1JK8B 4TRPL 5H37G 1MCEA 4P2QE 4TVPE 5BMFH 4XC3H 1IFHL 3GSRB 4Y4HB 1PAMA 3TH3T 4RMVA 1WITA 3NIFE 3HC0B 4LK4A 1QRNE 4HS6B 2X9YA 2RFXA 1OSPL 1RZFH 2ZUUA 5DK2B 1DQTA 2PTUA 4FOMA 3OMZA 2I07B 3BD5A 5I17A 3SE8L 3ULUL 1I7RA 3CH1B 2IJ0C 3QUXD 4L8DA 4MA7L 5SV3A 5KSBA 4R4FL 3MUGB 3A6BL 3IRPX 3ALPA 2HT3C 2E27H 5ITBH 2PW1A 4HIXL 1MFAH 2JB6B 3DV6A 1N8ZB 3KPSE 4JO4H 5F88B 3HC3L 1G0XA 3RDTC 4FQXA 3MRMA 3V2AR 3W9DA 1I75A 4LNRB 1ZHBB 3W82A 2R0WH 1CD1B 1K2DA 1NUGA 4ZUWA 1JGEB 1ITCA 1G1CA 1BD2D 2WV3A 4WGWB 3CDYA 3GSVA 2WBJA 3C6LB 1JNLL 4HIHB 4L8SA 3EYFB 4U31A 1S5IL 4JO1H 4X8XA 1SMOA 2A6JA 4I18B 3QZWA 3O3DA 5K9JL 2Y7QA 1I4FA 3QDJE 4RDQF 5F9AC 1DQMH 3T3ME 3EYVB 5KJRL 3U6RB 3MGTB 3X3FH 3UZVB 4GLRI 1MCLA 4OZ4B 3TM6A 5KS9B 4PJIF 2FX9L 4Y7MA 2CKBB 4KGJA 4ODTH 5EU6A 2BY3A 4LP4A 1BBJB 3KYKH 5D9SB 3A67L 1YEJH 3DURA 1X5AA 3T4AA 3NGBB 3QIBB 1QSED 3L3JB 3QHZL 3OKEA 3D2UA 3HE6C 2ICEA 4NFBA 4I13B 1F3JB 3CFCL 3FMGH 3MXVH 3AXLA 5IJKC 4M7ZC 2EKSA 3T3PE 2X41A 1SBSL 1I9RH 4MJIB 4S1QL 4HUVA 4Y2OA 2PXYC 2IQAA 4LAQL 3U36A 5EOQH 3VMPA 4WUKH 3LD8C 4JFEA 2XTJD 4OSUH 4P57B 2PW2B 1LO2H 3D0LB 5FUZL 4QYOB 4DTGH 2P43B 4DKFL 1JK8A 3W2DL 4XNMA 5AG8A 4D0BB 5IMMB 4FXLA 5F7LB 4LSVH 1AGEA 4JM4H 4ZSOB 4DFHA 2UWEB 2OS7A 2IANB 4HIJB 4PJFE 2DB8A 4ZO8A 4X98A 5ESAB 3PGFL 4WW2A 3FRUA 3MRPB 5F1OB 3VD4A 4TVPD 3CAFA 2NY3C 3Q0HA 1AQDB 2WNGA 4FABH 1Z9MA 4OGZA 8FABA 4NRXA 2V9QA 2Q20A 4U1NA 4IRSC 3P73A 4S2SB 3KPRA 1C7TA 3SE3A 3L3KB 1GGBL 4UILL 1FZKA 1WICA 3UMTA 2BFVL 4HAGA 4WV1C 1MFCL 3MRLB 1A3QA 5K9QI 3ARGB 1X5YA 1W0WA 2W0FB 4OB5L 5F93C 1NJ9A 4HCRH 4P0DA 4Q6IC 3A6CL 2EYRA 4NKOB 5ICZA 1U8NB 2DWEB 1GGCL 3CFEA 3UTTE 1ZEAL 4NZRH 4ZS7L 2OYPA 5LGKA 1A7QH 4APQC 1F58H 5SX5H 1BZ9A 4CGTA 1EZVX 1OM3H 3U1SH 4ALAL 3WXVL 4WWID 4X7SH 4GAGH 4JN1L 3D9AL 3NBNA 4PPTA 4BSJA 5SWSE 5TJWK 4JKPH 2VDPH 3WEXA 2CK0H 4P5KB 2CK0L 3VG9C 4J4PD 1YEDB 4G8GE 3QWOB 1W0VA 5TPWH 3LMJH 4G8FA 3DX7A 1BZ7B 1AFVH 5HYJB 4NDMA 1DQQB 5B3JE 2LE9A 4KVCH 2X1PA 4PJEA 3KWWA 5E8EA 4X99A 4WWKA 3U7WL 1RVFL 1MCCA 2P8MA 2XTJC 5C0NC 4L5FL 3VI3E 2X09A 5FKAA 1R3HB 2NZ9D 3MCLH 5ILTL 4EN3A 4BSVB 3O6FC 1LK2B 1U58A 1MY7A 3LN5A 2JKXA 2VLMD 4BSWA 2G2RB 4HFUL 3L6FA 4X6DB 4I3SH 4MCZB 4GMSH 5FGBA 4PJ9C 5IMMA 4D9LL 5K59E 1W8OA 3FB7A 1UKQA 4WENB 3BKML 4EN3D 2CUHA 3T65B 1RIVH 4LLQB 1MY5A 2PCPA 2KH2B 2DQCL 1VSCA 4B41A 5HBBA 5DQ9A 2HJLB 1FYTB 4G80B 3IDNA 3BGFC 3PP3K 2H26A 3SKNB 3IDYB 1MJJA 3OQ3B 1CG9A 3RNQA 4LU5H 4PYGA 1KCUL 4IRJA 1KCUH 4ELKB 1I8MA 2VZSA 4P99A 3IDGB 1GYAA 4M7KH 3CSYB 1VERA 3CXHJ 3VXMA 2RIKA 5DGQA 2GKIA 4FFVD 2XV6B 1OCWH 5A16A 1P1ZA 4BKLA 5IIEA 2QHLA 4PJFB 4GW1B 4NFCA 4OFIA 2R1WB 3O8XD 2Y07H 4LLWA 5L9DL 2XWBA 4ZOEA 4Z77A 1GVIA 1MH5B 1TMCB 4HFUH 2VXSH 4OFVA 1CICD 4AZ8A 1KCRH 4NQCD 2XWJA 4OUUB 5EU7E 5DYOB 1BQUA 2CJUL 3BYYA 1V3KA 3L5XL 5DURD 2F54B 2WINB 1JF5A 2V7NA 3IAPA 4JAMB 4OM1L 2H6PA 5GIRB 4EI5B 5FYKL 4FQ1L 2CDEA 1KJVB 3I6LE 3QWOA 5FYLD 1SVCP 4GRLD 4M8VA 4BFGA 1U8NA 5D1ZA 1B3JA 2HMIC 3LAFA 3OG4B 3D3VB 2Z93B 1R24A 2VB5A 1FP5A 5MEPB 1NKOA 1QFOA 4X99B 4ZAKA 3RKDC 4NQED 2DQFB 3L95A 1A0QH 2M2DA 4MXQC 1G7JA 3RWCA 1ZT4A 2IBZY 5HYEA 4V1DA 3UYRL 1IKFL 1KEML 1W0VB 1OAUH 5JOFA 1RIHH 2Q76B 4WFFE 4X0KA 3GMLB 5HXMA 1GGCH 4YDVA 2NLJA 4ODTL 4D9RD 4HDIB 3DV4B 1X7QA 3O45A 4V2CB 4L9DA 2R56L 1P84K 5ADOL 4QHNB 3RWJB 4WNQB 4AL8H 1KSRA 1TCRA 3LKSB 4NNYB 2XTJB 1ZHKA 1F45A 4XXDA 1ZA3B 4OZGF 3RUGB 4RGMC 1EEYB 5FA3A 5C8JA 4KZEL 3QFDB 1NBYB 1M6OB 4F8QA 4XVSH 3EO0A 5CD3B 4XVJL 1I1FA 4GXUM 3AREA 5FOBB 4DOHB 5FUOH 5CGYC 1KULA 1QUNA 2WIIA 1P6FA 2PNDA 1BWWA 1KIPB 2QR0B 1FVDB 4KUCD 5ANMA 3J7HA 4I5BB 2NTSP 3BESR 5L8LB 5IB2A 5HHME 5I1AA 2DQGL 4BQ8A 4EZMA 4FQXD 4M6NL 1LILA 3VI4E 4H1LB 3DARA 3AXLB 4HKJB 3LN4B 5IEKA 2Y07L 3SOBH 4J3UA 4JZOB 2ERJC 2FYYB 3BO8B 1G6VK 4OF5A 4NHCH 1DVFD 4CVXA 3E2HC 4U1JB 1MHHA 4PJCF 1BLNA 5IMOA 4XPAH 2X89A 2DIBA 2YPLD 3VA6A 4DVRL 1VGKA 4LSSL 3KXFD 1A6UH 1Q9WB 5ICXB 3DURB 5T5FH 4LLYB 1CF8H 4KDTC 4JQIL 4HQQH 5JW5A 3IJHB 4M8QB 4CL7A 4HZAA 4S1RH 4PREA 3BIKB 1OWRM 3HMXH 3TT1L 1J5OH 1NQBA 2XN9B 4AG4H 2IALB 4BFIB 1JGVL 3NCMA 3PGCA 4PJ5A 3CSYA 4JFFB 3VFRA 1UYWH 5CUSH 3S97C 1QQDB 2OI9B 3PQYB 1EX0A 4I4WB 4OLWL 1QSVA 4PY8I 4X7EC 1G9NH 1HI6A 1P4BH 4KQ4L 3MFGB 2LFGA 2EEAA 1ODAA 1V7MH 2MFNA 5FB8B 2BNUB 4RISH 3F7RA 1N8ZA 5L2JB 3MLWH 1MHCB 5IFJB 3G5XA 1I7TB 3MRBA 3MNVB 3CVIL 4H0IA 4H88L 5EUOE 4ZUUA 1VGEL 5C0AA 1JUFB 5F88A 3MGTA 1N5AA 4N5UA 3VMNA 3EFDL 1FIGH 4NQSA 3T2NL 3OPZH 1YMHA 1J1OH 3OB0H 2Q7NA 1RUKL 1UM5L 2XRAH 2FH6A 5LCVL 4Y16C 3V4PH 3BQUB 3SDDB 4KWUA 1XR9A 1G7HA 1XR8A 2HKFH 4LASH 3GSVB 1PQZA 1NSNL 2ZUSA 4L4VE 3P9MA 4PJIB 3C2SA 3MOAH 4BA8A 12E8L 1YEFH 1FO0A 1NLBL 4X6DE 5SWSA 5GGVH 4KJPD 1KC5H 3OX8A 4FQXC 2VIRB 1IQWL 4OZFH 1IT9H 2UY6A 2XTJE 3A0OA 4HWZB 5EBMB 4LIQL 2C1OB 2CDGB 1ORQB 4NQDD 5FM4A 1CLYL 2B4CH 4RZCA 4OZIB 1VPOH 3PP4H 5E8NA 4GKZB 3TH4T 4BQBA 1OAKH 1P4LB 3LKQB 4LLDA 4IHOB 5H37H 1TNMA 3TF7C 4HKZA 5F7MC 2EECA 4HUKB 2G75A 1RURH 4CU7A 4NQVA 3ORJA 1LEIB 1TJIH 4UT9L 4JFOA 1QSEB 4JFQA 5IQ9B 1BIIB 4OF6A 4OGAD 3IDIB 4P2OD 4M6MH 5DD3L 3FTGA 5C1MB 3EGSA 3LB6C 3T0EB 2ZG3A 4UQ3B 3QO1A 4K3GA 3W0WB 4Y4FC 4JHBA 4MA3B 4ZOBA 4Q2ZB 4UNVA 3MLTB 3N85L 2NY1D 1OARH 2OP4H 2A2QT 3C87A 5E7BA 3SDDD 2AEPH 1FFQA 3K2UH 4Y88A 4NZUH 4OCYL 4GW4A 4TUOA 5EIVA 4KMQA 3OAUL 3D48R 1MI5D 1UYWL 5CUSL 5FEBA 5HYSB 4KZDL 2HJFB 5ANMB 4RMTA 3QCTH 3VFOA 4JFHE 1IGYB 1CWVA 1ZGLB 1F4XL 5GRVK 3BGFB 4RAUB 1DZBA 3C09C 2JIXA 5CIPB 2B0SH 4JO2H 1E4JA 5ACZB 3HNTL 1D6EA 3MYJB 6FABL 3X3GH 5SWZE 4ZUUB 4HQQL 1TZHA 3R1GL 5HVWA 4YFEA 4YDJB 4LEXL 1MUJA 3CSPA 5IG7A 3M1BB 3HE7D 3QDME 3FQRA 2X4SB 2X70A 2IEPA 1RZJC 3PXJA 1JYWA 5DI8B 2EC9U 3G6DL 1TZGH 2EIZB 4X7TA 3MNZB 4F7EB 5DJ6A 3V6OA 5DRZA 1DBMH 1T22B 2P5WE 4Z7VB 3SGJA 1MEXH 2W60A 4F37F 2C3GA 2P24A 3V7MA 4F7PA 3L1OL 4ODHL 3IDYC 1SY6H 4YEEA 2XA8H 3VGGA 5T1LA 4XPGL 4EI5D 3V52H 2AEPL 3B5HA 4QXUL 1HYSD 1JPTL 2OJEB 4ORZC 5GGQH 4LCUA 3ARFD 4TUJA 1S9YA 3PIQA 4Z0XA 4U1IA 5TDOA 1U92B 3GNML 5DC0A 4CVUA 5IFJA 2VLME 2Z93A 1S5IH 2DD8H 4JO1L 1ZT1B 5C9JB 35C8L 3K74B 4MD4A 1AC6A 3BZEB 2IFGA 3BQUC 4YDLB 3PJSB 2YPKA 4D0DA 4NUJA 4Q9QL 3TT3H 1BVZA 4YAQB 1MHCA 1A4KA 3MACL 1XR8B 1XZ0A 5DA4A 4R9HA 5JUEL 4PB0L 4WTZA 1L7TL 4QEGA 5JIIA 3RTQB 4OF3A 4WHDA 1BGXL 1KJ3H 3ZE1F 4PGEA 3DX9A 3GMOB 3JWNC 1OARL 1XF2A 1P4IL 4DGYL 3MBEC 1IC4H 5BW7A 5I8OL 1EBPA 3MGOB 3MLSH 5DO2D 1MFDH 3VJ6A 5C0BB 5L2KE 3ULUE 4KTEH 1WCBA 3DUSA 2C4FU 4G6JH 5ID0B 1IEBB 4M02A 3O2DA 1JBJA 1MCOH 4U1HA 1H3UA 2W9LA 4U0RC 5MHSD 3V8CA 5IWLA 1NDMA 4CVXB 3TCXA 4FN0A 3BGMA 1EEZA 3G6JB 5F1NA 3NPSB 1IGTA 4NWTH 3KPPA 1MRFH 2IGFL 1XIWC 1JPST 3J8F7 5EZJB 3LOWA 4GAGL 4JN1H 4LLMA 1I1RA 2EO1A 3B3IB 4Y4KA 3UTZB 4RRPG 1F58L 3HE7C 1QBAA 1T1WA 3SKOA 1DEEA 2F74B 4QXWA 4BH7B 2VDKH 4QNPF 3FRPA 5DDHB 4CJ0A 1U9KA 4AEHH 3MV8D 2IAMA 1MVUA 1UADC 5JORB 4FP8L 4JE4B 1IL1B 1IAKA 2CLRA 4YGAB 1DQJB 4JRYB 3IU3A 3VDCA 2HKFL 4LASL 3TWCL 5DMIH 1KELH 2VISB 3KLHC 4JG0H 1RIUL 4U6HA 3U9PL 1KN2H 5IHZA 5GGRY 2FATH 2CXKA 5TDNA 5L9DH 2JELL 1AY1H 5D7KE 5JOPE 2A77H 3M1BA 5SWZB 3OKKA 2APVA 2J2ZA 4FTVD 2W65A 2IBZX 3EBAA 4Z7NF 1BOYA 2EZ0D 3QCTL 1E4KC 2K3TA 3IXTB 3CU7A 4LF3A 5B22A 4LLVB 3PWLA 1YQVH 2CLVA 1ZSDB 2NMSA 1T4KA 3FN3A 4EI5A 4QRPE 5EUKA 3HZYB 2FGWH 3LQAC 5CINH 3QI9A 4R97C 4ODWA 3U30B 1QA9B 3AM8C 1KUMA 3FHAA 3G6JF 2EDNA 5JZ7D 3WEXB 4TVPH 1BQLL 3WJLC 1ZT4B 4X5LA 3MBED 1A47A 5DURB 3P4MB 2FWOB 4XMPH 3UTQA 3OGOE 1UACL 4XHJD 1FFRA 2R15A 3EYOB 3TT1H 4XXDB 3W0WE 5I2IB 1J5OL 4M7ZB 4XCFL 2F58H 4H20H 1HHHB 3I2CH 4X4XB 1OSZA 3RU8H 5CEYA 4EUPA 3WNPA 3EAKA 3UDWA 1U8MB 1JWMA 3ARBC 1U3ZA 1AKJB 4YDLC 3WS3A 2AJZB 4N0UB 3VG0H 4LPCA 5JLZA 4Q6IA 4J8RB 4OZGB 3MROB 4RGND 4U1SA 4PLKC 3HAEB 2LU3A 1NDMB 3MRCA 4M03A 3RHWF 2OSLB 4KFZC 3P73B 4J4PC 4JFDD 5HVHB 5I1GL 3MLUH 2W0KA 4KK5C 3B2UC 3L9RB 3QEHA 3RWHA 4HUXB 5JO5A 1AI1H 4P4KD 2P8LB 5GRJH 2PCPB 3NACH 4DK3A 3KG5A 2ZOKB 3FFDB 3GSUA 5IFAH 1VCAA 3VXQA 5MEQB 1KLUB 4PP1D 4J3VA 3AU1A 4MNQD 5L0QC 3QAZC 4GLRH 5CJ5A 1INDL 4XP4L 5DQJB 2X1XR 4WHYH 5HYJD 3F8UB 2HVJB 3DX8B 1K8DB 2DLFL 1GAFL 3GRWA 1A3LL 1JTTA 1T89A 3IDNB 3MOBH 3MV7D 5GS2D 1GZPA 4Y4FA 4ETQA 4TNVF 4TTDD 5HGHB 3QNXB 3MXWH 3PWVB 5DD5H 3EHBD 1CT8B 1KJ2H 4W4OA 3D39D 4EUPH 5IMKB 5J6GB 2Z8WC 1EK3A 1YEEH 4U6XA 3R06B 3OF6A 4G80A 5DQ9B 4IDJH 1JZ4A 1AR1C 1N6VA 4QRTA 2NTFA 1J1PL 2GYSA 1LE5B 4HUVB 2X4OA 1A6TB 4GQPH 5C08D 3WNOA 3DNKA 4YX2H 2DS4A 3ZE0F 2A6IB 2OK0L 4OTXL 5BCAA 3RVVC 1MOEA 3HTLX 5L2JA 4KC3B 2GTZB 1TPXC 3MLPA 1NC4A 3AREC 1VEPA 1UG9A 3MNZA 1LK2A 4F7EA 4Z7UA 3SKNA 1FPTH 4OD2A 3WS6C 3RIAF 3JXAA 3ZDYE 1RZJH 1TVHA 2CQVA 2VJXA 2AJUL 2VERN 1ZVHA 2GJ6A 2CKBH 4HV8A 3SDXF 2VDRH 3VXRB 3I2CL 4RIRA 5ETUA 2NX5E 2HKHH 3ZMRA 5TGBA 4K9EL 1JWMB 1PBYA 2FH8A 1ZSDA 5DC4B 5DK3A 2QL1A 3DX6B 3KDMA 4NC1E 1P7KB 4PJDE 2AGJH 3VFOB 1KXVC 1AD0A 4MNQA 4S0TD 4POYA 1QBML 1ZXQA 3MJ6A 4LRIC 3PG2A 4JZJA 4M6NH 3GSWB 4FQXB 1WFTA 4OT1H 2BC4B 3QWQB 1RJYA 1RY7B 4HIIA 4P5MA 4L3CB 5E03A 2DM7A 3VG9B 4Y4FD 1PY4A 4ZG1A 3WE6A 5TH2B 3KAAA 4PRHD 2DLFH 5JQ6L 4HH9B 4WW2C 3RGVB 3LKPA 2BRRH 1D5ZA 1IGML 2PTTA 1P2CA 1J88A 2A0LC 5FGSA 4X6CE 1YUHB 5DFVC 3GJFH 3QUYC 4XBPB 2QV2A 2YD5A 3L3OA 3OAYK 2FHFA 1TJHL 1K4CB 1T2JA 3BPOB 4YNYB 4LU5L 2N56A 4JY4A 4ZQKA 2CD0A 2VUYA 4QT5B 2AVGA 2X4TB 2X89D 3GHEL 1MFBH 2AXGA 3QHTC 2APBA 4YZFE 4C83B 2G9HB 1NBYA 2YD9A 3G9VA 2HLAB 2VDLL 1NEZA 4OAWA 1KIUA 1PZ5B 3TZVD 1MJ8H 5HI5D 1RV6X 4YIQA 3QHFH 4KMLB 4JFPB 4WRLA 3SDAD 1DEDA 2C26A 4BZYA 1DDHA 3C8DA 1Q0XH 2XXMB 1Q0XL 1D5ZB 4PJBA 3G08B 3GMLA 1IC7H 2DAVA 5HGBB 5GGTH 5JIHA 2PYFA 1I3GH 4I9WE 3ZKXB 3W81A 2F58L 3RDTA 3DX9B 5KOMC 4YDKL 5HYQB 1ZHLA 5JNYB 4HUUA 3SEPA 1N4XH 1Q94B 4WCYL 5E9DB 3UZQA 4XMKH 5JHDB 4HK0B 3VXTB 5CLTA 3S36L 3ROLA 1AJ7H 5GS2H 5E8OB 5ID0A 3EOAA 3VRIB 2H8PA 4KY1H 1DBKH 1IAIM 4QHLA 1EHLL 1PD6A 5E2UH 2ADGB 1KJMA 2YC1A 2O61A 3LEVH 3VG0L 1AE6L 4DKAA 4F7CA 2ARJQ 4U7KA 1N3NB 2F19L 1P7QA 1H5BA 2IQ9H 4J1UB 4IMKC 1WUNT 3LS4H 1OAZH 3P4NB 4U1GC 1XGTA 1UM6L 4Z7QF 1W72L 1U8HA 2P24B 4U1KA 5C0IB 5LXGH 4HWUA 4JO3H 3H8NA 4FFWC 3HG1D 3VD7A 4M1CD 3CLEL 1DL7L 2X4PA 5DZLA 3GSRA 5FYLH 3DGCR 3MR9B 4LVOC 1MIEH 4XCYA 2ZCHH 3KJ4C 4GAYA 5B21A 4JPKL 4M7LT 4U1LA 3TPUB 5DRXA 3G5YA 5D2NB 3DMMD 1VA9A 1QTYT 4GBXC 4LLUA 3TVMC 4WIQA 1H0DB 1ED3A 2A77L 1EGJL 4LLAA 5KZCD 2Y36L 3TA3A 5ALCL 1J05B 4LHUA 4QHUA 1LK3H 5HDBE 2R29H 4XBPA 2A6DB 4LP5A 1OP3H 4N9GB 3AM8A 1CDIA 3TA3C 1E6OH 1ZTXH 3ARFB 3JZ7A 4PS4L 2BJML 1D5IL 5CJXC 3F6LA 3BKYH 3RGVA 1EVTC 3HC0A 5E8PA 1XGUB 3W9DB 2EIDA 3TEUA 2EH7H 4NZTH 1LVEA 4OTXH 3HCVA 2C3VB 3W5NA 4UDUB 5ERWA 1OAQL 1OY3B 4UIMA 1PYWB 5JMRA 4FHBD 3OJDA 4KTYA 5SWSD 4XNYH 2GK0B 3EO9L 3UBXG 2I07A 2Q8BH 3BMWA 3T2PA 4JDTL 4YHIB 3SKMB 4OUOA 1FSKB 2Q7YA 1KJ2L 5IT2H 1T0MA 4JB9H 2BMKB 2YRLA 5HGDA 1JPSL 4NDMB 3MOBL 3RDTD 3X14A 1X4ZA 3H3PH 3MA9H 4WU7A 4P3CL 5EBWB 2AJVL 4NO2A 3CZFA 3JTTA 4RMRA 3NTCH 1CXFA 3RWEA 3O3AA 3L3DA 4ISVB 2OSLA 4RX4A 4ONGL 1UZ6F 3I02B 4JFQB 1TQBB 3IB4A 3LVEA 1MLBB 3UTTB 4MNQE 1PSKH 4LPVA 4APQB 3GJEB 2GEEA 4P2OC 4FFWD 3OZ9H 4K8RH 1G7LB 4PJDA 4KV5E 1L7TH 4MMXC 3T4YA 2FIKB 1S9XB 2LTQC 5E6YA 2NCMA 3MACH 2KPNA 4CN1A 4XP6H 3D3VD 1YNKH 4DQOL 1YYMH 1A3LH 2FZ3A 1MAJA 4MX7B 1OLLA 1I1CA 3CLFH 12E8H 1YEFL 4GQ9L 5K33A 1FG2B 4PJ9B 2DTML 4IIQA 4JB9L 4ONHA 3VFWB 4S2SA 2ADFL 4PTTA 5IT2L 4RMQA 1RUAH 5DYOA 4JPWH 1FL5B 5I1DB 5TFSL 2DM3A 3PWVA 5IB1A 2C1PB 5JW3H 4FZ8L 3VGBA 3HMXA 3GKWH 3NZ8A 3RGVD 1MELA 4KK5D 4IM8A 4IJ3C 1QBMH 1R6VA 4RQQA 2IANE 1INEH 2V2WB 5DWUL 3MRPA 3WO3B 5INCB 4QF1B 5B38A 4MAUL 4NQCB 1JV5A 4AH2B 3V5KB 3SDCA 4PP1C 4XAWL 1A9BA 1DFBL 3ROOA 3BIAX 1U8QB 4ZFGH 4L9LC 1UH3A 3FO0H 5DHYA 3S7GA 1U8JA 5DQDH 1VADA 4MVBD 3WS6A 1SM3H 2MSPA 5GXBB 1C1EH 4YK4B 3ZYIA 4LVOB 5B8CC 5EPMB 3QJHB 4RISL 4FZEH 4TSBL 4I48B 2Z35A 3RL1A 4OCSL 4X9HA 3SGEH 2VMFA 3EOBB 1I3VA 1K8IA 5I71B 5J9PB 1T3FA 2CIKB 4NNXB 4ODVL 4JRXB 2ZCKH 5D93B 5E00A 2A9NL 5FXCH 3CSBA 3X12A 2ITDB 1MFNA 2CO7B 5C0CE 5TE4H 3SKUD 2IH1A 4OCWL 4KMTL 5MENB 4NSKB 3DPBA 1CD8A 3ARDA 4LRNH 2F19H 2R2EB 1HCFX 4Q0XH 3FO2A 3B6SA 3BQUD 3GB7A 2W92A 3O2DH 2R8SL 5I18H 3MLXL 3MCLL 5ILTH 4XH2A 3TBWB 3MLRL 5KSBF 1CLYH 3WO4C 5F9JA 3KHOA 4O4YL 3G6JA 2KZWA 5L7XL 3KPOB 4YUEH 4L29B 4NWUH 4ZFGL 1HSBB 5I1LB 2DQEH 3NFSH 1WAAF 4L9LB 1HN1A 5FGCE 3QDJB 4PRNA 3HNSH 4NN5C 4R0LC 1T3FB 1KIPA 4NNXA 4PJGF 5E8EB 5AWNL 1E6JL 3WHE1 5JPNB 4RDQG 1I8KB 1XGRB 3BKMH 4HMEA 4Y5YC 3EYSH 3RY6A 3TP4A 4JCMA 1I8LC 4HEPG 4XPHH 5I8KL 5D6DC 1FSKC 1YYLL 3EYUL 5IM7B 3BIBX 1CGXA 2H2SC 1BZ7A 4I2XE 4MA1B 5LCVH 5J12C 1PVHA 2L0DA 5I0DA 1EGJA 1FIGL 4PRDA 4POUB 3FFCD 3IDJB 3RRQA 4CMHB 5E6ZA 3V5HA 1U8PB 4ODSL 1QLFA 4U6VH 1WTGT 3PV6B 1Q0YL 2DLIA 3GSNB 5BMFL 2FR4A 1RK1A 4B7IA 2AP2A 1QOKA 3H9HA 1V7ML 4TSCH 1F02I 4MQXD 3RZCD 3QQ3A 3ARGD 4ONGH 4KHXH 3RHWK 4P2QB 4L4TB 3MRGA 1I3UA 1QKZH 1V8HA 2R1YA 4ETYA 3G5ZB 4J3SA 5EPMA 3DI2B 4AIXA 2P5EE 4M3KB 4W81A 4A2LA 5JMOC 1QEWB 4U0RB 4X6FB 4U1NB 4X8JA 5H35B 5LQBH 2I5YH 5DEGA 5CZVH 3SE4C 4XPBH 5EO0B 4XX1G 2X7LA 1U6AH 5B38B 4KJQD 1FZMB 3V4VH 2VQ1A 3O4LE 4MNGA 1T5XA 4R97B 2B1AH 5HDQH 4JG1H 4RGMB 5CWSA 5JHDD 2G60L 5IB1B 2VSCA 4ODHH 1OTUC 4OUUA 5F1IB 1IAKB 1Q9OB 5FO8B 1DN2A 2EDBA 5H8DA 3D69A 5IV2B 1MH5A 4HT1L 2VLKB 3BPLB 3BH9B 5E94A 5IR1B 3WFCH 2GUOB 3TBWA 1EAPB 3VGDA 5T1DL 3GIVA 1RI8A 5JZ7C 4Z8FH 4OFYD 5CJXA 4URTB 4HC1H 5D7LE 3D39E 3KJ6H 4IRJC 1XF4A 4G8GD 4P4RA 3NA9L 3WIIH 5DGRA 3ES6A 5T33H 5EU6D 4HLZH 4EBQL 2YWYA 4FZEL 5SV4A 4BK4A 2X44D 1M7IB 3PE9A 3WLBB 2EDHA 3IXAB 5EU6E 4J3WA 4WFHE 4M62H 3BN9D 2W9EH 2FEEI 4PRPE 3O2WH 1XGUA 4XVJH 5HHXH 1DBML 1JWSA 3EOTL 4WI7A 4XMLL 1EMTH 4NCC2 3VXUB 4OZ4A 2F53B 1URLA 3N85H 4OCXL 3VFSB 1RK0A 4E41D 1SBSH 5TFSH 4ZXBD 3GMOA 1FE8H 5T3XL 3RY5A 1AGBA 2ADIB 4R7NB 3FQWB 3VWKB 3QXAB 1HEZA 3S88H 4M1CC 3GMMB 4Y2DA 3UYRH 1F6LL 3HG1E 4F15B 2XG5A 4HKBB 2FJGB 2HJLA 3CIQA 1QBLL 1G9MH 5FAAA 4AYFA 4QHMB 2BRQA 4Y8AA 4YC2B 2CDFB 4D0DB 4D8PB 5JR1H 1S7UB 3BQUA 1IKNA 4PJXE 2FO4B 3T2OA 4XVSL 4F9LA 4EIZC 1KPUA 4ZUVA 5BW7C 3GBML 1YMMB 4R4FH 5D6DA 5HTSA 4KUZH 3QIUC 1I7UB 5FYJE 1BGXH 5BZDA 1JRHI 1K6QH 2E7CA 1ZGLA 4TOYL 2JE8A 1A7RL 2YKLH 3U7WH 5I1DA 4QRQB 1OTUD 2NY6D 4JRWA 3V5DA 3KXFB 2DMKA 1BFSA 1TJGL 3C6SA 1NAMA 4LSUH 3H3PL 1QFUH 5E5RB 3SDAC 2JCCB 3GMQA 3QXWA 1NH6A 2CLZB 5I71C 3IJYB 4NT6A 5EU3A 4WI2A 1E6OL 1Q38A 4XXCC 3VFRB 1LO3H 5GPRA 4Z7UE 4FQLL 2WUCH 4Y4HD 3S4SB 4QRSA 5I8CA 5KS9F 5GS1B 1BOGA 2C3XA 5E6IA 1TZHB 1U8KB 4JPIA 2A74A 5DUPH 3GJEA 4PREB 2VDLH 3N1PC 2FJFA 1HK6A 3OBAA 4N8CL 1GRWA 4GRWB 4AQOA 2K9UA 2IALA 1P5VA 5D1QA 2BXZA 1DVFC 4IOIA 2GTWA 3U4EA 3WN5C 2CKNA 3WNKA 2X4RB 3JV6B 2CH8A 4KAQL 5MI0C 4NKOA 4TUOB 5ISZD 4FXKB 1DL7H 1DVFA 5KAQF 2MTPA 5DJ0B 2CSPA 2FIRT 5E94B 1VDGA 3UJIH 2AK4D 1T1ZA 1XF3B 1DE4B 1JHTA 4KHTH 1KEGH 1S7SA 3DXAA 1S7XA 1OHQA 4G9FE 5H94B 3CFDA 1VGKB 4OI8A 5BQ7A 1N2RA 2NY1C 1FNEA 1LO4H 2JELH 2VAAB 1ULVA 3ZDXE 2ZUXA 1AP2A 3AMKA 3BD3A 1OCWL 3NN8A 1C5CL 3RVUD 2KBGA 1T80A 2APXA 2HT2D 3KHQA 4UUJA 5FHAH 4I0PA 1D5MB 3I50H 3OG6B 4YHPA 3MLWL 4WW1A 3JVGA 3D0VA 1ORSA 5J6HB 2FGWL 2GJJA 3DMMC 3MCG1 5EC2B 4GKZA 1T04A 2E6PA 1U8LA 4N1CA 2I9LB 2UVEA 3MLVL 2Z0BA 4Z78B 4KKBC 3LKRB 1GGYA 5KVDL 5EU5A 3CFKA 4NGHH 4PGDB 2IC2A 1NGZB 4YDKH 1GC1H 2HTLD 3MUJA 4YE4H 3VW3L 2J88L 2O5YL 4AT6B 2HLAA 3CK0L 4G8GA 4XPFH 1M1SA 2I9TA 3TA3D 1KNOB 1NCBL 1I9RL 4HBCH 3PWJA 4S1QH 5D5MF 4S1SL 1E4XH 3MJ8A 1R5VB 2BVUA 1NDGA 1S3KH 5IFHL 1MQKH 5C2BH 5EULV 5D2LB 4HCRA 4WUUD 3BKJH 2D4DA 4QCIA 3S36H 4DKEL 3U6RA 1A6WL 2YK1L 4NO0B 2R39A 3FO0L 2YZ8A 1AQKL 3GMNB 3BZFB 3VFTB 4P2RE 2IPTH 3OR6A 4KXZH 1DQDL 1NFDB 1QRNA 2ADGA 4QY8A 1J1XL 3MNVA 4UTBH 1TCMA 1MWAL 4OZHF 5D7LA 3LY6A 1QLFB 2CDEB 3HZVA 1AC0A 4G42A 1CGSH 1L6XA 5E6ID 1S7VB 1JHKH 3KPQB 1YNLH 1MCPL 1DN0A 3ZKNC 4LEOA 2A6IA 1PGRB 2V2XB 3F7YB 4RAHA 3THMH 2R2HA 3SJVB 3H42L 2D7TL 1T0NB 4OGAC 1INDH 4GS7C 1D6VL 3H9ZA 1YPZE 4G43B 4X4ME 3O4LA 4QXUH 1C5BL 4DW2L 1TQCB 1FG9C 4ZFOL 4DAGL 4Y5VA 2AI0H 2GJ6B 1CD0A 4MCYB 1P1ZB 4I3GA 3ULVF 3REVB 1IGCH 1KCLA 4ZUSB 5EU4B 5IB3A 2P5WD 2WBWB 4Z5RA 4WTXA 2H2SD 5HHQB 2HG5A 5EORH 3D25A 4LL9A 1HXYA 1RJLB 3WIFA 2DYPA 2Y5TB 3L3IB 4TTGA 5DMYA 4MDJB 2VN7A 4YHOH 3PGFH 1F90H 2HN7A 1GGUA 3WMSA 3T8XA 3BT2H 2AJ3B 4H8WH 1O7VA 2NLJB 5JA8B 1RU9L 3CMOH 3ZYZA 4FG6D 1JNNH 3VRLE 2HVKA 1MCQA 4YXKL 2EICA 1Z5LB 2H3NA 4I0PB 2AK1L 3VXUD 2AK1H 1E27B 1UJ3B 2VDNL 1Q9KA 2DQFA 2E5EA 5LGJA 3MV01 4KQ3H 3K2UL 4DW2H 1TVBA 4XBGB 3WS3B 1FIEA 4FZ8H 1N6UA 2AK4E 1SEQL 4HIEB 3UTSE 5DJXA 43CAA 4O2EB 4K3EL 3DYPA 2UVFA 3GSOA 4M43L 4ZYKB 4KJQC 1WBYB 4P3WA 3O45B 5KAQG 4N0CC 4ZXBB 1RUQL 5K9KA 5I66B 1FVEB 2ESVA 4QRPD 3HS0A 4R90H 1FFOA 3EFFB 3C60D 3RZWA 4J2XA 4PGZA 1P69B 5FM5M 3E3QC 2BNQD 4X5WB 2BDNL 2D7OA 1I8LA 2X10A 4ISVA 4OLYH 4LOUC 3ZYJA 1MREL 2FNBA 4FP8H 5C07E 2NNAB 5DVMA 3F5WA 1AJ7L 1YY9C 3CFBB 4WU7B 1KTLA 2VH5L 1G7PB 1D6VH 3X14B 3NIDE 3UAJD 3X11A 3MXWL 1N4XL 3ZT6A 4JQVA 2IF7A 1EBAA 2VSDA 4MB4A 3LQMA 4MNHB 5C0CD 4PJ5E 1IKFH 5KG9B 4K2UL 1KC5L 4Z7UB 3SDYL 5KANI 5BZWA 3GJFB 4F57L 2BOCB 2OR9H 2Z31D 5GQBA 4TRPH 5F8QC 2VZVA 3SGKC 1EZVY 1PKQB 4U6XB 2VL5B 5DJDA 3ALXA 4X9GA 3V5DB 5GGUA 1IL1A 1T2QH 1T2QL 2COQA 3B5TA 5B3NA 1BVLB 1NGWB 5LGHH 5F3BB 3D9AH 3GI8L 5C0GA 1QACA 5JPMA 4NOFA 1J1OL 4DCQB 2V5RA 2MKWA 3FRUB 2WP3O 3QEQD 4NM4H 4OF8A 3ARPA 4UMGA 5IJVB 1WF5A 4EI6A 3P0VH 4NGHL 3SBWC 3RWIA 3NH7H 4LCWE 2HH0H 3UO1L 3OKKB 4N1HB 5IKCB 5GGVL 3SHSA 3LPFA 4CJ1A 1OAXH 4LEOB 4ZUSA 3IDXL 3LRSB 1MNUH 2BFVH 4F15C 1QVOA 1ZT7A 1UJ3A 2JJWA 1QFWL 3B9AA 4PJBE 1RZ7H 3EHBC 3G5VA 4YBQD 2ZUWA 3C9NB 5GRUH 5FECB 3KLHD 2DIJA 3Q1SL 2OR9L 1DUZA 4NKMA 5IESH 1JYNA 2AJSL 3GSNH 1LO0L 4U1MB 2XXCB 3DX7B 4N0CD 2C4FT 3W11D 2AEWA 2BVPA 3VXUE 2PYEE 5C92A 4TVPL 4EJ1C 4OLVH 2DYPD 2YD1A 5JHLL 3BWAA 2FX7H 1NUDA 4LHUB 1LO5B 3V79C 2GHWB 2XFXA 4IRSD 2GITB 2AQ2A 1IM9A 4U49A 2UV3A 4PRIB 5AZ2H 3QA3B 4UZGA 3VXNA 4J8RA 4P2RD 1NANH 1YN6A 3BN3B 5DFTA 1A3RH 4LGSB 1R5VA 1IGMH 1YY9D 1SEBB 3T1FA 3VA2C 1WEJH 4U1HB 1KB9K 4Y4HC 4MAYA 5J9PA 4FQJH 1Z3GL 2PYEB 1C16A 1MFEH 1QA9A 2A9NH 3QYCA 4FQHA 4O02L 1FN4A 4LAQH 5C09E 2Y7QB 3CFJA 2DQGH 4GW5A 3JVGC 4LSQH 3EYFA 4L8SB 4Z8FL 2EYSB 1X5IA 1G0DA 5CHNB 3TBSA 2H32A 3C08L 3ZKSD 5SWZA 5F7FA 5JNYA 1BFVL 2Q3ZA 2EDRA 3STZA 1H3GA 3O3DB 2OTWA 4RMWA 3QDMD 1I3RB 3MQIA 3VWKD 1OWWA 1RHHB 5D5MB 5HHOB 3DV6B 4YX2L 1QO3B 3WFHB 3TYFB 3DIFB 4ELMF 2PYED 1MSPA 2QQNL 4J6RL 4KZEH 4UQ2B 3VFPA 4Y19D 4PJ7F 4X8JB 1I3GL 4KPHH 4YPGA 4HK0A 5EDXA 3L3HB 5D72H 4AT6A 4N0FB 4UV7H 5HD8D 3ZE2F 2E8YA 1DR9A 3ARBB 4HPYH 4OFDA 5FHBL 4EQ2A 2JIXB 5CIPA 4NPYA 3EZJB 4P57A 2D7PA 4YO0B 5GS0C 3QG6A 1DBBL 4BZ1H 2J8UB 4RGOH 1SJHB 5EZLA 1DLHA 3IFOB 4NQDB 1NBZA 3IRZA 1O5DT 4GW4B 1J9CT 1HH9A 4K3HA 1I1AA 4QOKB 5IW6A 1IM9D 2VKWA 1WBZB 3QAZB 1YJDH 1M05A 4X4MA 3RZCB 2L7UA 4OCRL 3L3IA 2BVQB 1DQML 5KJRH 2PUQT 3V6BR 2EZ0C 5ADOH 2NY4C 4X5XA 3MLUL 4H5SA 4D0BA 2VLRD 5C07B 1C8PA 5IVZA 4JM2F 3D18A 3WFBL 3REVA 1OTTC 3CCHB 3TT3L 4XHQA 1C5DB 3OTTA 4MCYA 3TNMA 3FL7A 3L5JA 3RWDB 1FORL 4LVNC 4LFHG 1LP9B 4GKNB 2H1PH 5CILL 3VFUA 1OPGL 5FA4A 5ACLA 2X4RA 5FHBH 1IGFL 4Y19B 1QHPA 4LSTL 4DN4L 4NQEE 3ARWA 5DJCB 5GZOC 2XRAL 1QLEL 1MFEL 4JKLA 4YAQA 4H26A 3S96B 5B4MD 1XF2B 4L4TD 2MHAB 1RSFA 4L3CA 5BV7H 3MO1B 5CZXC 4MD4B 3BZEA 1YDPA 3PUCA 5E1AA 3MV7B 3MRRA 3MRDA 1LO2L 5FUZH 2DKSA 1JFQL 2DRUA 3OAUH 3JBG7 4GG6E 4P2CG 1MRDL 4HKBA 4PG9B 3BKYL 5I18L 2XT1B 1I7RB 1F4YH 3CH1A 5CD5C 3ECBB 4MJ2A 1LHZA 1YQVL 1KB5B 1S7TB 5JHLH 2F9BT 2LU7A 4OLVL 3OR6B 3QXUA 5LXGL 4HC1L 1FVCA 3HUJF 4G6FD 3N1FC 4ZFZB 5FCUL 3GSQB 4FQJL 4N5ED 3QDJD 2F5BH 4PJAE 1CLZH 1U8OB 4FFZH 4S1RL 3MRBB 1KCSH 1IEAB 5EG6C 1RIUH 3INUH 2BZDA 1G1YA 3FT3B 4K94L 4M5YH 3R0MA 4Y2DD 1OQXA 1JHLL 5FYKE 2JCCA 2V2WA 3U46A 1DBKL 5F1KC 5HDQL 4RBPK 5DZOA 4TTDC 1DUYB 1CDBA 1CFSA 1JWUB 1L9MA 3MA7B 4JHZA 4QRPA 4CVZA 4CADA 1FL5A 5FCSH 2ORBH 3RX7A 3FN0H 5JXAH 1EJOH 1DBJL 3HLAB 3OKNA 4OBSA 3TO4D 2NY4D 1I7UA 4WDIA 1CQYA 1AXTH 1EFQA 5E2VL 2MNUA 3BDXA 3NCYS 3SE3C 3SPVA 1RK0B 1TENA 2QKIA 5BOPA 4R0LA 3RFZC 5IVNA 1R3LB 1IGYA 4OCNC 4XP4H 5IVZB 2NY7L 5HPOA 4F3FA 2AQ3A 2FIKA 1PDKA 1MWAH 2P45B 1UM5H 3HC4H 4WGVB 5DLML 3KGRA 1JPGA 2OMBA 4C56A 1Q94A 5CMAA 4UU9B 3PL6C 4MA8L 4ZTPL 5GRVL 4U7MA 5INDA 2LVEA 3GHEH 2ZPKL 3LKOA 3P0GB 2O5ZL 5IBTL 3V8OA 1IQWH 1NBZB 3CXDL 3GFUA 3DVGA 1DVFB 3DGGA 2R23B 1XH3A 3D18B 3KS0H 1B0GA 1BMGA 4AEIH 3O2DL 3O41B 1MQKL 1ADQH 4U7SA 5A1AA 3ILPB 4XNUH 5E6IC 4Y1AA 2NW3B 3ULUD 1A02N 3DECA 3ZKQD 2BY0A 3T0VA 1CL7H 4OAWB 4OI9A 2C3HA 2P4AB 2ZNWA 1M05B 2WW8A 1CD9B 32C2A 5AWNH 5H2BB 3LSOB 4N0UA 2YUVA 4Y5XC 5JIKA 5IGXL 2YXFA 3OGCA 4S10A 4BZ2H 3O3EA 3CVIH 3IVKB 4ZYKA 2DQHL 2LVCA 1CF8L 5E2JA 5DHVB 3BP4B 2E3VA 3L3GB 1WWCA 1NC2D 3PHQB 2Z31C 2HRPH 3HI5L 1EHNA 4N90E 5ELIA 2NR6D 3T3MF 4OI7A 2RHEA 3SDCD 4V1DB 1CL7I 3HG1A 3WKNA 1GZQB 1JGVH 2F5AL 3F58L 4PY8J 5HHMD 3IKCA 3UPRA 1EHAA 2GAZB 1EO8L 5LBSL 2FX8L 5EOQL 3QQ3B 4DVBB 1H0DA 1YQ2A 5CJOH 1DSFH 2DD8L 3EJZD 5EO9A 1NAKH 3DXAE 5C0DA 1PW3A 1FE8L 3K2MC 2EIBA 5C8JB 5JDSA 4NN7C 5FA3B 3AS2A 3TZVC 3X3GL 4Y16D 3BXNB 1UA6L 1QFPA 2D9CA 2YPLE 3VWJA 4YFDB 5E0QA 3V5HB 1TCRB 4KGLA 5DMGD 1BAFH 3FKUS 2XICA 1IM9B 1AO7E 3HPLA 2ICCA 3FQWA 5EN2A 4EDXA 5FKPA 3K1DA 4Z7WE 2WANA 1F3DH 4P49A 2HA1A 2YHGA 4N8CH 4FQIL 4EEEA 2W9EL 2Q6WB 4OJFL 3OAZK 3IJSA 1KB5L 1KXTB 2ZCLH 3Q6GL 4WEUD 1N5YL 4JG1L 4KI5C 1JIBA 1RU9H 1NMCB 2XZZA 2VUOA 5EC1B 3LS5H 5BVPL 1FN4B 3W11C 2ADFH 4RX4D 5IK3B 4CAGA 2J4WH 1Z0NA 3PWPE 1Y18B 1B0GB 5J3HC 4XCEA 2Y06H 4EVNA 4PJFF 2R2HB 3SJVA 4Z95H 5FK9A 4TN9A 3QISA 15C8H 2EXWD 3KPPB 4WFEE 4QXTA 3CVHB 5I73B 3VFGH 2OK0H 5CS7A 3ES6B 2R0KH 1S7VA 3BHBA 3HZMA 3QIWA 4C56B 2BNRB 3G04A 2FYYA 3O6FB 4UB0H 5AZEH 4E9LA 2Y6SD 4GSDH 4ETQB 5DZNA 4BZ2L 4HG4J 1FFNA 5F97E 1ZANL 4NO3B 4WCYH 5DJAB 5ESQB 5FYKH 1BFOA 5D2LE 4M7JL 4MA1C 3CX2A 4HS8L 4K9EC 1U92A 3RAJL 1MCWM 2AXFB 4WEBL 3T0AA 5T1KB 3U0TB 4QF1A 3B9KD 4RGNB 4C83A 4K23H 1A4KB 2EDXA 5E4IA 4E0RA 3IFNH 4AEIL 5D7JC 2Y36H 3LSOA 3QHFL 4HHAB 7FABH 1K4CA 4YNYA 5H35A 4XNXL 1OM3L 1WZMA 3U1SL 3ME0A 5DMKA 1JYVA 3VCLB 2CIKA 3DSFH 4X4YA 1FDLL 3TLRA 3DYMA 1CIUA 5C09B 5BS0D 2D31B 5F70A 1FNSH 5IVXF 4PJ8C 3RGHA 4G8FB 4O51B 4FMKA 3SGDI 3IGAB 2M26A 3OKDB 4XC3L 5DEFA 3FB7B 5BO1H 4J12A 3HS0B 3TC9A 1XGQB 2CJUH 4P5KA 4PTUB 1R5IA 1VFAB 3HRZB 1ZLWK 3HKFA 5HGGS 4AEEA 1A9BB 3ROOB 2VR4A 2DQTH 4KRNA 2VLRA 4HIEA 1EGJH 5LBSH 2J88H 3O0RL 3NMEA 4NRZA 3L3DB 2QEJA 3RPKA 5L88L 2CUIA 2H32B 1G7PA 1JGDB 3R4DA 1N2RB 1CFQA 3O9WD 1T20A 2DQJH 4RFOH 1LP9E 5FUCE 2R69H 2AEIT 2JJTC 2E8ZA 4ZOCA 4LKXB 2PO6D 5E56A 4LSDA 4MLSA 4E41E 4GW5B 1GCFA 5FDWB 1EHLH 1EUTA 2VLKE 2NY3D 4DEPB 3FTGB 4G6MH 5FYJL 1XGRA 4I0PC 2W38A 5T1LD 3SQOH 5GS3A 4WUUB 5DJZA 3TZVA 4YWGL 3I84A 1QSEA 1YEKL 3OB0K 3V6OE 3RL2B 3C6LC 4IOIB 1IRAY 4PJ7A 1HZHH 4JRYD 4LDEB 4LOUD 4L3AA 2XWBB 3GSOB 1SJEB 1RIVL 1V3MA 1YC8A 2EE9A 5IHZB 1S9WA 4RAVA 1TJIL 5E8NB 5IVXB 1KN4H 4DN4H 1L0QA 4KROC 4JQIH 1BOGB 3T0EA 4PRHB 2FLBT 1WC7B 4F3FB 4KK9D 5HI4C 5IQ9A 4PRHE 1HXMA 2P8PB 3QUXA 1JZ7A 1F3RB 2XPGB 3DBXB 4MHHG 2R4RH 4PJHA 3QR2A 3GMPB 1RVFH 3O3UN 5GJSH 3NCCB 1IT9L 4NKIL 4ZO9A 1U8HB 3MV9E 2NPLX 3N1MC 7FABL 3V95A 3IFLL 4FFYH 3K46A 3S37H 5KVEH 1Y6KR 2AEQL 4TNWF 4TNWK 5D2NA 1NFDF 3QIBA 1W72A 2APTA 3H9YA 3VGHA 4PG2C 5C0ND 1T89C 3ISWA 5EOTA 4GRWH 5J12B 4L8SC 5IJVA 5EWIH 3DO7B 3GSUB 5ESQA 3JUZA 1WISA 1RUQH 1GIGH 1RUPL 4P59H 5DD1L 4DCQA 5J1AA 2OZ4H 4Z7WB 1D3CA 2Y1VA 4AK1A 3VFVA 3QRGH 1A7RH 1J0JA 2PW2A 4WO4C 4EQ3A 4WWKB 1CLOL 3MLSL 1HKLH 3MBXL 4JLRA 4QLRA 5CBAA 2AK4A 5A2IH 2Y25A 1P4BL 2XA8L 3H7BA 1SY6L 3UTSB 5J06A 2YN3A 1ZWIA 1X9QA 4OZGE 4ZUWB 4X83A 3ZTNL 5C0RL 3BMVA 3VD9A 4Y5XB 1UWGH 1RFDH 2I9TB 2VC2H 2NXYC 1B4JH 4ZTOH 3ULVH 3AFLA 3FOLA 3ARGA 4V1DE 1CDCA 1BZ9B 1WWAX 3MJ7A 4YC2C 3M8OH 4JN2A 1MWAA 1CDHA 1KPRB 2GQHA 3REWA 5HY9B 4AQ1B 1INQB 3KR3L 4KKLC 3BZDA 4QGTA 4F58H 3RWEB 4P23D 1FPTL 1R0AH 4JRXE 2XI9A 5FV1L 3LN9A 2XFXB 1KT2A 1EMTL 1HQRA 5E9DD 5AUMA 4RGNE 1I1AD 4JRXD 1OD9A 2BVPB 2BNRD 4S1DC 3ESUF 5F6HJ 5C6WH 4QRRB 5ISZE 5HGBA 3C5SB 2XKNA 3MOQA 5FO9B 2J1KA 5MEND 4JPKH 1JZ2A 4YHIA 1DDHB 1N59A 4PJCE 2VRAA 5TH2A 3B2UD 3BSZL 3L7FA 5GSVB 3VFPB 1CI5A 2WIIB 4NQCE 1RZKC 3M45A 1IC1A 2F8OA 4K8RD 4WW2B 4P4KB 5IF0A 4D2NA 3QNYA 3IU3B 4U05A 1JE6A 2I24N 1T7XA 4L4TE 4ZTOL 4K71C 5CJQL 5C0AE 3Q1SH 4FS0A 3AB0C 1J11A 4DGIH 4UBDC 4JKMA 3WFBH 3SJVE 3D85B 4XNMB 4OD3H 3GO1H 1A64A 4I3SL 2HFEA 4R4BA 4HZLA 4LFHD 1U0QA 5F9WC 3DBXA 2UYLA 2P8PA 4R2GB 5DRNB 3MRFB 2EXYC 4K7FA 3A6BH 3TV3H 1I85C 5TGBB 4G6AD 3ARBA 1PZ5A 5T5NG 3C5JB 2UZYB 3LKPB 3HR6A 4K3JL 1JGLH 3RY4A 1QFWM 2HG5B 4C55A 1NC2A 3HR5A 2W9DH 3H42H 4QXGL 4N0RA 5F1NB 3MNWA 2D0HA 3JV6A 5F7UA 4MNQB 1S7XB 2QSVA 3H7BB 5EUOF 1KLGA 1KBGL 3MUY1 4G7YH 4MZ2A 4QTIH 4MJ5B 5D7JA 2VZUA 3FQNB 5LWYL 1QD0A 3KLSA 3GHBL 3GHBH 1TPXB 3RY6C 1RJZB 3PHOA 5C9KA 5CGYD 5KANG 3OKDA 1A5FH 4IRZL 5DEFB 3DX6A 3MCKA 1MHEA 5D1QB 3HPJB 4V2BA 3WSQH 4MDIB 1AR2A 1LMKA 4P48A 4CW1B 4F57H 3EZ8A 5C0BE 1LNUB 2R2CA 4ZS7H 4M1DH 4KRPB 1BD2B 3ZKMC 4ZUVB 4Y89A 1RJYB 3ZT7A 4NNPH 3OXRB 1LEKB 2ZUQB 3JV5A 3JWOL 2FRGP 4Z7WA 4HIHA 5BRZE 1BQHB 5J1TC 3SE4A 1UJ3C 2W0LA 4R4ND 1MWAB 4Y5XA 1XR9B 4WY7L 1CDGA 4HFWB 1CD1A 4LLWB 4O2EA 5IOPA 3QUML 4HX1A 4DK6A 2AXFA 4P46B 1QP1A 1H15B 2RFXB 4AM0B 1KCSL 2I60L 2PW1B 3OAYH 1M4KA 1OGAB 2DM4A 3JV4A 1CFNA 3SDYH 4K2UH 1OVZA 4Z18A 3VH8G 1KPVA 5C0JA 5EO1B 2IAMC 4HUXA 2P5ED 3LHPH 2Z91B 2R4SH 1IBGL 4KKAC 3WN5B 4BK5A 2VLJD 1G6RH 4G9FA 1CG9B 3RNQB 3RVWD 3VE0A 5I0ZA 3U46B 4HF5H 1OP5H 3VFNB 1K8DA 3DX8A 1WCQA 2DLGA 3NVQA 5FYJH 5KSUA 4HBQA 2YUWA 3FT3A 3HE6A 4ZODA 1B2WH 3WLWC 3BEVA 3DJ9A 4YLQT 2XOTA 3VXRD 1U3JA 4BM7A 1QPXA 2IMMA 2PXYA 1KLUA 4ONOA 3VWJC 3U48A 2ZOLB 1KIRB 3BPNB 2BRRL 1EV2E 3LKRA 3C60A 1IQDA 1T1XA 2R1XB 2DQCH 2WLZA 3MZTA 3RKPA 4FABL 2NTFB 4QRTB 1KOAA 4YBLC 1JNNL 2FO1A 1GGIL 3D0VB 2GSIB 5KVMC 4HMDA 3U0WL 2VDQL 1SYSB 2IH3B 4XWOC 2I25N 3UJIL 3RGVC 5IV2A 5DT1L 5GRYA 4NRYB 2NXZC 5E2UL 4KJWD 3AAZA 2QJDA 4EI6B 5CWSB 3CDCA 3RJQB 3MLTA 2A6KA 4DKFH 3ESVF 1UXWB 4PY7B 2VYRE 3TIDB 1V3JA 5C0RH 5ICYA 1EEUA 3QO1B 1UH2A 2J8UE 4OSUL 1CE6B 3FO9A 3BPCB 4MAUH 3C2AL 4MZ3A 3E6FA 4XZUA 2N4IA 5D7JB 2H32H 5F7KC 1C12B 1VEOA 5ESVB 2JB5L 3ABZA 4X6FA 1QEWA 4X9IA 3D6GA 4YPJA 1S9WB 2QR0A 1NMAL 5D7IA 1P7KA 4I77H 3GJFK 1OPGH 5DUMH 3FAXA 3UJJL 5DD1H 3CUPA 4MNGB 2EYRB 4Z7OE 2VDOL 2VQ1B 3D69B 3O6KL 1MHEB 3K8KA 4PJXB 3ULUC 3T0WA 4FQQA 4OLZH 4HV8B 3S3SA 2AJ3A 4ODXB 4PJAB 1K3IA 4HPYL 4HWZA 1IGCL 1H3WM 3SDAB 4O5LH 4HUWA 5T1KA 5DO2C 1WJ3A 1C5BH 1NAMH 4IDJL 2DYPB 3QCVL 3MMEA 3D1MC 5TF1H 5E08L 3QEQA 1G7HB 1R5IB 1VFAA 4PJEE 3GEWB 32C2B 5I1GH 3OJDB 1WQVT 3DWTA 5F7DA 4C4KT 4DVBA 1IVLA 1GL4B 1S7WB 3SDDC 5GJTH 3QBTB 4JVUA 4NQTA 4GMTH 4HPOH 1OL0A 4I9WD 4TUKL 5BV7B 2Q86B 2B1HL 4JFDA 3RUGF 1XF1A 3ILPA 2HVKB 1OP9A 4A6YA 5I8EA 2VLJE 3T77B 2DJSA 4P2YA 4DZ8A 3PHQA 1F11B 4JDTH 1X5LA 2UY7A 3H3BC 2NY0C 3MGOA 5C71A 4JEGB 2FECL 3NCBB 5ALBL 3T0ED 1R3IH 1OTSC 5L8JB 4NQEB 4JKWA 3RNKA 5F7EL 1EO7A 1SYSA 2IH3A 1KB5H 1RHHA 3MV11 5FB8A 4PJ8D 2HFFA 5IM7A 2BY1A 4ORGA 4R7NA 1MRCL 3BKCL 4NC0B 2WBJD 4OQTL 5MEOA 1QFWI 2Z9TA 3WXWH 1N0LA 3NFPB 1EEZB 1RUML 2YPVL 3MV9D 1CICB 2YUXA 1PG7H 3I9GL 2BJMH 2QBWA 1BREA 3FOLB 5DDHA 1WBXA 2GSIA 5EZIH 2HYMA 1J8HB 5DVLA 3QDGD 1NAKL 1LGVA 1TTGA 5EC1A 3QCUH 4N90D 2BNRA 2OTUB 4Q74A 1HIMH 3N50A 2JJSA 4ERSH 3P0YL 4AENA 4OZGA 4FMFA 4PBXA 4U1SB 3QUYA 1L4IA 4LPWA 4ODVH 1LE9B 3KPNA 3FQUA 2AKRA 3G04B 1A3RL 2DBJA 5IROA 3TWCH 2Y9RT 3K81A 5CJ8A 4EVNB 4YK4C 5J3HD 4M7KL 1YY8B 5C0FA 3LH2H 1LEGA 2H26B 1PJ9A 1SMAA 5JA9A 1OSZB 2ICWI 4XRCA 1J0ZA 3ZDZF 3K0WA 3CXDH 1IAII 4ZO7A 4L5FH 5FV2A 5IB4A 4QHLB 4H25B 4JFED 5F44A 4Z76A 2BVOA 3F12A 1JNLH 5EBLB 4UINH 3LDBC 3VRJA 3EOBA 5I1CH 4JPVH 1TETL 4LSRL 4YHKH 5KTEL 2WUCL 1A1MB 4ZS6D 4XTRD 2FBJH 5J1AB 3JWDC 3IXTA 1NEUA 3D2UD 4DOHE 1FNFA 2E9WA 3PL6A 2B1HH 4IOFD 1KTRL 2LU4A 5H94A 2QQKH 5IQ7L 3SDAA 2QQLH 1LNUA 1P9MA 2UWEF 1RULH 1HQ4B 1G7QB 1XIWD 4MA8H 4ZTPH 3C5ZC 5CLWA 3H2WA 1Z0MA 4WHCA 4F33B 2ED7A 5DLMH 1NAML 2E9IA 2I9LA 4F7PB 4I2XA 3U0PA 1Q8MA 1AGFB 4IMKA 4HS3A 1NL0L 1OGAD 1G7JB 2ZG1A 1L7IH 4MXVE 2JF1A 2JJUA 3O6FD 3PWUA 4OGYH 2NW3A 3MFFB 3TN0A 3BEWA 3JSSA 1EPFA 5DJYB 3KPSD 1TETH 4YHKL 1B4RA 2XNAA 4WO4D 1A7QL 4YBQC 3HNSL 4M7LL 1ORSB 2J6EH 1PYWA 4OKDA 2G5BB 3Q5TA 2GJZA 4O4YH 3QWRA 4XVUC 1ZGLP 1J12A 2O26U 4DEPC 2DDQH 1Q1JL 2BMKA 4IS6B 5HGDB 4UT7H 2ZP0T 5A40E 1GGBH 2EE3A 1BP3B 2F54E 3TNNA 3U0PB 3HLAA 3OKNB 3Q48A 1QBBA 2VDNH 4OQTH 5KVFL 4D0CB 5C0BA 3PWUB 1JGUL 1KJ2B 4AG4L 1VFMA 5E70A 2QKIB 3DETC 5CSBA 1WV7T 2WWKO 5B4MC 2IANA 4HIJA 4KHTL 5TE7H 3DLQR 1KIRA 4UI2A 4UDTA 5EZIL 3ARQA 1ZLSH 3VXRA 2NY1B 2P5EB 3FO1B 1CFSB 1JWUA 1QSFA 2IG2H 1MAML 4HJJH 1MRDH 4NRYA 4HWEH 4OD2B 1SM3L 2A38A 4RFEA 4MAYC 3GSXA 4JR9H 2GTZA 4QRSB 1HHKB 2VITB 5I8CB 1DLHB 3IFOA 5EZLB 5KSVA 1N7ML 4M62L 4LARH 3UBXA 4PLKD 3C60B 1DBAH 3ARDC 1FYTE 2DJ4A 4RNRA 4U0QB 4GRLC 5EOCL 1CIDA 2X4OB 3MRNB 4R7DA 2XKSA 5ADPH 4GAFB 3U7YL 2HMID 1JUFA 5I1EH 5FO7A 4OZFB 1HXYB 3D25B 4LCIL 3RKDD 4AH2A 2HFGH 2IAND 3LDBB 4Z76B 2W59A 4BZ1L 1HSAB 1DBBH 4HFWA 1CVRA 4P2QD 3RVUC 4Z5RB 4NHUB 1NFKA 1UWGL 1IAOA 2R0ZH 3DXAD 3LEXA 1XCTA 3MV7A 1IAIH 4W6YB 2CRIA 3STLB 4JJHA 5FA4B 3SGKA 3V0WL 4EOWL 3BIKA 4OCRH 3RX5A 2OL3L 3ARXA 3FCTA 1PSKL 1O7SA 3WFZA 2GUOA 5MEQA 3GBMH 1TDQA 5EU7C 4YEFA 2HH0L 3UO1H 3G08A 3ILQD 1JGEA 1T21A 2VOTA 4LBEB 4MSWA 1C16B 4FQHB 1I9JL 2Q1EA 4KRPC 4F7TB 1XGPB 3HI6H 5EOTB 3QO0B 4WO4A 2MOVA 4YZFF 3MRDB 1DCLA 3LMJL 2B5IB 2VDML 4HUUB 3MOAL 5I1LA 1HSBA 1T1YB 1YEGL 2VN4A 1H3VA 2ENSA 3BP6B 2AQ1A 2AABH 4H5SB 5ICZB 4GBXB 3DVNB 5CP7A 2NYYC 5DJCA 1SJHA 1BFTA 4EDXB 3B83A 3GB7B 1N6QL 1AXTL 4O2CB 5D96B 4A6YB 5CGTA 1XIWA 3CNKA 2X9WA 3K1KC 5MI0B 3RWJA 3VWJB 1OGAE 5B8CA 4NKQB 1P2CB 4JR9L 3N1GC 3QEUA 1JN6A 4YIQB 5D2LA 1ES0A 1P4LA 3LKQA 5F7DB 1KCKA 1D5BA 5E4EC 1NCWL 1UA6H 2NY0B 5EIIA 4I18C 5FYLL 3IAQA 5CD3A 3IETA 4PP2A 5C6TL 1FZOA 4OZIA 3LQZA 3TIEA 2Q86A 4B50A 1X4XA 4NPYB 3NCEB 1VHPA 2NY7H 3PV6A 4GRWF 3OXSB 4YHLH 1NCCL 3U4AA 5EBMA 5I8KH 5BZWB 4OD3L 5ECJE 4NFDA 4JZOA 3HRPA 3AB0B 1X4YA 3X11B 2BCKB 1U8IA 2CIIA 4HZLB 4K71B 7CGTA 1HH9B 4RMSA 1EEYA 4K8RC 1KEGL 4ZSOE 2B20A 4LVEA 4XAKD 5KVFH 4B0MM 4RWYL 1KN2L 4PBVC 3SO5A 3OHXB 3MPCA 1YEHH 2WUBL 3G5ZA 1YEIL 4AY0A 1ZV5A 4OCYH 4JFEB 1EUUA 2NY2D 5J13B 1KT2B 1A9EA 1G9NL 1T03L 3NN8B 3H9HB 3FB6A 3CUPB 4JQXA 1TVHB 3KJ4B 5DC9B 3RJDA 1DFBH 1F3JA 4HLZG 3QUYD 3U4BH 2XWTB 5J1SC 5FUCC 2EXYD 4NHCL 4G8IA 1Z9SA 2AJSH 3GSNL 2GIYA 1MI5A 4GAYB 4NO5A 3T0EC 1R24B 1OTSD 4D9LH 1WVZA 3T3PF 5DJ0A 1R0AL 3T0EE 3IDJA 4PV9A 3BT2L 4KJWC 3O6LH 4XZUB 4YHLL 3U83A 1SEBA 1YEGH 4U1GB 5HVGB 3B8YA 5H2BA 4MD0B 3RQ3A 2BSED 2K1MA 1OAXL 4LDOB 4BFIA 4U1MA 2YD6A 5D71L 5GIRA 3TJEH 4PRIA 3P4NA 3QRFM 4OGXH 2GITA 3QFJB 3GI9L 3C9NA 1JPGB 4G6JL 3BWAB 2GI7A 2O93L 3QO0A 1MFBL 1A1OA 4TOYH 3IJHA 3ZHDA 3QCVH 2JCCF 5J13C 4OV6F 1W0YT 5KBNC 2YD7A 4WJ5B 1A5FL 4IRZH 4N8VB 3TJHC 1IAIL 1EEQA 1E4XI 2R0KL 4HC1A 3WIFB 3RTQA 4J23A 3A6OA 4IMLA 2OL3B 4KK8C 4LVHB 4R4NC 2GK0A 4GG6B 1N26A 3FHQA 1LO5A 4Q9CA 5F9DC 4QHKJ 4GUPB 3GDBA 2D7QA 5ERWB 1UGNA 3QQ9C 4P5TC 4D3CL 2NW2A 3L9RA 3QEHB 3RWHB 5I1AB 5EUOA 3F7VA 5BVPH 1JGLL 5JW4R 1FZJB 1IC4L 4AIZA 4G9FB 1FGNL 5EOCH 5GHWL 2XY1A 4MA7H 3Q6GH 1N5YH 1IZJA 1KG0A 1H15A 5J8OA 3B43A 2ZZUT 4I3RL 1S7UA 3UAJC 4ZFOA 4KKAD 1WZLA 2BY2A 3FB8B 4QGYA 4LRNL 1LDPH 3ZL4H 2BOBA 1OQOA 2ZUVA 4XP9L 3DRTB 5D1ZD 3QDMB 2J12B 4QT5A 5GSRA 3O6ML 4RGOL 1PLGL 4K9EH 2OL3A 2WMPA 3GIZH 3CFBA 4PJDB 1IQDB 1N0XL 1T1XB 1ZA3A 2R1XA 1ZLVK 5INCA 4X6BB 4OD1H 2OQJA 4M43H 2B5IC 4UOW1 5EU4A 4N8PA 3ZHLA 2OXHA 4OCSH 2ZKHL 3KJ6L 1VADB 4N8VG 3B9DA 2VR5A 2CK2A 3O3AB 3PNWA 1NFDA 5EA0L 5FYJD 1CFNB 1DTUA 5EZOH 4AIZB 3V5KA 1YEJL 3U2SA 2ZUQC 1GC1L 5GZNC 3L7EA 3VI3F 1FYHB 1S9VA 2CLVB 3MRQB 2IWGA 2Z8VC 4FQCL 1CTOA 2CRYA 4GRLA 4F8TA 4FTVE 3V6FB 3S8WA 3QUZC 1ND0B 4YXKH 2W65B 3WFDH 4R26H 1S9XA 3GSWA 4IIQB 3E2HB 4WHTB 5A2JH 3WBDA 1PKOA 4UIKH 2V6HA 3CMOL 2XQBL 1H5BB 1GOFA 1P53A 4EI5C 5DJZB 3TZVB 3RWDA 4OCLC 1YEIH 5KG9A 3MV9B 4KI5D 3CCHA 4K7PX 1KJMB 1ZHNA 4GKSA 4HUWB 5I2IA 3LHPL 2A73A 4ZD3L 1AIFB 3BZ4A 3JTSB 1LO0H 4X5XB 1T4KB 5E8OA 1PY9A 3VH8A 4JQXC 5E8PB 4LLVA 4LF3B 5E99H 1ZLUK 2BVQA 3QXTA 3KYMA 5IBLC 2GSGA 2D31A 4KHXL 3BP4A 3BJLA 2MQCA 4OM0L 1UWXH 4UT7L 1HILA 1KLFA 3WYRA 4XHJC 5FGRA 4M3JA 2R1WA 4FFVC 1RJLA 1EFXA 4AEHL 3ZZ1A 1I85A 4ZSOA 5F7NC 1F8TH 3FRPG 3F62A 4KROD 1A6ZA 3G5YB 4X98B 5HVFB 4PJIE 5T3ZE 2V5SA 4AJ0A 4QWWC 1F2XK 4WUUE 1P9MC 2LAAA 5C2BL 4PRPB 3P30L 1RZ7L 4X4YB 1A6AB 1AXSB 1I9EA 1UFUA 2YZ1A 1CT8A 5HDLA 4HHAA 1UCBH 3HE6D 4P46D 1E4WL 4JHAH 2D0FA 3IFLH 5K9OA 1E6JH 2B4CL 2YA2A 1AHWA 2Y5EA 5MERA 1T1YA 1J05A 2ICEB 3D2UB 3FZUD 1OGAA 3JV4B 4GG6A 5JXAL 1I4FB 5BRZA 3HZMB 3QIWB 5FOJA 2DQEL 3NFSL 4WV1B 5I16A 1ZANH 4M00A 3MLVH 4QKXB 1IFHH 2VLJB 3TBTA 1A6VL 1MHPH 5GISL 1CDUA 1TQCC 1T7VA 3PJSA 1K2DB 5C07D 5IF0B 2PYEA 1RAMA 3WFHA 2WLYA 4QYOA 3ULVC 3ZHKA 4K94H 2WUBH 3SPVB 3S5LA 3HFML 1D5XB 2NX5B 2DQJL 1FZOB 4HBCL 1NCBH 3I6GB 5F96H 1CLZL 5EIIB 2EDWA 2DQIH 5HYQA 5TE4L 1EXUB 3O0RH 3ARFC 1WCBB 1MLCA 3HZKB 4FNLL 5FO9A 5CCKL 3ULSB 4GRLB 2EDOA 2P46B 2EKSB 2HWZH 5JW4M 4AENB 1WT5A 1J8KA 4F9PC 1NFIA 4YUEL 4NQXB 4POZD 2YUZA 1DN0B 3U2SB 1HDMB 5IBLD 3C5ZB 4KRPD 1WBXB 4MAYB 1KLGB 4PD4J 4DVRH 5BS0A 4OFKA 1M71A 4PLNC 1HHGB 2CRZA 2QADB 3U9UA 4YDIH 3RI5F 4G5ZH 4GAJL 2SEBB 3DSNA 5T1LB 4KI1A 4WI3A 4XI5C 1AGBB 3WJJA 4U1JA 1M7DB 3BAEL 1I1YB 4TVSa 1W0WB 3LPGA 4UV4L 1HIML 5D8JL 4ERSL 4U1IB 5CZKA 3P9LA 2ESVD 2MCPH 4NO0A 2XPGA 4JPWL 3KYNA 3HPJA 1MAKA 2HJFA 1JPFB 2UZXB 1AH1A 3RPIB 4HEME 3VFMB 3CU1A 3OHXA 1J86A 1MNUL 5CILH 5L6YL 3KPLB 4UIKL 3B2VH 4HH9A 4PJHB 1G0YR 2ZUYA 5A2LH 2OCFD 2NY4B 1JJUA 1ZT7B 3PDDA 4KZDH 5B3JF 4PRHA 5BV7L 5C07A 3SGJC 1INEL 2BC4A 4IOFC 4XNXH 4NYLA 4UB0L 5LJYH 4WI9A 1HINH 1FLRL 5EIQA 1QLRB 3PQYD 4JFPA 4YJZL 5I1KL 3BP5A 2ZKHH 2BHZA 4WV1A 5I15H 3TNMB 1DQLH 3MBEA 5BVJA 1WBZA 2KQMA 3BE1L 2PTTB 1AO7B 1FO0L 4NBXB 4TULH 1HQRB 3Q5YA 1MCPH 3OGCB 1YNLL 4GT7A 2G5BA 4JPIB 5JW4Q 3WIHH 4B5EA 5CP7B 3QG7L 2YPLB 3TVMB 4XP9H 4Y2DC 1UB5B 4PRAB 2YKLL 3JUYA 1OB1A 1MFDL 2VXQH 2VH5H 4UV7L 5IMLA 5ADPL 1CU4H 4P5MB 4JN2B 4F7MA 4I3RH 5KN5B 1IZKA 1ACYH 3GUTA 1J7VR 1C7SA 4LCYB 3MLZL 4OZFG 2FCBA 3ELAT 1JMXA 4Q6IB 5GSVA 2IMNA 4FXKA 1U8MA 4MJ4A 4U2ZA 3GO1L 3DUUA 2ICWJ 1KTLB 2YOCA 1UVQB 3SN6N 1ZWIB 1T1ZB 2AJVH 4RAVB 4PUBL 2R1YB 5DJXB 2NNAA 1BAFL 4OZIF 5BZDB 2WWMD 1T0PB 4HKZB 3C08H 1NAMB 4Z7VE 2Q87A 2NXYD 2DN7A 3UX9B 2H45A 2NYYD 2GJ6E 2A6JB 4I18A 3EKCA 4KJPC 3O4OC 4Q9BA 5D72L 4GRMA 4YR6A 2Q8BL 3ARYA 3DIFA 2CUMA 4UV4H 5D8JH 3T2NH 3I3BA 1JNHA 5BRZD 3BP7A 4Z7UF 1E28A 3QFJE 1D7FA 4OV5A 1F13A 1JGUH 3N06B 4Z0BL 3U0TA 1FCGA 3MV8E 3MV9A 5HHXL 1RZIA 3QUMA 4OZFA 5FO7B 4K7PL 2F8VA 1EIBA 2Z31B 3KPLA 3JWDH 3DRTA 4WUKL 5F6HI 3MRNA 1UEYA 4PB9H 3VXSA 3KYNB 3NAAL 5IHBA 4K3DH 2DI8A 2VLKD 4Q0XL 3F6IA 3QQ9D 4P5TD 2D3VA 4IRJB 2VXSL 3RA7L 2IPUK 2F15A 2NY3B 1G6RL 4XRCB 5TE6H 3KXFA 3GMRA 2CXGA 2WSKA 5T1DH 1FFNB 4IRSA 3GSNA 2BVOB 2B0SL 2J8HA 4JO2L 3PNWB 3WLBA 1GH7A 3EO1B 3VGFA 43C9A 4M6OL 1DUZB 1QYGL 4NKMB 2DQTL 4L1HA 5JLZB 3UTOA 4A6YL 1SHMA 5DA0B 3S35H 2HT4C 5DJ8A 1Z2KA 3DTXB 2DLTA 1QSEE 1F3DJ 3CH8A 2VZ1A 5F6IC 5DUBB 3CVHL 4P9MH 3GIVB 2DDQL 3WKMH 4E0RB 3MRIB 5HYJE 5EH1A 2Z92A 4U6VL 1CXHA 2D7TH 4RA3A 5FYLE 5D6CA 4XGZA 1Q9OA 4CN4A 5FO8A 5D70L 3O9WB 3U82B 3OL2A 1AY1L 3AU1B 4ODWB 4LBEA 4MSWB 3QPXH 4UTAL 5I1HL 1UKSA 1CL7L 3HAEA 4PJCB 1BHGA 5BV7C 2VAJA 4RBPH 1UXSA 1M7IA 3LEVL 4NQEA 2X7LB 3L5WA 5CSZA 3TBTB 5GRZA 5IUSA 3EYQD 3IDIA 1FGVH 5I1CL 4GMTL 3UXFA 1AI1L 5JTWA 1JF1B 5ISZA 3TCLA 1CBVH 5SX4H 5FDYA 4I5BA 1ZOXA 1KCVL 2L7JA 3UYOD 4H88H 2WIMA 3QUXC 2QQKL 4O9HH 4X0KB 3MREB 4JHWH 2DWEA 2VWEC 2EDJA 2FECI 5C0DB 5IB2B 1H3PH 3GM0A 3LH2L 1QRNB 2QSCL 5IEHB 4LPYA 4PJ9A 4XNZC 5DR5H 4K23L 2B4CC 1LO3L 1U95A 3RUGA 2FJHB 3MV7E 4WEBH 1L9NA 2DTSA 5C0AD 15C8L 1BD2E 1DEEB 4WNQA 3NFPA 3AREB 3I75B 1BVKA 2BVEA 3OKOA 3SCMB 3T4YB 2H41A 1KB9J 2OTPA 1G7LA 5TE6L 3LRHA 3GNMH 4JM2A 3VGAB 3BP7B 3BGMB 5F72S 4NO5B 4JVPA 3FT4B 3RVWC 4KK6D 5TQ2L 5CINL 4X7DC 4NJAH 1KJ3L 2YR3A 4LQFL 1IEHA 3I3EA 3TO4B 2CIIB 3RIAK 2XWTA 1F4WH 4PTTB 4G9FD 3BW9B 4PJHE 4M9PA 5F89B 3T04D 1BQHG 4NZTL 2R23A 4JREC 4DGVL 4OCWH 1WFUA 4UQ2A 3L3GA 3O8XA 2JJVA 3HMXL 4NOBA 3KXFE 3HMWH 2ZCKL 4PJFA 3LQAL 4CUCA 5JW3L 2OTWB 5M95B 1XH3B 1UCTA 2A6KB 4K55A 5A16B 5T3XH 1QSFE 4FG6C 3ZLQC 5DMIL 1C12A 5ESVA 3U7YH 2YD2A 1SEQH 3KVQA 4OQTA 4H1LG 1LK3L 4KKCC 5CJOL 2HN7B 3FN9A 5HSFA 4QNPE 4LCWA 2H9GB 5DQDL 2A74B 4X6DF 1P84J 2C7UB 3O3BA 3HB3C 4J7RA 1FNAA 4NUGL 5CSZB 5JW5B 1WAAA 4MS8D 4NSKA 2EDQA 1BFOB 5DUPL 3RL1B 4TQEH 4I48A 4XGZB 5D6CB 2AS5M 2GTWB 5ENWA 2AV1B 5CEZD 3GMQB 2MWCA 4JRXA 2HLFD 2YA1A 3V4VL 1QNZH 1NMBH 4LVHC 1JI1A 2R9HC 1ZVYA 2YMXL 4GQ9H 4L3EB 3CLFL 3B4NA 5CZVL 5ISZB 4FNLH 2Z92B 3KPOA 3GK8H 3HNVH 3WUWB 1V3LA 2X70B 1ORQA 3FB8A 3BXNA 2V5MA 2PO6C 3H6JA 1A0QL 1I7ZB 5JDSB 1ACZA 5E8DL 1YMMA 1ZHBA 1LD9B 3NIGF 5D2NC 1AE6H 2MKLC 4XNUL 5E1HB 4I0PD 2IPUG 2NZIA 3LEXB 3ZKND 4DFIA 3EDEA 4PG2A 2IFFL 5EUOB 1J1XH 4NCDA 1U8OA 3L6FB 4EOWH 3QIWC 3P9MB 2IH1B 1S78D 4LCUB 3MSPA 4KK6C 2X9XA 1HEZB 1A14L 2A6DA 5E2WL 1BVLA 1AD9A 3L5HA 4G8EA 3T65A 5A2KH 5SWZD 1F6AB 2KKQA 2R2BA 4LMQE 1QBLH 5LQBL 1GIGL 2EC9T 4XXCA 3GMNA 3PDGA 4MB3A 4X6DA 4L8BA 2VDOH 2P8MB 4C58B 4R7DB 1MCKA 3HA0A 4F7CB 2E7MA 4PRIE 1DQLL 2OM5A 4CADB 4MA3A 2SEBA 3MO1A 4I77L 3RVXC 1NMBL 4B53A 4MQTB 3T0DA 3WUZA 5KSVB 3Q2CA 4PRID 5JO5B 3MJ8B 1H3PL 1J18A 2A9ML 2NXYB 4UDTB 5JHDA 3GSQA 2Y72A 2DQDL 2R0LL 2QADC 2QLVB 5T5NF 4LCYA 2EDYA 2UUDH 2XY2A 3VXMD 2OJZH 3WHXB 4RA0C 1IEAA 1SJEA 1S7TA 3ARGC 1ZLVH 4XPTL 2D03L 1AHWC 1T0MB 3ULSA 3R8BB 3MRJA 3V6ZA 3A6CH 1SVZA 5EU5B 4RNRB 2A83A 4BYHA 1UVQA 2FGZA 3UJTL 4ZFZA 3MNWB 2OTUA 4XBEH 1BJ1J 2MPAL 5FF6A 1D5IH 1EA9C 3S3PA 1MCDA 2E7LC 4HF5L 4UNTA 3R1GH 4A6YH 4EN3C 3BH9A 3C5JA 3EYOA 4LCWB 2J6EA 4S0SD 5TQ0L 1HZHL 1MCBA 2E9JA 2FLRT 1BD2A 3ARFA 2BNRE 3GGWB 1AQDA 1E27A 1KELL 4TPRH 1IILE 2FD6L 3SE9L 5T5FL 4Z77B 4CW1A 3WKML 1I1AB 1U93A 3NAAH 4OFYA 2YPVH 1NGYA 1JHLH 1RUMH 1SYVA 1XCQB 2K7QA 5IR1A 4ZNEE 2WWMC 4I2XB 5FF6B 3W2DH 1J87A 1AXSA 2UZIH 4XI5D 3ZE1E 2CO6B 2PN5A 1QLRA 1QR4A 4MJ5A 3DVGB 3NCJH 4CVWA 3P11L 3IGAA 4H1LH 1NCDH 3DROB 1U2HA 3QEGL 4JFDB 3CC5A 3S37X 4ENEC 3BEVB 4HS3B 5IROC 3ZDYF 1Q9KB 5FGCB 1CGWA 1E4WH 2YEZB 4ZPVB 5LKNA 1I3RA 4R8WL 2AXGB 5BXFA 4F33A 4MAYD 4E41B 5KVGL 5IB3B 4M5ZL 4JKPL 4JY4B 3KYAA 4LCCC 2H2PD 3RVXD 1A6UL 3MTRA 4WY7H 4ZS6C 5C0JB 1CE1L 4WWKD 1T66C 3T8XB 4M48H 3O2VL 2UUDK 1A7OH 4L4VD 1PG7X 5B8CB 1YNKL 3BEWB 2HAZA 3CZJA 3MFFA 3N1QC 3PF2A