1DBKL

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL01
5HDBE 1I7ZB 3U7WL 4MB4A 3VD9A 4DUVA 5KVDH 4JFFD 1AP2A 3EO9L 3UJJL 4IJ3C 3RJQB 4M62H 5ICXB 4IDJL 1VPOH 3LRHA 1N6QH 4RWYL 3S3JA 1F3JA 4HBCL 3QG6B 3PDOA 5A2IH 1A7QL 1SJEB 5I1HL 5GSRB 1JWUB 5L0QB 4NKIH 1Q9OA 2FGZA 5IFHH 4JO3L 1NGQL 4B50A 2P8LB 4OQTA 4HKXB 4NN6B 4YHOH 3V0WH 5D6DA 1YNKH 4N0UA 4OD1H 3FKUS 3KPSA 2AK4B 2EECA 2BNQE 4Y4HD 1JCKA 3D0VB 4JM2B 2IFFH 1QVOA 4OCYL 4WHYH 2F74A 4QRQB 3LEYL 4HCRH 3RZCD 3TA3C 5DMJB 2LU7A 3WFDH 3WE6B 2IQAB 2W0FB 2SEBA 4I0KA 3WO4C 1G6RL 4ZDHB 2W9EL 3QFJD 3MO1B 3KHOA 3WIHH 5JW4M 3T0XA 2YHGA 1KGCD 5H37H 4WJ5B 2GSIA 4ELMA 3PWUA 4MJIA 3WDHA 1WFUA 2IQ9L 1JPTL 5CGYD 1NAMA 4Z7WE 4HWEL 1CGWA 4JY6B 5C9KA 2DQUH 3FT3B 5JW5A 3R8BB 1JZ4A 1QFUL 3MMEA 2I24N 3BT2L 4KTYA 1XEDA 3I6LE 3DRQB 3OKEA 3PWPB 3KR3H 4YAQA 3F65A 3NIDF 2VLJA 1KACB 2IMMA 3PDGA 1ORSA 1PKQB 1DLHA 1U3HC 2IANB 3JVGA 2CGRH 1HQ4A 1BQLL 4LSUL 1MFDL 2Z91A 4LCWE 3BZFA 2HMID 4YDKH 4KJWD 3BPLC 5J13C 5C0DB 3LEVL 4MA7L 1F13A 4DAGL 1N5YH 3NA4A 2C1PB 4G42A 1V7MH 5BZDB 1BQHA 2ADGB 2A6KA 2E7MA 2DJSA 4HS3B 5SV4A 5I1LB 1QSEE 2XKUA 3RDTA 5CJOH 3CDCA 5HDOA 4L3CB 3HR6A 2APFA 2F5AH 3RKDD 5BMFL 1S78D 5E6IC 1D5ZA 1DE4A 4LRIC 4ZO6A 3WXVL 4ZUTB 4XRCA 4NQEB 1T03H 4Y5YB 4NOBA 1MWAH 1A7NL 3QFDA 1I85C 1MAML 1G7LB 4M7JH 3FO9A 2CRIA 2NXZB 4OLUL 4NO2B 2N4IA 5T3XL 5HGHB 4OD2A 4GSDH 2ZZUT 1CQYA 4M8QA 2NY5H 4O51B 2G9HA 2P5WA 1U8PA 2YD2A 4K8RC 1TPXC 3B9DA 1FL3B 2QQQA 4R2GD 4P59H 2CKBL 3DYMA 2FECI 1CE1H 2YR3A 1GAFL 4NCDA 2XA8L 3RI5K 3CFEB 3K8LA 1N8ZB 2W9DH 3H9HB 3VXTA 4F2MB 4HULB 2VJXA 5FHAL 4LGSB 1IEBA 4OZIF 3MLTB 3O6FC 4M93C 5LBSL 3MLYH 5I6XC 1DBAL 2AXJA 4JRYA 4P23A 3NCCB 2Z31D 3MJGX 3WFBH 2PR4H 5EUOB 1KPVB 4FXLA 2OR7A 2YA1A 4GRWB 5DHVA 2E8ZA 2AJUH 1FSKC 5JR1L 4Y1AE 4FFYL 1EFXD 2PW2A 3KWWB 1CK0L 3JV0A 2ATPA 3S5LG 1U92A 3MACH 1IC7L 2NMSA 4ZXBC 5T33H 1MIMH 4EKXA 2I9TB 1MJ8L 4OLVH 5I16A 3T2NH 1XGPB 3JWDH 4NKOB 4R4NC 3TN0A 4Q9RL 3BWUC 4YDJB 2VAAA 2XZAH 3MGOA 4G6FD 1A0QH 3GIZL 4YPGB 5L88H 5F72S 1Q9KB 3PQYD 2K1MA 3OPZH 3QFJB 4GBXA 5IT2H 2GJZB 3EO0A 1VKXA 8FABB 3IFPA 3NZHH 3TV3L 1A3QA 1MCQA 2KZWA 2HFGL 3PXHA 3QDAA 4WW2F 2DQJL 1YQVH 4HUKB 2DMKA 3Q5OA 5L2KD 5GSVB 5D8JL 3TBWB 4MJ5B 4NUGL 3I02B 1MQKL 5C7XH 5JZ7D 1F97A 4TVPE 1RUQH 2ARJA 2ESVD 2V5TA 4PS4H 1MEXL 2C4FT 2BDNL 3KLHD 4FTVE 4XP5H 4JDTL 3FONA 1MCBA 2DIBA 4KUZH 3WIFA 1NBVH 4JO1H 3ESVF 4FFVC 5ALBL 4AENB 3QDJE 3QUML 5CD5C 4MA3A 4I2XA 5TF1L 1YEFH 5I15H 3IDGB 1S7SA 2W0LA 5AZ2L 5CEZH 5E03A 4GKSA 3DYPA 4RRPG 4UU9A 5GRJL 2EXWC 2Y6SC 5T3ZL 4C4KO 5KSAA 1GCFA 4HS8L 4CMHC 1NDMB 2AQ3A 3EGSA 1KTKE 1LO0H 2ZCKH 4Y19B 1X5YA 2PCPA 4HKZA 2D9QB 4N0CC 3PWVB 3LS5H 1A3RL 2GCYA 2XZQL 5DDHA 1JN6B 3KPMB 5E8PB 5TE6H 3D87B 3OGOE 4I5BB 1SM3L 1L7IH 5GZND 1F4YH 3VH8A 1JZ3A 4JKPL 3TBSB 3LS4L 2V9QA 5E8EA 1MHCA 3L6FA 3WN5C 1U6AL 1ZA3A 1WVZA 3Q6GH 1D5XB 1GOFA 5FOBA 3I9GL 4DN4L 3GI9H 1J5OH 4BK5A 4LLUA 3GMNB 4M3KB 4G6ML 3QQNA 3M45A 3VMPA 5E4EB 2NTFB 4L1HA 1LE9A 4D9QE 3RBSA 5B8CB 1S7UB 4XCCH 5JIKA 1MH5A 3LRSB 5CFHA 1P4IH 1MJ7L 3O6LH 3S3SA 1LEKA 3ARGC 3BZEB 3MRFB 5FCSH 2RCSH 1I8LA 3VWKB 3QEUA 4O00A 3RWFB 2FH6A 2YC1B 1ONQB 1XFPA 5CJBA 3BP5B 4ZS6C 1ZLSL 2YD9A 4X6CB 3PGCB 4OAWB 4MZ2A 4CADB 4IMKC 3VDBA 3O3DA 4MNGA 3SE4C 3T2QA 3X11B 2XZCH 1CU4H 1EFXB 2BVOA 3RY4A 2R0ZH 1WUNT 5IKCB 2WSKA 2H26B 4JHBA 1AE6L 5CBAA 4U1HA 4LIQL 4YGAB 3SE8L 1QP1A 3QNYB 4PG9B 4UINH 2BY3A 4YHIB 4L29A 5EA0H 4F7PB 4JZJC 3W5MA 4JY4A 1OAZH 1RUKH 3GSQB 3H9SD 1KCKA 2A2QT 3ARBA 5GS0C 3KYOB 4JCLA 1DQTA 2W92A 2C26A 4IS6B 5TQ2L 4DQOL 1H15A 1NC4B 1Z2KA 5EZLA 2AJZA 4XP6L 4R7DB 3GSVB 4WNQB 4Z95H 3IRPX 1JRHI 4PLJC 4KU1A 4XMPH 4QTHA 3KG5A 5L2KB 4JFHD 1NEZB 3FCTB 4HWUA 1A7RL 2VLKA 3MLXL 3FB7B 4PJ5A 3NZ8B 5TDNA 1OT2A 1GRWA 4MA8H 5AZEH 3BX7C 1TXKA 4K7PL 4BZYA 1D3CA 1P4LB 2NY3C 4G8EB 1NFDA 4ONGH 1IGCH 3ILQC 5EFIB 3LN5B 3U9PL 2JF1A 2H45A 1MHEB 3QUZC 4GMTH 5LJYH 3VE0B 3EJZC 5E2TL 3EOAB 4HUVB 2DTML 3L7FB 4PREB 1OGAB 1I9RL 1AO7D 5D6CB 4QHLA 5FYJL 3C08H 2Q3AA 3GSNL 1H3PL 4L3ED 2DLEA 1MHHB 3CZFA 1PZ5A 2CDFB 4PJ8A 5TDOA 5HHOD 3V5DB 1S7TB 3P30L 5GGUA 4OCNC 3TIDB 2JIXB 4Y2DD 3ARDC 1AHWA 4MB5A 2VABA 3FMGL 3SE9H 1D5IL 3NCMA 1ZHKA 3CCHA 1UH2A 4J7RA 4WU5B 4NQVA 4OTXL 3R1GH 1JNJA 1MVUB 3AFLA 4EZMA 1AD0A 5JMOC 5DQDH 3CFDA 4Y4FD 3EO9H 3CMGA 4M7ZC 3OJMB 4IBLT 4IDJH 3RI5F 1M05A 4JFOA 4RWYH 4XPBL 4OCXL 3HA0A 2XIDA 2X10A 3GSRA 3OR7A 1W72H 5FYLD 2C3VA 3W9DA 1A7QH 1F2QA 3LKNA 5I1HH 4N68A 4U3CA 5CIPA 3V52L 1YEDB 3FO1A 3V8OA 4Z8FL 3B6SB 4JG0L 4JO3H 4ZAKD 4MD4A 2CKBA 3WDIA 1NGQH 4N5ED 3BP6B 4K23H 5ELIA 3VXSD 2D7PA 5J12C 5FO9B 3ULVC 3BP4A 2VR5A 3P40A 1YN6A 4DGIL 4PRHA 3H0TA 3VI3F 2ICWI 1MCLA 3QDMA 4FQXA 3RY6A 3BKML 5I1EL 1PGRB 4NO5A 1A4JA 4OCYH 2ZUQB 3DX7A 4F7EB 5C07D 1KOAA 3G6JF 4HZLA 4Z7UA 5KSBB 2FZ3A 3LEYH 4NT6A 5EZOL 1MFEL 1X7QA 1WIUA 3UX9B 4JPVL 4OV6F 1JGEA 1T21A 2XY2A 1HWHB 1G6RH 1T4KA 5CINH 5DGQA 2DYPD 2BVYA 3KJ6L 4KJPC 1N3NB 2IH1B 4U6YA 5FXCH 5H35B 1CFBA 2X44D 5KG9A 2IQ9H 3EHBC 1KJ3H 4ODWB 3BN9D 1TTUA 3DV4A 1I9IL 3LH2L 1U41A 4HWEH 4OZIA 1PSKL 3TO2A 5CILL 4PR5A 1DN0A 2Y1VA 5J6GA 1QQDA 3OAUL 4HMDA 4GAGL 3LKOB 4DZBA 4KC3B 1CI5A 2CUMA 3HI1A 3I6KB 1FO0B 4YZFF 3QUKA 3ES6A 1VADA 2MTPA 3MBEA 4LPTA 3WS6A 4NHCH 1N7ML 4Q2ZB 5IB4A 5IVNA 4IOIA 2HTKC 4PJIF 1MFDH 4YXLH 5DUML 4FP8H 3UYPA 3C60C 1QLRA 3QI9B 3LEVH 2Q7YB 4MA7H 2ARJQ 1Z9SA 2DMCA 2X4PA 2Y23A 3FB5A 3TNMB 1R3IL 2JJWA 3QUMA 1OF2B 2YUXA 5KSUA 3HRPA 5CGMA 4MJ6B 3KYKH 2VUOA 3PHOB 1EGJH 1YPZF 3CH1B 4Z5RA 4Y16D 4EN3C 1F6FB 3TYGL 4UQ2B 5FYJU 2EYRA 1AO7B 2ICWJ 4WW2A 5HBBA 4E41D 3STZA 4XVSH 5CSBA 3ARSA 4J6RH 1A7OL 4JRWA 2BJML 2GITA 5IGXL 3TPKA 4KJQC 4QOKE 5HHOB 1U0QA 4F7CA 5GS2H 2XWBB 1I1AC 3GK8L 4KI5D 4XX1G 5BV7B 4XPTL 2CJUL 4DN3L 3FB8A 3BIBX 1TCRB 2GSGB 2QL1A 2EH8L 3B9AA 5IW1B 5F7NC 3GMLA 1JYVA 2EDWA 4Y5VC 3GI8H 1U8KA 2AV1A 5IP4A 1WC7B 1OL0A 1UCTA 1JWMB 1QEWA 1T5WB 3ZE0E 2XA8H 1P69B 1HKFA 4PRPB 4MDJA 4OCRL 5DK2A 4KZDL 4F15C 3H6JA 4UOJA 3HZVA 3HN3A 2ADIB 5HY9B 3T0EA 5LBSH 2FEEL 3SDAA 4MWFA 3TESA 5HYJD 4G6KH 4CMMA 4QRPA 3W0WA 2WUBH 3QHFL 2WLZA 3RIFK 5L8KB 1GHFL 1L6ZA 1T5XA 4BKLA 4CVXB 2PXYC 1NBYB 4OBRA 3Q3GB 2IF7A 1KB5B 2VDMH 1JTOA 4JFEA 3VXSB 1R3LA 1RJYA 4XVUD 5JR1H 4KTEL 4FFYH 1BVZA 3TH3T 4G8GB 3EFFA 3F12B 1KN4H 1RJLB 4M7LT 3KYAA 1KCRL 1SBBA 4H26B 4NBYB 1A9BB 1MJ8H 4ORGB 4DVRH 4POZC 3U4EB 3QQ9D 1DEEB 5DTFA 1LILA 1DLFL 5E9DA 1TQCC 2J4WH 4YEFA 3HNTL 3KJ4C 2PTTA 3HS0A 1P7QB 5IMLA 1PVHA 3B8SA 5FM8A 1KIRB 2DYPB 5SWZA 3FT4B 4LCCA 4KUCD 2XWTA 2HAZA 2VQ1A 3R06B 4APQA 4ETQA 4QRSA 3EYOB 4P2QE 2NW3A 1YMHA 2H9GA 3UTSB 5D8JH 4U1JA 4PTTA 1MQKH 1F4XL 3FFCE 3HAEA 3WXWL 5J6HB 2FIKA 1CT8A 3HC0B 4QWWD 1KPRB 2G2RB 2BDNH 3HPJA 2DWEB 1RHHB 3QPQC 1TVBA 3CUPA 3BPLB 3L95A 1ADQL 5HGGS 5FO8B 1DSFL 1DBKL 5ALBH 3MRRB 3HZMB 4WHCA 3FFDA 3U30C 2FX7L 3PABA 5ICZA 2I25N 3BH9B 3LMJL 1ZGLA 3G5XA 4M48L 1HHHB 3ALWA 3L3OB 3SCMC 1O0VA 4OZGE 2P1YA 5KN5B 2IADB 2L7JA 3AUVA 3ULUD 5C0IA 3V6FB 3DUUA 4HS8H 5E5UB 5E56A 5DSCA 5SX5H 2JCCB 3OKDA 1WZ1H 4JREC 1XIWD 4LDEB 1XF4B 2DI7A 2YRLA 4X6DE 1BM3H 3RWEA 4JDVA 4JQXA 2MCG1 2HH0L 1A3RH 4ETYA 3CH8A 2R23A 1NLBH 5FK9A 5IB1A 2HTLC 3DGGB 4GKOA 2WMPA 2J88H 4E41B 5FGCB 3IJSB 5MERB 1NDGB 2W0PA 3LS4H 1F45A 1R3HA 1U6AH 5JHDE 1X5KA 1JZ2A 4KMTL 3I9GH 2QKIB 5DJYA 3GJFB 5T5NF 4AM0A 1RQ5A 2DBJA 5EORL 3L3KA 4G6MH 3ZYOA 3GKWL 4O02H 5I9QB 3X14A 5JDJA 2VO5A 2R4RH 1DQQB 3DLQR 3GMRA 4JFDA 3QXUA 5F7WC 2ZG3A 2ZKHL 4LSRL 2C7UB 2VZUA 1MJ7H 1FSKB 1A4KA 1I1RA 1OD9A 4PJXF 4P5TD 4WFEE 3WHE1 3IVKA 2ZUYA 4M1CC 3WLBB 4PRBA 5C0BE 5HYJB 1CGYA 5C0CB 3MUY1 3M1BB 5IFJB 1PFCA 1JHLH 1OY3B 2UZIL 4HKJA 4MQ7B 3OR6A 2M8XA 4A2LA 5I8KH 1Z9MA 4LVHB 4ZTOH 3EUUA 2GJ6E 2R9HD 3QCTL 4HIIA 5MENB 5IJKA 1AJ7L 4HG4J 2EYSA 3KPLB 4UIKL 4MGXA 3OAYK 3EJJX 2FYYA 3BIKA 2F8VA 4UOW1 5CKGA 5DA4A 3LPGA 3VI4E 1IZJA 3EOYG 5JO5A 1QKZL 3EYQC 4ISVB 1GC1H 1P2CB 3NIFE 2VDRL 3BAEL 4G5ZH 1JBJA 1CXIA 1OTSC 1UKQA 3O2DA 5TQ2H 4NKDB 1FFPB 5DEFA 3LZFL 3FHAA 4RFEB 1JHTA 4TPRH 4L8SB 5JW4N 1C5CH 2HLFD 3DV6B 4A6YL 3O8XA 3TT1L 2OP4H 3STBA 1WT5A 4TULL 5C9JA 3CK0H 4ENEC 3QUXD 3G6JA 1E27A 4I77H 4NJAL 4G7VL 4ZPTB 3IDIB 1I1CA 2FSEB 5CJ5A 5FYKE 2FJFA 3SDXF 1K6QH 3N9GH 3DVFA 2D4FA 3QIUA 5E00A 3VXUE 15C8H 2I60L 5IMKB 3KPRD 4YDVA 5FYJH 4U05A 2XPGB 4NFCA 4WDIB 4U6XA 1IEAB 1NMCB 1KXQE 2YKLL 2NW2B 4DOHB 2ZUUA 4PJEB 3QUYA 4XPGL 1KTLA 4M1DL 4KPHH 1U8HB 4TNWK 1RZ8B 5GS1A 5MHSD 3ULVE 4GW5B 4KDVA 2YXFA 4WEBH 1AQDB 1MHPL 4L4TD 1OSPL 6FABL 1A6PA 3VDAA 4AK1A 4R96B 3IFLL 4MJ2A 4C56E 3GMMB 2M1KA 4E42A 4HWZA 4YHMH 4PLNC 3QO0A 3RU8L 4ZUWB 4JM2F 4GLRH 5TH2B 2HJLB 4I4WA 4R26L 4M02A 4PJIA 1EAJA 4D0BB 4IRSD 3IJHB 5DD1H 5DZOA 2QSTA 1UACH 3WNNA 5JNYA 4L9LA 3MZTA 4PJFB 1XCQB 3QDGD 5A2KH 4K3JL 4Z8FH 1MCOL 2WWKT 3D3VE 4WFGD 5I1IL 4NHUB 5CBEA 4NZJA 1IKFL 4LVOC 2VDPL 1T1YA 1YPZA 2CKNA 1YY9C 4NZTL 5BOPA 2VZVA 4YXHL 3WDJA 3MRNA 1HHJA 2VXTH 4AEEA 1Q9WB 4DGIH 1PBYA 4QHMA 1IAOA 4HIJA 2RB8A 3VGHA 5ISZE 3BKCH 3D2UD 4P2RD 4QNPF 3DUSA 4EUPB 5C0ND 1VEPA 5E8DH 4FXGA 1A2YB 1G9ML 1H8NA 3CIQA 4RX4A 3PL6D 3MRDB 1CFNB 4GT7A 1P7KB 4L4VE 3ZKXB 1QFPA 4XCNB 2DQTL 3P77B 4N1HB 4YO0B 2B4CL 3O3UN 4N1EA 5DMGC 2A38A 2OBGA 5C09D 4QT5B 4WIQA 5BW7A 3I3BA 3AMKA 1J9CT 1UGNA 3C5ZB 3MV8A 3PWNB 2UY6A 3ARFC 5DJAB 1YDPA 1B6UA 2WWMC 3SGEH 3LH2H 5F9WB 5DYOB 1MLCA 3KLAB 1DQJA 3JVGC 1PSKH 4MNQE 3WIHA 3HPLA 4LVNC 1A02N 2V5YA 3OB0K 3OAUH 1BFVH 1A14L 5C2BH 2VQTA 1WITA 2E7LC 3U0WH 3C09B 1RZJL 1FYTD 4X4XB 4QEGA 3FQTB 2X1XR 3G6AA 1K4DA 3L3JB 4TUOB 4I13B 3BZ4A 3EIFA 4H5SB 3QCUL 4H25B 4J12A 3VFVB 4PGEB 2EH7L 5DUMH 3H2WA 2R56L 1CGUA 3QWOB 2EDOA 4PB0L 1ADQA 3ME0A 1FHGA 1IZKA 5EPMA 4CJ0A 1R3IH 2XWJA 3VU2A 4WUUD 3IXTB 2C3XA 4GRMA 1R24A 1R3JA 1EEQA 5LAXB 4N1CA 3O2WL 2C3WA 3MRBB 3N06B 1NJ9A 5HI3C 4AEHH 5EC1B 4D0CB 1JTTA 2G5BB 1TZIA 3FTGA 1A7OH 3DVGA 5I75C 2BJMH 1QFWL 2BXYA 3IJYB 4HFUL 4UTBL 2ICWA 4JY5L 2R2BA 3IDUA 2X70B 3V4VH 5L9DL 4L4TB 2CJUH 3AS1A 3VXME 3HI5L 4KJYB 2X6MA 4K55A 3LVEA 4MAYD 5CP7B 4AEIH 4NQCA 4I0CC 4JPIA 4RNRA 1MWAA 3UZVB 1OW0A 1A6AB 3ISWA 3TO4A 2YEZB 4GKNA 3OX8B 1ZAGA 5DEZA 5HHQA 3OKYA 1L0XA 2F53E 1JWSA 5EIIB 5IQ7L 3PWJA 4KZDH 1YJDC 3UTTE 3DMMD 4F7TB 3G5ZA 3S96B 1CLZH 2CR6A 4FFZH 1GGUA 1CXEA 5LXGH 3RAJL 5EU6D 1GXEA 3QDGB 4LMQE 2R2EA 2DM2A 4BQ6A 1FC1A 1ZLVH 3QHFH 1GHFH 2CRZA 2FB4L 2IAMD 2CK0H 3TYFA 3DSNA 2XICA 3MLZH 1A8JH 4OGYH 1HYSC 4H20L 1XGUA 3E6FB 4KTEH 4XNZB 4X0KB 4XXDA 1G7QB 4MHHI 4GBXC 5C8JA 1DZBA 4BSVB 4TSAL 3BH8B 3MV9E 3VXOB 4X4YA 3D2UB 4P2RB 3MR9A 3NABL 4PP2B 1Q9LA 4HT1L 3HNSL 2MWCA 5DUBB 1U93A 3WMSA 1DLFH 4I3GA 2Q86B 4XNMB 4PJHB 3HNTH 3PL6B 1FP5A 3FHQA 1MI5B 1PLGH 1EIBA 4NRZB 3I75A 1AFVL 5AD0B 1EHXA 1CDJA 1N5AA 3T3PF 4PRID 1VGEL 1UKTA 5T1KB 2O61B 2UYLB 3AREB 5GGTA 4K71C 4PJ7E 4U2ZA 4EI5A 4LF3A 1M6OA 2ZOLB 4PJXA 1NSNL 1F4XH 3CSYB 5HVWA 4L8DA 1T80A 3QP3A 2VIRB 1NLDL 5KSAC 4NQDD 4KWUA 2GT9A 5HD8D 1BBJA 3KPNB 1IM9A 2AJSL 1W8NA 4GMSL 3Q6FB 1FYTB 1DSFH 2A6DB 5FUZH 3N0PB 3VMNA 3F7YA 1BJ1H 5DS8B 4X99A 4XTRD 4CU7A 1WBXA 5A3IC 4FXKB 5SWSB 3GFUA 2PN5A 3ILPA 2PO6D 1DQDL 2YS4A 2A6JB 5IMMA 2Y25A 3OJDA 1CF8L 2WBJA 5E5MB 1NFIA 3H8NA 3O81A 3CXHK 3QAZB 1FE8L 4TNWF 5H2BA 3BEWB 3HHRB 3I6LD 4OV5B 1N0XH 4PB9H 5EBWA 1OAKL 3MOBH 3EJYC 1Z6JT 2EDRA 1HHIB 1ZHLA 1PD6A 1MIEL 4GAYB 5J1AB 4OZHB 3X12A 4JR9H 4BJLA 3GUTA 4N8CL 3DWTA 3NFNA 4P2OB 1SBSL 4KKCD 2JKXA 1T7YA 2QV2A 5GGRB 4X9FA 5FFLA 1MRFL 1VFUA 4JKKA 2Q8AH 4U1LB 1N4XH 2O93L 4GS7C 3LQAH 1QBBA 4KVCL 4LGPB 2NX5E 4OD3L 4JDZB 4PGZA 4X6CF 4RGMC 2BSSA 4XGZB 5EUKA 2VDQL 4MAYB 1FV1A 4H8WL 3TT3H 4YJZL 2JB5L 1CXKA 5F88A 3RA7L 3SDXA 1U58A 5F8QC 1I7ZA 5E8OB 1PEWA 3MC0A 3L3IB 3LKQA 4CBPA 4MD0B 4V1DB 2PXYB 4NBXB 3DMMB 3FQNA 5D72H 2ZPKL 1OD7A 3I6GA 5H94B 2DQHH 3IAQA 4YX2L 1UA6L 1A64A 1I1FB 1KEGH 1DJSA 1WCBA 3PP3H 1ZMYA 2DBLL 3T3MF 5JORB 4YUEH 1KTDB 3RPIB 2P48B 4HKXA 3ZKMC 4LHUD 3ZT7A 3ARBC 4I0PA 5D7JB 4JN2A 1IM3B 2QQNL 3QULB 4JM2A 2A9MH 2EXYD 3ABZA 1MPAL 3O41B 2BNRE 4R7NA 1A1MB 1L9MA 2X4TB 4XMLL 2IQAA 1AD9B 3JXAA 3PP4H 3OXSA 1RURH 1B90A 4LHQB 3ARUA 2XZZA 2UV3A 4GLRI 3LKSA 1DBJL 5E2UL 4QF1B 5C0RL 1CE6A 1KC5L 2UWEE 3BAEH 4Y1AD 3MO1A 4GRLD 4X6FB 4L8CB 5DQJB 2Q8BL 4W68A 2VR9A 3LZFH 4P3CL 4XP9H 4WJ5A 3BGFC 3TJEL 3UZEA 4PFEA 2I5YL 4PRIB 1VA9A 3P9LB 4RFOL 2R1WB 4A6YH 2R1XB 3PE9A 4CNIB 1EK3A 3WFEL 3R4DA 1JGDB 3OMZA 4IOFC 3D85D 4M6ML 2HT2D 5IBTH 3FT3A 3IXAB 5DT1L 1A3LH 3C6SB 2Q6WA 4OLXL 5EH1A 3QIWB 4NQDB 1IGFH 1JP5A 1U8NA 2E7CA 1NGPL 4PJ8C 1JPST 1A6ZB 3UBXB 2BVEA 5ESAA 1RSFA 5FM5O 4NQUA 4Y5XB 5HVFB 2XQYK 4YR6B 4HUXA 4NBZB 3KPSE 1AHWC 1II4E 2F54D 5ITFA 4QRTA 1QHOA 5EOCL 4M43L 5A40E 1I7RB 1KEML 2CXKA 4LSVH 1RJZB 1PKQA 4Z7WB 2J8UB 3F8UB 2IALB 4LSDA 3DRTB 5CGTA 2LTQB 2JELH 4TVPD 3SO3C 1I3GL 5C0DA 3PG2A 3V6OE 1BHGA 2ZCHH 4XPGH 2NY2C 2ENYA 4FTVD 3HUJE 3SDYH 3LRGA 5TE4H 1CL7L 2ADGA 4R90L 4J4PA 1BFTA 5IFAL 1OSPH 3F7RA 3QT2A 4L3CA 1BIIB 3SGEI 5HGAB 2J1KA 3GHEL 2A83B 3IKCB 5EZIH 3RHWK 3PIQB 3RU8H 2MHAB 1C7TA 4MXWL 3LV3B 4XC1L 3E8UL 1ZLVK 3DROA 5BVJA 3LKRB 2P7TB 4R26H 1G7LA 5MP6L 2RFXA 5KSBF 3ELAT 3G5VB 4U7SA 4POYA 3CXHJ 3V7AG 5HGHA 3TZVD 4MS8D 4EVNA 1QHPA 4FQXC 3RY6C 1IC1A 4JFYA 4O51A 4UV4H 1MUJA 5GRWA 4MNHB 1Q38A 4BZ2L 3ARWA 4JHWH 3MNZA 2MQCA 1S5HB 2B8OT 2VLMD 3MLSL 3QIBD 4RFNC 5I0ZA 4NZTH 2OZ4H 2MOVA 4JFFA 2WM0A 4U31A 4QGTA 3CFEA 2EDYA 3SEPA 3H9HA 3WSQH 4F2MA 3I50H 4PJCB 4W4OA 1U8OB 3VWJD 3RX8A 1OCWL 1CYGA 5F7UA 3QEQE 1C7SA 4YHLL 1XGYH 5CEZE 1G9MH 3P4OB 1OAYH 1FLTX 2FWOB 1KPVA 4YNYB 1FGNH 4D9QD 2HVKA 2EIDA 1NCCH 4MDIB 1HINL 2JTDA 3EDJA 2QSQA 4N9OB 2V9RA 1QBMH 4RGNB 5D7IB 1KJ2B 3LIZL 1AGBB 4LU5L 4PLOB 3RWCB 3ZDYF 4Y4HA 3T0WA 3P4NB 1AY1H 1V3JA 2VDLL 3CVHA 4WCYL 3IGAB 4OIAA 4M8VA 4KRLB 2FJGB 1OAXL 3MBEC 2I9TA 4PJGB 5HHNB 4YQXL 5E5RB 1XGPA 3WS6C 3RZCA 2G60L 3O4LB 3RDTD 5EOQL 1QO3B 1ZA6A 4YDJA 5LVEA 3SJVD 2JK5B 4OKVB 5DWUL 4YPGA 2ZG2A 1NEZG 5D2LB 1KIPB 3S35L 3PXJA 3QFJA 2GJZA 1HH6A 8FABA 1CGSL 4P2YA 2D0GA 2MCPH 3ZE1F 1Y6KR 3MNWA 4G80A 5F7HA 4ZPVA 5FO7A 2JLLA 1A5FH 1FO0L 5E99H 2YPLA 1KLGA 3C2AL 4U49A 4MXQD 5E94B 1IFHH 3VRJA 4NP4L 5D1QD 4HWBH 2DQEH 1KELL 5ACLA 2R56H 2D3VA 4PB0H 1QPPA 4UBDD 1DFBL 3MLWL 2PYEB 4GOSA 5ACZA 2FGWL 1AP2B 4WRLA 1NC2D 3HC3L 5ALCH 2F54B 3BSZL 2YMXL 1F3JB 3SQBA 3CX5K 3O2WH 2ATKA 1SVCP 3PDOB 4X9HA 1XGRB 1EUUA 3RY5A 3ZYIA 5ADOL 4ZS7H 2DMBA 2CR3A 2R15A 3BFOA 3MRGA 5JTWA 4HFUH 3VD5A 2XOTA 4JY5H 2DD8H 1DQLH 1BP3B 5EU7E 3MX0A 5L9DH 5JW3L 3S37L 2AEPH 3WLWD 4Z7VF 1HSBB 4XVTH 4MA1C 4OF8A 5B21A 4Z7QE 4V2CB 4FMFA 4X5XB 4OUUA 4OZ4B 1XR8B 2OI9B 1MNUL 3KPMA 5GHWH 3UTZA 1GOHA 1QVOB 3GRWH 3WS3A 3BEVA 4U1KB 1KJVA 3ZDZE 2E5EA 1TQBB 2YUVA 2VE6B 1QYGL 4PV9A 1A6TA 1S7RA 4WUKL 2Q3ZA 4JFQA 1D5XA 4PY8I 1B3JA 5C08D 5I71C 1EBAA 1UZ8A 2OSLA 2WQRA 2VZ3A 1QRND 4ODHL 3T2PA 1R5WA 5F8RC 2GSIB 5D1ZA 4ELMB 4U1GB 4MJIB 2UUDH 3TA3D 1VSCA 2FB4H 4YFLI 3E6HA 1JGUH 4LFHG 1NAMB 3DI3B 5B8CA 1S7UA 3TBYB 3CFJA 1QBLL 5D71H 4N90E 1KB5L 3HNVL 5JW5B 3LRSA 4YH6A 4O4YL 3MMEB 4KK9D 4LCCC 1BPVA 3VWJB 5ITBH 5J1TC 4APQC 3BZEA 3MRFA 4TQEH 3NABH 3RL1B 2VN4A 3OKEB 2Y7QB 4HT1H 1RZIB 5F1KC 4YAQB 1GGCL 2Z31A 4WWKC 1UJTA 3DI2B 4X6CA 4OI9A 3A6CL 4OAWA 4CADA 1K5NA 1ORSB 1DLHB 3AGVA 1RUAH 1CDHA 1EFXA 1CVSC 1AFVH 3BZFB 5IKCA 4QXGH 4OGXH 1G84A 1G7HB 1T7ZA 4IMLB 4OZFB 2BFVL 4G6AC 3BPNB 4PYHA 1JNLH 3K2UH 1LVEA 1H3VA 3LCYA 1NSNH 3NTCL 3RDTB 4UT7H 5C0AE 3GSQA 5FA3B 3ZHDA 4ZNCD 3SJVB 2BRRH 5C6TH 4EBQL 4FRWA 1UYWL 2DOCA 2QQKH 2VC2L 1BAFL 4IS6A 4XPAH 1D5ZB 3PQYA 1WAAA 4X8JA 2AJSH 4KVNH 4XRCB 4OSUL 3QWRA 4R7DA 3QFDB 3GSVA 4UZGA 4YLQT 3WKNA 4HS6B 3FO9B 4S1RL 1MFAH 2DQFA 3U7AA 2FEDD 4M5ZH 4AMKL 1YEKL 4PY8J 5L2KA 2QHRL 4OD2B 5D1QB 4KK5C 3FCTA 1BJ1J 1DANU 2G9HB 5ECJE 2P5WB 1U8PB 4PJAE 1CF8H 2ESVA 4KI5F 1IAIL 2E6PA 5EU3B 1FNLA 4G8EA 1FJ1B 5D7LE 5EFIA 3DVIA 3LN5A 3O4OB 2LU4A 4OQ1A 1OAKH 1NC2B 2EKSB 3VE0A 4L8BB 1MIEH 1J0JA 3EOAA 1CGVA 4HUVA 4GKZA 1JI2A 1IEBB 5JUEL 4D8PA 2QSVA 1SBSH 3RHWF 3AXLA 2Q76B 4OCMC 1JK8B 4P23B 32C2B 4K3DH 3B5HA 2D7OA 1CR9L 1P7HL 2CDFA 1E4XL 5HHXL 2IBBA 2C4XA 3ZDXE 5DHVB 5ABDE 1MCWM 3SDDA 4C4KT 1YUHA 4ODTL 3RVXD 3MA7A 3GBLA 3K4AA 4LPCA 4C57C 2PW2B 3MXWL 3O6FD 1G7IA 4ERSH 1MVUA 2ATPB 4H8WH 5DK0B 3CX5J 5KVEH 4I9WD 2X4NB 5I16B 3ZT5A 5GZOC 4ZUVA 5JOEA 3TN0B 4LEXL 4OM0L 4EIGB 3QWQB 4QOKD 5D96C 2VAAB 3MGOB 5C70A 2ZUTA 5C08B 3TNNB 3QH3A 2H6PB 1QRNB 1J88A 4WHTA 4Z0BH 1IILE 2XTJC 3WCYA 3IFPB 5TQ0L 1HE7A 3NGBB 3FT2A 1S7XB 3IU3A 4R4ND 1IT9L 1ZTXL 3MRJB 3BP6A 4KUCF 4H1LB 1X5AA 4HUUA 5FO9A 1JFQL 2VLKD 4LKXA 5CSZB 3EKCA 4KK6C 4YBLC 2ARJB 4EXPX 5CCKL 4LSQH 5F6IB 4E5XA 3LEXB 3FONB 1ZSDA 1U95A 1QPXA 3WIFB 5KSBA 2AJYL 3O8XC 1OPGH 1YECH 4XMLH 4MA3B 3RGVC 3VXRE 1T3FB 5DRWA 1XF1A 2FX8L 1S7SB 4J3WA 5K9QI 1KC5H 3LDBB 4XI5C 4UU9B 3E2HC 4YFLF 2DQIL 1YA5A 1MF2H 1SVZA 2EDFA 1N3NA 4AY0A 5T3XE 4K3EL 2IH1A 5FCUH 3T1FA 4FFVD 4RMQA 3GJEA 4J3UA 5CD5D 4M1GH 4U2YA 1ZHBB 4YC2C 1AC6A 3QA3B 2PCPB 1IGYA 2GCYB 3H9SA 4OB5L 2Y6SD 4LLDA 4OFIA 3ALPA 3MNVA 3BJ91 3LKOA 4JVWA 5DD5L 1NGPH 4F33A 3VH8B 3I6KA 1FO0A 1F4WL 2YPKB 1H3GA 2V2TA 4RMSA 1MHCB 3L6FB 4JEGB 1ZA3B 4M43H 4P2QD 2Y36L 3SBWC 5FOBB 5DR5H 1FG2A 4K3HA 2ITDB 4NCC1 4Z7UE 3FFCD 2P44B 1I3GH 2AGJL 1IGIH 1OTUC 3PWLB 3WFCL 1NCNA 1UH4A 1I3UA 4NYLA 3ULUL 1LE9B 3GO1L 3H3PH 1CL7H 4HK3N 3OKLB 7CGTA 3PHOA 2W65B 3QNZA 3CH1A 2A77L 2FO4A 5ANMB 4PRNB 4UQ2A 4GO6B 4CJ1A 1AO7A 1HNFA 1VEOA 4U3XA 4FQ2H 2F8XC 4L3EA 4MXWH 5HVHB 4XC1H 4NKMB 5HYSA 4HEPG 5SX4H 5ICYA 3GBML 5MP6H 5HHOA 2XWBA 4Y2DA 3O3DB 1J05A 1DQMH 3IS1X 1IQWL 3FZUC 3ARGD 4U7MA 4EXKA 3DYOA 2J5LB 1OLZA 5IW1A 5F9JB 1J18A 3S98A 4ODUB 3MLSH 2ZNWA 5CBAB 1WC7A 4U1HB 4ZS6D 2QADC 1JWMA 1T5WA 4Y4FA 4CW1B 1OGTB 1WEJL 1C1EL 4L29B 4G9DB 2D7TL 4JY4B 4Q74A 2P8PA 1JYNA 3VJ6A 4WFHE 3W11D 4Z0XB 3BXNA 4ZAKA 1A6WH 1JGLL 1FL5A 4UV7H 3Q3GA 5T3ZE 5JOFB 1KB5A 1S9WB 2XKNA 4QTHB 3VXSA 4KKBC 5I66B 1C08A 2VLKB 4RQQA 4ZD3L 3BO8A 4LU5H 4PJ5B 5INCB 4WCYH 4OF6A 1E28B 3O6ML 4H26A 4WFED 1IVLA 1OAXH 5C07A 3HB3C 4ORGA 4YQXH 5C0BD 2HKHH 4O2EB 5EOQH 1K3IA 3WJJA 3DX6A 2HG5B 5DK3A 1JE6A 5B38B 1EO7A 3BKJH 4KKLC 5LQBH 4JVUA 1KIRA 4EOWH 5CHNA 3A67L 2NY3D 1CGSH 2DYPA 1WFTA 3FT4A 3MGAA 3ILQD 3CZFB 2V5RA 1FC2D 3QNXB 1NKOA 3IDXH 2OM5A 3DO3A 2OK0L 3EYOA 5GGUB 4F9PC 3EJZD 1AHWB 2VABB 1ZEAH 3K1KC 3KLSA 2BP3A 1KELH 5F3HB 3BD4A 1JF5A 2JE8A 3IRZA 4RWHA 5IVXF 5J7CC 3HC0A 1L7TH 1KPRA 2G2RA 1AD0B 3DURB 2E8YA 5IHBA 1GPOH 3CFDB 3H9YA 3HMXL 2WUCL 1NUGA 1FFQA 3HZMA 4I8DA 4G7YH 1M05B 2NY0C 3MJ8A 2PETA 5EN2B 3GSRB 3OR7B 3L3OA 3S4SA 3W9DB 2EC9U 4KRPC 5KN5A 3MV7E 1CD8A 5IBUB 5CIPB 2ERJB 5ADOH 2DQGL 3FFCB 2VISA 4KGLA 1MCWW 2JCCA 5KVGH 1A21A 3H42H 5FYKD 1XF4A 2AXGA 3IF1B 1KIQA 4R0LC 4HMCA 3B43A 2X9WA 3BP4B 3U1SL 1YN6B 4LIQE 4Y16A 4PV8B 3WEXA 4FQIL 3H0TB 4OIBA 3VXUD 1MNUH 1S9YB 1H5BA 1WGOA 3QDMB 4NO5B 1A4JB 3DX7B 4R9HA 1WBYB 5K9JH 4HZLB 4UDUB 3IJSA 1CICA 2FZ3B 4HDIB 4NT6B 3MRPA 1NDGA 1QYGH 5TE7L 3JWNC 4FQCL 5KS9E 3GSOB 5FKPB 4LLWA 3ULVD 1DN2A 2NY7L 1CLCA 2EE3A 4HLJA 5L7XL 4HGWB 5BS0E 2QKIA 1R0AL 2DLFL 1NCAH 3GJFA 1TETL 1CFVH 3TH4T 4C56D 3RP1A 2NXYC 4U6YB 4WY7H 3C8KA 4EUPG 2E9WA 1JMXA 5KG9B 1RPQA 4AL8H 4TTDD 2OYPA 3UC0L 1UEYA 5IESH 1MCPL 3D1MC 2FX9L 4OZIB 4JHAL 3TO2B 3HNVH 4PR5B 1DN0B 1BBDH 1QQDB 1XZ0A 1ZLWK 3KDMA 4KJPD 3BRFA 1RY7B 1NGYB 3FN9A 3NCEB 3HI1B 3EHBD 1AQKL 5HYJA 3D3VD 3VRLF 3QUKB 4KHXL 4EI5C 2BSRA 3ES6B 1VADB 5FYJE 1V05A 3MBEB 3LD8B 3M1BA 4HGMA 2EEBA 5GRUH 3RVTD 3EYSH 4CVWA 2EDTA 3MJ9L 3SKNB 2R0KH 2CSPA 5IB4B 3C6LD 5CJQH 1A9EA 1C5BL 5AEAA 4RISH 3QJHA 4AT6A 4KFZC 1XT5A 2GAZB 1FNSL 1QR1A 3N1QC 5ISZD 5L2JA 4CGTA 2X4PB 4OLYL 4UAOB 5J06A 3FB5B 1J0HA 3EW3B 4MX7B 5JPNA 1VHPA 4KMQA 4Z5RB 2XA3A 5IHLB 1J1OL 4L4VD 4Z77B 3L5WA 1P2CA 2WBJC 1UYWH 4EBQH 5IEKA 2EYRB 2VC2H 3F7VB 4WW2B 1NGZB 2V7NA 4JGUA 3STZB 1FFPA 1PKOA 4CRPA 1I8MA 2YZ1A 4L8SA 4DWHA 4Z76B 4P99A 4XX1E 2D03H 4XCEA 4AIXA 1HXYA 3MUHL 1HHGB 4Q6IC 4H88H 4AMKH 2QHRH 5IR1A 5D70L 3FB8B 4MNQD 3MODH 1CLYL 25C8H 3U4BL 1XAUA 2GTZA 1MCIA 4NZDA 4HC1H 4ZPTA 2AV1B 5SWQB 3MRHA 4KJQD 3NN8B 5IROA 5F7KC 4MDJB 3F7QA 2X41A 3HFML 5T1MA 2HRPL 3VFRB 5IMKA 2XTJE 4D9LH 4OJFL 5I1KL 3HZVB 3TGXA 4X6BA 3T0EB 4LEOA 5IV2A 3SDAB 1IEAA 4MWFB 2NW2A 5IVOA 2Z93B 4CMMB 1CR9H 1VGKA 4QRPB 1X5LA 4K8RH 1PZUB 2HN7B 1FAIH 1RZ8A 1T5XB 2FBJL 5IB3B 5T1DH 5CP3H 1XIWA 1RJYB 4ODTH 3E1F1 5HDBF 1RZ7H 2YWYA 2XG5A 5L0QC 3PGFH 3EFFB 3GMMA 3AROA 3HZKA 2ADFL 5T1LD 5TFSL 4Y88A 5IHUH 3L5IA 4NN6C 4EQ2A 1PW3A 5TH2A 2HJLA 4U1SA 3VFGH 5DTFB 5E9DB 3HE7D 1KG0A 1LQSR 5J56B 5IMLB 3VXPB 2N7AA 1NPUA 2VR4A 4BA8A 4RA3A 4JM2C 4MCZA 4X7EC 3VXMD 4PJFA 1FZOA 5SWZB 2XWTB 4NHUA 2O5XH 2VQ1B 4HLZG 4F57L 3T0VA 1SY6A 3B2VH 4QRSB 1DL7L 1UCBL 5BOZG 1IT9H 3D9AL 4JO2L 1ZTXH 2EDEA 4KQ4L 4A2MA 2R8SL 1YMHB 1J0IA 2H9GB 2B4CC 2X05A 1JFQH 4PTTB 3HAEB 2F53D 4NNXA 3WNKA 3UTTD 2AEIT 1IBGL 4JJ5B 4RMWA 4P5TA 1ZT4A 1TVBB 3CUPB 3L95B 1G7JA 5D7KE 1NCDH 2AJYH 1ZS8A 1R5IA 1A2YA 4K7FB 2PKDA 4NOFA 3UYRL 4OLZH 4WTZA 4UTAL 3MJ7A 5ICZB 2E6QA 4PBWD 2VUYA 2DN7A 3G5XB 5SX4I 1CFNA 4OCWL 3UTPE 3RJDA 5FV1L 1RZJC 5B4MC 4WI4A 4NRXB 2X9XA 2HVJA 3QPQD 1BREA 3KPQB 3OTTA 1OM3H 3MV9D 5DSCB 5TDPB 2IPTL 3PWNA 1AGDB 3SQOL 5KANG 3ZZ1A 5DYOA 4KY1L 4JDVB 5I18H 3FB6B 4OB5H 4OFVA 5IOPA 2R23B 3VGAB 2VDNL 3GNML 5F96H 4X8XA 4L4VB 5HHPA 3VFSA 5DD5H 2HT4D 1NMBH 3PUCA 4HPOL 4J4PC 1S7WA 3L3JA 3P73B 3IU4L 1R3HB 4TUOA 4C54A 4QTIL 3AM8C 4H25A 3VFVA 4KKNA 2AABH 3JSSA 5I1DA 1VB9A 5IVZA 2R0WL 3OB8A 5DJYB 1E4JA 2CIKA 1KSRA 2DWDB 5C0EA 3QWOA 3QUXA 5B3JF 5DJCA 4G9FE 3HMXA 4Y5YC 1HDMB 1R5VA 1JPGA 3X14B 4ZFOB 3ZE2E 2NXZC 4NWUL 3QG7H 3ARRA 5KAQF 1QRKA 1J1XL 5LAXA 1EBPA 1JUFA 1VERA 3KPRA 5EC1A 5C0GB 2ZSVA 3A6BH 1RHFA 2WBWB 4LLQA 3FQXB 4LCYB 5DHYA 3RVUC 1RJCA 2PYFA 2X70A 5BRZD 2JB6A 5I8EA 4HKJB 3OR6B 3REWA 1KTRL 5IVXA 1LO4L 1KFAL 4W4OC 4L4TA 43C9A 2H8PA 5GGVH 4KJYA 3F5WA 5CP7A 2WW8A 5D2NA 1MQ8A 2Q87A 4GXVH 1WLHA 4GXUN 2EYSB 5AWNH 1SMAA 5FDYA 3P9WB 4M1CD 1A6AA 2QHLA 1L9NA 2GQHA 4MXVF 3BIKB 2AEWA 1HYRC 1INDL 3SDCD 2Y4SA 4LPXA 1C1EH 3OX8A 5JO5B 2D7TH 1QOKA 2BVTA 3HE7B 5EIIA 1ZANL 3J7HA 4F3FA 4HSQA 4IRSA 4GG6E 4AQOA 3AY4C 4J1UA 1RIHH 1CFSA 2WIMA 3VXMB 2RJMA 2OR9L 3QDGA 3MOAL 1S9VB 4F58L 1LK3H 2ZSWB 4PP1D 4GW1B 2AS5M 4YGVB 5ETUB 4ZSOA 5C9JB 3EYQD 3E6FA 1L4IA 4ODXA 4X0KA 1G7QA 3NCBB 5DGRA 3S88L 5KVFL 4KI1A 4ZD3H 4P4RB 1OTSD 4PGBA 4XBPB 3ZYJA 3G6JB 1E27B 5GRVK 4BSVA 3QZWB 3FAWA 1OP9A 5DHXB 4HPYL 1KJ2L 5GS0H 3D2UA 4P2RA 2IH3A 2FJFB 2BERA 2Q86A 4NQCE 1JZ7A 3QIUB 4PJHA 4XNMA 5E00B 2ADJB 5IEHB 2IG2L 2J7LA 3PL6A 1ROWA 2FBOJ 1BJMA 5A16A 4PJDE 4YDVB 2P5EA 2P47B 4LSSH 4NRZA 3RUGE 3P9MA 3WYRA 1P4BL 2DQDL 5C09A 1WIOA 4ODBD 3QUYB 2BNRD 2A9NL 1KTLB 3UBXG 2O61A 3MV9B 2QSCL 5GS1B 2OK0H 3MOQA 1MCFA 1SEQL 3MUGB 2BSED 5IUSA 4N0FA 3CSYA 4L9DA 4K94L 4NGHL 5K9OA 2VIRA 4DW2L 3K2MC 2D7NA 1QSFE 4E42B 4HWZB 4KJWC 3P0YH 3QO0B 1LP9E 1B0RB 1T04A 2HWZL 4PG2C 3Q6FA 5EC2A 1FYTA 2GHWB 4M6OL 2CMRH 1TCMA 4L1DA 4PJIB 1IGML 3MRMA 2VZ1A 1MJUL 2A6JA 3RKDC 1A6UL 3FOMB 4ZYKA 5JNYB 1S78C 4L9LB 2OLDA 3VD4A 2B5IB 1YMME 5E5MA 1RUPH 3TJHD 3AMLA 5DLML 4U1MA 1T1YB 1YPZB 4JQVC 4DGVL 3OV6A 4HK3J 5DRZA 4OV5A 5F9OL 4WUUA 2VXVH 3C8DA 5EG6C 3U1SH 1UFUA 4H8WC 4GAYA 5J1AA 4OZHA 4OF5A 1EERB 4HIJB 4QHMB 1G7MA 3CAFA 4YBQC 5E4EC 3DUSB 3QEHA 3OGCB 1YY9D 4O9HH 3KXFE 4FXGB 5B8CC 2AXHA 3LHPH 1GSMA 1ZLUK 5BRZB 3I2CL 1H8SA 1M7IA 4M7LL 2DLFH 3LKPA 2EE6A 1IRAY 3GRWA 2XN9D 3T0AA 3X3GH 4MAYA 3RWGB 4YHKH 5KJRL 4ODVL 3VWKC 5TPWH 3MV8B 5E8OA 4CVZB 1YDPB 5E2WH 1M4KA 3UC0H 3SDCB 5JA9A 1MLCB 1EFQA 1QLEL 5JXAH 2FX9H 1DQJB 1NAML 5DVNA 1FYHB 3HPLB 5HHME 3DMMA 5DMGD 4BQCA 2J3SA 4XP4L 5H94A 4GW4B 3TC9A 1AQKH 3RQ3A 2BCKB 5EU6A 3FL7A 1X4XA 4KHXH 3G6AB 2HFTA 4UUJB 1BIHA 3BZ4B 1KTDA 3RPIA 2IAMA 3VCLB 1IKNA 1TMCB 3AU1A 4ODSH 3MCLL 2ORBL 2FJHB 3CD4A 5A43C 4RBPH 1CD0A 1J1PL 3QULA 3F6LA 1JPSH 1FNSH 3DXAE 1BGXL 4DKEL 3O41A 4OLYH 1Z0NA 1SJHB 2ZCLL 1IMHC 1FZMA 4P5KA 4P46D 1OVZA 5CEZD 3RVVD 2E7BA 2OL3A 5LG1A 4M6AA 5DD3L 4GRMB 4ESKA 1UWEL 4IIQB 1R24B 1R3JB 3IAPA 4YXKL 2A0LD 4FQQA 1AI1L 5JZ7C 5KZCD 2W91A 3MA9L 2Z0BA 1S3KL 2AK1L 1K8IB 3KLHC 1KENH 3B9KA 4U6HA 1TZIB 4X80H 3FTGB 1XF5B 3OAZK 2ICWB 4HKBA 1FIEA 2AJXH 2R2BB 1U8LA 3VDCA 1FRGL 3EBAA 3TF7C 3P4MB 1K8DA 4ZODA 2EZ0D 4WTWA 5D70H 1AXTL 1CLYH 1UKSA 1VEMA 3U4BH 4OFPA 1BQUA 4H0HB 4JPIB 1HZHL 1MWAB 3WBDA 1A6VL 2X5PA 3L5XL 1WFOA 1WFNA 2CO7B 4GH7B 1AGEA 3TO4B 1KJMA 3UBXA 1JV5A 5IK3B 3HG1D 2Z8SA 4GKNB 2AK4E 4NQXB 5HHQB 4FNLH 2B2XL 3CDGB 3THMH 1T83A 1JWSB 3O6KH 1I7RA 3MJ6A 3PWJB 4ALAH 5DJ6B 1RJZA 4Z7WA 5I1KH 1E4WL 2PO6A 1FH5L 2IALA 5C2UB 2KUTA 1CTNA 5GZNC 2R2EB 1OP3K 1Y18B 4LLMB 1ED3A 2FBJH 1Q0YL 3TYFB 5FDWA 4CVUA 4PPTA 4X6EB 4I0PD 5IG7A 1FZKA 1WTLA 2QQLL 4XXDB 4NN7C 2Z9TA 3FQWB 1YY8B 3D39D 5C8JB 1NCTA 1M1SA 1MJJA 5HGAA 2YRZA 5KBNC 2Z4QB 2A83A 3IKCA 1HXMA 3U36B 4X4YB 2I9LB 3MR9B 2ZUVA 1UJ3A 2IWGA 1JF1A 4QRUB 3FQUA 3UCRA 4KMLB 2P7TA 3RPKA 3G5VA 4LCIL 2AI0H 2PUQT 3VRLE 4PUBH 4Z7NE 2QTEA 1FLRL 2Y06L 2EICA 3VW3H 3GMOA 3I75B 2XN9B 2XRAL 2DI9A 3PWPE 3OHXA 3P0GB 1HSAA 3W5NA 3OKMB 4F57H 1UCBH 1AIFB 3D9AH 4JO2H 1PKQE 2IANE 4KQ4H 1W0YT 4BYHA 4F9LA 1RMFL 4KHTL 4LF3B 1MFCH 1IAMA 4PJXB 2OMBA 5CUSH 2FATL 4HXAH 4L8DB 1MFBH 1URLA 3EYFB 1ZGLM 3DSFL 2G75B 2O5YL 1HQRB 3ZTJH 1A7PH 2CRMA 4X99B 4OZFG 1WBXB 4UB0H 5HI5C 2FWOA 3U0PA 2H2SD 2JJSA 1B4RA 4OCWH 4KZEL 4MDIA 2LQRA 1J8HD 4LHUA 5IMMB 4NQEE 4N90D 5CZVL 1D6VH 2F5BL 5I30L 5GISL 3ROLA 3OJDB 5FAAA 1U8IA 2DIJA 5FUOH 5HYIA 4HQQH 4TUJA 4LOUD 5E24E 5I19H 4S0SD 4P9ML 5H2BB 3EOTH 5FGBC 1NL0L 4BZ1L 4P46B 5GIRB 1QO3A 5F6HI 3NPSB 3IDNB 3X12B 4XZUB 2VDNH 4KROD 3QI9C 4YWGH 1G7PB 1KIPA 3EDEA 2EYTB 4Y1AA 4GRLA 1I7TA 43CAB 1Q1JL 3HZYB 1KLFA 4HPOH 4KTDL 2YD4A 4QTIH 1CN4A 3EJYD 5JQ6H 3IDJA 6CGTA 12E8H 5J11B 4DKAA 4PLKC 3D85A 1OP5K 4XXCC 5C0AD 5EUKB 3KPOA 1FV1B 2HRLA 3OL2A 1YYMH 4OM1H 5EBLB 2C3GA 5EUOE 5F88B 3SDXB 5MEOA 1VFAA 4GRWE 4L3AA 4XCFH 1FVCB 3LKQB 3HG1B 1HIML 4NWUH 2KPNA 2F54A 1TJIH 5BV7C 1SJVA 4IRJD 1J1XH 3ZKSD 3FQNB 1XGRA 4P3WA 3I6GB 3Q0HA 3A6OA 4ZTPL 4NC2B 4UNUA 4WV1A 5IJVA 3UDWC 4YDIH 1WCBB 1AGFB 2PW1A 1MCSA 5ESQA 4FTVA 4YE4L 2GK0A 4D9RE 3QFJE 5EWIL 4I0PB 1HSBA 4JN2B 4X5XA 1B2WL 3BMVA 3ZE0F 3D39B 4OZ4A 1XR8A 1X5ZA 4NN5B 1OARH 2GUOA 1OQOA 1UM4H 2OQJA 3F7PC 4R7NB 4U1KA 4NZRL 1LD9B 1RIUL 2VE6A 4N5EC 5GRYA 2NY1D 3TVMD 4F7MA 1J87A 1L6XA 3OXSB 3QHZH 2EDLA 5F6HJ 3LKSB 4I18A 4H1LG 1CE6B 2VXQH 3W81A 1IGJB 3TZVA 1V8HA 3BPOB 2J12B 5F1NA 2OR9H 2VWEE 1JMZA 3RWHA 2LABA 4JANA 3TEUA 3SE3A 2IMNA 2YPLD 3QIBA 3QXTA 5DJ8A 2GY5A 1BJ8A 4NQSA 4RDQG 3TBYA 1PX3A 3S88H 5KVFH 4MQSB 4R97B 4P3DA 4EDWL 2Q6WB 1I7UA 1YEGL 2XNAA 5I73C 4KQ3L 4I3SL 4HPYH 1KJ2H 3IETB 1U8NB 3V0VA 3VWJA 1U42A 4Y19E 3SOBL 5ESAB 1A47A 3RL1A 2Y7QA 3BN9C 2FCBA 4HUXB 1RZIA 4QHUA 5ITFB 4QRTB 1KULA 4JKMA 4IOFD 4XNUH 3KAAA 3QR2A 4U6VL 2NY6D 3MLRL 1J8HB 2YN3A 4FS0A 2BOCA 2F15A 1UM5H 4NQTA 1G7HA 1P9MC 5FGSA 1EAPA 3VH8G 4QYOB 2QSCH 4IMLA 4OZFA 3INUL 2ZG1A 5B3JE 3MFFB 1F11A 4AQ1B 1NUFA 1NH6A 4NM8H 3CLFL 4X7SH 3VXRD 4GAJH 4LP5A 2CK2A 5FA3A 3CFBA 3JUZA 3CC5A 3SJVA 5JXED 1HK6A 4FQJL 4MAUH 4KROB 2IEPA 2DQCH 3QRFM 2HWZH 5GS2D 2R29L 3V7AE 4J23A 5T3XD 3CMOL 3DROB 5BVJB 4OZGF 4DK6A 4XPHL 3QB7C 1BD2E 4JAMA 4HS6A 2RFXB 3VXQB 3MBXL 3NAAH 3NIGE 1IGMH 2DLHA 4EVNB 1MJUH 1UADC 5D1QA 1A6UH 4R4FL 3TFKD 1X5IA 4JFYB 1MUJB 5C0AB 5D1ZD 1DBML 5HPOA 4X6DF 3MNZB 5CJXA 5EU3A 1GGBH 3VFPB 1FJ1A 4B7LA 3KGRA 1MREH 1I1YA 1W72B 4R8WH 5DRNB 4JFFB 3SY0A 5F9OH 3VG0L 1NC2A 2EKSA 5HYEA 3C5SA 4OQTH 4WI7A 3LAFA 5F89A 2FL5A 4L8BA 4OLWL 4KI5C 4MXVE 4IRJB 2DLGA 1T2JA 3NFSH 3B2UC 3HE6A 2C1OA 1G0XA 4DTGH 2Q76A 1JK8A 4XAWL 32C2A 5I9QC 2P4AB 2AKRB 4O58L 3TIEB 5TGBA 1X5HA 1CD1B 2B20A 2O26U 4M5YL 2IGFL 3WHXA 3L5HA 2HVKB 5GGSA 4Q0XL 3MUJA 1GVIA 4NO0D 1CIDA 4Y4HB 5KJRH 4XWOD 3CVHB 4ODVH 5DK0A 1T0MA 4TSBH 4P2CG 1UM6L 1WWCA 2X4NA 2R0LH 3BUYB 4JGJA 3GBNH 5GGSY 2FHFA 3MRCA 3K1DA 3RZCB 4TTGA 3K0WA 3TVMB 2NY1B 1ZA6B 3RWJA 4LVHC 1HI6A 5ILTL 1KCSL 1NAMH 4XVUC 2FD6L 1BFSA 5C08A 3TNNA 4S1QH 4JG1L 2H6PA 4XAKE 5DZLA 2DKSA 1QRNA 1HH6B 3NCYS 3QWRD 3MNWB 4G80B 4LLYB 1S7XA 4ZPVB 5FO7B 5D4QA 1OGAE 3TA3A 2YPLB 3MRJA 1ITCA 1KLGB 3DECA 4XWGL 1E4KC 3O2VH 5IMOA 3VRJB 1JF6A 5BJTB 3TWCL 4H1LA 4U1NB 4WI5A 4ZOCA 3MCLH 5CSZA 1VFOA 4OF0A 5B38G 5EO1B 3EOBB 3VI4F 4DKEH 3B3IA 4L8SC 2ZCLH 3LEXA 3VD7A 4WFHD 4D94A 2AV7A 5ACZB 4GAFB 4BELD 3NIFF 4JLRA 5AYUH 1ZT1B 4LAJH 5DD3H 4ZFGH 4YXKH 1T3FA 2ATKB 1AI1H 1DCLA 3B9EA 3D5OF 5FECB 3MA9H 2NY6B 2VXUH 1JTPA 5FM5M 3ULSB 1ZKAA 4ZNEE 4LNRA 1FFRA 4ONHA 5DI8B 2H2PD 3MRGB 3FO2A 1FIGL 5IROC 2LE9A 1C5DB 4QHNB 1FRGH 2GK2A 3SDDD 1ZHBA 1YEJL 4PTUA 4HFWB 2ICEB 3QA3A 3VFWB 5DVOA 4OUUB 1D9KD 5INDA 1NMCC 5IBUG 1FORH 2O5ZL 3L5XH 4PYGA 3UTZB 3ULUC 3BKYH 3WS3B 3BEVB 4U0RB 2COQA 1KJVB 2VH5H 4RGOL 3QO1A 3FAXA 2F19L 2YPKA 3WUZA 4PV9B 1A6TB 2B2XH 4JO4H 1S7RB 1CDCA 4JFQB 2E27H 3JUYA 5IW3A 4ACPA 1UZ8B 3JV4A 4GJTB 1SEBA 1E4WH 2ITDA 2OSLB 3MCKA 2L0DA 3ULVF 1JNHB 4LMQI 1R5WB 4CKVX 2IPUG 5D1ZB 3PWLA 5TF0A 4R2GB 3BVNA 2XV6B 2R69L 3E6HB 2W1NA 3OKLA 2AJ3B 3IDYB 1TNMA 2V7HB 1QA9A 5E08L 1AR1D 1MY7A 2W65A 2CPCA 3CFJB 3RNQA 5ANMA 1TZGH 5FYKL 4PRNA 5K93A 1IARB 1Q72H 1YJDH 3MV7D 2R4SL 3O0RL 3OKOB 4G3YL 1UB5A 2DLIA 2EDBA 4HIEB 5EO0A 4Q7DA 1H8OA 1KB9K 2BX5A 4NKMA 1NCBH 5FHBL 5JQHC 3UO1L 1N2RB 2Z31B 5AG8A 2W38A 2NYYD 3DTXB 3VFUB 4LCIH 1K5NB 4R4BA 3BP7A 2M2DA 4HF5L 1F90L 4OGAC 1J8KA 5HYQA 4LAQL 2APVA 1EO8L 4AIZA 4BH8B 3O6FA 5BXFB 1MELA 3MRKB 4YPJA 1TJHH 5D7SH 4Q9QH 5F9JA 4ODUA 4IOSD 4WWKD 1CBVL 4CW1A 4FABH 1OGTA 4G9DA 3UJIH 3ZKXC 4XMKH 4CUCA 2ICCA 2FATH 3V2AR 7FABL 4QOKA 2R9HC 4G6FB 3UJTL 3MZGB 1BFOB 5L6YL 1VCAA 5BS0D 1PQZA 1BF2A 3PQYB 3DSFH 2DM7A 4X8JB 2O5YH 3C5ZC 4JZOB 4O5LL 4Z0XA 4G6AD 2J6EL 2DDQL 5F9WC 5EZJA 2DQFB 5JOFA 4PY7B 1S9WA 5I66A 5I30H 5GISH 2FECL 3C09C 1DVFD 4LPWA 2ESVB 5INCA 5HHOE 1E28A 3U7YL 4P9HL 4P9MH 4I48B 3SKJH 4YFEA 1RIVL 1WWBX 2HLFC 4QXUL 3CFCH 1LDPL 3IFNH 4BZ1H 4O2EA 5FYJD 2VMFA 3W2DL 1LMKA 2EDJA 2HG5A 2B0SL 3ECBB 4GKZB 3X17A 5B38A 2VDKL 4HEME 4D8PB 2FR4B 4D2NA 1LK2A 3AXLB 2NY4D 5GJTL 4PRPE 2EDQA 5M95B 3CGTA 2DLTA 4KTDH 3QNXA 3R0MA 2ZJSH 4PJ9D 1T2QL 1YNLL 4R6UA 1RV6X 4XPFL 2DKUA 2I27N 3FOLB 3GHBH 1EX0A 3SDDB 4JRXD 1HKLL 1YUHB 1H3TA 3ROOA 2V17H 4PGCA 3MA7B 5F3HA 4D3CL 1BZ9A 1D9KB 1G7IB 4FG6D 1EO5A 2ID5A 5DURD 5I1AB 1JHKL 2VXSL 3DURA 5DQ9A 3U7WH 3VXSE 3QXAA 4GUPB 1N26A 4ZO7A 3UJJH 3EAKA 4G8GE 4ZUVB 4L5FL 4ZFOL 1I3VA 4HBCH 5EN2A 4P2QA 3BRGC 4WO4D 1MAKA 3QH3B 4NN7B 4ZTPH 3ARTA 3P0VL 3FFCA 4WHTB 4JPWL 4J3TA 1TTGA 1P84K 5LGKA 35C8L 3FT2B 4NWTL 4YE4H 1X44A 3IU3B 5D5ME 2V5SA 5EWIH 3IF1A 4HUUB 5F1OB 4LKXB 5FYKU 3CLEL 1KCVL 4PV8A 3D69B 1S9YA 2XTJD 2MMXA 4OZGA 1U8QA 3U83A 1E0OB 4E5XB 3EYVA 4Q9CA 1WBYA 1ZSDB 4MQXC 3UTSE 4Y4KD 1U95B 2F8OA 4HDIA 4UDUA 5CWSB 5DJ2B 3T04D 3GSOA 4XNZC 3U82B 5FKPA 4MJ4A 1OTTC 5DRWB 4HGWA 3HAEG 2W9EH 4X6DA 1LEIB 4GQ9L 4JQIL 5D93B 3ARGA 3JBG7 3O2DL 5GGVY 3T1FB 4P4KD 3ZKND 3S36X 3GJEB 1JPTH 3RGVD 3GGWA 1YYLL 2ZUWA 3FRUA 3PL6C 1KB9J 1UXSB 4P49A 3SE4A 4HD9A 1IGYB 4ZOBA 3H9SB 1LO3L 2ED9A 4LLDB 1F5WA 1QFUH 2JCCE 5ENWA 3MNVB 3BMWA 5JOPE 1NGYA 3BT2H 3CFKA 4F33B 5C6WH 4U1IB 3AREC 1MCJA 2UZYB 2V2TB 5KSVA 2K9UA 3O3AB 1S9XA 1B4JL 3BQUD 3KYNB 1I8IB 4JZJA 3SKNA 4S10A 1KCUL 1FG2B 3MLRH 4E41E 1BQLH 4LSUH 5FGCE 2APXA 1ZVYA 3WNPA 4PJ7F 2GAZA 2PTUA 3WUWB 4DAGH 1NMAL 5DEGB 1UVQA 1QFWM 4NYLB 1FCGA 3INUH 3BRDA 5D7KD 4MX7A 5C0BA 3QNZB 1UWGL 2FO4B 3H3KA 3K4DA 3VGFA 5C0JA 4XP1L 5BMFH 4Z77A 3UTPD 3D18B 3L5JA 3F7VA 1JJUA 2GJ6A 1NGZA 4L3EB 4YHPB 1CICD 3WXVH 3QAZC 2NLJB 2NY4B 5F7DA 5HYSB 2MFNA 5ICYB 4Z76A 1A7NH 2RBLA 1MAMH 4PJ9B 4ZFFA 1HHGA 4OLUH 4Y2DB 5T3XH 4KGJA 5LWYL 1SYSA 1J05B 3IAGC 4JRXB 5HYJE 4P2OC 1T0NB 3C9NA 5C0CE 5CIPH 5DURB 5KVDL 5SWQA 5I1GL 2CKBH 4EI6B 4Y4FB 3NN8A 1VPOL 1GAFH 1HH9A 1N6QL 3VG0H 5DA0B 5MENE 4HG4K 2P8PB 3VFRA 5FHAH 3VJ6B 4MAYC 4WO4B 3FZUD 2VZSA 2H32H 3CSPA 4DK3A 4K3GA 1JRHL 1DBAH 5IFHL 3WFZA 4MD5B 2Z93A 1UB6A 1ZVSB 2BHZA 2QADD 3LN9A 3BXNB 4ZAKB 2AW2A 4M5YH 2HN7A 1FL5B 4Z7VB 4YHOL 4YIQB 5IB3A 1JL8A 3IDMA 5B22A 2XKNB 3SKOA 4OD1L 3DMMC 4Q0XH 1C08B 1ZVHA 1FVDB 1CK0H 4PRAB 4RQQB 4JFXA 3BO8B 2IFFL 3MSPA 3C8HA 3VXUA 3IT8D 3DHJA 2M26A 2PTVA 1IC7H 3WNMA 1FNGB 1UM6H 1QUNA 1S7QA 4ZOEA 5C07B 3PNWA 5EO9B 3WFDL 4Y4KB 1ES0B 3OZ9L 5FF6A 2XY1A 5C3LD 1P84J 3U6RA 4Q9RH 3MCG1 1KCSH 3DX6B 5D7JC 2FD6H 3GIZH 3KYMB 3VXPA 3H7BB 5C0FB 3WIHL 3KNBB 4JG1H 5HVGB 4KDTC 5CHNB 3QZWG 4DCQB 3TV3H 5I73B 4C56A 3LSOB 3HB3D 3SHSA 3PJSB 2HFGH 2DQJH 3STLA 4P4KB 4NC0B 4XWGH 5F1IA 1Z3GL 2A6IB 3KS0H 4NUGH 2DQUL 3MFGB 2D0HA 4DOHE 4PJEE 3WJLC 3SO5A 1MEXH 4JJ5A 4JDTH 2J6EA 1IL1B 2WP3O 3KR3L 3D3VA 1NUNB 4IRZL 4K7FA 2UWEF 1NGWA 3QUMH 1H0DB 3BQUB 3MJ8B 5TF1H 4XHJD 3S4SB 2CGRL 5AZ2H 3K3QA 2WNGA 2VL4A 3QIWC 3C6LA 5GRJH 4C55A 1BWMA 5HD8C 2VISB 5T3ZH 4NRXA 2QR0B 1HHKA 2FO1A 4FQPA 3KPQA 4Y5XC 2WAHA 5BO1L 5ISZA 1V7ML 5TDPA 1AGDA 1T83C 2AXGB 5CJOL 4PJFE 1KIQB 3QJFA 2PO6C 5K9KA 3FB6A 2F5AL 4Y16B 2XZQH 3WEXB 2LTQC 2Q20A 3WFHB 1H5BB 4OCLC 4L4VA 1DANT 2EIZA 1SM3H 3B5GA 1MWAL 1CICB 3LPWA 4JKPH 3MRPB 4M7JL 2MSPA 2NZIA 3P73A 4MSWB 3IS0X 2WIIA 4LLWB 2X42A 2A1WL 4GSDL 4DN4H 4YHZL 4HAFA 3HUJF 5D9SA 2X4QA 3NFPB 4MNQA 2DWDA 1M71B 1QSFD 1HDMA 3RWIB 4P59L 3C8KB 3CSBA 1MY5A 4ZFOA 1CE1L 3BDBA 3K80A 3Q48A 4BQ9A 1KIUA 5B39B 3FRPA 1XZ0B 1IGTB 2A74A 3R0NA 3KDMB 3MLYL 2LVEA 2NXYD 2R4SH 3VFMA 5C0GA 1XH3A 1HEZA 3DIFA 3UPAA 1YMMD 4HBQA 3BE1L 3WFBL 2VKXA 3UO1H 2BSRB 3FQXA 1JPFA 4LCYA 3AAZB 4X83A 3V8CA 4F9LC 1ZLSH 1VACB 4ZUUB 4V2BA 2AJUL 1TVDA 2XACC 4PGDA 1U91B 4HF5H 1F90H 4NFBA 1A9EB 5HHVL 5DO2C 5CMAA 3QJHB 4WI8A 4AT6B 1A7BA 3MACL 1N6VA 1QR1B 5L2JB 1EH9A 1AE6H 5T1LA 4LIQH 1FN4A 3SE8H 3T2NL 2YUWA 3JWDL 1OHQA 2Z92B 2JJSC 3KXFD 1KT2A 2X1OA 5GGTL 5JPNB 1F6LL 2VRAA 1A0QL 3HE7A 5L88L 4RGNC 1QLFB 3G5YA 3OPZL 3HAEH 3L5WB 5IT2L 5IEKB 2V7NB 4DQOH 3NZHL 3VXMA 2EXYC 1I8MB 4O5LH 1M7DB 3ZL4L 1EA9C 4XP6H 1YQVL 4XCEB 4Y8DC 2X1PA 1S9VA 1HXYB 2X4UB 2ZSWA 4OT1L 1ZGLP 1I9JL 4GW1A 2MQ0A 4YGVA 5ETUA 3W9EA 5C7XL 5IR1B 1IAKA 2Y5TA 1A7RH 2F53A 4P4RA 4PS4L 3MLXH 4XBPA 3EDKA 2GTZB 4RZCA 5HHMD 3QZWA 3UTTA 5M7QA 1HWGB 4GG6B 4K7PH 4P9HH 4KUZL 3M17A 3FO0L 2EDHA 4JO1L 3U9PH 3MRHB 1LDPH 3SGKC 3MRQA 1YEFL 4K94C 5T1MB 5E2TH 2ADJA 5IEHA 2DTMH 1HN1A 3TPUA 3V6ZA 5GXBB 1I9RH 4XC3L 3UPRB 4X6BB 2B1HL 2GJJA 4LEOB 5IV2B 1B6DA 3GSNH 1H3PH 1X6NA 2LVCA 2V5MA 4WENB 1VGKB 3DXAD 1CD9B 1T2QH 1YNLH 2P49B 3MV9A 3PV6A 3P30H 1LO0L 4NNPL 1INEL 2HFEB 3MUGA 4XCYB 1XIWB 2VLRD 3CX2A 4KDWA 2DL2A 3FMGH 5AYQA 1D5IH 3QDGE 5IQ9B 4OTXH 1BVKA 5TE6L 2H1PL 1QFHA 1L7IL 3HZKB 1F4YL 1B0RA 4ELKB 4L5FH 4U1SB 3L3DA 3QRGL 5D6DC 4MLSA 1KG0B 4OCXH 4XPBH 1J5OL 1NUDA 4PJ7A 1EEZA 3O11A 2OI9C 4MCZB 3FOMA 3V52H 4S1DC 1FZOB 1C12B 4JG0H 1P6AB 4PJHE 35C8H 1TQBC 4Z7QF 5E1HB 1GZQA 2V2XB 1MI5E 1LP9B 4XCCL 1TITA 1MLBB 4CDGC 4YHYB 2AK4D 1YC7A 5T5NG 3OG4B 4ZUSA 1SHMA 1P4IL 4MS8C 3ARVA 3ZDZF 4NNXB 3BKMH 5I1EH 5C92A 5FA4A 2VKWA 3LPFA 4P5TB 4U1GC 4UT6L 2WINA 1ZT4B 3T2OA 3SE3C 1G7JB 5EZOH 3OGCA 1ZS8B 1MFEH 3JV6A 1R5IB 5H8DA 4JPVH 3MJ7B 5GGQL 5BRZA 2XZCL 3L9RA 2VITA 2P5ED 1CU4L 3MYJA 1FYTE 2R0ZL 1G6VK 3KJ6H 4GQ9H 3VWJC 3RWGA 2HVJB 1Z5LA 1KNOB 4HCRA 3GMPB 3O2DH 5SWSE 1OWWA 4M6NL 4MCYB 4CVZA 3IB4A 1I9IH 1SYVB 3SDCA 5EA0L 1VENA 3KXFB 4WTXA 1RUKL 4E0RB 1YNTA 1GGTA 1WZLA 5CILH 5B4MD 3RIAK 1LO3H 3C2SA 5IOPB 5F21B 5HHPB 1ZT7B 4GAGH 4GW4A 3VFSB 5E2JA 3PWPD 2BCKA 3BPNC 1DDHA 1DUYA 4Z95L 5SX5K 1S7WB 4UUJA 3RDTC 2IAND 2K7PA 3VCLA 1XCTA 2B39A 1N7MH 3GM0A 5I1DB 1KCUH 5IVZB 4HJJL 2CIKB 2FJHA 4HWNA 5E7BA 4XBGB 5C0EB 4MA8L 3ORJA 3QUXB 5AZEL 5DJCB 5DRXA 1NMAH 4ONGL 1R5VB 1IGCL 1SJHA 1JPGB 3NACL 5IBLD 4U7KA 1E6OL 4JHZA 5E1AA 1DP0A 1MCKA 5EULV 5J57B 1UWGH 4IIQA 5D1QC 1BOGA 1J0KA 1T1WA 4JZNA 3TCLB 3TYGH 4PRDB 4DJMA 1JUFB 1ORQA 1OOAA 2EO1A 3KPRB 4NSKB 4NQED 1PG7L 1K8IA 5CJXC 2ZSVB 3MRIA 4V1DE 1XF5A 5IGXH 4LLQB 5DHYB 3O4OC 1KXTB 2BNRA 2PYFB 4PJAF 2JB6B 3OBAA 5I8EB 4LSPL 3P4MA 3SE9L 3N50A 3REWB 2CUIA 2VLRB 3GK8H 5IVXB 4XPTH 43C9B 4DN3H 2H8PB 3F5WB 5D2NB 1DEDA 2EC9T 3VA2C 3VG9B 4P23C 2EH8H 1C8PA 1CGXA 2UWEA 5HI4C 2ITCB 5ID0A 5I1GH 4HIHB 3HTLX 4JKLA 5IK3A 3RVUD 5FM4A 1H3UA 4KXZH 4EQ3A 1X5XA 4UT9L 4NQXA 4LCUB 3CDGA 3HCVA 1W72L 3WLWC 3W39B 4OCRH 4F3FB 4IRSB 5DJ6A 2DF3A 3I3DA 4POUB 5F7MC 3UTQA 4J1UB 1CFSB 1KLUB 1JRHH 4OFKA 3ZDXF 4M03A 5C3TA 4WWID 1EVTC 1D5BA 1Y18A 3OXRA 4LLMA 3UP1A 4K23L 2BVPB 4ZOAA 1QFOA 5ESVA 3TN0C 1TLKA 3JWOL 4OI7A 1LNUA 4X6EA 3O9WD 4ZSOB 3D25B 4ODXB 4L4JA 3FQWA 1YY8A 4PGBB 4PRIE 4HHAB 1KCRH 2Z4QA 3U36A 3NGBC 4KRNA 2I9LA 3DVNB 1NAKL 1X9QA 3CVHL 2IH3B 4Y0GA 4HH9B 4QRUA 3OZ9H 1NFDF 3V6OA 3WO3B 4LBEA 5JPMB 1ZV5A 3HUJA 1PX4A 1PY4A 4D9RD 4NQDE 4LARL 5CINL 5A16B 1MSPA 2D2OA 4HV8B 4JB9L 2P5EB 4QRRE 3B9KD 5DVLA 2P42B 4KK9C 5F6IC 3P9MB 2XN9A 1PJ9A 2BNQD 3GSXB 5C09B 1LE5A 1P53A 3OKMA 5EOTA 1KJ3L 4AH2A 3M07A 1AIFA 1Y0LA 2J8UE 1B0WA 1Z3GH 3QPXL 3VA6A 3WXWH 3LDBC 4N0FB 4S11A 1WICA 4QCIB 5K9OB 3EYFA 4BQBA 4PD4J 5CEYB 3KS0J 4X5WA 3K46A 2AVGA 2G75A 1ADQH 1T04B 5EBGA 1HQRA 4NDMB 1IAIM 5EC2B 1R3KB 3DETD 3ARFA 4IRZH 1DBKH 3BYTA 2FX7H 2QJDA 5IIEA 4NHCL 4W81A 3LMJH 4M48H 5DJ0A 5F93C 4YXLL 3MRMB 4FP8L 4ZYKB 2OMNA 4KV5E 4DGYL 2E7LA 2EE2A 3GB7B 5BO1H 5EIQA 4U1MB 1J0ZA 4Y19D 1CDIA 3QEQA 2L7UA 3KYKL 1EGJL 5DRZB 3CSGA 3K7UA 4P46A 3V95A 2FEDC 4LLVB 4WUUB 5GIRA 1CS6A 5F3BA 4NUJA 2K3TA 2HH0H 3IDNA 4XZUA 2EDNA 1G7MB 1G7PA 4XVSL 4J6RL 2EYTA 4O2CB 4LCWD 4X9GA 3QEHB 2DRUA 43CAA 3HZYA 1FGVL 4Z7UF 4HXBL 4PJCE 1MCDA 4KMTH 2A1WH 2CLZA 4B53A 4YHZH 2UZXB 1M7IB 3O3EB 3LKPB 1QSED 4EDXB 5FGRA 5EORH 4YBQD 5HVHC 1CXFA 1I8LC 5EBLA 3GKWH 3GI8L 3GSUA 5DJXA 3EYUL 4C58B 3OJ2C 3CU7A 1T0PB 1FVCA 3HG1A 4RGNE 5D7IE 1BD2D 2WLYA 2ZKHH 3RVXC 4LSRH 1RK1B 3BZDA 5J9PB 4G8FA 4PJGE 2J5LC 3NA9L 3S34L 3VWKD 4G6KL 2ZWLT 3O4LE 2WUBL 3BE1H 5EU6B 3TBTA 1AGFA 2X1WL 2HJFA 2IFGA 5D2LE 2IAMB 2VDML 1WZKA 2UZIH 3UPCA 1LO2L 3O9WB 3AU1B 3RNKA 3QCTH 5HHVH 1KN4L 3D39A 1AJ7H 1V7NL 4UIKH 3QHTC 1FZMB 5DJDB 2N7BA 3IKKA 4DVRL 4P5KB 1LD9A 4LQFL 2J4WL 2OL3B 5GGTH 5CZKA 2KL6A 4PJBE 3RIAF 1QKZH 2PYEE 4FQQB 1D5MB 1NC4D 2VDRH 1IGJA 1X4YA 2R1YA 2NCMA 3B9KB 4U6HB 3CFIC 4WVRA 2BNQB 3ZL4H 5I74B 3REVA 2F54E 5MI0B 3RWDA 4HKBB 1VESA 1U8LB 4OT1H 3TT1H 1I9JH 4TULH 1OAQL 1K8DB 4BUGA 4LL9A 4OF7A 4XVJL 4QHKI 3T0BA 4NJAH 4G7VH 3IETA 2GFBB 4XAKD 4BFBD 1AGEB 3FO0H 1KJMB 5D1XD 1JV5B 4N0UE 3KHQA 3QXDB 1MAJA 4M61B 1OGAD 1TJGL 3MQIA 4NPYB 1KPUA 3MXVL 5A2JH 4XC3H 5CD3A 2I60H 1WWAX 3TCXA 2PO6B 1J8HA 2B1HH 3LB6C 4HW6A 2OJEA 3UXFA 1IC4L 2YKLH 5BZWA 3S7GA 4YK4B 2V2WA 4Z78B 1WZ1L 2JIXD 4QYOA 4M1DH 1S7VB 1ED3B 3UYOD 3ZO0A 4NNPH 1INEH 5FDWB 1BM3L 3AVEA 5IM7B 3MFFA 1INQB 5HGDA 1MHPH 3DBXB 4FQ1L 4WU7A 1FZKB 5IG7B 4MVBC 6FABH 3QDJD 4ELME 1NLBL 2ERJC 1MJJB 3IFLH 3A0OA 4MJIE 2H1PH 2R2CA 1KYOK 5DFVC 1K4CB 2J88L 1H9VA 3RTQD 1HXMB 2VLME 3GIVA 1GZPB 1UJ3B 4LCWB 2OTWB 1JF1B 3FQUB 1R6VA 3QRGH 5BCAA 1T66D 1FNHA 3GZKA 3CZJA 3VXQA 1FFNB 3OKKB 1BLNA 2Q7NA 1QSEB 3GMOB 5C0AA 1QZ1A 1UZ6F 2YRPA 3OHXB 2HT3D 3EO1B 1MCOH 4K3JH 1HSAB 4O02L 5I1IH 1IKFH 3VFPA 3WL9A 2VDPH 2VLJE 2R4RL 5DRNA 1W72A 1FL6B 4YXHH 5JHLL 1BD2B 2BNUB 4IRJA 4X98A 2KH2B 1DTUA 2DIAA 4QHKJ 1NKRA 4YDLB 1OSZA 1XF3B 4Z7OE 5KS9F 4UT6H 2XT1B 3PHSA 4KRMB 4LFHD 1OB1B 2AKRA 4PJAA 3VFTA 1FVEA 3TIEA 4MLIA 1CD1A 2ZOKB 3MGTA 3SJVE 1JHLL 5F7FA 3U0PB 3OKNB 5D7LA 5E6YA 5I8KL 5GGQH 3OG6B 4ZTOL 4N8VB 4LHUB 2DQTH 1XGTA 1ITBB 5I2IB 2B4CH 1GL4B 3ROLB 1U8IB 3U46B 5FKAB 3W11C 4TUJB 4U3HA 5EDXA 1BMGA 3QDHA 1Z9OA 4M6NH 3BUYA 2BC4B 3BD3A 1Q94B 3LD8C 5HI5D 2Y72A 4LGRB 1G6RA 1LWRA 1F00I 2P5WE 3TVMA 2Y07L 2NNAA 1GC1L 2RR3A 4KXZI 3S5LA 4G5ZL 1I4FA 1A14H 1KN2L 3HLAB 4Y1AB 2X89D 4GRLB 1I7TB 4UAOC 4TPRL 1RZJH 2BY2A 2EO9A 1C5CL 4RCAA 4LLYA 2FEEI 1DUZA 3B5TA 2OP4L 3AS3A 3AB0B 3QCUH 3IDJB 5E6ZA 5BJTA 3CK0L 2EH7H 4HJJH 4JRYE 4U1NA 3D85B 3G04B 3QI9D 4WW2C 4I77L 3KPOB 3VGDA 5EO1A 5HDQL 3EOBA 1RI8A 5MEOB 1VFAB 3NACH 4MHHG 4W6YB 4OFDA 2IPKB 5D1XB 1E6OH 4IHOB 1K6QL 3N9GL 5DUPL 2YUZA 1K2DB 1ZT1A 5F7YC 4PLKD 15C8L 3MV01 4NO3A 3HE6D 5FECA 2RAMA 5J3HD 1PG7H 3ULSA 5ACMA 1X6LA 5DI8A 1QFWH 1TENA 2EIBA 4WV1B 5IJVB 2FHBA 4FQLL 4UTBH 1AXSB 4KPHL 1KCLA 1EGJA 2PW1B 3OF6A 5ESQB 1C5DA 4FTVB 4QHNA 5C08E 2GK0B 2YZ8A 5AAMA 2L4OA 4WEBL 3W82A 4EJ1C 4LSPH 4JKWA 2W0KA 2ZUXA 3T8XA 1AGCA 1QRNE 2R2HA 2ICEA 4HFWA 5IF0A 4GXUM 2MKWA 3VFWA 3QDJB 4RRPA 3HI5H 3T0EC 3VXRA 1TIUA 3SDAC 3UAJC 5BV7L 5AG9A 4YHML 5BVPL 5JXEA 2GUOB 3RTQB 4N0YL 2OQJB 3X13A 4CDHA 1LO5A 3U79A 4PRPD 4DVBB 3ZKQD 2CLVB 3PP3K 4UT9H 5J0BA 4F7MB 2YA0A 5IQ7H 3ZSTA 4I18B 5DD1L 4HX1B 1UACL 1C16B 3TZVB 2CQVA 5FUCC