1DBKL

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkL01
1E4WL 5DLML 1OTTD 2QQQA 4ZAKA 3OZ9H 2YUVA 3IS0X 4XC3H 3CH1A 4UOW1 1EA9C 4NCDA 5FV2A 1HZHH 3RA7L 4Q6IB 1ND0B 5F1NA 3V0AC 2NZ9D 4Y8DC 5GRYA 3SDAC 1CFTA 4G8FB 4RISH 3RIAK 4LOUC 4GXUM 5DJYA 5TGBA 1EUTA 5J11C 3UP1A 1ZXQA 5MP6H 1FFRA 3O6LH 3R0NA 5D7SH 3HI1B 5I6XC 5JO5B 2DQEL 5ANMA 1JPFB 3ZDXF 1IAMA 3GM0A 3X11A 4OCYH 3MLPA 1RAMA 2XTJC 3QWOB 1N0XL 3ARYA 4F3FA 2IQAA 3VGAC 5KZCD 2FJHA 3A67H 3SGDI 2DJUA 1VGEH 1NCWL 1X5FA 1P84J 3NIFF 5IT2L 1AXSA 5CEYA 3U0WH 2OMNA 1D5IH 4U2ZA 4QHKJ 1TVDA 3QCUH 4S1DC 4PJHF 5KS9A 2I9LB 5K9JL 3MNZA 3KLHD 4PRAB 4PRPB 4YHKH 3TN0B 4KKLD 4TNVF 3SDXF 4KVCL 3D18A 1A7QH 1XIWB 4IOIB 3B6SA 2A74A 4WWKA 5HGBB 3ZYOA 4N5UA 4ZAKD 3X13A 2NQCA 4PV8B 1Y0LA 3FT4B 2RGSA 1X5JA 4OCWH 5HPMA 5H35B 3L3KA 2E9JA 5E9DA 4MNGE 4I3SL 1NANH 4MD5B 1JF1A 4AG4L 1MCEA 5HGGS 2J5LB 4PRIE 1U8IB 3QZWG 5IF0A 3EOAA 2GSIB 5F44A 1QFPA 3SDDD 3VXNB 4YDIH 2CGRH 3JWDL 3PGDB 1AGFB 1CGTA 5F3BA 1EDQA 1ES0B 3SGKA 4AEEA 4HH8A 2W0LA 2AKRB 4YHLH 4N8VA 4M7ZC 1PG7H 1TJIH 2X70B 1Y18A 4LSVL 1HHKB 4MD0A 5FUZH 3OKYA 4PJDE 2VLRB 1HHHB 2IBZX 4KUCD 2ZCKH 4M1GL 1FLRH 4YIQA 3SQBA 4G6JH 3V79C 4ZFGH 2DI9A 3RWHB 1HWGB 5E6YA 2WINB 4OFYD 4GMTH 4RDQF 2MQ3A 2KL6A 3QUYB 3MA9H 2G2RB 1CXEA 3AAZB 4OQTH 5BO1L 1OSZB 1UKSA 3TJHC 1F2QA 4WWKD 3LKQB 2E7LC 5KVFL 1G7PA 4TOYL 1WF5A 5TH2B 1GGIL 3S34H 2I5YH 1VHPA 1QO3A 3KXFA 1YYMH 4AEHL 3OXRB 5CLTA 5HHOB 4FXGB 4JFZL 4RWHA 5E9DD 4XMKL 2H2PC 4LARL 3B9KC 4MSWA 1FNGB 1EBAA 3PV7A 2Y06L 1ZA6A 5J89A 4KK9C 4V2CB 5EO0A 4OFDA 3MRBB 1R3JB 4LGRB 4RNRB 2FBJH 4PJFF 3WO4C 2X40A 1UT9A 2BRQA 3SKMB 1T21A 2D3VA 1AI1L 5SWQA 4G7YL 4HFWB 1CLOH 3CZFA 4XB8A 5I1HL 1AP2B 3KYNB 3TH4T 1ZT7A 2GQHA 4ZQKA 3B43A 4IIQC 1HHGA 1DANT 2AEQL 4XX1G 4CMMA 4IRJB 4MB5A 5C2BH 4X6CB 5ID0B 2DICA 1MF2H 4GG6F 4BQ9A 3UO1L 3TWCH 4U3HA 2HH0H 4DUVA 1FNEB 4XAKD 1INEL 3F12A 3QUZA 1BWWA 5F70A 3G6AA 2DMCA 4GRMA 3KYKH 4P4KC 3C9NB 4NKDA 2NLJA 5D1ZB 1KELL 2LVEA 4POYA 3BP5B 4OCRL 5E7FA 3HLAA 2DQTH 1F4HA 3MRMB 3WD5L 3MV7A 4QRQA 4L8CA 4JR9L 4XCCL 2I60L 4LRNH 1OAYH 2B2XH 3KXFD 1U2HA 2NYYD 2X5PA 4I0PC 2CO7B 4QHNA 1UQSA 3I3EA 2FO4A 2R1WB 4Y2DB 3BQUB 3MODH 4Z7NF 2XTJE 1BZ9A 4Y4HA 4LDOB 4AL8H 3CVIL 3U0PA 4CMHB 1BREA 1YMME 4M3JA 3BGFC 4CDGC 1EO8L 3HUJB 5I73C 5E8DH 5IQ9A 5ECJE 3OKEA 4NQCE 2F54E 1KIRA 1PGRB 2QKIB 2F53D 2HT4D 3M45A 4F8QA 2VTFA 3G5XB 3N06B 4LRIC 4OGYH 4XVTL 3LN9A 5TDPA 4HXAH 3O0RH 1KN4L 3LMJH 1Z5LA 3D9AH 3ILQC 4HCRA 3HZKB 2VZOA 4XVSH 4YHPA 2WUBL 1F11B 2NCMA 4UT9H 1JZ8A 3ARBC 2X4UA 3L3OB 5JR1L 1CFNB 3AS3A 2GTWB 3OR6A 1A4KA 1WC7A 2Z92A 4AQ1B 1FL3A 2BVOB 3MV7D 1ITCA 4KU1A 2XPGB 3RTQB 1JHLL 5ENWA 1J1OH 1BGXH 1DP0A 3WYRA 4NNXA 1JHKL 3HI6L 1GCFA 3KWWA 4NHCL 4ENEC 3WKNA 1TVHA 5GZOD 1GC1C 2J2ZA 1LDPH 2DQDL 4QEGA 5CJOL 4K71C 2Z31C 3MBXL 1I3GL 1U8QB 5KBNC 5EU3A 1I8KA 3IT8D 4R7NB 5DD0L 3HFML 2VDKH 4XRCB 1I8LA 1ZT4A 1XGUA 4L8SA 4MXWH 3ZT5A 5GS0D 1HXMB 5IFJB 5F7FA 3BUTA 4LLMB 1PLGH 2IANB 2ESVB 1T3FA 4K7FB 5JPNA 2FBOJ 2B20A 2CDFB 3KPLA 4F8TA 1YEDA 3C6LC 3JV0A 3E6HB 3UTOA 1AGEA 1P9MA 3C08H 1I3RB 4ZG1A 3MCG1 5IP4A 3RY6C 3D0VB 1P84K 2BRRH 2VOTA 1U3ZA 1MIEL 1T7ZA 1YNTB 4HK0B 4BUHA 5LAXA 4JRYB 3RVWD 1BOGB 4MCYB 2QSTA 2CK0L 4PV9A 4OBSA 4X4YA 4JY4A 5MEND 1DR9A 3D5OF 5B39A 5IESL 4G5ZH 3PDOB 3LH2H 4OM0H 4RFNB 4GW4B 4PJ9C 1CFVH 3HCVB 1DQML 1H15A 3KHQA 4WW2A 1KOAA 3VXUE 2WK2A 2A6IB 5BV7B 1IJ9A 4GQ9L 5D1XD 3L5WB 5B3JE 4ZYKB 3GSQA 3MUHL 1RJYA 3P0YL 3STZA 3QIWC 3IDXH 1RZGB 4XH2A 4A6YB 3H3BC 1FZOA 4H1LB 1F3DH 3CMOL 5EUOE 4N0FB 2JELL 1BQUA 2HP4A 1J8HB 3WFHB 1IEAB 4Q7DA 1GRWA 1GGTA 1YEKH 5HGHB 3ULUD 3GSNA 5BXFB 3MLYL 3H9SA 3O9WA 1SM3H 3LN5A 1A21A 2HFGL 3TNMB 2W60A 1PKOA 3MJ9H 3FFCE 1FG2B 4BQCA 4KPHH 1VCAA 4FTVA 2HLAB 1FIGL 5DTFA 2NXZB 4U0RC 3HB3D 3EO0A 3K4AA 4GW1A 4PJAB 1X44A 2MJWA 5EZJA 2YMXL 3MRLA 3LS4H 3FMGL 2DM4A 2H9GA 4LPXA 3GUTA 4WJ5A 4ZUWA 3GJEB 4H5SB 2Y6SC 1JTTA 4OLYL 2QADD 5DD3H 1CE1H 3MA7A 1Q38A 4X9IA 3QEUB 3V6FB 4QOKE 4KTYA 4NQEB 5JOPE 1H5BA 4N1HB 1FO0A 3BDXA 1J1XH 5CFHA 1E27A 4JO3H 2Z8WC 3B9AA 4PS4L 3FQXB 4R7DB 5C6WH 1JGLH 5J8OA 1KCUH 2ITDA 2X4RA 4HDIB 4X7TB 3MGAA 1FCGA 1E4WH 1JWSA 3PWPB 1BZ7A 5DLMH 3C87A 1QD0A 3G6JA 1EPFA 4QHMB 1AD9A 5F7MC 1K8DB 2KZ1B 4HBCL 1QACA 1IAOA 1S9YA 3CLEH 3RDTC 3H9SD 3O9WD 2Q86A 1GZPA 4U1JA 2ZSWA 4PB9L 4Z7WA 1JHTB 1WZMA 1KB5B 3RZCB 1OAXL 1MCQA 3DMMA 5HD8D 1JBJA 1QLRA 4M93C 4RZCA 3K8LA 4FTVD 1YPZA 2EKJA 2DQEH 4KH2A 4O2CB 4QRTA 2B0SL 4LLUA 4RFOL 3D6GA 4PJIB 4P46B 3LKOA 4GS7B 4JO1H 3RNKB 5C08E 3VFTA 3VXME 1A7OL 2FEEI 4U7KA 3RWJB 1NCWH 3QZWA 1DLHA 3ZKXC 3GMLA 5C9JB 3Q1SL 2GITA 5DJ8A 3RHWF 1Q9WA 1JYWA 3EO9L 5LGJA 5K9JH 4JZOB 3B4NA 2EECA 2R15A 3HG1B 2UWEA 1ETZA 1VFUA 4BFIA 5LQBL 3EYOA 5DR5L 1IAIM 5I18L 4EUPB 1WFUA 4X4XA 1SJEA 3ULSA 5H2BB 3D39A 5F1IB 5B8CC 2GI7A 2WV3A 3MC0A 5I1IH 4RBPH 1RZKC 1WEJH 5CIPA 3DLQR 5DJ6A 2MFNA 4M03A 4YFLF 2VXTH 2LAGB 4YNYB 4KDTA 1UCBL 3V6OE 3RWCA 3N1MC 1FFOB 4I3SH 4S1SH 3RGVC 5DJAB 4Q2ZA 4J3WA 3DMMD 4AG4H 1R5WB 3KNBB 5L2KE 4PJ8A 4NO3B 2JTDA 1GGBL 3U6RB 3QJFB 1BHGA 1QFUL 3JWDH 4WV1B 3QULB 1VKXA 2GUOB 3I85A 5IB4A 2Q8AL 3QDGB 2X1OA 4K3EL 4KRPB 4KROD 5E99L 2ZOKA 4UZGA 2EEDA 5IKCA 2OSLB 1FZKB 4L9DA 2CMRL 1QQDA 4CVXB 2EDKA 4RAUA 5D2LA 5IV2B 3VFSB 4M1GH 4LVHB 3IJSA 4JFFB 3WFBL 1R3LA 1HQRA 3QYCA 3ZO0A 5E24E 2OL3B 2IQ9L 3IRPX 1NKOA 3W39A 3NCEB 5JW3H 4HUVB 1U3JA 3L5IA 2QJDA 6CGTA 1MHEA 3DIFB 3EYVA 4JZNA 5BO1H 2IC2A 5CJBA 5T1MB 5C92A 1A7BA 4ZTOL 4XCFH 4QNPF 5KVFH 2DF3A 4TOYH 2CJUH 3LIZL 5GS0L 3GB7A 1GGIH 3T2PA 2C1PA 4AEHH 1JZ6A 4HXBH 4JFZH 1MNUL 4XMKH 4LARH 1NSNH 4PGDA 5TDOA 1G7QB 1ERNA 3ULVL 3PV6A 1ED3A 3GSXA 2Y06H 4GKZB 4UB0L 1CR9H 4JDTL 2AJSL 3PGCB 3J8F7 4Z7UB 3DHMA 1L0QA 2H6PA 4NKQB 4HG4J 5I1DA 1BFSA 5GGSB 3TT1H 5I75C 1EO7A 2YPLE 4UU9A 3AU1A 5ESQB 1QVOB 3CFJB 3H2WA 5T3ZL 2Y5EA 4G7YH 1IL1B 3CVHB 5HHME 1KTLB 3ARFC 5I16B 3I6GB 4YK4C 4M43L 3MRNB 4M7KL 1ZWIA 2AEQH 4D9RE 3V5KA 4UAOB 5IIEB 1LO3L 5C8JB 4G9FD 3HI5L 2A0LD 4LVEA 3SKNB 3UO1H 32C2A 3BPNB 5F7NC 3DUSA 4QHUA 2XN9E 5FDYA 2WSKA 5EN2B 3IU3A 2EDJA 2KBGA 1INEH 4YJZL 1EVUA 2IPKA 2W07A 1WIOA 1XGQB 3V6ZA 1U8JB 5D4QA 2H32A 4OCRH 1YEEL 4M5ZH 1CLZL 1MHHA 2NY2D 1HEZB 5TFSL 3ULUF 3QUXC 4JR9H 3QIBB 4HH9A 4X9BA 4CGTA 4GAJL 2FIRT 3TGXA 4FFWC 4DOHE 5DEZA 5FGCB 3DURA 3TH3T 5DMIL 1U8PA 2E27H 3SPVA 2JB5L 4AQOA 5K93A 2HTLC 1S7UA 1K8IB 4EI5C 2YA2A 3L9RA 1PVHA 3H0TB 3P77A 1I1RA 5DRNA 4Z7VA 3SY0A 4LPTA 1AGCA 3CVIH 1WK0A 5FYJD 3T0XA 2ADFL 1J0ZA 1T7VA 2VR5A 4AYFA 5MI0B 2F8VA 2AGJL 4LSPL 2AXFA 1WZLA 4BKLA 5D7LD 5E4EC 3NVQA 4HF5L 4MNQB 4PJEE 4XVTH 3LDBC 2HT2C 3SCMC 2L0DA 2VDLL 4W6XB 5E2WL 1HK6A 1KN4H 1DN2A 5C09A 3C5JA 3DYPA 3SGJC 1OLZA 5BW7C 2H8PA 1IM9A 4X9FA 1G9MC 5JOFB 2VXSL 5E2TL 3HC3L 3PHOB 5GGTA 3DX9A 5JR1H 3TV3L 2JCCB 3WNPA 3ESUF 4P5MB 1NUGA 1A14L 4R8WL 3NCJL 2FLBT 1DL7L 4ELKA 5KSUA 3LHPL 4HWUA 5BS0A 3HPJB 1JHKH 2IH3A 1S7WB 5TJWK 2YN5A 3P9LA 3HI6H 4Y8AA 4KI5C 1XGPB 3ARGB 5FA4B 4NHCH 1ZVYA 4CVZA 3MR9A 1BOYA 5E2JA 3ZYZA 1WFTA 5GGUB 1I3GH 4WU5A 5MEQB 4JREC 5IG7A 1M05B 3HFMH 4NQXA 1O0VA 1IARB 3QH3A 2C7UB 5JHDE 1RHFA 1IGTA 3VXPB 1HH6B 1FVEB 2Z4QA 3X3GH 5C07E 3JTSB 1QSFB 4POZD 1A8JH 1C8PA 4MAYC 5EOTB 5I15L 5HTSA 1GSMA 3VFMA 3O3UN 5C09D 1CLYL 1HYRC 1RIVL 4O5LL 1X5HA 4GG8B 5J6HA 1LO5B 2CK0H 2X4QA 4LNRA 3BESR 1JGUH 5T1KA 2DQCL 5IESH 4BSVA 2G5RA 5DO2D 3FO9A 3G6JF 1FDLL 2BSRA 3HE6C 4OZFH 3V52L 4JFYA 3R0MA 1R3HB 3BSZL 5CEZD 4NKMA 4Z7WF 4I2XE 2CH8A 4K8RL 1E4KC 5DGRA 3DRQB 4YFEA 4JO4L 3P0YH 1OAKL 2VRAA 4OZHB 2XFXA 1OY3B 1YPZF 1TZHA 5LBSH 3OR7A 1AH1A 1EFXA 4FQIL 5F7EL 1MOEA 4KAQL 4K55A 4U1HB 1Z9SA 4TYUA 3CMOH 4F9LC 3HE7A 43C9B 2JELH 3WNOA 2HAZA 1VFBA 5F9JB 4NYLB 1OTTC 3P4NA 4HT1L 5MHSD 1IGJB 4F9PA 5T1DH 2DMKA 2BNRE 4XWOC 3MLYH 4F57L 1D6VL 1Q9OA 3UYRL 5EU4A 2HFGH 1OLLA 1V7ML 2Q3AA 5GRVK 3ZHDA 1T89A 5A2IH 4Y4KB 1FIGH 2C3WA 2UWEF 4LVOC 1OGAA 5KSAA 4QXTB 4IRZH 4PJGE 2OK0L 3BZ4A 1MFCL 2IWGA 1R0AL 4IMKA 1L7IL 3EBAA 3MRGB 3OKMA 3UTSE 5T1KD 4R6UA 5DHYA 5HGAA 4OLYH 5JIKA 1M4KA 1U36A 3OPZL 4C56A 5EO9B 3KPSE 2CR3A 1DBKL 3ZKQD 4IRSB 2AV7B 3DVGA 1NDMB 1XF3B 1BJ1H 3HRZB 4PGBB 1ZHLA 1P2CA 3FOLB 5CZXC 2FEEL 1AR1D 3IKCA 3B2VH 4PS4H 3WHXB 4KKLC 1BIHA 4H25B 4CADA 1GAFL 3VDCA 5DEFA 5T3XH 3HE7D 4C83B 5J12B 4LCUB 2KZWA 3I50L 1BFTA 2IAMB 4U1MB 5C70A 4ZAKC 4MNGB 3L7EA 3VRLF 4HG4K 3GBLA 1G6VK 1AKJB 4G6FB 3E3QE 4HLZH 3OMZA 4PRIB 1BVLA 3KPOB 4G8GE 4N8PA 4PB9H 5D7IA 3V5HA 1I1YB 5D2LF 1QRND 4BFBD 2BNUA 3Q6FB 1OAXH 3P73B 4YBLC 5JA9A 3WFDL 1JUFB 3ROLA 1LVEA 2YZ1A 1MJ7H 4Q6IA 1ND0A 3RAJL 1OGAD 5KSAD 4G8FA 1NFDE 1TFHA 4Y4FC 5T33H 1LEKA 3VFRB 3CDGB 3FJTA 4S0SD 2AXGB 1U8HB 2B0SH 5EFIB 3SDDC 3OKNB 1ZE3C 4BFEA 3CDYA 5IVNA 3G6DL 3P4LA 3Q48A 2LTQC 4CDHA 1JPFA 1OWWA 4Y1AE 1DUZB 3B5TA 3PHQA 3PNWB 3Q1SH 2WWMD 3BAEL 4QF1B 3O6FC 4CU8A 4KI5E 3MX0A 5K9KB 3EO9H 1MSPA 2C3HA 4JLRB 1S9WA 43CAB 4J6RH 1T5WA 2XNAB 2BNQA 1EVTC 5DD5L 3VA2C 1JRHI 1P7KB 1AD0B 3L1OL 1NCBL 5IW1B 1YUHB 4BELD 3MTRA 4PRPA 1FORL 3HR5B 1U3YA 2OZ4A 3ARRA 5EH1A 3EKCA 1Q94B 1MLCA 4U33A 4PPTA 1QPXA 1KJMB 1IFHL 4H20H 3MLWL 4IOIA 3BPOC 3MRDA 5I1GL 1UCBH 2IADB 1JPGB 4MZ3A 4FFZH 3T3PE 4X98A 1ZTXL 1FHGA 3N1FC 1G7IB 5FYKD 4TUOB 3STLB 3EYFB 5E94B 1GGBH 1OF2B 4RQQB 3RWIA 3KPPB 3MRJB 1UB5B 2PR4L 4MD5A 4L3AA 5CMAA 2HJLB 5DF0A 4XHJD 3MZGB 5TPWL 1U8IA 3KDMA 3AY4A 5F88B 2APFA 5EU7C 4LLDA 3DO7A 3HZMA 4JPIB 1LP9A 5E99H 1AGFA 4PREB 4DVRL 2CMRH 1UVQA 2DIBA 5DVLA 5I1EH 2AKRA 1YNKL 2EH7H 2ENSA 5FGSA 2PO6B 3UCRA 3WFBH 1F3DJ 3TF7C 4JN1L 2BY0A 1KJ2B 1TZIB 5IBUB 3PWLB 4FZ8L 4PRPD 1LE9B 3TN0D 1RUAL 4ZTOH 2WINA 3NTCL 4Q9BA 4WI9A 3AROA 5FFLA 3WIHL 2DQUL 5I6XB 1HXYB 3UPRB 2WBJC 2A73A 1XIWD 5D1QA 2NYYC 1WITA 1F90L 2HT3D 1CS6A 4OT1L 3LSOB 1MNUH 1WWBX 2Y5TB 1X7QB 5IW6B 4ODTH 3Q6GH 7FABL 5DMYA 3ULVH 3I02B 4JFEE 1NGQL 1YMMB 4JDTH 5HHOA 1ZHBB 5ID1A 1ZV5A 2PXYA 2ADGB 1NH6A 1XF5B 2IPUG 2BC4B 1MFAL 2F54B 3QIUB 5KOMC 1T0MA 3ZSTA 3QRGL 4JFOB 5T3ZH 2LVCA 2OR9L 4RNRA 3TP4A 1DFBH 2XA8H 4M43H 4M7KH 3GI9H 5LG1A 1NBZB 4OLUH 2E7BA 1G84A 3PDDA 1CU4L 3VG0L 2FIKA 2BSSB 5HHPB 5CAYB 1KT2A 1V3LA 4XMPL 4LASH 5IB3A 1S7SB 4PRDA 4J2XA 2W0KA 3EGSB 4UT6L 3A6BL 4X6CA 5ID0A 4WFED 1FRGH 2XKNA 3VFOA 2BVPB 2FX7H 3WN5B 1FNEA 3LOWA 4CU6A 2BY1A 2YXMA 1QOKA 4XXCC 1YEEH 3PJSA 1CLZH 3UROR 5JLZB 3QUYD 5D1ZA 2NY1B 2X9WA 5D1QD 3RBGA 2DJSA 3DSFL 4GAJH 4YO0B 5KN5A 3Q5YA 2F8XC 4CKVX 3WBDA 3GFUA 1T1WA 3LAFA 2JB5H 3WJLA 1PQZB 3QDHA 4P2RE 2GJJA 1CI5A 4Z0BH 2X05A 2XWBA 5HHOD 1MIMH 1JCKA 4LLYB 4YAQB 4OTXL 2M1KA 4PG9A 2NY7L 1KTRL 2O5YL 3L5HA 1T04B 4MWFB 2RBLA 1RVFL 4KKBC 3BQUA 5GS0C 3T77A 3AMLA 3S98A 4XNMA 3EDJA 3QWQB 2AGJH 4LSPH 3MLXL 5CGYD 5DFTA 3DV6A 2ZCHL 5IVXE 5GS1C 4DKFL 1CQYA 5CILL 2YSSB 4PP2A 2JJVA 2DL2A 3X17A 2VDLH 1FGNL 2ICEA 1R3KA 2QKIA 2FGWL 4OUOA 4LFHG 5HDOA 4HWNA 5IB1B 4IRJD 2YRPA 4AT6A 1TCMA 5IHBA 3O2DL 3V7MA 2VXSH 2ZUVA 3RVWC 3D25B 3U0TB 3HC3H 3NA9L 1YQVL 2ZKHH 1UB6B 3VXUB 3K1KC 1A14H 1OAUL 4LBEB 4R8WH 1KLFA 3NCJH 4R90L 3WFCL 5DJ0B 4ELME 4GT7A 5D1ZD 3L3OA 2VR4A 3DXAB 3LHPH 3TZVB 3VMPA 4P5KA 5D1XC 1C5BL 3SE4A 4O2FA 1T1YB 3C8DA 3K8MA 4ETYA 1YYLL 4ZFZB 2QHLA 5EUOB 1HILB 5AAMA 2VB5A 3FONB 3RX7A 4NNYB 1QYGL 2NY0B 4OCMC 3WHE0 1BQLH 2VABB 1K6QL 2W59A 1RZJH 4Y2DD 3T0EE 3K1DA 5CJXC 3BQUD 2MWCA 5DEGA 5EU7E 4G43B 4DK6A 4R9HA 2VKXA 4NO5B 4OBRA 4TVPH 5FDWA 3CSYB 4P9HL 3FFCB 2AK4E 4YHIB 3X12B 3W2DL 5E7BA 1CD1A 3CFDA 1HXMA 5IFJA 5F89B 4P4KB 3LN4A 2HRPL 4B7LA 2WNGA 2IANA 4N1CA 5I0DA 2ZG3A 3HTLX 1CLYH 3JV5A 4QRUB 1PX4A 3VH8B 3HB3C 4O5LH 2EE6A 2XXCB 4I0PB 1I3RA 4YFLI 1MCKA 1EZVX 2DQCH 1SJHB 4QOKB 4KMLB 1AIFB 2BJMH 1I7UB 5EUKB 4HK0A 1FDLH 1URLA 3CFKB 4MCYA 3V52H 2QADC 4WW2C 5C0JB 3OB0H 3BSZH 5D7IF 4WUUE 4K8RH 1XF2B 4NC0B 4JO4H 1SYSA 4TULH 5K9OA 3HNVH 1OAKH 3E6FB 3RTQD 5I73B 5C0BE 2D2OA 1N26A 4ZYKA 4HJGB 1HOCA 1KXVC 5F7EH 4NBZB 4KAQH 5ALBL 2ERJC 1AHWC 2OCFD 3WFEH 1BVKA 1S7XB 1TENA 4XCEA 1KLUB 4A6YA 4N68A 4KFZC 4ZXBB 4HT1H 1UXSA 3VFUB 4WFHD 4ODWB 4N0FA 1E6JL 1G9NL 2IH1B 3VWKC 3S9DB 1QA9A 1R5VB 3O9WC 1A02N 1IEAA 5CZKA 3UYRH 2BVUA 3ARBB 3QDMA 5DYOB 3QBTB 5EWIL 1V7MH 5HGHA 4BH8B 3FQRB 5D8JL 2HMID 2DN7A 2IAND 2ESVD 3O81A 5T1LA 3WEXB 1XCQA 5C08B 3I6KB 3WLBA 5JNYB 3I2CL 4HK3N 1BEYL 2FWOB 5JW5A 3VXRA 1UWEL 4JFXA 3QPXL 3EJYD 2OK0H 1MFCH 1FG2A 2WLYA 3GSUA 1KG0A 2WANA 5I1JL 1IT9H 2F15A 3N9GL 4N0CD 3P4OA 1JPTL 1NKRA 2DMBA 2DDQL 2GYSA 4FQHA 4JRYD 3NN8B 3OPZH 2Z31B 3Q2CA 4FXKA 3BPLB 3RKDD 1R5IB 2QSCL 4YR6B 1KN2L 2PKDA 4H5SA 3IDMB 4IDLA 4JPKL 3QEUA 5FYLD 4MA8L 1K2DB 1GAFH 4GKNB 3CGTA 4YPJA 3KPNB 3U7WL 1VFOA 3I50H 2VQ1B 4R7DA 4PJXE 1OD9A 4OAWB 2DYPB 5A16B 1LP9F 1YZZA 3ULVE 3PWPA 4K8RC 1JRHL 1J8HD 5L2KB 3DX6B 1G6RH 35C8L 3RUGE 5F7HA 1CWVA 4GJTB 3UDWC 3UTTA 1K8DA 5CHNB 4PYGA 4JRXA 3O45B 1A1MB 5E4IA 1MI5E 4L3CA 5T3ZE 3EAKA 3TO2B 4NKOA 3RZCA 4E0RB 1CN4A 3ES6B 4YHMH 1NFIB 1ZEAH 5AG8A 5EULV 2NXZD 1T22A 4OUUB 2GJ6E 4O2CA 5JQHC 5GSVB 2PYEE 5H37G 4PJIA 4P46A 3STBA 3RNKA 4BQ6A 4UILL 5KTEL 4JANB 4Z9KB 4PRHA 4M61B 2DM2A 1KNOB 3RWJA 1G1YA 4ZFOB 3BGAA 5C9JA 2E6QA 3SDCA 3BP4B 3MRCB 3IAQA 5EZLB 2EDDA 2W65A 3PG2A 3JV4A 4NQED 4PJ7E 3L1OH 1NCBH 1FBIH 4JZOA 1IAKA 2VIRB 1HSBB 2MQCA 3O3DA 1GJIA 3HG1A 4NN5B 1FORH 2HN7A 3P9MB 1O5DT 1JI1A 3W5NA 1H8SA 1P5VA 1UYWL 1IFHH 4XHQA 3MLWH 4U0RB 1OAZL 3PWPD 4OV5B 1A6TA 3LKNB 3IFPA 3ZE1E 1ZTXH 3MLSH 1TNMA 3MYJB 2AXHA 1RIUL 3UTTD 2YPLB 4OV6F 2Y9RT 4NPYB 4NM4L 2AJ3A 2HTKD 5EBLB 5HHMB 2AK1L 3RZCD 1S7RB 3IJHA 4XVJL 1AE6L 4J8RB 4UTAL 1FVDB 2B1AH 4XBEH 1FAIL 3KNBA 4ACPA 4NO3A 3NACL 5CKGA 3U6RA 3UYOD 3VW3L 2N7AA 2YHGA 3B2UD 2BOBB 1J1PH 4E41A 4ORZC 4P46D 3QULA 3BEVA 1S9XB 2XN9B 4EBQL 3EHBD 1VACB 4DVRH 2XV6B 4HUWB 1S8DA 4LP4A 1XR9A 3QI9C 1D5XB 1YNKH 4UIMA 2A0LC 4K94L 4ERSH 4LKCB 4X9GA 2OBGA 3L7FA 4BH7A 3ALXA 5CJQL 5FOJA 2EH8L 2OSLA 4L29B 1FZKA 3S3PA 1JTPA 5T5NF 2YZ8A 4J3XA 5IHLB 3VFSA 3PL6A 2GT9A 1VENA 2FZ3B 2N1KA 5GZND 3HG1D 2OL3A 1RUAH 1WZ1H 4ZNCD 4DOHB 1NUFA 5LWYL 2NY2C 4G6KH 4Y5XA 2DQUH 4XI5C 1X5ZA 4IJ3B 3TO4A 5T1MA 3U7AA 3IETB 7FABH 5I2IB 3CH8A 2CUIA 4U1SB 2JIXB 4QRPE 1NGQH 1F6AB 4X5XB 2UYLA 1DTUA 4B41A 4MCZB 3UAJD 1KIQA 5KANI 1RUPL 1HQ4B 4XCYB 1BP3B 4GKZA 4OLXL 2X41A 3DV4B 4JJHA 4OD1L 3KR3L 2IEPA 3F6IA 4GMSL 4PJEB 1BJ1J 3TA3B 1C08B 3CFJA 3D87B 3QDGD 3VG0H 4KRPD 4YXHL 1KTLA 3MOQA 4PBWD 4RGOL 5I16A 3I6GA 3O6ML 4XMPH 3H3KA 2CDEA 4TVSa 5ILTL 4HV8B 5CP3H 3S3SA 3NFNB 4UOW0 5IBUG 5C0EA 4UT6H 4PY7A 3PL6D 4ZPVB 1M7DB 1CXFA 4JFFD 3SKNA 4GRWH 1IQDA 3DX7B 2X4SA 1DSFL 1P4BL 1IC7L 4M7LL 2XY2A 1OQXA 4IEFB 4KK6D 3VXSB 1B0GB 1MAJA 3ZKND 2D7MA 3QWRD 3TVMB 2IBZY 4MLIA 5BQ7B 1XGQA 1A7PL 2D7PA 2MKWA 1WFNA 1BECA 3IU4L 1CICA 1DQJB 5E5RB 1SY6L 5JHDB 4OTXH 5SWZA 5E8EB 3GSWA 1BLNB 5F7LB 2NY7H 2O5YH 5C07B 2VLMD 5GRZA 1HSAA 3IDIB 2ZUTA 1FCCA 4GOSA 3IFLL 4LLVB 4X6DA 2G60L 1RVFH 3D48R 3AREA 4NN6C 3H0TA 3WIIL 4POZC 1F42A 3MLXH 5GGVL 2ZCHH 4GFTB 4YFDB 4DKFH 5CILH 1QTYT 5HY9A 4J4PD 2GK0B 3SKJH 2Z9TA 4Z5RB 3PWJA 2L7UA 5F7KC 1FFNB 1GIGL 1F3JB 1FGNH 2FGWH 4P4RB 4PBXA 4ONFL 3P4MA 3S7GA 4MNQA 5D96C 1AGBA 1YQVH 2W9EH 1RK0A 3OGCB 3WFCH 1LMKA 5ALCH 4D8PB 4LFHD 5HDBE 1NCCH 1RZ8A 4E9LA 2VZ3A 3WUWB 3OSKA 3BPCA 1UH3A 4IOSD 1NMAH 2XWTA 1YYLH 4WI8A 3QIBD 1AJ7L 3EUUA 4J1UB 3MMEA 2QR0A 2R23B 3DX8A 1CGXA 3C5ZA 4YK4B 1S7WA 5ABDE 3MRRB 1XGPA 5HJ3B 1JF5A 1FYTA 2WQRA 4LMQI 2BNRB 1EEQA 3WNMA 5GSRB 4DQOL 3GIVB 3IFOB 5EU6A 1M05A 2ZPKH 2DWDB 3W2DH 1ZVHA 1QKZL 1OW0A 4G9FE 4GSDL 4JG0H 3RP1A 3U4BH 4BUGA 1KPUB 1RZFH 1SQ2N 1U8LB 4PJGB 2HRPH 3MSPA 4Y88A 1NBQA 1EUUA 4L3EA 3UTSB 1VGKB 3KPMA 3QUXB 2R9HD 4M9OA 1BFOB 2J12B 3MJGX 4MNQD 3VFGL 2EDFA 4LVNC 2B1HH 3OJ2C 3KPSB 4NO0B 1WISA 4OF5A 3JUYA 1D9KA 2IALB 3ZT7A 1V3MA 4F7CA 1IEBA 5L8LB 3M17A 4JN2A 3BYTA 2CR6A 1Q0XL 2ATPB 1UZ8A 1H3GA 1ACYH 5ALBH 2OQJA 3DRQA 3ARGD 3QNXB 4OB5L 3V4VL 4OZHA 2NX5E 3NZ8B 3M8OL 4YWGL 5B3NA 3DBXB 5CSBA 4NC1C 5GQBA 3W9EB 3VJ6B 1RY7B 43C9A 1E6JH 1G9NH 3QCTL 4G6AD 1NMCC 5F9JA 4NYLA 5EWIH 1JGEA 1NFDB 1CG9B 1QSFD 5F7YC 1IGJA 5IFHL 3VH8G 5DSCB 4NQDE 2HG5B 1IGIL 1BEYH 5F96L 2MTPA 1NEUA 1UWEH 3RI5K 4Y1AB 4NUGL 2BVTA 3QO1B 3QO0B 1FSKB 4Y4KA 3T4AA 4Q9QL 1BX2A 2YC1B 5I1JH 1NBVL 4S0TD 4LCWA 3N9GH 4P9HC 2I26N 2FYYA 1BBDL 1JPTH 3BO8B 1TDQA 5SX5K 1P4LA 3P3YA 5EZIH 2FR4B 3K2MC 5BRZA 1P1ZB 2WWMC 4KHTH 4X4MA 4YHNB 3CX5J 2NXYB 4HWZA 2QSCH 4NBYB 3PIQB 4JREB 4WO4A 5EBWB 4NO2B 2CKBL 3W9DB 4XTRC 2MHAA 4YUEL 3DJ9A 5TE4H 3FOMB 4EDXA 4UT7L 2Z8SA 5AUMA 2BMKA 4MA8H 1I8IB 5TQ0L 3CPLB 1OGTB 1NDMA 4L5FL 4MAYB 4BK5A 1KIPB 3MCKA 4GKSA 2OJZH 4PGBA 5ICXB 3U7WH 3QQ3A 3FOLA 4MQTB 4JM2B 4AEIH 1U93B 3LQMA 1A9EA 3SE3C 2E7HA 4K3DL 1G7HB 1BQHB 2MOVA 4OZIE 3G5VB 1M7XA 4JZJB 1JRHH 2CQVA 3MXVH 3P0VL 3TIEA 1I8MB 5DQJB 2IAMA 2P5EA 1D5MB 4UQ3B 4P59L 3BHBA 2X1XR 3HE6B 2EKSB 4PRIA 5F8RC 5KJRH 5JW4R 4QXWA 1I1YA 4KV5F 3Q6FA 1YC7A 4KJYA 1JUFA 4XPBH 2R2EB 4Y4KD 4XHJC 4OFKA 4MA1B 3KPRE 2X1QA 4DWHA 3ABZA 2AXGA 1U8HA 5EFIA 2V2XB 5D2NE 5E1AB 3S36L 2WWKO 2VITA 4LK4A 5KSVA 4UILH 5FECB 1UACL 1H3VA 4PJDA 2EDHA 3LEXA 3BXNB 3BDBA 4H0IA 5CSZB 4B5EA 4OQ1A 5BZDA 3GGWA 4JO2L 3OJDB 4QF1A 5IM7B 5F9DC 4X8JA 5DJXA 5JPMA 1E4JA 5K9KA 4IRSD 4UDUA 4PLOB 2Q7YA 4JLRA 4EI6B 4ORGA 3T09A 2GY7B 2NW2A 2OYPA 3TN0C 3AS0A 5I8EB 1P7KA 3ARPA 1UYWH 1XIWC 2JB6B 3RWGA 1EX0A 4JFEB 4LSTL 1A6ZB 2HT3C 2IAMD 4KXZI 3W0WE 4XNYL 1HHIA 3C6SB 1MJ8L 1J0KA 3BKJL 3BW9B 4JY6A 4HWBL 1AKJD 3CVHL 2H41A 5ISZA 4PJBF 2FH6A 4G6FD 4Z6AT 2IADA 4PRID 1C12A 3V5DB 5AD0A 2AK1H 4JG1L 1OARL 1CT8B 1MCOL 2GIYA 4D3CL 1AE6H 3QEHA 3DECA 1JV5B 4FQ2L 1CDHA 4MJIB 3ZDXE 5HYJA 2GAZA 2G9HB 5E94A 1FAIH 4LLWA 4OKVB 2J5LC 1FNSL 1WBXB 3BVNB 5AYUL 4AY0A 3VW3H 2EXWD 3MRJA 4HS8L 5BJTB 3E1F1 25C8L 1PD6A 3TYFB 3QAZB 2VN7A 4EBQH 4LPUA 4LHJB 4XNZB 2B8OT 3TCLB 4K94H 2D0GA 4OZFB 1U8NB 4PJHE 3S4SB 3P30L 4PREA 2NR6D 5CJQH 1FL6A 2EH8H 3E0GA 5C0CB 1RSFA 1I1AB 1RJZB 1WAAF 2BSTB 2EE2A 1WT5C 3PQYE 2PO6A 3FQUA 3VD7A 3DI3B 4X6DF 3HAEH 3IJYB 1YEHL 3EYUH 4NC1E 2NZIA 1KJ2A 4XXDB 2A38A 1TZIA 5LWYH 1F8TL 3QUYC 2NY5L 3PWLA 1K4DA 3SDAA 3U83A 5FO7B 4DZ8B 3O2WL 4P2RB 1QRNE 3QNZA 4KJQD 5ESAA 4FQ1L 2ZUWA 1JWUB 1NBYA 1X5IA 3WDIA 1HXYA 3UPRA 3PXHA 4D0BB 1C5CL 4HULB 2MKLC 3F5WB 5J9PA 3O6FB 4WHYG 4P2OB 1M7IB 1YMMA 5IVXB 4XPTL 3I6LE 4OD1H 3BDYL 2R0KL 3LV3B 3VCLB 4GMSH 5HHQB 4NQCA 2ENYA 2F54A 3KYMA 1OSPH 3BIAX 4JFOA 5ACMA 4KY1L 5JTWA 1J5OL 1U8OA 1ZLVH 2G5BB 3MLZH 4YXHH 3GNMH 4P57B 2R39A 3VXQB 3O6MH 2WUCL 3S88H 1A6UL 2JK5A 2LQRA 3HMXL 3WS3B 4D0DB 3DSNA 4IRJC 1J05B 1LE5B 2BSSA 4CW1A 2PO6D 4HUXB 5L7XL 4XP6L 1S7SA 4RMSA 4C59B 3MLVL 1IC7H 3EGSA 4M7LH 4X9HA 1M1SA 1CTOA 2EO1A 4K7PL 4JRWA 1J0HA 2HFTA 3FB8A 4N8CL 1C16A 1DANU 4PD4K 5JOEA 4LOUD 4HWEL 4ONOA 4K94C 4LKXA 1WV7T 4TN9A 3FO2B 3IU4H 2P5WE 3T0EB 4XAWL 3ZZ1A 3KHOA 1SY6H 4YO0A 2H26B 5TDNA 1I4FA 5AZEL 1QSVA 3ILPB 4PJFE 4Y2DC 2YEZB 5HHXH 2AK4B 4F7PB 2G60H 3BQUC 1YMMD 3MLTA 1CXHA 2X2YA 5DI8A 5DK0B 4CJ1A 4OSUH 2PF6A 5LCVL 1T04A 2OM5A 4NQCD 2VLLB 2F54D 2FX8H 2V2WB 4OLZL 4QHLB 5DWUL 2XKUA 4G9DB 2FHBA 3W11D 3M1BA 3U30B 5KVDL 3FFDB 4OF7A 4WVRA 2DWEB 1NC4B 4GG6E 5I9QB 3JV6B 1QLFB 2H2SD 2YSSA 1MCJA 2WBJB 2XZQH 3OXSA 2FJGB 1NANI 4ZUUB 5C0RH 3MRFB 3FCTA 5ACLA 4U2YA 5EPMA 3QXWA 5DURB 2E7LA 3ECBA 4NT6A 3QCVL 1PFCA 4WUUB 5IVZB 1XFPA 2FJFB 3IAGC 2V6HA 1I7TA 4DGIL 4EXKA 3CCHB 2QQKL 3OHXB 2Z91A 3VXUA 3B9KA 4PJ5A 4HEME 4AMKL 5C0BB 3F7VA 5L0QB 3RX5A 3BZEA 1N59B 4OFIA 5HHNB 3P40A 1ZAGA 1AJ7H 2NY1D 3TZVA 3RTQC 5E00A 1VERA 1K5NB 1T1YA 4Z7NE 3CD4A 3MBEB 4RX4D 2Q7NA 1CL7H 3DRTA 4LSDA 3QB7C 4OCLC 3QUMA 4JHWH 4OLWH 4ZO8A 2KKQA 2J3SA 4G80A 4DQOH 4C58B 4RIRB 2VABA 4IIQA 5E2UL 1S7QB 2OTPA 1JZ3A 4X80L 1AXTH 1QKZH 3MV9E 3TNNA 4G43A 4MNHB 1ONQB 1UM6L 4MD4B 4MS8D 4Y19E 1BJMA 4NO5A 3SBWC 3U7YL 3LQZA 3FFCA 5DQ9B 2VLRE 3WLWC 2QQLL 5I30L 1NQBA 4I5BB 5D9SB 3D69B 5SWSA 3ZSSA 2VAAA 2YRZA 2YA1A 4P4KA 5ERWA 1HIML 3VFGH 1NAMA 4YXKL 4LIQL 4B50A 4NFCA 1NL0L 4HJJL 5C0DB 1MCPL 3VH8A 4PLNC 3SGEI 4Y5YB 3WJJC 4KKCC 4I0PA 4L4JA 3TT3L 4OZGA 3WUWG 4U6XB 4ZODA 1GOFA 2BHYA 2ICWJ 3O4LA 2H2PD 4FG6D 3VXUD 1SJHA 3RKDC 5EUKA 1T2JA 4RFNC 4UTBL 4X6EA 3QA3A 1I7RB 1Q0XH 5TF1L 3SOBL 3DXAD 2VISA 3TZVD 2ZNWA 2EYSB 3IDGB 5BV7C 5CKAA 4PJXB 5IFAL 3VXTB 4JAMB 4M1DL 1DN0A 5AWNL 2LU7A 5F7DB 4OB5H 3QEGH 3V4VH 3E6FA 3PWUA 4HCRH 2NY0D 4HJGA 5EIIB 2OTUA 1ZOXA 3RUGB 2I9TA 1TCRB 4NQVB 4PRBA 1S7XA 3GK8L 3QCTH 4LRIA 5L88L 2Y25A 4K23L 5EBMA 4PJDF 1MI5B 5FKPB 2VN4A 3QHFH 1FVCB 4AEFA 1UA6H 3OB0K 4WCYL 2Z93B 3VFNA 3VFUA 3FFCD 5IFHH 2VLJB 4X5WA 1R5VA 1IGIH 3ARBA 5F96H 5DYOA 4P4KD 4ZUTA 2GJ6B 1TLKA 4NUGH 5K59E 4L9LB 1DBMH 2PYEB 2RQ8A 3NPSC 4XB7A 4QTIL 5JHLL 5JNYA 3VXMA 3GJFA 2NXZC 4MDIB 1Q9LA 1BBDH 2P8PB 2XA3A 4GBXB 4I0PD 5CJ5A 3DVIA 1CFBA 5E8OB 4F33B 1U8MB 3VXOB 2EDRA 3HNSL 3BMVA 5I71B 4QOKD 3TPUA 3UTZB 5JOPD 4PJ7B 4KJPD 2AJVL 2IGFL 3ULUH 3B9EA 4HZAA 2Z31A 2VZ1A 2IFGA 4UT7H 4HIHA 2XTLA 4G3YL 1T20B 5TQ0H 5CP7A 3CUPB 4HMEA 1YECL 1DBBL 3IDMA 4L5FH 1G7MA 4PY8I 3MUJA 4ZTPL 1EEZB 1UKTA 1A6AA 5B38B 4DN3L 2UZIL 5FUCC 3BE1L 2MPAH 1BVZA 1LQSR 3AGVA 4GAYB 1H8NA 5BVPL 3P0VH 3V6OA 4WU7A 1P7QB 1YN6B 2GJZB 4OAWA 4ZXBD 2JKXA 4UUJB 3RY6A 4P59H 4JFDA 2X1WL 1B90A 4ZFFB 4I77L 3DX6A 2HTKC 3ARBD 1JVKA 1S5HB 3KGRA 3MO1B 3O45A 1I75A 5C08D 3UYPA 3VXMD 4PTUA 3KS0H 3FB7B 4PJ9A 4MA3B 1BF8A 1YY8B 3H7BB 4E0RA 5MEPB 2L7JA 1RFDL 3B2UC 5GRVL 5SV3A 3S36H 3ES6A 4P46C 5I8KH 4GS7C 1UACH 3EHBC 2R56L 1S7VA 4PFEA 1XCTB 2ERJB 1AFVL 2DBJA 3QIWA 5GIRB 2OR8A 5GSVA 3QDAA 2X4NB 3L3GB 4JO2H 2Z31D 1I1FA 3IKKA 5IHZA 1KNOA 3QQ9C 4ZFOA 4M6MH 1J87A 1IBGL 4LPYA 4JCLA 3BP4A 5GZNC 3O11B 1O7VA 4O51B 2D7TH 2LE9A 1J88A 5F3HA 3LQAC 4Q6YA 4UMGA 1RMFH 4QRPB 4LSTH 4XNYH 2DYPD 1MRCL 2WLZA 1MJ8H 2OP4L 1INDL 1QR1B 2VUYA 4OV5A 5L2KD 3UAJC 4MDJB 4JG1H 1OARH 4HAFA 1X5LA 3NCYP 4FQ2H 4O00A 3FQWB 4NPYA 2P8MB 1T5XB 1FNSH 1S9VB 3BX7C 4M1CC 5EBLA 5AYUH 3QJHA 4HS8H 4MHHI 4UI2A 3U4EA 2VXQL 3FAWA 4WV1C 1FVDA 1BAFL 25C8H 3EO1A 1WVZA 1U8KA 4PP1C 4Y16C 2SEBB 3A6CL 3QXAA 1ZT1A 1GPOL 4DCQB 2AJZB 4UV7L 2BOBA 3VRJA 5IK3B 4YDLB 3P30H 4MYWB 3RRQA 1S9XA 2XN9A 5KW9L 1VACA 4G6ML 4FS0A 2EYRB 3CLFL 3KLAA 5HDLA 4LVHC 3GMQB 5JIHA 1JMZA 3BZFB 1GOHA 1V7NL 2CLVB 4L29A 1N3NB 1TZGH 4MA7H 5DJDA 3OKKB 3HZVA 4M48L 3RDTA 4KK6C 1M71A 1F8TH 1J8HE 2NY5H 4I4WB 3O2WH 5ICYB 4TSCL 5A3IC 3O41A 5EC1A 4FQ1H 4TUJB 1RUML 3O6LL 5D7SL 3MRPB 1WSST 2YD8A 3QUKB 1JZ2A 4FZEL 3CMGA 1C5CH 2UVEA 4OCYL 1HINL 4OJFH 2X4PA 2XWJA 1JTOA 2YPLD 5I2IA 5IOPA 1WWCA 1BD2A 3WKMH 3T8XA 4FMFA 2DI8A 3ZYJA 4MCZA 4XPTH 5HHMD 2O61B 2R0KH 3WIFB 4ODHL 1HQ4A 4XCYA 5JUEH 3S96B 4D9RD 3T08A 4KY1H 1J5OH 3DV4A 1A2YB 2OZ4L 4J4PC 4OZFG 4X0KA 5B3JF 5CIPH 2ZUQB 3UC0L 1N6UA 4PJEA 1MHCA 2WUCH 4NQEE 1DQQA 1A6UH 2XN9D 3HMXH 4ALAL 1A9BA 4D9LL 4X83A 3IAPA 5FO9B 2DLFL 2A83B 2EDEA 3CFBB 2DM7A 2HFFB 3H8NA 5B8CA 3D3VA 3QXUA 3ZMRA 3BPNC 2FHFA 4XP6H 4K7PX 5FK9B 3NFNA 5FUCE 3MLVH 2ADJA 4Q74A 5FM8A 1H8OA 4EIGB 4AENB 4ZPVA 3GMPB 2AV1A 4QNPE 1M7DA 2B4CH 5F6IB 3DX7A 4WW1A 4U3CA 1ZS8A 4HWEH 3RGVA 5GGQL 4QGYA 1OD7A 2AQ2A 2V7HB 4FNLL 1MREL 1ADQA 1XZ0B 5GGRY 4G8EB 2J8UA 1X5YA 1Q0YH 4JY5L 3QIBC 4QLRA 4I1NB 4JM4L 2BDNH 3TVMA 4XAWH 1QBBA 5BQ7A 1T0NB 4LGPB 1IE5A 3NA4A 1G6RB 3V8CA 1IGFL 4R0LB 1JJUA 4RA3A 1F02I 1DQJA 3QI9B 4YHLL 5JHDA 3BH8B 1EHNA 1PG7L 4EN3C 4MJ5A 5E8EA 1BLNA 1JGVL 1EJ6A 3K0WA 3IDIA 3MJ7B 4OZGF 4I0CC 4OLZH 4PGCB 3AS2A 1A1OA 3HPLB 1ZHKB 1KLGB 4JDVA 1QBAA 1CGUA 5KVDH 4YDKL 1CQKA 1UM4L 3F7YA 3L6FB 4L8DB 4NRXB 3TA3D 5LVEA 1V05A 1T7XA 4L1DA 2MCPL 3IDYB 2R9HC 2X7LB 4Z5RA 4OQTL 4GLRI 1W0VA 1S7TA 1F3JA 2ARJQ 1B0WA 3QXDA 2ATKB 2I5YL 1YYML 4NDMA 4LGSB 1OPGH 3DOSA 4DGIH 2QQKH 3KLSA 3OGCA 2V5RA 4AMKH 5FYJH 4OZHE 3GMRB 3BN3B 4I2XA 2IPTH 5C9KA 2B39A 3VXSD 4JDZA 4G8IA 4NGHL 4L4TA 3TVMD 2A6KB 2NX5B 5DA0B 4ETQB 3MZTA 3ARSA 4HIJB 4P49A 3ARGC 3QEQA 4RMWA 1LK2B 4J1UA 5DC9B 2R23A 1EEYB 3ARFA 2Q87A 5JHDD 4LF3B 5C07D 1DEEA 3MRRA 5HJ3A 3VI3F 5LGHH 5CGMA 2BNRA 4Y5VB 4X80H 3KPQB 5C2BL 4NQDB 4G6AC 1OW0C 3LRSA 3EYQC 5GSRA 1UM6H 3EFDH 3FZUD 3GIVA 3TWCL 5E6IB 4WEBH 2FH8A 3MV01 2FDBP 3ROOA 5GRUL 1DJSA 2QQLH 1LDSA 5I30H 2DAVA 5KAQG 3DARA 4HGMA 3BJ91 4XGZA 5BVJB 4CL7A 4LQ1A 3O3BB 1F3RB 1VEOA 4M7LT 4NSKB 3RNQB 1UWXK 1HIMH 1PW3A 4YXKH 4NZUL 1HDMB 4LIQH 4U1IB 5C0GB 3T0DA 1NL0H 1U3HB 3FT3B 2VZVA 4HJJH 3QUXA 1T80A 3TYGH 1LO2L 2C3XA 4U6HB 1BQSA 3ZKSD 3KPSA 2V9RA 1OTUD 2WBWB 4U6YB 4UTBH 1MJUH 1RPQA 3O3AB 2IALA 1NDGA 4XCNB 3SOBH 2GSGA 1TJHH 3IVKB 3MUGA 3NABH 5IFAH 1H3UA 3TLRA 4M1DH 3FO1B 5AWNH 3FQNB 2YRLA 2ATPA 4PJCB 1N8ZB 3QQNA 4YZFF 1WFOA 1FNAA 4OZIB 3OAZK 4JJ5A 2V2TA 3T1FB 4R4BB 3NIGF 2W0FB 4M4PA 3MGOB 3TBVB 1MCCA 3QNXA 3V4PL 2BNRD 3B9VA 2I07B 3RIFK 5I76B 3GK8H 5L88H 4K23H 4G8GA 1R6VA 3I9GL 3SCMA 2DIJA 1U91A 3LMJL 1B4JL 4WCYH 3W9EA 3ZE2F 3SGJA 5FHBL 3WE6B 5BW7A 3U9UB 5IR1B 4IHOA 3BT2L 2AQ3A 2ED8A 3KPRB 1NFDA 5CEZH 2ID5A 5D2NB 4E42B 4QRRB 4QTIH 3VWJB 5JHLH 3UTSD 3QUXD 2E5EA 4PG2A 1QBML 5DUML 2LABA 1J1OL 1BGXL 4GRWB 4HJ0D 3KPSD 3HNSH 4NO0D 1B6UA 3BO8A 4Z7WE 4Z78B 2FR4A 2IGFH 3ZTJH 4H26A 5F1KC 3B5GA 1NC2B 1T0PB 4YHNA 4JGUA 4JQXC 1Q8MA 5DMKA 3PIQA 5EBWA 4NO2A 1YEFH 1G7JB 1YPZE 4IRSC 4LHUA 1EZVY 4ONGH 3W9DA 1YECH 1DBBH 4MXWL 3O6KL 4ZTPH 1JPSH 4FQXC 2VDMH 2ZUUA 3SJVE 3W0WB 3OAUL 1H3TA 4N5EC 4DN3H 4MAYA 3IFNL 3BE1H 1FV1B 1KIPA 5ICXA 2BVYA 5J12C 4JM2A 4N9GB 5D7JB 1T1XA 1U93A 5BVPH 1JN6A 3JWOL 2R2HA 2IAMC 2HT2D 1L6ZA 3QPQD 2NY3C 2BRRL 1G7HA 4R96B 1VA9A 3PWVA 3HC0B 4WFFE 4HZLB 1CCZA 5C71A 1OCWL 4K9EH 2FEDD 2UWEE 1D5MA 3RWDA 4UQ3A 3GIZL 3VFVB 1FN4B 3HE6A 3D39E 4KXZH 3VMNA 4W6YB 1QR4A 3FTGB 3ZKMD 4Y1AD 1RFDH 4PJHB 3OKOB 2CD0A 4N0YL 2R2BB 5K33A 4W4OC 2R56H 1E4KA 3GSVB 4PR5A 4KI5D 2HVKB 3BFOA 3PQYB 2PW1A 4HKZB 2V2XA 2GFBB 1MCFA 4AIZB 3SDXB 4P2QE 4U1NB 4LAQL 5DHXB 5JDSA 2NXYD 3D2UB 4DKDC 4F9LA 5CSZA 2CDGA 4EJ1C 1NMCB 1T66C 1OB1B 3OJDA 5IM7A 5B38G 1MCDA 3R8BB 1IZJA 5FOBB 1XH3B 4MAYD 4EI6A 1SM3L 3VRLE 2B7DT 4JM2D 2YKLL 3VMOA 4KJQC 5IMKA 5I8EA 5MEOB 1DVFB 4KPHL 1MRCH 1I1CA 1INDH 2OP4H 1D5BB 5I1LA 1F6FB 2G75A 1A6ZA 3W81A 4XX1E 4WHTA 2MSPA 2V9QA 3HE6D 1FZJB 3V5DA 4AH2B 1QLEL 5DD3L 1CT8A 1Q9KB 2AXJA 4GW5B 4RWYH 2VXQH 1BAFH 1FPTH 7CGTA 2EDWA 4OKVA 3ARVA 1WBXA 3G5YA 1ZLUK 3A6CH 1GPOH 2J8UF 4JO3L 5IB2A 3PDGA 3TYFA 1JGLL 5KW9H 3D0LB 4G6MH 3RKPA 4Z0XA 4KZEL 1KCUL 3CLFH 2ICCA 2X4TB 2PO6C 3TCLA 4OZFA 1SHMA 3MOAL 1OAQH 4FA8A 2HJFB 1V7NH 3RL2A 2BSTA 4RFEA 2A6JB 3SKOB 3AS1A 3CLEL 4XWOD 1KC5L 4M48H 1ROWA 2P5WB 1SEBA 3IJYA 1T1ZB 4TSCH 4LEOB 4TRPH 4XXDA 3JBG7 1RUMH 2HA1A 5CWSB 2DM3A 3FAXA 3MPCA 3FKUS 1C5DA 4PJFB 4JFED 4FZEH 4NC2B 4P2RA 4Y4FA 2V5SA 5F9OL 5FIEA 5DZNA 3SDDA 3QFDB 1HINH 3T65B 1T2QL 5DD6B 1JWUA 4JO1L 4N0UA 3V0VB 5ICZB 4NQUA 4R4NC 1FNFA 5ITBL 2BVEA 1X5KA 1J0JA 3F5WA 4BJLA 3O6FA 2J8HA 4WHCA 4MJID 4ODHH 3QIUC 4EXPX 5I74C 1EEUA 4GG6B 3W11C 4DVBB 5IVXA 2OZ4H 5CZXD 3UC0H 5HHQA 3EOBA 5IWLC 2PW2A 4LIQE 4OFYA 3S35L 4ALAH 4D9LH 2H2SC 2DLFH 4JPVL 1P5UA 2OMBA 1Z9OA 5I1IL 3IDJA 1WEJL 3R1GL 1I1AD 2VXTL 4HGWB 3G9VA 4ELMA 3MRIB 2YD6A 3WN5C 4S1SL 4JFQB 5GGQH 1CZ8H 4FNLH 1MREH 3CFEA 4NWTL 4JY5H 3BUYA 2NY1C 4JM4H 1F00I 1ZLVK 4YPGA 1RJLB 4P2RD 4Y4FD 3PF2A 5J6GB 5IMMB 3RWFA 3KS0J 1IGFH 1KTDA 4MMZC 4GUPB 1JYNA 1RUKH 1A3LL 2VZSA 3MV9B 1INQB 2H26A 4Z7OF 3FN0L 3MFFA 3P9WB 4Y19B 1JGVH 3OTTA 1JL8A 1YN7A 3O6FD 5BZWB 2YEZA 4P2OD 1GGCL 3MRHB 3BP7B 5HYSB 1I7ZB 4P3CH 1RZ7L 3G04B 5BS0E 4MS8C 5DK0A 4XBPA 4YDKH 1UM4H 4QHLA 2Y7QA 3RIFF 5JW3L 4MZ2A 4NZJA 4G9DA 4PRNB 5T5FH 2MCPH 5IB5B 3UBXA 3BKYH 2ZSVB 5FGBC 3FFDA 4JQVC 4YX2L 3TBYB 2VKWA 1E28B 3V2AR 1JI2A 4P23C 4XCFL 3EJZD 1QLFA 2CJUL 2PCPA 2WBJA 3UJJL 4ZUUA 1ZANL 3WS6C 5F7UA 1KYOK 3SO3B 4ISVB 4HXBL 2APVA 3C2AL 4FG6C 1K4CB 3F58L 1NSNL 3REVB 3DTXA 2VH5L 5KSBA 2P42B 2Q6WB 3DROB 1CR9L 4NGHH 5T3XD 1W0WB 1LEIA 3TZVC 3R06B 3SGEH 1N4XL 5C0BA 3TT1L 1N59A 2O93L 1FQ9C 1NFDF 4ODUB 4NUJA 3RHWK 1EAPB 1HH9B 2Z35B 5HHNA 3T0ED 4DGYH 2NTFA 3C8KB 1K5NA 2NY0C 1Z9LA 4XZUB 4CVWA 3TPKA 2F53A 1ZLWK 2AK4D 1A4JA 4YHOL 4PBVC 3REWB 2CRIA 4KUZH 5HI3D 5I1KL 5DS8B 3Q5OA 3WV0A 2Y36L 1S7QA 5GRUH 1KPVB 1QFWM 2RFXA 2AP2A 4MNHA 2IMMA 5AYQA 5E70A 4NZUH 5DQ9A 4XXCA 3CH1B 1NC4D 4M5ZL 3D69A 3BKCL 3AMKA 2WBJD 5F1NB 4HIXH 3TH2T 3GRWL 1LO2H 4CAGA 5DURD 3HAEB 4XBGB 3UTQB 2E27L 3T3PF 2FB4L 2ARJB 2DQFA 4KJPC 3X14B 4WUUD 3WNLA 5GGRA 1MCBA 3X11B 5FHAL 1KF9B 5C0BD 3AB0B 5HYIA 5DK3A 4Y7MA 1W72A 2IQAB 3TIDA 1I3VA 2FJHB 4O2EB 2EYSA 1AXSB 4PJXA 2AQ1A 3FO0L 3O2VH 5DHVA 4JAMA 3VXTA 3MBED 4Z76A 4K3GA 5GS1A 3V4PH 4K3JL 3MNZB 5D5MF 1MCWW 4C56E 3I9GH 4ZXBC 1B4JH 3RUGA 5C0FA 4JHAL 4HGKC 1TCRA 4NQVA 5FHBH 1SEQL 5FF6B 1K9TA 3BT2H 3D18B 1MLBA 1TVBA 4HIIB 5LGKA 5FKPA 3B6SB 3GSOA 1FVCA 3HHRB 4J3OC 1MH5B 1AC6A 5MENA 5I66A 1BBJB 1ZHNA 2XQYK 3ZTNL 4ZD3H 1Y0LB 3BIBX 4DUXA 2WW8A 4M6OL 2QLVB 3OX8B 1QBMH 5DUMH 3AM8C 3MXWL 5D1XA 3MRQA 2DLTA 1HCFX 1JF1B 5JORB 3CSPA 3MREA 3RPIA 2F5BH 5D7IE 3PWNA 5IF0B 3V6BR 3W82A 4H8WL 3EOAB 2PTTA 4FFVC 2P45B 3BPLC 5J1AA 3ARZA 3UTZA 4PJ7A 4KKBD 5CJXA 2JJSA 2AS5M 4GAGH 4N8VB 3O6KH 3MRKA 4FQQA 5A2JH 3X3GL 2WP3O 4UQ2B 5D6DC 1T20A 1Y18B 5F7WC 5J13B 3IF1A 3S97C 1X4YA 1T7WA 3OAUH 1F45A 4HKBB 3IFNH 4P3WA 2X9YA 5DRZA 3ULVD 1SMAA 2HKHL 4X8XA 4YIQB 2H3NA 3L95B 3JWOH 3V6OC 4C55A 3PUCA 5D72L 5B38A 1EERB 2Q8BL 2EDQA 4GAYA 5F71A 5I8OL 5CUSH 1MI5D 2C9AA 1OCWH 1YN6A 2GJZA 5T3ZD 2BNQE 4HPOL 3BP6A 1S3KH 1JGUL 2D4DA 4MJ6A 1FNHA 3GIZH 1B6DA 1G7PB 3I75A 1FJ1A 4A2MA 2Z8VC 2K7PA 4WI5A 1J12A 1QO3B 2DB8A 1S5HA 2GJ6D 1HKFA 3BGMA 2PYED 4MSWB 4N0YH 5ITFA 1CK0L 1TQCC 2FD6L 3VFPA 3DXAE 3ZL4L 2E7MA 4GBXD 3DUUB 4FP8L 5LBSL 3UEZA 5FKAB 5C0IA 4PYHA 4LAQH 2BY3A 4Q97A 2ORBL 2BFVL 1XCTA 1IKNC 1AHWA 2EE3A 1A7RL 4U7MA 5GIRA 2DLGA 1ZA3B 2X4NA 4ODXA 5DDHA 1ZT7B 5I1AA 1HHGB 5T1DL 3VWKA 2VDQH 1QEWB 5F9WB 1LP9E 3KAAA 4FQPA 1W0YT 2YKLH 4NN5C 5KS9F 4WEMB 4KUCF 5IVXF 5INDA 3NPSB 4FFYL 2OXHA 4J7RA 3F12B 3QUZB 5HGDA 4F2MA 4GRMB 5IEKA 1EJOL 4IRZL 1DE4A 4DJMA 1OT1A 3LEYL 2X9XA 3MV7B 2YWZA 4YDJA 4L8CB 3QSKB 5CEXA 1QLEH 2P7TB 1AQKL 1UQSB 4ELMF 4APQB 5DRWA 1PX3A 4OGAD 2FO4B 1W8OA 1CVRA 1S9VA 1JGDA 1KEMH 3B2VL 3PABB 5HSFA 2PYFA 4Y4HB 3TEUA 2J8OA 1JPST 3PHSA 2SEBA 3U0PB 5T3XL 4KZEH 2BERA 2AJZA 3HZYA 1XAUA 3MOAH 5IK3A 5IQ9B 5GXBB 3OKEB 3TBWA 1LO4L 1KIRB 1A47A 2F19L 2KDGA 4RGMC 2EYRA 3MV8E 1KC5H 3VWKD 2Y23A 3LKPA 1KPRA 4I18B 4TPRH 4Z77B 4WIQA 5ADPL 4KI1A 3UDWA 4PLKC 1MJ7L 4YHPB 4IJ3C 4QRPD 4I4WA 5F9OH 5ICYA 5T33L 4F15B 2EDYA 9CGTA 2P48B 1T2QH 1A4KB 1U95A 1SJXA 1XGRA 3MRPA 5D93B 4RMUA 1QHPA 3MQIA 5DZOA 5ITBH 1NMBH 3BIKB 5ENWB 5JIPA 5KAQF 5FUOH 1RIHL 1YJDL 1N2RA 3GHEH 4ESKA 2OJEB 1TVHB 3VGBA 4RDQG 2O61A 4J6RL 3T0VA 5KSBF 3WIFA 3TA3C 1EGJA 3S96A 4OZ4A 3V9FA 5EC2B 3S35H 1A2YA 4JPVH 3S3JA 1IGML 2ITCA 2CKBB 1XEDA 2GHWB 1PEZA 3R1GH 1T3FB 3CFBA 4X5LA 4H20L 1UZ6F 5JPNB 4K8RD 4UIKL 2FX9H 4FFZL 1MJJA 3VRIA 1AGEB 3FQTB 4U1KA 4ZNEA 4NKIL 2DL9A 2XZCH 4GLRH 1ZGLB 1DDHB 4NWTH 5E5MA 3VI4E 1IGCL 5J4MA 2FSEA 1RZIB 5C0AE 1JYXA 3TVMC 5LAXB 4PV9B 2V17L 4X4YB 1MWAL 2FL5A 2V7HA 4JY4B 4ZSOA 3B3IA 4RMQA 4Y16B 3DVNB 1A3LH 3L3HB 1X6NA 4M8QA 3GM8A 1I3UA 5DD1H 1KGCE 3FN0H 4D0CB 4F7EB 2R4SH 3OKDB 4MVBD 3BWAA 3GSQB 5I1EL 1GGCH 3QI9A 2EH7L 4G9FA 3BH8A 1RZ7H 2EDOA 3FZUC 4ZO9A 4PUBH 4XH2B 4OF8A 2HWZL 2ZG2A 1FZOB 4MX7A 4HBQA 4R2GB 5IJVB 4YGVB 3L3IB 4NJ9L 4YX2H 5IGXL 1GZQA 4S1QL 5BMFH 5JMRA 3UJJH 3BRFA 1PG7W 1ZANH 3WO3B 5FV1L 1MRDL 2W60B 3C2AH 2ATKA 1YNLL 4ODTL 1OTUC 3F58H 3Q6GL 4IMLA 2VH5H 2YD7A 3EO0B 2E9IA 4R3SA 1WZKA 2DQIH 1N4XH 3HS0A 3RVTD 3NH7L 2AEPL 2H9GB 2DI7A 3GUTB 1R24A 2A6KA 4KQ3H 2NX5A 3C2SA 3U2SA 4ETQA 1DFBL 2O26U 4HIJA 3MA7B 2XA8L 3VE0B 1L9NA 3GI9L 3ZHLA 5DRXA 4OLUL 5D7LA 5HYSG 3WFZA 3HMWH 4E5XB 1LK2A 1H5BB 4YHOH 3TBTB 3QI9D 4ZUVB 4LASL 2A2QT 1E27B 2A1WH 5I1KH 2Y36H 5SV4A 4Y5VA 3JWDC 4YC2C 1HKLL 2ITDB 1FRGL 4H88L 4ZOCA 2FX7L 1L0YA 3LKRA 1AD9B 1QG3A 3BKCH 4WWID 4XI5D 3O3BA 4HEPG 2R1YB 1S5IH 1GZPB 4NSKA 4U1JB 2ZSWB 4Z7WB 1E0OB 3GRWH 1HDMA 4K2UL 1VFMA 2JJTA 1Z2KA 3DMMB 1U3HA 4HJ0C 1YMHA 1S78D 5TF0A 2R0WH 4RZCB 3ZE1F 2AEWA 1YPZB 2FB4H 4M02A 3QDME 4Z0BL 3I3DA 1MIML 4EN3B 3CU1A 5FHAH 2VNCA 3LKOB 3UMTA 3FB6B 4ZDHA 3SJVB 3VFTB 2VXVH 2XRAL 3O3AA 1L7TH 3VXRE 3WIHA 4KROB 3QZWB 1DLHB 2NX5D 2Z0BA 1UJ3C 3BZDA 5FB8B 4OI8A 3JSSA 3FO0H 1FC1A 4BQ8A 3FO1A 4WW2F 1AGDA 4OZIA 4K3JH 2ICWA 3E3QC 3WCYA 3HN3A 3T1FA 3CFIC 3QPQC 4KKAD 1FAKT 2UWEB 1ETZB 4Q9RL 4BFIB 4JHAH 3EYOB 1G0YR 2UY7A 4X4XB 2I07A 1SEQH 4NQDD 4NJAL 4CNIA 1JFQH 3ALWA 3D39B 2FEDC 3QG6B 2ZKHL 5E6ID 1NJ9A 2OTWB 5CIPB 5DJ6B 5GHWH 1FGVL 3ZTNH 4MAUL 3U9UA 4JFPA 2GKIA 4EDWL 3OF6A 1QUNA 4M6OH 4PG2C 3ZKMC 3B8YA 4YE4H 5D2NA 3HAEG 3MXWH 1FSKC 1NGWA 2CIKA 3L3DA 1I9JL 4P2QB 4MQXD 4E42A 1U3HD 4HPYL 1VEMA 3QUML 4GRLC 3VXSE 1IC5L 4PJ8B 5DJ2B 3ZHKA 3KVQA 2VQUA 5DJZB 4H8WH 1D5ZB 3RVXD 1BQLL 2NXYC 1RZJL 4JRXE 4YLQT 4XP9L 4RGNE 3RFZC 5GRJL 3VA6A 4Z78A 4J12A 5BCAA 4MXQD 2E8YA 1UEYA 1NC2A 4TVPL 1G7JA 5GJTL 5J3HC 2DOCA 3FB5A 1NLBH 1QQDB 5D2LB 4NWUL 1EMTL 2EDTA 2HKHH 4JM2C 4D2NA 1R3LB 1HQRB 1A1NB 5D6CA 3W0WA 5D72H 1DBJL 1EHLL 4PRHE 3W39B 5ESVB 2Q8BH 1ZSDA 4JZJC 5I8OH 4JZNB 3GMOA 1FE8H 4HPOH 3NFSH 3CXDL 4R96A 4BYHA 2BJML 2NY4B 3OF6D 4OCXH 2CSPA 3KPRD 1IZKA 1UXWA 3TJEH 1NCDL 3S37H 3VFVA 1W2KT 4QRRD 1BIIA 3VWJD 5TDOB 2X44D 1Q1JL 4Q58C 5JXEC 4MA1C 1ED3B 1CK0H 3GSXB 3RPKA 2FD6H 4TULL 3ZL4H 3HNVL 3O2DA 2H6PB 3F62A 4FP8H 4PJHA 1CXIA 3OKOA 4QKXB 5HYQB 3GSVA 2ORBH 2BFVH 5HYFA 1SMOA 3WFEL 1A7RH 2HVKA 1OP3H 3PQYA 1KJVA 5SX5H 4AIZA 1EXUA 1NC2D 5JMOC 1ZWIB 5E8PA 3GKWL 2EIZA 5HBBA 3V5KB 1IILE 1J0IA 5CBEA 2VSCA 1FL5A 3K7UA 5CZVL 2WZPD 2X6MA 4QY8A 1QRNA 4E41E 1TTUA 32C2B 3DUSB 4QHUB 1QSEE 3W0WD 3IU3B 2CPCA 4FFYH 1XH3A 4YBHA 3LB6C 3RBSA 5D7JD 1EJOH 1RK1A 1NFKA 5FM5M 5IEHA 3G5ZA 4X7DC 2Y1VA 3LEYH 3OJMB 1IT9L 2KPNA 4KV5E 3O3EA 1GC1L 1NGZA 2AJUL 4OD2A 1EIBA 3QHTC 4HH9B 4W4NA 4QCIB 5AZ2L 1AQKH 3UTPE 4CU7A 3DURB 2EDNA 4M8VA 4J3SA 4MB4A 1OM3L 1JNHB 1U8PB 1H3PL 4AH2A 1KB9J 5TE6L 4BZ1L 5HI5D 4NQSB 1Q9KA 1CDBA 4GW5A 3L9RB 4FQXB 4H1LG 3P77B 3QAZC 1MVUB 3SY0B 1UH2A 5CS7A 4YQXL 2YBRA 4XNZC 3JTTA 3KYOB 3PQYD 3SE3A 1N5AB 4Z8FL 3HNTL 5FA3A 4BKLB 4YDVB 4DAGL 1LO4H 1I1AC 2NY3B 3D2UD 1X5AA 4WNQB 2F19H 2P44B 2EXYC 3MFGB 3ZDZF 1J0YA 1JZ4A 4PY8J 1G6RL 2HJFA 4NN7B 3VU2A 3FHAA 1GYAA 5ADPH 4ODVL 2A6JA 5I8CB 1BJ8A 3C5JB 1IM9B 2P5WA 2DTSA 1DQDL 1MRFL 1AQDB 1CTNA 4PJBE 4YHML 1ZEAL 3HI1A 5CWSA 2EE9A 5GGSY 4PJFA 5JO5A 1L9MA 4X99B 3GI8H 1OP5H 3U9PL 4F58H 3SHSA 4ELKB 5KSUB 4KGLA 3QFDA 3I6LD 2VL5B 1RV6X 4R4FL 5BS0B 3QWOA 2AJYH 2IH3B 4P2OC 1RIHH 3V0VA 5ICZA 1YJDH 2COQA 2V5MA 4XTRD 4CVZB 1G7LB 3MR9B 1KEGL 2VERN 5EO1B 3QG7L 4F37K 1MCRA 3PE9A 3T3ME 5IG7B 5IJKC 4DVBA 2I9LA 1F6LL 1FBIL 4NQXB 5IQ7L 1VPOL 4PRAA 1WAAE 4JKPL 1IGMH 4QO1A 4D9QE 2GCYB 5SWZE 3TN0A 3EJZC 3NGBC 4X6DE 3MJ6A 2R0ZL 5DJCB 1XIWA 2VQTA 2WIIB 4EVNB 5HGBA 4UIKH 3MLSL 4PV8A 5JW4Q 4NKIH 2EC8A 1VFAB 3FT4A 1SJVA 2P1YA 5H35A 1IGCH 2P5WD 5J6HB 2UZXB 2X4QB 2V17H 4JFQA 1PAMA 4V1DE 1MWAH 2QSQA 2K9UA 1XT5A 5T1KB 4XBEL 2B1AL 1WIPA 2V5TA 4PIRF 4JFHE 3FO9B 1BFVL 2BSRB 3T0EC 2GSIA 4O4YL 2C4XA 1QZ1A 1J1PL 3VXNA 5LKNA 3PGDA 3IYLW 1ES0A 5E56A 4MXVF 4H0HB 2R4RH 4ERSL 5HI3C 2X70A 1IAII 1HHKA 4EUPG 2HWZH 5BZWA 1EFXB 1TPXB 4WUKH 2VLRA 1HHHA 3MRHA 3BP7A 5HYSA 1WT5A 1PJ9A 5JQ6H 3G04A 5E8NB 4Z7VF 1LHZA 4NJ9H 3U30C 3RWHA 5IGXH 1WZ1L 4S1QH 1Z9MA 5I9QC 1NCAL 4G6KL 4PRNA 3OWEA 1WTGT 3QUYA 5IB5A 2G2RA 3AAZA 1Q9OB 3MACL 1OSZA 3K2UL 5EU4B 4DTGL 1GL4B 5KG9B 1MRDH 3QDJE 3LKQA 5EU6E 2FO1A 2Y07H 1YNLH 2LV4A 1J10A 5TH2A 4KZDL 1CFQB 2R29L 1OGAB 6FABL 3OXRA 4FXGA 1CD8A 3BZ4B 1FNGA 4OCSH 1MFNA 3MROB 5L0QC 3REVA 3OKMB 1PZUB 3NH7H 4L3EE 2AEPH 4J3VA 5I74B 3QHZL 3DROA 5DHYB 3MRBA 5HGAB 1N5YH 1W0WA 1LNUB 2J4WL 1R3JA 2O5ZL 3SE9L 1HHJB 1F97A 2NW3B 4C56B 4MJIE 3SKMA 3MBEC 4Z7QF 4GAFB 3DVGB 4BK4A 3NBNA 1RZKL 2P8LB 4HFWA 2WAHA 3MV9D 1WUNT 1AP2A 4M6NL 3KYNA 2QTEA 4XZUA 4Y19D 3C5SB 1XR8B 3IKCB 4YHYB 4IRJA 2VLRD 3JVGC 5DEFB 3REWA 1HKLH 4TNWF 3VGDA 4HFUL 4H88H 4EOWL 5LJYH 1OP9A 5C0CE 1KPVA 3L7EB 2H45A 3C9NA 3S5LB 1DQLL 1U0QA 1BVLB 5D7IB 3V5HB 4K2UH 3BP5A 2BNUB 4DZBB 1KCSH 2ADIB 3MRMA 3ROLB 3UZEA 2FNBA 4Y5YC 4HUUB 1LEKB 3HAEA 4XBGA 2R1WA 3UTQA 4Y2DA 3DWTA 2ARJA 3X14A 2XRAH 5DFVD 3PHQB 4U3XA 5F6HI 4XPFL 3F7QA 4LCWE 1YY9D 1IKFL 4O2EA 1RHHB 3ULVC 3HUJA 2APBA 1S9WB 5BRZE 1MAML 3SKJL 1T5WB 4NCC2 2BNQB 4X4ME 4Q9RH 4P23B 2VXUL 4OIIL 3G5XA 4NJAH 5KANG 3B9DA 4D94A 1WIUA 2XY1A 1YEJL 1KB9K 2W9EL 1MCNA 5D7KE 1MLCB 1FGVH 3HZKA 4MAUH 5FF6A 5ALCL 5C7XL 1F11A 4EDWH 1NCCL 4HIIA 1WCBB 4LP5A 3MRDB 3MUY1 5GRXG 3B5HA 1XMWA 1MH5A 1CFNA 1UFUA 2GTWA 1BBJA 4X98B 4L9LC 2RB8A 4LSQH 3WXWL 4LCCB 2V9TA 1I9JH 1NMAL 4HPYH 2BVOA 3QUMH 1IC5H 4PLJD 5T3XE 2XPGA 3OX8A 2C4FU 3RTQA 4GBXC 2P5EE 3O8XC 3RWIB 1FZMB 3UBXI 2VE6B 2B5IB 5CMAB 5I71C 4RAVB 5JORA 4XP9H 5GRJH 1V8HA 4YH6A 3KDMB 5C1MB 3AXLB 2JJSC 1OT2A 4LLDB 1DUYB 3DO7B 3HZMB 1LP9B 1U8QA 3RU8H 4X7SL 4R7NA 2ZPKL 5GJTH 4XRCA 1UVQB 5JW4N 4JG0L 3U4BL 4NWUH 1RZFL 8FABB 1NAMH 1EMTH 3NMEA 4UQ2A 3SBWA 1P4IH 4LLMA 1SY6A 2X1PA 1DBJH 1EHLH 2ESVA 1CXLA 4HKBA 4PTTB 4K7FA 1QHOA 4JGMA 2V5YA 2CDFA 4LDLB 3L95A 3E6HA 3ARQA 1IQWL 1CGSL 5L9DL 3D0VA 2B1HL 3CXDH 4P9MH 4PGEB 1YNTA 2A73B 3WJJA 2A9NL 4JRYA 1BOGA 5D1QB 1CL7I 2K3TA 1NCDH 3PDOA 4OGAC 3DYMA 1NAKL 4GW4A 1KFAL 1Q1JH 1UG9A 4L1HA 3HCVA 3LS5L 4M6AA 3LY6A 1XGTB 5ID1B 2A6IA 1KENH 2PXYB 1ACYL 4QTHB 4WENB 4GKOA 3QXTA 3L5WA 1GGUA 5INCB 1T0MB 5ISZE 3MV8B 3DUUA 4AIXA 1RZGA 5FKAA 4F37F 1WWAX 3NCMA 5HYJE 4HC1L 4H1LA 2DQHH 2V7NB 1G9ML 2BY2A 3GKWH 4YEEA 1ZA3A 1T83C 1J8HA 4U1LB 2FIKB 3BWUC 3WFHA 5C86A 1KT2B 5CZVH 4U0QB 3SN6N 4AIOA 5IB3B 4PRDB 5BXFA 3GJFH 3WLWD 4V2BA 5DC0A 1QEWA 4WY7L 1RZJC 3TNMA 2HLFD 2XKNB 4TQEL 2D7OA 3VFOB 2HLAA 3VG9B 1GC1H 3PJSB 2AJUH 1IGYB 1B9ZA 2QSVA 4PJAA 2MCG1 4G7VH 4KKCD 5EZIL 1FP5A 2DBLH 5AZ2H 2ZP0T 4KHTL 2P4AB 2UUDK 2UVFA 5KN5B 5IROC 4LU5L 2QQNL 3TESA 3TFKC 3C60C 1OM3H 3GJEA 1T1WB 3RWEB 4BZYA 1H3PH 1YEIL 2X10A 5TE6H 4BZ1H 5HPOA 2P7TA 2XWBB 1P69B 3GKZA 5TE4L 2BXZA 3V6FA 4P3DB 4APQA 4PG9B 4UNUA 4NQEA 2E9WA 1AXIB 4TSBL 2F5AH 4YQXH 3CXHK 2OJZL 3T77B 4XNMB 4AEIL 3FQXA 3PABA 4YDLC 4Z8FH 3HNTH 1GXEA 4DAGH 1L0XA 3DV6B 4WI2A 4P48A 4HDIA 4X7TA 3CK0H 3MXVL 1FFPB 5C0AB 4PP2B 1DBAL 4QHMA 4RMTA 4ODVH 2ICEB 1R3KB 2JF1A 4CUCA 4AT6B 1KCVL 5KJRL 4I18A 1JHTA 1DQDH 1KB5A 1MRFH 3QQ4B 4Z77A 4WI6A 4CBPA 5J7CC 2VLJE 4U7SA 4XPBL 2D0FA 3QUZD 5FCUL 1TQCB 3U9PH 1RJCA 4NP4H 4R4FH 4YBQD 3WXVH 2K1MA 4P5KB 5K9QI 5J1SC 4O2FB 3N85L 4MVBC 2DD8L 3ET9F 2C1OB 3BKML 2KUTA 3BIKA 4IDJL 3CDFA 1KEGH 1A6WH 1MFEL 1MUJB 4MQ7B 4APQD 2ZCLL 3QG7H 3E2HB 2BVQB 3GMNB 3LEVL 2OJEA 3ZE0E 3LCYA 5IQ7H 1VPOH 1LEGB 3LRGA 3WMSA 5DEGB 4JKPH 2ZUQC 5IHUL 4WGVB 4KQ4H 4Z18A 4Y4HD 5FDWB 4EUPA 3NAAL 5EC2A 5H2BA 5CD5D 1IAIL 2RR3A 2R0ZH 3CIQA 1CD1B 5F1IA 3CFDB 2CKBA 3MLRL 3LN4B 4KMTL 4OFPA 2EYTB 1NLDL 5CCKL 2W92A 4YNYA 4P5TB 5F1SA 5F6IC 3SKUD 3FQTA 1FFOA 1S9KC 5EOQL 5DJAA 4X6CF 2R69L 4WHYH 3RVTC 1E6OL 1QRKA 3E8UL 1R5WA 1ZGLA 1DDHA 2XG5A 3RIAF 2E6PA 5K59F 3H3PL 1BFVH 1RZIA 2HFEB 4DUWA 4KWUA 3QJFA 3FRPG 2CO6B 1AY1L 4O4YH 2EC9U 2ZZUT 4QT5B 4WV1A 5C3LD 4R0LC 2GUOA 4HUKB 4Y16A 3DVNA 3QDGA 3L3HA 1SYSB 5K9OB 2IG2L 4PJ5E 1F58L 4U1GB 4JHZA 4D0CA 4F7EA 1HOCB 3OKDA 2D31B 4CVXA 4BFGA 3EFFB 3H9ZA 4RGMB 5IV2A 3QQ9D 4YXLL 5HVFB 1BVKB 4JFFA 3ZTJG 4XCEB 2IPUK 3CAFA 3EYUL 2BZDA 1UXSB 3H42H 4HUVA 4KMQA 1NCAH 3IDYC 5IJVA 1QA9B 3DIFA 4ZMAT 1CD0A 3QWRA 2VDRL 4YGVA 3L3IA 3MACH 3QDMB 1ORQB 2CUHA 3K2UH 4DTGH 1CD9B 4HQQL 3HUJF 1S78C 5T1LB 3LD8B 1XCQB 3WLBB 4KZDH 2O5XL 1YQ2A 2R29H 6FABH 5JW5B 3VXRB 4JFXB 4YEFA 1OOAA 3K46A 3GSUB 1JWMB 1G7QA 1KG0B 4TVPE 4S1RH 5SWSE 3QHZH 4KHXH 3P4OB 4Z7UA 3PGCA 4M1CD 2J4WH 4FQHB 5GGSA 2O5ZH 3SE9H 3C8HA 4LAJH 4FXKB 1OSPL 5ESQA 1QVOA 4HWBA 4PP1D 4Y16D 5DT1L 1JYVA 1IL1A 1RZKH 3CVHA 4J4PA 4OZGE 3MLZL 3GNML 4M6NH 2GEEA 3O4LE 3MRNA 2A77L 4KKAC 3VE0A 3S88L 5EBGA 1TETH 4Y5VC 4E5XA 3TBTA 5IIEA 5C8JA 4ZUVA 4HFUH 4EOWH 5E6IC 1ADQH 5EN2A 3OKLB 3U46B 2R8SH 2R2CA 3WL9B 1T03H 3G9AB 1QFWH 2APTA 4C4KO 4R2GD 1DQLH 2RJMA 5A3ID 1U8JA 2VZUA 4MQXC 2JJTC 3O4OB 3UTTB 1ITBB 1U3HC 3RA7H 1HEZA 4FN0A 3KLDA 4JRXB 3QIBA 4RGNB 2R1YA 4L3CB 3OQ3B 4NKOB 1IM3B 3RVXC 1TTFA 5HHXL 4MXQC 1T22B 4Y2OA 1K8IA 3DUHA 4EN3A 4HKXB 4OSUL 1F2XK 1N0XH 3FB6A 3SJVA 2PTVA 4XPFH 2FX8L 2NNAB 3BH9B 4PRHB 3ORJA 1IKFH 3IDNB 3S6CA 3VI3E 2XT1B 1CGWA 1MAMH 3TBSB 1U9KA 4JKKA 3SDCB 2C26A 3LVEA 5IT2H 5FB8A 2C3GA 1VESA 2VL4A 2W65B 3JV4B 2VXUH 4OIIH 2XZQL 1IAKB 5C0RL 1UWGL 3O3DB 1YEJH 3BEWB 1PZ5B 1TNNA 2EIDA 2HN7B 1REIA 2FCBA 2YWYA 4KVCH 5TQ2L 5C7XH 3S5LG 5JOFA 3BRDA 3PHOA 3FHQA 5E6ZA 2LFGA 3QG6A 5C0NC 1A6TB 3IFPB 2JCCA 2OTWA 5D2NC 4P5MA 3WXWH 3T04D 3VWJC 3HMXA